3IA3A

A cis-proline in alpha-hemoglobin stabilizing protein directs the structural reorganization of alpha-hemoglobin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
ALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A cis-proline in alpha-hemoglobin stabilizing protein directs the structural reorganization of alpha-hemoglobin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxygen transport
molecule keywords Alpha-hemoglobin-stabilizing protein
total genus 29
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 3ia3A00
3OVUA 3QOFA 4IDPA 4IDOA 1W09A 1W0AA 4IDNA 3QNUA 3X1DA 1W0BA 1Z8UA 4IDQA 1XZYA 3IA3A 3Q5DA 3Q5EA 1Y01A
chains in the Genus database with same CATH superfamily
3P4QA 2E5VA 4C90A 2UXCT 5CJ5A 4X1KE 5HXRA 3UUXB 2WWVA 1Z8UA 1JNZA 3KBTA 3P4PA 5IHYA 2HN2A 4LF7T 3UFGA 2L9QA 2V7JA 5JDNA 2BS3A 1KF6A 2JRKA 2LSJA 2WY2A 4LMLA 4MALA 1UX5A 1GQEA 5JREA 3KINB 3RH3A 4ZI2D 5JDLA 1KNRA 4ILCA 2X0YA 4YHHT 2I59A 1IBLT 4EAHA 1FEWA 1U5PA 5L4EA 3CK6A 4HWIB 3NRYA 4LF4T 2IDOB 3KVBA 3RRWA 2JQKA 1KEYA 3CKDA 2M6BA 4ZEYA 2VL0A 5CB4E 3AAEB 2VVSA 5AQSB 4K0UA 3ZSSA 4YSYA 2XAQB 5LGNB 4YY3T 2PJQA 2D0TA 3E08A 4EIWA 4OX9T 4B3MT 2E9XA 3UQ4A 4JUYA 4H9OC 2D2SA 2XQ6A 3MXZA 2V1DB 3JC6C 5FVLA 3CVRA 3GMIA 4NPPA 3Q9DA 4TX5A 4EV6A 2XAJB 2FJBA 2XAGB 3CX8B 3JCFA 4H9NC 5ABEA 1HX8A 4U31A 4QXBB 1EZ3A 2I6HA 3CX6B 3N2GE 4V1Av 2BG9C 2GK9A 3EABA 3I1AA 4KUMB 3P8CD 5AQQB 2QGSA 5FYMA 4CXXA 3E0ZA 4TN7B 1FMWA 2LJLA 2V8SV 3KV4A 4UV8B 4JI2T 5JR9C 4HWHA 3CQXC 2VK9A 4PJMA 4DBQA 4AKHA 2LRLA 2Q9QA 4QH5A 1FIOA 3AE8A 2MTQA 2BG9A 2ACXA 1MIWA 2M67A 4DUZT 2ES0A 5AQIB 5FY1A 4OYJA 1G73A 4A5XA 3AB3B 3Q5XA 3L09A 4H9QC 2V7KA 2MAWA 4YHJA 2P9BA 4PK5A 4JI3T 4Z91A 3HR0A 4DUYT 5BR8T 3P4WA 3GN5A 2WBLA 3O1HA 2CA5A 2CWOA 3ZKRA 1N36T 4IDNA 5JVDE 2KMFA 3AA7B 4H63V 2H7OA 4ZOLE 5J0ZA 2D0UA 3Q5DA 4PW8A 1OEDC 5LHIB 2Y8DA 2WP9A 3AE9A 2IW5B 4AQFC 2A72A 3AAIA 2K5BB 2DHRA 3PUXF 3FBZA 1UK5A 1MIYA 3LK2B 5F8PA 5FKYA 1N34T 2X68A 1HG2A 2WDVA 4A56A 1HNXT 2V6YA 4JBWF 4I55E 3ABVA 1G8XA 5JH7E 2CMRA 4XBFB 1MIVA 3DJBA 4U72A 3FHNA 2KSRA 2XQ8A 3ETUA 5DQVA 5BMVE 1QLBA 3R84B 3ANWB 4JV5T 4U2ZA 1HFAA 2YU1A 2HPJA 5M4YA 2XQ4A 2WB5A 4DV5T 5A1LA 2BBJA 4WBOA 1HTJF 3NKZA 3KV9A 5JDFA 2BKNA 1N33T 1IBKT 2XJ7A 2IC6A 1V9DA 2C5KT 3LJCA 2X9HA 4WBNE 4YXDA 3AE5A 4NUUA 5EK4A 3ZJ1A 1E2AA 3ZJ2A 4ILUA 2DLRA 3HKBE 3IEEA 3P50A 3H3AA 3QB5A 3PUSA 4TWHA 3Q2MA 5FXVA 5FY7A 5IUXA 4X64T 2BVLA 2HH7A 2VKOA 3ZN1B 4ISTA 2X66A 3B13A 4ZI7E 1BR2A 3NVOA 1D1CA 2ZM8A 2XM2A 4IE6A 4IDOA 5L2LA 3CX7B 2WZIA 3QNUA 4PFOA 3NWIA 2DCFA 3ETVA 3PE0A 4HFDA 1NAFA 4DR6T 3HI2A 4EXTA 2W0GA 5HCMA 5ADXL 3QOFA 2F4VT 3E22E 4ZI3D 5FL0A 3PURA 3PJAA 2LKHA 1ZP0A 5FNVE 4HWFA 4EOZB 4AKGA 1D1BA 3Q5WA 2UUCT 3RIUA 2IAKA 5L47A 5JRCB 2H7VC 4BJMA 2NTXA 3TLTA 1X79A 1M62A 2YINA 1B7TA 1LKXA 4GYSA 4O4HE 4UVBB 2BKPA 3HL6A 5HEHA 4YJ2E 5HXHA 5LG4A 2UU9T 1J5WA 4HWDA 4YT0A 3JAFA 3ZLIA 4LF5T 2LOPA 1Z0PA 4QXHB 3AEBA 2WU5A 3N5LA 2X9XA 3K3QC 4JI8T 2ZM6T 2XM1A 2NWBA 1W0BA 2LE8A 3KFWX 4COFA 2X9YA 3C64A 3HKDE 4L0RA 1CHUA 5C2TA 1US7B 2PBIA 3AE2A 2RA1A 3AXJA 4WZXA 3RGLA 4X1YE 3K1SA 3AEFA 4FI5A 2E9XC 1VCSA 1BR1A 2FJEA 4KBMB 1YQ4A 2A9UA 5AQOB 2QA7A 5H6QB 3RIFA 4EYUA 2E5LT 4K0KT 2CBJA 2XQ5A 2PG8A 3N9PA 1D0XA 1W09A 2L8KA 3WI3A 3AE7A 3VKHA 3AEGA 2WAUA 2RP4A 2XY8B 4YLHA 4L5GA 4DR5T 3SWHA 1ZOYA 4X1IE 2UXBT 5DJQC 2KINB 5LHGB 2YDSA 3CPZA 1XDOA 2NOXA 2NW8A 4IHJE 4WNKA 1SUMB 1M7KA 2K48A 3NZQA 5IYZE 2JJ9A 5ETWA 3N9MA 5L4HA 4CN1A 5L3BB 2CHOA 2LHRA 3ESLA 2PTFA 2I0MA 4HFVA 2IHR1 4O2AE 3UUMA 4EB6E 2WQYA 4YTPA 3RYHE 5LXTE 4P0AA 3V5SA 1XNRT 4H9RC 2VASA 2W61A 3RI5A 2Z6EA 4NUVA 2YN6A 1MNEA 3D0TA 3H3MA 2FUPA 5LGUB 4HN9A 2CRBA 3CQGB 3ZN0B 1LRZA 1LVFA 1FJGT 3MK7C 2LSYA 3PJAJ 4IDQA 5CA0E 2IC9A 2FBWA 3PUQA 2A3DA 3ZC1A 4DR7T 1Y01A 3TKLB 3N2OA 3L8RA 4JI1T 3X1DA 3TLSA 2HHHT 5L3CB 3TLWA 2LHNA 2A2FX 3UUBA 3PUGA 3EI0A 3ZT7A 4LFAT 4YSZA 4HKAA 4DV3T 2M6IA 3FZHB 2E8IA 3O1JA 3PUVF 4ILAA 4O8SA 5CGMA 4YTMA 5FY0A 1JNRA 2X51A 4I0UA 2IMLA 3FXEB 4UEMA 3RPUA 4JI7T 2KWIB 3C4WA 3ZMSB 3OYZA 2K3WA 3O4XE 3LK42 1XZYA 2LOSA 1S94A 2Y6XA 3NZPA 3Q5EA 4UF0B 5FXXA 4C91A 2CPTA 5LMUT 2BKOA 5LNKA 3K8PC 2N9DA 5AQNB 4ADZA 2VURA 3AA6B 4MLKA 3RC3A 3UULA 1R8IA 4DR4T 2BG9B 3ONJA 4O2BE 1OXZA 4Z90A 1UCUA 4ILBA 5HEOA 3JC6D 3R6NA 3F31A 3ZMUB 2YK0A 3CIRA 3ZEFB 3EDUA 3KVAA 3OYXA 2R6GF 4JEHB 4A98A 1CUNA 1QSDA 3WAKA 3GN5B 1KNZA 3FZKB 4GIWA 3RIAA 4ZZCA 5JTGA 5AQHB 5ABGA 1UX4A 3RYFE 4WW0A 2W2UA 4EYYR 3MA9A 4DBRA 5J2TE 1H7CA 3OPCA 4DV6T 3I9YA 2G0UA 2XASB 3OBVE 4PK6A 3J9X1 4LF9T 3V5UA 3EUHA 1DU2A 4HFCA 4ANJA 3N9LA 4IREA 3OTOT 2BVMA 2JMKA 5H6RB 3UU5A 3CWZB 2V6XA 2W63A 3AECA 5EK2A 3RC8A 2UXDT 1OEDE 2JQHA 2VQET 3ZT6A 5JDMA 1HCIA 4PJNA 4CI2B 3BQKA 3ZMVB 2XHEB 3AE3A 3C4ZA 3BQIA 3RIUC 2DWKA 4DO0A 4TV8E 2V7MA 1ZV4X 4UIGA 2DNXA 2V7LA 1D0YA 3IF8B 4HFIA 4PK4A 3N2KE 5DABA 4JI6T 4X5TA 1ZKEA 3PV0F 3RRCA 2V7IA 4DNDA 2CM0A 4JI0T 3VU7H 1HG5A 2CCQA 4IE7A 4GK5E 5GONE 2MYSA 4PJJA 1VCTA 4TUYE 4DV2T 2ZM2A 5ABFB 3A7MA 4U3CA 5EZYE 2XUEA 1MMNA 2YU2A 4IT4A 3U3IA 2BZBA 2MOZA 3PUYF 4UELA 3C4XA 5AQMB 5HWYA 3PUZF 5HWXA 1ZHCA 2SPCA 3MKDA 3UU8A 4EEBA 3ZCJA 4GKJT 4UVAB 3U78A 4NXNT 4KHPT 1I6ZA 3RF1A 2H89A 4IGUA 5AFUL 3T8OA 3IA3A 4TV9E 4YJ3E 3J7Yq 3MJXA 5HCJA 4DR3T 3ZT5A 2NR4A 5E0OA 4H9PC 1XNQT 2ZMAA 1NEKA 1N32T 2XQ3A 3FB2A 4A97A 3LDQB 5LYJE 3ZYMA 4U2YA 1WYCA 4AKRB 1T7SA 4JYAT 1QUUA 2JQQA 2WCAA 3RLFF 5AQVB 1IJ5A 1S35A 2KT9A 2N1GA 2XZEA 5AQKB 3UFEA 4F6RC 2X0LB 2VL8A 1HNWT 1VOMA 2XQ9A 3WAJA 2YEVC 1WR6A 2XSBA 3QC9A 4AKIA 4JLEA 3UTKA 2CEAA 2LSGA 3QK6A 1J1JA 4HFBA 4KI0F 5LGTB 3RKGA 4J2CA 4AQFA 2QVAA 5F3JA 5L3GB 4I43B 1OEDA 3RQWA 4MHCA 2FJDA 4GYRA 1BR4A 2DI4A 2FJAA 2L3LA 4U7YA 5KXJA 2VVNA 4IE0A 1SE7A 3ZMTB 3FZLB 3JADA 4BA9A 1KK7A 1YKHB 3LSVA 3H37A 5L3FB 2ZM0A 1VRBA 3VR8A 3QUJA 4Z8XA 1UUSA 1FMVA 4QWNB 3RYIE 2NW9A 2J4GA 1SHZC 2X0HA 2DL1A 3IBPA 2HN1A 4G63A 4U74A 3AEAA 4IIJE 4CQIA 4LFCT 4HE8A 2W00A 3BK9A 4YTNA 4I50E 2LSIA 4FJOA 3NBXX 5DQWA 5AQPB 1E1HB 2V26A 4DMVA 4YSXA 2CWYA 5IWAT 3OKQA 4DVDA 1OWAA 3GA8A 1LVKA 3EDVA 1T72A 5KDMC 2J1DG 1IJ6A 5JRCA 2YDQA 2XPKA 5TAOA 1J5ET 5JR9A 2XTLA 2D9DA 3EAMA 3C50A 4KX6A 2WZHA 2XQYA 3F57A 2OLTA 2W66A 4UV9B 5FP3A 1WCRA 5FL1A 5JDQA 2BS2A 4IL4A 1T8BA 4QXCB 2E2AA 2X9WA 4CXWA 3L3PA 3BQLA 4MBQA 4ZS2A 3HKCE 5JDHA 2IIUA 3N9OA 2ODUA 5LCYA 5HEJA 2RPAA 5J2UE 4E7SA 3AXJB 3ZSTA 2PFVA 3P4RA 4MFRA 3CMLA 4N78D 3UU4A 5ABFA 5J1GA 1O3XA 4DR2T 4NXMT 2DWGA 1U4QA 2W67A 3KBUA 3VHLA 2UUBT 4GKKT 1AJ3A 2D5UA 4AISA 4P1NA 3IHRA 4ERRA 2X67A 2C5JA 2NP9A 4QH1A 3AE1A 2Q9QC 3NRXA 2WMOA 4IDPA 4PJLA 4CI3B 3KDSE 5LMNT 3UQ7A 2V5DA 3M3ZB 1XMOT 3VKGA 5HXCA 1X9BA 1WLXA 4X66T 2EHOD 1YW0A 2XQAA 4AKLA 2CXDA 3VR9A 1Y64B 1SA0E 4HTEA 3SOLA 3O9XA 3F2EA 3RHWA 3ANWA 5AQRB 4H63H 3FBLA 4JI5T 3PTRB 4CN4A 3FZFB 4ASKA 2BG9E 2J47A 4HEAA 3LK3B 1KNPA 1IBMT 4AQYT 3AE6A 2UUAT 2OA5A 2H3RA 1W9RA 2VWAA 3KV6A 2YKSA 4KMCA 4DV1T 2Y48B 2LT3A 3AE4A 1HR0T 3I0QA 1D1AA 5LJMA 2Q9QD 4O4IE 4E7ZA 3JAEA 3DTOA 3LG7A 2EHOB 2CXLA 4XZCA 3KV5A 3AVRA 2W4XA 3ZMZB 5AQLB 1WYBA 4UXNB 5LA6E 3PU8A 5CFBA 4TNWA 3M65A 2EHOC 3TLVA 4OYKA 3RQUA 3RX6A 3S4UA 2JPFA 2VB6A 1YD8G 2CLYC 2LRKA 5FXWA 3UU3A 2WM9A 4QH4A 3AAAB 3QB5K 4UF0A 4UR9A 3RKOA 5HXSA 1HNZT 4ZXLA 4AQGA 3C98B 4OFZA 1W0AA 2Q9QB 1UGOA 3LBXA 3OJAA 5HYAA 1MNDA 5L3DB 5LB7B 4TNVA 4B3RT 4EGWA 2WWUA 2LM2A 3K3NA 2UXNB 1ZEEA 1XDPA 4X65T 4IDZA 3B57A 4X20E 2BBHA 3LFMA 2WDRA 3SFEA 5LBQB 3AEEA 2LEHA 4ZI2C 5LOVE 4G2AA 4JEUB 4HFEA 4ZZBA 1NWMX 5LHHB 2EHOA 5LP6E 2JIWA 4UVCB 3A5XA 3SS1A 2VQFT 2LM9A 4P09A 3SFDA 2JQ9A 4HGAA 4EZHA 4ZI3C 2JMHA 2KLQA 3EVYA 1YXRA 2KNDA 2VKDA 2N2NA 3PUWF 4H9SE 5FVKA 4EEDA 4IL9A 4OK0A 2ODVA 3K3OA 3N9QA 4DIDB 2MBGA 4BJNA 4QX7B 5LBMA 3ZC0A 2QRXA 4CN6A 1HF8A 2K24A 3RYCE 1BR0A 4XAXB 5HXEA 3ZYLA 4ISSA 4DV0T 3FZMB 4AXPA 4HFHA 5JR9B 1MMAA 3I9WA 1HX1B 3AA0B 5LG3A 3AA1B 2XQ7A 4LMJA 4PNIA 2V5CA 3AVSA 4F8HA 1XMQT 2OV9A 4B6XA 1IAPA 4CI1B 1MMGA 2VKJA 2VKHA 5LJNA 4DV7T 1I94T 1IZNB 4M1PA 5AQGB 5FXZA 1HS7A 4O4JE 4QX8B 3MZKB 3HA4A 2ACZA 2BS4A 3P4SA 4U7IA 2NTYA 4AI6A 5EK3A 3ZYKA 4LF8T 4LF6T 1E7PA 5C8YE 2XAFB 2E9XB 2HPLA 3UU6A 2KXPB 1KFYA 3ZPOA 4OHFA 4B3TT 4QHOA 4LFBT 3N9NA 5L3EB 2B1EA 2LKGA 2H88A 4ZHQE 2CE7A 4BAYB 3PUAA 4KP3C 2K9AA 3OVUA 2LLYA 3T1YT 3T1HT 1OEDB 4X62T 2XAHB 2CXFA 1YKEB 2IUBA 2WU2A 5HEUA 3SRZA 4QKNA 3VRBA 2WS3A 3PU3A 2AE9A 5KX5E 2AXDS 4GOUA 1WFDA 2C0SA 3AEDA 4O4LE 3UUNA 5AQTB 4GK0E 2UXXB 2WSSV 4Q25A 5AQUB 4DMWA 4IE4A 4PFPA 4DR1T 3O1IA 4YFSA 3W15B 5C3JA 1WRDA 4TWDA 5AQFB 2YDRA 1NENA 2BDEA 3C51A 2CLYB 2YOEA 2E9XD 5F5WA 3B5MA 1WR0A 3L39A 1XWMA 5CA1E 3DP7A 2KWHA 3GWHA 4EZ4A 3TLUA 4DV4T 4WYVA 5HAXA 3CQCB 4CZZB 4U33A 4TWFA 2C5IT 1YQ3A 1MMDA 2CHNA 2NW7A 4HWCA 5AQJB 3FXDB 3HKEE 1D0ZA 2CBIA 4AIUA 3LBXB 4TZ4C 5KMGP 3UT5E 2LSKA 4PAGA 3G06A 4L9IA 2W62A 3MACA 4KHZF 1T98A 2ZLYA 2QYWA 4I4TE 3ZCIA 3A8YC 4IE5A 4B3ST 4P0BA 2XSAA 4JI4T 2WDQA 2MPKA 3ONLC 5JDGA 3I0OA 3PDYA 5FMNA 4NIQA 4CXYA 2B76A 5ABHA 3P7IA 3EHZA 5HEGA 5JQGE 2V6YB 4ZS3A 1UURA 2WMNA 4LMKA 3VRAA 2KZ7B 3ONXA 2J62A 1L0VA
chains in the Genus database with same CATH topology
3OVUA 3QOFA 4IDPA 4IDOA 1W09A 1W0AA 4IDNA 3QNUA 3X1DA 1W0BA 1Z8UA 4IDQA 1XZYA 3IA3A 3Q5DA 3Q5EA 1Y01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVU A;  3QOF A;  4IDP A;  4IDO A;  1W09 A;  1W0A A;  4IDN A;  3QNU A;  3X1D A;  1W0B A;  1Z8U A;  4IDQ A;  1XZY A;  3IA3 A;  3Q5D A;  3Q5E A;  1Y01 A; 
#chains in the Genus database with same CATH topology
 3P4Q A;  2E5V A;  4C90 A;  2UXC T;  5CJ5 A;  4X1K E;  5HXR A;  3UUX B;  2WWV A;  1Z8U A;  1JNZ A;  3KBT A;  3P4P A;  5IHY A;  2HN2 A;  4LF7 T;  3UFG A;  2L9Q A;  2V7J A;  5JDN A;  2BS3 A;  1KF6 A;  2JRK A;  2LSJ A;  2WY2 A;  4LML A;  4MAL A;  1UX5 A;  1GQE A;  5JRE A;  3KIN B;  3RH3 A;  4ZI2 D;  5JDL A;  1KNR A;  4ILC A;  2X0Y A;  4YHH T;  2I59 A;  1IBL T;  4EAH A;  1FEW A;  1U5P A;  5L4E A;  3CK6 A;  4HWI B;  3NRY A;  4LF4 T;  2IDO B;  3KVB A;  3RRW A;  2JQK A;  1KEY A;  3CKD A;  2M6B A;  4ZEY A;  2VL0 A;  5CB4 E;  3AAE B;  2VVS A;  5AQS B;  4K0U A;  3ZSS A;  4YSY A;  2XAQ B;  5LGN B;  4YY3 T;  2PJQ A;  2D0T A;  3E08 A;  4EIW A;  4OX9 T;  4B3M T;  2E9X A;  3UQ4 A;  4JUY A;  4H9O C;  2D2S A;  2XQ6 A;  3MXZ A;  2V1D B;  3JC6 C;  5FVL A;  3CVR A;  3GMI A;  4NPP A;  3Q9D A;  4TX5 A;  4EV6 A;  2XAJ B;  2FJB A;  2XAG B;  3CX8 B;  3JCF A;  4H9N C;  5ABE A;  1HX8 A;  4U31 A;  4QXB B;  1EZ3 A;  2I6H A;  3CX6 B;  3N2G E;  4V1A v;  2BG9 C;  2GK9 A;  3EAB A;  3I1A A;  4KUM B;  3P8C D;  5AQQ B;  2QGS A;  5FYM A;  4CXX A;  3E0Z A;  4TN7 B;  1FMW A;  2LJL A;  2V8S V;  3KV4 A;  4UV8 B;  4JI2 T;  5JR9 C;  4HWH A;  3CQX C;  2VK9 A;  4PJM A;  4DBQ A;  4AKH A;  2LRL A;  2Q9Q A;  4QH5 A;  1FIO A;  3AE8 A;  2MTQ A;  2BG9 A;  2ACX A;  1MIW A;  2M67 A;  4DUZ T;  2ES0 A;  5AQI B;  5FY1 A;  4OYJ A;  1G73 A;  4A5X A;  3AB3 B;  3Q5X A;  3L09 A;  4H9Q C;  2V7K A;  2MAW A;  4YHJ A;  2P9B A;  4PK5 A;  4JI3 T;  4Z91 A;  3HR0 A;  4DUY T;  5BR8 T;  3P4W A;  3GN5 A;  2WBL A;  3O1H A;  2CA5 A;  2CWO A;  3ZKR A;  1N36 T;  4IDN A;  5JVD E;  2KMF A;  3AA7 B;  4H63 V;  2H7O A;  4ZOL E;  5J0Z A;  2D0U A;  3Q5D A;  4PW8 A;  1OED C;  5LHI B;  2Y8D A;  2WP9 A;  3AE9 A;  2IW5 B;  4AQF C;  2A72 A;  3AAI A;  2K5B B;  2DHR A;  3PUX F;  3FBZ A;  1UK5 A;  1MIY A;  3LK2 B;  5F8P A;  5FKY A;  1N34 T;  2X68 A;  1HG2 A;  2WDV A;  4A56 A;  1HNX T;  2V6Y A;  4JBW F;  4I55 E;  3ABV A;  1G8X A;  5JH7 E;  2CMR A;  4XBF B;  1MIV A;  3DJB A;  4U72 A;  3FHN A;  2KSR A;  2XQ8 A;  3ETU A;  5DQV A;  5BMV E;  1QLB A;  3R84 B;  3ANW B;  4JV5 T;  4U2Z A;  1HFA A;  2YU1 A;  2HPJ A;  5M4Y A;  2XQ4 A;  2WB5 A;  4DV5 T;  5A1L A;  2BBJ A;  4WBO A;  1HTJ F;  3NKZ A;  3KV9 A;  5JDF A;  2BKN A;  1N33 T;  1IBK T;  2XJ7 A;  2IC6 A;  1V9D A;  2C5K T;  3LJC A;  2X9H A;  4WBN E;  4YXD A;  3AE5 A;  4NUU A;  5EK4 A;  3ZJ1 A;  1E2A A;  3ZJ2 A;  4ILU A;  2DLR A;  3HKB E;  3IEE A;  3P50 A;  3H3A A;  3QB5 A;  3PUS A;  4TWH A;  3Q2M A;  5FXV A;  5FY7 A;  5IUX A;  4X64 T;  2BVL A;  2HH7 A;  2VKO A;  3ZN1 B;  4IST A;  2X66 A;  3B13 A;  4ZI7 E;  1BR2 A;  3NVO A;  1D1C A;  2ZM8 A;  2XM2 A;  4IE6 A;  4IDO A;  5L2L A;  3CX7 B;  2WZI A;  3QNU A;  4PFO A;  3NWI A;  2DCF A;  3ETV A;  3PE0 A;  4HFD A;  1NAF A;  4DR6 T;  3HI2 A;  4EXT A;  2W0G A;  5HCM A;  5ADX L;  3QOF A;  2F4V T;  3E22 E;  4ZI3 D;  5FL0 A;  3PUR A;  3PJA A;  2LKH A;  1ZP0 A;  5FNV E;  4HWF A;  4EOZ B;  4AKG A;  1D1B A;  3Q5W A;  2UUC T;  3RIU A;  2IAK A;  5L47 A;  5JRC B;  2H7V C;  4BJM A;  2NTX A;  3TLT A;  1X79 A;  1M62 A;  2YIN A;  1B7T A;  1LKX A;  4GYS A;  4O4H E;  4UVB B;  2BKP A;  3HL6 A;  5HEH A;  4YJ2 E;  5HXH A;  5LG4 A;  2UU9 T;  1J5W A;  4HWD A;  4YT0 A;  3JAF A;  3ZLI A;  4LF5 T;  2LOP A;  1Z0P A;  4QXH B;  3AEB A;  2WU5 A;  3N5L A;  2X9X A;  3K3Q C;  4JI8 T;  2ZM6 T;  2XM1 A;  2NWB A;  1W0B A;  2LE8 A;  3KFW X;  4COF A;  2X9Y A;  3C64 A;  3HKD E;  4L0R A;  1CHU A;  5C2T A;  1US7 B;  2PBI A;  3AE2 A;  2RA1 A;  3AXJ A;  4WZX A;  3RGL A;  4X1Y E;  3K1S A;  3AEF A;  4FI5 A;  2E9X C;  1VCS A;  1BR1 A;  2FJE A;  4KBM B;  1YQ4 A;  2A9U A;  5AQO B;  2QA7 A;  5H6Q B;  3RIF A;  4EYU A;  2E5L T;  4K0K T;  2CBJ A;  2XQ5 A;  2PG8 A;  3N9P A;  1D0X A;  1W09 A;  2L8K A;  3WI3 A;  3AE7 A;  3VKH A;  3AEG A;  2WAU A;  2RP4 A;  2XY8 B;  4YLH A;  4L5G A;  4DR5 T;  3SWH A;  1ZOY A;  4X1I E;  2UXB T;  5DJQ C;  2KIN B;  5LHG B;  2YDS A;  3CPZ A;  1XDO A;  2NOX A;  2NW8 A;  4IHJ E;  4WNK A;  1SUM B;  1M7K A;  2K48 A;  3NZQ A;  5IYZ E;  2JJ9 A;  5ETW A;  3N9M A;  5L4H A;  4CN1 A;  5L3B B;  2CHO A;  2LHR A;  3ESL A;  2PTF A;  2I0M A;  4HFV A;  2IHR 1;  4O2A E;  3UUM A;  4EB6 E;  2WQY A;  4YTP A;  3RYH E;  5LXT E;  4P0A A;  3V5S A;  1XNR T;  4H9R C;  2VAS A;  2W61 A;  3RI5 A;  2Z6E A;  4NUV A;  2YN6 A;  1MNE A;  3D0T A;  3H3M A;  2FUP A;  5LGU B;  4HN9 A;  2CRB A;  3CQG B;  3ZN0 B;  1LRZ A;  1LVF A;  1FJG T;  3MK7 C;  2LSY A;  3PJA J;  4IDQ A;  5CA0 E;  2IC9 A;  2FBW A;  3PUQ A;  2A3D A;  3ZC1 A;  4DR7 T;  1Y01 A;  3TKL B;  3N2O A;  3L8R A;  4JI1 T;  3X1D A;  3TLS A;  2HHH T;  5L3C B;  3TLW A;  2LHN A;  2A2F X;  3UUB A;  3PUG A;  3EI0 A;  3ZT7 A;  4LFA T;  4YSZ A;  4HKA A;  4DV3 T;  2M6I A;  3FZH B;  2E8I A;  3O1J A;  3PUV F;  4ILA A;  4O8S A;  5CGM A;  4YTM A;  5FY0 A;  1JNR A;  2X51 A;  4I0U A;  2IML A;  3FXE B;  4UEM A;  3RPU A;  4JI7 T;  2KWI B;  3C4W A;  3ZMS B;  3OYZ A;  2K3W A;  3O4X E;  3LK4 2;  1XZY A;  2LOS A;  1S94 A;  2Y6X A;  3NZP A;  3Q5E A;  4UF0 B;  5FXX A;  4C91 A;  2CPT A;  5LMU T;  2BKO A;  5LNK A;  3K8P C;  2N9D A;  5AQN B;  4ADZ A;  2VUR A;  3AA6 B;  4MLK A;  3RC3 A;  3UUL A;  1R8I A;  4DR4 T;  2BG9 B;  3ONJ A;  4O2B E;  1OXZ A;  4Z90 A;  1UCU A;  4ILB A;  5HEO A;  3JC6 D;  3R6N A;  3F31 A;  3ZMU B;  2YK0 A;  3CIR A;  3ZEF B;  3EDU A;  3KVA A;  3OYX A;  2R6G F;  4JEH B;  4A98 A;  1CUN A;  1QSD A;  3WAK A;  3GN5 B;  1KNZ A;  3FZK B;  4GIW A;  3RIA A;  4ZZC A;  5JTG A;  5AQH B;  5ABG A;  1UX4 A;  3RYF E;  4WW0 A;  2W2U A;  4EYY R;  3MA9 A;  4DBR A;  5J2T E;  1H7C A;  3OPC A;  4DV6 T;  3I9Y A;  2G0U A;  2XAS B;  3OBV E;  4PK6 A;  3J9X 1;  4LF9 T;  3V5U A;  3EUH A;  1DU2 A;  4HFC A;  4ANJ A;  3N9L A;  4IRE A;  3OTO T;  2BVM A;  2JMK A;  5H6R B;  3UU5 A;  3CWZ B;  2V6X A;  2W63 A;  3AEC A;  5EK2 A;  3RC8 A;  2UXD T;  1OED E;  2JQH A;  2VQE T;  3ZT6 A;  5JDM A;  1HCI A;  4PJN A;  4CI2 B;  3BQK A;  3ZMV B;  2XHE B;  3AE3 A;  3C4Z A;  3BQI A;  3RIU C;  2DWK A;  4DO0 A;  4TV8 E;  2V7M A;  1ZV4 X;  4UIG A;  2DNX A;  2V7L A;  1D0Y A;  3IF8 B;  4HFI A;  4PK4 A;  3N2K E;  5DAB A;  4JI6 T;  4X5T A;  1ZKE A;  3PV0 F;  3RRC A;  2V7I A;  4DND A;  2CM0 A;  4JI0 T;  3VU7 H;  1HG5 A;  2CCQ A;  4IE7 A;  4GK5 E;  5GON E;  2MYS A;  4PJJ A;  1VCT A;  4TUY E;  4DV2 T;  2ZM2 A;  5ABF B;  3A7M A;  4U3C A;  5EZY E;  2XUE A;  1MMN A;  2YU2 A;  4IT4 A;  3U3I A;  2BZB A;  2MOZ A;  3PUY F;  4UEL A;  3C4X A;  5AQM B;  5HWY A;  3PUZ F;  5HWX A;  1ZHC A;  2SPC A;  3MKD A;  3UU8 A;  4EEB A;  3ZCJ A;  4GKJ T;  4UVA B;  3U78 A;  4NXN T;  4KHP T;  1I6Z A;  3RF1 A;  2H89 A;  4IGU A;  5AFU L;  3T8O A;  3IA3 A;  4TV9 E;  4YJ3 E;  3J7Y q;  3MJX A;  5HCJ A;  4DR3 T;  3ZT5 A;  2NR4 A;  5E0O A;  4H9P C;  1XNQ T;  2ZMA A;  1NEK A;  1N32 T;  2XQ3 A;  3FB2 A;  4A97 A;  3LDQ B;  5LYJ E;  3ZYM A;  4U2Y A;  1WYC A;  4AKR B;  1T7S A;  4JYA T;  1QUU A;  2JQQ A;  2WCA A;  3RLF F;  5AQV B;  1IJ5 A;  1S35 A;  2KT9 A;  2N1G A;  2XZE A;  5AQK B;  3UFE A;  4F6R C;  2X0L B;  2VL8 A;  1HNW T;  1VOM A;  2XQ9 A;  3WAJ A;  2YEV C;  1WR6 A;  2XSB A;  3QC9 A;  4AKI A;  4JLE A;  3UTK A;  2CEA A;  2LSG A;  3QK6 A;  1J1J A;  4HFB A;  4KI0 F;  5LGT B;  3RKG A;  4J2C A;  4AQF A;  2QVA A;  5F3J A;  5L3G B;  4I43 B;  1OED A;  3RQW A;  4MHC A;  2FJD A;  4GYR A;  1BR4 A;  2DI4 A;  2FJA A;  2L3L A;  4U7Y A;  5KXJ A;  2VVN A;  4IE0 A;  1SE7 A;  3ZMT B;  3FZL B;  3JAD A;  4BA9 A;  1KK7 A;  1YKH B;  3LSV A;  3H37 A;  5L3F B;  2ZM0 A;  1VRB A;  3VR8 A;  3QUJ A;  4Z8X A;  1UUS A;  1FMV A;  4QWN B;  3RYI E;  2NW9 A;  2J4G A;  1SHZ C;  2X0H A;  2DL1 A;  3IBP A;  2HN1 A;  4G63 A;  4U74 A;  3AEA A;  4IIJ E;  4CQI A;  4LFC T;  4HE8 A;  2W00 A;  3BK9 A;  4YTN A;  4I50 E;  2LSI A;  4FJO A;  3NBX X;  5DQW A;  5AQP B;  1E1H B;  2V26 A;  4DMV A;  4YSX A;  2CWY A;  5IWA T;  3OKQ A;  4DVD A;  1OWA A;  3GA8 A;  1LVK A;  3EDV A;  1T72 A;  5KDM C;  2J1D G;  1IJ6 A;  5JRC A;  2YDQ A;  2XPK A;  5TAO A;  1J5E T;  5JR9 A;  2XTL A;  2D9D A;  3EAM A;  3C50 A;  4KX6 A;  2WZH A;  2XQY A;  3F57 A;  2OLT A;  2W66 A;  4UV9 B;  5FP3 A;  1WCR A;  5FL1 A;  5JDQ A;  2BS2 A;  4IL4 A;  1T8B A;  4QXC B;  2E2A A;  2X9W A;  4CXW A;  3L3P A;  3BQL A;  4MBQ A;  4ZS2 A;  3HKC E;  5JDH A;  2IIU A;  3N9O A;  2ODU A;  5LCY A;  5HEJ A;  2RPA A;  5J2U E;  4E7S A;  3AXJ B;  3ZST A;  2PFV A;  3P4R A;  4MFR A;  3CML A;  4N78 D;  3UU4 A;  5ABF A;  5J1G A;  1O3X A;  4DR2 T;  4NXM T;  2DWG A;  1U4Q A;  2W67 A;  3KBU A;  3VHL A;  2UUB T;  4GKK T;  1AJ3 A;  2D5U A;  4AIS A;  4P1N A;  3IHR A;  4ERR A;  2X67 A;  2C5J A;  2NP9 A;  4QH1 A;  3AE1 A;  2Q9Q C;  3NRX A;  2WMO A;  4IDP A;  4PJL A;  4CI3 B;  3KDS E;  5LMN T;  3UQ7 A;  2V5D A;  3M3Z B;  1XMO T;  3VKG A;  5HXC A;  1X9B A;  1WLX A;  4X66 T;  2EHO D;  1YW0 A;  2XQA A;  4AKL A;  2CXD A;  3VR9 A;  1Y64 B;  1SA0 E;  4HTE A;  3SOL A;  3O9X A;  3F2E A;  3RHW A;  3ANW A;  5AQR B;  4H63 H;  3FBL A;  4JI5 T;  3PTR B;  4CN4 A;  3FZF B;  4ASK A;  2BG9 E;  2J47 A;  4HEA A;  3LK3 B;  1KNP A;  1IBM T;  4AQY T;  3AE6 A;  2UUA T;  2OA5 A;  2H3R A;  1W9R A;  2VWA A;  3KV6 A;  2YKS A;  4KMC A;  4DV1 T;  2Y48 B;  2LT3 A;  3AE4 A;  1HR0 T;  3I0Q A;  1D1A A;  5LJM A;  2Q9Q D;  4O4I E;  4E7Z A;  3JAE A;  3DTO A;  3LG7 A;  2EHO B;  2CXL A;  4XZC A;  3KV5 A;  3AVR A;  2W4X A;  3ZMZ B;  5AQL B;  1WYB A;  4UXN B;  5LA6 E;  3PU8 A;  5CFB A;  4TNW A;  3M65 A;  2EHO C;  3TLV A;  4OYK A;  3RQU A;  3RX6 A;  3S4U A;  2JPF A;  2VB6 A;  1YD8 G;  2CLY C;  2LRK A;  5FXW A;  3UU3 A;  2WM9 A;  4QH4 A;  3AAA B;  3QB5 K;  4UF0 A;  4UR9 A;  3RKO A;  5HXS A;  1HNZ T;  4ZXL A;  4AQG A;  3C98 B;  4OFZ A;  1W0A A;  2Q9Q B;  1UGO A;  3LBX A;  3OJA A;  5HYA A;  1MND A;  5L3D B;  5LB7 B;  4TNV A;  4B3R T;  4EGW A;  2WWU A;  2LM2 A;  3K3N A;  2UXN B;  1ZEE A;  1XDP A;  4X65 T;  4IDZ A;  3B57 A;  4X20 E;  2BBH A;  3LFM A;  2WDR A;  3SFE A;  5LBQ B;  3AEE A;  2LEH A;  4ZI2 C;  5LOV E;  4G2A A;  4JEU B;  4HFE A;  4ZZB A;  1NWM X;  5LHH B;  2EHO A;  5LP6 E;  2JIW A;  4UVC B;  3A5X A;  3SS1 A;  2VQF T;  2LM9 A;  4P09 A;  3SFD A;  2JQ9 A;  4HGA A;  4EZH A;  4ZI3 C;  2JMH A;  2KLQ A;  3EVY A;  1YXR A;  2KND A;  2VKD A;  2N2N A;  3PUW F;  4H9S E;  5FVK A;  4EED A;  4IL9 A;  4OK0 A;  2ODV A;  3K3O A;  3N9Q A;  4DID B;  2MBG A;  4BJN A;  4QX7 B;  5LBM A;  3ZC0 A;  2QRX A;  4CN6 A;  1HF8 A;  2K24 A;  3RYC E;  1BR0 A;  4XAX B;  5HXE A;  3ZYL A;  4ISS A;  4DV0 T;  3FZM B;  4AXP A;  4HFH A;  5JR9 B;  1MMA A;  3I9W A;  1HX1 B;  3AA0 B;  5LG3 A;  3AA1 B;  2XQ7 A;  4LMJ A;  4PNI A;  2V5C A;  3AVS A;  4F8H A;  1XMQ T;  2OV9 A;  4B6X A;  1IAP A;  4CI1 B;  1MMG A;  2VKJ A;  2VKH A;  5LJN A;  4DV7 T;  1I94 T;  1IZN B;  4M1P A;  5AQG B;  5FXZ A;  1HS7 A;  4O4J E;  4QX8 B;  3MZK B;  3HA4 A;  2ACZ A;  2BS4 A;  3P4S A;  4U7I A;  2NTY A;  4AI6 A;  5EK3 A;  3ZYK A;  4LF8 T;  4LF6 T;  1E7P A;  5C8Y E;  2XAF B;  2E9X B;  2HPL A;  3UU6 A;  2KXP B;  1KFY A;  3ZPO A;  4OHF A;  4B3T T;  4QHO A;  4LFB T;  3N9N A;  5L3E B;  2B1E A;  2LKG A;  2H88 A;  4ZHQ E;  2CE7 A;  4BAY B;  3PUA A;  4KP3 C;  2K9A A;  3OVU A;  2LLY A;  3T1Y T;  3T1H T;  1OED B;  4X62 T;  2XAH B;  2CXF A;  1YKE B;  2IUB A;  2WU2 A;  5HEU A;  3SRZ A;  4QKN A;  3VRB A;  2WS3 A;  3PU3 A;  2AE9 A;  5KX5 E;  2AXD S;  4GOU A;  1WFD A;  2C0S A;  3AED A;  4O4L E;  3UUN A;  5AQT B;  4GK0 E;  2UXX B;  2WSS V;  4Q25 A;  5AQU B;  4DMW A;  4IE4 A;  4PFP A;  4DR1 T;  3O1I A;  4YFS A;  3W15 B;  5C3J A;  1WRD A;  4TWD A;  5AQF B;  2YDR A;  1NEN A;  2BDE A;  3C51 A;  2CLY B;  2YOE A;  2E9X D;  5F5W A;  3B5M A;  1WR0 A;  3L39 A;  1XWM A;  5CA1 E;  3DP7 A;  2KWH A;  3GWH A;  4EZ4 A;  3TLU A;  4DV4 T;  4WYV A;  5HAX A;  3CQC B;  4CZZ B;  4U33 A;  4TWF A;  2C5I T;  1YQ3 A;  1MMD A;  2CHN A;  2NW7 A;  4HWC A;  5AQJ B;  3FXD B;  3HKE E;  1D0Z A;  2CBI A;  4AIU A;  3LBX B;  4TZ4 C;  5KMG P;  3UT5 E;  2LSK A;  4PAG A;  3G06 A;  4L9I A;  2W62 A;  3MAC A;  4KHZ F;  1T98 A;  2ZLY A;  2QYW A;  4I4T E;  3ZCI A;  3A8Y C;  4IE5 A;  4B3S T;  4P0B A;  2XSA A;  4JI4 T;  2WDQ A;  2MPK A;  3ONL C;  5JDG A;  3I0O A;  3PDY A;  5FMN A;  4NIQ A;  4CXY A;  2B76 A;  5ABH A;  3P7I A;  3EHZ A;  5HEG A;  5JQG E;  2V6Y B;  4ZS3 A;  1UUR A;  2WMN A;  4LMK A;  3VRA A;  2KZ7 B;  3ONX A;  2J62 A;  1L0V A; 
#chains in the Genus database with same CATH homology
 3OVU A;  3QOF A;  4IDP A;  4IDO A;  1W09 A;  1W0A A;  4IDN A;  3QNU A;  3X1D A;  1W0B A;  1Z8U A;  4IDQ A;  1XZY A;  3IA3 A;  3Q5D A;  3Q5E A;  1Y01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...