3IA3A

A cis-proline in alpha-hemoglobin stabilizing protein directs the structural reorganization of alpha-hemoglobin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
ALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A cis-proline in alpha-hemoglobin stabilizing protein directs the structural reorganization of alpha-hemoglobin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxygen transport
molecule keywords Alpha-hemoglobin-stabilizing protein
total genus 29
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 3ia3A00
1Z8UA 3IA3A 3OVUA 3QNUA 1Y01A 3QOFA 1XZYA 4IDOA 3X1DA 1W0BA 3Q5EA 4IDPA 3Q5DA 4IDNA 1W0AA 4IDQA 1W09A
chains in the Genus database with same CATH superfamily
3CMLA 3JCFA 4U2YA 3ZKRA 3ZEFB 4DR2T 2JMKA 2ZM6T 4C90A 4IE0A 5L3BB 5CA0E 5C3JA 4EIWA 3LDQB 1G73A 5HEJA 1LRZA 3RH3A 3TLSA 2DWKA 4M1PA 4PJNA 1WR6A 3MK7C 3K3NA 4YSZA 2WZHA 4DV4T 3FZFB 3X1DA 4X1YE 4LF8T 2EHOD 2DCFA 4GYRA 2L8KA 3I9WA 3J7Yq 4HWHA 4YTMA 2JQ9A 2WS3A 2CMRA 2X9XA 2NW9A 2Q9QA 3UQ4A 4EYUA 2XAGB 1CUNA 1Z8UA 3PURA 3M3ZB 3I0OA 1SE7A 3P4QA 3UU4A 4JI5T 3W15B 4B3TT 3ZT5A 4P0AA 2JPFA 4IDPA 5JDGA 2VL8A 4K0UA 3FZMB 2ZLYA 1IJ6A 2E9XA 3DP7A 4TWFA 2BZBA 5L4HA 4AIUA 2WWUA 3T8OA 5HXSA 5L3GB 2CHNA 3PJAA 4DUZT 2IIUA 2X9HA 2F4VT 3JAEA 3NRYA 2C5IT 3RC8A 5CA1E 4P1NA 3MXZA 1W0AA 2QGSA 3ETVA 3TLUA 5ABHA 2SPCA 4YFSA 3LK2B 4X1KE 2CBJA 4YY3T 4YJ3E 1YQ4A 2KINB 2JJ9A 4CI1B 3O1IA 1NWMX 1OXZA 2VKHA 4TV9E 4UF0B 4ZI2D 4JV5T 3AA1B 1X79A 2V5CA 3OYZA 4IE5A 2BBHA 1ZOYA 3E0ZA 2C5JA 2YINA 3O4XE 4NPPA 3EDUA 4UEMA 1WLXA 1UGOA 4DV0T 5IUXA 1QSDA 1YKHB 4NUUA 1I6ZA 4JI2T 2DLRA 3N2GE 2CPTA 2X0HA 3VU7H 4EZHA 5L3FB 4G2AA 2XTLA 4H9SE 2BS4A 2WM9A 3FBZA 3N9MA 3P4RA 3P4PA 4LF5T 3FZHB 1V9DA 1D0YA 1J1JA 3N5LA 2VVSA 1T98A 3LBXA 4HE8A 4OYJA 5FXXA 3ZYMA 1XNQT 4K0KT 3RYFE 3M65A 1MMNA 1VRBA 4DIDB 4MBQA 1T8BA 2XQ5A 2QRXA 2V7KA 3AAAB 3UU8A 1IZNB 3ZYKA 4ZI3C 4Z90A 4IE4A 3AEGA 4QH1A 2WU2A 2OA5A 2KLQA 2V7MA 4PK4A 2I59A 1XZYA 2LE8A 2WMOA 3HKDE 4IL4A 2M6IA 5LXTE 3Q5XA 3EAMA 5FNVE 1KFYA 4EZ4A 5JDHA 3GN5B 3NWIA 4EOZB 4HGAA 1UX5A 4JUYA 4U2ZA 4A98A 2L3LA 1XDPA 3ONXA 4MALA 5ETWA 5FKYA 2DHRA 3OYXA 3TLTA 2CWOA 3SS1A 5LNKA 4B3ST 3ZYLA 3JAFA 2IMLA 2CLYC 2EHOA 2XHEB 3UUNA 4CI2B 4JYAT 3N9QA 2YDRA 4U72A 1SHZC 3AE2A 4LF6T 3LJCA 3AB3B 1BR2A 2BVLA 3RX6A 2KZ7B 1D0ZA 5JR9A 3UFGA 5JDNA 5FVLA 2V8SV 3MZKB 2JRKA 2Q9QD 2WZIA 3IEEA 2X51A 5AQIB 5AQLB 5GONE 2LRKA 3PUZF 1XMQT 4WW0A 2V26A 4LMKA 5ABFA 2FBWA 1IBMT 3KV9A 4HFBA 2E9XD 2NW8A 3PUYF 4CN4A 1LVFA 2K24A 3K3OA 4PFPA 3HKCE 2A9UA 3AA0B 5M4YA 1Z0PA 2N9DA 2X0LB 3A5XA 2UXNB 3AECA 3AVRA 4F6RC 2YOEA 4DBRA 3PU8A 4X64T 3CX8B 1NAFA 5FP3A 4CN1A 3PV0F 3I9YA 3RRCA 4GK0E 4KHPT 4DMWA 1DU2A 1WFDA 2E2AA 2P9BA 1SA0E 2C5KT 3AAIA 3AEBA 4H9RC 1YKEB 5AQVB 1UCUA 4HFDA 3T1HT 3N9PA 1S94A 2E5VA 3BQLA 4PW8A 5C2TA 3P50A 1MNDA 2BG9E 3KFWX 3CK6A 1D1BA 1HG2A 2LOPA 4U74A 2XQ4A 3A7MA 2Z6EA 3I0QA 1UK5A 3AA6B 3WAKA 5AFUL 3UU5A 2VWAA 4UVAB 2MPKA 3KV6A 3CKDA 1MMAA 2B1EA 5AQSB 3EVYA 4AKRB 3AE4A 3RC3A 2W66A 3QOFA 5LCYA 2DL1A 3R84B 3VR9A 3PUSA 5JQGE 3RI5A 2LKGA 3L39A 3ZJ1A 2XAQB 4IDQA 3L3PA 4GOUA 3RIUC 2KXPB 4YT0A 5HXHA 5JR9C 4DR6T 3PDYA 5A1LA 3SRZA 4BJMA 4G63A 3S4UA 2ODUA 4ANJA 3TKLB 4ZOLE 3CVRA 3AE9A 3PUQA 4PJLA 4QKNA 4MFRA 2W2UA 1D0XA 4NUVA 3RIUA 4LFCT 3RF1A 2WCAA 3MKDA 4LF4T 5AQUB 2FJDA 3N9LA 4LMJA 2UUCT 1BR4A 2H7OA 3AE7A 5BMVE 5FL1A 5E0OA 5JRCB 2FJAA 4PJMA 2A72A 3GN5A 3VRBA 2VQFT 1KNZA 2LSGA 4B3MT 2D0UA 3CX7B 2K5BB 2Y8DA 4AQYT 2WMNA 5C8YE 2V6XA 3AE1A 4WBNE 2BDEA 4C91A 4ZI7E 5CJ5A 5JDQA 4FJOA 3OPCA 1OEDE 3NZPA 2CRBA 2H7VC 2XSAA 3BQKA 3OTOT 1VCSA 5J0ZA 1KF6A 2W00A 2KNDA 3WI3A 3ZC1A 4U7YA 2VL0A 2W4XA 4AXPA 5J2UE 3FBLA 3FB2A 3Q9DA 4U33A 5LG3A 2XSBA 3K3QC 1OEDB 3KVAA 3ZN0B 2A2FX 5LMNT 1UX4A 2W67A 5KMGP 2V6YA 5EK3A 1N33T 2CM0A 1M7KA 4Q25A 4LMLA 1OEDC 3CPZA 3KV5A 2KWIB 3ONJA 2J62A 4IREA 5LB7B 5FXWA 4DUYT 2KMFA 1E7PA 4YJ2E 2J1DG 5AQFB 2J4GA 2XZEA 4PAGA 1XDOA 2IUBA 3HA4A 3AA7B 1QUUA 3LFMA 3QK6A 4HFHA 2WY2A 5HCMA 4WBOA 1MNEA 4AQFA 3VHLA 4AQFC 3C4WA 4E7ZA 1GQEA 2RPAA 3BQIA 4H9QC 4ZS3A 3ZMUB 3CX6B 3Q5EA 2AXDS 5CGMA 2WWVA 4UV9B 4DMVA 4BA9A 1JNZA 3UULA 1U5PA 2YN6A 4L5GA 4QX8B 4DR3T 3L8RA 3NZQA 2ZM8A 4H9NC 4DV6T 1HG5A 2E9XC 4I4TE 4O4HE 1H7CA 4GK5E 2X0YA 2ZM0A 3ETUA 4HEAA 3PUGA 1HNWT 2M67A 3SFDA 5J2TE 2WB5A 4AKLA 3PUAA 3ZPOA 4IDNA 3KBUA 2PJQA 5FMNA 4YSYA 3UQ7A 4ZXLA 3CIRA 4I0UA 1HFAA 2W63A 2JIWA 4ILCA 5AQKB 4B6XA 5JDMA 2XAHB 1XWMA 3DJBA 3TLVA 3B5MA 3C98B 3F57A 4KHZF 4QHOA 2D9DA 4I55E 3P4WA 3U78A 3NKZA 5AQNB 4ZI2C 4ILBA 3RIAA 1HTJF 4H63V 4QH5A 5JR9B 1IBLT 2BS2A 4OX9T 1EZ3A 4HTEA 3UUXB 3RQUA 2E8IA 2DWGA 5AQOB 1W9RA 4PNIA 1B7TA 3G06A 4JEUB 5FXVA 3VR8A 4IT4A 3WAJA 1XNRT 3F31A 2WDVA 2V6YB 5CB4E 2BVMA 3EABA 3FZLB 4DVDA 2LLYA 5ABFB 5HEHA 4DV2T 1WYBA 5FXZA 5HXCA 5DJQC 3FHNA 3ZLIA 2IC9A 4HWDA 4UVCB 4YSXA 3MJXA 3FXDB 1FMVA 2ODVA 3QNUA 3SWHA 4H9PC 5F3JA 3VRAA 4JI7T 1HCIA 2LHRA 5H6RB 4A97A 1U4QA 1US7B 3AXJA 2HPJA 2LJLA 2NWBA 2PG8A 5BR8T 5LG4A 4CXXA 1HR0T 1JNRA 1MIVA 4HFCA 2HPLA 4EXTA 5L3EB 4ADZA 1MIYA 4GYSA 4O8SA 4TV8E 2CEAA 2D5UA 2I0MA 2MTQA 2VKDA 2VASA 2W62A 5LBQB 2YEVC 4KUMB 2XQ7A 4QWNB 5JTGA 4LF9T 2HN1A 4AQGA 2NOXA 2A3DA 1R8IA 2MOZA 3PU3A 3LK42 4HFEA 2XQ6A 3LBXB 4F8HA 1CHUA 1SUMB 3GMIA 5LHIB 4DR7T 4TX5A 1KNPA 3IA3A 4IE6A 4ZZBA 2YDQA 1N36T 2K48A 2WDRA 2YDSA 4HFIA 4NIQA 3C50A 5F5WA 1VCTA 4LFAT 5LYJE 4EEBA 2CLYB 4OK0A 3UFEA 2DI4A 1YD8G 3V5UA 2QA7A 2WAUA 2YU1A 2Q9QC 3GWHA 1J5WA 2WQYA 1YXRA 3Q5DA 5AQGB 2IW5B 4ZHQE 2V1DB 4KP3C 4ILAA 3HKBE 2LSYA 3UT5E 5LJMA 4OYKA 2VVNA 2LRLA 2YKSA 2AE9A 2IAKA 3C4ZA 3LG7A 4U7IA 5AQHB 5AQPB 5H6QB 3VKGA 4X62T 2FUPA 2DNXA 4EAHA 4COFA 4IHJE 3U3IA 2XM2A 5FY7A 2WP9A 5LHGB 5LGNB 5JREA 5AQQB 3RKGA 4AI6A 5LMUT 3C4XA 4CI3B 2GK9A 2LSKA 4EYYR 3UTKA 2YK0A 4O4JE 3EI0A 1IJ5A 4JI8T 5HEUA 3ZCIA 3HI2A 3QB5K 2KT9A 3CQXC 2WDQA 4EV6A 3RYCE 2X9WA 1WRDA 2NTXA 2RP4A 4Z8XA 4CXYA 2N1GA 3L09A 4CZZB 2UXCT 2BG9C 2B76A 3B57A 1KEYA 1ZV4X 4OFZA 2D0TA 5L2LA 4YXDA 1VOMA 1BR1A 3PUVF 5LBMA 2PTFA 2LOSA 3E08A 4JI3T 5ADXL 4XBFB 2G0UA 3ZN1B 3FXEB 3ZMVB 3ZT6A 1FJGT 2KSRA 4UR9A 1OEDA 3AE6A 2CCQA 3EHZA 5TAOA 5ABEA 2EHOB 3GA8A 3N9NA 4HFVA 4PJJA 4DR4T 2BKOA 2Q9QB 3R6NA 1IBKT 4TUYE 1UURA 4NXMT 3ABVA 3NVOA 3QC9A 4B3RT 4ZI3D 5DABA 5LHHB 4WYVA 5EZYE 1T72A 2EHOC 5AQJB 2NR4A 5HEGA 5IHYA 2WSSV 3CQGB 4U3CA 3PUWF 3RRWA 4BJNA 4DV7T 5FY1A 4TNWA 5EK4A 5LGUB 2YU2A 3RQWA 4DBQA 2UUAT 3CQCB 2CBIA 3JADA 1FMWA 2CXDA 3JC6C 3HKEE 1BR0A 3SOLA 4UIGA 4GKKT 4WNKA 3RLFF 2ES0A 2XUEA 4HWFA 2CXFA 2MYSA 5AQMB 3RPUA 2KWHA 2V7IA 3K8PC 5JVDE 2LM2A 1E1HB 4HKAA 5LA6E 3AVSA 3H3MA 3NRXA 1OWAA 3ZMZB 2V5DA 4H63H 4MHCA 3V5SA 4X20E 2R6GF 3ZSTA 4KI0F 4LF7T 2BG9B 1LVKA 2HN2A 3EUHA 4MLKA 3ZCJA 3KVBA 4L9IA 3IBPA 1I94T 3I1AA 5LGTB 2XAFB 5AQTB 4O2BE 2Y48B 1O3XA 2L9QA 3AEDA 3MA9A 2ZM2A 5JDFA 5DQWA 4QXBB 3D0TA 5HYAA 4WZXA 3KBTA 2V7JA 4ISTA 2XY8B 4ISSA 4EEDA 2VQET 4YTNA 4DR5T 5JRCA 3ONLC 2J47A 1E2AA 2XJ7A 4GIWA 4ZZCA 4YHHT 4TN7B 3LK3B 4AKGA 4IDOA 2UXDT 4XZCA 5DQVA 4ZEYA 4YTPA 4NXNT 2X9YA 2XM1A 3ANWA 4KMCA 5CFBA 4X65T 2VB6A 4KBMB 3PTRB 2VK9A 2X67A 4UF0A 5KDMC 2XQ3A 4JI4T 4YHJA 2BKNA 4EB6E 3ZMSB 2XQ8A 2WU5A 5IWAT 4BAYB 1AJ3A 3MACA 3F2EA 4U31A 1G8XA 1KNRA 1WR0A 1L0VA 3T1YT 2ACXA 2K9AA 3PJAJ 5L4EA 3PE0A 3O9XA 2CHOA 2I6HA 3N9OA 4JLEA 2IHR1 3HR0A 3AAEB 4IL9A 1T7SA 2CA5A 3H3AA 2UXXB 5IYZE 3PUXF 4HWIB 3RYIE 4FI5A 4ASKA 4QXHB 1D1AA 1Y64B 3UUMA 4QH4A 2UU9T 2C0SA 1MMGA 1MIWA 1W09A 2ZMAA 2LSIA 4A5XA 2BS3A 2LT3A 3B13A 4EGWA 2H89A 4DV5T 5HAXA 2UUBT 3AE3A 4XAXB 1ZEEA 4DR1T 3OKQA 3P4SA 2JMHA 2W61A 3ZMTB 3UU3A 4DV1T 4JI6T 2X66A 2K3WA 1NENA 3RYHE 3K1SA 1LKXA 3OBVE 3O1JA 3AEAA 3QUJA 4UVBB 1N32T 2QVAA 1FIOA 2CE7A 2XQAA 1YW0A 4O4IE 3UUBA 3A8YC 4PK6A 2XQ9A 3AEEA 5F8PA 1KK7A 2D2SA 2X68A 2JQHA 4X1IE 4IGUA 4CN6A 3IF8B 5JH7E 2CXLA 2LSJA 1HF8A 1ZHCA 1IAPA 2LHNA 2IDOB 3QB5A 1WYCA 3LSVA 3O1HA 4I50E 2FJEA 4TWHA 4UXNB 5FYMA 2XASB 2XPKA 2JQKA 1NEKA 4TWDA 5HWYA 5LOVE 1S35A 3RHWA 3TLWA 3UU6A 4V1Av 4CXWA 4L0RA 3BK9A 4AISA 3VKHA 4HN9A 2NTYA 2BBJA 4IDZA 2NP9A 2LEHA 3E22E 2IC6A 1HX1B 1XMOT 5HWXA 2VKJA 3H37A 3CWZB 2XQYA 4N78D 2H3RA 2XAJB 4P0BA 2MBGA 2VKOA 4OHFA 5L3CB 4Z91A 3KINB 2ACZA 3AE5A 5AQRB 3DTOA 2JQQA 2Y6XA 1FEWA 3FZKB 2LKHA 3C64A 2BKPA 3OVUA 2E5LT 4PFOA 4UELA 1HS7A 4ILUA 3KDSE 4H9OC 4UV8B 1W0BA 4AKIA 3JC6D 3Q2MA 3OJAA 4O4LE 3ZJ2A 4X66T 2HHHT 4JEHB 1N34T 4QX7B 4CQIA 1X9BA 1WCRA 3P8CD 5L3DB 4IIJE 2PBIA 4ZS2A 1MMDA 2V7LA 3KV4A 1UUSA 4DO0A 1HNZT 2FJBA 3N2OA 2VURA 4KX6A 3ZT7A 4J2CA 5KX5E 5LP6E 4DV3T 1HNXT 4QXCB 5FVKA 3AEFA 2W0GA 3ESLA 3ANWB 4JBWF 5HXRA 1HX8A 2QYWA 1Y01A 3AE8A 2OV9A 4TNVA 4I43B 5HCJA 2LM9A 1ZP0A 3RKOA 3IHRA 4HWCA 4ERRA 5JDLA 4JI0T 4P09A 3RIFA 2HH7A 4E7SA 5EK2A 3N2KE 1ZKEA 5FY0A 5HEOA 3EDVA 3P7IA 4IE7A 5LJNA 2N2NA 4TZ4C 4JI1T 3ZSSA 4A56A 3HL6A 4PK5A 2PFVA 3ZC0A 4O2AE 2UXBT 4AKHA 4LFBT 1D1CA 2WBLA 5ABGA 3C51A 5KXJA 4GKJT 5L47A 2MAWA 4YLHA 2E9XB 3AXJB 1QLBA 4X5TA 2H88A 1M62A 2RA1A 3NBXX 1J5ET 3J9X1 2CWYA 2M6BA 3RGLA 4DNDA 2BG9A 5J1GA 5FL0A 2OLTA 3Q5WA 3SFEA 2NW7A 5HXEA 1YQ3A
chains in the Genus database with same CATH topology
1Z8UA 3IA3A 3OVUA 3QNUA 1Y01A 3QOFA 1XZYA 4IDOA 3X1DA 1W0BA 3Q5EA 4IDPA 3Q5DA 4IDNA 1W0AA 4IDQA 1W09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z8U A;  3IA3 A;  3OVU A;  3QNU A;  1Y01 A;  3QOF A;  1XZY A;  4IDO A;  3X1D A;  1W0B A;  3Q5E A;  4IDP A;  3Q5D A;  4IDN A;  1W0A A;  4IDQ A;  1W09 A; 
#chains in the Genus database with same CATH topology
 3CML A;  3JCF A;  4U2Y A;  3ZKR A;  3ZEF B;  4DR2 T;  2JMK A;  2ZM6 T;  4C90 A;  4IE0 A;  5L3B B;  5CA0 E;  5C3J A;  4EIW A;  3LDQ B;  1G73 A;  5HEJ A;  1LRZ A;  3RH3 A;  3TLS A;  2DWK A;  4M1P A;  4PJN A;  1WR6 A;  3MK7 C;  3K3N A;  4YSZ A;  2WZH A;  4DV4 T;  3FZF B;  3X1D A;  4X1Y E;  4LF8 T;  2EHO D;  2DCF A;  4GYR A;  2L8K A;  3I9W A;  3J7Y q;  4HWH A;  4YTM A;  2JQ9 A;  2WS3 A;  2CMR A;  2X9X A;  2NW9 A;  2Q9Q A;  3UQ4 A;  4EYU A;  2XAG B;  1CUN A;  1Z8U A;  3PUR A;  3M3Z B;  3I0O A;  1SE7 A;  3P4Q A;  3UU4 A;  4JI5 T;  3W15 B;  4B3T T;  3ZT5 A;  4P0A A;  2JPF A;  4IDP A;  5JDG A;  2VL8 A;  4K0U A;  3FZM B;  2ZLY A;  1IJ6 A;  2E9X A;  3DP7 A;  4TWF A;  2BZB A;  5L4H A;  4AIU A;  2WWU A;  3T8O A;  5HXS A;  5L3G B;  2CHN A;  3PJA A;  4DUZ T;  2IIU A;  2X9H A;  2F4V T;  3JAE A;  3NRY A;  2C5I T;  3RC8 A;  5CA1 E;  4P1N A;  3MXZ A;  1W0A A;  2QGS A;  3ETV A;  3TLU A;  5ABH A;  2SPC A;  4YFS A;  3LK2 B;  4X1K E;  2CBJ A;  4YY3 T;  4YJ3 E;  1YQ4 A;  2KIN B;  2JJ9 A;  4CI1 B;  3O1I A;  1NWM X;  1OXZ A;  2VKH A;  4TV9 E;  4UF0 B;  4ZI2 D;  4JV5 T;  3AA1 B;  1X79 A;  2V5C A;  3OYZ A;  4IE5 A;  2BBH A;  1ZOY A;  3E0Z A;  2C5J A;  2YIN A;  3O4X E;  4NPP A;  3EDU A;  4UEM A;  1WLX A;  1UGO A;  4DV0 T;  5IUX A;  1QSD A;  1YKH B;  4NUU A;  1I6Z A;  4JI2 T;  2DLR A;  3N2G E;  2CPT A;  2X0H A;  3VU7 H;  4EZH A;  5L3F B;  4G2A A;  2XTL A;  4H9S E;  2BS4 A;  2WM9 A;  3FBZ A;  3N9M A;  3P4R A;  3P4P A;  4LF5 T;  3FZH B;  1V9D A;  1D0Y A;  1J1J A;  3N5L A;  2VVS A;  1T98 A;  3LBX A;  4HE8 A;  4OYJ A;  5FXX A;  3ZYM A;  1XNQ T;  4K0K T;  3RYF E;  3M65 A;  1MMN A;  1VRB A;  4DID B;  4MBQ A;  1T8B A;  2XQ5 A;  2QRX A;  2V7K A;  3AAA B;  3UU8 A;  1IZN B;  3ZYK A;  4ZI3 C;  4Z90 A;  4IE4 A;  3AEG A;  4QH1 A;  2WU2 A;  2OA5 A;  2KLQ A;  2V7M A;  4PK4 A;  2I59 A;  1XZY A;  2LE8 A;  2WMO A;  3HKD E;  4IL4 A;  2M6I A;  5LXT E;  3Q5X A;  3EAM A;  5FNV E;  1KFY A;  4EZ4 A;  5JDH A;  3GN5 B;  3NWI A;  4EOZ B;  4HGA A;  1UX5 A;  4JUY A;  4U2Z A;  4A98 A;  2L3L A;  1XDP A;  3ONX A;  4MAL A;  5ETW A;  5FKY A;  2DHR A;  3OYX A;  3TLT A;  2CWO A;  3SS1 A;  5LNK A;  4B3S T;  3ZYL A;  3JAF A;  2IML A;  2CLY C;  2EHO A;  2XHE B;  3UUN A;  4CI2 B;  4JYA T;  3N9Q A;  2YDR A;  4U72 A;  1SHZ C;  3AE2 A;  4LF6 T;  3LJC A;  3AB3 B;  1BR2 A;  2BVL A;  3RX6 A;  2KZ7 B;  1D0Z A;  5JR9 A;  3UFG A;  5JDN A;  5FVL A;  2V8S V;  3MZK B;  2JRK A;  2Q9Q D;  2WZI A;  3IEE A;  2X51 A;  5AQI B;  5AQL B;  5GON E;  2LRK A;  3PUZ F;  1XMQ T;  4WW0 A;  2V26 A;  4LMK A;  5ABF A;  2FBW A;  1IBM T;  3KV9 A;  4HFB A;  2E9X D;  2NW8 A;  3PUY F;  4CN4 A;  1LVF A;  2K24 A;  3K3O A;  4PFP A;  3HKC E;  2A9U A;  3AA0 B;  5M4Y A;  1Z0P A;  2N9D A;  2X0L B;  3A5X A;  2UXN B;  3AEC A;  3AVR A;  4F6R C;  2YOE A;  4DBR A;  3PU8 A;  4X64 T;  3CX8 B;  1NAF A;  5FP3 A;  4CN1 A;  3PV0 F;  3I9Y A;  3RRC A;  4GK0 E;  4KHP T;  4DMW A;  1DU2 A;  1WFD A;  2E2A A;  2P9B A;  1SA0 E;  2C5K T;  3AAI A;  3AEB A;  4H9R C;  1YKE B;  5AQV B;  1UCU A;  4HFD A;  3T1H T;  3N9P A;  1S94 A;  2E5V A;  3BQL A;  4PW8 A;  5C2T A;  3P50 A;  1MND A;  2BG9 E;  3KFW X;  3CK6 A;  1D1B A;  1HG2 A;  2LOP A;  4U74 A;  2XQ4 A;  3A7M A;  2Z6E A;  3I0Q A;  1UK5 A;  3AA6 B;  3WAK A;  5AFU L;  3UU5 A;  2VWA A;  4UVA B;  2MPK A;  3KV6 A;  3CKD A;  1MMA A;  2B1E A;  5AQS B;  3EVY A;  4AKR B;  3AE4 A;  3RC3 A;  2W66 A;  3QOF A;  5LCY A;  2DL1 A;  3R84 B;  3VR9 A;  3PUS A;  5JQG E;  3RI5 A;  2LKG A;  3L39 A;  3ZJ1 A;  2XAQ B;  4IDQ A;  3L3P A;  4GOU A;  3RIU C;  2KXP B;  4YT0 A;  5HXH A;  5JR9 C;  4DR6 T;  3PDY A;  5A1L A;  3SRZ A;  4BJM A;  4G63 A;  3S4U A;  2ODU A;  4ANJ A;  3TKL B;  4ZOL E;  3CVR A;  3AE9 A;  3PUQ A;  4PJL A;  4QKN A;  4MFR A;  2W2U A;  1D0X A;  4NUV A;  3RIU A;  4LFC T;  3RF1 A;  2WCA A;  3MKD A;  4LF4 T;  5AQU B;  2FJD A;  3N9L A;  4LMJ A;  2UUC T;  1BR4 A;  2H7O A;  3AE7 A;  5BMV E;  5FL1 A;  5E0O A;  5JRC B;  2FJA A;  4PJM A;  2A72 A;  3GN5 A;  3VRB A;  2VQF T;  1KNZ A;  2LSG A;  4B3M T;  2D0U A;  3CX7 B;  2K5B B;  2Y8D A;  4AQY T;  2WMN A;  5C8Y E;  2V6X A;  3AE1 A;  4WBN E;  2BDE A;  4C91 A;  4ZI7 E;  5CJ5 A;  5JDQ A;  4FJO A;  3OPC A;  1OED E;  3NZP A;  2CRB A;  2H7V C;  2XSA A;  3BQK A;  3OTO T;  1VCS A;  5J0Z A;  1KF6 A;  2W00 A;  2KND A;  3WI3 A;  3ZC1 A;  4U7Y A;  2VL0 A;  2W4X A;  4AXP A;  5J2U E;  3FBL A;  3FB2 A;  3Q9D A;  4U33 A;  5LG3 A;  2XSB A;  3K3Q C;  1OED B;  3KVA A;  3ZN0 B;  2A2F X;  5LMN T;  1UX4 A;  2W67 A;  5KMG P;  2V6Y A;  5EK3 A;  1N33 T;  2CM0 A;  1M7K A;  4Q25 A;  4LML A;  1OED C;  3CPZ A;  3KV5 A;  2KWI B;  3ONJ A;  2J62 A;  4IRE A;  5LB7 B;  5FXW A;  4DUY T;  2KMF A;  1E7P A;  4YJ2 E;  2J1D G;  5AQF B;  2J4G A;  2XZE A;  4PAG A;  1XDO A;  2IUB A;  3HA4 A;  3AA7 B;  1QUU A;  3LFM A;  3QK6 A;  4HFH A;  2WY2 A;  5HCM A;  4WBO A;  1MNE A;  4AQF A;  3VHL A;  4AQF C;  3C4W A;  4E7Z A;  1GQE A;  2RPA A;  3BQI A;  4H9Q C;  4ZS3 A;  3ZMU B;  3CX6 B;  3Q5E A;  2AXD S;  5CGM A;  2WWV A;  4UV9 B;  4DMV A;  4BA9 A;  1JNZ A;  3UUL A;  1U5P A;  2YN6 A;  4L5G A;  4QX8 B;  4DR3 T;  3L8R A;  3NZQ A;  2ZM8 A;  4H9N C;  4DV6 T;  1HG5 A;  2E9X C;  4I4T E;  4O4H E;  1H7C A;  4GK5 E;  2X0Y A;  2ZM0 A;  3ETU A;  4HEA A;  3PUG A;  1HNW T;  2M67 A;  3SFD A;  5J2T E;  2WB5 A;  4AKL A;  3PUA A;  3ZPO A;  4IDN A;  3KBU A;  2PJQ A;  5FMN A;  4YSY A;  3UQ7 A;  4ZXL A;  3CIR A;  4I0U A;  1HFA A;  2W63 A;  2JIW A;  4ILC A;  5AQK B;  4B6X A;  5JDM A;  2XAH B;  1XWM A;  3DJB A;  3TLV A;  3B5M A;  3C98 B;  3F57 A;  4KHZ F;  4QHO A;  2D9D A;  4I55 E;  3P4W A;  3U78 A;  3NKZ A;  5AQN B;  4ZI2 C;  4ILB A;  3RIA A;  1HTJ F;  4H63 V;  4QH5 A;  5JR9 B;  1IBL T;  2BS2 A;  4OX9 T;  1EZ3 A;  4HTE A;  3UUX B;  3RQU A;  2E8I A;  2DWG A;  5AQO B;  1W9R A;  4PNI A;  1B7T A;  3G06 A;  4JEU B;  5FXV A;  3VR8 A;  4IT4 A;  3WAJ A;  1XNR T;  3F31 A;  2WDV A;  2V6Y B;  5CB4 E;  2BVM A;  3EAB A;  3FZL B;  4DVD A;  2LLY A;  5ABF B;  5HEH A;  4DV2 T;  1WYB A;  5FXZ A;  5HXC A;  5DJQ C;  3FHN A;  3ZLI A;  2IC9 A;  4HWD A;  4UVC B;  4YSX A;  3MJX A;  3FXD B;  1FMV A;  2ODV A;  3QNU A;  3SWH A;  4H9P C;  5F3J A;  3VRA A;  4JI7 T;  1HCI A;  2LHR A;  5H6R B;  4A97 A;  1U4Q A;  1US7 B;  3AXJ A;  2HPJ A;  2LJL A;  2NWB A;  2PG8 A;  5BR8 T;  5LG4 A;  4CXX A;  1HR0 T;  1JNR A;  1MIV A;  4HFC A;  2HPL A;  4EXT A;  5L3E B;  4ADZ A;  1MIY A;  4GYS A;  4O8S A;  4TV8 E;  2CEA A;  2D5U A;  2I0M A;  2MTQ A;  2VKD A;  2VAS A;  2W62 A;  5LBQ B;  2YEV C;  4KUM B;  2XQ7 A;  4QWN B;  5JTG A;  4LF9 T;  2HN1 A;  4AQG A;  2NOX A;  2A3D A;  1R8I A;  2MOZ A;  3PU3 A;  3LK4 2;  4HFE A;  2XQ6 A;  3LBX B;  4F8H A;  1CHU A;  1SUM B;  3GMI A;  5LHI B;  4DR7 T;  4TX5 A;  1KNP A;  3IA3 A;  4IE6 A;  4ZZB A;  2YDQ A;  1N36 T;  2K48 A;  2WDR A;  2YDS A;  4HFI A;  4NIQ A;  3C50 A;  5F5W A;  1VCT A;  4LFA T;  5LYJ E;  4EEB A;  2CLY B;  4OK0 A;  3UFE A;  2DI4 A;  1YD8 G;  3V5U A;  2QA7 A;  2WAU A;  2YU1 A;  2Q9Q C;  3GWH A;  1J5W A;  2WQY A;  1YXR A;  3Q5D A;  5AQG B;  2IW5 B;  4ZHQ E;  2V1D B;  4KP3 C;  4ILA A;  3HKB E;  2LSY A;  3UT5 E;  5LJM A;  4OYK A;  2VVN A;  2LRL A;  2YKS A;  2AE9 A;  2IAK A;  3C4Z A;  3LG7 A;  4U7I A;  5AQH B;  5AQP B;  5H6Q B;  3VKG A;  4X62 T;  2FUP A;  2DNX A;  4EAH A;  4COF A;  4IHJ E;  3U3I A;  2XM2 A;  5FY7 A;  2WP9 A;  5LHG B;  5LGN B;  5JRE A;  5AQQ B;  3RKG A;  4AI6 A;  5LMU T;  3C4X A;  4CI3 B;  2GK9 A;  2LSK A;  4EYY R;  3UTK A;  2YK0 A;  4O4J E;  3EI0 A;  1IJ5 A;  4JI8 T;  5HEU A;  3ZCI A;  3HI2 A;  3QB5 K;  2KT9 A;  3CQX C;  2WDQ A;  4EV6 A;  3RYC E;  2X9W A;  1WRD A;  2NTX A;  2RP4 A;  4Z8X A;  4CXY A;  2N1G A;  3L09 A;  4CZZ B;  2UXC T;  2BG9 C;  2B76 A;  3B57 A;  1KEY A;  1ZV4 X;  4OFZ A;  2D0T A;  5L2L A;  4YXD A;  1VOM A;  1BR1 A;  3PUV F;  5LBM A;  2PTF A;  2LOS A;  3E08 A;  4JI3 T;  5ADX L;  4XBF B;  2G0U A;  3ZN1 B;  3FXE B;  3ZMV B;  3ZT6 A;  1FJG T;  2KSR A;  4UR9 A;  1OED A;  3AE6 A;  2CCQ A;  3EHZ A;  5TAO A;  5ABE A;  2EHO B;  3GA8 A;  3N9N A;  4HFV A;  4PJJ A;  4DR4 T;  2BKO A;  2Q9Q B;  3R6N A;  1IBK T;  4TUY E;  1UUR A;  4NXM T;  3ABV A;  3NVO A;  3QC9 A;  4B3R T;  4ZI3 D;  5DAB A;  5LHH B;  4WYV A;  5EZY E;  1T72 A;  2EHO C;  5AQJ B;  2NR4 A;  5HEG A;  5IHY A;  2WSS V;  3CQG B;  4U3C A;  3PUW F;  3RRW A;  4BJN A;  4DV7 T;  5FY1 A;  4TNW A;  5EK4 A;  5LGU B;  2YU2 A;  3RQW A;  4DBQ A;  2UUA T;  3CQC B;  2CBI A;  3JAD A;  1FMW A;  2CXD A;  3JC6 C;  3HKE E;  1BR0 A;  3SOL A;  4UIG A;  4GKK T;  4WNK A;  3RLF F;  2ES0 A;  2XUE A;  4HWF A;  2CXF A;  2MYS A;  5AQM B;  3RPU A;  2KWH A;  2V7I A;  3K8P C;  5JVD E;  2LM2 A;  1E1H B;  4HKA A;  5LA6 E;  3AVS A;  3H3M A;  3NRX A;  1OWA A;  3ZMZ B;  2V5D A;  4H63 H;  4MHC A;  3V5S A;  4X20 E;  2R6G F;  3ZST A;  4KI0 F;  4LF7 T;  2BG9 B;  1LVK A;  2HN2 A;  3EUH A;  4MLK A;  3ZCJ A;  3KVB A;  4L9I A;  3IBP A;  1I94 T;  3I1A A;  5LGT B;  2XAF B;  5AQT B;  4O2B E;  2Y48 B;  1O3X A;  2L9Q A;  3AED A;  3MA9 A;  2ZM2 A;  5JDF A;  5DQW A;  4QXB B;  3D0T A;  5HYA A;  4WZX A;  3KBT A;  2V7J A;  4IST A;  2XY8 B;  4ISS A;  4EED A;  2VQE T;  4YTN A;  4DR5 T;  5JRC A;  3ONL C;  2J47 A;  1E2A A;  2XJ7 A;  4GIW A;  4ZZC A;  4YHH T;  4TN7 B;  3LK3 B;  4AKG A;  4IDO A;  2UXD T;  4XZC A;  5DQV A;  4ZEY A;  4YTP A;  4NXN T;  2X9Y A;  2XM1 A;  3ANW A;  4KMC A;  5CFB A;  4X65 T;  2VB6 A;  4KBM B;  3PTR B;  2VK9 A;  2X67 A;  4UF0 A;  5KDM C;  2XQ3 A;  4JI4 T;  4YHJ A;  2BKN A;  4EB6 E;  3ZMS B;  2XQ8 A;  2WU5 A;  5IWA T;  4BAY B;  1AJ3 A;  3MAC A;  3F2E A;  4U31 A;  1G8X A;  1KNR A;  1WR0 A;  1L0V A;  3T1Y T;  2ACX A;  2K9A A;  3PJA J;  5L4E A;  3PE0 A;  3O9X A;  2CHO A;  2I6H A;  3N9O A;  4JLE A;  2IHR 1;  3HR0 A;  3AAE B;  4IL9 A;  1T7S A;  2CA5 A;  3H3A A;  2UXX B;  5IYZ E;  3PUX F;  4HWI B;  3RYI E;  4FI5 A;  4ASK A;  4QXH B;  1D1A A;  1Y64 B;  3UUM A;  4QH4 A;  2UU9 T;  2C0S A;  1MMG A;  1MIW A;  1W09 A;  2ZMA A;  2LSI A;  4A5X A;  2BS3 A;  2LT3 A;  3B13 A;  4EGW A;  2H89 A;  4DV5 T;  5HAX A;  2UUB T;  3AE3 A;  4XAX B;  1ZEE A;  4DR1 T;  3OKQ A;  3P4S A;  2JMH A;  2W61 A;  3ZMT B;  3UU3 A;  4DV1 T;  4JI6 T;  2X66 A;  2K3W A;  1NEN A;  3RYH E;  3K1S A;  1LKX A;  3OBV E;  3O1J A;  3AEA A;  3QUJ A;  4UVB B;  1N32 T;  2QVA A;  1FIO A;  2CE7 A;  2XQA A;  1YW0 A;  4O4I E;  3UUB A;  3A8Y C;  4PK6 A;  2XQ9 A;  3AEE A;  5F8P A;  1KK7 A;  2D2S A;  2X68 A;  2JQH A;  4X1I E;  4IGU A;  4CN6 A;  3IF8 B;  5JH7 E;  2CXL A;  2LSJ A;  1HF8 A;  1ZHC A;  1IAP A;  2LHN A;  2IDO B;  3QB5 A;  1WYC A;  3LSV A;  3O1H A;  4I50 E;  2FJE A;  4TWH A;  4UXN B;  5FYM A;  2XAS B;  2XPK A;  2JQK A;  1NEK A;  4TWD A;  5HWY A;  5LOV E;  1S35 A;  3RHW A;  3TLW A;  3UU6 A;  4V1A v;  4CXW A;  4L0R A;  3BK9 A;  4AIS A;  3VKH A;  4HN9 A;  2NTY A;  2BBJ A;  4IDZ A;  2NP9 A;  2LEH A;  3E22 E;  2IC6 A;  1HX1 B;  1XMO T;  5HWX A;  2VKJ A;  3H37 A;  3CWZ B;  2XQY A;  4N78 D;  2H3R A;  2XAJ B;  4P0B A;  2MBG A;  2VKO A;  4OHF A;  5L3C B;  4Z91 A;  3KIN B;  2ACZ A;  3AE5 A;  5AQR B;  3DTO A;  2JQQ A;  2Y6X A;  1FEW A;  3FZK B;  2LKH A;  3C64 A;  2BKP A;  3OVU A;  2E5L T;  4PFO A;  4UEL A;  1HS7 A;  4ILU A;  3KDS E;  4H9O C;  4UV8 B;  1W0B A;  4AKI A;  3JC6 D;  3Q2M A;  3OJA A;  4O4L E;  3ZJ2 A;  4X66 T;  2HHH T;  4JEH B;  1N34 T;  4QX7 B;  4CQI A;  1X9B A;  1WCR A;  3P8C D;  5L3D B;  4IIJ E;  2PBI A;  4ZS2 A;  1MMD A;  2V7L A;  3KV4 A;  1UUS A;  4DO0 A;  1HNZ T;  2FJB A;  3N2O A;  2VUR A;  4KX6 A;  3ZT7 A;  4J2C A;  5KX5 E;  5LP6 E;  4DV3 T;  1HNX T;  4QXC B;  5FVK A;  3AEF A;  2W0G A;  3ESL A;  3ANW B;  4JBW F;  5HXR A;  1HX8 A;  2QYW A;  1Y01 A;  3AE8 A;  2OV9 A;  4TNV A;  4I43 B;  5HCJ A;  2LM9 A;  1ZP0 A;  3RKO A;  3IHR A;  4HWC A;  4ERR A;  5JDL A;  4JI0 T;  4P09 A;  3RIF A;  2HH7 A;  4E7S A;  5EK2 A;  3N2K E;  1ZKE A;  5FY0 A;  5HEO A;  3EDV A;  3P7I A;  4IE7 A;  5LJN A;  2N2N A;  4TZ4 C;  4JI1 T;  3ZSS A;  4A56 A;  3HL6 A;  4PK5 A;  2PFV A;  3ZC0 A;  4O2A E;  2UXB T;  4AKH A;  4LFB T;  1D1C A;  2WBL A;  5ABG A;  3C51 A;  5KXJ A;  4GKJ T;  5L47 A;  2MAW A;  4YLH A;  2E9X B;  3AXJ B;  1QLB A;  4X5T A;  2H88 A;  1M62 A;  2RA1 A;  3NBX X;  1J5E T;  3J9X 1;  2CWY A;  2M6B A;  3RGL A;  4DND A;  2BG9 A;  5J1G A;  5FL0 A;  2OLT A;  3Q5W A;  3SFE A;  2NW7 A;  5HXE A;  1YQ3 A; 
#chains in the Genus database with same CATH homology
 1Z8U A;  3IA3 A;  3OVU A;  3QNU A;  1Y01 A;  3QOF A;  1XZY A;  4IDO A;  3X1D A;  1W0B A;  3Q5E A;  4IDP A;  3Q5D A;  4IDN A;  1W0A A;  4IDQ A;  1W09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...