3IA3A

A cis-proline in alpha-hemoglobin stabilizing protein directs the structural reorganization of alpha-hemoglobin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
b'ALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hemoglobin-stabilizing protein
publication title A cis-proline in alpha-hemoglobin stabilizing protein directs the structural reorganization of alpha-hemoglobin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxygen transport
total genus 29
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 3ia3A00
4IDNA 3X1DA 3QNUA 3QOFA 1XZYA 1W0AA 3Q5EA 3OVUA 3Q5DA 1W0BA 4IDOA 1Y01A 4IDPA 1W09A 3IA3A 1Z8UA 4IDQA
chains in the Genus database with same CATH superfamily
4JI4T 4LFCT 1IJ6A 2K5BB 4TNWA 1E2AA 2LSYA 3LG7A 4KHPT 5FL1A 3CKDA 2XM2A 4H9PC 2XQYA 3FZMB 5HCMA 2KNDA 4DR4T 4LMJA 5AQFB 4HFBA 2PBIA 2DL1A 2MOZA 3UUBA 5LG4A 4IGUA 3LK3B 4JI3T 3N9QA 2KMFA 4PJMA 2RPAA 5FVKA 4EEDA 1KNPA 1MIYA 2OV9A 4DBRA 2LSKA 4GK0E 3OKQA 3A8YC 1LRZA 3AEAA 2LJLA 2UXDT 5BR8T 4ZHQE 3UU6A 2CCQA 4HWHA 3LDQB 2XAJB 4UVAB 3R6NA 5C2TA 4DR3T 2Q9QD 3AAIA 1O3XA 4Z91A 2K3WA 1YXRA 3HR0A 4A97A 4DMVA 4AKHA 1HG5A 1D1AA 3T8OA 3E22E 4M1PA 2JPFA 2Y8DA 1E1HB 3JC6D 4P0BA 2WDVA 2JQ9A 1D0XA 1ZKEA 3VKHA 4CXYA 3RIUA 2XQ9A 3OVUA 2CA5A 3RIFA 4Q25A 4IE0A 1OWAA 3AE4A 3RIUC 1GQEA 5M4YA 5FL0A 4NXNT 2DCFA 3F2EA 4KP3C 5HAXA 4IIJE 2J4GA 4QWNB 4YTNA 1J5ET 3N2GE 3IA3A 4CI3B 1NWMX 2W67A 3ZC0A 2XM1A 3V5SA 2WSSV 2CLYB 2WMNA 3JAFA 1T8BA 3QK6A 4O2AE 4HFVA 2Z6EA 3FHNA 3ZMZB 3CMLA 1N33T 3NBXX 5JRCB 1W0AA 1HF8A 4U74A 3B5MA 4IE7A 1MNDA 3UU4A 1XWMA 5AQNB 5JDGA 2LOPA 2VKDA 5FY1A 2WWUA 3JCFA 4A5XA 2V5DA 4CN1A 4AKRB 4QX8B 3Q5EA 2XQ8A 1U4QA 4DVDA 3RGLA 5L3EB 5AQGB 2C5IT 4EAHA 3S4UA 4EV6A 3ZT7A 4HEAA 2L3LA 1BR2A 1UCUA 2NOXA 4EZHA 2SPCA 2AE9A 2ACZA 2WY2A 3VHLA 1XMQT 3OYXA 5C8YE 2FJAA 2BS4A 4DR5T 2E9XB 2VKJA 5ABFA 4PNIA 2IC9A 4C91A 4YFSA 3OBVE 5J1GA 4P0AA 4AISA 2JMKA 4IHJE 4E7ZA 3ZYMA 3RYFE 5LBQB 4HWCA 4DUYT 4LF6T 2J62A 3O4XE 1E7PA 2XJ7A 3ZCIA 3PUZF 2A72A 2MPKA 3GA8A 2BKOA 3KBUA 4IDQA 3AE7A 1FEWA 5HCJA 3ETUA 4ZZBA 3FZFB 2DLRA 4YXDA 4CI2B 2W61A 1FMVA 4IT4A 2BVLA 2LE8A 5IWAT 4ANJA 3FB2A 1ZHCA 2BVMA 3AA0B 3IEEA 3E08A 2NWBA 3ZMVB 3O1HA 4YSXA 1FIOA 1HFAA 2HN2A 5BMVE 1IBKT 4LF4T 4OYJA 3CPZA 3PUWF 1KEYA 2Y48B 5FY0A 5A1LA 1JNRA 2BG9B 1EZ3A 4HFCA 5FXZA 3PJAJ 2JRKA 4A98A 2X9HA 4DV7T 5AQJB 4ZI3D 3CQXC 2BKNA 1UURA 4GK5E 3ZJ1A 3HI2A 3CVRA 2IUBA 1I94T 2E2AA 3ANWA 2CPTA 1YD8G 4QXHB 1BR1A 4K0UA 3VRAA 4BA9A 2BBJA 5JDMA 1Z0PA 2E5LT 2I6HA 3JADA 5AQQB 1UGOA 4H9NC 1MNEA 2WB5A 3EVYA 5FXXA 3J7Yq 3ONJA 2CBIA 2GK9A 3AVSA 2LKGA 3P8CD 3ZN1B 4G63A 3KV9A 4KX6A 4LF8T 3AEEA 4A56A 2BKPA 5HXHA 4H63V 3MXZA 2ES0A 3KINB 3OPCA 2E9XD 4BJMA 3RYCE 5DABA 3O9XA 1HX1B 5L3DB 2N9DA 2D5UA 2KXPB 2X9YA 4GIWA 2VVSA 4AXPA 5JTGA 1KK7A 5LB7B 3UUMA 2M6IA 2E5VA 3N9MA 3RLFF 2WU2A 5TAOA 3RRCA 2BBHA 3RC8A 5JVDE 4JEHB 3HKCE 2EHOB 3P4PA 1L0VA 3WAJA 2X0LB 4DR7T 5FVLA 3UUNA 2LRLA 3ZMUB 2CWOA 5J2UE 3P50A 3CK6A 4UV8B 4MALA 2XAGB 3FBZA 4PK6A 1MMAA 2P9BA 3RKOA 2LEHA 4I4TE 3ZLIA 3I0QA 2ZM2A 2BZBA 1S94A 3PU8A 4QH5A 4YSYA 4ILCA 4I55E 4DV6T 4ERRA 1KNRA 1LVKA 4YTMA 2JQKA 4TWDA 5L47A 2A3DA 1IBMT 1VRBA 3X1DA 3AXJA 3UFEA 3SFDA 4GYRA 2OLTA 4X1IE 2VK9A 2H3RA 3CQGB 4GKKT 5LP6E 1NENA 2K9AA 3VR9A 1KNZA 5F8PA 3QNUA 2UUCT 4OFZA 3Q5XA 2CXFA 1HCIA 1WRDA 5DJQC 3N2KE 3JAEA 5LGNB 3QOFA 5L4HA 2X0YA 2XSBA 3FBLA 2PFVA 4WBNE 3U3IA 2CM0A 4YHJA 2LKHA 2K48A 2VASA 3RX6A 3MZKB 1UUSA 3AE3A 3V5UA 4EZ4A 2IHR1 4NIQA 3TLUA 3HKBE 4O2BE 3KV6A 5AQHB 1G73A 4AQGA 4H9OC 3EUHA 2H7OA 5LHIB 3LBXB 2HPLA 4PAGA 5HXEA 3K1SA 5LJMA 3C4WA 2XHEB 2KWHA 3PUXF 4MHCA 2V7MA 2ODVA 3EAMA 4QX7B 1D0YA 4KUMB 4UV9B 1HX8A 3ONLC 1D1CA 1IAPA 5LYJE 5LMNT 1ZP0A 3Q2MA 4EEBA 4ILAA 4H9QC 3GN5A 1AJ3A 2EHOD 4IE4A 2CHOA 4H9RC 2LOSA 3AA6B 1SA0E 3OJAA 2LLYA 3VU7H 2C5KT 2YOEA 5FXWA 4DBQA 4ZI2D 2B76A 3HL6A 2N1GA 2I59A 4YT0A 3UTKA 4GOUA 1JNZA 4EB6E 4P09A 5AQMB 3T1YT 5LBMA 5AQTB 3LFMA 1SHZC 5JR9A 4N78D 5ADXL 3D0TA 5AQIB 3PUGA 5AQPB 4HTEA 2H89A 5AFUL 3AAAB 5AQKB 3CX8B 5JR9C 4LF7T 2DHRA 5JDFA 3WI3A 5LMUT 4G2AA 5HEOA 1XDOA 2WCAA 2NW8A 3L09A 2IC6A 5L3GB 1QUUA 3UULA 1HNZT 4JLEA 3N9LA 2X51A 1W09A 5EK4A 3PURA 1T98A 5EZYE 2D0TA 2V6YB 3AEFA 4O4LE 1YQ4A 4YHHT 3P7IA 3ZSSA 2UXXB 4PW8A 2E8IA 2FBWA 2UXNB 4P1NA 4HFIA 5CJ5A 4HWDA 4X20E 2UXCT 3TLVA 4QKNA 3DJBA 3SRZA 2ZLYA 5KX5E 4DV5T 1WR0A 2I0MA 5ABGA 3RKGA 2NTXA 5ABEA 1W9RA 2W00A 1OEDA 2W2UA 3CIRA 3AECA 3RYIE 2WS3A 2VURA 4X66T 3CX7B 5L4EA 4KBMB 4AQFA 5IHYA 2HN1A 1OEDC 1WLXA 2M6BA 4EYUA 4JV5T 3OYZA 3DP7A 3HKDE 2ZMAA 1WR6A 5F5WA 3SWHA 3ZMSB 4UIGA 1KFYA 4AQFC 4O4HE 3RH3A 5EK3A 5GONE 3FZKB 3RF1A 5JH7E 1J1JA 4NUVA 1N34T 2V7LA 4CQIA 3ZT6A 1MIWA 1NEKA 2BS3A 2D0UA 5CA1E 3PTRB 5JREA 3ZPOA 5AQRB 4TZ4C 2KINB 1X9BA 2X9XA 3I0OA 5ETWA 3W15B 1MMGA 4DR2T 4CN4A 3MKDA 5AQOB 2QA7A 2ZM0A 1HTJF 2XAFB 4TV8E 4WW0A 3NVOA 5LGUB 2YU1A 2G0UA 2WZHA 4TWFA 1CHUA 5HWYA 2Y6XA 1LKXA 4YY3T 3I9WA 3J9X1 2XAHB 1R8IA 2UU9T 2WQYA 1NAFA 4NXMT 1IZNB 4XZCA 3C4XA 3MJXA 2Q9QA 3L39A 1WYBA 2QVAA 4UF0A 5KXJA 4L9IA 5J0ZA 2Q9QC 2BS2A 5FNVE 4AKGA 5CFBA 3EDVA 2V1DB 1Z8UA 3AE5A 3GWHA 2YU2A 3JC6C 2C0SA 3GMIA 4CZZB 1D0ZA 5CA0E 2VWAA 4I0UA 1FJGT 2W4XA 3UQ7A 3PU3A 5HYAA 2XQ6A 2CWYA 4IDZA 3LK2B 4MFRA 4IL4A 3H3AA 3ZYLA 1ZEEA 5HXRA 2XTLA 1YKHB 3F57A 3RYHE 2KWIB 3NRXA 5AQVB 3IF8B 2LM9A 3C50A 2A9UA 3K3NA 5FKYA 2H7VC 2LM2A 4B6XA 2NR4A 5E0OA 3AA1B 4FJOA 1VOMA 4K0KT 2LT3A 3RQUA 2WM9A 4TX5A 4BJNA 3IHRA 5ABFB 1G8XA 1WYCA 4NUUA 4OK0A 4JI1T 3UFGA 3UU5A 1CUNA 4EIWA 1N36T 3O1JA 5FY7A 2XQ5A 5JDNA 4E7SA 2XQ7A 4V1Av 3P4WA 3U78A 4HWFA 4JYAT 2UUBT 2D9DA 4PJNA 2MAWA 2W62A 3ZT5A 4U7IA 2CMRA 4L5GA 1YQ3A 4DO0A 3N9PA 2LSJA 4GYSA 3I1AA 2XQ4A 2X66A 4LF9T 3IBPA 2HHHT 3KFWX 2F4VT 4JI7T 3Q5DA 1W0BA 3PV0F 3TLSA 2HPJA 3Q5WA 4PJLA 4DV1T 4X5TA 1HNWT 3K8PC 3UQ4A 3K3OA 4Z90A 3ANWB 2KT9A 4UELA 3T1HT 4XAXB 3C4ZA 3M65A 4LF5T 3ZSTA 4AI6A 4HWIB 2ZM8A 3HKEE 3C51A 4H9SE 5JQGE 4JI5T 1FMWA 2WZIA 4FI5A 4HE8A 4ISSA 3LJCA 3H3MA 1ZV4X 3FXDB 3MACA 4CI1B 4IDNA 4YLHA 4QH4A 3AEDA 4COFA 2QYWA 2OA5A 4KMCA 2CLYC 4PFPA 1XNRT 5CB4E 5JRCA 2XQAA 4EOZB 2YEVC 4ZI3C 4KHZF 2PTFA 3AE1A 5HWXA 4ISTA 5LHGB 4X65T 1Y64B 5HEGA 4IE5A 4ILBA 3RIAA 3KV4A 2CBJA 2RP4A 2XZEA 1DU2A 3QC9A 2ODUA 2X68A 3H37A 3RHWA 2W66A 1YW0A 3ETVA 2PJQA 2NW9A 2L8KA 2UUAT 4U33A 1KF6A 1X79A 2V7IA 3ABVA 5AQLB 3FZHB 2VL8A 2JMHA 1SUMB 1WCRA 4U7YA 1N32T 5LXTE 3CX6B 2CHNA 2YKSA 2DI4A 3ZJ2A 2V6XA 3PUYF 5ABHA 2E9XA 4EXTA 1T72A 4TWHA 3VRBA 3AE9A 5HEJA 5FXVA 4XBFB 2IW5B 3FXEB 5HXSA 2E9XC 5JDHA 5F3JA 1HG2A 2CRBA 4JEUB 1V9DA 5L3CB 1BR4A 3NKZA 4AQYT 4I50E 2QRXA 2WMOA 2RA1A 4J2CA 4AKLA 2BG9E 4LFBT 5DQVA 3AXJB 4AIUA 4OHFA 3R84B 3A5XA 3AB3B 4U31A 4QXBB 1VCSA 2YK0A 4WBOA 4Z8XA 5H6RB 3UT5E 4JI0T 3N2OA 2DWKA 3PDYA 1LVFA 1XMOT 4F8HA 2V7JA 3PUQA 5LA6E 1OEDE 2LRKA 3FZLB 4GKJT 4B3TT 3ZKRA 4LMKA 2CXDA 3RQWA 2WU5A 4CXWA 4ZOLE 4DMWA 4X1KE 1ZOYA 5IUXA 2BG9A 4O8SA 2K24A 2WBLA 4PJJA 3ZMTB 2XPKA 2MYSA 1SE7A 2YDRA 2BG9C 4JBWF 5LGTB 2MBGA 2AXDS 2J47A 2V7KA 1UX5A 2V26A 3UU8A 3BQIA 4CXXA 3TLWA 5KMGP 3LSVA 4UEMA 3M3ZB 3PUAA 3NRYA 3QB5K 2L9QA 3P4RA 3PUVF 5C3JA 4JI8T 4B3ST 4O4JE 1Y01A 2FJBA 4QHOA 3ZN0B 4IDOA 3KVAA 4ASKA 4QXCB 2V5CA 4U2YA 4YJ2E 1BR0A 2WWVA 3GN5B 4X64T 1QSDA 5CGMA 2VQFT 2JQQA 4ILUA 1YKEB 4I43B 2FJDA 2XQ3A 2R6GF 3AE6A 3E0ZA 3MK7C 4C90A 2WP9A 2IIUA 2NP9A 4UVBB 3TKLB 5LNKA 1XNQT 3AVRA 3NZPA 4CN6A 4UXNB 2QGSA 2KLQA 2DWGA 2YINA 4DR1T 4DIDB 5AQUB 3C98B 3P4SA 3RI5A 4TV9E 5JR9B 1M62A 2MTQA 4IREA 3ZC1A 4YTPA 4F6RC 1MMDA 2EHOA 2FJEA 5DQWA 3DTOA 1HS7A 2EHOC 3EHZA 3EI0A 3LK42 2M67A 4JI6T 3TLTA 2VKOA 2JIWA 4DR6T 2CXLA 1IJ5A 5LHHB 2W0GA 2XY8B 3AE2A 3KBTA 4ZI2C 4WNKA 4ZS3A 3SFEA 3KV5A 4IE6A 4EYYR 4HGAA 1IBLT 3QB5A 4TN7B 1QLBA 2W63A 2XASB 3ZCJA 4LMLA 3SS1A 5L3BB 2ACXA 3P4QA 5L2LA 1OXZA 2LSIA 1UX4A 3EABA 4KI0F 5KDMC 1B7TA 4TNVA 1S35A 3EDUA 3I9YA 2NTYA 5LG3A 3VR8A 4U2ZA 4HKAA 3PJAA 4ZS2A 3AEGA 4OX9T 1I6ZA 2HH7A 3OTOT 2PG8A 2KSRA 1OEDB 4X1YE 5HXCA 1U5PA 2LHNA 1J5WA 3RC3A 2X67A 3VKGA 5FP3A 2WDQA 2X0HA 3CQCB 4ZEYA 4H63H 2WAUA 4PK4A 2IAKA 4WYVA 1XDPA 3L3PA 3AAEB 4ADZA 3KVBA 2YN6A 4PK5A 3LBXA 3NWIA 3AEBA 5H6QB 4HFDA 2YDSA 4DV2T 3N9OA 3HA4A 3ONXA 4IDPA 4NPPA 4UR9A 5FYMA 4DUZT 2BDEA 2X9WA 2N2NA 2NW7A 5J2TE 4YJ3E 1UK5A 2WDRA 5AQSB 4ZXLA 4YSZA 4BAYB 4DV3T 4ZZCA 2V8SV 3G06A 4QH1A 4DV4T 3QUJA 5IYZE 2JQHA 4EGWA 3NZQA 3KDSE 2KZ7B 4B3MT 3PE0A 3ZEFB 4DNDA 4U3CA 2XSAA 2UXBT 1MIVA 3SOLA 3CWZB 2IDOB 3Q9DA 1T7SA 2VB6A 4HFHA 3AE8A 1VCTA 5LJNA 4AKIA 4X62T 2XUEA 2DNXA 3BQKA 2D2SA 3O1IA 1MMNA 1US7B 2YDQA 4HN9A 3K3QC 1HR0T 2JJ9A 2VL0A 5L3FB 4MBQA 4HFEA 2VQET 4MLKA 2Q9QB 3UUXB 2ZM6T 4UF0B 4TUYE 2B1EA 5LOVE 2VVNA 3WAKA 3B13A 1H7CA 4ZI7E 4OYKA 3C64A 4WZXA 4IL9A 2LHRA 3A7MA 1HNXT 4UVCB 3L8RA 4L0RA 2A2FX 4LFAT 3UU3A 4PFOA 2H88A 4O4IE 5JDQA 2V6YA 2LSGA 4B3RT 5LCYA 3RPUA 3BK9A 5JDLA 3N5LA 3ZYKA 4DV0T 3ESLA 3B57A 2C5JA 2VKHA 3MA9A 2FUPA 2XAQB 2CEAA 3BQLA 4JI2T 4JUYA 1M7KA 3RRWA 1D1BA 3N9NA 4U72A 2IMLA 1XZYA 3F31A 2J1DG 5FMNA 5EK2A 5HEUA 3PUSA 2CE7A 5HEHA 3AA7B 1WFDA
chains in the Genus database with same CATH topology
4IDNA 3X1DA 3QNUA 3QOFA 1XZYA 1W0AA 3Q5EA 3OVUA 3Q5DA 1W0BA 4IDOA 1Y01A 4IDPA 1W09A 3IA3A 1Z8UA 4IDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDN A;  3X1D A;  3QNU A;  3QOF A;  1XZY A;  1W0A A;  3Q5E A;  3OVU A;  3Q5D A;  1W0B A;  4IDO A;  1Y01 A;  4IDP A;  1W09 A;  3IA3 A;  1Z8U A;  4IDQ A; 
#chains in the Genus database with same CATH topology
 4JI4 T;  4LFC T;  1IJ6 A;  2K5B B;  4TNW A;  1E2A A;  2LSY A;  3LG7 A;  4KHP T;  5FL1 A;  3CKD A;  2XM2 A;  4H9P C;  2XQY A;  3FZM B;  5HCM A;  2KND A;  4DR4 T;  4LMJ A;  5AQF B;  4HFB A;  2PBI A;  2DL1 A;  2MOZ A;  3UUB A;  5LG4 A;  4IGU A;  3LK3 B;  4JI3 T;  3N9Q A;  2KMF A;  4PJM A;  2RPA A;  5FVK A;  4EED A;  1KNP A;  1MIY A;  2OV9 A;  4DBR A;  2LSK A;  4GK0 E;  3OKQ A;  3A8Y C;  1LRZ A;  3AEA A;  2LJL A;  2UXD T;  5BR8 T;  4ZHQ E;  3UU6 A;  2CCQ A;  4HWH A;  3LDQ B;  2XAJ B;  4UVA B;  3R6N A;  5C2T A;  4DR3 T;  2Q9Q D;  3AAI A;  1O3X A;  4Z91 A;  2K3W A;  1YXR A;  3HR0 A;  4A97 A;  4DMV A;  4AKH A;  1HG5 A;  1D1A A;  3T8O A;  3E22 E;  4M1P A;  2JPF A;  2Y8D A;  1E1H B;  3JC6 D;  4P0B A;  2WDV A;  2JQ9 A;  1D0X A;  1ZKE A;  3VKH A;  4CXY A;  3RIU A;  2XQ9 A;  3OVU A;  2CA5 A;  3RIF A;  4Q25 A;  4IE0 A;  1OWA A;  3AE4 A;  3RIU C;  1GQE A;  5M4Y A;  5FL0 A;  4NXN T;  2DCF A;  3F2E A;  4KP3 C;  5HAX A;  4IIJ E;  2J4G A;  4QWN B;  4YTN A;  1J5E T;  3N2G E;  3IA3 A;  4CI3 B;  1NWM X;  2W67 A;  3ZC0 A;  2XM1 A;  3V5S A;  2WSS V;  2CLY B;  2WMN A;  3JAF A;  1T8B A;  3QK6 A;  4O2A E;  4HFV A;  2Z6E A;  3FHN A;  3ZMZ B;  3CML A;  1N33 T;  3NBX X;  5JRC B;  1W0A A;  1HF8 A;  4U74 A;  3B5M A;  4IE7 A;  1MND A;  3UU4 A;  1XWM A;  5AQN B;  5JDG A;  2LOP A;  2VKD A;  5FY1 A;  2WWU A;  3JCF A;  4A5X A;  2V5D A;  4CN1 A;  4AKR B;  4QX8 B;  3Q5E A;  2XQ8 A;  1U4Q A;  4DVD A;  3RGL A;  5L3E B;  5AQG B;  2C5I T;  4EAH A;  3S4U A;  4EV6 A;  3ZT7 A;  4HEA A;  2L3L A;  1BR2 A;  1UCU A;  2NOX A;  4EZH A;  2SPC A;  2AE9 A;  2ACZ A;  2WY2 A;  3VHL A;  1XMQ T;  3OYX A;  5C8Y E;  2FJA A;  2BS4 A;  4DR5 T;  2E9X B;  2VKJ A;  5ABF A;  4PNI A;  2IC9 A;  4C91 A;  4YFS A;  3OBV E;  5J1G A;  4P0A A;  4AIS A;  2JMK A;  4IHJ E;  4E7Z A;  3ZYM A;  3RYF E;  5LBQ B;  4HWC A;  4DUY T;  4LF6 T;  2J62 A;  3O4X E;  1E7P A;  2XJ7 A;  3ZCI A;  3PUZ F;  2A72 A;  2MPK A;  3GA8 A;  2BKO A;  3KBU A;  4IDQ A;  3AE7 A;  1FEW A;  5HCJ A;  3ETU A;  4ZZB A;  3FZF B;  2DLR A;  4YXD A;  4CI2 B;  2W61 A;  1FMV A;  4IT4 A;  2BVL A;  2LE8 A;  5IWA T;  4ANJ A;  3FB2 A;  1ZHC A;  2BVM A;  3AA0 B;  3IEE A;  3E08 A;  2NWB A;  3ZMV B;  3O1H A;  4YSX A;  1FIO A;  1HFA A;  2HN2 A;  5BMV E;  1IBK T;  4LF4 T;  4OYJ A;  3CPZ A;  3PUW F;  1KEY A;  2Y48 B;  5FY0 A;  5A1L A;  1JNR A;  2BG9 B;  1EZ3 A;  4HFC A;  5FXZ A;  3PJA J;  2JRK A;  4A98 A;  2X9H A;  4DV7 T;  5AQJ B;  4ZI3 D;  3CQX C;  2BKN A;  1UUR A;  4GK5 E;  3ZJ1 A;  3HI2 A;  3CVR A;  2IUB A;  1I94 T;  2E2A A;  3ANW A;  2CPT A;  1YD8 G;  4QXH B;  1BR1 A;  4K0U A;  3VRA A;  4BA9 A;  2BBJ A;  5JDM A;  1Z0P A;  2E5L T;  2I6H A;  3JAD A;  5AQQ B;  1UGO A;  4H9N C;  1MNE A;  2WB5 A;  3EVY A;  5FXX A;  3J7Y q;  3ONJ A;  2CBI A;  2GK9 A;  3AVS A;  2LKG A;  3P8C D;  3ZN1 B;  4G63 A;  3KV9 A;  4KX6 A;  4LF8 T;  3AEE A;  4A56 A;  2BKP A;  5HXH A;  4H63 V;  3MXZ A;  2ES0 A;  3KIN B;  3OPC A;  2E9X D;  4BJM A;  3RYC E;  5DAB A;  3O9X A;  1HX1 B;  5L3D B;  2N9D A;  2D5U A;  2KXP B;  2X9Y A;  4GIW A;  2VVS A;  4AXP A;  5JTG A;  1KK7 A;  5LB7 B;  3UUM A;  2M6I A;  2E5V A;  3N9M A;  3RLF F;  2WU2 A;  5TAO A;  3RRC A;  2BBH A;  3RC8 A;  5JVD E;  4JEH B;  3HKC E;  2EHO B;  3P4P A;  1L0V A;  3WAJ A;  2X0L B;  4DR7 T;  5FVL A;  3UUN A;  2LRL A;  3ZMU B;  2CWO A;  5J2U E;  3P50 A;  3CK6 A;  4UV8 B;  4MAL A;  2XAG B;  3FBZ A;  4PK6 A;  1MMA A;  2P9B A;  3RKO A;  2LEH A;  4I4T E;  3ZLI A;  3I0Q A;  2ZM2 A;  2BZB A;  1S94 A;  3PU8 A;  4QH5 A;  4YSY A;  4ILC A;  4I55 E;  4DV6 T;  4ERR A;  1KNR A;  1LVK A;  4YTM A;  2JQK A;  4TWD A;  5L47 A;  2A3D A;  1IBM T;  1VRB A;  3X1D A;  3AXJ A;  3UFE A;  3SFD A;  4GYR A;  2OLT A;  4X1I E;  2VK9 A;  2H3R A;  3CQG B;  4GKK T;  5LP6 E;  1NEN A;  2K9A A;  3VR9 A;  1KNZ A;  5F8P A;  3QNU A;  2UUC T;  4OFZ A;  3Q5X A;  2CXF A;  1HCI A;  1WRD A;  5DJQ C;  3N2K E;  3JAE A;  5LGN B;  3QOF A;  5L4H A;  2X0Y A;  2XSB A;  3FBL A;  2PFV A;  4WBN E;  3U3I A;  2CM0 A;  4YHJ A;  2LKH A;  2K48 A;  2VAS A;  3RX6 A;  3MZK B;  1UUS A;  3AE3 A;  3V5U A;  4EZ4 A;  2IHR 1;  4NIQ A;  3TLU A;  3HKB E;  4O2B E;  3KV6 A;  5AQH B;  1G73 A;  4AQG A;  4H9O C;  3EUH A;  2H7O A;  5LHI B;  3LBX B;  2HPL A;  4PAG A;  5HXE A;  3K1S A;  5LJM A;  3C4W A;  2XHE B;  2KWH A;  3PUX F;  4MHC A;  2V7M A;  2ODV A;  3EAM A;  4QX7 B;  1D0Y A;  4KUM B;  4UV9 B;  1HX8 A;  3ONL C;  1D1C A;  1IAP A;  5LYJ E;  5LMN T;  1ZP0 A;  3Q2M A;  4EEB A;  4ILA A;  4H9Q C;  3GN5 A;  1AJ3 A;  2EHO D;  4IE4 A;  2CHO A;  4H9R C;  2LOS A;  3AA6 B;  1SA0 E;  3OJA A;  2LLY A;  3VU7 H;  2C5K T;  2YOE A;  5FXW A;  4DBQ A;  4ZI2 D;  2B76 A;  3HL6 A;  2N1G A;  2I59 A;  4YT0 A;  3UTK A;  4GOU A;  1JNZ A;  4EB6 E;  4P09 A;  5AQM B;  3T1Y T;  5LBM A;  5AQT B;  3LFM A;  1SHZ C;  5JR9 A;  4N78 D;  5ADX L;  3D0T A;  5AQI B;  3PUG A;  5AQP B;  4HTE A;  2H89 A;  5AFU L;  3AAA B;  5AQK B;  3CX8 B;  5JR9 C;  4LF7 T;  2DHR A;  5JDF A;  3WI3 A;  5LMU T;  4G2A A;  5HEO A;  1XDO A;  2WCA A;  2NW8 A;  3L09 A;  2IC6 A;  5L3G B;  1QUU A;  3UUL A;  1HNZ T;  4JLE A;  3N9L A;  2X51 A;  1W09 A;  5EK4 A;  3PUR A;  1T98 A;  5EZY E;  2D0T A;  2V6Y B;  3AEF A;  4O4L E;  1YQ4 A;  4YHH T;  3P7I A;  3ZSS A;  2UXX B;  4PW8 A;  2E8I A;  2FBW A;  2UXN B;  4P1N A;  4HFI A;  5CJ5 A;  4HWD A;  4X20 E;  2UXC T;  3TLV A;  4QKN A;  3DJB A;  3SRZ A;  2ZLY A;  5KX5 E;  4DV5 T;  1WR0 A;  2I0M A;  5ABG A;  3RKG A;  2NTX A;  5ABE A;  1W9R A;  2W00 A;  1OED A;  2W2U A;  3CIR A;  3AEC A;  3RYI E;  2WS3 A;  2VUR A;  4X66 T;  3CX7 B;  5L4E A;  4KBM B;  4AQF A;  5IHY A;  2HN1 A;  1OED C;  1WLX A;  2M6B A;  4EYU A;  4JV5 T;  3OYZ A;  3DP7 A;  3HKD E;  2ZMA A;  1WR6 A;  5F5W A;  3SWH A;  3ZMS B;  4UIG A;  1KFY A;  4AQF C;  4O4H E;  3RH3 A;  5EK3 A;  5GON E;  3FZK B;  3RF1 A;  5JH7 E;  1J1J A;  4NUV A;  1N34 T;  2V7L A;  4CQI A;  3ZT6 A;  1MIW A;  1NEK A;  2BS3 A;  2D0U A;  5CA1 E;  3PTR B;  5JRE A;  3ZPO A;  5AQR B;  4TZ4 C;  2KIN B;  1X9B A;  2X9X A;  3I0O A;  5ETW A;  3W15 B;  1MMG A;  4DR2 T;  4CN4 A;  3MKD A;  5AQO B;  2QA7 A;  2ZM0 A;  1HTJ F;  2XAF B;  4TV8 E;  4WW0 A;  3NVO A;  5LGU B;  2YU1 A;  2G0U A;  2WZH A;  4TWF A;  1CHU A;  5HWY A;  2Y6X A;  1LKX A;  4YY3 T;  3I9W A;  3J9X 1;  2XAH B;  1R8I A;  2UU9 T;  2WQY A;  1NAF A;  4NXM T;  1IZN B;  4XZC A;  3C4X A;  3MJX A;  2Q9Q A;  3L39 A;  1WYB A;  2QVA A;  4UF0 A;  5KXJ A;  4L9I A;  5J0Z A;  2Q9Q C;  2BS2 A;  5FNV E;  4AKG A;  5CFB A;  3EDV A;  2V1D B;  1Z8U A;  3AE5 A;  3GWH A;  2YU2 A;  3JC6 C;  2C0S A;  3GMI A;  4CZZ B;  1D0Z A;  5CA0 E;  2VWA A;  4I0U A;  1FJG T;  2W4X A;  3UQ7 A;  3PU3 A;  5HYA A;  2XQ6 A;  2CWY A;  4IDZ A;  3LK2 B;  4MFR A;  4IL4 A;  3H3A A;  3ZYL A;  1ZEE A;  5HXR A;  2XTL A;  1YKH B;  3F57 A;  3RYH E;  2KWI B;  3NRX A;  5AQV B;  3IF8 B;  2LM9 A;  3C50 A;  2A9U A;  3K3N A;  5FKY A;  2H7V C;  2LM2 A;  4B6X A;  2NR4 A;  5E0O A;  3AA1 B;  4FJO A;  1VOM A;  4K0K T;  2LT3 A;  3RQU A;  2WM9 A;  4TX5 A;  4BJN A;  3IHR A;  5ABF B;  1G8X A;  1WYC A;  4NUU A;  4OK0 A;  4JI1 T;  3UFG A;  3UU5 A;  1CUN A;  4EIW A;  1N36 T;  3O1J A;  5FY7 A;  2XQ5 A;  5JDN A;  4E7S A;  2XQ7 A;  4V1A v;  3P4W A;  3U78 A;  4HWF A;  4JYA T;  2UUB T;  2D9D A;  4PJN A;  2MAW A;  2W62 A;  3ZT5 A;  4U7I A;  2CMR A;  4L5G A;  1YQ3 A;  4DO0 A;  3N9P A;  2LSJ A;  4GYS A;  3I1A A;  2XQ4 A;  2X66 A;  4LF9 T;  3IBP A;  2HHH T;  3KFW X;  2F4V T;  4JI7 T;  3Q5D A;  1W0B A;  3PV0 F;  3TLS A;  2HPJ A;  3Q5W A;  4PJL A;  4DV1 T;  4X5T A;  1HNW T;  3K8P C;  3UQ4 A;  3K3O A;  4Z90 A;  3ANW B;  2KT9 A;  4UEL A;  3T1H T;  4XAX B;  3C4Z A;  3M65 A;  4LF5 T;  3ZST A;  4AI6 A;  4HWI B;  2ZM8 A;  3HKE E;  3C51 A;  4H9S E;  5JQG E;  4JI5 T;  1FMW A;  2WZI A;  4FI5 A;  4HE8 A;  4ISS A;  3LJC A;  3H3M A;  1ZV4 X;  3FXD B;  3MAC A;  4CI1 B;  4IDN A;  4YLH A;  4QH4 A;  3AED A;  4COF A;  2QYW A;  2OA5 A;  4KMC A;  2CLY C;  4PFP A;  1XNR T;  5CB4 E;  5JRC A;  2XQA A;  4EOZ B;  2YEV C;  4ZI3 C;  4KHZ F;  2PTF A;  3AE1 A;  5HWX A;  4IST A;  5LHG B;  4X65 T;  1Y64 B;  5HEG A;  4IE5 A;  4ILB A;  3RIA A;  3KV4 A;  2CBJ A;  2RP4 A;  2XZE A;  1DU2 A;  3QC9 A;  2ODU A;  2X68 A;  3H37 A;  3RHW A;  2W66 A;  1YW0 A;  3ETV A;  2PJQ A;  2NW9 A;  2L8K A;  2UUA T;  4U33 A;  1KF6 A;  1X79 A;  2V7I A;  3ABV A;  5AQL B;  3FZH B;  2VL8 A;  2JMH A;  1SUM B;  1WCR A;  4U7Y A;  1N32 T;  5LXT E;  3CX6 B;  2CHN A;  2YKS A;  2DI4 A;  3ZJ2 A;  2V6X A;  3PUY F;  5ABH A;  2E9X A;  4EXT A;  1T72 A;  4TWH A;  3VRB A;  3AE9 A;  5HEJ A;  5FXV A;  4XBF B;  2IW5 B;  3FXE B;  5HXS A;  2E9X C;  5JDH A;  5F3J A;  1HG2 A;  2CRB A;  4JEU B;  1V9D A;  5L3C B;  1BR4 A;  3NKZ A;  4AQY T;  4I50 E;  2QRX A;  2WMO A;  2RA1 A;  4J2C A;  4AKL A;  2BG9 E;  4LFB T;  5DQV A;  3AXJ B;  4AIU A;  4OHF A;  3R84 B;  3A5X A;  3AB3 B;  4U31 A;  4QXB B;  1VCS A;  2YK0 A;  4WBO A;  4Z8X A;  5H6R B;  3UT5 E;  4JI0 T;  3N2O A;  2DWK A;  3PDY A;  1LVF A;  1XMO T;  4F8H A;  2V7J A;  3PUQ A;  5LA6 E;  1OED E;  2LRK A;  3FZL B;  4GKJ T;  4B3T T;  3ZKR A;  4LMK A;  2CXD A;  3RQW A;  2WU5 A;  4CXW A;  4ZOL E;  4DMW A;  4X1K E;  1ZOY A;  5IUX A;  2BG9 A;  4O8S A;  2K24 A;  2WBL A;  4PJJ A;  3ZMT B;  2XPK A;  2MYS A;  1SE7 A;  2YDR A;  2BG9 C;  4JBW F;  5LGT B;  2MBG A;  2AXD S;  2J47 A;  2V7K A;  1UX5 A;  2V26 A;  3UU8 A;  3BQI A;  4CXX A;  3TLW A;  5KMG P;  3LSV A;  4UEM A;  3M3Z B;  3PUA A;  3NRY A;  3QB5 K;  2L9Q A;  3P4R A;  3PUV F;  5C3J A;  4JI8 T;  4B3S T;  4O4J E;  1Y01 A;  2FJB A;  4QHO A;  3ZN0 B;  4IDO A;  3KVA A;  4ASK A;  4QXC B;  2V5C A;  4U2Y A;  4YJ2 E;  1BR0 A;  2WWV A;  3GN5 B;  4X64 T;  1QSD A;  5CGM A;  2VQF T;  2JQQ A;  4ILU A;  1YKE B;  4I43 B;  2FJD A;  2XQ3 A;  2R6G F;  3AE6 A;  3E0Z A;  3MK7 C;  4C90 A;  2WP9 A;  2IIU A;  2NP9 A;  4UVB B;  3TKL B;  5LNK A;  1XNQ T;  3AVR A;  3NZP A;  4CN6 A;  4UXN B;  2QGS A;  2KLQ A;  2DWG A;  2YIN A;  4DR1 T;  4DID B;  5AQU B;  3C98 B;  3P4S A;  3RI5 A;  4TV9 E;  5JR9 B;  1M62 A;  2MTQ A;  4IRE A;  3ZC1 A;  4YTP A;  4F6R C;  1MMD A;  2EHO A;  2FJE A;  5DQW A;  3DTO A;  1HS7 A;  2EHO C;  3EHZ A;  3EI0 A;  3LK4 2;  2M67 A;  4JI6 T;  3TLT A;  2VKO A;  2JIW A;  4DR6 T;  2CXL A;  1IJ5 A;  5LHH B;  2W0G A;  2XY8 B;  3AE2 A;  3KBT A;  4ZI2 C;  4WNK A;  4ZS3 A;  3SFE A;  3KV5 A;  4IE6 A;  4EYY R;  4HGA A;  1IBL T;  3QB5 A;  4TN7 B;  1QLB A;  2W63 A;  2XAS B;  3ZCJ A;  4LML A;  3SS1 A;  5L3B B;  2ACX A;  3P4Q A;  5L2L A;  1OXZ A;  2LSI A;  1UX4 A;  3EAB A;  4KI0 F;  5KDM C;  1B7T A;  4TNV A;  1S35 A;  3EDU A;  3I9Y A;  2NTY A;  5LG3 A;  3VR8 A;  4U2Z A;  4HKA A;  3PJA A;  4ZS2 A;  3AEG A;  4OX9 T;  1I6Z A;  2HH7 A;  3OTO T;  2PG8 A;  2KSR A;  1OED B;  4X1Y E;  5HXC A;  1U5P A;  2LHN A;  1J5W A;  3RC3 A;  2X67 A;  3VKG A;  5FP3 A;  2WDQ A;  2X0H A;  3CQC B;  4ZEY A;  4H63 H;  2WAU A;  4PK4 A;  2IAK A;  4WYV A;  1XDP A;  3L3P A;  3AAE B;  4ADZ A;  3KVB A;  2YN6 A;  4PK5 A;  3LBX A;  3NWI A;  3AEB A;  5H6Q B;  4HFD A;  2YDS A;  4DV2 T;  3N9O A;  3HA4 A;  3ONX A;  4IDP A;  4NPP A;  4UR9 A;  5FYM A;  4DUZ T;  2BDE A;  2X9W A;  2N2N A;  2NW7 A;  5J2T E;  4YJ3 E;  1UK5 A;  2WDR A;  5AQS B;  4ZXL A;  4YSZ A;  4BAY B;  4DV3 T;  4ZZC A;  2V8S V;  3G06 A;  4QH1 A;  4DV4 T;  3QUJ A;  5IYZ E;  2JQH A;  4EGW A;  3NZQ A;  3KDS E;  2KZ7 B;  4B3M T;  3PE0 A;  3ZEF B;  4DND A;  4U3C A;  2XSA A;  2UXB T;  1MIV A;  3SOL A;  3CWZ B;  2IDO B;  3Q9D A;  1T7S A;  2VB6 A;  4HFH A;  3AE8 A;  1VCT A;  5LJN A;  4AKI A;  4X62 T;  2XUE A;  2DNX A;  3BQK A;  2D2S A;  3O1I A;  1MMN A;  1US7 B;  2YDQ A;  4HN9 A;  3K3Q C;  1HR0 T;  2JJ9 A;  2VL0 A;  5L3F B;  4MBQ A;  4HFE A;  2VQE T;  4MLK A;  2Q9Q B;  3UUX B;  2ZM6 T;  4UF0 B;  4TUY E;  2B1E A;  5LOV E;  2VVN A;  3WAK A;  3B13 A;  1H7C A;  4ZI7 E;  4OYK A;  3C64 A;  4WZX A;  4IL9 A;  2LHR A;  3A7M A;  1HNX T;  4UVC B;  3L8R A;  4L0R A;  2A2F X;  4LFA T;  3UU3 A;  4PFO A;  2H88 A;  4O4I E;  5JDQ A;  2V6Y A;  2LSG A;  4B3R T;  5LCY A;  3RPU A;  3BK9 A;  5JDL A;  3N5L A;  3ZYK A;  4DV0 T;  3ESL A;  3B57 A;  2C5J A;  2VKH A;  3MA9 A;  2FUP A;  2XAQ B;  2CEA A;  3BQL A;  4JI2 T;  4JUY A;  1M7K A;  3RRW A;  1D1B A;  3N9N A;  4U72 A;  2IML A;  1XZY A;  3F31 A;  2J1D G;  5FMN A;  5EK2 A;  5HEU A;  3PUS A;  2CE7 A;  5HEH A;  3AA7 B;  1WFD A; 
#chains in the Genus database with same CATH homology
 4IDN A;  3X1D A;  3QNU A;  3QOF A;  1XZY A;  1W0A A;  3Q5E A;  3OVU A;  3Q5D A;  1W0B A;  4IDO A;  1Y01 A;  4IDP A;  1W09 A;  3IA3 A;  1Z8U A;  4IDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...