4DR1T

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr1T00
2VQFT 4JI8T 4DUYT 4DV1T 4X62T 4DV2T 1XNQT 4X66T 5LMNT 4X64T 1N34T 2UUCT 4JYAT 4JI2T 1XMOT 4JI5T 4X65T 3T1HT 2VQET 1HNXT 2HHHT 4AQYT 2UXCT 4DV4T 5IWAT 4LFBT 2UU9T 4JI7T 4JI1T 4JV5T 1IBMT 4LFCT 4DUZT 3T1YT 4DR4T 2F4VT 2UUBT 4B3TT 4B3MT 4JI3T 1N33T 4DV0T 4KHPT 2E5LT 5BR8T 4LF4T 1FJGT 4LFAT 1HNWT 2ZM6T 4DR2T 4LF9T 4DR1T 4GKKT 4DV3T 4JI6T 1HNZT 4LF5T 4DR5T 3OTOT 1N36T 4B3RT 4JI4T 2UXBT 1XMQT 4JI0T 2UUAT 4DV5T 1N32T 4NXNT 5LMUT 1I94T 4DR6T 1IBKT 4NXMT 1HR0T 1IBLT 4LF7T 4DV6T 4DR3T 4OX9T 1XNRT 1J5ET 4B3ST 4GKJT 4LF8T 4YY3T 4YHHT 4DV7T 2UXDT 4K0KT 4DR7T 4LF6T
chains in the Genus database with same CATH superfamily
1GQEA 4IE5A 3UU8A 3K8PC 2I0MA 5CA0E 4WBNE 1XNQT 3MACA 2HN2A 5HWXA 4YXDA 4KHZF 2H7VC 1WR6A 3UQ7A 1Y01A 3WAJA 2BBJA 2ACXA 4IE4A 4QH1A 4L9IA 2ACZA 2Q9QA 4WZXA 1S94A 1MNDA 3ZT5A 2W63A 3M3ZB 2A9UA 4ZOLE 1YD8G 3FBZA 1HF8A 2V7KA 5AQKB 3MZKB 2BKPA 4HWIB 2HN1A 3RKOA 5FVKA 3PDYA 3UU3A 4LFAT 3C98B 2CA5A 4A97A 2N2NA 3N5LA 3N2OA 3GN5B 3WAKA 2E9XC 4YSXA 1MMAA 5DJQC 2EHOD 2CLYB 3R84B 2VKDA 3OTOT 3CX8B 1Z0PA 4G2AA 4YTMA 3ZJ2A 4TV8E 3I9YA 3KV4A 4L5GA 1HFAA 5FL0A 5L3EB 4QKNA 4NXMT 3O1IA 4I0UA 3HI2A 4GK5E 4U7YA 3PU8A 5HXCA 2GK9A 5AQPB 3N9QA 5LBMA 3AE6A 3MXZA 1OEDB 4YJ3E 3ZSTA 3AVSA 2W61A 1KNRA 4HWFA 3ONLC 3K3OA 3RHWA 3J9X1 4AQYT 2E9XA 1W0AA 3H37A 5IUXA 1UX4A 2UU9T 3AECA 2XQ7A 3RKGA 3SFEA 3GWHA 1ZEEA 4AISA 3T8OA 3KVBA 3AE1A 3PUYF 2BDEA 3ETVA 4UEMA 1FJGT 3L09A 5LCYA 3AXJB 3UT5E 4QH4A 3ZYKA 3ZMTB 3V5UA 1UX5A 2H7OA 3ETUA 1D0ZA 3P4QA 5ABEA 4LF5T 3C4ZA 1HG2A 1ZOYA 4LMLA 4OK0A 2XQ4A 5L3BB 3NZQA 2E5VA 2CPTA 2WP9A 3CIRA 2A72A 3UFGA 2AE9A 4WNKA 4HFIA 3ZMSB 2CBIA 2V8SV 1ZP0A 5FXZA 1WFDA 4EZ4A 4YLHA 2NOXA 2CEAA 3SWHA 1WLXA 4UELA 2C5KT 2V1DB 4YTPA 3P4RA 2VQFT 4JI8T 3JC6D 4DV1T 4I55E 3CWZB 2NW9A 3CVRA 5HEJA 2UUCT 4TV9E 1KFYA 1X9BA 3T1HT 2LSGA 4X1KE 5ETWA 4EZHA 4PJJA 4WBOA 3CMLA 3UFEA 5HEGA 2K3WA 2ZM0A 4DR4T 2E8IA 5DQWA 3ZJ1A 4YTNA 1N33T 4XAXB 2FJDA 1MIVA 1B7TA 2ZMAA 4HFHA 5AQIB 3KFWX 3OBVE 1J1JA 4ZXLA 4ANJA 5EK2A 1BR1A 2XM2A 3AA7B 5LHIB 3ZKRA 2XQ5A 3NWIA 3L8RA 5F5WA 3VRAA 5JREA 3E08A 4MALA 1UGOA 3NRYA 2JQQA 5LGNB 3PUSA 4EXTA 3IEEA 2UUAT 2X67A 3O1JA 3FZLB 4ZI3C 5HWYA 4ERRA 4PFOA 4CXYA 3SS1A 1XDPA 2RPAA 4IDOA 2V7MA 2YU2A 3AEFA 3N9OA 3P4SA 4KX6A 4GKJT 2JMHA 3PUVF 2VVSA 4OYJA 3ZC0A 3LBXA 2LSIA 5CB4E 2MYSA 3RGLA 4O4IE 2VQET 4Q25A 5GONE 5HCJA 2RP4A 4EEBA 1HTJF 2M67A 5JTGA 4GIWA 2DWGA 2F4VT 3CQXC 4CN4A 4TWDA 2DHRA 4B3MT 2ZM2A 3EAMA 3HKEE 4DV0T 3BQKA 1T98A 5F3JA 2WQYA 4HKAA 5M4YA 3JADA 2IC9A 1D1CA 1XDOA 4AI6A 5HEHA 1SUMB 2BG9E 2IDOB 1MMGA 1XZYA 4EYUA 3SRZA 4ZS3A 5JDLA 2C0SA 4JI6T 2DLRA 3RPUA 4DR5T 2NTYA 4HFBA 5LHHB 2CLYC 2H3RA 4ZS2A 4HWDA 2D9DA 5HCMA 1AJ3A 3NBXX 4GK0E 5HEUA 4GOUA 3KV5A 4O4JE 5AQGB 4ZI2C 4YJ2E 2X0HA 4HFVA 5JRCA 2WBLA 1SE7A 2A3DA 3PUGA 2IAKA 4DR3T 3ZSSA 2JRKA 4B3ST 3CX7B 3RYIE 4CXXA 4ISSA 4IHJE 5AQRB 1HS7A 4LMKA 2BBHA 3IA3A 5AQLB 2V6XA 2QYWA 1YQ3A 3PV0F 3KINB 3Q5XA 2JIWA 3I0OA 4MLKA 5JQGE 3HL6A 3B5MA 2CHNA 1BR0A 5AQHB 5HAXA 3LJCA 4B6XA 2OA5A 4JI1T 2LRKA 4DVDA 3PUXF 4M1PA 1FMWA 3U78A 2FJEA 2IMLA 4JI3T 2V6YB 5LBQB 5EK4A 2HH7A 4HE8A 1WRDA 5L3CB 3UU6A 4LF4T 3VRBA 3TLWA 3JAEA 1HNWT 4EB6E 1W0BA 2XSBA 4TZ4C 4DR1T 4GKKT 4IGUA 3ZMZB 2BVLA 3VR9A 4CI1B 2Y6XA 4O2BE 2WU2A 4TNWA 3IBPA 2KXPB 3ZN0B 5LJMA 5FP3A 2XAHB 3C4XA 2ZLYA 4ILAA 4I4TE 2BZBA 5FY0A 1D1AA 2MBGA 2LOPA 2K5BB 4LF7T 4DBQA 3GMIA 2WCAA 4IREA 5LG3A 2B1EA 2NW7A 5JDNA 4LF8T 5FXWA 1YKEB 4DV7T 2CE7A 2UXNB 4PAGA 3PUAA 4CZZB 2XM1A 4AIUA 2WMOA 3AXJA 2CCQA 4DNDA 1V9DA 4PK6A 5JR9A 4DUZT 4OYKA 4DO0A 2DL1A 2OLTA 4KMCA 2WAUA 2X66A 4ADZA 2XASB 2KWIB 2BS2A 1OEDE 2G0UA 2W66A 3RIFA 4IE7A 1UCUA 2WY2A 5DQVA 4AQFC 3EHZA 5JH7E 3TLSA 4P0AA 1KK7A 4F6RC 3RF1A 3P50A 4ZHQE 2V5DA 3L39A 4YSZA 3AA0B 4YSYA 3FHNA 5CFBA 2JJ9A 2FJBA 4DMWA 3H3MA 5JDGA 3OVUA 4NPPA 3PU3A 1YXRA 4AKLA 3AEDA 3QNUA 2EHOC 1T8BA 2VVNA 2CMRA 2W2UA 4HWCA 4AQFA 1VCTA 2LJLA 3P4WA 4JI5T 3KDSE 3GA8A 2YKSA 2IIUA 2MAWA 4H9SE 2LKHA 1WR0A 2XQ8A 4UF0B 3ZPOA 3AE2A 2C5JA 2ODUA 2X9YA 3UTKA 4PJMA 2WMNA 5EZYE 5J1GA 3TLTA 3AE9A 2YINA 4J2CA 3RIAA 2QGSA 4QHOA 5LGUB 3ZCIA 3N9LA 4KUMB 1G8XA 4Z91A 4OFZA 3N2GE 5H6RB 2A2FX 1US7B 4I43B 2EHOA 1QUUA 3C4WA 2DCFA 5LNKA 2W4XA 1IZNB 5LB7B 1OXZA 5JDFA 3E22E 4DR6T 1IBKT 2R6GF 2IC6A 2FBWA 5J2UE 4U3CA 1BR2A 2X68A 5H6QB 2XSAA 2Y48B 3S4UA 3NRXA 4ISTA 2YK0A 5HXHA 2KWHA 4PK5A 4DV2T 3ZN1B 1N34T 4JBWF 2XQ9A 4IE0A 2I59A 4HFEA 4G63A 4CN1A 3UUXB 2J4GA 4DV4T 3RC8A 3BQLA 3AEBA 4UIGA 3W15B 1EZ3A 3T1YT 2Q9QB 5AQSB 3AAAB 2DWKA 3KV9A 3A8YC 2BS3A 5ABFA 2CXFA 3RI5A 2BG9C 4PJNA 2LSKA 1YQ4A 3PE0A 2X51A 3AE8A 2AXDS 4FI5A 5AQOB 3LDQB 1HCIA 4QXCB 5LYJE 3EDVA 3LK3B 4O4LE 1L0VA 2D5UA 2YU1A 4HGAA 4ILUA 4U2ZA 1U4QA 2H88A 2LM9A 1G73A 3ESLA 4ILBA 2N9DA 1UURA 4K0UA 3CKDA 3QUJA 5L3FB 2ZM8A 1N32T 2XQ3A 4H63V 5IYZE 1HR0T 4H9PC 1MIWA 5F8PA 4AQGA 3DJBA 4A5XA 3O1HA 4XZCA 3LG7A 2L8KA 3Q5DA 5AQJB 4QWNB 2BG9A 3PUWF 5ABGA 2K48A 1MMDA 1WCRA 1BR4A 4JI2T 4ZI3D 3UULA 3SOLA 2RA1A 3ZC1A 3EABA 2HPLA 3AAIA 4JEHB 3SFDA 4WW0A 4IDPA 4Z90A 1IBMT 2E9XB 4X5TA 4O4HE 5L47A 3BQIA 5IHYA 3K1SA 4MBQA 1T72A 1D0YA 2LEHA 4PW8A 4IL9A 4KHPT 2E5LT 2XAGB 5LG4A 3AA1B 3VKGA 3UUMA 1SHZC 5TAOA 3EUHA 2E2AA 2XY8B 3TKLB 2KZ7B 3AE7A 3NZPA 1FIOA 2KMFA 2VURA 3R6NA 1NAFA 1Z8UA 4ASKA 3RX6A 2W0GA 5HYAA 3C50A 4P1NA 4XBFB 1QSDA 4X20E 3OPCA 3FZKB 3P4PA 3EDUA 4BA9A 4DV5T 4FJOA 2LSYA 4V1Av 1IJ5A 3MK7C 2J47A 5FMNA 3RLFF 3LFMA 3N9MA 2UXDT 4DR7T 1OWAA 5AFUL 3FBLA 2FJAA 2V5CA 4X64T 5LMNT 3ZT7A 4ZI2D 3ZYLA 4CI3B 2QRXA 1HNXT 4UR9A 5AQTB 4JI7T 4LFCT 3O4XE 2KNDA 3P8CD 4CN6A 4EGWA 2J1DG 2UUBT 3ZMUB 3RC3A 1OEDC 4QX7B 2JPFA 1M62A 4HN9A 2JQKA 2LM2A 1HX1B 1W9RA 4H9OC 1KNPA 2BS4A 3GN5A 2HPJA 3ZCJA 1KF6A 1NENA 2L3LA 3Q5WA 3QK6A 3HA4A 5KXJA 3PUZF 5LOVE 3AA6B 3AE4A 1WYCA 2WB5A 4IIJE 1X79A 4TX5A 3E0ZA 4HTEA 2L9QA 3RQWA 3ANWB 2VKHA 3QB5K 2XTLA 5AQQB 1E1HB 3QC9A 2IW5B 5L3DB 5CJ5A 4DV6T 5LA6E 2WDQA 4GYRA 1OEDA 2FUPA 3QB5A 3VR8A 1ZV4X 2MTQA 5J0ZA 2P9BA 2SPCA 2WZIA 1MNEA 2YDQA 1CUNA 4U31A 1M7KA 2XAQB 3LBXB 4YHJA 2PBIA 5HXRA 1E2AA 2NW8A 2Q9QD 3RYHE 4LFBT 4X1YE 4AKRB 1IJ6A 2PFVA 3OJAA 2NP9A 3QOFA 3C51A 2WWUA 3K3QC 3PUQA 3PJAA 4ZZBA 3O9XA 3CPZA 4F8HA 2NR4A 4HFCA 4DV3T 3N9PA 2MPKA 2W67A 1VOMA 2XHEB 5LHGB 4PFPA 4UVAB 4JLEA 2VL8A 2LHRA 4L0RA 5EK3A 5CA1E 2LRLA 2PTFA 5JDMA 2YDSA 4U74A 4GYSA 3HKBE 4AXPA 2X9WA 1I94T 4CXWA 5JRCB 4OX9T 2M6IA 1XNRT 2KSRA 5FVLA 2WU5A 4PJLA 4QXBB 3F31A 5DABA 3AE5A 3OYZA 4P0BA 2NTXA 4X65T 1LVKA 3C64A 2E9XD 2UXCT 1SA0E 4EYYR 5JDHA 5IWAT 4EIWA 5FXXA 4PK4A 4O8SA 2QA7A 4COFA 2X0LB 3J7Yq 3I1AA 3ONJA 3RIUC 4IDZA 3ZT6A 2YOEA 3B13A 3DP7A 2CXLA 2DI4A 1NWMX 3NVOA 4H9NC 3F57A 3K3NA 3LK2B 5C8YE 1LRZA 4A98A 1T7SA 1IAPA 5AQNB 4JI4T 4ZI7E 2D0UA 2C5IT 3OYXA 3I9WA 3UUNA 1XMQT 2LKGA 4U72A 2VL0A 3EVYA 1Y64B 2MOZA 2VK9A 5KMGP 2H89A 5FY1A 1S35A 2WDVA 1ZHCA 1W09A 2LSJA 4MHCA 2WS3A 4YY3T 3FXEB 2X0YA 5LJNA 3RIUA 3U3IA 5C2TA 2B76A 2CRBA 4H63H 1FMVA 2LT3A 4NIQA 5L3GB 3FZFB 4EOZB 2XPKA 2JQ9A 2LLYA 3AE3A 4ZEYA 2V7IA 1ZKEA 3VKHA 3UQ4A 4JV5T 4OHFA 4QX8B 1I6ZA 3I0QA 3Q9DA 2YEVC 5JR9B 4CQIA 3HR0A 2VWAA 1NEKA 2Z6EA 2WM9A 5LP6E 3FXDB 3AVRA 3ZEFB 4KP3C 4UVCB 4WYVA 4BAYB 2M6BA 4P09A 3RRWA 1XWMA 3HKCE 2V26A 3OKQA 3PTRB 4B3RT 2CBJA 3JC6C 3F2EA 2UXBT 2CXDA 2XUEA 3A5XA 1YW0A 3TLVA 2IHR1 5LMUT 5J2TE 4AKGA 2ODVA 1HG5A 3TLUA 4HWHA 3MKDA 3JCFA 4HEAA 5LXTE 5AQMB 4ILCA 3AEGA 5E0OA 4YHHT 5KDMC 5HEOA 2VB6A 3CK6A 2KT9A 2XQYA 2V7JA 1JNZA 3UUBA 2W62A 2WDRA 3CX6B 2WWVA 5AQVB 4LMJA 4HFDA 4UVBB 2V6YA 4O2AE 2K9AA 4IDQA 4B3TT 3B57A 2LHNA 1R8IA 3KBTA 2CWOA 4AKIA 4PNIA 1U5PA 2CM0A 4EAHA 3ANWA 1DU2A 3MA9A 3PJAJ 3V5SA 2XAJB 2NWBA 4DR2T 3FB2A 3DTOA 1JNRA 4E7SA 1KEYA 3CQGB 3UU5A 5L2LA 2VKOA 1FEWA 2EHOB 2YN6A 4DMVA 3X1DA 4NXNT 4TUYE 4MFRA 1MIYA 2D2SA 3ZMVB 1IBLT 3ONXA 1J5ET 2LE8A 4E7ZA 4JEUB 4QH5A 5CGMA 4K0KT 2I6HA 2XZEA 3AB3B 4DUYT 5AQUB 1YKHB 4X66T 1WYBA 2BKOA 4JYAT 1MMNA 2K24A 4H9RC 1XMOT 3VU7H 3IF8B 1KNZA 2VASA 1CHUA 2HHHT 1E7PA 5LGTB 1D0XA 3L3PA 5C3JA 3ABVA 2UXXB 3N2KE 3HKDE 4UV9B 2WZHA 3CQCB 2BKNA 3BK9A 3EI0A 2J62A 2XQAA 5FKYA 2PJQA 4C90A 3VHLA 5FXVA 5BR8T 3FZHB 1VCSA 4TNVA 4AKHA 4I50E 1QLBA 5ABFB 2XAFB 3KBUA 4U33A 4NUVA 2ZM6T 4UXNB 4YFSA 4KI0F 2IUBA 2JMKA 5ABHA 4NUUA 4Z8XA 4U7IA 3M65A 5BMVE 3RYFE 4ZZCA 4IDNA 3JAFA 2N1GA 4DIDB 4JI0T 2VKJA 3Q2MA 4TN7B 4TWHA 4U2YA 4A56A 2W00A 2ES0A 5HXEA 3ZYMA 2DNXA 2CWYA 3KV6A 5L4HA 4IL4A 5HXSA 5JDQA 4EV6A 5FY7A 5L4EA 4LF6T 3LSVA 4X62T 5ADXL 2LOSA 3LK42 2BG9B 2CHOA 3RRCA 5AQFB 2D0TA 4JUYA 4IT4A 2JQHA 3D0TA 1UK5A 1VRBA 1D1BA 4CI2B 4UF0A 3Q5EA 2KLQA 1UUSA 3RYCE 5A1LA 5FL1A 4YT0A 4TWFA 3P7IA 1HX8A 3KVAA 3AEAA 5JR9C 2Y8DA 3AAEB 3H3AA 3PURA 3RQUA 1J5WA 3NKZA 3N9NA 4BJMA 2XJ7A 3MJXA 2V7LA 3G06A 4LF9T 2X9HA 1LKXA 1HNZT 2OV9A 5KX5E 5JVDE 2Q9QC 4N78D 3IHRA 5FNVE 3RH3A 1N36T 2PG8A 4DBRA 1O3XA 2YDRA 2BVMA 3ZLIA 3AEEA 4EEDA 4BJNA 4KBMB 4C91A 4QXHB 2X9XA 1H7CA 1LVFA 2WSSV 4X1IE 5FYMA 2KINB 2XQ6A 2QVAA 3WI3A 3UU4A 4H9QC 4UV8B 4IE6A 3FZMB 3A7MA
chains in the Genus database with same CATH topology
2VQFT 4JI8T 4DUYT 4DV1T 4X62T 4DV2T 1XNQT 4X66T 5LMNT 4X64T 1N34T 2UUCT 4JYAT 4JI2T 1XMOT 4JI5T 4X65T 3T1HT 2VQET 1HNXT 2HHHT 4AQYT 2UXCT 4DV4T 5IWAT 4LFBT 2UU9T 4JI7T 4JI1T 4JV5T 1IBMT 4LFCT 4DUZT 3T1YT 4DR4T 2F4VT 2UUBT 4B3TT 4B3MT 4JI3T 1N33T 4DV0T 4KHPT 2E5LT 5BR8T 4LF4T 1FJGT 4LFAT 1HNWT 2ZM6T 4DR2T 4LF9T 4DR1T 4GKKT 4DV3T 4JI6T 1HNZT 4LF5T 4DR5T 3OTOT 1N36T 4B3RT 4JI4T 2UXBT 1XMQT 4JI0T 2UUAT 4DV5T 1N32T 4NXNT 5LMUT 1I94T 4DR6T 1IBKT 4NXMT 1HR0T 1IBLT 4LF7T 4DV6T 4DR3T 4OX9T 1XNRT 1J5ET 4B3ST 4GKJT 4LF8T 4YY3T 4YHHT 4DV7T 2UXDT 4K0KT 4DR7T 4LF6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF T;  4JI8 T;  4DUY T;  4DV1 T;  4X62 T;  4DV2 T;  1XNQ T;  4X66 T;  5LMN T;  4X64 T;  1N34 T;  2UUC T;  4JYA T;  4JI2 T;  1XMO T;  4JI5 T;  4X65 T;  3T1H T;  2VQE T;  1HNX T;  2HHH T;  4AQY T;  2UXC T;  4DV4 T;  5IWA T;  4LFB T;  2UU9 T;  4JI7 T;  4JI1 T;  4JV5 T;  1IBM T;  4LFC T;  4DUZ T;  3T1Y T;  4DR4 T;  2F4V T;  2UUB T;  4B3T T;  4B3M T;  4JI3 T;  1N33 T;  4DV0 T;  4KHP T;  2E5L T;  5BR8 T;  4LF4 T;  1FJG T;  4LFA T;  1HNW T;  2ZM6 T;  4DR2 T;  4LF9 T;  4DR1 T;  4GKK T;  4DV3 T;  4JI6 T;  1HNZ T;  4LF5 T;  4DR5 T;  3OTO T;  1N36 T;  4B3R T;  4JI4 T;  2UXB T;  1XMQ T;  4JI0 T;  2UUA T;  4DV5 T;  1N32 T;  4NXN T;  5LMU T;  1I94 T;  4DR6 T;  1IBK T;  4NXM T;  1HR0 T;  1IBL T;  4LF7 T;  4DV6 T;  4DR3 T;  4OX9 T;  1XNR T;  1J5E T;  4B3S T;  4GKJ T;  4LF8 T;  4YY3 T;  4YHH T;  4DV7 T;  2UXD T;  4K0K T;  4DR7 T;  4LF6 T; 
#chains in the Genus database with same CATH topology
 1GQE A;  4IE5 A;  3UU8 A;  3K8P C;  2I0M A;  5CA0 E;  4WBN E;  1XNQ T;  3MAC A;  2HN2 A;  5HWX A;  4YXD A;  4KHZ F;  2H7V C;  1WR6 A;  3UQ7 A;  1Y01 A;  3WAJ A;  2BBJ A;  2ACX A;  4IE4 A;  4QH1 A;  4L9I A;  2ACZ A;  2Q9Q A;  4WZX A;  1S94 A;  1MND A;  3ZT5 A;  2W63 A;  3M3Z B;  2A9U A;  4ZOL E;  1YD8 G;  3FBZ A;  1HF8 A;  2V7K A;  5AQK B;  3MZK B;  2BKP A;  4HWI B;  2HN1 A;  3RKO A;  5FVK A;  3PDY A;  3UU3 A;  4LFA T;  3C98 B;  2CA5 A;  4A97 A;  2N2N A;  3N5L A;  3N2O A;  3GN5 B;  3WAK A;  2E9X C;  4YSX A;  1MMA A;  5DJQ C;  2EHO D;  2CLY B;  3R84 B;  2VKD A;  3OTO T;  3CX8 B;  1Z0P A;  4G2A A;  4YTM A;  3ZJ2 A;  4TV8 E;  3I9Y A;  3KV4 A;  4L5G A;  1HFA A;  5FL0 A;  5L3E B;  4QKN A;  4NXM T;  3O1I A;  4I0U A;  3HI2 A;  4GK5 E;  4U7Y A;  3PU8 A;  5HXC A;  2GK9 A;  5AQP B;  3N9Q A;  5LBM A;  3AE6 A;  3MXZ A;  1OED B;  4YJ3 E;  3ZST A;  3AVS A;  2W61 A;  1KNR A;  4HWF A;  3ONL C;  3K3O A;  3RHW A;  3J9X 1;  4AQY T;  2E9X A;  1W0A A;  3H37 A;  5IUX A;  1UX4 A;  2UU9 T;  3AEC A;  2XQ7 A;  3RKG A;  3SFE A;  3GWH A;  1ZEE A;  4AIS A;  3T8O A;  3KVB A;  3AE1 A;  3PUY F;  2BDE A;  3ETV A;  4UEM A;  1FJG T;  3L09 A;  5LCY A;  3AXJ B;  3UT5 E;  4QH4 A;  3ZYK A;  3ZMT B;  3V5U A;  1UX5 A;  2H7O A;  3ETU A;  1D0Z A;  3P4Q A;  5ABE A;  4LF5 T;  3C4Z A;  1HG2 A;  1ZOY A;  4LML A;  4OK0 A;  2XQ4 A;  5L3B B;  3NZQ A;  2E5V A;  2CPT A;  2WP9 A;  3CIR A;  2A72 A;  3UFG A;  2AE9 A;  4WNK A;  4HFI A;  3ZMS B;  2CBI A;  2V8S V;  1ZP0 A;  5FXZ A;  1WFD A;  4EZ4 A;  4YLH A;  2NOX A;  2CEA A;  3SWH A;  1WLX A;  4UEL A;  2C5K T;  2V1D B;  4YTP A;  3P4R A;  2VQF T;  4JI8 T;  3JC6 D;  4DV1 T;  4I55 E;  3CWZ B;  2NW9 A;  3CVR A;  5HEJ A;  2UUC T;  4TV9 E;  1KFY A;  1X9B A;  3T1H T;  2LSG A;  4X1K E;  5ETW A;  4EZH A;  4PJJ A;  4WBO A;  3CML A;  3UFE A;  5HEG A;  2K3W A;  2ZM0 A;  4DR4 T;  2E8I A;  5DQW A;  3ZJ1 A;  4YTN A;  1N33 T;  4XAX B;  2FJD A;  1MIV A;  1B7T A;  2ZMA A;  4HFH A;  5AQI B;  3KFW X;  3OBV E;  1J1J A;  4ZXL A;  4ANJ A;  5EK2 A;  1BR1 A;  2XM2 A;  3AA7 B;  5LHI B;  3ZKR A;  2XQ5 A;  3NWI A;  3L8R A;  5F5W A;  3VRA A;  5JRE A;  3E08 A;  4MAL A;  1UGO A;  3NRY A;  2JQQ A;  5LGN B;  3PUS A;  4EXT A;  3IEE A;  2UUA T;  2X67 A;  3O1J A;  3FZL B;  4ZI3 C;  5HWY A;  4ERR A;  4PFO A;  4CXY A;  3SS1 A;  1XDP A;  2RPA A;  4IDO A;  2V7M A;  2YU2 A;  3AEF A;  3N9O A;  3P4S A;  4KX6 A;  4GKJ T;  2JMH A;  3PUV F;  2VVS A;  4OYJ A;  3ZC0 A;  3LBX A;  2LSI A;  5CB4 E;  2MYS A;  3RGL A;  4O4I E;  2VQE T;  4Q25 A;  5GON E;  5HCJ A;  2RP4 A;  4EEB A;  1HTJ F;  2M67 A;  5JTG A;  4GIW A;  2DWG A;  2F4V T;  3CQX C;  4CN4 A;  4TWD A;  2DHR A;  4B3M T;  2ZM2 A;  3EAM A;  3HKE E;  4DV0 T;  3BQK A;  1T98 A;  5F3J A;  2WQY A;  4HKA A;  5M4Y A;  3JAD A;  2IC9 A;  1D1C A;  1XDO A;  4AI6 A;  5HEH A;  1SUM B;  2BG9 E;  2IDO B;  1MMG A;  1XZY A;  4EYU A;  3SRZ A;  4ZS3 A;  5JDL A;  2C0S A;  4JI6 T;  2DLR A;  3RPU A;  4DR5 T;  2NTY A;  4HFB A;  5LHH B;  2CLY C;  2H3R A;  4ZS2 A;  4HWD A;  2D9D A;  5HCM A;  1AJ3 A;  3NBX X;  4GK0 E;  5HEU A;  4GOU A;  3KV5 A;  4O4J E;  5AQG B;  4ZI2 C;  4YJ2 E;  2X0H A;  4HFV A;  5JRC A;  2WBL A;  1SE7 A;  2A3D A;  3PUG A;  2IAK A;  4DR3 T;  3ZSS A;  2JRK A;  4B3S T;  3CX7 B;  3RYI E;  4CXX A;  4ISS A;  4IHJ E;  5AQR B;  1HS7 A;  4LMK A;  2BBH A;  3IA3 A;  5AQL B;  2V6X A;  2QYW A;  1YQ3 A;  3PV0 F;  3KIN B;  3Q5X A;  2JIW A;  3I0O A;  4MLK A;  5JQG E;  3HL6 A;  3B5M A;  2CHN A;  1BR0 A;  5AQH B;  5HAX A;  3LJC A;  4B6X A;  2OA5 A;  4JI1 T;  2LRK A;  4DVD A;  3PUX F;  4M1P A;  1FMW A;  3U78 A;  2FJE A;  2IML A;  4JI3 T;  2V6Y B;  5LBQ B;  5EK4 A;  2HH7 A;  4HE8 A;  1WRD A;  5L3C B;  3UU6 A;  4LF4 T;  3VRB A;  3TLW A;  3JAE A;  1HNW T;  4EB6 E;  1W0B A;  2XSB A;  4TZ4 C;  4DR1 T;  4GKK T;  4IGU A;  3ZMZ B;  2BVL A;  3VR9 A;  4CI1 B;  2Y6X A;  4O2B E;  2WU2 A;  4TNW A;  3IBP A;  2KXP B;  3ZN0 B;  5LJM A;  5FP3 A;  2XAH B;  3C4X A;  2ZLY A;  4ILA A;  4I4T E;  2BZB A;  5FY0 A;  1D1A A;  2MBG A;  2LOP A;  2K5B B;  4LF7 T;  4DBQ A;  3GMI A;  2WCA A;  4IRE A;  5LG3 A;  2B1E A;  2NW7 A;  5JDN A;  4LF8 T;  5FXW A;  1YKE B;  4DV7 T;  2CE7 A;  2UXN B;  4PAG A;  3PUA A;  4CZZ B;  2XM1 A;  4AIU A;  2WMO A;  3AXJ A;  2CCQ A;  4DND A;  1V9D A;  4PK6 A;  5JR9 A;  4DUZ T;  4OYK A;  4DO0 A;  2DL1 A;  2OLT A;  4KMC A;  2WAU A;  2X66 A;  4ADZ A;  2XAS B;  2KWI B;  2BS2 A;  1OED E;  2G0U A;  2W66 A;  3RIF A;  4IE7 A;  1UCU A;  2WY2 A;  5DQV A;  4AQF C;  3EHZ A;  5JH7 E;  3TLS A;  4P0A A;  1KK7 A;  4F6R C;  3RF1 A;  3P50 A;  4ZHQ E;  2V5D A;  3L39 A;  4YSZ A;  3AA0 B;  4YSY A;  3FHN A;  5CFB A;  2JJ9 A;  2FJB A;  4DMW A;  3H3M A;  5JDG A;  3OVU A;  4NPP A;  3PU3 A;  1YXR A;  4AKL A;  3AED A;  3QNU A;  2EHO C;  1T8B A;  2VVN A;  2CMR A;  2W2U A;  4HWC A;  4AQF A;  1VCT A;  2LJL A;  3P4W A;  4JI5 T;  3KDS E;  3GA8 A;  2YKS A;  2IIU A;  2MAW A;  4H9S E;  2LKH A;  1WR0 A;  2XQ8 A;  4UF0 B;  3ZPO A;  3AE2 A;  2C5J A;  2ODU A;  2X9Y A;  3UTK A;  4PJM A;  2WMN A;  5EZY E;  5J1G A;  3TLT A;  3AE9 A;  2YIN A;  4J2C A;  3RIA A;  2QGS A;  4QHO A;  5LGU B;  3ZCI A;  3N9L A;  4KUM B;  1G8X A;  4Z91 A;  4OFZ A;  3N2G E;  5H6R B;  2A2F X;  1US7 B;  4I43 B;  2EHO A;  1QUU A;  3C4W A;  2DCF A;  5LNK A;  2W4X A;  1IZN B;  5LB7 B;  1OXZ A;  5JDF A;  3E22 E;  4DR6 T;  1IBK T;  2R6G F;  2IC6 A;  2FBW A;  5J2U E;  4U3C A;  1BR2 A;  2X68 A;  5H6Q B;  2XSA A;  2Y48 B;  3S4U A;  3NRX A;  4IST A;  2YK0 A;  5HXH A;  2KWH A;  4PK5 A;  4DV2 T;  3ZN1 B;  1N34 T;  4JBW F;  2XQ9 A;  4IE0 A;  2I59 A;  4HFE A;  4G63 A;  4CN1 A;  3UUX B;  2J4G A;  4DV4 T;  3RC8 A;  3BQL A;  3AEB A;  4UIG A;  3W15 B;  1EZ3 A;  3T1Y T;  2Q9Q B;  5AQS B;  3AAA B;  2DWK A;  3KV9 A;  3A8Y C;  2BS3 A;  5ABF A;  2CXF A;  3RI5 A;  2BG9 C;  4PJN A;  2LSK A;  1YQ4 A;  3PE0 A;  2X51 A;  3AE8 A;  2AXD S;  4FI5 A;  5AQO B;  3LDQ B;  1HCI A;  4QXC B;  5LYJ E;  3EDV A;  3LK3 B;  4O4L E;  1L0V A;  2D5U A;  2YU1 A;  4HGA A;  4ILU A;  4U2Z A;  1U4Q A;  2H88 A;  2LM9 A;  1G73 A;  3ESL A;  4ILB A;  2N9D A;  1UUR A;  4K0U A;  3CKD A;  3QUJ A;  5L3F B;  2ZM8 A;  1N32 T;  2XQ3 A;  4H63 V;  5IYZ E;  1HR0 T;  4H9P C;  1MIW A;  5F8P A;  4AQG A;  3DJB A;  4A5X A;  3O1H A;  4XZC A;  3LG7 A;  2L8K A;  3Q5D A;  5AQJ B;  4QWN B;  2BG9 A;  3PUW F;  5ABG A;  2K48 A;  1MMD A;  1WCR A;  1BR4 A;  4JI2 T;  4ZI3 D;  3UUL A;  3SOL A;  2RA1 A;  3ZC1 A;  3EAB A;  2HPL A;  3AAI A;  4JEH B;  3SFD A;  4WW0 A;  4IDP A;  4Z90 A;  1IBM T;  2E9X B;  4X5T A;  4O4H E;  5L47 A;  3BQI A;  5IHY A;  3K1S A;  4MBQ A;  1T72 A;  1D0Y A;  2LEH A;  4PW8 A;  4IL9 A;  4KHP T;  2E5L T;  2XAG B;  5LG4 A;  3AA1 B;  3VKG A;  3UUM A;  1SHZ C;  5TAO A;  3EUH A;  2E2A A;  2XY8 B;  3TKL B;  2KZ7 B;  3AE7 A;  3NZP A;  1FIO A;  2KMF A;  2VUR A;  3R6N A;  1NAF A;  1Z8U A;  4ASK A;  3RX6 A;  2W0G A;  5HYA A;  3C50 A;  4P1N A;  4XBF B;  1QSD A;  4X20 E;  3OPC A;  3FZK B;  3P4P A;  3EDU A;  4BA9 A;  4DV5 T;  4FJO A;  2LSY A;  4V1A v;  1IJ5 A;  3MK7 C;  2J47 A;  5FMN A;  3RLF F;  3LFM A;  3N9M A;  2UXD T;  4DR7 T;  1OWA A;  5AFU L;  3FBL A;  2FJA A;  2V5C A;  4X64 T;  5LMN T;  3ZT7 A;  4ZI2 D;  3ZYL A;  4CI3 B;  2QRX A;  1HNX T;  4UR9 A;  5AQT B;  4JI7 T;  4LFC T;  3O4X E;  2KND A;  3P8C D;  4CN6 A;  4EGW A;  2J1D G;  2UUB T;  3ZMU B;  3RC3 A;  1OED C;  4QX7 B;  2JPF A;  1M62 A;  4HN9 A;  2JQK A;  2LM2 A;  1HX1 B;  1W9R A;  4H9O C;  1KNP A;  2BS4 A;  3GN5 A;  2HPJ A;  3ZCJ A;  1KF6 A;  1NEN A;  2L3L A;  3Q5W A;  3QK6 A;  3HA4 A;  5KXJ A;  3PUZ F;  5LOV E;  3AA6 B;  3AE4 A;  1WYC A;  2WB5 A;  4IIJ E;  1X79 A;  4TX5 A;  3E0Z A;  4HTE A;  2L9Q A;  3RQW A;  3ANW B;  2VKH A;  3QB5 K;  2XTL A;  5AQQ B;  1E1H B;  3QC9 A;  2IW5 B;  5L3D B;  5CJ5 A;  4DV6 T;  5LA6 E;  2WDQ A;  4GYR A;  1OED A;  2FUP A;  3QB5 A;  3VR8 A;  1ZV4 X;  2MTQ A;  5J0Z A;  2P9B A;  2SPC A;  2WZI A;  1MNE A;  2YDQ A;  1CUN A;  4U31 A;  1M7K A;  2XAQ B;  3LBX B;  4YHJ A;  2PBI A;  5HXR A;  1E2A A;  2NW8 A;  2Q9Q D;  3RYH E;  4LFB T;  4X1Y E;  4AKR B;  1IJ6 A;  2PFV A;  3OJA A;  2NP9 A;  3QOF A;  3C51 A;  2WWU A;  3K3Q C;  3PUQ A;  3PJA A;  4ZZB A;  3O9X A;  3CPZ A;  4F8H A;  2NR4 A;  4HFC A;  4DV3 T;  3N9P A;  2MPK A;  2W67 A;  1VOM A;  2XHE B;  5LHG B;  4PFP A;  4UVA B;  4JLE A;  2VL8 A;  2LHR A;  4L0R A;  5EK3 A;  5CA1 E;  2LRL A;  2PTF A;  5JDM A;  2YDS A;  4U74 A;  4GYS A;  3HKB E;  4AXP A;  2X9W A;  1I94 T;  4CXW A;  5JRC B;  4OX9 T;  2M6I A;  1XNR T;  2KSR A;  5FVL A;  2WU5 A;  4PJL A;  4QXB B;  3F31 A;  5DAB A;  3AE5 A;  3OYZ A;  4P0B A;  2NTX A;  4X65 T;  1LVK A;  3C64 A;  2E9X D;  2UXC T;  1SA0 E;  4EYY R;  5JDH A;  5IWA T;  4EIW A;  5FXX A;  4PK4 A;  4O8S A;  2QA7 A;  4COF A;  2X0L B;  3J7Y q;  3I1A A;  3ONJ A;  3RIU C;  4IDZ A;  3ZT6 A;  2YOE A;  3B13 A;  3DP7 A;  2CXL A;  2DI4 A;  1NWM X;  3NVO A;  4H9N C;  3F57 A;  3K3N A;  3LK2 B;  5C8Y E;  1LRZ A;  4A98 A;  1T7S A;  1IAP A;  5AQN B;  4JI4 T;  4ZI7 E;  2D0U A;  2C5I T;  3OYX A;  3I9W A;  3UUN A;  1XMQ T;  2LKG A;  4U72 A;  2VL0 A;  3EVY A;  1Y64 B;  2MOZ A;  2VK9 A;  5KMG P;  2H89 A;  5FY1 A;  1S35 A;  2WDV A;  1ZHC A;  1W09 A;  2LSJ A;  4MHC A;  2WS3 A;  4YY3 T;  3FXE B;  2X0Y A;  5LJN A;  3RIU A;  3U3I A;  5C2T A;  2B76 A;  2CRB A;  4H63 H;  1FMV A;  2LT3 A;  4NIQ A;  5L3G B;  3FZF B;  4EOZ B;  2XPK A;  2JQ9 A;  2LLY A;  3AE3 A;  4ZEY A;  2V7I A;  1ZKE A;  3VKH A;  3UQ4 A;  4JV5 T;  4OHF A;  4QX8 B;  1I6Z A;  3I0Q A;  3Q9D A;  2YEV C;  5JR9 B;  4CQI A;  3HR0 A;  2VWA A;  1NEK A;  2Z6E A;  2WM9 A;  5LP6 E;  3FXD B;  3AVR A;  3ZEF B;  4KP3 C;  4UVC B;  4WYV A;  4BAY B;  2M6B A;  4P09 A;  3RRW A;  1XWM A;  3HKC E;  2V26 A;  3OKQ A;  3PTR B;  4B3R T;  2CBJ A;  3JC6 C;  3F2E A;  2UXB T;  2CXD A;  2XUE A;  3A5X A;  1YW0 A;  3TLV A;  2IHR 1;  5LMU T;  5J2T E;  4AKG A;  2ODV A;  1HG5 A;  3TLU A;  4HWH A;  3MKD A;  3JCF A;  4HEA A;  5LXT E;  5AQM B;  4ILC A;  3AEG A;  5E0O A;  4YHH T;  5KDM C;  5HEO A;  2VB6 A;  3CK6 A;  2KT9 A;  2XQY A;  2V7J A;  1JNZ A;  3UUB A;  2W62 A;  2WDR A;  3CX6 B;  2WWV A;  5AQV B;  4LMJ A;  4HFD A;  4UVB B;  2V6Y A;  4O2A E;  2K9A A;  4IDQ A;  4B3T T;  3B57 A;  2LHN A;  1R8I A;  3KBT A;  2CWO A;  4AKI A;  4PNI A;  1U5P A;  2CM0 A;  4EAH A;  3ANW A;  1DU2 A;  3MA9 A;  3PJA J;  3V5S A;  2XAJ B;  2NWB A;  4DR2 T;  3FB2 A;  3DTO A;  1JNR A;  4E7S A;  1KEY A;  3CQG B;  3UU5 A;  5L2L A;  2VKO A;  1FEW A;  2EHO B;  2YN6 A;  4DMV A;  3X1D A;  4NXN T;  4TUY E;  4MFR A;  1MIY A;  2D2S A;  3ZMV B;  1IBL T;  3ONX A;  1J5E T;  2LE8 A;  4E7Z A;  4JEU B;  4QH5 A;  5CGM A;  4K0K T;  2I6H A;  2XZE A;  3AB3 B;  4DUY T;  5AQU B;  1YKH B;  4X66 T;  1WYB A;  2BKO A;  4JYA T;  1MMN A;  2K24 A;  4H9R C;  1XMO T;  3VU7 H;  3IF8 B;  1KNZ A;  2VAS A;  1CHU A;  2HHH T;  1E7P A;  5LGT B;  1D0X A;  3L3P A;  5C3J A;  3ABV A;  2UXX B;  3N2K E;  3HKD E;  4UV9 B;  2WZH A;  3CQC B;  2BKN A;  3BK9 A;  3EI0 A;  2J62 A;  2XQA A;  5FKY A;  2PJQ A;  4C90 A;  3VHL A;  5FXV A;  5BR8 T;  3FZH B;  1VCS A;  4TNV A;  4AKH A;  4I50 E;  1QLB A;  5ABF B;  2XAF B;  3KBU A;  4U33 A;  4NUV A;  2ZM6 T;  4UXN B;  4YFS A;  4KI0 F;  2IUB A;  2JMK A;  5ABH A;  4NUU A;  4Z8X A;  4U7I A;  3M65 A;  5BMV E;  3RYF E;  4ZZC A;  4IDN A;  3JAF A;  2N1G A;  4DID B;  4JI0 T;  2VKJ A;  3Q2M A;  4TN7 B;  4TWH A;  4U2Y A;  4A56 A;  2W00 A;  2ES0 A;  5HXE A;  3ZYM A;  2DNX A;  2CWY A;  3KV6 A;  5L4H A;  4IL4 A;  5HXS A;  5JDQ A;  4EV6 A;  5FY7 A;  5L4E A;  4LF6 T;  3LSV A;  4X62 T;  5ADX L;  2LOS A;  3LK4 2;  2BG9 B;  2CHO A;  3RRC A;  5AQF B;  2D0T A;  4JUY A;  4IT4 A;  2JQH A;  3D0T A;  1UK5 A;  1VRB A;  1D1B A;  4CI2 B;  4UF0 A;  3Q5E A;  2KLQ A;  1UUS A;  3RYC E;  5A1L A;  5FL1 A;  4YT0 A;  4TWF A;  3P7I A;  1HX8 A;  3KVA A;  3AEA A;  5JR9 C;  2Y8D A;  3AAE B;  3H3A A;  3PUR A;  3RQU A;  1J5W A;  3NKZ A;  3N9N A;  4BJM A;  2XJ7 A;  3MJX A;  2V7L A;  3G06 A;  4LF9 T;  2X9H A;  1LKX A;  1HNZ T;  2OV9 A;  5KX5 E;  5JVD E;  2Q9Q C;  4N78 D;  3IHR A;  5FNV E;  3RH3 A;  1N36 T;  2PG8 A;  4DBR A;  1O3X A;  2YDR A;  2BVM A;  3ZLI A;  3AEE A;  4EED A;  4BJN A;  4KBM B;  4C91 A;  4QXH B;  2X9X A;  1H7C A;  1LVF A;  2WSS V;  4X1I E;  5FYM A;  2KIN B;  2XQ6 A;  2QVA A;  3WI3 A;  3UU4 A;  4H9Q C;  4UV8 B;  4IE6 A;  3FZM B;  3A7M A; 
#chains in the Genus database with same CATH homology
 2VQF T;  4JI8 T;  4DUY T;  4DV1 T;  4X62 T;  4DV2 T;  1XNQ T;  4X66 T;  5LMN T;  4X64 T;  1N34 T;  2UUC T;  4JYA T;  4JI2 T;  1XMO T;  4JI5 T;  4X65 T;  3T1H T;  2VQE T;  1HNX T;  2HHH T;  4AQY T;  2UXC T;  4DV4 T;  5IWA T;  4LFB T;  2UU9 T;  4JI7 T;  4JI1 T;  4JV5 T;  1IBM T;  4LFC T;  4DUZ T;  3T1Y T;  4DR4 T;  2F4V T;  2UUB T;  4B3T T;  4B3M T;  4JI3 T;  1N33 T;  4DV0 T;  4KHP T;  2E5L T;  5BR8 T;  4LF4 T;  1FJG T;  4LFA T;  1HNW T;  2ZM6 T;  4DR2 T;  4LF9 T;  4DR1 T;  4GKK T;  4DV3 T;  4JI6 T;  1HNZ T;  4LF5 T;  4DR5 T;  3OTO T;  1N36 T;  4B3R T;  4JI4 T;  2UXB T;  1XMQ T;  4JI0 T;  2UUA T;  4DV5 T;  1N32 T;  4NXN T;  5LMU T;  1I94 T;  4DR6 T;  1IBK T;  4NXM T;  1HR0 T;  1IBL T;  4LF7 T;  4DV6 T;  4DR3 T;  4OX9 T;  1XNR T;  1J5E T;  4B3S T;  4GKJ T;  4LF8 T;  4YY3 T;  4YHH T;  4DV7 T;  2UXD T;  4K0K T;  4DR7 T;  4LF6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...