2M67A

Full-length mercury transporter protein merf in lipid bilayer membranes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
MKDPKTLLRVSIIGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASSTPKFNGVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MerF
publication title The Structure of the Mercury Transporter MerF in Phospholipid Bilayers: A Large Conformational Rearrangement Results from N-Terminal Truncation.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Transport protein
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2m67A00
2MOZA 2M67A
chains in the Genus database with same CATH superfamily
2WQYA 3F31A 2CXDA 2LRKA 3FBZA 2C5JA 2BS3A 3A7MA 4OHFA 2W67A 2NOXA 2W63A 4IE5A 4I4TE 2Q9QB 4QH1A 2BVLA 2P9BA 5BR8T 3CWZB 4WBNE 2BDEA 4O4HE 2YKSA 2M6BA 2E5VA 1UX5A 4P0AA 3QOFA 3AE7A 4AKHA 4HWFA 1XDOA 4YXDA 4YTNA 3V5UA 4UF0A 2ZMAA 2NR4A 3N9MA 3Q9DA 2QVAA 4U3CA 3HI2A 1OEDA 1QLBA 5J1GA 1IBLT 3P50A 3C64A 1UCUA 3AEEA 2UXNB 4UV9B 2IDOB 2XAFB 2JQ9A 5TAOA 4ADZA 5CB4E 3CIRA 3FZKB 2V7IA 3OPCA 4OFZA 1HX8A 4ERRA 3KBUA 5LGUB 5HXEA 3P7IA 3E08A 4IHJE 2CXLA 3SRZA 3AXJB 3RKGA 1X79A 4IE7A 3KBTA 2I6HA 2NTXA 1W9RA 1T7SA 1MMNA 3PUSA 3RIFA 4U2YA 3TLUA 1XNRT 4EOZB 3IA3A 2CMRA 1B7TA 1T72A 2DWGA 2C5IT 4ZXLA 2CWYA 2LSGA 3HA4A 3RKOA 5KDMC 2L8KA 3KVBA 4B3RT 3AEFA 2BKOA 2LHRA 3AA6B 4I0UA 2XM1A 4HFCA 5IUXA 2K5BB 3L8RA 5IHYA 3KV4A 3T8OA 5DABA 3SWHA 1KEYA 3RYIE 3RH3A 3RLFF 2AE9A 1XDPA 4QX7B 4A98A 5AQVB 2ZM0A 2G0UA 3ZN1B 3B13A 5L4EA 4ZHQE 2V5DA 3KDSE 5FYMA 2JJ9A 3MK7C 3ETVA 3KV5A 3NWIA 4QH5A 2XQAA 2XHEB 1HR0T 1KNPA 3X1DA 1MNEA 4NXNT 2JQKA 4JV5T 4I55E 5HCMA 3LJCA 5JDLA 4YSXA 4UVCB 2X9HA 1N34T 2XM2A 1E1HB 3AEAA 3EABA 1LKXA 4DR5T 4KI0F 1BR2A 2XQ3A 5F5WA 2ES0A 1W0BA 3ZJ1A 3UU6A 4V1Av 4NUVA 2IHR1 2LHNA 2J1DG 4U74A 4KBMB 3N9QA 1WR6A 2KT9A 4YSYA 1Y64B 4K0UA 4B6XA 3VR8A 2OLTA 5FL1A 1G8XA 1WR0A 2ODVA 4DV0T 5LJNA 4CXYA 3RGLA 4M1PA 2Y6XA 3OYXA 5L3EB 1FJGT 4IDOA 3ZYKA 1IBMT 2YOEA 3SOLA 4PJLA 4CN6A 1O3XA 4AQYT 2YU2A 2Z6EA 2V7JA 4WNKA 3PUZF 1X9BA 5FNVE 4YJ3E 2VQFT 4ZS3A 1T98A 3GWHA 1FMVA 3GA8A 2B1EA 5C2TA 2K48A 2NW7A 3ZMUB 3AVSA 4QXHB 5LGTB 2XQ7A 1LRZA 2X9XA 4IGUA 3L09A 3TLTA 1ZEEA 3DP7A 2X51A 3I0OA 2CHNA 3K3NA 3O4XE 4AISA 2VK9A 1VCTA 3H3AA 4DIDB 3AE8A 1XMQT 2V6YA 3P4WA 3IBPA 2DWKA 4EIWA 1NWMX 2HN2A 4H9PC 4H63H 5AQOB 3P8CD 4TWHA 4IE4A 3GN5A 1S35A 4LMKA 3AAAB 4DR3T 1Z8UA 3ETUA 3JCFA 4TX5A 3P4PA 3ONJA 4PJMA 3ZMVB 3MXZA 3OJAA 2YDQA 2I0MA 5FL0A 3MJXA 1IZNB 1NAFA 5EZYE 3AECA 2HH7A 3UQ4A 3VR9A 2XAHB 4AKGA 1UK5A 4ZEYA 4DR7T 5LNKA 4HWIB 2KINB 3LBXB 1CHUA 5AQTB 2MTQA 2WP9A 1UX4A 4CN1A 5J2TE 1BR4A 3PUQA 1KFYA 4P0BA 4TWDA 2YU1A 5HXHA 4EGWA 5EK4A 2H7VC 3NBXX 3VKHA 4ASKA 4PAGA 1EZ3A 4Z91A 5ABFA 2YK0A 4NIQA 2X0HA 4PW8A 2WDRA 3Q5DA 2A72A 2YDRA 4N78D 1HTJF 5JR9B 1L0VA 3C51A 3F57A 4JEUB 4LF6T 1N36T 4HN9A 3VHLA 4AI6A 1XWMA 4IDZA 3B5MA 4EZHA 4ZI2D 3CX6B 1VCSA 1CUNA 4WW0A 3RF1A 5JRCB 1YXRA 5FVKA 4QX8B 1HNWT 1JNZA 2VVSA 4U7IA 2MBGA 1MIWA 5LB7B 3N9NA 4IREA 4Z8XA 4HFIA 2M67A 4DV3T 2XQ4A 4EV6A 5J0ZA 5FKYA 2XPKA 4G2AA 3RIUA 1D0XA 1KK7A 2CHOA 3S4UA 3ZMZB 1V9DA 3HKCE 4E7SA 2X0LB 3ESLA 1KF6A 5HWXA 2JQQA 2CLYB 2JMHA 2W66A 3C50A 3ZJ2A 2KXPB 1WYBA 2Q9QA 3DTOA 2LSIA 1U4QA 3WAJA 3TLSA 2IC6A 2W62A 3U3IA 2V6XA 4GK0E 5AQRB 4KHZF 4UEMA 2V7MA 3PJAA 2KNDA 2V7KA 3UULA 2LM2A 5HEJA 1M62A 4GYSA 3K1SA 4X62T 4DR4T 1WRDA 3FBLA 2I59A 2IW5B 1J5ET 4OK0A 4YY3T 1HCIA 4DV7T 3BQKA 4CXWA 2XQYA 3RIUC 3NZQA 1US7B 3HKDE 4F8HA 5C3JA 3I0QA 5AQJB 2PG8A 2XUEA 4I43B 3LK3B 2XZEA 4QH4A 4DV2T 4YSZA 2Q9QC 1HX1B 2RP4A 5KXJA 3EAMA 3CVRA 4EYYR 3AXJA 4TNWA 4WZXA 1QSDA 3ZCIA 2WB5A 5JVDE 3N2GE 5HYAA 5LHIB 3H3MA 5JTGA 4OYJA 5HAXA 4UVAB 3ZEFB 4ZOLE 5LXTE 5ABEA 4EEDA 4KUMB 3OKQA 2NTYA 3FZLB 2DI4A 2X68A 4DNDA 4YJ2E 2IC9A 5EK2A 4GKJT 3VRBA 1XNQT 3UU4A 2A2FX 3NRYA 1VRBA 1XZYA 1HNZT 4IIJE 4WYVA 3U78A 2K9AA 5HXRA 5ADXL 3H37A 4EXTA 4KHPT 4DR6T 3MA9A 2V1DB 1HFAA 5AQNB 3UTKA 1QUUA 2XQ5A 3ZN0B 4DMVA 3RRCA 5AQPB 5CA0E 4TV9E 1D0YA 1UURA 3TKLB 4EEBA 4K0KT 4X65T 2BBJA 4BJNA 5JDGA 1UUSA 2WZIA 2BZBA 3CQCB 4TV8E 2E9XD 3P4RA 5FXXA 2BS2A 2UUCT 3BQIA 2C0SA 2CPTA 2WCAA 2WSSV 3ZMSB 4AQGA 4IDQA 3NZPA 2VASA 4IL4A 5CA1E 4ZI3C 5HWYA 4U2ZA 4NPPA 3HL6A 4B3MT 2LT3A 3QB5K 2ODUA 4IT4A 4LF7T 3JAEA 2W61A 3AA1B 5AQIB 4JI5T 4JEHB 3D0TA 4PK5A 2WDVA 2FJDA 3JAFA 4JI1T 2LRLA 5LA6E 2BVMA 2X9WA 1HG5A 4ZI2C 2XQ6A 2J62A 1KNRA 3NKZA 3J9X1 2LE8A 5F8PA 3SFDA 4O2AE 1ZV4X 1T8BA 4L5GA 4ZZCA 1MNDA 3Q2MA 2X67A 4E7ZA 2VL0A 2ACZA 2J47A 4L9IA 3ZC0A 3C4XA 3EUHA 1FMWA 3AE9A 5HXSA 1ZP0A 2W00A 3HKEE 5L2LA 2F4VT 3JC6D 2WS3A 1MMGA 5LGNB 5AQMB 4PJJA 2QRXA 2JIWA 4HE8A 1WFDA 2EHOD 5AQLB 4AKIA 1N32T 1J1JA 1M7KA 3NRXA 3O9XA 2XAQB 2LOSA 5DQWA 3O1IA 1HF8A 3M3ZB 4U33A 2VB6A 4QXCB 4GIWA 5H6RB 3W15B 4IE6A 2VURA 3LBXA 2CRBA 5BMVE 3ANWB 4LF5T 3PTRB 4PK4A 3AE3A 3R6NA 3AA0B 4H63V 5FXVA 2HN1A 2LSYA 5L47A 2R6GF 4YTMA 5JDQA 3L3PA 4I50E 2D0TA 4DR1T 4WBOA 3E22E 5LOVE 5FY7A 3UUXB 2UXXB 1FIOA 3PJAJ 4CI1B 2X0YA 4ILCA 2E5LT 5JR9A 2UXCT 4X1YE 2LSJA 2N9DA 5LMNT 1MIVA 3OTOT 4X64T 4IDNA 5L3GB 2QGSA 3N5LA 3HKBE 3I9WA 3A5XA 4HWDA 2WMOA 4TNVA 3R84B 5LBQB 3DJBA 2CCQA 3VU7H 2HPLA 1LVFA 3FZFB 1ZOYA 5JRCA 4PNIA 1D0ZA 5HEUA 4MHCA 2OV9A 2YN6A 2CM0A 2LM9A 5LG4A 1WYCA 2Y8DA 3EI0A 3RRWA 5F3JA 3I1AA 3N2OA 3K3QC 2XSAA 2Y48B 1OWAA 2MAWA 4P09A 1SUMB 2XASB 2CWOA 3M65A 2DL1A 3WAKA 4C90A 4GYRA 4AIUA 2BG9B 2BG9E 4CN4A 2RPAA 5JR9C 2W2UA 4JI7T 2BG9C 2JPFA 3UU3A 3ONXA 3CX7B 3T1YT 1WLXA 4IE0A 3ZYMA 3Q5XA 2VKDA 2C5KT 2FJAA 1N33T 1IBKT 5FXZA 1HS7A 5HEGA 2L9QA 2E9XB 4H9SE 3QUJA 3AAIA 1AJ3A 3PUAA 2E9XC 2YINA 1HG2A 2XTLA 1Y01A 3OVUA 2FUPA 4CZZB 2BKNA 4COFA 4HFVA 4CI3B 4PFOA 5FVLA 3KV9A 4P1NA 2WDQA 2UUBT 5AQUB 3PUYF 3CX8B 2DCFA 2IIUA 2WU2A 4ZZBA 2WBLA 3ZT7A 4XBFB 3ZCJA 4ZS2A 2V7LA 2JQHA 1D1AA 3LK2B 2VVNA 5JH7E 2NW9A 2HPJA 5H6QB 4PK6A 3UUNA 2FJBA 3QNUA 4LFAT 1IAPA 4QWNB 2VKHA 3JADA 2CLYC 4DV1T 4DUZT 3TLWA 2ZM8A 5DQVA 5KMGP 1I6ZA 3J7Yq 3RX6A 5FY0A 2WY2A 1WCRA 5LHHB 4LF9T 1NENA 3E0ZA 2YEVC 3ABVA 2KWIB 4YFSA 3EDUA 4EB6E 2CXFA 1OXZA 3PUXF 3PU8A 3KVAA 3KFWX 3RI5A 4OYKA 4ILBA 1W0AA 4EZ4A 2NP9A 4BA9A 5IYZE 4LFCT 4H9QC 4YHHT 2D9DA 2LSKA 3P4QA 4O4IE 3GMIA 4UELA 2W0GA 2H89A 3MZKB 2WU5A 5L3BB 2EHOB 2KLQA 5ETWA 3AE1A 1BR1A 3UU8A 3B57A 2EHOC 2UXDT 4J2CA 3MKDA 3O1HA 3ZYLA 4ILAA 4JI2T 4JI6T 1YQ4A 3K3OA 4DV4T 3ZC1A 2E2AA 3RYFE 2A9UA 1KNZA 3PURA 3IF8B 2VWAA 3ZSTA 4ILUA 4QHOA 3PUVF 5FMNA 4UVBB 2W4XA 2K24A 4A5XA 2XQ8A 3FXDB 4CXXA 2D2SA 1DU2A 2LEHA 5JDNA 4XAXB 5M4YA 4O2BE 3RIAA 2QA7A 4JLEA 2AXDS 2PFVA 2MPKA 5EK3A 4TZ4C 5J2UE 3RYCE 1IJ6A 3LSVA 2MOZA 3FHNA 4L0RA 4NUUA 3UQ7A 4HGAA 1JNRA 5JREA 4OX9T 2SPCA 1J5WA 4DUYT 2JMKA 3AEDA 3ZKRA 4O4JE 4MALA 1ZKEA 4B3TT 3QK6A 4CQIA 4H9NC 2KMFA 3FZMB 3MACA 1ZHCA 4DV6T 5L3CB 3ZLIA 2H3RA 2DLRA 2ZM6T 4BJMA 3LFMA 1MIYA 3ZSSA 2PBIA 4UF0B 4X66T 4UIGA 4CI2B 5AFUL 2VKJA 2WZHA 3AAEB 1IJ5A 1OEDB 1OEDE 4A56A 4U72A 2J4GA 2CA5A 3IHRA 1OEDC 3NVOA 3P4SA 4H9OC 1H7CA 3QB5A 4UV8B 3UFGA 2BS4A 1E7PA 3OBVE 3L39A 2PJQA 4H9RC 5GONE 3C98B 2ZM2A 2VKOA 2GK9A 3RC3A 4B3ST 4LMLA 3SFEA 2HHHT 2BBHA 4QXBB 4UXNB 2H88A 5DJQC 3KV6A 2KZ7B 2XAJB 3ZMTB 4TN7B 5LG3A 1I94T 1G73A 3SS1A 2WM9A 3BQLA 1MMDA 4YTPA 3VRAA 4BAYB 5AQSB 3AEGA 2WMNA 4JBWF 5L3FB 4KMCA 3AVRA 3CMLA 2N2NA 3AA7B 4NXMT 2XSBA 5A1LA 2X9YA 3EVYA 2V5CA 2YDSA 2ZLYA 2MYSA 2NW8A 3C4WA 5JDHA 2DHRA 2IUBA 4X5TA 4LFBT 5KX5E 3EDVA 4O4LE 3T1HT 3ANWA 3UT5E 1S94A 4ISTA 3N9PA 4HEAA 4IDPA 4MBQA 5AQKB 2LJLA 4ZI7E 3HR0A 3RPUA 2A3DA 4YHJA 3KINB 3UUMA 1XMOT 5LP6E 3IEEA 3PUWF 2Q9QD 5AQFB 3BK9A 2V26A 4X20E 2LKGA 3ZT6A 1UGOA 2L3LA 3ONLC 2VQET 4UR9A 3RYHE 3CQXC 2ACXA 2UUAT 4MLKA 4TWFA 2V8SV 2D0UA 3PV0F 4C91A 1E2AA 3RQWA 2LKHA 4LF4T 3WI3A 2X66A 4EAHA 5E0OA 3Q5WA 2CEAA 4DBQA 5ABHA 3RQUA 5FY1A 4HFDA 4LF8T 4AXPA 2KWHA 3G06A 4Q25A 4GK5E 2XJ7A 3PE0A 4O8SA 2KSRA 2LOPA 3PUGA 1SA0E 1Z0PA 2IMLA 3N2KE 1YKEB 2XQ9A 1D1BA 3LG7A 3VKGA 4DBRA 2BG9A 2WWVA 4FI5A 3QC9A 4DR2T 4MFRA 5LHGB 4JYAT 1NEKA 2UXBT 5JDMA 4KX6A 4X1IE 3CKDA 2NWBA 3AEBA 2V6YB 3A8YC 5FP3A 3LK42 5LCYA 2E9XA 3OYZA 4GOUA 4HWHA 5L3DB 5LJMA 3FXEB 3GN5B 3UUBA 4X1KE 5IWAT 5L4HA 4A97A 4AKLA 4EYUA 4KP3C 4F6RC 4AQFA 3TLVA 5AQGB 3LDQB 2H7OA 3ZPOA 3V5SA 4HWCA 1SE7A 1SHZC 1GQEA 5HEHA 5CJ5A 4ZI3D 2FBWA 3PDYA 4DVDA 3FZHB 3PU3A 3AE4A 4JI3T 4HFEA 2N1GA 3UFEA 4JI0T 4JUYA 4YLHA 2PTFA 3AE5A 1BR0A 5CGMA 4YT0A 1U5PA 3AB3B 2D5UA 5HEOA 1VOMA 3UU5A 4GKKT 2BKPA 5HCJA 2CE7A 2IAKA 3CK6A 4PFPA 2UU9T 5FXWA 3AE2A 2E8IA 4LMJA 3CPZA 2CBIA 4XZCA 2QYWA 4AKRB 5CFBA 2JRKA 4U31A 1R8IA 2K3WA 5ABFB 1YW0A 4AQFC 4QKNA 2WWUA 5LYJE 1W09A 4HFHA 2XY8B 3I9YA 4FJOA 4DMWA 4HFBA 2DNXA 2VL8A 2CBJA 5JDFA 5LBMA 3FB2A 4ISSA 1MMAA 2B76A 2EHOA 2LLYA 4JI8T 4PJNA 2M6IA 5JQGE 2WAUA 3N9LA 1D1CA 5ABGA 5AQHB 3O1JA 2OA5A 5C8YE 3RHWA 4G63A 3EHZA 4ANJA 1FEWA 3ZT5A 4DO0A 4IL9A 3C4ZA 5AQQB 4DV5T 2RA1A 3K8PC 2FJEA 4Z90A 5HXCA 3CQGB 4TUYE 4HTEA 3F2EA 1YD8G 3Q5EA 4HKAA 4U7YA 4JI4T 3AE6A 5LMUT 2XAGB 1LVKA 1YQ3A 3RC8A 1HNXT 3N9OA 1YKHB 3JC6C
chains in the Genus database with same CATH topology
5DQWA 3O1IA 1IJ5A 1HF8A 3F31A 4N78D 1HTJF 2CXDA 5JR9B 2VB6A 4QXCB 4A56A 3FBZA 2C5JA 4U72A 3C51A 3F57A 2CA5A 3IHRA 4OHFA 4JEUB 4GIWA 2NOXA 4HN9A 3VHLA 4AI6A 5H6RB 3W15B 4IDZA 4H9OC 4IE6A 2W63A 1H7CA 4IE5A 4EZHA 4I4TE 2Q9QB 4ZI2D 3LBXA 4UV8B 5BMVE 2BVLA 2P9BA 3CX6B 3ANWB 3CWZB 3OBVE 3PTRB 2PJQA 4WBNE 4H9RC 2BDEA 4PK4A 4O4HE 1CUNA 5GONE 3C98B 4WW0A 2ZM2A 3R6NA 5JRCB 2VKOA 2GK9A 3RC3A 3AA0B 4H63V 5FXVA 2LSYA 4QXBB 4UXNB 5DJQC 3KV6A 1UX5A 5JDQA 3L3PA 4I50E 2KZ7B 2XAJB 4P0AA 3ZMTB 2D0TA 4AKHA 4WBOA 4TN7B 3E22E 4QX8B 1G73A 3SS1A 2MBGA 1MIWA 5LOVE 3V5UA 2WM9A 3N9NA 5FY7A 4UF0A 2ZMAA 3BQLA 4Z8XA 1MMDA 3N9MA 3Q9DA 3UUXB 2UXXB 2M67A 4BAYB 1FIOA 2WMNA 5L3FB 4CI1B 3HI2A 4KMCA 3AVRA 3CMLA 2N2NA 3AA7B 5J1GA 5JR9A 4X1YE 4G2AA 2LSJA 1D0XA 3C64A 2N9DA 5A1LA 2X9YA 1KK7A 1UCUA 3EVYA 2UXNB 3S4UA 4UV9B 3ZMZB 2ZLYA 1V9DA 2MYSA 3HKCE 2XAFB 4E7SA 5TAOA 2NW8A 1MIVA 2X0LB 3C4WA 4ADZA 2DHRA 5CB4E 5JDHA 3ESLA 2V7IA 5HWXA 2JQQA 2CLYB 5KX5E 2JMHA 3C50A 4OFZA 3ZJ2A 5L3GB 3EDVA 1HX8A 2KXPB 2QGSA 3KBUA 1WYBA 2Q9QA 4ERRA 5HXEA 3DTOA 5LGUB 3P7IA 3E08A 2LSIA 3HKBE 1U4QA 2CXLA 3N5LA 3I9WA 4IHJE 4O4LE 3WAJA 3A5XA 3SRZA 1X79A 4IE7A 2WMOA 3R84B 3KBTA 5LBQB 3ANWA 3DJBA 3UT5E 2IC6A 2CCQA 2W62A 2NTXA 3VU7H 3U3IA 1MMNA 4GK0E 2HPLA 3PUSA 1LVFA 1S94A 4ISTA 4UEMA 5JRCA 4EOZB 4PNIA 2CMRA 1D0ZA 2V7MA 2KNDA 3N9PA 2V7KA 4MHCA 3UULA 1B7TA 2DWGA 4HEAA 4MBQA 2CM0A 2C5IT 2LM9A 5LG4A 2LJLA 1WYCA 2Y8DA 4ZI7E 3RRWA 3HR0A 3RPUA 4GYSA 5F3JA 3I1AA 2CWYA 2LSGA 3HA4A 3RKOA 3N2OA 5KDMC 2L8KA 2A3DA 4YHJA 3K3QC 3KINB 1WRDA 3UUMA 3KVBA 3FBLA 2Y48B 5LP6E 2I59A 2IW5B 1OWAA 3IEEA 2LHRA 3AA6B 2Q9QD 4P09A 4OK0A 2XASB 2CWOA 1HCIA 3M65A 3WAKA 4C90A 2K5BB 4GYRA 3BQKA 4CXWA 2XQYA 5IHYA 3KV4A 3T8OA 3BK9A 5DABA 3SWHA 2V26A 3RYIE 5JR9C 3NZQA 4X20E 1US7B 3RH3A 3HKDE 3I0QA 2L3LA 2JPFA 2PG8A 2XUEA 4I43B 3LK3B 4QX7B 3RYHE 3ONXA 2ZM0A 2G0UA 3CQXC 3CX7B 1WLXA 3ZN1B 4IE0A 3B13A 3ZYMA 2Q9QC 4ZHQE 3Q5XA 2ACXA 2RP4A 2VKDA 2C5KT 3KDSE 4MLKA 5FYMA 2JJ9A 1HS7A 3MK7C 3CVRA 3ETVA 5FXZA 4EYYR 3KV5A 2L9QA 2E9XB 2D0UA 4H9SE 1QSDA 3ZCIA 3QUJA 4C91A 3AAIA 1AJ3A 2XHEB 5JVDE 3N2GE 5HYAA 1MNEA 3PUAA 5LHIB 4OYJA 5HAXA 4I55E 3LJCA 4UVAB 3WI3A 2X66A 3ZEFB 4EAHA 2E9XC 2YINA 1HG2A 5JDLA 2XTLA 5E0OA 4ZOLE 3Q5WA 4CZZB 4UVCB 5LXTE 2X9HA 4HFVA 2CEAA 4DBQA 4KUMB 4CI3B 3OKQA 1E1HB 4PFOA 2NTYA 1LKXA 2DI4A 3KV9A 2X68A 1BR2A 5FY1A 2ES0A 4AXPA 2KWHA 4DNDA 3ZJ1A 4YJ2E 3CX8B 2DCFA 4GK5E 2IC9A 5EK2A 4V1Av 4NUVA 3PE0A 4O8SA 2LHNA 2J1DG 4U74A 2LOPA 3PUGA 1SA0E 1Z0PA 3N9QA 4KBMB 3N2KE 1YKEB 1WR6A 1D1BA 2WBLA 2KT9A 3LG7A 4XBFB 2A2FX 3VKGA 3NRYA 4DBRA 3ZCJA 4ZS2A 4FI5A 1Y64B 1VRBA 2V7LA 3QC9A 4K0UA 4B6XA 4MFRA 1G8XA 5LHGB 1D1AA 3LK2B 5JH7E 4IIJE 2NW9A 2ODVA 2HPJA 5LJNA 5H6QB 4CXYA 4PK6A 3UUNA 5JDMA 3U78A 1IAPA 4QWNB 2K9AA 2VKHA 4X1IE 3CKDA 4M1PA 2CLYC 2Y6XA 5HXRA 3OYXA 5ADXL 5L3EB 3H37A 4EXTA 2NWBA 2ZM8A 5DQVA 5KMGP 3J7Yq 3MA9A 3RX6A 5FP3A 5FY0A 3LK42 5LHHB 5LCYA 2E9XA 2V1DB 3E0ZA 1HFAA 2YEVC 2KWIB 3UTKA 4YFSA 1QUUA 3OYZA 4GOUA 3ZN0B 3ZYKA 4DMVA 5L3DB 3JC6C 3EDUA 4EB6E 2CXFA 3RRCA 3SOLA 1OXZA 5LJMA 3PU8A 5CA0E 4PJLA 3FXEB 3KVAA 1D0YA 3KFWX 4TV9E 3GN5B 4OYKA 4X1KE 1O3XA 3TKLB 4AKLA 2YU2A 2Z6EA 4EYUA 2V7JA 4WNKA 4KP3C 4F6RC 4AQFA 4EZ4A 2NP9A 4BA9A 5IYZE 5FNVE 4YJ3E 4H9QC 2H7OA 4ZS3A 4BJNA 3ZPOA 3V5SA 1SHZC 1T98A 3GWHA 5JDGA 2LSKA 1FMVA 4ZI3D 4O4IE 2BZBA 3GMIA 3GA8A 4UELA 2W0GA 3CQCB 4TV8E 2B1EA 3MZKB 2E9XD 2K48A 2NW7A 3PDYA 5L3BB 2EHOB 3ZMUB 2KLQA 5FXXA 5ETWA 3AVSA 4DVDA 4QXHB 3PU3A 5LGTB 1BR1A 3B57A 2EHOC 3BQIA 2C0SA 2N1GA 3UFEA 1LRZA 2X9XA 4IGUA 3L09A 2WSSV 1ZEEA 3DP7A 4JUYA 4YLHA 1BR0A 3ZMSB 4J2CA 2X51A 3MKDA 4AQGA 3O1HA 3ZYLA 3NZPA 3I0OA 2VASA 1U5PA 3K3NA 3O4XE 3K3OA 2VK9A 3AB3B 5CA1E 2D5UA 3H3AA 4ZI3C 1VOMA 3ZC1A 5HWYA 3RYFE 1KNZA 3PURA 3IBPA 3HL6A 2CE7A 2IAKA 2LT3A 4PFPA 5FXWA 2E8IA 3IF8B 2VWAA 2DWKA 3CPZA 4ILUA 4QHOA 2ODUA 4XZCA 4EIWA 2W61A 3AA1B 1NWMX 4JEHB 3D0TA 4AKRB 4PK5A 4H9PC 5FMNA 4H63H 2JRKA 4UVBB 3P8CD 4IE4A 3GN5A 1S35A 2K24A 3FXDB 3AAAB 4CXXA 1YW0A 2D2SA 4AQFC 4QKNA 5LA6E 2LEHA 2BVMA 2WWUA 3ETUA 5LYJE 5JDNA 4XAXB 2X9WA 1HG5A 4ZI2C 5M4YA 4O2BE 2QA7A 3I9YA 4FJOA 4JLEA 4TX5A 2PFVA 4DMWA 4PJMA 3ZMVB 3J9X1 3MXZA 5EK3A 2DNXA 2LE8A 3OJAA 4TZ4C 2VL8A 5F8PA 5JDFA 5LBMA 5J2UE 3FB2A 3MJXA 1ZV4X 4ISSA 1IJ6A 4O2AE 2MOZA 1IZNB 1MMAA 1NAFA 3RYCE 4L5GA 5EZYE 2HH7A 3FHNA 2EHOA 1MNDA 2XAHB 4L0RA 4PJNA 5JQGE 2WAUA 3Q2MA 4AKGA 2X67A 3N9LA 1D1CA 4NUUA 4HGAA 4E7ZA 5JREA 3O1JA 5LNKA 2OA5A 2KINB 3LBXB 2SPCA 5C8YE 4L9IA 3ZC0A 2MTQA 3C4XA 3EUHA 1FMWA 2JMKA 1UX4A 4G63A 5HXSA 5J2TE 4O4JE 4MALA 2W00A 1BR4A 1FEWA 4ANJA 4DO0A 3HKEE 1ZKEA 3C4ZA 5L2LA 3QK6A 3PUQA 4CQIA 4H9NC 2KMFA 3JC6D 1MMGA 2RA1A 3K8PC 3MACA 1ZHCA 4P0BA 2YU1A 5L3CB 3ZLIA 5LGNB 5HXHA 2H3RA 4PJJA 2DLRA 5HXCA 5EK4A 3CQGB 4BJMA 4HE8A 3LFMA 4TUYE 2H7VC 1MIYA 4HTEA 3F2EA 1YD8G 2EHOD 3NBXX 4HKAA 2PBIA 3VKHA 4AKIA 4ASKA 2XAGB 4UF0B 4PAGA 1EZ3A 3NRXA 1LVKA 4UIGA 2YK0A 3O9XA 4CI2B 2XAQB 5AFUL 2VKJA 3RC8A 4PW8A 3AAEB 3N9OA 2LOSA 1YKHB 2A72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOZ A;  2M67 A; 
#chains in the Genus database with same CATH topology
 2WQY A;  3F31 A;  2CXD A;  2LRK A;  3FBZ A;  2C5J A;  2BS3 A;  3A7M A;  4OHF A;  2W67 A;  2NOX A;  2W63 A;  4IE5 A;  4I4T E;  2Q9Q B;  4QH1 A;  2BVL A;  2P9B A;  5BR8 T;  3CWZ B;  4WBN E;  2BDE A;  4O4H E;  2YKS A;  2M6B A;  2E5V A;  1UX5 A;  4P0A A;  3QOF A;  3AE7 A;  4AKH A;  4HWF A;  1XDO A;  4YXD A;  4YTN A;  3V5U A;  4UF0 A;  2ZMA A;  2NR4 A;  3N9M A;  3Q9D A;  2QVA A;  4U3C A;  3HI2 A;  1OED A;  1QLB A;  5J1G A;  1IBL T;  3P50 A;  3C64 A;  1UCU A;  3AEE A;  2UXN B;  4UV9 B;  2IDO B;  2XAF B;  2JQ9 A;  5TAO A;  4ADZ A;  5CB4 E;  3CIR A;  3FZK B;  2V7I A;  3OPC A;  4OFZ A;  1HX8 A;  4ERR A;  3KBU A;  5LGU B;  5HXE A;  3P7I A;  3E08 A;  4IHJ E;  2CXL A;  3SRZ A;  3AXJ B;  3RKG A;  1X79 A;  4IE7 A;  3KBT A;  2I6H A;  2NTX A;  1W9R A;  1T7S A;  1MMN A;  3PUS A;  3RIF A;  4U2Y A;  3TLU A;  1XNR T;  4EOZ B;  3IA3 A;  2CMR A;  1B7T A;  1T72 A;  2DWG A;  2C5I T;  4ZXL A;  2CWY A;  2LSG A;  3HA4 A;  3RKO A;  5KDM C;  2L8K A;  3KVB A;  4B3R T;  3AEF A;  2BKO A;  2LHR A;  3AA6 B;  4I0U A;  2XM1 A;  4HFC A;  5IUX A;  2K5B B;  3L8R A;  5IHY A;  3KV4 A;  3T8O A;  5DAB A;  3SWH A;  1KEY A;  3RYI E;  3RH3 A;  3RLF F;  2AE9 A;  1XDP A;  4QX7 B;  4A98 A;  5AQV B;  2ZM0 A;  2G0U A;  3ZN1 B;  3B13 A;  5L4E A;  4ZHQ E;  2V5D A;  3KDS E;  5FYM A;  2JJ9 A;  3MK7 C;  3ETV A;  3KV5 A;  3NWI A;  4QH5 A;  2XQA A;  2XHE B;  1HR0 T;  1KNP A;  3X1D A;  1MNE A;  4NXN T;  2JQK A;  4JV5 T;  4I55 E;  5HCM A;  3LJC A;  5JDL A;  4YSX A;  4UVC B;  2X9H A;  1N34 T;  2XM2 A;  1E1H B;  3AEA A;  3EAB A;  1LKX A;  4DR5 T;  4KI0 F;  1BR2 A;  2XQ3 A;  5F5W A;  2ES0 A;  1W0B A;  3ZJ1 A;  3UU6 A;  4V1A v;  4NUV A;  2IHR 1;  2LHN A;  2J1D G;  4U74 A;  4KBM B;  3N9Q A;  1WR6 A;  2KT9 A;  4YSY A;  1Y64 B;  4K0U A;  4B6X A;  3VR8 A;  2OLT A;  5FL1 A;  1G8X A;  1WR0 A;  2ODV A;  4DV0 T;  5LJN A;  4CXY A;  3RGL A;  4M1P A;  2Y6X A;  3OYX A;  5L3E B;  1FJG T;  4IDO A;  3ZYK A;  1IBM T;  2YOE A;  3SOL A;  4PJL A;  4CN6 A;  1O3X A;  4AQY T;  2YU2 A;  2Z6E A;  2V7J A;  4WNK A;  3PUZ F;  1X9B A;  5FNV E;  4YJ3 E;  2VQF T;  4ZS3 A;  1T98 A;  3GWH A;  1FMV A;  3GA8 A;  2B1E A;  5C2T A;  2K48 A;  2NW7 A;  3ZMU B;  3AVS A;  4QXH B;  5LGT B;  2XQ7 A;  1LRZ A;  2X9X A;  4IGU A;  3L09 A;  3TLT A;  1ZEE A;  3DP7 A;  2X51 A;  3I0O A;  2CHN A;  3K3N A;  3O4X E;  4AIS A;  2VK9 A;  1VCT A;  3H3A A;  4DID B;  3AE8 A;  1XMQ T;  2V6Y A;  3P4W A;  3IBP A;  2DWK A;  4EIW A;  1NWM X;  2HN2 A;  4H9P C;  4H63 H;  5AQO B;  3P8C D;  4TWH A;  4IE4 A;  3GN5 A;  1S35 A;  4LMK A;  3AAA B;  4DR3 T;  1Z8U A;  3ETU A;  3JCF A;  4TX5 A;  3P4P A;  3ONJ A;  4PJM A;  3ZMV B;  3MXZ A;  3OJA A;  2YDQ A;  2I0M A;  5FL0 A;  3MJX A;  1IZN B;  1NAF A;  5EZY E;  3AEC A;  2HH7 A;  3UQ4 A;  3VR9 A;  2XAH B;  4AKG A;  1UK5 A;  4ZEY A;  4DR7 T;  5LNK A;  4HWI B;  2KIN B;  3LBX B;  1CHU A;  5AQT B;  2MTQ A;  2WP9 A;  1UX4 A;  4CN1 A;  5J2T E;  1BR4 A;  3PUQ A;  1KFY A;  4P0B A;  4TWD A;  2YU1 A;  5HXH A;  4EGW A;  5EK4 A;  2H7V C;  3NBX X;  3VKH A;  4ASK A;  4PAG A;  1EZ3 A;  4Z91 A;  5ABF A;  2YK0 A;  4NIQ A;  2X0H A;  4PW8 A;  2WDR A;  3Q5D A;  2A72 A;  2YDR A;  4N78 D;  1HTJ F;  5JR9 B;  1L0V A;  3C51 A;  3F57 A;  4JEU B;  4LF6 T;  1N36 T;  4HN9 A;  3VHL A;  4AI6 A;  1XWM A;  4IDZ A;  3B5M A;  4EZH A;  4ZI2 D;  3CX6 B;  1VCS A;  1CUN A;  4WW0 A;  3RF1 A;  5JRC B;  1YXR A;  5FVK A;  4QX8 B;  1HNW T;  1JNZ A;  2VVS A;  4U7I A;  2MBG A;  1MIW A;  5LB7 B;  3N9N A;  4IRE A;  4Z8X A;  4HFI A;  2M67 A;  4DV3 T;  2XQ4 A;  4EV6 A;  5J0Z A;  5FKY A;  2XPK A;  4G2A A;  3RIU A;  1D0X A;  1KK7 A;  2CHO A;  3S4U A;  3ZMZ B;  1V9D A;  3HKC E;  4E7S A;  2X0L B;  3ESL A;  1KF6 A;  5HWX A;  2JQQ A;  2CLY B;  2JMH A;  2W66 A;  3C50 A;  3ZJ2 A;  2KXP B;  1WYB A;  2Q9Q A;  3DTO A;  2LSI A;  1U4Q A;  3WAJ A;  3TLS A;  2IC6 A;  2W62 A;  3U3I A;  2V6X A;  4GK0 E;  5AQR B;  4KHZ F;  4UEM A;  2V7M A;  3PJA A;  2KND A;  2V7K A;  3UUL A;  2LM2 A;  5HEJ A;  1M62 A;  4GYS A;  3K1S A;  4X62 T;  4DR4 T;  1WRD A;  3FBL A;  2I59 A;  2IW5 B;  1J5E T;  4OK0 A;  4YY3 T;  1HCI A;  4DV7 T;  3BQK A;  4CXW A;  2XQY A;  3RIU C;  3NZQ A;  1US7 B;  3HKD E;  4F8H A;  5C3J A;  3I0Q A;  5AQJ B;  2PG8 A;  2XUE A;  4I43 B;  3LK3 B;  2XZE A;  4QH4 A;  4DV2 T;  4YSZ A;  2Q9Q C;  1HX1 B;  2RP4 A;  5KXJ A;  3EAM A;  3CVR A;  4EYY R;  3AXJ A;  4TNW A;  4WZX A;  1QSD A;  3ZCI A;  2WB5 A;  5JVD E;  3N2G E;  5HYA A;  5LHI B;  3H3M A;  5JTG A;  4OYJ A;  5HAX A;  4UVA B;  3ZEF B;  4ZOL E;  5LXT E;  5ABE A;  4EED A;  4KUM B;  3OKQ A;  2NTY A;  3FZL B;  2DI4 A;  2X68 A;  4DND A;  4YJ2 E;  2IC9 A;  5EK2 A;  4GKJ T;  3VRB A;  1XNQ T;  3UU4 A;  2A2F X;  3NRY A;  1VRB A;  1XZY A;  1HNZ T;  4IIJ E;  4WYV A;  3U78 A;  2K9A A;  5HXR A;  5ADX L;  3H37 A;  4EXT A;  4KHP T;  4DR6 T;  3MA9 A;  2V1D B;  1HFA A;  5AQN B;  3UTK A;  1QUU A;  2XQ5 A;  3ZN0 B;  4DMV A;  3RRC A;  5AQP B;  5CA0 E;  4TV9 E;  1D0Y A;  1UUR A;  3TKL B;  4EEB A;  4K0K T;  4X65 T;  2BBJ A;  4BJN A;  5JDG A;  1UUS A;  2WZI A;  2BZB A;  3CQC B;  4TV8 E;  2E9X D;  3P4R A;  5FXX A;  2BS2 A;  2UUC T;  3BQI A;  2C0S A;  2CPT A;  2WCA A;  2WSS V;  3ZMS B;  4AQG A;  4IDQ A;  3NZP A;  2VAS A;  4IL4 A;  5CA1 E;  4ZI3 C;  5HWY A;  4U2Z A;  4NPP A;  3HL6 A;  4B3M T;  2LT3 A;  3QB5 K;  2ODU A;  4IT4 A;  4LF7 T;  3JAE A;  2W61 A;  3AA1 B;  5AQI B;  4JI5 T;  4JEH B;  3D0T A;  4PK5 A;  2WDV A;  2FJD A;  3JAF A;  4JI1 T;  2LRL A;  5LA6 E;  2BVM A;  2X9W A;  1HG5 A;  4ZI2 C;  2XQ6 A;  2J62 A;  1KNR A;  3NKZ A;  3J9X 1;  2LE8 A;  5F8P A;  3SFD A;  4O2A E;  1ZV4 X;  1T8B A;  4L5G A;  4ZZC A;  1MND A;  3Q2M A;  2X67 A;  4E7Z A;  2VL0 A;  2ACZ A;  2J47 A;  4L9I A;  3ZC0 A;  3C4X A;  3EUH A;  1FMW A;  3AE9 A;  5HXS A;  1ZP0 A;  2W00 A;  3HKE E;  5L2L A;  2F4V T;  3JC6 D;  2WS3 A;  1MMG A;  5LGN B;  5AQM B;  4PJJ A;  2QRX A;  2JIW A;  4HE8 A;  1WFD A;  2EHO D;  5AQL B;  4AKI A;  1N32 T;  1J1J A;  1M7K A;  3NRX A;  3O9X A;  2XAQ B;  2LOS A;  5DQW A;  3O1I A;  1HF8 A;  3M3Z B;  4U33 A;  2VB6 A;  4QXC B;  4GIW A;  5H6R B;  3W15 B;  4IE6 A;  2VUR A;  3LBX A;  2CRB A;  5BMV E;  3ANW B;  4LF5 T;  3PTR B;  4PK4 A;  3AE3 A;  3R6N A;  3AA0 B;  4H63 V;  5FXV A;  2HN1 A;  2LSY A;  5L47 A;  2R6G F;  4YTM A;  5JDQ A;  3L3P A;  4I50 E;  2D0T A;  4DR1 T;  4WBO A;  3E22 E;  5LOV E;  5FY7 A;  3UUX B;  2UXX B;  1FIO A;  3PJA J;  4CI1 B;  2X0Y A;  4ILC A;  2E5L T;  5JR9 A;  2UXC T;  4X1Y E;  2LSJ A;  2N9D A;  5LMN T;  1MIV A;  3OTO T;  4X64 T;  4IDN A;  5L3G B;  2QGS A;  3N5L A;  3HKB E;  3I9W A;  3A5X A;  4HWD A;  2WMO A;  4TNV A;  3R84 B;  5LBQ B;  3DJB A;  2CCQ A;  3VU7 H;  2HPL A;  1LVF A;  3FZF B;  1ZOY A;  5JRC A;  4PNI A;  1D0Z A;  5HEU A;  4MHC A;  2OV9 A;  2YN6 A;  2CM0 A;  2LM9 A;  5LG4 A;  1WYC A;  2Y8D A;  3EI0 A;  3RRW A;  5F3J A;  3I1A A;  3N2O A;  3K3Q C;  2XSA A;  2Y48 B;  1OWA A;  2MAW A;  4P09 A;  1SUM B;  2XAS B;  2CWO A;  3M65 A;  2DL1 A;  3WAK A;  4C90 A;  4GYR A;  4AIU A;  2BG9 B;  2BG9 E;  4CN4 A;  2RPA A;  5JR9 C;  2W2U A;  4JI7 T;  2BG9 C;  2JPF A;  3UU3 A;  3ONX A;  3CX7 B;  3T1Y T;  1WLX A;  4IE0 A;  3ZYM A;  3Q5X A;  2VKD A;  2C5K T;  2FJA A;  1N33 T;  1IBK T;  5FXZ A;  1HS7 A;  5HEG A;  2L9Q A;  2E9X B;  4H9S E;  3QUJ A;  3AAI A;  1AJ3 A;  3PUA A;  2E9X C;  2YIN A;  1HG2 A;  2XTL A;  1Y01 A;  3OVU A;  2FUP A;  4CZZ B;  2BKN A;  4COF A;  4HFV A;  4CI3 B;  4PFO A;  5FVL A;  3KV9 A;  4P1N A;  2WDQ A;  2UUB T;  5AQU B;  3PUY F;  3CX8 B;  2DCF A;  2IIU A;  2WU2 A;  4ZZB A;  2WBL A;  3ZT7 A;  4XBF B;  3ZCJ A;  4ZS2 A;  2V7L A;  2JQH A;  1D1A A;  3LK2 B;  2VVN A;  5JH7 E;  2NW9 A;  2HPJ A;  5H6Q B;  4PK6 A;  3UUN A;  2FJB A;  3QNU A;  4LFA T;  1IAP A;  4QWN B;  2VKH A;  3JAD A;  2CLY C;  4DV1 T;  4DUZ T;  3TLW A;  2ZM8 A;  5DQV A;  5KMG P;  1I6Z A;  3J7Y q;  3RX6 A;  5FY0 A;  2WY2 A;  1WCR A;  5LHH B;  4LF9 T;  1NEN A;  3E0Z A;  2YEV C;  3ABV A;  2KWI B;  4YFS A;  3EDU A;  4EB6 E;  2CXF A;  1OXZ A;  3PUX F;  3PU8 A;  3KVA A;  3KFW X;  3RI5 A;  4OYK A;  4ILB A;  1W0A A;  4EZ4 A;  2NP9 A;  4BA9 A;  5IYZ E;  4LFC T;  4H9Q C;  4YHH T;  2D9D A;  2LSK A;  3P4Q A;  4O4I E;  3GMI A;  4UEL A;  2W0G A;  2H89 A;  3MZK B;  2WU5 A;  5L3B B;  2EHO B;  2KLQ A;  5ETW A;  3AE1 A;  1BR1 A;  3UU8 A;  3B57 A;  2EHO C;  2UXD T;  4J2C A;  3MKD A;  3O1H A;  3ZYL A;  4ILA A;  4JI2 T;  4JI6 T;  1YQ4 A;  3K3O A;  4DV4 T;  3ZC1 A;  2E2A A;  3RYF E;  2A9U A;  1KNZ A;  3PUR A;  3IF8 B;  2VWA A;  3ZST A;  4ILU A;  4QHO A;  3PUV F;  5FMN A;  4UVB B;  2W4X A;  2K24 A;  4A5X A;  2XQ8 A;  3FXD B;  4CXX A;  2D2S A;  1DU2 A;  2LEH A;  5JDN A;  4XAX B;  5M4Y A;  4O2B E;  3RIA A;  2QA7 A;  4JLE A;  2AXD S;  2PFV A;  2MPK A;  5EK3 A;  4TZ4 C;  5J2U E;  3RYC E;  1IJ6 A;  3LSV A;  2MOZ A;  3FHN A;  4L0R A;  4NUU A;  3UQ7 A;  4HGA A;  1JNR A;  5JRE A;  4OX9 T;  2SPC A;  1J5W A;  4DUY T;  2JMK A;  3AED A;  3ZKR A;  4O4J E;  4MAL A;  1ZKE A;  4B3T T;  3QK6 A;  4CQI A;  4H9N C;  2KMF A;  3FZM B;  3MAC A;  1ZHC A;  4DV6 T;  5L3C B;  3ZLI A;  2H3R A;  2DLR A;  2ZM6 T;  4BJM A;  3LFM A;  1MIY A;  3ZSS A;  2PBI A;  4UF0 B;  4X66 T;  4UIG A;  4CI2 B;  5AFU L;  2VKJ A;  2WZH A;  3AAE B;  1IJ5 A;  1OED B;  1OED E;  4A56 A;  4U72 A;  2J4G A;  2CA5 A;  3IHR A;  1OED C;  3NVO A;  3P4S A;  4H9O C;  1H7C A;  3QB5 A;  4UV8 B;  3UFG A;  2BS4 A;  1E7P A;  3OBV E;  3L39 A;  2PJQ A;  4H9R C;  5GON E;  3C98 B;  2ZM2 A;  2VKO A;  2GK9 A;  3RC3 A;  4B3S T;  4LML A;  3SFE A;  2HHH T;  2BBH A;  4QXB B;  4UXN B;  2H88 A;  5DJQ C;  3KV6 A;  2KZ7 B;  2XAJ B;  3ZMT B;  4TN7 B;  5LG3 A;  1I94 T;  1G73 A;  3SS1 A;  2WM9 A;  3BQL A;  1MMD A;  4YTP A;  3VRA A;  4BAY B;  5AQS B;  3AEG A;  2WMN A;  4JBW F;  5L3F B;  4KMC A;  3AVR A;  3CML A;  2N2N A;  3AA7 B;  4NXM T;  2XSB A;  5A1L A;  2X9Y A;  3EVY A;  2V5C A;  2YDS A;  2ZLY A;  2MYS A;  2NW8 A;  3C4W A;  5JDH A;  2DHR A;  2IUB A;  4X5T A;  4LFB T;  5KX5 E;  3EDV A;  4O4L E;  3T1H T;  3ANW A;  3UT5 E;  1S94 A;  4IST A;  3N9P A;  4HEA A;  4IDP A;  4MBQ A;  5AQK B;  2LJL A;  4ZI7 E;  3HR0 A;  3RPU A;  2A3D A;  4YHJ A;  3KIN B;  3UUM A;  1XMO T;  5LP6 E;  3IEE A;  3PUW F;  2Q9Q D;  5AQF B;  3BK9 A;  2V26 A;  4X20 E;  2LKG A;  3ZT6 A;  1UGO A;  2L3L A;  3ONL C;  2VQE T;  4UR9 A;  3RYH E;  3CQX C;  2ACX A;  2UUA T;  4MLK A;  4TWF A;  2V8S V;  2D0U A;  3PV0 F;  4C91 A;  1E2A A;  3RQW A;  2LKH A;  4LF4 T;  3WI3 A;  2X66 A;  4EAH A;  5E0O A;  3Q5W A;  2CEA A;  4DBQ A;  5ABH A;  3RQU A;  5FY1 A;  4HFD A;  4LF8 T;  4AXP A;  2KWH A;  3G06 A;  4Q25 A;  4GK5 E;  2XJ7 A;  3PE0 A;  4O8S A;  2KSR A;  2LOP A;  3PUG A;  1SA0 E;  1Z0P A;  2IML A;  3N2K E;  1YKE B;  2XQ9 A;  1D1B A;  3LG7 A;  3VKG A;  4DBR A;  2BG9 A;  2WWV A;  4FI5 A;  3QC9 A;  4DR2 T;  4MFR A;  5LHG B;  4JYA T;  1NEK A;  2UXB T;  5JDM A;  4KX6 A;  4X1I E;  3CKD A;  2NWB A;  3AEB A;  2V6Y B;  3A8Y C;  5FP3 A;  3LK4 2;  5LCY A;  2E9X A;  3OYZ A;  4GOU A;  4HWH A;  5L3D B;  5LJM A;  3FXE B;  3GN5 B;  3UUB A;  4X1K E;  5IWA T;  5L4H A;  4A97 A;  4AKL A;  4EYU A;  4KP3 C;  4F6R C;  4AQF A;  3TLV A;  5AQG B;  3LDQ B;  2H7O A;  3ZPO A;  3V5S A;  4HWC A;  1SE7 A;  1SHZ C;  1GQE A;  5HEH A;  5CJ5 A;  4ZI3 D;  2FBW A;  3PDY A;  4DVD A;  3FZH B;  3PU3 A;  3AE4 A;  4JI3 T;  4HFE A;  2N1G A;  3UFE A;  4JI0 T;  4JUY A;  4YLH A;  2PTF A;  3AE5 A;  1BR0 A;  5CGM A;  4YT0 A;  1U5P A;  3AB3 B;  2D5U A;  5HEO A;  1VOM A;  3UU5 A;  4GKK T;  2BKP A;  5HCJ A;  2CE7 A;  2IAK A;  3CK6 A;  4PFP A;  2UU9 T;  5FXW A;  3AE2 A;  2E8I A;  4LMJ A;  3CPZ A;  2CBI A;  4XZC A;  2QYW A;  4AKR B;  5CFB A;  2JRK A;  4U31 A;  1R8I A;  2K3W A;  5ABF B;  1YW0 A;  4AQF C;  4QKN A;  2WWU A;  5LYJ E;  1W09 A;  4HFH A;  2XY8 B;  3I9Y A;  4FJO A;  4DMW A;  4HFB A;  2DNX A;  2VL8 A;  2CBJ A;  5JDF A;  5LBM A;  3FB2 A;  4ISS A;  1MMA A;  2B76 A;  2EHO A;  2LLY A;  4JI8 T;  4PJN A;  2M6I A;  5JQG E;  2WAU A;  3N9L A;  1D1C A;  5ABG A;  5AQH B;  3O1J A;  2OA5 A;  5C8Y E;  3RHW A;  4G63 A;  3EHZ A;  4ANJ A;  1FEW A;  3ZT5 A;  4DO0 A;  4IL9 A;  3C4Z A;  5AQQ B;  4DV5 T;  2RA1 A;  3K8P C;  2FJE A;  4Z90 A;  5HXC A;  3CQG B;  4TUY E;  4HTE A;  3F2E A;  1YD8 G;  3Q5E A;  4HKA A;  4U7Y A;  4JI4 T;  3AE6 A;  5LMU T;  2XAG B;  1LVK A;  1YQ3 A;  3RC8 A;  1HNX T;  3N9O A;  1YKH B;  3JC6 C; 
#chains in the Genus database with same CATH homology
 5DQW A;  3O1I A;  1IJ5 A;  1HF8 A;  3F31 A;  4N78 D;  1HTJ F;  2CXD A;  5JR9 B;  2VB6 A;  4QXC B;  4A56 A;  3FBZ A;  2C5J A;  4U72 A;  3C51 A;  3F57 A;  2CA5 A;  3IHR A;  4OHF A;  4JEU B;  4GIW A;  2NOX A;  4HN9 A;  3VHL A;  4AI6 A;  5H6R B;  3W15 B;  4IDZ A;  4H9O C;  4IE6 A;  2W63 A;  1H7C A;  4IE5 A;  4EZH A;  4I4T E;  2Q9Q B;  4ZI2 D;  3LBX A;  4UV8 B;  5BMV E;  2BVL A;  2P9B A;  3CX6 B;  3ANW B;  3CWZ B;  3OBV E;  3PTR B;  2PJQ A;  4WBN E;  4H9R C;  2BDE A;  4PK4 A;  4O4H E;  1CUN A;  5GON E;  3C98 B;  4WW0 A;  2ZM2 A;  3R6N A;  5JRC B;  2VKO A;  2GK9 A;  3RC3 A;  3AA0 B;  4H63 V;  5FXV A;  2LSY A;  4QXB B;  4UXN B;  5DJQ C;  3KV6 A;  1UX5 A;  5JDQ A;  3L3P A;  4I50 E;  2KZ7 B;  2XAJ B;  4P0A A;  3ZMT B;  2D0T A;  4AKH A;  4WBO A;  4TN7 B;  3E22 E;  4QX8 B;  1G73 A;  3SS1 A;  2MBG A;  1MIW A;  5LOV E;  3V5U A;  2WM9 A;  3N9N A;  5FY7 A;  4UF0 A;  2ZMA A;  3BQL A;  4Z8X A;  1MMD A;  3N9M A;  3Q9D A;  3UUX B;  2UXX B;  2M67 A;  4BAY B;  1FIO A;  2WMN A;  5L3F B;  4CI1 B;  3HI2 A;  4KMC A;  3AVR A;  3CML A;  2N2N A;  3AA7 B;  5J1G A;  5JR9 A;  4X1Y E;  4G2A A;  2LSJ A;  1D0X A;  3C64 A;  2N9D A;  5A1L A;  2X9Y A;  1KK7 A;  1UCU A;  3EVY A;  2UXN B;  3S4U A;  4UV9 B;  3ZMZ B;  2ZLY A;  1V9D A;  2MYS A;  3HKC E;  2XAF B;  4E7S A;  5TAO A;  2NW8 A;  1MIV A;  2X0L B;  3C4W A;  4ADZ A;  2DHR A;  5CB4 E;  5JDH A;  3ESL A;  2V7I A;  5HWX A;  2JQQ A;  2CLY B;  5KX5 E;  2JMH A;  3C50 A;  4OFZ A;  3ZJ2 A;  5L3G B;  3EDV A;  1HX8 A;  2KXP B;  2QGS A;  3KBU A;  1WYB A;  2Q9Q A;  4ERR A;  5HXE A;  3DTO A;  5LGU B;  3P7I A;  3E08 A;  2LSI A;  3HKB E;  1U4Q A;  2CXL A;  3N5L A;  3I9W A;  4IHJ E;  4O4L E;  3WAJ A;  3A5X A;  3SRZ A;  1X79 A;  4IE7 A;  2WMO A;  3R84 B;  3KBT A;  5LBQ B;  3ANW A;  3DJB A;  3UT5 E;  2IC6 A;  2CCQ A;  2W62 A;  2NTX A;  3VU7 H;  3U3I A;  1MMN A;  4GK0 E;  2HPL A;  3PUS A;  1LVF A;  1S94 A;  4IST A;  4UEM A;  5JRC A;  4EOZ B;  4PNI A;  2CMR A;  1D0Z A;  2V7M A;  2KND A;  3N9P A;  2V7K A;  4MHC A;  3UUL A;  1B7T A;  2DWG A;  4HEA A;  4MBQ A;  2CM0 A;  2C5I T;  2LM9 A;  5LG4 A;  2LJL A;  1WYC A;  2Y8D A;  4ZI7 E;  3RRW A;  3HR0 A;  3RPU A;  4GYS A;  5F3J A;  3I1A A;  2CWY A;  2LSG A;  3HA4 A;  3RKO A;  3N2O A;  5KDM C;  2L8K A;  2A3D A;  4YHJ A;  3K3Q C;  3KIN B;  1WRD A;  3UUM A;  3KVB A;  3FBL A;  2Y48 B;  5LP6 E;  2I59 A;  2IW5 B;  1OWA A;  3IEE A;  2LHR A;  3AA6 B;  2Q9Q D;  4P09 A;  4OK0 A;  2XAS B;  2CWO A;  1HCI A;  3M65 A;  3WAK A;  4C90 A;  2K5B B;  4GYR A;  3BQK A;  4CXW A;  2XQY A;  5IHY A;  3KV4 A;  3T8O A;  3BK9 A;  5DAB A;  3SWH A;  2V26 A;  3RYI E;  5JR9 C;  3NZQ A;  4X20 E;  1US7 B;  3RH3 A;  3HKD E;  3I0Q A;  2L3L A;  2JPF A;  2PG8 A;  2XUE A;  4I43 B;  3LK3 B;  4QX7 B;  3RYH E;  3ONX A;  2ZM0 A;  2G0U A;  3CQX C;  3CX7 B;  1WLX A;  3ZN1 B;  4IE0 A;  3B13 A;  3ZYM A;  2Q9Q C;  4ZHQ E;  3Q5X A;  2ACX A;  2RP4 A;  2VKD A;  2C5K T;  3KDS E;  4MLK A;  5FYM A;  2JJ9 A;  1HS7 A;  3MK7 C;  3CVR A;  3ETV A;  5FXZ A;  4EYY R;  3KV5 A;  2L9Q A;  2E9X B;  2D0U A;  4H9S E;  1QSD A;  3ZCI A;  3QUJ A;  4C91 A;  3AAI A;  1AJ3 A;  2XHE B;  5JVD E;  3N2G E;  5HYA A;  1MNE A;  3PUA A;  5LHI B;  4OYJ A;  5HAX A;  4I55 E;  3LJC A;  4UVA B;  3WI3 A;  2X66 A;  3ZEF B;  4EAH A;  2E9X C;  2YIN A;  1HG2 A;  5JDL A;  2XTL A;  5E0O A;  4ZOL E;  3Q5W A;  4CZZ B;  4UVC B;  5LXT E;  2X9H A;  4HFV A;  2CEA A;  4DBQ A;  4KUM B;  4CI3 B;  3OKQ A;  1E1H B;  4PFO A;  2NTY A;  1LKX A;  2DI4 A;  3KV9 A;  2X68 A;  1BR2 A;  5FY1 A;  2ES0 A;  4AXP A;  2KWH A;  4DND A;  3ZJ1 A;  4YJ2 E;  3CX8 B;  2DCF A;  4GK5 E;  2IC9 A;  5EK2 A;  4V1A v;  4NUV A;  3PE0 A;  4O8S A;  2LHN A;  2J1D G;  4U74 A;  2LOP A;  3PUG A;  1SA0 E;  1Z0P A;  3N9Q A;  4KBM B;  3N2K E;  1YKE B;  1WR6 A;  1D1B A;  2WBL A;  2KT9 A;  3LG7 A;  4XBF B;  2A2F X;  3VKG A;  3NRY A;  4DBR A;  3ZCJ A;  4ZS2 A;  4FI5 A;  1Y64 B;  1VRB A;  2V7L A;  3QC9 A;  4K0U A;  4B6X A;  4MFR A;  1G8X A;  5LHG B;  1D1A A;  3LK2 B;  5JH7 E;  4IIJ E;  2NW9 A;  2ODV A;  2HPJ A;  5LJN A;  5H6Q B;  4CXY A;  4PK6 A;  3UUN A;  5JDM A;  3U78 A;  1IAP A;  4QWN B;  2K9A A;  2VKH A;  4X1I E;  3CKD A;  4M1P A;  2CLY C;  2Y6X A;  5HXR A;  3OYX A;  5ADX L;  5L3E B;  3H37 A;  4EXT A;  2NWB A;  2ZM8 A;  5DQV A;  5KMG P;  3J7Y q;  3MA9 A;  3RX6 A;  5FP3 A;  5FY0 A;  3LK4 2;  5LHH B;  5LCY A;  2E9X A;  2V1D B;  3E0Z A;  1HFA A;  2YEV C;  2KWI B;  3UTK A;  4YFS A;  1QUU A;  3OYZ A;  4GOU A;  3ZN0 B;  3ZYK A;  4DMV A;  5L3D B;  3JC6 C;  3EDU A;  4EB6 E;  2CXF A;  3RRC A;  3SOL A;  1OXZ A;  5LJM A;  3PU8 A;  5CA0 E;  4PJL A;  3FXE B;  3KVA A;  1D0Y A;  3KFW X;  4TV9 E;  3GN5 B;  4OYK A;  4X1K E;  1O3X A;  3TKL B;  4AKL A;  2YU2 A;  2Z6E A;  4EYU A;  2V7J A;  4WNK A;  4KP3 C;  4F6R C;  4AQF A;  4EZ4 A;  2NP9 A;  4BA9 A;  5IYZ E;  5FNV E;  4YJ3 E;  4H9Q C;  2H7O A;  4ZS3 A;  4BJN A;  3ZPO A;  3V5S A;  1SHZ C;  1T98 A;  3GWH A;  5JDG A;  2LSK A;  1FMV A;  4ZI3 D;  4O4I E;  2BZB A;  3GMI A;  3GA8 A;  4UEL A;  2W0G A;  3CQC B;  4TV8 E;  2B1E A;  3MZK B;  2E9X D;  2K48 A;  2NW7 A;  3PDY A;  5L3B B;  2EHO B;  3ZMU B;  2KLQ A;  5FXX A;  5ETW A;  3AVS A;  4DVD A;  4QXH B;  3PU3 A;  5LGT B;  1BR1 A;  3B57 A;  2EHO C;  3BQI A;  2C0S A;  2N1G A;  3UFE A;  1LRZ A;  2X9X A;  4IGU A;  3L09 A;  2WSS V;  1ZEE A;  3DP7 A;  4JUY A;  4YLH A;  1BR0 A;  3ZMS B;  4J2C A;  2X51 A;  3MKD A;  4AQG A;  3O1H A;  3ZYL A;  3NZP A;  3I0O A;  2VAS A;  1U5P A;  3K3N A;  3O4X E;  3K3O A;  2VK9 A;  3AB3 B;  5CA1 E;  2D5U A;  3H3A A;  4ZI3 C;  1VOM A;  3ZC1 A;  5HWY A;  3RYF E;  1KNZ A;  3PUR A;  3IBP A;  3HL6 A;  2CE7 A;  2IAK A;  2LT3 A;  4PFP A;  5FXW A;  2E8I A;  3IF8 B;  2VWA A;  2DWK A;  3CPZ A;  4ILU A;  4QHO A;  2ODU A;  4XZC A;  4EIW A;  2W61 A;  3AA1 B;  1NWM X;  4JEH B;  3D0T A;  4AKR B;  4PK5 A;  4H9P C;  5FMN A;  4H63 H;  2JRK A;  4UVB B;  3P8C D;  4IE4 A;  3GN5 A;  1S35 A;  2K24 A;  3FXD B;  3AAA B;  4CXX A;  1YW0 A;  2D2S A;  4AQF C;  4QKN A;  5LA6 E;  2LEH A;  2BVM A;  2WWU A;  3ETU A;  5LYJ E;  5JDN A;  4XAX B;  2X9W A;  1HG5 A;  4ZI2 C;  5M4Y A;  4O2B E;  2QA7 A;  3I9Y A;  4FJO A;  4JLE A;  4TX5 A;  2PFV A;  4DMW A;  4PJM A;  3ZMV B;  3J9X 1;  3MXZ A;  5EK3 A;  2DNX A;  2LE8 A;  3OJA A;  4TZ4 C;  2VL8 A;  5F8P A;  5JDF A;  5LBM A;  5J2U E;  3FB2 A;  3MJX A;  1ZV4 X;  4ISS A;  1IJ6 A;  4O2A E;  2MOZ A;  1IZN B;  1MMA A;  1NAF A;  3RYC E;  4L5G A;  5EZY E;  2HH7 A;  3FHN A;  2EHO A;  1MND A;  2XAH B;  4L0R A;  4PJN A;  5JQG E;  2WAU A;  3Q2M A;  4AKG A;  2X67 A;  3N9L A;  1D1C A;  4NUU A;  4HGA A;  4E7Z A;  5JRE A;  3O1J A;  5LNK A;  2OA5 A;  2KIN B;  3LBX B;  2SPC A;  5C8Y E;  4L9I A;  3ZC0 A;  2MTQ A;  3C4X A;  3EUH A;  1FMW A;  2JMK A;  1UX4 A;  4G63 A;  5HXS A;  5J2T E;  4O4J E;  4MAL A;  2W00 A;  1BR4 A;  1FEW A;  4ANJ A;  4DO0 A;  3HKE E;  1ZKE A;  3C4Z A;  5L2L A;  3QK6 A;  3PUQ A;  4CQI A;  4H9N C;  2KMF A;  3JC6 D;  1MMG A;  2RA1 A;  3K8P C;  3MAC A;  1ZHC A;  4P0B A;  2YU1 A;  5L3C B;  3ZLI A;  5LGN B;  5HXH A;  2H3R A;  4PJJ A;  2DLR A;  5HXC A;  5EK4 A;  3CQG B;  4BJM A;  4HE8 A;  3LFM A;  4TUY E;  2H7V C;  1MIY A;  4HTE A;  3F2E A;  1YD8 G;  2EHO D;  3NBX X;  4HKA A;  2PBI A;  3VKH A;  4AKI A;  4ASK A;  2XAG B;  4UF0 B;  4PAG A;  1EZ3 A;  3NRX A;  1LVK A;  4UIG A;  2YK0 A;  3O9X A;  4CI2 B;  2XAQ B;  5AFU L;  2VKJ A;  3RC8 A;  4PW8 A;  3AAE B;  3N9O A;  2LOS A;  1YKH B;  2A72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...