3IA3A

A cis-proline in alpha-hemoglobin stabilizing protein directs the structural reorganization of alpha-hemoglobin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
ALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen transport
molecule keywords Alpha-hemoglobin-stabilizing protein
publication title A cis-proline in alpha-hemoglobin stabilizing protein directs the structural reorganization of alpha-hemoglobin.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 3ia3A00
3Q5EA 3IA3A 4IDQA 1W0AA 1W09A 4IDOA 3X1DA 3Q5DA 1XZYA 3OVUA 1Y01A 3QOFA 4IDNA 1Z8UA 1W0BA 3QNUA 4IDPA
chains in the Genus database with same CATH superfamily
2PTFA 4IDQA 4DO0A 4LF7T 4KP3C 4AI6A 3AA0B 5LP6E 3R84B 2CE7A 2QA7A 3AE5A 3TLUA 5TAOA 4DBQA 4GK0E 1D1AA 4EB6E 2IMLA 2OLTA 2LKGA 3AEBA 4DVDA 5CA0E 3JADA 5DQWA 1I94T 4AXPA 2DWKA 4EIWA 1NENA 1E2AA 2BG9E 4DV6T 3RGLA 4LMJA 1J5ET 3Q5EA 3FZHB 3E08A 4DR5T 2MYSA 4HWDA 1N32T 2BDEA 2XUEA 4DV4T 2V6YA 1S94A 3NKZA 3KVAA 5LGNB 2KMFA 4MHCA 2L9QA 4YHHT 2JPFA 4YSYA 5ABEA 2W67A 2EHOA 4COFA 4LFBT 3ONXA 1US7B 2V1DB 1W09A 2W66A 3FXDB 4H9PC 4YJ2E 3JC6D 3LFMA 3PUXF 4AIUA 5AQTB 4KUMB 4ILAA 4AQFC 3KFWX 4OK0A 4ZXLA 4QH5A 3RYCE 2A9UA 3UULA 4TUYE 5EK3A 2YDRA 1SA0E 2CEAA 2LE8A 2B76A 1BR1A 1XMQT 5HAXA 4I55E 5KX5E 5ABGA 3FBLA 2XAGB 3GN5B 2K3WA 2H7VC 3GMIA 5ADXL 2WWUA 2X68A 3LDQB 1UX5A 1YKHB 2NTYA 3PJAA 4DV3T 2WDQA 1KEYA 4JI6T 3AE9A 5LBMA 5AQJB 2V5DA 3LSVA 1NWMX 4HFCA 5FXWA 4QHOA 3LBXB 1N34T 3C51A 3N9QA 2M6BA 3LG7A 4CXWA 3IF8B 1LRZA 4X1KE 5F8PA 3A8YC 3O9XA 4KBMB 4CI3B 4TZ4C 3AE3A 4ZI7E 4UF0B 1BR4A 2JQKA 2XSAA 4LMKA 3ZT5A 2C5IT 4NUVA 5LGUB 5JR9B 2DI4A 4EZ4A 4JI8T 2WP9A 2H89A 2LKHA 1WR6A 3VHLA 4A56A 1J5WA 4UELA 5AQUB 3RQWA 1J1JA 3ZMUB 3ANWB 2DCFA 3FZKB 2E9XB 4UV8B 4GOUA 2KZ7B 1BR2A 2HN1A 1G8XA 3J9X1 3L39A 2K48A 4U7YA 2V7JA 3ESLA 1H7CA 4CZZB 5HXHA 1Z8UA 3N9OA 3F2EA 2UXXB 1D0ZA 4F6RC 4DMVA 2D9DA 2BVLA 3QUJA 4DBRA 3ZN0B 5LHHB 3QNUA 4TWFA 4PNIA 5IWAT 1IBLT 5JR9C 3E22E 5HEJA 4AISA 2LSGA 4JI7T 4PJJA 1SUMB 2ODUA 4PK5A 4H63H 1Z0PA 3C4XA 3UFGA 3K3NA 1HNZT 4DR3T 2VQET 2D0UA 2XQ5A 1SE7A 2BG9B 2YINA 4ZS3A 4DMWA 2WB5A 4CQIA 4YTMA 3K1SA 2LRKA 3VKHA 5AQQB 2CBIA 2G0UA 2Q9QB 4YFSA 3CWZB 3C4WA 4QKNA 3FBZA 2L3LA 4QH1A 5AQMB 4AKGA 3GWHA 1FJGT 3ZN1B 3A7MA 4V1Av 2E2AA 3AA6B 3PV0F 4EAHA 1XNQT 3OVUA 4A97A 2X0LB 3RRWA 2WDVA 1HTJF 4GYRA 5HCMA 5LMUT 3BQKA 2AE9A 4H63V 4IL4A 5AQOB 3ZKRA 2BKNA 5EZYE 4OFZA 3NRYA 1XZYA 5AQVB 1V9DA 2BG9C 3EVYA 5CB4E 1XNRT 5CJ5A 3CQGB 3OBVE 1IBKT 4IREA 1HCIA 2NOXA 3ZSTA 3VKGA 3V5UA 5LHIB 5HWYA 2Q9QC 3N9LA 3NZQA 4YT0A 2A3DA 3QB5K 4PW8A 3SS1A 5L3DB 5KXJA 3WAJA 3OPCA 2MPKA 3ZCIA 5LOVE 2LHNA 4U3CA 2YU1A 1B7TA 4IE7A 4HFVA 2V26A 3KV9A 3MACA 5FXZA 2W61A 3RC3A 2Z6EA 3OYZA 4ZZBA 2XY8B 4CN1A 4ILCA 3N2KE 2IUBA 4AQYT 4EV6A 3LK2B 4NPPA 3FZMB 3RQUA 5FXVA 2HHHT 1NAFA 5FY7A 2ES0A 3QB5A 2XQ4A 4FI5A 2LSIA 4QXBB 4WYVA 3NZPA 3IHRA 5FY1A 4HN9A 5LA6E 4HKAA 3ZC0A 1ZEEA 4U2ZA 1G73A 2XHEB 1MMGA 3I0OA 3KDSE 5J0ZA 5FL1A 5KDMC 4JI0T 2WU2A 3H3MA 4DV5T 2JJ9A 4E7SA 5AQFB 2M67A 5GONE 3AAAB 5BMVE 1X9BA 2MOZA 3U78A 5FYMA 5FY0A 1W0BA 2CA5A 3O1HA 2X67A 5C8YE 1CHUA 2QYWA 5LJNA 3D0TA 4YXDA 3AE8A 2DWGA 3AE2A 1WYBA 1UUSA 2C5KT 4LMLA 2MAWA 2VKHA 1FMWA 1T72A 4P0BA 5HWXA 5LNKA 4WNKA 4O4LE 3AEAA 4LF9T 3H3AA 2BBHA 4O2BE 3EAMA 1OEDE 3ZMTB 4Z91A 3HL6A 4HFBA 3RI5A 4BJMA 1R8IA 5BR8T 3HA4A 2MBGA 2I6HA 2YDQA 4ADZA 4PK4A 5DQVA 4YJ3E 4UR9A 2JMKA 3N9PA 2VL8A 3NRXA 1KNPA 3CX6B 4N78D 5FP3A 2VVNA 2V7IA 2PFVA 3NVOA 4O4IE 1HX1B 4LFCT 4ZHQE 1D1CA 3PUQA 1T7SA 3SFEA 2BS3A 2XQ9A 3X1DA 3Q2MA 4A5XA 1VRBA 4H9QC 1EZ3A 1ZHCA 5L3BB 4ISTA 2W00A 5JDGA 1CUNA 4P1NA 5JVDE 3FZFB 2V5CA 4I50E 4IDNA 3OJAA 4U31A 5LG4A 3ZT6A 2Q9QD 5JDQA 3GA8A 2X9WA 1ZOYA 3TKLB 2CHOA 2UUAT 4I4TE 2J47A 1W9RA 2WBLA 2XQYA 4QXCB 1JNZA 5C3JA 2LSYA 2X9HA 4U74A 3C98B 4HWCA 4LF8T 2RP4A 4U33A 5AQNB 4EEDA 4BJNA 1UK5A 1T98A 5HXRA 3JAEA 1UCUA 2UXBT 2ZM8A 2LEHA 3NWIA 3P4PA 2DHRA 4DV0T 5JDLA 1X79A 2LHRA 3TLVA 3OTOT 4CI1B 2XPKA 2IHR1 4B3RT 1U5PA 3M3ZB 5JDNA 5HEGA 4PK6A 2CCQA 1MMNA 3O4XE 3PUSA 3AXJA 3HKDE 2XAQB 2JMHA 2OA5A 5LYJE 5FVLA 3Q5XA 3UU6A 2AXDS 2WCAA 3V5SA 2BKPA 5AQGB 3N2OA 4LF5T 4GYSA 3ZC1A 4U7IA 2CLYB 1HX8A 2ZLYA 2FJAA 2XZEA 1I6ZA 1Y01A 5LHGB 4EZHA 3ZT7A 4EGWA 2NW7A 3CVRA 4LFAT 2MTQA 3CQCB 4K0UA 4IE5A 3KV6A 4JBWF 3RC8A 2KNDA 4CN4A 3FHNA 4HGAA 5LB7B 4AQFA 5LCYA 2VQFT 4MALA 5HEOA 4YSZA 3PU8A 3KBUA 3WAKA 5F5WA 2KXPB 1MMAA 4ISSA 4L9IA 4JEUB 4X1IE 2WMNA 2XQAA 1KNZA 3EHZA 4NUUA 5LGTB 3ZJ1A 3G06A 4Z8XA 4ERRA 4ASKA 5AQLB 3PE0A 5LMNT 4DNDA 3L3PA 5FMNA 3ONLC 1QLBA 2VASA 2UXCT 1OEDB 4HWHA 3CX7B 3K3OA 2W62A 5J1GA 4ZOLE 5L2LA 4UXNB 2BBJA 4F8HA 1YW0A 2QVAA 1E1HB 2NWBA 2K24A 4OX9T 3O1IA 4IT4A 3ZMSB 3PUGA 3AVSA 1HR0T 5FVKA 4MBQA 5AQIB 2CBJA 3KV4A 2C5JA 2VKJA 2XQ6A 4EEBA 2WSSV 5ABFB 1MNDA 2KINB 2H3RA 3GN5A 4KHZF 1KNRA 4G2AA 3CIRA 4IHJE 3RIFA 2IAKA 2JRKA 4WBNE 4X62T 4ZI3C 1OEDC 3JAFA 3RHWA 2E9XC 4O4JE 4HFEA 3UQ4A 3AE7A 4ZEYA 3LBXA 2KT9A 3ETUA 1QUUA 4IE4A 4OYKA 1LVFA 3VR9A 3AB3B 4B6XA 1HNXT 3HR0A 4KI0F 3DJBA 3ZCJA 2LM9A 3ONJA 4U72A 2ODVA 2XTLA 1ZKEA 4UF0A 3AEFA 4DR6T 4PJNA 5JRCB 1YQ4A 5L4EA 2LSJA 4X20E 5JR9A 2UXNB 2YEVC 4JI2T 3UU4A 2LT3A 3P4SA 2RPAA 3ZMVB 3ANWA 3SRZA 5LJMA 2E9XA 2M6IA 1XDOA 4EOZB 2KSRA 1HNWT 1UX4A 4ILUA 5AQKB 4JYAT 1YXRA 3P4QA 3OYXA 4G63A 5IHYA 3AAIA 1WRDA 4MLKA 3P7IA 3AE1A 3AEEA 4ILBA 1XMOT 3EI0A 4TNWA 2LOSA 3ZYKA 4OHFA 2ZM0A 3ZPOA 5L3FB 1YQ3A 2I0MA 2IC6A 1L0VA 5CFBA 2HPJA 3DP7A 4PFPA 3UUMA 2WM9A 4YY3T 4ZS2A 2Y48B 3TLTA 3PUAA 4KHPT 3P4WA 2BG9A 3VRAA 3JCFA 3K3QC 4HFHA 1OWAA 3H37A 2CWOA 1LVKA 2WS3A 3UFEA 3B13A 1FEWA 4UIGA 3AVRA 5C2TA 4DR2T 5H6QB 2Q9QA 3ZJ2A 2E8IA 1VCTA 3P8CD 3MKDA 4NXMT 2WZIA 2HN2A 2PBIA 4TV8E 3VRBA 1IBMT 3FXEB 2NP9A 5EK2A 3UUBA 2YDSA 5FL0A 2QGSA 2J62A 2ACZA 5A1LA 3KV5A 3MA9A 3RYIE 2YN6A 5FNVE 4KMCA 2CPTA 4Z90A 3MJXA 1XDPA 4ZI3D 4UVCB 2A2FX 5CGMA 2FBWA 2E9XD 2CXLA 2WY2A 5HXSA 3L09A 2CM0A 3RPUA 2KWIB 4IE0A 4PAGA 3ZYLA 4HFDA 2DLRA 4HWIB 3AEDA 2BS4A 2VKDA 2V6YB 4QX7B 5HCJA 4E7ZA 2GK9A 5AQPB 2UUCT 4ZZCA 4EXTA 4O2AE 2J4GA 3AE4A 5KMGP 1IZNB 4Q25A 2X51A 4AKRB 5E0OA 4PJLA 2W63A 5HEHA 2EHOB 1MIYA 5ETWA 1ZV4X 3CX8B 3P4RA 3ZMZB 2KWHA 1FIOA 2CRBA 5AQSB 2YOEA 3O1JA 1O3XA 2WDRA 1BR0A 2D0TA 4B3TT 3PU3A 3EUHA 4AKIA 1XWMA 3I0QA 4PFOA 3A5XA 4UV9B 4GKKT 1W0AA 2WMOA 2BZBA 5EK4A 1KFYA 2QRXA 3AAEB 1HFAA 3Q5WA 4JI1T 2H7OA 2IDOB 4H9OC 4JLEA 3ZSSA 3PUWF 3I9WA 4QX8B 1NEKA 2VVSA 3CMLA 2X66A 4GK5E 1UURA 2XQ7A 2EHOC 2XM2A 2N1GA 3TLSA 4HE8A 3UQ7A 1IJ6A 1UGOA 2YK0A 4GIWA 3J7Yq 1D0YA 1U4QA 2SPCA 4DUZT 2ZMAA 1SHZC 2XJ7A 4CXYA 1JNRA 3N2GE 4IE6A 4EYUA 5JDMA 1MNEA 4QH4A 1WFDA 5FXXA 1VOMA 2V7MA 3I9YA 4FJOA 3AEGA 4EYYR 1IAPA 3BK9A 2NR4A 4DV1T 4BA9A 1MMDA 3C4ZA 2I59A 3RIUC 4TWDA 5JQGE 4IGUA 5JTGA 5IYZE 2DL1A 2W0GA 3LK42 3B57A 2PG8A 4ANJA 2JQ9A 2R6GF 2V7LA 4IDOA 3HKBE 2CHNA 4WW0A 4AQGA 2YKSA 3CPZA 4BAYB 4XAXB 2K9AA 4X1YE 2FJDA 2XASB 3RIAA 3HKEE 2P9BA 3PUZF 1YD8G 3IBPA 3EDVA 4JV5T 1HS7A 2XQ3A 3CQXC 3T1YT 3RIUA 4B3ST 2NTXA 4NIQA 2W2UA 5L4HA 3RRCA 1N36T 1GQEA 4UEMA 5L3EB 2FJEA 4QXHB 3NBXX 2OV9A 2CLYC 3VU7H 1DU2A 1MIVA 5HEUA 3RX6A 4DV2T 2VB6A 2BKOA 2YU2A 2XQ8A 3N9NA 4TN7B 4YTPA 1OXZA 3PDYA 5JREA 4H9NC 4X5TA 3RLFF 2N2NA 2EHOD 2VL0A 4PJMA 5JH7E 5J2TE 3HKCE 3E0ZA 2LRLA 2RA1A 2W4XA 4IL9A 5JDFA 4GKJT 3ZLIA 2D2SA 3RYFE 3Q9DA 4HTEA 4LF4T 4K0KT 3BQLA 2Y6XA 3OKQA 3PTRB 2X9XA 1IJ5A 3FB2A 4JI5T 5DJQC 5HXCA 4NXNT 1D1BA 4KX6A 4X66T 5DABA 3IEEA 3UUXB 4L5GA 3B5MA 2HH7A 4QWNB 3UTKA 3W15B 2UUBT 3I1AA 4OYJA 4L0RA 3RH3A 2XAFB 3PUVF 4TV9E 4DUYT 4LF6T 3MZKB 3EABA 3F57A 2WWVA 4UVBB 5H6RB 2NW8A 3MK7C 2IW5B 3T8OA 3AE6A 3SOLA 4A98A 4AKLA 3C64A 3U3IA 4DR7T 4TNVA 4YLHA 3F31A 2LM2A 3ZEFB 5CA1E 5L3GB 2XM1A 4ZI2C 4C91A 3IA3A 2WQYA 4WZXA 3QOFA 3RKOA 2B1EA 4YSXA 2V6XA 2VKOA 4C90A 1S35A 4IDZA 4MFRA 3RKGA 3UU5A 4IIJE 1OEDA 2KLQA 4B3MT 3AECA 1MIWA 2WZHA 3PURA 2VWAA 2IIUA 2LJLA 2V8SV 2Y8DA 2K5BB 2E5VA 5L3CB 2A72A 4X64T 4DR1T 2ZM2A 3MXZA 4P09A 3DTOA 4DV7T 4YHJA 4TX5A 5AQHB 1M7KA 4JEHB 2LOPA 2UU9T 5LXTE 2IC9A 2WU5A 4I0UA 4UVAB 1T8BA 5ABFA 3L8RA 3WI3A 5F3JA 3ETVA 3KVBA 1QSDA 3ABVA 3KINB 4X65T 2NW9A 3P50A 5ABHA 2VK9A 4CN6A 2PJQA 3KBTA 3UUNA 5LBQB 3AA7B 2BVMA 3S4UA 3CKDA 2CMRA 3HI2A 2DNXA 3AA1B 4I43B 2JQHA 1E7PA 4M1PA 2CXDA 3BQIA 4DIDB 4HWFA 4HEAA 2HPLA 4HFIA 3UU3A 4IDPA 3Q5DA 4P0AA 2LLYA 2CWYA 1Y64B 1WYCA 3SFDA 3LK3B 2E5LT 4CXXA 4O8SA 5JRCA 4U2YA 2WAUA 3VR8A 2CXFA 1VCSA 2FUPA 3TLWA 5HYAA 5FKYA 4JUYA 2N9DA 2JIWA 1HF8A 3JC6C 5AFUL 2BS2A 3R6NA 3CK6A 3RYHE 4DR4T 1KF6A 4J2CA 3T1HT 2LSKA 4H9RC 4AKHA 1M62A 1AJ3A 3C50A 2L8KA 2VURA 1FMVA 2D5UA 2X0HA 1N33T 2X9YA 2XAJB 2C0SA 5IUXA 1HG5A 4JI3T 5L47A 3QC9A 5M4YA 2ACXA 3M65A 3N5LA 1WR0A 4XBFB 2F4VT 2V7KA 3UT5E 1WCRA 4O4HE 1HG2A 3UU8A 1KK7A 1D0XA 3EDUA 3N9MA 4ZI2D 2J1DG 3ZYMA 3PJAJ 3PUYF 2JQQA 4WBOA 1ZP0A 5LG3A 3QK6A 1LKXA 5JDHA 2FJBA 5AQRB 3SWHA 2X0YA 3AXJB 4XZCA 3LJCA 1YKEB 4JI4T 2ZM6T 4CI2B 4YTNA 3K8PC 2UXDT 2XSBA 5HXEA 2XAHB 4TWHA 2H88A 3RF1A 3FZLB 5J2UE 4H9SE 1WLXA
chains in the Genus database with same CATH topology
3Q5EA 3IA3A 4IDQA 1W0AA 1W09A 4IDOA 3X1DA 3Q5DA 1XZYA 3OVUA 1Y01A 3QOFA 4IDNA 1Z8UA 1W0BA 3QNUA 4IDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5E A;  3IA3 A;  4IDQ A;  1W0A A;  1W09 A;  4IDO A;  3X1D A;  3Q5D A;  1XZY A;  3OVU A;  1Y01 A;  3QOF A;  4IDN A;  1Z8U A;  1W0B A;  3QNU A;  4IDP A; 
#chains in the Genus database with same CATH topology
 2PTF A;  4IDQ A;  4DO0 A;  4LF7 T;  4KP3 C;  4AI6 A;  3AA0 B;  5LP6 E;  3R84 B;  2CE7 A;  2QA7 A;  3AE5 A;  3TLU A;  5TAO A;  4DBQ A;  4GK0 E;  1D1A A;  4EB6 E;  2IML A;  2OLT A;  2LKG A;  3AEB A;  4DVD A;  5CA0 E;  3JAD A;  5DQW A;  1I94 T;  4AXP A;  2DWK A;  4EIW A;  1NEN A;  1E2A A;  2BG9 E;  4DV6 T;  3RGL A;  4LMJ A;  1J5E T;  3Q5E A;  3FZH B;  3E08 A;  4DR5 T;  2MYS A;  4HWD A;  1N32 T;  2BDE A;  2XUE A;  4DV4 T;  2V6Y A;  1S94 A;  3NKZ A;  3KVA A;  5LGN B;  2KMF A;  4MHC A;  2L9Q A;  4YHH T;  2JPF A;  4YSY A;  5ABE A;  2W67 A;  2EHO A;  4COF A;  4LFB T;  3ONX A;  1US7 B;  2V1D B;  1W09 A;  2W66 A;  3FXD B;  4H9P C;  4YJ2 E;  3JC6 D;  3LFM A;  3PUX F;  4AIU A;  5AQT B;  4KUM B;  4ILA A;  4AQF C;  3KFW X;  4OK0 A;  4ZXL A;  4QH5 A;  3RYC E;  2A9U A;  3UUL A;  4TUY E;  5EK3 A;  2YDR A;  1SA0 E;  2CEA A;  2LE8 A;  2B76 A;  1BR1 A;  1XMQ T;  5HAX A;  4I55 E;  5KX5 E;  5ABG A;  3FBL A;  2XAG B;  3GN5 B;  2K3W A;  2H7V C;  3GMI A;  5ADX L;  2WWU A;  2X68 A;  3LDQ B;  1UX5 A;  1YKH B;  2NTY A;  3PJA A;  4DV3 T;  2WDQ A;  1KEY A;  4JI6 T;  3AE9 A;  5LBM A;  5AQJ B;  2V5D A;  3LSV A;  1NWM X;  4HFC A;  5FXW A;  4QHO A;  3LBX B;  1N34 T;  3C51 A;  3N9Q A;  2M6B A;  3LG7 A;  4CXW A;  3IF8 B;  1LRZ A;  4X1K E;  5F8P A;  3A8Y C;  3O9X A;  4KBM B;  4CI3 B;  4TZ4 C;  3AE3 A;  4ZI7 E;  4UF0 B;  1BR4 A;  2JQK A;  2XSA A;  4LMK A;  3ZT5 A;  2C5I T;  4NUV A;  5LGU B;  5JR9 B;  2DI4 A;  4EZ4 A;  4JI8 T;  2WP9 A;  2H89 A;  2LKH A;  1WR6 A;  3VHL A;  4A56 A;  1J5W A;  4UEL A;  5AQU B;  3RQW A;  1J1J A;  3ZMU B;  3ANW B;  2DCF A;  3FZK B;  2E9X B;  4UV8 B;  4GOU A;  2KZ7 B;  1BR2 A;  2HN1 A;  1G8X A;  3J9X 1;  3L39 A;  2K48 A;  4U7Y A;  2V7J A;  3ESL A;  1H7C A;  4CZZ B;  5HXH A;  1Z8U A;  3N9O A;  3F2E A;  2UXX B;  1D0Z A;  4F6R C;  4DMV A;  2D9D A;  2BVL A;  3QUJ A;  4DBR A;  3ZN0 B;  5LHH B;  3QNU A;  4TWF A;  4PNI A;  5IWA T;  1IBL T;  5JR9 C;  3E22 E;  5HEJ A;  4AIS A;  2LSG A;  4JI7 T;  4PJJ A;  1SUM B;  2ODU A;  4PK5 A;  4H63 H;  1Z0P A;  3C4X A;  3UFG A;  3K3N A;  1HNZ T;  4DR3 T;  2VQE T;  2D0U A;  2XQ5 A;  1SE7 A;  2BG9 B;  2YIN A;  4ZS3 A;  4DMW A;  2WB5 A;  4CQI A;  4YTM A;  3K1S A;  2LRK A;  3VKH A;  5AQQ B;  2CBI A;  2G0U A;  2Q9Q B;  4YFS A;  3CWZ B;  3C4W A;  4QKN A;  3FBZ A;  2L3L A;  4QH1 A;  5AQM B;  4AKG A;  3GWH A;  1FJG T;  3ZN1 B;  3A7M A;  4V1A v;  2E2A A;  3AA6 B;  3PV0 F;  4EAH A;  1XNQ T;  3OVU A;  4A97 A;  2X0L B;  3RRW A;  2WDV A;  1HTJ F;  4GYR A;  5HCM A;  5LMU T;  3BQK A;  2AE9 A;  4H63 V;  4IL4 A;  5AQO B;  3ZKR A;  2BKN A;  5EZY E;  4OFZ A;  3NRY A;  1XZY A;  5AQV B;  1V9D A;  2BG9 C;  3EVY A;  5CB4 E;  1XNR T;  5CJ5 A;  3CQG B;  3OBV E;  1IBK T;  4IRE A;  1HCI A;  2NOX A;  3ZST A;  3VKG A;  3V5U A;  5LHI B;  5HWY A;  2Q9Q C;  3N9L A;  3NZQ A;  4YT0 A;  2A3D A;  3QB5 K;  4PW8 A;  3SS1 A;  5L3D B;  5KXJ A;  3WAJ A;  3OPC A;  2MPK A;  3ZCI A;  5LOV E;  2LHN A;  4U3C A;  2YU1 A;  1B7T A;  4IE7 A;  4HFV A;  2V26 A;  3KV9 A;  3MAC A;  5FXZ A;  2W61 A;  3RC3 A;  2Z6E A;  3OYZ A;  4ZZB A;  2XY8 B;  4CN1 A;  4ILC A;  3N2K E;  2IUB A;  4AQY T;  4EV6 A;  3LK2 B;  4NPP A;  3FZM B;  3RQU A;  5FXV A;  2HHH T;  1NAF A;  5FY7 A;  2ES0 A;  3QB5 A;  2XQ4 A;  4FI5 A;  2LSI A;  4QXB B;  4WYV A;  3NZP A;  3IHR A;  5FY1 A;  4HN9 A;  5LA6 E;  4HKA A;  3ZC0 A;  1ZEE A;  4U2Z A;  1G73 A;  2XHE B;  1MMG A;  3I0O A;  3KDS E;  5J0Z A;  5FL1 A;  5KDM C;  4JI0 T;  2WU2 A;  3H3M A;  4DV5 T;  2JJ9 A;  4E7S A;  5AQF B;  2M67 A;  5GON E;  3AAA B;  5BMV E;  1X9B A;  2MOZ A;  3U78 A;  5FYM A;  5FY0 A;  1W0B A;  2CA5 A;  3O1H A;  2X67 A;  5C8Y E;  1CHU A;  2QYW A;  5LJN A;  3D0T A;  4YXD A;  3AE8 A;  2DWG A;  3AE2 A;  1WYB A;  1UUS A;  2C5K T;  4LML A;  2MAW A;  2VKH A;  1FMW A;  1T72 A;  4P0B A;  5HWX A;  5LNK A;  4WNK A;  4O4L E;  3AEA A;  4LF9 T;  3H3A A;  2BBH A;  4O2B E;  3EAM A;  1OED E;  3ZMT B;  4Z91 A;  3HL6 A;  4HFB A;  3RI5 A;  4BJM A;  1R8I A;  5BR8 T;  3HA4 A;  2MBG A;  2I6H A;  2YDQ A;  4ADZ A;  4PK4 A;  5DQV A;  4YJ3 E;  4UR9 A;  2JMK A;  3N9P A;  2VL8 A;  3NRX A;  1KNP A;  3CX6 B;  4N78 D;  5FP3 A;  2VVN A;  2V7I A;  2PFV A;  3NVO A;  4O4I E;  1HX1 B;  4LFC T;  4ZHQ E;  1D1C A;  3PUQ A;  1T7S A;  3SFE A;  2BS3 A;  2XQ9 A;  3X1D A;  3Q2M A;  4A5X A;  1VRB A;  4H9Q C;  1EZ3 A;  1ZHC A;  5L3B B;  4IST A;  2W00 A;  5JDG A;  1CUN A;  4P1N A;  5JVD E;  3FZF B;  2V5C A;  4I50 E;  4IDN A;  3OJA A;  4U31 A;  5LG4 A;  3ZT6 A;  2Q9Q D;  5JDQ A;  3GA8 A;  2X9W A;  1ZOY A;  3TKL B;  2CHO A;  2UUA T;  4I4T E;  2J47 A;  1W9R A;  2WBL A;  2XQY A;  4QXC B;  1JNZ A;  5C3J A;  2LSY A;  2X9H A;  4U74 A;  3C98 B;  4HWC A;  4LF8 T;  2RP4 A;  4U33 A;  5AQN B;  4EED A;  4BJN A;  1UK5 A;  1T98 A;  5HXR A;  3JAE A;  1UCU A;  2UXB T;  2ZM8 A;  2LEH A;  3NWI A;  3P4P A;  2DHR A;  4DV0 T;  5JDL A;  1X79 A;  2LHR A;  3TLV A;  3OTO T;  4CI1 B;  2XPK A;  2IHR 1;  4B3R T;  1U5P A;  3M3Z B;  5JDN A;  5HEG A;  4PK6 A;  2CCQ A;  1MMN A;  3O4X E;  3PUS A;  3AXJ A;  3HKD E;  2XAQ B;  2JMH A;  2OA5 A;  5LYJ E;  5FVL A;  3Q5X A;  3UU6 A;  2AXD S;  2WCA A;  3V5S A;  2BKP A;  5AQG B;  3N2O A;  4LF5 T;  4GYS A;  3ZC1 A;  4U7I A;  2CLY B;  1HX8 A;  2ZLY A;  2FJA A;  2XZE A;  1I6Z A;  1Y01 A;  5LHG B;  4EZH A;  3ZT7 A;  4EGW A;  2NW7 A;  3CVR A;  4LFA T;  2MTQ A;  3CQC B;  4K0U A;  4IE5 A;  3KV6 A;  4JBW F;  3RC8 A;  2KND A;  4CN4 A;  3FHN A;  4HGA A;  5LB7 B;  4AQF A;  5LCY A;  2VQF T;  4MAL A;  5HEO A;  4YSZ A;  3PU8 A;  3KBU A;  3WAK A;  5F5W A;  2KXP B;  1MMA A;  4ISS A;  4L9I A;  4JEU B;  4X1I E;  2WMN A;  2XQA A;  1KNZ A;  3EHZ A;  4NUU A;  5LGT B;  3ZJ1 A;  3G06 A;  4Z8X A;  4ERR A;  4ASK A;  5AQL B;  3PE0 A;  5LMN T;  4DND A;  3L3P A;  5FMN A;  3ONL C;  1QLB A;  2VAS A;  2UXC T;  1OED B;  4HWH A;  3CX7 B;  3K3O A;  2W62 A;  5J1G A;  4ZOL E;  5L2L A;  4UXN B;  2BBJ A;  4F8H A;  1YW0 A;  2QVA A;  1E1H B;  2NWB A;  2K24 A;  4OX9 T;  3O1I A;  4IT4 A;  3ZMS B;  3PUG A;  3AVS A;  1HR0 T;  5FVK A;  4MBQ A;  5AQI B;  2CBJ A;  3KV4 A;  2C5J A;  2VKJ A;  2XQ6 A;  4EEB A;  2WSS V;  5ABF B;  1MND A;  2KIN B;  2H3R A;  3GN5 A;  4KHZ F;  1KNR A;  4G2A A;  3CIR A;  4IHJ E;  3RIF A;  2IAK A;  2JRK A;  4WBN E;  4X62 T;  4ZI3 C;  1OED C;  3JAF A;  3RHW A;  2E9X C;  4O4J E;  4HFE A;  3UQ4 A;  3AE7 A;  4ZEY A;  3LBX A;  2KT9 A;  3ETU A;  1QUU A;  4IE4 A;  4OYK A;  1LVF A;  3VR9 A;  3AB3 B;  4B6X A;  1HNX T;  3HR0 A;  4KI0 F;  3DJB A;  3ZCJ A;  2LM9 A;  3ONJ A;  4U72 A;  2ODV A;  2XTL A;  1ZKE A;  4UF0 A;  3AEF A;  4DR6 T;  4PJN A;  5JRC B;  1YQ4 A;  5L4E A;  2LSJ A;  4X20 E;  5JR9 A;  2UXN B;  2YEV C;  4JI2 T;  3UU4 A;  2LT3 A;  3P4S A;  2RPA A;  3ZMV B;  3ANW A;  3SRZ A;  5LJM A;  2E9X A;  2M6I A;  1XDO A;  4EOZ B;  2KSR A;  1HNW T;  1UX4 A;  4ILU A;  5AQK B;  4JYA T;  1YXR A;  3P4Q A;  3OYX A;  4G63 A;  5IHY A;  3AAI A;  1WRD A;  4MLK A;  3P7I A;  3AE1 A;  3AEE A;  4ILB A;  1XMO T;  3EI0 A;  4TNW A;  2LOS A;  3ZYK A;  4OHF A;  2ZM0 A;  3ZPO A;  5L3F B;  1YQ3 A;  2I0M A;  2IC6 A;  1L0V A;  5CFB A;  2HPJ A;  3DP7 A;  4PFP A;  3UUM A;  2WM9 A;  4YY3 T;  4ZS2 A;  2Y48 B;  3TLT A;  3PUA A;  4KHP T;  3P4W A;  2BG9 A;  3VRA A;  3JCF A;  3K3Q C;  4HFH A;  1OWA A;  3H37 A;  2CWO A;  1LVK A;  2WS3 A;  3UFE A;  3B13 A;  1FEW A;  4UIG A;  3AVR A;  5C2T A;  4DR2 T;  5H6Q B;  2Q9Q A;  3ZJ2 A;  2E8I A;  1VCT A;  3P8C D;  3MKD A;  4NXM T;  2WZI A;  2HN2 A;  2PBI A;  4TV8 E;  3VRB A;  1IBM T;  3FXE B;  2NP9 A;  5EK2 A;  3UUB A;  2YDS A;  5FL0 A;  2QGS A;  2J62 A;  2ACZ A;  5A1L A;  3KV5 A;  3MA9 A;  3RYI E;  2YN6 A;  5FNV E;  4KMC A;  2CPT A;  4Z90 A;  3MJX A;  1XDP A;  4ZI3 D;  4UVC B;  2A2F X;  5CGM A;  2FBW A;  2E9X D;  2CXL A;  2WY2 A;  5HXS A;  3L09 A;  2CM0 A;  3RPU A;  2KWI B;  4IE0 A;  4PAG A;  3ZYL A;  4HFD A;  2DLR A;  4HWI B;  3AED A;  2BS4 A;  2VKD A;  2V6Y B;  4QX7 B;  5HCJ A;  4E7Z A;  2GK9 A;  5AQP B;  2UUC T;  4ZZC A;  4EXT A;  4O2A E;  2J4G A;  3AE4 A;  5KMG P;  1IZN B;  4Q25 A;  2X51 A;  4AKR B;  5E0O A;  4PJL A;  2W63 A;  5HEH A;  2EHO B;  1MIY A;  5ETW A;  1ZV4 X;  3CX8 B;  3P4R A;  3ZMZ B;  2KWH A;  1FIO A;  2CRB A;  5AQS B;  2YOE A;  3O1J A;  1O3X A;  2WDR A;  1BR0 A;  2D0T A;  4B3T T;  3PU3 A;  3EUH A;  4AKI A;  1XWM A;  3I0Q A;  4PFO A;  3A5X A;  4UV9 B;  4GKK T;  1W0A A;  2WMO A;  2BZB A;  5EK4 A;  1KFY A;  2QRX A;  3AAE B;  1HFA A;  3Q5W A;  4JI1 T;  2H7O A;  2IDO B;  4H9O C;  4JLE A;  3ZSS A;  3PUW F;  3I9W A;  4QX8 B;  1NEK A;  2VVS A;  3CML A;  2X66 A;  4GK5 E;  1UUR A;  2XQ7 A;  2EHO C;  2XM2 A;  2N1G A;  3TLS A;  4HE8 A;  3UQ7 A;  1IJ6 A;  1UGO A;  2YK0 A;  4GIW A;  3J7Y q;  1D0Y A;  1U4Q A;  2SPC A;  4DUZ T;  2ZMA A;  1SHZ C;  2XJ7 A;  4CXY A;  1JNR A;  3N2G E;  4IE6 A;  4EYU A;  5JDM A;  1MNE A;  4QH4 A;  1WFD A;  5FXX A;  1VOM A;  2V7M A;  3I9Y A;  4FJO A;  3AEG A;  4EYY R;  1IAP A;  3BK9 A;  2NR4 A;  4DV1 T;  4BA9 A;  1MMD A;  3C4Z A;  2I59 A;  3RIU C;  4TWD A;  5JQG E;  4IGU A;  5JTG A;  5IYZ E;  2DL1 A;  2W0G A;  3LK4 2;  3B57 A;  2PG8 A;  4ANJ A;  2JQ9 A;  2R6G F;  2V7L A;  4IDO A;  3HKB E;  2CHN A;  4WW0 A;  4AQG A;  2YKS A;  3CPZ A;  4BAY B;  4XAX B;  2K9A A;  4X1Y E;  2FJD A;  2XAS B;  3RIA A;  3HKE E;  2P9B A;  3PUZ F;  1YD8 G;  3IBP A;  3EDV A;  4JV5 T;  1HS7 A;  2XQ3 A;  3CQX C;  3T1Y T;  3RIU A;  4B3S T;  2NTX A;  4NIQ A;  2W2U A;  5L4H A;  3RRC A;  1N36 T;  1GQE A;  4UEM A;  5L3E B;  2FJE A;  4QXH B;  3NBX X;  2OV9 A;  2CLY C;  3VU7 H;  1DU2 A;  1MIV A;  5HEU A;  3RX6 A;  4DV2 T;  2VB6 A;  2BKO A;  2YU2 A;  2XQ8 A;  3N9N A;  4TN7 B;  4YTP A;  1OXZ A;  3PDY A;  5JRE A;  4H9N C;  4X5T A;  3RLF F;  2N2N A;  2EHO D;  2VL0 A;  4PJM A;  5JH7 E;  5J2T E;  3HKC E;  3E0Z A;  2LRL A;  2RA1 A;  2W4X A;  4IL9 A;  5JDF A;  4GKJ T;  3ZLI A;  2D2S A;  3RYF E;  3Q9D A;  4HTE A;  4LF4 T;  4K0K T;  3BQL A;  2Y6X A;  3OKQ A;  3PTR B;  2X9X A;  1IJ5 A;  3FB2 A;  4JI5 T;  5DJQ C;  5HXC A;  4NXN T;  1D1B A;  4KX6 A;  4X66 T;  5DAB A;  3IEE A;  3UUX B;  4L5G A;  3B5M A;  2HH7 A;  4QWN B;  3UTK A;  3W15 B;  2UUB T;  3I1A A;  4OYJ A;  4L0R A;  3RH3 A;  2XAF B;  3PUV F;  4TV9 E;  4DUY T;  4LF6 T;  3MZK B;  3EAB A;  3F57 A;  2WWV A;  4UVB B;  5H6R B;  2NW8 A;  3MK7 C;  2IW5 B;  3T8O A;  3AE6 A;  3SOL A;  4A98 A;  4AKL A;  3C64 A;  3U3I A;  4DR7 T;  4TNV A;  4YLH A;  3F31 A;  2LM2 A;  3ZEF B;  5CA1 E;  5L3G B;  2XM1 A;  4ZI2 C;  4C91 A;  3IA3 A;  2WQY A;  4WZX A;  3QOF A;  3RKO A;  2B1E A;  4YSX A;  2V6X A;  2VKO A;  4C90 A;  1S35 A;  4IDZ A;  4MFR A;  3RKG A;  3UU5 A;  4IIJ E;  1OED A;  2KLQ A;  4B3M T;  3AEC A;  1MIW A;  2WZH A;  3PUR A;  2VWA A;  2IIU A;  2LJL A;  2V8S V;  2Y8D A;  2K5B B;  2E5V A;  5L3C B;  2A72 A;  4X64 T;  4DR1 T;  2ZM2 A;  3MXZ A;  4P09 A;  3DTO A;  4DV7 T;  4YHJ A;  4TX5 A;  5AQH B;  1M7K A;  4JEH B;  2LOP A;  2UU9 T;  5LXT E;  2IC9 A;  2WU5 A;  4I0U A;  4UVA B;  1T8B A;  5ABF A;  3L8R A;  3WI3 A;  5F3J A;  3ETV A;  3KVB A;  1QSD A;  3ABV A;  3KIN B;  4X65 T;  2NW9 A;  3P50 A;  5ABH A;  2VK9 A;  4CN6 A;  2PJQ A;  3KBT A;  3UUN A;  5LBQ B;  3AA7 B;  2BVM A;  3S4U A;  3CKD A;  2CMR A;  3HI2 A;  2DNX A;  3AA1 B;  4I43 B;  2JQH A;  1E7P A;  4M1P A;  2CXD A;  3BQI A;  4DID B;  4HWF A;  4HEA A;  2HPL A;  4HFI A;  3UU3 A;  4IDP A;  3Q5D A;  4P0A A;  2LLY A;  2CWY A;  1Y64 B;  1WYC A;  3SFD A;  3LK3 B;  2E5L T;  4CXX A;  4O8S A;  5JRC A;  4U2Y A;  2WAU A;  3VR8 A;  2CXF A;  1VCS A;  2FUP A;  3TLW A;  5HYA A;  5FKY A;  4JUY A;  2N9D A;  2JIW A;  1HF8 A;  3JC6 C;  5AFU L;  2BS2 A;  3R6N A;  3CK6 A;  3RYH E;  4DR4 T;  1KF6 A;  4J2C A;  3T1H T;  2LSK A;  4H9R C;  4AKH A;  1M62 A;  1AJ3 A;  3C50 A;  2L8K A;  2VUR A;  1FMV A;  2D5U A;  2X0H A;  1N33 T;  2X9Y A;  2XAJ B;  2C0S A;  5IUX A;  1HG5 A;  4JI3 T;  5L47 A;  3QC9 A;  5M4Y A;  2ACX A;  3M65 A;  3N5L A;  1WR0 A;  4XBF B;  2F4V T;  2V7K A;  3UT5 E;  1WCR A;  4O4H E;  1HG2 A;  3UU8 A;  1KK7 A;  1D0X A;  3EDU A;  3N9M A;  4ZI2 D;  2J1D G;  3ZYM A;  3PJA J;  3PUY F;  2JQQ A;  4WBO A;  1ZP0 A;  5LG3 A;  3QK6 A;  1LKX A;  5JDH A;  2FJB A;  5AQR B;  3SWH A;  2X0Y A;  3AXJ B;  4XZC A;  3LJC A;  1YKE B;  4JI4 T;  2ZM6 T;  4CI2 B;  4YTN A;  3K8P C;  2UXD T;  2XSB A;  5HXE A;  2XAH B;  4TWH A;  2H88 A;  3RF1 A;  3FZL B;  5J2U E;  4H9S E;  1WLX A; 
#chains in the Genus database with same CATH homology
 3Q5E A;  3IA3 A;  4IDQ A;  1W0A A;  1W09 A;  4IDO A;  3X1D A;  3Q5D A;  1XZY A;  3OVU A;  1Y01 A;  3QOF A;  4IDN A;  1Z8U A;  1W0B A;  3QNU A;  4IDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...