2M67A

Full-length mercury transporter protein merf in lipid bilayer membranes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
MKDPKTLLRVSIIGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASSTPKFNGVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Mercury Transporter MerF in Phospholipid Bilayers: A Large Conformational Rearrangement Results from N-Terminal Truncation.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Transport protein
molecule keywords MerF
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2m67A00
2MOZA 2M67A
chains in the Genus database with same CATH superfamily
1VCSA 3RF1A 5JVDE 3FZLB 2HH7A 2LSYA 3OKQA 4LMLA 4QH1A 5F5WA 4CXXA 5LG4A 1Z0PA 4IL4A 4UEMA 3GA8A 3PU3A 1QLBA 5ABEA 4AQGA 3P8CD 2EHOB 3MK7C 5FMNA 4HWCA 1OEDA 4EIWA 4UR9A 2WQYA 2L8KA 1V9DA 1BR1A 3CVRA 3PUQA 4DR6T 3NVOA 5FNVE 3SOLA 2E9XB 4XZCA 3UU4A 4ERRA 2CLYC 4Z91A 4X66T 3LBXA 3FZHB 4DR2T 5HEHA 4YTNA 5DQVA 1D0YA 2UXXB 1HFAA 3ONJA 3QB5A 3SWHA 3RC3A 1SA0E 2UUAT 5ABGA 3N9MA 2YDRA 1IBKT 5JR9C 2XAQB 3T1YT 2BVMA 4CN4A 3FBLA 4DMVA 2Q9QD 2HHHT 4H63H 5HCJA 3JC6C 4YJ3E 3UT5E 2XQAA 3B57A 3MZKB 3ZPOA 1D0XA 1WR0A 2V6YA 3HL6A 2VL8A 1YW0A 2A2FX 2VL0A 2W00A 2JJ9A 2X0YA 2XQ8A 3HKCE 3MXZA 3Q5DA 4IE5A 4I50E 2OA5A 4ILCA 4YTMA 3RI5A 2W66A 3NRXA 3EABA 4BAYB 2YU1A 3UUNA 1W0AA 2UXBT 4HFBA 4A98A 2CPTA 4CI3B 3AE9A 5IUXA 2WDQA 4ANJA 2JIWA 3RX6A 4HFDA 4YJ2E 5CFBA 2H3RA 4TWFA 4M1PA 1UK5A 2V5CA 3AECA 4QX7B 4WYVA 3ZN0B 2V1DB 2BKNA 3AEFA 1UGOA 3FB2A 2B1EA 5JDGA 2NOXA 4IDZA 2W2UA 2DCFA 1FMWA 4JI1T 4GOUA 5EZYE 1OEDE 3MACA 5HXHA 3CIRA 3E0ZA 2V7MA 3FZFB 3PDYA 3P4PA 2LOSA 4KX6A 4O4IE 4Z90A 3AAEB 2YINA 3OPCA 4NUUA 5FP3A 3CQXC 2VQET 2LKHA 1GQEA 4EEDA 2YDSA 4DUZT 1J5WA 3AEEA 4OX9T 2SPCA 2XQ4A 4OYJA 4JEHB 4F6RC 4DR3T 1KK7A 3ANWA 4NPPA 4LFAT 2ZM0A 4AQFA 2Q9QA 2WBLA 4PNIA 5AQFB 5L2LA 2W61A 2AE9A 4DNDA 5JDLA 1H7CA 4B3RT 4TWDA 3UUBA 1E7PA 3LK2B 5AQOB 1T98A 4HFEA 3PV0F 2XHEB 3KBUA 2MTQA 1LKXA 2CEAA 5AQKB 3UU8A 5FKYA 4AIUA 4L9IA 3EUHA 4H9NC 2VURA 4AKGA 4ZXLA 5FXVA 2KNDA 5L3DB 2VASA 4U31A 3T8OA 2WWVA 3VRAA 4AKHA 4DR5T 2LKGA 2N9DA 1LRZA 3BQKA 2E5VA 1SE7A 1QSDA 2XAFB 4PW8A 2Q9QB 5CA1E 2UUBT 3IEEA 1DU2A 5H6QB 3ANWB 5FXXA 3FHNA 1HG5A 3K3NA 3RHWA 1HS7A 1HNZT 2CHNA 2WU5A 5ADXL 4DV4T 2CCQA 4U74A 3PE0A 4JI2T 4GK5E 4LF7T 1FEWA 3Q9DA 4EZ4A 4JI7T 3PURA 1LVFA 4X62T 4AQFC 3LFMA 3N2GE 4O4HE 3U3IA 5CJ5A 4A5XA 3GN5A 3AEAA 3VRBA 3OVUA 3UQ7A 4OYKA 4CQIA 1UUSA 4K0KT 4OFZA 4H9PC 1UX4A 4UELA 2NTYA 4B6XA 2VVNA 1QUUA 3CWZB 3I9WA 4IDQA 4CI1B 3P4QA 5ABFA 5KMGP 2NW7A 4PK4A 5LBMA 3CQCB 4JI6T 4ZZBA 2BVLA 5EK4A 4IHJE 5JRCA 2PTFA 3VKGA 2DWGA 5DJQC 2X9HA 4U2YA 4HEAA 3UFGA 1Y64B 3AXJB 4LF9T 4PK6A 3C51A 4MHCA 2I6HA 2ZLYA 3A8YC 1YD8G 3PUSA 3V5UA 1HF8A 2YKSA 2XQ5A 2PBIA 2V7IA 3ABVA 4DMWA 3D0TA 3CKDA 2DHRA 2XSAA 3SS1A 5CGMA 3OJAA 4P09A 4GKJT 1HG2A 2L9QA 5JDFA 5L47A 3ESLA 2Z6EA 3K3QC 1HTJF 1XMOT 1I6ZA 3ZKRA 2CXDA 4CZZB 3BQLA 4O4JE 5J0ZA 3NBXX 3ETUA 4EEBA 2XPKA 3QC9A 2CBIA 3ZMZB 3M65A 3RLFF 2NW9A 2XAJB 3FBZA 3KVBA 4NUVA 3F31A 4JI4T 4JEUB 2V6YB 5LXTE 2WCAA 4MBQA 1KF6A 1B7TA 2KZ7B 3DJBA 3TLVA 5CA0E 3PTRB 2QGSA 2JQHA 2IC9A 3E22E 4GYSA 4ZS2A 4BA9A 1HNXT 1FMVA 5AQIB 1ZV4X 2XAHB 3VKHA 1T7SA 3LK3B 4UV8B 4C90A 3N9QA 2I59A 3O1HA 3AAAB 3PJAJ 3PUXF 2K9AA 5LBQB 4HFIA 1KNPA 3FXDB 3RGLA 4HFCA 3RIFA 2JQ9A 2DL1A 2WDVA 3R6NA 3TLUA 5L3BB 3LJCA 5JTGA 3RYHE 2JQQA 4EYUA 1I94T 2MAWA 2BKPA 2YOEA 1NAFA 2XQ3A 2RA1A 3PJAA 5DABA 1XDOA 3KV9A 3L8RA 5HWYA 1E1HB 2ZM2A 2XAGB 3ZCIA 3RIUC 2DNXA 2LSJA 4ZI3C 2NWBA 2UXNB 4H9RC 4N78D 2XTLA 1SHZC 3RH3A 4C91A 4CXYA 2CA5A 4XAXB 4CN1A 2XM1A 4DBRA 3WAKA 4KMCA 1NWMX 4JYAT 4IDOA 3RRWA 2UXDT 4P0AA 3PUZF 2VK9A 2Y8DA 4QWNB 3RQUA 2UUCT 1VCTA 4YLHA 4DBQA 3AB3B 2KWHA 3P4SA 4TNWA 4ZS3A 5HXSA 3KINB 4DR7T 4HWFA 4EAHA 2KMFA 4Z8XA 2H89A 2GK9A 2ODVA 4U2ZA 5BMVE 2BZBA 5FY7A 4UVAB 3U78A 2ES0A 3JADA 4A56A 1ZEEA 2FJEA 2WDRA 2XY8B 3KBTA 5LGNB 5HXRA 2W62A 3A7MA 4DV3T 2NTXA 3N9LA 3PUVF 1IBMT 4P1NA 2WU2A 3SRZA 3JAFA 3QUJA 1WFDA 2KT9A 2BBHA 5LMNT 1MMGA 2W4XA 5F8PA 3RQWA 2BKOA 2M6IA 2B76A 5LA6E 3EAMA 3C98B 5HEGA 2K24A 5LCYA 1L0VA 2CMRA 4ADZA 5KDMC 4LF4T 4QHOA 3K8PC 4PJLA 3RKOA 4PJJA 4FI5A 2EHOC 4EGWA 5L3EB 4X65T 2E9XD 2KWIB 5HEOA 3SFDA 2JMHA 2LHRA 3O1IA 2V7KA 4BJMA 5L3GB 3MA9A 5J1GA 3P4WA 3C4WA 3I0OA 3ZCJA 3HI2A 4L5GA 4UIGA 2V6XA 4AISA 4H63V 4O2AE 1MMNA 4QH5A 4DVDA 1MMDA 3P4RA 3CX7B 3IA3A 4ILBA 4KP3C 3RIAA 5FY0A 5FXWA 5JREA 4AI6A 3N9NA 2WB5A 3B5MA 4X1YE 4TV8E 4DV2T 5AQGB 4WNKA 5AQNB 2KXPB 2QVAA 4HGAA 2G0UA 2H7VC 2XQ6A 4CI2B 3Q2MA 2KINB 3CK6A 4EZHA 2KLQA 3KDSE 4U33A 4TZ4C 2X67A 4O2BE 5JR9B 4EXTA 2VWAA 5GONE 2LRKA 2Q9QC 1X9BA 4HFVA 4X1IE 3ZT5A 1T8BA 1D1AA 1HCIA 2C0SA 4OHFA 1XZYA 4IGUA 3O4XE 5AQJB 1M7KA 1LVKA 5JR9A 1U5PA 2CLYB 4JBWF 4DR1T 5L4HA 5FL1A 1HNWT 4AKIA 1D0ZA 3MKDA 2FJBA 4WBNE 4HN9A 3ZC1A 1EZ3A 2J1DG 5DQWA 4GK0E 4NXMT 4QXCB 3KV4A 3RIUA 5LP6E 1YXRA 5JDQA 2BG9B 3EHZA 2WP9A 3HKEE 2WS3A 5JRCB 2E9XA 3N2OA 4COFA 3DTOA 2V26A 4PK5A 3IHRA 3JAEA 3J9X1 5AQHB 2BG9A 1XWMA 2X9YA 3C64A 3NWIA 5AQUB 3UTKA 5C2TA 2M67A 2NW8A 4ZZCA 3ZEFB 4LF8T 2XASB 1Z8UA 2BG9E 5HXCA 1AJ3A 2IW5B 2MBGA 3UUMA 5H6RB 3ZMUB 2WAUA 3HA4A 3UFEA 4YSZA 2PG8A 4H9SE 3C50A 3AE2A 1MNEA 3K3OA 4UV9B 4G2AA 4QXHB 4V1Av 3ZJ2A 2WSSV 3AVRA 5EK3A 3ZYMA 1KEYA 3EI0A 2MYSA 3GMIA 3ZC0A 2Y48B 5JDMA 4U72A 2EHOD 3ZT7A 1J1JA 3OTOT 2RPAA 4F8HA 2W0GA 3ZYLA 2CRBA 2L3LA 5FVLA 5HWXA 1S35A 1W0BA 4HWHA 1S94A 1MNDA 1U4QA 2HN1A 2IDOB 4YFSA 3ZMVB 3AE6A 2LLYA 1G73A 3EDVA 5FXZA 1OEDB 2OV9A 2ACZA 4DO0A 1N34T 1XMQT 1ZP0A 3L39A 1KNRA 4H9QC 3RC8A 3AE8A 4HWIB 3UQ4A 2NR4A 4IE4A 3RYIE 3ZMTB 4X64T 4U7IA 3V5SA 2FBWA 3CX6B 2XQ9A 4TV9E 1YQ3A 4EYYR 5AQRB 1BR0A 2IAKA 4DUYT 2X9WA 2LOPA 1IZNB 3H3AA 5LHIB 4JLEA 3J7Yq 4LF5T 4ILAA 4JV5T 5HEUA 2BS2A 1X79A 4ISTA 4YY3T 3KV6A 4NIQA 3PUYF 4LF6T 2LT3A 2WWUA 4UXNB 2DWKA 4LMJA 3AE3A 4EOZB 3CQGB 4X5TA 1R8IA 2H7OA 2FUPA 2VKOA 1JNRA 5LHHB 3VHLA 1OXZA 3R84B 3Q5XA 5LJMA 2C5KT 5FY1A 3QOFA 3KFWX 3H3MA 3Q5WA 1WCRA 3TLTA 4ZEYA 5HAXA 4B3MT 5FVKA 2D5UA 3GN5B 1CUNA 1T72A 4TX5A 1YKHB 4IE7A 3FZMB 3RRCA 3LDQB 3P50A 5F3JA 5LHGB 2BBJA 3ETVA 3S4UA 2NP9A 3LBXB 1US7B 2CXLA 5LGTB 4IDPA 3PU8A 2LE8A 2LSKA 4IT4A 4P0BA 4ISSA 1KFYA 3O1JA 5HYAA 2AXDS 5HCMA 2VB6A 4I43B 3ZLIA 4ZI2D 5E0OA 5IWAT 4IE6A 1MMAA 4CN6A 4JI5T 1ZHCA 5AQTB 1WRDA 2XZEA 3QK6A 5A1LA 3IF8B 2DI4A 4YT0A 2IHR1 1JNZA 3ZJ1A 2R6GF 3NZQA 5KX5E 3LSVA 2ODUA 3CMLA 2E5LT 3AA7B 4YSXA 4HKAA 5FYMA 1WLXA 4DIDB 1WYCA 4MLKA 5LYJE 1WYBA 2IC6A 2V7JA 3W15B 2J4GA 1OEDC 1NEKA 3E08A 4Q25A 4QKNA 5TAOA 3O9XA 4B3TT 4IREA 5JDHA 2ZM6T 4DV0T 4ZI3D 4UVCB 5JQGE 4ILUA 4KHPT 1BR4A 5IYZE 5AQLB 3WI3A 2FJDA 3N9OA 3JC6D 4H9OC 5LOVE 1G8XA 5BR8T 2N2NA 2J62A 2ZMAA 3AXJA 5HEJA 4GYRA 3AE5A 4FJOA 4KBMB 3AA0B 5L3FB 3AVSA 2YU2A 2K5BB 2VVSA 2ZM8A 4IIJE 5LMUT 2X68A 3N5LA 3AE7A 3OBVE 3ONXA 3T1HT 2VKJA 3HR0A 2D2SA 3VR9A 3AA6B 3OYZA 4YHJA 5IHYA 2E2AA 2X66A 2WZIA 3VU7H 3X1DA 4AXPA 4XBFB 1O3XA 4TNVA 2VKDA 3CX8B 1WR6A 2BG9C 4JUYA 3IBPA 2JQKA 4K0UA 3AAIA 5L4EA 4MALA 5ETWA 1SUMB 2LJLA 2V8SV 4J2CA 4ZHQE 4DV5T 4G63A 1BR2A 1YKEB 2XSBA 3AEBA 3GWHA 3TLWA 3AA1B 1D1BA 2KSRA 2YK0A 4E7ZA 1OWAA 3WAJA 1KNZA 2K48A 2XJ7A 4JI8T 3EVYA 1N36T 3N9PA 2JMKA 5HXEA 4HWDA 4OK0A 4U3CA 4ASKA 2IUBA 5AQQB 3RKGA 3AEDA 5JH7E 1UURA 2LSIA 2IMLA 3DP7A 4LFBT 2W67A 4I4TE 4KHZF 3UU6A 4JI0T 2D9DA 2V7LA 2PFVA 1XNQT 1FIOA 3LK42 2QRXA 3KVAA 4LMKA 3UUXB 3Q5EA 5LJNA 3ZSSA 1HR0T 3ZT6A 1HX1B 2RP4A 3FZKB 3UULA 2DLRA 3N2KE 5KXJA 1XNRT 5AFUL 1UX5A 2YN6A 3M3ZB 2C5JA 3NKZA 4IDNA 2HN2A 4TUYE 5AQPB 2D0TA 4CXWA 4ZI7E 2LHNA 5LGUB 2VKHA 2MPKA 4I55E 3NZPA 1E2AA 2WM9A 4NXNT 3H37A 2A9UA 2LM9A 3PUWF 4UVBB 4WZXA 3PUGA 4X20E 4AKLA 3AE4A 4BJNA 1MIYA 4HFHA 1J5ET 3A5XA 3KV5A 1Y01A 3OYXA 2JPFA 2E9XC 3C4XA 4X1KE 5LG3A 3RPUA 2BS4A 5AQSB 4HTEA 4YXDA 4PAGA 2PJQA 4U7YA 4HE8A 2EHOA 3FXEB 4AKRB 4YTPA 5LNKA 3QB5K 2UU9T 1N32T 2N1GA 5ABHA 4TN7B 2XM2A 1FJGT 3TKLB 3ZMSB 3ZYKA 4DR4T 2A72A 2H88A 2OLTA 1D1CA 2XQYA 4IL9A 5J2UE 1IJ6A 2J47A 2WMNA 3AE1A 3QNUA 3JCFA 4WW0A 4QXBB 2UXCT 2YEVC 4YSYA 3L09A 2X9XA 2A3DA 3C4ZA 4IE0A 2CWOA 2P9BA 2Y6XA 4O8SA 4QH4A 3HKDE 2QA7A 2YDQA 4ZOLE 4L0RA 1NENA 3ZSTA 4UF0A 5JDNA 5M4YA 5C3JA 4JI3T 5CB4E 2D0UA 4LFCT 5AQMB 4DV6T 1IBLT 4A97A 4PFOA 3I1AA 2WY2A 4UF0B 5ABFB 5EK2A 5LB7B 3SFEA 2X51A 2CM0A 2HPLA 1W9RA 3G06A 3PUAA 3RYFE 3VR8A 4YHHT 1XDPA 4EV6A 5L3CB 2XUEA 2E8IA 2WMOA 3K1SA 4KI0F 4DV7T 2JRKA 4WBOA 2BS3A 2CWYA 4KUMB 4I0UA 3ZN1B 4DV1T 2V5DA 1ZKEA 1YQ4A 2LEHA 1W09A 2LM2A 2M6BA 2X0LB 3P7IA 5AQVB 2X0HA 2IIUA 1N33T 3I0QA 2W63A 2MOZA 3NRYA 3RYCE 3BQIA 3EDUA 2C5IT 1VOMA 3ONLC 4B3ST 3HKBE 4MFRA 4QX8B 3LG7A 1IJ5A 3F2EA 1M62A 2WZHA 2CHOA 3MJXA 4O4LE 2FJAA 4PFPA 3UU3A 2CE7A 2LSGA 3F57A 5J2TE 1VRBA 4E7SA 4TWHA 2QYWA 4AQYT 3CPZA 1HX8A 3L3PA 4PJNA 1CHUA 5FL0A 1MIWA 2XQ7A 3TLSA 2K3WA 3AEGA 2LRLA 3B13A 2VQFT 3BK9A 2I0MA 1ZOYA 4GIWA 4EB6E 1UCUA 1MIVA 3UU5A 2CBJA 2HPJA 4ZI2C 2F4VT 4PJMA 3I9YA 5C8YE 2BDEA 2CXFA 4GKKT 2ACXA 1IAPA
chains in the Genus database with same CATH topology
5JVDE 3OKQA 2HH7A 2LSYA 4CXXA 5LG4A 1Z0PA 4UEMA 3GA8A 3PU3A 4AQGA 3P8CD 2EHOB 3MK7C 5FMNA 4EIWA 2L8KA 1V9DA 1BR1A 3CVRA 3PUQA 3SOLA 5FNVE 4ERRA 2E9XB 4XZCA 2CLYC 3LBXA 5DQVA 1D0YA 2UXXB 1HFAA 3SWHA 3RC3A 1SA0E 3N9MA 5JR9C 2XAQB 2BVMA 3FBLA 4DMVA 2Q9QD 4H63H 3JC6C 4YJ3E 3UT5E 3B57A 3MZKB 3ZPOA 1D0XA 3HL6A 2VL8A 1YW0A 2A2FX 2W00A 3HKCE 2JJ9A 3MXZA 4IE5A 5LJMA 4I50E 2OA5A 3NRXA 4BAYB 2YU1A 3UUNA 4CI3B 4ANJA 3RX6A 4YJ2E 2H3RA 4M1PA 4QX7B 3ZN0B 2V1DB 3FB2A 5JDGA 2B1EA 2NOXA 4IDZA 2DCFA 1FMWA 4GOUA 5EZYE 3MACA 5HXHA 3E0ZA 2V7MA 3PDYA 2LOSA 4O4IE 3AAEB 2YINA 4NUUA 5FP3A 3CQXC 2SPCA 4OYJA 4JEHB 4F6RC 1KK7A 3ANWA 2ZM0A 4AQFA 2Q9QA 2WBLA 4PNIA 5L2LA 2W61A 4DNDA 5JDLA 1H7CA 3LK2B 1T98A 2XHEB 3KBUA 2MTQA 1LKXA 2CEAA 4L9IA 3EUHA 4H9NC 4AKGA 5FXVA 2KNDA 5L3DB 2VASA 3T8OA 4AKHA 2N9DA 1LRZA 3BQKA 2XAFB 1QSDA 4PW8A 5CA1E 2Q9QB 3IEEA 5H6QB 3ANWB 5FXXA 3FHNA 1HG5A 3K3NA 1HS7A 5ADXL 2CCQA 4U74A 3PE0A 4GK5E 1FEWA 3Q9DA 4EZ4A 3PURA 1LVFA 4AQFC 3LFMA 3N2GE 4O4HE 3U3IA 3GN5A 4OYKA 4CQIA 4OFZA 4H9PC 1UX4A 4UELA 2NTYA 4B6XA 1QUUA 3CWZB 3I9WA 4CI1B 5KMGP 2NW7A 4PK4A 5LBMA 3CQCB 2BVLA 5EK4A 4IHJE 3VKGA 2DWGA 5DJQC 2X9HA 4HEAA 1Y64B 4PK6A 3C51A 4MHCA 2ZLYA 1YD8G 3PUSA 1HF8A 4DMWA 2PBIA 2V7IA 3D0TA 3CKDA 2DHRA 3SS1A 3OJAA 4P09A 1HG2A 2L9QA 5JDFA 3ESLA 2Z6EA 3K3QC 1HTJF 2CXDA 4CZZB 3BQLA 4O4JE 3NBXX 3ETUA 3QC9A 3ZMZB 3M65A 2NW9A 2XAJB 3FBZA 3KVBA 4NUVA 3F31A 4JEUB 5LXTE 4MBQA 1B7TA 2KZ7B 3DJBA 5CA0E 3PTRB 2QGSA 3E22E 2IC9A 4GYSA 4BA9A 4ZS2A 1FMVA 1ZV4X 2XAHB 3VKHA 3LK3B 4UV8B 4C90A 3N9QA 2I59A 3O1HA 3AAAB 5LBQB 2K9AA 3FXDB 3R6NA 5L3BB 3LJCA 3RYHE 2JQQA 4EYUA 1NAFA 2RA1A 5DABA 3KV9A 5HWYA 3ZCIA 1E1HB 2ZM2A 2XAGB 2DNXA 2LSJA 4ZI3C 2NWBA 2UXNB 4H9RC 4N78D 2XTLA 1SHZC 3RH3A 4C91A 4CXYA 2CA5A 4XAXB 4DBRA 3WAKA 4KMCA 1NWMX 3RRWA 4P0AA 2VK9A 2Y8DA 4QWNB 4YLHA 4DBQA 3AB3B 2KWHA 4ZS3A 5HXSA 3KINB 4EAHA 2KMFA 4Z8XA 2GK9A 2ODVA 5BMVE 2BZBA 5FY7A 4UVAB 3U78A 2ES0A 4A56A 1ZEEA 3KBTA 5LGNB 5HXRA 2W62A 2NTXA 3N9LA 3SRZA 3QUJA 2KT9A 1MMGA 5F8PA 5LA6E 3C98B 2K24A 5LCYA 4ADZA 2CMRA 5KDMC 4QHOA 3K8PC 4PJLA 3RKOA 4PJJA 4FI5A 2EHOC 5L3EB 2E9XD 2KWIB 2JMHA 2LHRA 3O1IA 2V7KA 4BJMA 5L3GB 3MA9A 5J1GA 3C4WA 3I0OA 3ZCJA 3HI2A 4L5GA 4UIGA 4H63V 4O2AE 1MMNA 4DVDA 1MMDA 4KP3C 3CX7B 5FY0A 5FXWA 5JREA 4AI6A 3N9NA 4X1YE 4TV8E 4WNKA 2KXPB 4HGAA 2G0UA 2H7VC 4EZHA 4CI2B 3Q2MA 2KINB 2KLQA 3KDSE 4TZ4C 2X67A 4O2BE 5JR9B 4EXTA 2VWAA 5GONE 2Q9QC 4X1IE 4HFVA 1D1AA 2C0SA 1HCIA 3V5UA 4OHFA 4IGUA 5JR9A 3O4XE 5JDQA 1LVKA 1U5PA 2CLYB 4AKIA 1D0ZA 3MKDA 4WBNE 4HN9A 3ZC1A 1EZ3A 2J1DG 5DQWA 4GK0E 4QXCB 3KV4A 5LP6E 3HKEE 5JRCB 2E9XA 3N2OA 3DTOA 2V26A 4PK5A 3IHRA 3J9X1 3UTKA 2X9YA 3C64A 2M67A 2NW8A 3ZEFB 2XASB 5HXCA 1AJ3A 2IW5B 2MBGA 3UUMA 5H6RB 3ZMUB 2WAUA 3HA4A 3UFEA 2PG8A 4H9SE 3C50A 1MNEA 3K3OA 4UV9B 4G2AA 4QXHB 4V1Av 3ZJ2A 2WSSV 3AVRA 5EK3A 3ZYMA 3ZC0A 2MYSA 3GMIA 2Y48B 5JDMA 4U72A 2EHOD 2W0GA 3ZYLA 2L3LA 5HWXA 1S35A 1S94A 1MNDA 1U4QA 4YFSA 3ZMVB 3EDVA 1G73A 5FXZA 4DO0A 4H9QC 3RC8A 4IE4A 3RYIE 3ZMTB 3V5SA 3CX6B 4TV9E 4EYYR 1BR0A 2IAKA 2X9WA 2LOPA 1IZNB 3H3AA 5LHIB 4JLEA 3J7Yq 1X79A 4ISTA 3KV6A 2LT3A 2WWUA 4UXNB 2DWKA 4EOZB 3CQGB 2H7OA 2VKOA 5LHHB 3VHLA 1OXZA 3R84B 3Q5XA 2C5KT 5FY1A 3KFWX 3Q5WA 5HAXA 2D5UA 3GN5B 1CUNA 4TX5A 5F3JA 1YKHB 4IE7A 3RRCA 5LHGB 3ETVA 3S4UA 2NP9A 3LBXB 1US7B 2CXLA 5LGTB 3PU8A 2LE8A 2LSKA 4P0BA 4ISSA 5HYAA 3O1JA 2VB6A 4I43B 3ZLIA 4ZI2D 5E0OA 4IE6A 1MMAA 1ZHCA 1WRDA 3QK6A 5A1LA 3IF8B 2DI4A 3ZJ1A 3NZQA 5KX5E 2ODUA 3CMLA 3AA7B 4HKAA 5FYMA 1WLXA 1WYCA 4MLKA 5LYJE 1WYBA 2IC6A 2V7JA 3W15B 3E08A 4QKNA 5TAOA 3O9XA 5JDHA 4ZI3D 4UVCB 5JQGE 4ILUA 1BR4A 5IYZE 3WI3A 3N9OA 4H9OC 3JC6D 5LOVE 1G8XA 2N2NA 2ZMAA 4GYRA 4FJOA 4KBMB 3AA0B 5L3FB 3AVSA 2YU2A 2K5BB 2ZM8A 4IIJE 2X68A 3N5LA 3OBVE 3ONXA 2VKJA 3HR0A 2D2SA 3AA6B 3OYZA 4YHJA 5IHYA 2X66A 3VU7H 4AXPA 4XBFB 1O3XA 2VKDA 3CX8B 1WR6A 4JUYA 3IBPA 4K0UA 3AAIA 4MALA 5ETWA 2LJLA 4J2CA 4ZHQE 4G63A 1BR2A 1YKEB 3GWHA 3AA1B 1D1BA 2YK0A 4E7ZA 3WAJA 1OWAA 1KNZA 2K48A 3EVYA 3N9PA 2JMKA 5HXEA 4OK0A 4ASKA 5JH7E 2LSIA 3DP7A 4I4TE 2V7LA 2PFVA 1FIOA 3LK42 3KVAA 3UUXB 5LJNA 2RP4A 3UULA 2DLRA 3N2KE 5AFUL 1UX5A 4TUYE 2C5JA 4ZI7E 2D0TA 4CXWA 5LGUB 2LHNA 2VKHA 4I55E 3NZPA 2WM9A 3H37A 4BJNA 2LM9A 4UVBB 4X20E 3PUGA 4AKLA 1MIYA 3A5XA 3KV5A 3OYXA 2JPFA 2E9XC 3C4XA 4X1KE 3RPUA 4HTEA 4PAGA 2PJQA 4HE8A 2EHOA 3FXEB 4AKRB 5LNKA 2N1GA 4TN7B 3TKLB 3ZMSB 3ZYKA 2A72A 1D1CA 2XQYA 5J2UE 1IJ6A 2WMNA 5JRCA 4WW0A 4QXBB 2YEVC 3L09A 2X9XA 2A3DA 3C4ZA 4IE0A 2CWOA 2P9BA 2Y6XA 4O8SA 4ZOLE 3HKDE 2QA7A 5JDNA 4L0RA 4UF0A 5M4YA 5CB4E 2D0UA 4PFOA 3I1AA 4UF0B 5EK2A 2X51A 2CM0A 2HPLA 3PUAA 3RYFE 5L3CB 2XUEA 2E8IA 2WMOA 2JRKA 4WBOA 2CWYA 4KUMB 3ZN1B 1ZKEA 2LEHA 2X0LB 3P7IA 3I0QA 2W63A 2MOZA 3NRYA 3RYCE 3BQIA 3EDUA 2C5IT 1VOMA 3HKBE 4MFRA 4QX8B 3LG7A 1IJ5A 3F2EA 3MJXA 4O4LE 4PFPA 2CE7A 2LSGA 3F57A 5J2TE 1VRBA 4E7SA 3CPZA 1HX8A 3L3PA 4PJNA 1MIWA 3B13A 3BK9A 4GIWA 4EB6E 1UCUA 1MIVA 4ZI2C 2HPJA 4PJMA 3I9YA 5C8YE 2BDEA 2CXFA 2ACXA 1IAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOZ A;  2M67 A; 
#chains in the Genus database with same CATH topology
 1VCS A;  3RF1 A;  5JVD E;  3FZL B;  2HH7 A;  2LSY A;  3OKQ A;  4LML A;  4QH1 A;  5F5W A;  4CXX A;  5LG4 A;  1Z0P A;  4IL4 A;  4UEM A;  3GA8 A;  3PU3 A;  1QLB A;  5ABE A;  4AQG A;  3P8C D;  2EHO B;  3MK7 C;  5FMN A;  4HWC A;  1OED A;  4EIW A;  4UR9 A;  2WQY A;  2L8K A;  1V9D A;  1BR1 A;  3CVR A;  3PUQ A;  4DR6 T;  3NVO A;  5FNV E;  3SOL A;  2E9X B;  4XZC A;  3UU4 A;  4ERR A;  2CLY C;  4Z91 A;  4X66 T;  3LBX A;  3FZH B;  4DR2 T;  5HEH A;  4YTN A;  5DQV A;  1D0Y A;  2UXX B;  1HFA A;  3ONJ A;  3QB5 A;  3SWH A;  3RC3 A;  1SA0 E;  2UUA T;  5ABG A;  3N9M A;  2YDR A;  1IBK T;  5JR9 C;  2XAQ B;  3T1Y T;  2BVM A;  4CN4 A;  3FBL A;  4DMV A;  2Q9Q D;  2HHH T;  4H63 H;  5HCJ A;  3JC6 C;  4YJ3 E;  3UT5 E;  2XQA A;  3B57 A;  3MZK B;  3ZPO A;  1D0X A;  1WR0 A;  2V6Y A;  3HL6 A;  2VL8 A;  1YW0 A;  2A2F X;  2VL0 A;  2W00 A;  2JJ9 A;  2X0Y A;  2XQ8 A;  3HKC E;  3MXZ A;  3Q5D A;  4IE5 A;  4I50 E;  2OA5 A;  4ILC A;  4YTM A;  3RI5 A;  2W66 A;  3NRX A;  3EAB A;  4BAY B;  2YU1 A;  3UUN A;  1W0A A;  2UXB T;  4HFB A;  4A98 A;  2CPT A;  4CI3 B;  3AE9 A;  5IUX A;  2WDQ A;  4ANJ A;  2JIW A;  3RX6 A;  4HFD A;  4YJ2 E;  5CFB A;  2H3R A;  4TWF A;  4M1P A;  1UK5 A;  2V5C A;  3AEC A;  4QX7 B;  4WYV A;  3ZN0 B;  2V1D B;  2BKN A;  3AEF A;  1UGO A;  3FB2 A;  2B1E A;  5JDG A;  2NOX A;  4IDZ A;  2W2U A;  2DCF A;  1FMW A;  4JI1 T;  4GOU A;  5EZY E;  1OED E;  3MAC A;  5HXH A;  3CIR A;  3E0Z A;  2V7M A;  3FZF B;  3PDY A;  3P4P A;  2LOS A;  4KX6 A;  4O4I E;  4Z90 A;  3AAE B;  2YIN A;  3OPC A;  4NUU A;  5FP3 A;  3CQX C;  2VQE T;  2LKH A;  1GQE A;  4EED A;  2YDS A;  4DUZ T;  1J5W A;  3AEE A;  4OX9 T;  2SPC A;  2XQ4 A;  4OYJ A;  4JEH B;  4F6R C;  4DR3 T;  1KK7 A;  3ANW A;  4NPP A;  4LFA T;  2ZM0 A;  4AQF A;  2Q9Q A;  2WBL A;  4PNI A;  5AQF B;  5L2L A;  2W61 A;  2AE9 A;  4DND A;  5JDL A;  1H7C A;  4B3R T;  4TWD A;  3UUB A;  1E7P A;  3LK2 B;  5AQO B;  1T98 A;  4HFE A;  3PV0 F;  2XHE B;  3KBU A;  2MTQ A;  1LKX A;  2CEA A;  5AQK B;  3UU8 A;  5FKY A;  4AIU A;  4L9I A;  3EUH A;  4H9N C;  2VUR A;  4AKG A;  4ZXL A;  5FXV A;  2KND A;  5L3D B;  2VAS A;  4U31 A;  3T8O A;  2WWV A;  3VRA A;  4AKH A;  4DR5 T;  2LKG A;  2N9D A;  1LRZ A;  3BQK A;  2E5V A;  1SE7 A;  1QSD A;  2XAF B;  4PW8 A;  2Q9Q B;  5CA1 E;  2UUB T;  3IEE A;  1DU2 A;  5H6Q B;  3ANW B;  5FXX A;  3FHN A;  1HG5 A;  3K3N A;  3RHW A;  1HS7 A;  1HNZ T;  2CHN A;  2WU5 A;  5ADX L;  4DV4 T;  2CCQ A;  4U74 A;  3PE0 A;  4JI2 T;  4GK5 E;  4LF7 T;  1FEW A;  3Q9D A;  4EZ4 A;  4JI7 T;  3PUR A;  1LVF A;  4X62 T;  4AQF C;  3LFM A;  3N2G E;  4O4H E;  3U3I A;  5CJ5 A;  4A5X A;  3GN5 A;  3AEA A;  3VRB A;  3OVU A;  3UQ7 A;  4OYK A;  4CQI A;  1UUS A;  4K0K T;  4OFZ A;  4H9P C;  1UX4 A;  4UEL A;  2NTY A;  4B6X A;  2VVN A;  1QUU A;  3CWZ B;  3I9W A;  4IDQ A;  4CI1 B;  3P4Q A;  5ABF A;  5KMG P;  2NW7 A;  4PK4 A;  5LBM A;  3CQC B;  4JI6 T;  4ZZB A;  2BVL A;  5EK4 A;  4IHJ E;  5JRC A;  2PTF A;  3VKG A;  2DWG A;  5DJQ C;  2X9H A;  4U2Y A;  4HEA A;  3UFG A;  1Y64 B;  3AXJ B;  4LF9 T;  4PK6 A;  3C51 A;  4MHC A;  2I6H A;  2ZLY A;  3A8Y C;  1YD8 G;  3PUS A;  3V5U A;  1HF8 A;  2YKS A;  2XQ5 A;  2PBI A;  2V7I A;  3ABV A;  4DMW A;  3D0T A;  3CKD A;  2DHR A;  2XSA A;  3SS1 A;  5CGM A;  3OJA A;  4P09 A;  4GKJ T;  1HG2 A;  2L9Q A;  5JDF A;  5L47 A;  3ESL A;  2Z6E A;  3K3Q C;  1HTJ F;  1XMO T;  1I6Z A;  3ZKR A;  2CXD A;  4CZZ B;  3BQL A;  4O4J E;  5J0Z A;  3NBX X;  3ETU A;  4EEB A;  2XPK A;  3QC9 A;  2CBI A;  3ZMZ B;  3M65 A;  3RLF F;  2NW9 A;  2XAJ B;  3FBZ A;  3KVB A;  4NUV A;  3F31 A;  4JI4 T;  4JEU B;  2V6Y B;  5LXT E;  2WCA A;  4MBQ A;  1KF6 A;  1B7T A;  2KZ7 B;  3DJB A;  3TLV A;  5CA0 E;  3PTR B;  2QGS A;  2JQH A;  2IC9 A;  3E22 E;  4GYS A;  4ZS2 A;  4BA9 A;  1HNX T;  1FMV A;  5AQI B;  1ZV4 X;  2XAH B;  3VKH A;  1T7S A;  3LK3 B;  4UV8 B;  4C90 A;  3N9Q A;  2I59 A;  3O1H A;  3AAA B;  3PJA J;  3PUX F;  2K9A A;  5LBQ B;  4HFI A;  1KNP A;  3FXD B;  3RGL A;  4HFC A;  3RIF A;  2JQ9 A;  2DL1 A;  2WDV A;  3R6N A;  3TLU A;  5L3B B;  3LJC A;  5JTG A;  3RYH E;  2JQQ A;  4EYU A;  1I94 T;  2MAW A;  2BKP A;  2YOE A;  1NAF A;  2XQ3 A;  2RA1 A;  3PJA A;  5DAB A;  1XDO A;  3KV9 A;  3L8R A;  5HWY A;  1E1H B;  2ZM2 A;  2XAG B;  3ZCI A;  3RIU C;  2DNX A;  2LSJ A;  4ZI3 C;  2NWB A;  2UXN B;  4H9R C;  4N78 D;  2XTL A;  1SHZ C;  3RH3 A;  4C91 A;  4CXY A;  2CA5 A;  4XAX B;  4CN1 A;  2XM1 A;  4DBR A;  3WAK A;  4KMC A;  1NWM X;  4JYA T;  4IDO A;  3RRW A;  2UXD T;  4P0A A;  3PUZ F;  2VK9 A;  2Y8D A;  4QWN B;  3RQU A;  2UUC T;  1VCT A;  4YLH A;  4DBQ A;  3AB3 B;  2KWH A;  3P4S A;  4TNW A;  4ZS3 A;  5HXS A;  3KIN B;  4DR7 T;  4HWF A;  4EAH A;  2KMF A;  4Z8X A;  2H89 A;  2GK9 A;  2ODV A;  4U2Z A;  5BMV E;  2BZB A;  5FY7 A;  4UVA B;  3U78 A;  2ES0 A;  3JAD A;  4A56 A;  1ZEE A;  2FJE A;  2WDR A;  2XY8 B;  3KBT A;  5LGN B;  5HXR A;  2W62 A;  3A7M A;  4DV3 T;  2NTX A;  3N9L A;  3PUV F;  1IBM T;  4P1N A;  2WU2 A;  3SRZ A;  3JAF A;  3QUJ A;  1WFD A;  2KT9 A;  2BBH A;  5LMN T;  1MMG A;  2W4X A;  5F8P A;  3RQW A;  2BKO A;  2M6I A;  2B76 A;  5LA6 E;  3EAM A;  3C98 B;  5HEG A;  2K24 A;  5LCY A;  1L0V A;  2CMR A;  4ADZ A;  5KDM C;  4LF4 T;  4QHO A;  3K8P C;  4PJL A;  3RKO A;  4PJJ A;  4FI5 A;  2EHO C;  4EGW A;  5L3E B;  4X65 T;  2E9X D;  2KWI B;  5HEO A;  3SFD A;  2JMH A;  2LHR A;  3O1I A;  2V7K A;  4BJM A;  5L3G B;  3MA9 A;  5J1G A;  3P4W A;  3C4W A;  3I0O A;  3ZCJ A;  3HI2 A;  4L5G A;  4UIG A;  2V6X A;  4AIS A;  4H63 V;  4O2A E;  1MMN A;  4QH5 A;  4DVD A;  1MMD A;  3P4R A;  3CX7 B;  3IA3 A;  4ILB A;  4KP3 C;  3RIA A;  5FY0 A;  5FXW A;  5JRE A;  4AI6 A;  3N9N A;  2WB5 A;  3B5M A;  4X1Y E;  4TV8 E;  4DV2 T;  5AQG B;  4WNK A;  5AQN B;  2KXP B;  2QVA A;  4HGA A;  2G0U A;  2H7V C;  2XQ6 A;  4CI2 B;  3Q2M A;  2KIN B;  3CK6 A;  4EZH A;  2KLQ A;  3KDS E;  4U33 A;  4TZ4 C;  2X67 A;  4O2B E;  5JR9 B;  4EXT A;  2VWA A;  5GON E;  2LRK A;  2Q9Q C;  1X9B A;  4HFV A;  4X1I E;  3ZT5 A;  1T8B A;  1D1A A;  1HCI A;  2C0S A;  4OHF A;  1XZY A;  4IGU A;  3O4X E;  5AQJ B;  1M7K A;  1LVK A;  5JR9 A;  1U5P A;  2CLY B;  4JBW F;  4DR1 T;  5L4H A;  5FL1 A;  1HNW T;  4AKI A;  1D0Z A;  3MKD A;  2FJB A;  4WBN E;  4HN9 A;  3ZC1 A;  1EZ3 A;  2J1D G;  5DQW A;  4GK0 E;  4NXM T;  4QXC B;  3KV4 A;  3RIU A;  5LP6 E;  1YXR A;  5JDQ A;  2BG9 B;  3EHZ A;  2WP9 A;  3HKE E;  2WS3 A;  5JRC B;  2E9X A;  3N2O A;  4COF A;  3DTO A;  2V26 A;  4PK5 A;  3IHR A;  3JAE A;  3J9X 1;  5AQH B;  2BG9 A;  1XWM A;  2X9Y A;  3C64 A;  3NWI A;  5AQU B;  3UTK A;  5C2T A;  2M67 A;  2NW8 A;  4ZZC A;  3ZEF B;  4LF8 T;  2XAS B;  1Z8U A;  2BG9 E;  5HXC A;  1AJ3 A;  2IW5 B;  2MBG A;  3UUM A;  5H6R B;  3ZMU B;  2WAU A;  3HA4 A;  3UFE A;  4YSZ A;  2PG8 A;  4H9S E;  3C50 A;  3AE2 A;  1MNE A;  3K3O A;  4UV9 B;  4G2A A;  4QXH B;  4V1A v;  3ZJ2 A;  2WSS V;  3AVR A;  5EK3 A;  3ZYM A;  1KEY A;  3EI0 A;  2MYS A;  3GMI A;  3ZC0 A;  2Y48 B;  5JDM A;  4U72 A;  2EHO D;  3ZT7 A;  1J1J A;  3OTO T;  2RPA A;  4F8H A;  2W0G A;  3ZYL A;  2CRB A;  2L3L A;  5FVL A;  5HWX A;  1S35 A;  1W0B A;  4HWH A;  1S94 A;  1MND A;  1U4Q A;  2HN1 A;  2IDO B;  4YFS A;  3ZMV B;  3AE6 A;  2LLY A;  1G73 A;  3EDV A;  5FXZ A;  1OED B;  2OV9 A;  2ACZ A;  4DO0 A;  1N34 T;  1XMQ T;  1ZP0 A;  3L39 A;  1KNR A;  4H9Q C;  3RC8 A;  3AE8 A;  4HWI B;  3UQ4 A;  2NR4 A;  4IE4 A;  3RYI E;  3ZMT B;  4X64 T;  4U7I A;  3V5S A;  2FBW A;  3CX6 B;  2XQ9 A;  4TV9 E;  1YQ3 A;  4EYY R;  5AQR B;  1BR0 A;  2IAK A;  4DUY T;  2X9W A;  2LOP A;  1IZN B;  3H3A A;  5LHI B;  4JLE A;  3J7Y q;  4LF5 T;  4ILA A;  4JV5 T;  5HEU A;  2BS2 A;  1X79 A;  4IST A;  4YY3 T;  3KV6 A;  4NIQ A;  3PUY F;  4LF6 T;  2LT3 A;  2WWU A;  4UXN B;  2DWK A;  4LMJ A;  3AE3 A;  4EOZ B;  3CQG B;  4X5T A;  1R8I A;  2H7O A;  2FUP A;  2VKO A;  1JNR A;  5LHH B;  3VHL A;  1OXZ A;  3R84 B;  3Q5X A;  5LJM A;  2C5K T;  5FY1 A;  3QOF A;  3KFW X;  3H3M A;  3Q5W A;  1WCR A;  3TLT A;  4ZEY A;  5HAX A;  4B3M T;  5FVK A;  2D5U A;  3GN5 B;  1CUN A;  1T72 A;  4TX5 A;  1YKH B;  4IE7 A;  3FZM B;  3RRC A;  3LDQ B;  3P50 A;  5F3J A;  5LHG B;  2BBJ A;  3ETV A;  3S4U A;  2NP9 A;  3LBX B;  1US7 B;  2CXL A;  5LGT B;  4IDP A;  3PU8 A;  2LE8 A;  2LSK A;  4IT4 A;  4P0B A;  4ISS A;  1KFY A;  3O1J A;  5HYA A;  2AXD S;  5HCM A;  2VB6 A;  4I43 B;  3ZLI A;  4ZI2 D;  5E0O A;  5IWA T;  4IE6 A;  1MMA A;  4CN6 A;  4JI5 T;  1ZHC A;  5AQT B;  1WRD A;  2XZE A;  3QK6 A;  5A1L A;  3IF8 B;  2DI4 A;  4YT0 A;  2IHR 1;  1JNZ A;  3ZJ1 A;  2R6G F;  3NZQ A;  5KX5 E;  3LSV A;  2ODU A;  3CML A;  2E5L T;  3AA7 B;  4YSX A;  4HKA A;  5FYM A;  1WLX A;  4DID B;  1WYC A;  4MLK A;  5LYJ E;  1WYB A;  2IC6 A;  2V7J A;  3W15 B;  2J4G A;  1OED C;  1NEK A;  3E08 A;  4Q25 A;  4QKN A;  5TAO A;  3O9X A;  4B3T T;  4IRE A;  5JDH A;  2ZM6 T;  4DV0 T;  4ZI3 D;  4UVC B;  5JQG E;  4ILU A;  4KHP T;  1BR4 A;  5IYZ E;  5AQL B;  3WI3 A;  2FJD A;  3N9O A;  3JC6 D;  4H9O C;  5LOV E;  1G8X A;  5BR8 T;  2N2N A;  2J62 A;  2ZMA A;  3AXJ A;  5HEJ A;  4GYR A;  3AE5 A;  4FJO A;  4KBM B;  3AA0 B;  5L3F B;  3AVS A;  2YU2 A;  2K5B B;  2VVS A;  2ZM8 A;  4IIJ E;  5LMU T;  2X68 A;  3N5L A;  3AE7 A;  3OBV E;  3ONX A;  3T1H T;  2VKJ A;  3HR0 A;  2D2S A;  3VR9 A;  3AA6 B;  3OYZ A;  4YHJ A;  5IHY A;  2E2A A;  2X66 A;  2WZI A;  3VU7 H;  3X1D A;  4AXP A;  4XBF B;  1O3X A;  4TNV A;  2VKD A;  3CX8 B;  1WR6 A;  2BG9 C;  4JUY A;  3IBP A;  2JQK A;  4K0U A;  3AAI A;  5L4E A;  4MAL A;  5ETW A;  1SUM B;  2LJL A;  2V8S V;  4J2C A;  4ZHQ E;  4DV5 T;  4G63 A;  1BR2 A;  1YKE B;  2XSB A;  3AEB A;  3GWH A;  3TLW A;  3AA1 B;  1D1B A;  2KSR A;  2YK0 A;  4E7Z A;  1OWA A;  3WAJ A;  1KNZ A;  2K48 A;  2XJ7 A;  4JI8 T;  3EVY A;  1N36 T;  3N9P A;  2JMK A;  5HXE A;  4HWD A;  4OK0 A;  4U3C A;  4ASK A;  2IUB A;  5AQQ B;  3RKG A;  3AED A;  5JH7 E;  1UUR A;  2LSI A;  2IML A;  3DP7 A;  4LFB T;  2W67 A;  4I4T E;  4KHZ F;  3UU6 A;  4JI0 T;  2D9D A;  2V7L A;  2PFV A;  1XNQ T;  1FIO A;  3LK4 2;  2QRX A;  3KVA A;  4LMK A;  3UUX B;  3Q5E A;  5LJN A;  3ZSS A;  1HR0 T;  3ZT6 A;  1HX1 B;  2RP4 A;  3FZK B;  3UUL A;  2DLR A;  3N2K E;  5KXJ A;  1XNR T;  5AFU L;  1UX5 A;  2YN6 A;  3M3Z B;  2C5J A;  3NKZ A;  4IDN A;  2HN2 A;  4TUY E;  5AQP B;  2D0T A;  4CXW A;  4ZI7 E;  2LHN A;  5LGU B;  2VKH A;  2MPK A;  4I55 E;  3NZP A;  1E2A A;  2WM9 A;  4NXN T;  3H37 A;  2A9U A;  2LM9 A;  3PUW F;  4UVB B;  4WZX A;  3PUG A;  4X20 E;  4AKL A;  3AE4 A;  4BJN A;  1MIY A;  4HFH A;  1J5E T;  3A5X A;  3KV5 A;  1Y01 A;  3OYX A;  2JPF A;  2E9X C;  3C4X A;  4X1K E;  5LG3 A;  3RPU A;  2BS4 A;  5AQS B;  4HTE A;  4YXD A;  4PAG A;  2PJQ A;  4U7Y A;  4HE8 A;  2EHO A;  3FXE B;  4AKR B;  4YTP A;  5LNK A;  3QB5 K;  2UU9 T;  1N32 T;  2N1G A;  5ABH A;  4TN7 B;  2XM2 A;  1FJG T;  3TKL B;  3ZMS B;  3ZYK A;  4DR4 T;  2A72 A;  2H88 A;  2OLT A;  1D1C A;  2XQY A;  4IL9 A;  5J2U E;  1IJ6 A;  2J47 A;  2WMN A;  3AE1 A;  3QNU A;  3JCF A;  4WW0 A;  4QXB B;  2UXC T;  2YEV C;  4YSY A;  3L09 A;  2X9X A;  2A3D A;  3C4Z A;  4IE0 A;  2CWO A;  2P9B A;  2Y6X A;  4O8S A;  4QH4 A;  3HKD E;  2QA7 A;  2YDQ A;  4ZOL E;  4L0R A;  1NEN A;  3ZST A;  4UF0 A;  5JDN A;  5M4Y A;  5C3J A;  4JI3 T;  5CB4 E;  2D0U A;  4LFC T;  5AQM B;  4DV6 T;  1IBL T;  4A97 A;  4PFO A;  3I1A A;  2WY2 A;  4UF0 B;  5ABF B;  5EK2 A;  5LB7 B;  3SFE A;  2X51 A;  2CM0 A;  2HPL A;  1W9R A;  3G06 A;  3PUA A;  3RYF E;  3VR8 A;  4YHH T;  1XDP A;  4EV6 A;  5L3C B;  2XUE A;  2E8I A;  2WMO A;  3K1S A;  4KI0 F;  4DV7 T;  2JRK A;  4WBO A;  2BS3 A;  2CWY A;  4KUM B;  4I0U A;  3ZN1 B;  4DV1 T;  2V5D A;  1ZKE A;  1YQ4 A;  2LEH A;  1W09 A;  2LM2 A;  2M6B A;  2X0L B;  3P7I A;  5AQV B;  2X0H A;  2IIU A;  1N33 T;  3I0Q A;  2W63 A;  2MOZ A;  3NRY A;  3RYC E;  3BQI A;  3EDU A;  2C5I T;  1VOM A;  3ONL C;  4B3S T;  3HKB E;  4MFR A;  4QX8 B;  3LG7 A;  1IJ5 A;  3F2E A;  1M62 A;  2WZH A;  2CHO A;  3MJX A;  4O4L E;  2FJA A;  4PFP A;  3UU3 A;  2CE7 A;  2LSG A;  3F57 A;  5J2T E;  1VRB A;  4E7S A;  4TWH A;  2QYW A;  4AQY T;  3CPZ A;  1HX8 A;  3L3P A;  4PJN A;  1CHU A;  5FL0 A;  1MIW A;  2XQ7 A;  3TLS A;  2K3W A;  3AEG A;  2LRL A;  3B13 A;  2VQF T;  3BK9 A;  2I0M A;  1ZOY A;  4GIW A;  4EB6 E;  1UCU A;  1MIV A;  3UU5 A;  2CBJ A;  2HPJ A;  4ZI2 C;  2F4V T;  4PJM A;  3I9Y A;  5C8Y E;  2BDE A;  2CXF A;  4GKK T;  2ACX A;  1IAP A; 
#chains in the Genus database with same CATH homology
 5JVD E;  3OKQ A;  2HH7 A;  2LSY A;  4CXX A;  5LG4 A;  1Z0P A;  4UEM A;  3GA8 A;  3PU3 A;  4AQG A;  3P8C D;  2EHO B;  3MK7 C;  5FMN A;  4EIW A;  2L8K A;  1V9D A;  1BR1 A;  3CVR A;  3PUQ A;  3SOL A;  5FNV E;  4ERR A;  2E9X B;  4XZC A;  2CLY C;  3LBX A;  5DQV A;  1D0Y A;  2UXX B;  1HFA A;  3SWH A;  3RC3 A;  1SA0 E;  3N9M A;  5JR9 C;  2XAQ B;  2BVM A;  3FBL A;  4DMV A;  2Q9Q D;  4H63 H;  3JC6 C;  4YJ3 E;  3UT5 E;  3B57 A;  3MZK B;  3ZPO A;  1D0X A;  3HL6 A;  2VL8 A;  1YW0 A;  2A2F X;  2W00 A;  3HKC E;  2JJ9 A;  3MXZ A;  4IE5 A;  5LJM A;  4I50 E;  2OA5 A;  3NRX A;  4BAY B;  2YU1 A;  3UUN A;  4CI3 B;  4ANJ A;  3RX6 A;  4YJ2 E;  2H3R A;  4M1P A;  4QX7 B;  3ZN0 B;  2V1D B;  3FB2 A;  5JDG A;  2B1E A;  2NOX A;  4IDZ A;  2DCF A;  1FMW A;  4GOU A;  5EZY E;  3MAC A;  5HXH A;  3E0Z A;  2V7M A;  3PDY A;  2LOS A;  4O4I E;  3AAE B;  2YIN A;  4NUU A;  5FP3 A;  3CQX C;  2SPC A;  4OYJ A;  4JEH B;  4F6R C;  1KK7 A;  3ANW A;  2ZM0 A;  4AQF A;  2Q9Q A;  2WBL A;  4PNI A;  5L2L A;  2W61 A;  4DND A;  5JDL A;  1H7C A;  3LK2 B;  1T98 A;  2XHE B;  3KBU A;  2MTQ A;  1LKX A;  2CEA A;  4L9I A;  3EUH A;  4H9N C;  4AKG A;  5FXV A;  2KND A;  5L3D B;  2VAS A;  3T8O A;  4AKH A;  2N9D A;  1LRZ A;  3BQK A;  2XAF B;  1QSD A;  4PW8 A;  5CA1 E;  2Q9Q B;  3IEE A;  5H6Q B;  3ANW B;  5FXX A;  3FHN A;  1HG5 A;  3K3N A;  1HS7 A;  5ADX L;  2CCQ A;  4U74 A;  3PE0 A;  4GK5 E;  1FEW A;  3Q9D A;  4EZ4 A;  3PUR A;  1LVF A;  4AQF C;  3LFM A;  3N2G E;  4O4H E;  3U3I A;  3GN5 A;  4OYK A;  4CQI A;  4OFZ A;  4H9P C;  1UX4 A;  4UEL A;  2NTY A;  4B6X A;  1QUU A;  3CWZ B;  3I9W A;  4CI1 B;  5KMG P;  2NW7 A;  4PK4 A;  5LBM A;  3CQC B;  2BVL A;  5EK4 A;  4IHJ E;  3VKG A;  2DWG A;  5DJQ C;  2X9H A;  4HEA A;  1Y64 B;  4PK6 A;  3C51 A;  4MHC A;  2ZLY A;  1YD8 G;  3PUS A;  1HF8 A;  4DMW A;  2PBI A;  2V7I A;  3D0T A;  3CKD A;  2DHR A;  3SS1 A;  3OJA A;  4P09 A;  1HG2 A;  2L9Q A;  5JDF A;  3ESL A;  2Z6E A;  3K3Q C;  1HTJ F;  2CXD A;  4CZZ B;  3BQL A;  4O4J E;  3NBX X;  3ETU A;  3QC9 A;  3ZMZ B;  3M65 A;  2NW9 A;  2XAJ B;  3FBZ A;  3KVB A;  4NUV A;  3F31 A;  4JEU B;  5LXT E;  4MBQ A;  1B7T A;  2KZ7 B;  3DJB A;  5CA0 E;  3PTR B;  2QGS A;  3E22 E;  2IC9 A;  4GYS A;  4BA9 A;  4ZS2 A;  1FMV A;  1ZV4 X;  2XAH B;  3VKH A;  3LK3 B;  4UV8 B;  4C90 A;  3N9Q A;  2I59 A;  3O1H A;  3AAA B;  5LBQ B;  2K9A A;  3FXD B;  3R6N A;  5L3B B;  3LJC A;  3RYH E;  2JQQ A;  4EYU A;  1NAF A;  2RA1 A;  5DAB A;  3KV9 A;  5HWY A;  3ZCI A;  1E1H B;  2ZM2 A;  2XAG B;  2DNX A;  2LSJ A;  4ZI3 C;  2NWB A;  2UXN B;  4H9R C;  4N78 D;  2XTL A;  1SHZ C;  3RH3 A;  4C91 A;  4CXY A;  2CA5 A;  4XAX B;  4DBR A;  3WAK A;  4KMC A;  1NWM X;  3RRW A;  4P0A A;  2VK9 A;  2Y8D A;  4QWN B;  4YLH A;  4DBQ A;  3AB3 B;  2KWH A;  4ZS3 A;  5HXS A;  3KIN B;  4EAH A;  2KMF A;  4Z8X A;  2GK9 A;  2ODV A;  5BMV E;  2BZB A;  5FY7 A;  4UVA B;  3U78 A;  2ES0 A;  4A56 A;  1ZEE A;  3KBT A;  5LGN B;  5HXR A;  2W62 A;  2NTX A;  3N9L A;  3SRZ A;  3QUJ A;  2KT9 A;  1MMG A;  5F8P A;  5LA6 E;  3C98 B;  2K24 A;  5LCY A;  4ADZ A;  2CMR A;  5KDM C;  4QHO A;  3K8P C;  4PJL A;  3RKO A;  4PJJ A;  4FI5 A;  2EHO C;  5L3E B;  2E9X D;  2KWI B;  2JMH A;  2LHR A;  3O1I A;  2V7K A;  4BJM A;  5L3G B;  3MA9 A;  5J1G A;  3C4W A;  3I0O A;  3ZCJ A;  3HI2 A;  4L5G A;  4UIG A;  4H63 V;  4O2A E;  1MMN A;  4DVD A;  1MMD A;  4KP3 C;  3CX7 B;  5FY0 A;  5FXW A;  5JRE A;  4AI6 A;  3N9N A;  4X1Y E;  4TV8 E;  4WNK A;  2KXP B;  4HGA A;  2G0U A;  2H7V C;  4EZH A;  4CI2 B;  3Q2M A;  2KIN B;  2KLQ A;  3KDS E;  4TZ4 C;  2X67 A;  4O2B E;  5JR9 B;  4EXT A;  2VWA A;  5GON E;  2Q9Q C;  4X1I E;  4HFV A;  1D1A A;  2C0S A;  1HCI A;  3V5U A;  4OHF A;  4IGU A;  5JR9 A;  3O4X E;  5JDQ A;  1LVK A;  1U5P A;  2CLY B;  4AKI A;  1D0Z A;  3MKD A;  4WBN E;  4HN9 A;  3ZC1 A;  1EZ3 A;  2J1D G;  5DQW A;  4GK0 E;  4QXC B;  3KV4 A;  5LP6 E;  3HKE E;  5JRC B;  2E9X A;  3N2O A;  3DTO A;  2V26 A;  4PK5 A;  3IHR A;  3J9X 1;  3UTK A;  2X9Y A;  3C64 A;  2M67 A;  2NW8 A;  3ZEF B;  2XAS B;  5HXC A;  1AJ3 A;  2IW5 B;  2MBG A;  3UUM A;  5H6R B;  3ZMU B;  2WAU A;  3HA4 A;  3UFE A;  2PG8 A;  4H9S E;  3C50 A;  1MNE A;  3K3O A;  4UV9 B;  4G2A A;  4QXH B;  4V1A v;  3ZJ2 A;  2WSS V;  3AVR A;  5EK3 A;  3ZYM A;  3ZC0 A;  2MYS A;  3GMI A;  2Y48 B;  5JDM A;  4U72 A;  2EHO D;  2W0G A;  3ZYL A;  2L3L A;  5HWX A;  1S35 A;  1S94 A;  1MND A;  1U4Q A;  4YFS A;  3ZMV B;  3EDV A;  1G73 A;  5FXZ A;  4DO0 A;  4H9Q C;  3RC8 A;  4IE4 A;  3RYI E;  3ZMT B;  3V5S A;  3CX6 B;  4TV9 E;  4EYY R;  1BR0 A;  2IAK A;  2X9W A;  2LOP A;  1IZN B;  3H3A A;  5LHI B;  4JLE A;  3J7Y q;  1X79 A;  4IST A;  3KV6 A;  2LT3 A;  2WWU A;  4UXN B;  2DWK A;  4EOZ B;  3CQG B;  2H7O A;  2VKO A;  5LHH B;  3VHL A;  1OXZ A;  3R84 B;  3Q5X A;  2C5K T;  5FY1 A;  3KFW X;  3Q5W A;  5HAX A;  2D5U A;  3GN5 B;  1CUN A;  4TX5 A;  5F3J A;  1YKH B;  4IE7 A;  3RRC A;  5LHG B;  3ETV A;  3S4U A;  2NP9 A;  3LBX B;  1US7 B;  2CXL A;  5LGT B;  3PU8 A;  2LE8 A;  2LSK A;  4P0B A;  4ISS A;  5HYA A;  3O1J A;  2VB6 A;  4I43 B;  3ZLI A;  4ZI2 D;  5E0O A;  4IE6 A;  1MMA A;  1ZHC A;  1WRD A;  3QK6 A;  5A1L A;  3IF8 B;  2DI4 A;  3ZJ1 A;  3NZQ A;  5KX5 E;  2ODU A;  3CML A;  3AA7 B;  4HKA A;  5FYM A;  1WLX A;  1WYC A;  4MLK A;  5LYJ E;  1WYB A;  2IC6 A;  2V7J A;  3W15 B;  3E08 A;  4QKN A;  5TAO A;  3O9X A;  5JDH A;  4ZI3 D;  4UVC B;  5JQG E;  4ILU A;  1BR4 A;  5IYZ E;  3WI3 A;  3N9O A;  4H9O C;  3JC6 D;  5LOV E;  1G8X A;  2N2N A;  2ZMA A;  4GYR A;  4FJO A;  4KBM B;  3AA0 B;  5L3F B;  3AVS A;  2YU2 A;  2K5B B;  2ZM8 A;  4IIJ E;  2X68 A;  3N5L A;  3OBV E;  3ONX A;  2VKJ A;  3HR0 A;  2D2S A;  3AA6 B;  3OYZ A;  4YHJ A;  5IHY A;  2X66 A;  3VU7 H;  4AXP A;  4XBF B;  1O3X A;  2VKD A;  3CX8 B;  1WR6 A;  4JUY A;  3IBP A;  4K0U A;  3AAI A;  4MAL A;  5ETW A;  2LJL A;  4J2C A;  4ZHQ E;  4G63 A;  1BR2 A;  1YKE B;  3GWH A;  3AA1 B;  1D1B A;  2YK0 A;  4E7Z A;  3WAJ A;  1OWA A;  1KNZ A;  2K48 A;  3EVY A;  3N9P A;  2JMK A;  5HXE A;  4OK0 A;  4ASK A;  5JH7 E;  2LSI A;  3DP7 A;  4I4T E;  2V7L A;  2PFV A;  1FIO A;  3LK4 2;  3KVA A;  3UUX B;  5LJN A;  2RP4 A;  3UUL A;  2DLR A;  3N2K E;  5AFU L;  1UX5 A;  4TUY E;  2C5J A;  4ZI7 E;  2D0T A;  4CXW A;  5LGU B;  2LHN A;  2VKH A;  4I55 E;  3NZP A;  2WM9 A;  3H37 A;  4BJN A;  2LM9 A;  4UVB B;  4X20 E;  3PUG A;  4AKL A;  1MIY A;  3A5X A;  3KV5 A;  3OYX A;  2JPF A;  2E9X C;  3C4X A;  4X1K E;  3RPU A;  4HTE A;  4PAG A;  2PJQ A;  4HE8 A;  2EHO A;  3FXE B;  4AKR B;  5LNK A;  2N1G A;  4TN7 B;  3TKL B;  3ZMS B;  3ZYK A;  2A72 A;  1D1C A;  2XQY A;  5J2U E;  1IJ6 A;  2WMN A;  5JRC A;  4WW0 A;  4QXB B;  2YEV C;  3L09 A;  2X9X A;  2A3D A;  3C4Z A;  4IE0 A;  2CWO A;  2P9B A;  2Y6X A;  4O8S A;  4ZOL E;  3HKD E;  2QA7 A;  5JDN A;  4L0R A;  4UF0 A;  5M4Y A;  5CB4 E;  2D0U A;  4PFO A;  3I1A A;  4UF0 B;  5EK2 A;  2X51 A;  2CM0 A;  2HPL A;  3PUA A;  3RYF E;  5L3C B;  2XUE A;  2E8I A;  2WMO A;  2JRK A;  4WBO A;  2CWY A;  4KUM B;  3ZN1 B;  1ZKE A;  2LEH A;  2X0L B;  3P7I A;  3I0Q A;  2W63 A;  2MOZ A;  3NRY A;  3RYC E;  3BQI A;  3EDU A;  2C5I T;  1VOM A;  3HKB E;  4MFR A;  4QX8 B;  3LG7 A;  1IJ5 A;  3F2E A;  3MJX A;  4O4L E;  4PFP A;  2CE7 A;  2LSG A;  3F57 A;  5J2T E;  1VRB A;  4E7S A;  3CPZ A;  1HX8 A;  3L3P A;  4PJN A;  1MIW A;  3B13 A;  3BK9 A;  4GIW A;  4EB6 E;  1UCU A;  1MIV A;  4ZI2 C;  2HPJ A;  4PJM A;  3I9Y A;  5C8Y E;  2BDE A;  2CXF A;  2ACX A;  1IAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...