2M67A

Full-length mercury transporter protein merf in lipid bilayer membranes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
b'MKDPKTLLRVSIIGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASSTPKFNGVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MerF
publication title The Structure of the Mercury Transporter MerF in Phospholipid Bilayers: A Large Conformational Rearrangement Results from N-Terminal Truncation.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Transport protein
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2m67A00
2MOZA 2M67A
chains in the Genus database with same CATH superfamily
4QWNB 4EB6E 2WMNA 3O1IA 5JR9C 2W2UA 4JI0T 4HFIA 4CI2B 2X9YA 4DBQA 2ZM0A 1SE7A 2M6IA 3OYXA 4YXDA 3CX7B 4IE7A 2K3WA 3O4XE 2KMFA 1L0VA 4G63A 2MTQA 4EV6A 3M3ZB 4YTNA 4XBFB 4AKGA 4LMLA 1HX8A 4ILAA 2ZM8A 2DLRA 1YKEB 3J7Yq 2E5LT 3C4WA 5L3DB 4ZS2A 3ESLA 5AQPB 4O8SA 5LB7B 1HX1B 1KFYA 2BKPA 2VL8A 2YU1A 3FBLA 3UQ4A 2H89A 4WBNE 3HI2A 2N2NA 2XPKA 4KHPT 3P4SA 4P0AA 1T7SA 4IL9A 4UIGA 5EK4A 3CQGB 4GKKT 4JI4T 1VOMA 2JMHA 4AQYT 4HFDA 4DV1T 4OHFA 3ZEFB 4DUZT 4H9SE 1OEDA 1YKHB 3AXJB 2UUAT 3KBTA 3PUQA 1T8BA 4LF8T 1SA0E 4H9NC 2IHR1 3ZJ1A 2N1GA 3EAMA 3PUVF 4JI8T 4DV3T 3DTOA 5FXXA 3LDQB 3AEAA 2I6HA 1MIVA 4LF9T 2GK9A 4JBWF 3ZC1A 2VASA 5JR9A 4COFA 1OWAA 4V1Av 2WY2A 3NWIA 3K8PC 5JDNA 3P4QA 3OYZA 1N32T 2VKHA 1J1JA 3KVAA 2I59A 2VQET 2C0SA 5ABFA 3JCFA 4ILBA 1D0YA 1W0BA 4NXNT 3I0OA 3JAFA 2CBIA 5HYAA 3EHZA 4A5XA 4BAYB 1S94A 2L8KA 3ZT5A 1MMGA 1UX4A 1E2AA 1R8IA 2LOPA 2W62A 3NRYA 4GIWA 5AQGB 1LVKA 5AQUB 2X66A 4I55E 1BR0A 2PFVA 2VVSA 4IDOA 5HWYA 4WBOA 5HXHA 3C50A 2LOSA 1HTJF 2IUBA 2VKDA 4C90A 3RKOA 1EZ3A 1OEDE 3PUYF 3KV9A 3N9MA 3AE2A 3FZFB 4UEMA 4U3CA 5ADXL 4LF4T 4KUMB 4U33A 3BQKA 3JAEA 1XMQT 2NOXA 3SRZA 3U3IA 3HKEE 1ZHCA 2Y8DA 1T98A 2X0HA 3AEDA 1MIYA 4PFOA 2VVNA 2JMKA 2ACZA 3TKLB 2A2FX 2CE7A 5EZYE 3C4XA 1WCRA 1VCSA 4YLHA 4O4HE 4ISSA 4PJNA 3HKDE 4I0UA 4ZXLA 4MBQA 1W09A 3UUXB 4YSXA 2J1DG 1CHUA 3L3PA 1UGOA 1AJ3A 4IHJE 5AQNB 4AXPA 1WLXA 4B3TT 2WU5A 3ZMZB 1X9BA 3FZHB 4H9QC 2Z6EA 3AEEA 2X0LB 5LCYA 3RHWA 3EDVA 3ZT6A 1NEKA 2WZIA 2LRKA 2JQQA 3AE3A 4DV5T 3RGLA 3CMLA 3E08A 3FZKB 1JNZA 3UU4A 5HWXA 2LSIA 3UU8A 3N9PA 1IJ5A 2V1DB 2YDRA 3OJAA 4XZCA 2LLYA 4LFBT 4IDPA 2H3RA 5FL0A 5L4HA 3HKCE 5FNVE 5L3GB 5J1GA 5CA1E 1ZP0A 1YD8G 2XY8B 3TLVA 4KBMB 3I1AA 3N5LA 4YY3T 4O2AE 4DNDA 2X68A 5FYMA 5JR9B 5M4YA 3IBPA 5LGUB 4I43B 4PAGA 2QVAA 2V8SV 1FJGT 1HF8A 3RX6A 2W4XA 3B5MA 2YINA 1KNZA 2HPJA 3RC8A 4B6XA 2DCFA 3AA0B 2OLTA 4JLEA 3MKDA 4QH1A 4K0UA 3RI5A 2WBLA 2C5JA 4DV7T 5L2LA 3HL6A 3K1SA 2LEHA 3O9XA 5AQHB 5LNKA 3ETVA 2ODVA 4YJ3E 5L4EA 2KZ7B 4DR1T 4HFVA 3G06A 5AQOB 3ABVA 3AB3B 3IF8B 4EYYR 2HN2A 2DL1A 2V26A 2XQYA 2EHOB 4UVBB 2WDVA 3RIAA 3N9OA 1I6ZA 2HH7A 2WMOA 4MLKA 2WZHA 5LYJE 4EOZB 4WZXA 2B1EA 3LK2B 2HN1A 4U74A 2LSJA 4JEHB 4U2ZA 3CVRA 5LA6E 4PK6A 5JH7E 2NR4A 2BS4A 4G2AA 4DR3T 4EYUA 4IDQA 4DR5T 5AQMB 3AE8A 2H7VC 4U7YA 2NP9A 1HFAA 3JADA 2XQ4A 3H3AA 2IIUA 2NTYA 2ZM2A 1IAPA 4DMWA 4LFCT 3NVOA 3WAKA 5A1LA 5AQLB 3RYFE 2JQ9A 5JTGA 2CWYA 5JVDE 3RC3A 1MNEA 1SUMB 2KLQA 4IE5A 5IUXA 1NAFA 4HWCA 3MZKB 3RKGA 2YU2A 3NZPA 3LJCA 3ONJA 4Q25A 2H7OA 4F8HA 4L5GA 2RP4A 3UUMA 1UK5A 2F4VT 3VRAA 3CWZB 4DBRA 4KP3C 2BKNA 2L9QA 5JDHA 4CI3B 3PU3A 2UUBT 4GK5E 4OYJA 3Q5EA 2UU9T 2VQFT 5L3BB 5HXEA 3LK3B 4PK4A 5JRCA 2MYSA 2J47A 4I4TE 4EEDA 3AAIA 4TZ4C 4ZI3D 3AE4A 3F57A 4ZI2D 3PJAA 2CPTA 5FVKA 3PUXF 1M7KA 4DUYT 4IGUA 2OV9A 3UFGA 3RH3A 3A5XA 5L3CB 4BA9A 2X9WA 5FXWA 5DQVA 3EVYA 2LHRA 1N34T 3FXEB 5AQFB 1J5WA 1M62A 5J2TE 3ZKRA 4HFCA 1QUUA 2LKGA 4YFSA 3ANWB 5ETWA 3ZJ2A 3N9QA 3I0QA 3RIFA 2HPLA 3NKZA 4NUVA 1Z0PA 4UF0B 2VB6A 2V7IA 3OPCA 5HCMA 1LRZA 2XQ7A 2XSAA 2ODUA 2WCAA 3N2OA 1IZNB 5FL1A 3F2EA 3CQCB 3QK6A 2PJQA 2LJLA 2JJ9A 5JDMA 3EDUA 3KFWX 2X51A 5HEOA 4ZI7E 3J9X1 4X64T 1JNRA 5JQGE 4CN4A 4I50E 2C5IT 4H63V 5L3EB 2BZBA 3DJBA 2E8IA 3T8OA 4JI7T 2QRXA 5FY7A 4KI0F 4LF5T 3N2GE 3RPUA 2P9BA 3CIRA 5LHIB 3AE5A 1MMNA 4IIJE 4IREA 1HNXT 4X1YE 5TAOA 2CM0A 3QOFA 4FJOA 2OA5A 3PJAJ 2XJ7A 3GN5B 4QXHB 5HEUA 2XHEB 4O4JE 3P4WA 4X5TA 1YW0A 2LHNA 2VKOA 1D1AA 2WWUA 5DJQC 5BMVE 3SOLA 3VKGA 5HEHA 3Q5WA 2BKOA 4P09A 2IW5B 2H88A 4UR9A 2XAHB 4DVDA 2ZLYA 2V7JA 2E9XB 1N33T 2Y48B 2UXDT 1DU2A 5LGNB 3KDSE 5C3JA 4E7ZA 2J4GA 1VCTA 4Z8XA 2JQHA 2WS3A 3UU6A 4NUUA 4TN7B 1XNQT 2V6YA 2XUEA 3C4ZA 3AAAB 4AKRB 2LM9A 4U31A 4NXMT 4TUYE 4IE0A 5LG3A 2Q9QD 3CX6B 3VRBA 1UCUA 1XZYA 1KF6A 2RPAA 3AVRA 2X67A 5JREA 2XM2A 3WI3A 4PJMA 2CHNA 4QH4A 1G8XA 4LF6T 2R6GF 4AQFC 4Z90A 3HR0A 2B76A 4MHCA 3C98B 1J5ET 1Y64B 1WR6A 3S4UA 4IE6A 2BVLA 3PUWF 1O3XA 4DIDB 3RQWA 4ZI3C 3AE1A 2K5BB 4JI6T 2L3LA 4ZI2C 3AA6B 5KX5E 5AQIB 4Z91A 3ZSSA 4HWFA 4KMCA 2LM2A 4C91A 4H9PC 4TWFA 1KNRA 1HG2A 4QX7B 1UUSA 1N36T 2DNXA 2YN6A 5EK3A 5LBQB 3R84B 4H9RC 5KXJA 3VKHA 2YK0A 3PURA 4LMKA 3HKBE 5FP3A 4ZZBA 1ZOYA 3P4RA 1IJ6A 4AI6A 1MNDA 1OEDB 4XAXB 3K3QC 4NPPA 4OFZA 5C2TA 4TWHA 3MXZA 2W67A 5AFUL 4PK5A 2A72A 2CWOA 3A8YC 3RLFF 2D5UA 3PE0A 3TLWA 1G73A 3FZMB 2YEVC 2K48A 5AQJB 4HFEA 2XQ8A 3TLSA 4CXWA 1UX5A 2CXDA 4JYAT 2V7KA 1V9DA 4IDNA 3SS1A 4AQFA 3RIUC 1FMWA 4EZ4A 3ZMVB 5ABFB 2YOEA 2V7LA 3GWHA 5F5WA 3Q2MA 4X66T 2UXBT 4CZZB 3V5SA 3H37A 3OVUA 3Q9DA 2WDRA 1XWMA 3O1HA 2CBJA 4AKLA 2AE9A 2XQ5A 3QNUA 3BK9A 5AQKB 1ZKEA 2EHOD 1WRDA 2PBIA 1HR0T 3X1DA 2CCQA 3ZMTB 5AQTB 2BG9C 2N9DA 1ZV4X 3VR9A 4U2YA 4ZS3A 2WSSV 4CI1B 2J62A 2LSGA 1HNZT 4GYSA 3FZLB 4DR6T 3LFMA 1KEYA 2QA7A 2UXXB 3IA3A 2V7MA 3PU8A 3U78A 2Q9QC 2CEAA 3R6NA 3RRWA 2NW7A 3SFDA 4TV9E 2W63A 4TWDA 4O2BE 2WB5A 1HNWT 2W66A 2BBJA 1BR4A 3BQIA 2XAJB 3AXJA 2BS3A 3PUAA 2V5DA 5CA0E 1IBLT 1BR2A 1YQ3A 4YSYA 2WM9A 3O1JA 5FMNA 5ABGA 4PFPA 4O4IE 2CA5A 4TNVA 5HEGA 3AA7B 5FXVA 2ACXA 5CJ5A 4B3MT 4JI3T 4DV4T 1UURA 3I9YA 4UV9B 3ZLIA 5JDLA 3RIUA 2LSKA 2LT3A 2M67A 4DR2T 4X62T 2K9AA 3EI0A 4OX9T 4MFRA 4UXNB 3L09A 5AQVB 4QH5A 4PJJA 2X9XA 4HKAA 4X1IE 3GMIA 4B3RT 3FXDB 3K3NA 4IDZA 4AKIA 4QX8B 5FXZA 3EUHA 2HHHT 2DWGA 5LOVE 3Q5DA 2BBHA 2DI4A 4DO0A 3RF1A 3CK6A 4ZOLE 2JPFA 4JEUB 1MIWA 3NZQA 1NWMX 2BG9A 1WFDA 3V5UA 3T1HT 4ADZA 4EGWA 3ZCIA 2M6BA 2YDQA 5JDGA 4CQIA 2VL0A 3ZYKA 3CPZA 4HN9A 3B13A 2WU2A 2Q9QA 4L9IA 2QYWA 4IE4A 2MAWA 2WP9A 4PNIA 4GOUA 4DMVA 4TX5A 4JV5T 4EXTA 2XQ6A 3OKQA 3UUBA 2ZMAA 1WYCA 2WQYA 1U4QA 4EEBA 3VU7H 1U5PA 3AEFA 3PUGA 4F6RC 1ZEEA 4BJMA 5JDQA 2XAQB 3FB2A 4DV2T 2D0TA 3CX8B 3GA8A 4DR7T 2MPKA 4JI2T 1NENA 3PUSA 1BR1A 4GK0E 1FEWA 1KNPA 5HXRA 2VKJA 2SPCA 2NWBA 1D0ZA 4H9OC 5CGMA 5LGTB 3P7IA 5DABA 2EHOC 2A3DA 1US7B 4ILUA 2CLYC 5L47A 2E5VA 5CB4E 5LP6E 4YHHT 3N9NA 1XDPA 4YJ2E 1HS7A 2BG9E 2BS2A 1SHZC 5J0ZA 1CUNA 2PG8A 2W61A 3ZN1B 3ZCJA 4EIWA 4HTEA 4K0KT 2ES0A 4P1NA 2XSBA 4HEAA 2UUCT 4KHZF 3DP7A 4TNWA 2VK9A 3LG7A 1Z8UA 2KNDA 2CXLA 2E9XD 3RQUA 4YTMA 4P0BA 4X1KE 2LKHA 2X9HA 4U7IA 2V5CA 3UU3A 1QLBA 4ASKA 4QXCB 2FBWA 3UULA 2RA1A 3RYIE 3P8CD 5EK2A 1MMAA 1XNRT 5AQRB 5IHYA 3C64A 4EZHA 3N2KE 4X65T 4N78D 5BR8T 1YXRA 1OXZA 5KMGP 2NW9A 3K3OA 2IC6A 2KSRA 4WW0A 4B3ST 2XQ3A 2NW8A 4ISTA 4GYRA 2XM1A 2A9UA 5F3JA 5L3FB 2LRLA 4TV8E 3AECA 4HWDA 3QB5K 3AEGA 3KV5A 2VWAA 2BG9B 3ONLC 2D9DA 3RYCE 4HWIB 1WYBA 1GQEA 2EHOA 3WAJA 5F8PA 5JRCB 1IBKT 3AA1B 1H7CA 3D0TA 3KBUA 2IMLA 5KDMC 5ABHA 2FJAA 4H63H 3NRXA 2Q9QB 3Q5XA 3QB5A 1IBMT 2UXNB 4L0RA 5IWAT 5IYZE 5LHGB 4EAHA 1QSDA 4ZEYA 2E2AA 1XMOT 5JDFA 3PTRB 2XASB 2CXFA 2ZM6T 2CHOA 2NTXA 3FHNA 3L8RA 3ZMSB 4HFHA 5LBMA 3W15B 2JIWA 1D0XA 3AE6A 3JC6D 1LKXA 3ONXA 4CN1A 4ILCA 4CXXA 3C51A 2WDQA 1E7PA 5LXTE 2CMRA 3AE9A 3HA4A 4YT0A 4AKHA 2IDOB 3LBXA 2FJEA 1FMVA 3AVSA 1I94T 3ZPOA 2FUPA 2AXDS 3UQ7A 5LMNT 1X79A 4NIQA 5HCJA 1Y01A 3UTKA 2JRKA 5LMUT 3E0ZA 3UT5E 3RRCA 3OBVE 3RYHE 1WR0A 5C8YE 4YSZA 2W00A 3B57A 4AIUA 3KV4A 4HE8A 4FI5A 2K24A 4QHOA 2XQAA 3OTOT 2FJDA 2KWIB 3AE7A 4QKNA 5H6RB 2YKSA 3QC9A 1HCIA 4GKJT 4JI1T 2KWHA 4PJLA 2KINB 3UFEA 4LFAT 3LSVA 4WNKA 4ZZCA 3PUZF 4X20E 3MJXA 2BVMA 2WWVA 3H3MA 4OYKA 3IHRA 4JUYA 4DR4T 2E9XC 2QGSA 3F31A 4J2CA 4M1PA 4HFBA 4ERRA 2G0UA 3ZMUB 2JQKA 5HXSA 3UU5A 2VURA 3ANWA 4YTPA 1VRBA 3FBZA 2XAFB 5FY1A 3CQXC 2V6YB 4O4LE 3KV6A 2XZEA 4UF0A 4UVAB 2X0YA 2MOZA 4UVCB 5E0OA 1FIOA 5LG4A 5LHHB 5J2UE 1E1HB 1W9RA 2Y6XA 4DV0T 3ZN0B 4UV8B 3A7MA 4AISA 2PTFA 2XQ9A 4LMJA 5H6QB 3VHLA 3KINB 4WYVA 3UUNA 3M65A 3NBXX 2KXPB 4OK0A 4PW8A 4HWHA 5HXCA 3ZYLA 2LSYA 2CLYB 4BJNA 3P50A 3T1YT 2DWKA 2C5KT 2D2SA 5FKYA 3PDYA 3LK42 5DQWA 3AAEB 3SFEA 2CRBA 2IAKA 2WAUA 3ZT7A 5CFBA 4DV6T 3GN5A 5HAXA 1D1CA 2MBGA 5FY0A 4JI5T 5ABEA 3ETUA 4MALA 3IEEA 3MK7C 5FVLA 5GONE 3I9WA 3L39A 3BQLA 3P4PA 5LJMA 2YDSA 1XDOA 5LJNA 3VR8A 4A98A 2V6XA 2DHRA 1HG5A 4CN6A 4IL4A 3CKDA 2KT9A 2LE8A 3TLUA 1MMDA 3N9LA 4IT4A 3QUJA 3SWHA 5AQQB 2E9XA 3JC6C 4A97A 3PV0F 4YHJA 1D1BA 2UXCT 4A56A 3LBXB 2W0GA 4QXBB 4LF7T 2IC9A 3AEBA 1KK7A 1S35A 2XAGB 3ZYMA 2FJBA 4HGAA 5AQSB 1OEDC 4E7SA 2XTLA 2I0MA 3EABA 3ZC0A 4CXYA 4AQGA 1B7TA 2D0UA 4U72A 1T72A 5HEJA 1LVFA 3MACA 4KX6A 4ANJA 4UELA 4ZHQE 1W0AA 3KVBA 3TLTA 1YQ4A 2BDEA 3ZSTA 3MA9A 3E22E
chains in the Genus database with same CATH topology
4QWNB 4EB6E 2WMNA 2DNXA 4ASKA 4QXCB 3O1IA 2V26A 5EK3A 2RA1A 5LBQB 3UULA 5JR9C 3RYIE 3P8CD 3R84B 5EK2A 1MMAA 4CI2B 2XQYA 2X9YA 4DBQA 4H9RC 2ZM0A 2EHOB 3VKHA 4UVBB 2YK0A 3PURA 5IHYA 3N9OA 3OYXA 3C64A 4EZHA 3N2KE 3CX7B 2HH7A 3HKBE 2WMOA 4IE7A 3O4XE 4MLKA 5FP3A 2KMFA 5LYJE 4EOZB 4N78D 4G63A 2MTQA 1IJ6A 4AI6A 1OXZA 4XBFB 4AKGA 5KMGP 1HX8A 2NW9A 2B1EA 1MNDA 3LK2B 3K3OA 2IC6A 4XAXB 2ZM8A 4U74A 4WW0A 2DLRA 1YKEB 3K3QC 3J7Yq 2LSJA 4OFZA 3C4WA 5L3DB 4JEHB 2NW8A 4ZS2A 4ISTA 3MXZA 5AFUL 4PK5A 3CVRA 3ESLA 4GYRA 5LA6E 4PK6A 5JH7E 2A72A 2CWOA 4O8SA 5F3JA 4G2AA 5L3FB 4EYUA 2D5UA 2YU1A 4TV8E 2VL8A 3FBLA 3PE0A 4WBNE 3KV5A 2VWAA 1G73A 3HI2A 2N2NA 2K48A 2YEVC 2H7VC 3RYCE 4CXWA 1UX5A 2NP9A 1HFAA 1WYBA 4P0AA 2EHOA 3WAJA 2CXDA 4UIGA 2V7KA 1V9DA 5F8PA 5EK4A 5JRCB 3AA1B 3CQGB 1H7CA 3H3AA 3SS1A 3D0TA 3KBUA 4AQFA 5KDMC 2NTYA 1VOMA 2JMHA 2ZM2A 1IAPA 4DMWA 4H63H 1FMWA 3WAKA 5A1LA 3NRXA 4EZ4A 3RYFE 2Q9QB 3ZMVB 2CWYA 5JVDE 3Q5XA 3RC3A 4OHFA 3ZEFB 4H9SE 2V7LA 2UXNB 3GWHA 4L0RA 1YKHB 1MNEA 2KLQA 4IE5A 1NAFA 3Q2MA 5IYZE 3MZKB 5LHGB 3KBTA 2YU2A 3NZPA 4EAHA 3LJCA 3V5SA 1QSDA 3H37A 3Q9DA 4CZZB 3PUQA 2H7OA 5JDFA 3O1HA 4AKLA 3PTRB 2XASB 2CXFA 2RP4A 4L5GA 2NTXA 3UUMA 3FHNA 3ZMSB 1SA0E 3BK9A 4H9NC 5LBMA 3ZJ1A 3W15B 3CWZB 2N1GA 4DBRA 1ZKEA 2EHOD 1WRDA 4KP3C 1D0XA 2PBIA 2L9QA 3JC6D 5JDHA 4CI3B 2CCQA 3PU3A 3ZMTB 1LKXA 2N9DA 3DTOA 4GK5E 3ONXA 4OYJA 1ZV4X 5FXXA 4CXXA 4ZS3A 2WSSV 1MIVA 2GK9A 3C51A 3ZC1A 5L3BB 2VASA 5HXEA 4CI1B 3LK3B 4PK4A 2LSGA 5JR9A 4GYSA 2MYSA 5LXTE 5JRCA 1OWAA 2CMRA 3HA4A 4V1Av 4AKHA 3LFMA 2QA7A 2UXXB 4I4TE 3K8PC 5JDNA 3LBXA 1FMVA 2V7MA 3AVSA 3OYZA 3PU8A 3U78A 3AAIA 2VKHA 2Q9QC 2CEAA 3R6NA 3KVAA 2NW7A 3RRWA 2I59A 3ZPOA 4TZ4C 4TV9E 2C0SA 4ZI3D 2W63A 4O2BE 3F57A 4ZI2D 1D0YA 1X79A 3BQIA 1BR4A 2XAJB 3I0OA 4IGUA 5HYAA 4BAYB 3PUAA 1S94A 3UTKA 2JRKA 3A5XA 3RH3A 5L3CB 4BA9A 2L8KA 2X9WA 5CA0E 5FXWA 5DQVA 3E0ZA 3UT5E 1MMGA 3RRCA 3EVYA 2LHRA 3OBVE 3RYHE 1UX4A 3FXEB 5J2TE 5C8YE 2W00A 2LOPA 1QUUA 3B57A 1BR2A 2W62A 4YFSA 3NRYA 4GIWA 3ANWB 3KV4A 5ETWA 1LVKA 3ZJ2A 4HE8A 2WM9A 4FI5A 2K24A 3N9QA 2X66A 3O1JA 4QHOA 3I0QA 5FMNA 2KWIB 4I55E 2HPLA 4NUVA 1Z0PA 4QKNA 1BR0A 2PFVA 4PFPA 5H6RB 4UF0B 4O4IE 2VB6A 2V7IA 3QC9A 5HWYA 4WBOA 2CA5A 1HCIA 1LRZA 5HXHA 3C50A 2ODUA 3AA7B 2LOSA 5FXVA 2ACXA 1HTJF 3N2OA 1IZNB 2VKDA 2KWHA 4PJLA 4C90A 3F2EA 3RKOA 2KINB 3CQCB 3I9YA 3UFEA 1EZ3A 4WNKA 4UV9B 3ZLIA 3KV9A 3QK6A 4X20E 3N9MA 2PJQA 3MJXA 5JDLA 2BVMA 2LJLA 2JJ9A 2LSKA 4UEMA 5JDMA 3EDUA 4OYKA 3KFWX 2X51A 4ZI7E 2LT3A 3IHRA 3RC8A 2M67A 4JUYA 3J9X1 5ADXL 5JQGE 2K9AA 4I50E 2C5IT 4KUMB 4MFRA 4H63V 3L09A 2E9XC 4UXNB 2QGSA 5L3EB 3F31A 3BQKA 4PJJA 2X9XA 2BZBA 4J2CA 4HKAA 4X1IE 4M1PA 3GMIA 2NOXA 3DJBA 2E8IA 3T8OA 3SRZA 3U3IA 3FXDB 4ERRA 3HKEE 1ZHCA 5FY7A 3K3NA 4IDZA 4AKIA 2G0UA 3N2GE 4QX8B 3ZMUB 2Y8DA 1T98A 5HXSA 5FXZA 3RPUA 2P9BA 3EUHA 2DWGA 5LOVE 5LHIB 1MMNA 1MIYA 4IIJE 3ANWA 4PFOA 2DI4A 4DO0A 2JMKA 1VRBA 4X1YE 3FBZA 4ZOLE 2XAFB 5FY1A 3TKLB 3CQXC 2A2FX 2JPFA 4JEUB 1MIWA 5TAOA 2CE7A 4O4LE 5EZYE 3NZQA 3KV6A 2CM0A 3C4XA 4UF0A 1NWMX 4FJOA 4UVAB 2OA5A 2MOZA 4YLHA 3GN5B 4UVCB 3V5UA 4QXHB 4O4HE 5E0OA 1FIOA 2XHEB 4ISSA 5LG4A 4ADZA 3ZCIA 4O4JE 5J2UE 5LHHB 1E1HB 2Y6XA 4PJNA 5JDGA 1YW0A 2LHNA 3HKDE 2VKOA 1D1AA 2WWUA 3ZN0B 5DJQC 4MBQA 4UV8B 4CQIA 3ZYKA 5BMVE 3UUXB 3CPZA 5H6QB 3SOLA 3VHLA 2J1DG 3KINB 4HN9A 3VKGA 3L3PA 1AJ3A 3Q5WA 3B13A 4IHJE 2Q9QA 4L9IA 4AXPA 4P09A 2IW5B 3UUNA 4IE4A 4PNIA 4GOUA 3M65A 4DMVA 1WLXA 2XAHB 4TX5A 3NBXX 2KXPB 4OK0A 4PW8A 4EXTA 3ZMZB 4DVDA 2ZLYA 3OKQA 2V7JA 2ZMAA 1WYCA 5HXCA 2E9XB 1U4QA 3ZYLA 2LSYA 2CLYB 4BJNA 2DWKA 4H9QC 2C5KT 2Y48B 2Z6EA 5LGNB 2X0LB 3KDSE 2D2SA 5LCYA 4E7ZA 3EDVA 3PDYA 3VU7H 1U5PA 3LK42 4Z8XA 3PUGA 5DQWA 2JQQA 4NUUA 4TN7B 3AAEB 4F6RC 1ZEEA 4BJMA 3CMLA 5JDQA 2XAQB 3E08A 3FB2A 2IAKA 2WAUA 2XUEA 3C4ZA 3AAAB 3GN5A 5HAXA 2LM9A 1D1CA 2D0TA 4AKRB 2MBGA 3CX8B 3GA8A 5FY0A 5HWXA 2LSIA 3ETUA 4MALA 3IEEA 3MK7C 3PUSA 1BR1A 4TUYE 5GONE 3N9PA 4IE0A 2Q9QD 1IJ5A 3I9WA 4GK0E 3BQLA 3CX6B 5LJMA 2V1DB 1UCUA 1FEWA 3OJAA 4XZCA 5LJNA 5HXRA 2DHRA 2VKJA 3AVRA 2H3RA 1HG5A 3HKCE 2SPCA 5FNVE 5L3GB 2X67A 5JREA 2NWBA 1D0ZA 5J1GA 3WI3A 5CA1E 4H9OC 1YD8G 3CKDA 2KT9A 5LGTB 2LE8A 3P7IA 5DABA 4PJMA 4KBMB 1MMDA 3N9LA 3QUJA 3SWHA 3I1AA 2EHOC 3N5LA 2A3DA 1US7B 2E9XA 2CLYC 4ILUA 4O2AE 4DNDA 3JC6C 2X68A 5FYMA 1G8XA 4YHJA 5JR9B 3IBPA 5LGUB 4I43B 5CB4E 5LP6E 5M4YA 4AQFC 1D1BA 4A56A 4PAGA 3N9NA 3HR0A 3LBXB 4YJ2E 2W0GA 1HS7A 1HF8A 4QXBB 3RX6A 4MHCA 1SHZC 2IC9A 1CUNA 1KK7A 2YINA 1S35A 3C98B 1KNZA 2HPJA 2XAGB 2PG8A 2DCFA 3ZYMA 2W61A 3ZN1B 4B6XA 3AA0B 4HGAA 3ZCJA 4EIWA 4HTEA 1Y64B 1WR6A 2ES0A 4IE6A 3S4UA 4E7SA 2BVLA 1O3XA 2XTLA 4HEAA 4JLEA 3MKDA 3ZC0A 4ZI3C 4K0UA 3DP7A 2WBLA 2C5JA 2K5BB 2L3LA 4ZI2C 4CXYA 3AA6B 4AQGA 5L2LA 1B7TA 3HL6A 2VK9A 3LG7A 2D0UA 5KX5E 2LEHA 4U72A 3O9XA 2KNDA 4KMCA 2CXLA 5LNKA 3ETVA 1LVFA 3MACA 2ODVA 4YJ3E 2E9XD 4ANJA 4C91A 4H9PC 2KZ7B 4UELA 4ZHQE 4HFVA 4P0BA 4X1KE 1HG2A 2X9HA 3KVBA 3AB3B 4QX7B 2BDEA 3IF8B 3MA9A 3E22E 4EYYR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOZ A;  2M67 A; 
#chains in the Genus database with same CATH topology
 4QWN B;  4EB6 E;  2WMN A;  3O1I A;  5JR9 C;  2W2U A;  4JI0 T;  4HFI A;  4CI2 B;  2X9Y A;  4DBQ A;  2ZM0 A;  1SE7 A;  2M6I A;  3OYX A;  4YXD A;  3CX7 B;  4IE7 A;  2K3W A;  3O4X E;  2KMF A;  1L0V A;  4G63 A;  2MTQ A;  4EV6 A;  3M3Z B;  4YTN A;  4XBF B;  4AKG A;  4LML A;  1HX8 A;  4ILA A;  2ZM8 A;  2DLR A;  1YKE B;  3J7Y q;  2E5L T;  3C4W A;  5L3D B;  4ZS2 A;  3ESL A;  5AQP B;  4O8S A;  5LB7 B;  1HX1 B;  1KFY A;  2BKP A;  2VL8 A;  2YU1 A;  3FBL A;  3UQ4 A;  2H89 A;  4WBN E;  3HI2 A;  2N2N A;  2XPK A;  4KHP T;  3P4S A;  4P0A A;  1T7S A;  4IL9 A;  4UIG A;  5EK4 A;  3CQG B;  4GKK T;  4JI4 T;  1VOM A;  2JMH A;  4AQY T;  4HFD A;  4DV1 T;  4OHF A;  3ZEF B;  4DUZ T;  4H9S E;  1OED A;  1YKH B;  3AXJ B;  2UUA T;  3KBT A;  3PUQ A;  1T8B A;  4LF8 T;  1SA0 E;  4H9N C;  2IHR 1;  3ZJ1 A;  2N1G A;  3EAM A;  3PUV F;  4JI8 T;  4DV3 T;  3DTO A;  5FXX A;  3LDQ B;  3AEA A;  2I6H A;  1MIV A;  4LF9 T;  2GK9 A;  4JBW F;  3ZC1 A;  2VAS A;  5JR9 A;  4COF A;  1OWA A;  4V1A v;  2WY2 A;  3NWI A;  3K8P C;  5JDN A;  3P4Q A;  3OYZ A;  1N32 T;  2VKH A;  1J1J A;  3KVA A;  2I59 A;  2VQE T;  2C0S A;  5ABF A;  3JCF A;  4ILB A;  1D0Y A;  1W0B A;  4NXN T;  3I0O A;  3JAF A;  2CBI A;  5HYA A;  3EHZ A;  4A5X A;  4BAY B;  1S94 A;  2L8K A;  3ZT5 A;  1MMG A;  1UX4 A;  1E2A A;  1R8I A;  2LOP A;  2W62 A;  3NRY A;  4GIW A;  5AQG B;  1LVK A;  5AQU B;  2X66 A;  4I55 E;  1BR0 A;  2PFV A;  2VVS A;  4IDO A;  5HWY A;  4WBO A;  5HXH A;  3C50 A;  2LOS A;  1HTJ F;  2IUB A;  2VKD A;  4C90 A;  3RKO A;  1EZ3 A;  1OED E;  3PUY F;  3KV9 A;  3N9M A;  3AE2 A;  3FZF B;  4UEM A;  4U3C A;  5ADX L;  4LF4 T;  4KUM B;  4U33 A;  3BQK A;  3JAE A;  1XMQ T;  2NOX A;  3SRZ A;  3U3I A;  3HKE E;  1ZHC A;  2Y8D A;  1T98 A;  2X0H A;  3AED A;  1MIY A;  4PFO A;  2VVN A;  2JMK A;  2ACZ A;  3TKL B;  2A2F X;  2CE7 A;  5EZY E;  3C4X A;  1WCR A;  1VCS A;  4YLH A;  4O4H E;  4ISS A;  4PJN A;  3HKD E;  4I0U A;  4ZXL A;  4MBQ A;  1W09 A;  3UUX B;  4YSX A;  2J1D G;  1CHU A;  3L3P A;  1UGO A;  1AJ3 A;  4IHJ E;  5AQN B;  4AXP A;  1WLX A;  4B3T T;  2WU5 A;  3ZMZ B;  1X9B A;  3FZH B;  4H9Q C;  2Z6E A;  3AEE A;  2X0L B;  5LCY A;  3RHW A;  3EDV A;  3ZT6 A;  1NEK A;  2WZI A;  2LRK A;  2JQQ A;  3AE3 A;  4DV5 T;  3RGL A;  3CML A;  3E08 A;  3FZK B;  1JNZ A;  3UU4 A;  5HWX A;  2LSI A;  3UU8 A;  3N9P A;  1IJ5 A;  2V1D B;  2YDR A;  3OJA A;  4XZC A;  2LLY A;  4LFB T;  4IDP A;  2H3R A;  5FL0 A;  5L4H A;  3HKC E;  5FNV E;  5L3G B;  5J1G A;  5CA1 E;  1ZP0 A;  1YD8 G;  2XY8 B;  3TLV A;  4KBM B;  3I1A A;  3N5L A;  4YY3 T;  4O2A E;  4DND A;  2X68 A;  5FYM A;  5JR9 B;  5M4Y A;  3IBP A;  5LGU B;  4I43 B;  4PAG A;  2QVA A;  2V8S V;  1FJG T;  1HF8 A;  3RX6 A;  2W4X A;  3B5M A;  2YIN A;  1KNZ A;  2HPJ A;  3RC8 A;  4B6X A;  2DCF A;  3AA0 B;  2OLT A;  4JLE A;  3MKD A;  4QH1 A;  4K0U A;  3RI5 A;  2WBL A;  2C5J A;  4DV7 T;  5L2L A;  3HL6 A;  3K1S A;  2LEH A;  3O9X A;  5AQH B;  5LNK A;  3ETV A;  2ODV A;  4YJ3 E;  5L4E A;  2KZ7 B;  4DR1 T;  4HFV A;  3G06 A;  5AQO B;  3ABV A;  3AB3 B;  3IF8 B;  4EYY R;  2HN2 A;  2DL1 A;  2V26 A;  2XQY A;  2EHO B;  4UVB B;  2WDV A;  3RIA A;  3N9O A;  1I6Z A;  2HH7 A;  2WMO A;  4MLK A;  2WZH A;  5LYJ E;  4EOZ B;  4WZX A;  2B1E A;  3LK2 B;  2HN1 A;  4U74 A;  2LSJ A;  4JEH B;  4U2Z A;  3CVR A;  5LA6 E;  4PK6 A;  5JH7 E;  2NR4 A;  2BS4 A;  4G2A A;  4DR3 T;  4EYU A;  4IDQ A;  4DR5 T;  5AQM B;  3AE8 A;  2H7V C;  4U7Y A;  2NP9 A;  1HFA A;  3JAD A;  2XQ4 A;  3H3A A;  2IIU A;  2NTY A;  2ZM2 A;  1IAP A;  4DMW A;  4LFC T;  3NVO A;  3WAK A;  5A1L A;  5AQL B;  3RYF E;  2JQ9 A;  5JTG A;  2CWY A;  5JVD E;  3RC3 A;  1MNE A;  1SUM B;  2KLQ A;  4IE5 A;  5IUX A;  1NAF A;  4HWC A;  3MZK B;  3RKG A;  2YU2 A;  3NZP A;  3LJC A;  3ONJ A;  4Q25 A;  2H7O A;  4F8H A;  4L5G A;  2RP4 A;  3UUM A;  1UK5 A;  2F4V T;  3VRA A;  3CWZ B;  4DBR A;  4KP3 C;  2BKN A;  2L9Q A;  5JDH A;  4CI3 B;  3PU3 A;  2UUB T;  4GK5 E;  4OYJ A;  3Q5E A;  2UU9 T;  2VQF T;  5L3B B;  5HXE A;  3LK3 B;  4PK4 A;  5JRC A;  2MYS A;  2J47 A;  4I4T E;  4EED A;  3AAI A;  4TZ4 C;  4ZI3 D;  3AE4 A;  3F57 A;  4ZI2 D;  3PJA A;  2CPT A;  5FVK A;  3PUX F;  1M7K A;  4DUY T;  4IGU A;  2OV9 A;  3UFG A;  3RH3 A;  3A5X A;  5L3C B;  4BA9 A;  2X9W A;  5FXW A;  5DQV A;  3EVY A;  2LHR A;  1N34 T;  3FXE B;  5AQF B;  1J5W A;  1M62 A;  5J2T E;  3ZKR A;  4HFC A;  1QUU A;  2LKG A;  4YFS A;  3ANW B;  5ETW A;  3ZJ2 A;  3N9Q A;  3I0Q A;  3RIF A;  2HPL A;  3NKZ A;  4NUV A;  1Z0P A;  4UF0 B;  2VB6 A;  2V7I A;  3OPC A;  5HCM A;  1LRZ A;  2XQ7 A;  2XSA A;  2ODU A;  2WCA A;  3N2O A;  1IZN B;  5FL1 A;  3F2E A;  3CQC B;  3QK6 A;  2PJQ A;  2LJL A;  2JJ9 A;  5JDM A;  3EDU A;  3KFW X;  2X51 A;  5HEO A;  4ZI7 E;  3J9X 1;  4X64 T;  1JNR A;  5JQG E;  4CN4 A;  4I50 E;  2C5I T;  4H63 V;  5L3E B;  2BZB A;  3DJB A;  2E8I A;  3T8O A;  4JI7 T;  2QRX A;  5FY7 A;  4KI0 F;  4LF5 T;  3N2G E;  3RPU A;  2P9B A;  3CIR A;  5LHI B;  3AE5 A;  1MMN A;  4IIJ E;  4IRE A;  1HNX T;  4X1Y E;  5TAO A;  2CM0 A;  3QOF A;  4FJO A;  2OA5 A;  3PJA J;  2XJ7 A;  3GN5 B;  4QXH B;  5HEU A;  2XHE B;  4O4J E;  3P4W A;  4X5T A;  1YW0 A;  2LHN A;  2VKO A;  1D1A A;  2WWU A;  5DJQ C;  5BMV E;  3SOL A;  3VKG A;  5HEH A;  3Q5W A;  2BKO A;  4P09 A;  2IW5 B;  2H88 A;  4UR9 A;  2XAH B;  4DVD A;  2ZLY A;  2V7J A;  2E9X B;  1N33 T;  2Y48 B;  2UXD T;  1DU2 A;  5LGN B;  3KDS E;  5C3J A;  4E7Z A;  2J4G A;  1VCT A;  4Z8X A;  2JQH A;  2WS3 A;  3UU6 A;  4NUU A;  4TN7 B;  1XNQ T;  2V6Y A;  2XUE A;  3C4Z A;  3AAA B;  4AKR B;  2LM9 A;  4U31 A;  4NXM T;  4TUY E;  4IE0 A;  5LG3 A;  2Q9Q D;  3CX6 B;  3VRB A;  1UCU A;  1XZY A;  1KF6 A;  2RPA A;  3AVR A;  2X67 A;  5JRE A;  2XM2 A;  3WI3 A;  4PJM A;  2CHN A;  4QH4 A;  1G8X A;  4LF6 T;  2R6G F;  4AQF C;  4Z90 A;  3HR0 A;  2B76 A;  4MHC A;  3C98 B;  1J5E T;  1Y64 B;  1WR6 A;  3S4U A;  4IE6 A;  2BVL A;  3PUW F;  1O3X A;  4DID B;  3RQW A;  4ZI3 C;  3AE1 A;  2K5B B;  4JI6 T;  2L3L A;  4ZI2 C;  3AA6 B;  5KX5 E;  5AQI B;  4Z91 A;  3ZSS A;  4HWF A;  4KMC A;  2LM2 A;  4C91 A;  4H9P C;  4TWF A;  1KNR A;  1HG2 A;  4QX7 B;  1UUS A;  1N36 T;  2DNX A;  2YN6 A;  5EK3 A;  5LBQ B;  3R84 B;  4H9R C;  5KXJ A;  3VKH A;  2YK0 A;  3PUR A;  4LMK A;  3HKB E;  5FP3 A;  4ZZB A;  1ZOY A;  3P4R A;  1IJ6 A;  4AI6 A;  1MND A;  1OED B;  4XAX B;  3K3Q C;  4NPP A;  4OFZ A;  5C2T A;  4TWH A;  3MXZ A;  2W67 A;  5AFU L;  4PK5 A;  2A72 A;  2CWO A;  3A8Y C;  3RLF F;  2D5U A;  3PE0 A;  3TLW A;  1G73 A;  3FZM B;  2YEV C;  2K48 A;  5AQJ B;  4HFE A;  2XQ8 A;  3TLS A;  4CXW A;  1UX5 A;  2CXD A;  4JYA T;  2V7K A;  1V9D A;  4IDN A;  3SS1 A;  4AQF A;  3RIU C;  1FMW A;  4EZ4 A;  3ZMV B;  5ABF B;  2YOE A;  2V7L A;  3GWH A;  5F5W A;  3Q2M A;  4X66 T;  2UXB T;  4CZZ B;  3V5S A;  3H37 A;  3OVU A;  3Q9D A;  2WDR A;  1XWM A;  3O1H A;  2CBJ A;  4AKL A;  2AE9 A;  2XQ5 A;  3QNU A;  3BK9 A;  5AQK B;  1ZKE A;  2EHO D;  1WRD A;  2PBI A;  1HR0 T;  3X1D A;  2CCQ A;  3ZMT B;  5AQT B;  2BG9 C;  2N9D A;  1ZV4 X;  3VR9 A;  4U2Y A;  4ZS3 A;  2WSS V;  4CI1 B;  2J62 A;  2LSG A;  1HNZ T;  4GYS A;  3FZL B;  4DR6 T;  3LFM A;  1KEY A;  2QA7 A;  2UXX B;  3IA3 A;  2V7M A;  3PU8 A;  3U78 A;  2Q9Q C;  2CEA A;  3R6N A;  3RRW A;  2NW7 A;  3SFD A;  4TV9 E;  2W63 A;  4TWD A;  4O2B E;  2WB5 A;  1HNW T;  2W66 A;  2BBJ A;  1BR4 A;  3BQI A;  2XAJ B;  3AXJ A;  2BS3 A;  3PUA A;  2V5D A;  5CA0 E;  1IBL T;  1BR2 A;  1YQ3 A;  4YSY A;  2WM9 A;  3O1J A;  5FMN A;  5ABG A;  4PFP A;  4O4I E;  2CA5 A;  4TNV A;  5HEG A;  3AA7 B;  5FXV A;  2ACX A;  5CJ5 A;  4B3M T;  4JI3 T;  4DV4 T;  1UUR A;  3I9Y A;  4UV9 B;  3ZLI A;  5JDL A;  3RIU A;  2LSK A;  2LT3 A;  2M67 A;  4DR2 T;  4X62 T;  2K9A A;  3EI0 A;  4OX9 T;  4MFR A;  4UXN B;  3L09 A;  5AQV B;  4QH5 A;  4PJJ A;  2X9X A;  4HKA A;  4X1I E;  3GMI A;  4B3R T;  3FXD B;  3K3N A;  4IDZ A;  4AKI A;  4QX8 B;  5FXZ A;  3EUH A;  2HHH T;  2DWG A;  5LOV E;  3Q5D A;  2BBH A;  2DI4 A;  4DO0 A;  3RF1 A;  3CK6 A;  4ZOL E;  2JPF A;  4JEU B;  1MIW A;  3NZQ A;  1NWM X;  2BG9 A;  1WFD A;  3V5U A;  3T1H T;  4ADZ A;  4EGW A;  3ZCI A;  2M6B A;  2YDQ A;  5JDG A;  4CQI A;  2VL0 A;  3ZYK A;  3CPZ A;  4HN9 A;  3B13 A;  2WU2 A;  2Q9Q A;  4L9I A;  2QYW A;  4IE4 A;  2MAW A;  2WP9 A;  4PNI A;  4GOU A;  4DMV A;  4TX5 A;  4JV5 T;  4EXT A;  2XQ6 A;  3OKQ A;  3UUB A;  2ZMA A;  1WYC A;  2WQY A;  1U4Q A;  4EEB A;  3VU7 H;  1U5P A;  3AEF A;  3PUG A;  4F6R C;  1ZEE A;  4BJM A;  5JDQ A;  2XAQ B;  3FB2 A;  4DV2 T;  2D0T A;  3CX8 B;  3GA8 A;  4DR7 T;  2MPK A;  4JI2 T;  1NEN A;  3PUS A;  1BR1 A;  4GK0 E;  1FEW A;  1KNP A;  5HXR A;  2VKJ A;  2SPC A;  2NWB A;  1D0Z A;  4H9O C;  5CGM A;  5LGT B;  3P7I A;  5DAB A;  2EHO C;  2A3D A;  1US7 B;  4ILU A;  2CLY C;  5L47 A;  2E5V A;  5CB4 E;  5LP6 E;  4YHH T;  3N9N A;  1XDP A;  4YJ2 E;  1HS7 A;  2BG9 E;  2BS2 A;  1SHZ C;  5J0Z A;  1CUN A;  2PG8 A;  2W61 A;  3ZN1 B;  3ZCJ A;  4EIW A;  4HTE A;  4K0K T;  2ES0 A;  4P1N A;  2XSB A;  4HEA A;  2UUC T;  4KHZ F;  3DP7 A;  4TNW A;  2VK9 A;  3LG7 A;  1Z8U A;  2KND A;  2CXL A;  2E9X D;  3RQU A;  4YTM A;  4P0B A;  4X1K E;  2LKH A;  2X9H A;  4U7I A;  2V5C A;  3UU3 A;  1QLB A;  4ASK A;  4QXC B;  2FBW A;  3UUL A;  2RA1 A;  3RYI E;  3P8C D;  5EK2 A;  1MMA A;  1XNR T;  5AQR B;  5IHY A;  3C64 A;  4EZH A;  3N2K E;  4X65 T;  4N78 D;  5BR8 T;  1YXR A;  1OXZ A;  5KMG P;  2NW9 A;  3K3O A;  2IC6 A;  2KSR A;  4WW0 A;  4B3S T;  2XQ3 A;  2NW8 A;  4IST A;  4GYR A;  2XM1 A;  2A9U A;  5F3J A;  5L3F B;  2LRL A;  4TV8 E;  3AEC A;  4HWD A;  3QB5 K;  3AEG A;  3KV5 A;  2VWA A;  2BG9 B;  3ONL C;  2D9D A;  3RYC E;  4HWI B;  1WYB A;  1GQE A;  2EHO A;  3WAJ A;  5F8P A;  5JRC B;  1IBK T;  3AA1 B;  1H7C A;  3D0T A;  3KBU A;  2IML A;  5KDM C;  5ABH A;  2FJA A;  4H63 H;  3NRX A;  2Q9Q B;  3Q5X A;  3QB5 A;  1IBM T;  2UXN B;  4L0R A;  5IWA T;  5IYZ E;  5LHG B;  4EAH A;  1QSD A;  4ZEY A;  2E2A A;  1XMO T;  5JDF A;  3PTR B;  2XAS B;  2CXF A;  2ZM6 T;  2CHO A;  2NTX A;  3FHN A;  3L8R A;  3ZMS B;  4HFH A;  5LBM A;  3W15 B;  2JIW A;  1D0X A;  3AE6 A;  3JC6 D;  1LKX A;  3ONX A;  4CN1 A;  4ILC A;  4CXX A;  3C51 A;  2WDQ A;  1E7P A;  5LXT E;  2CMR A;  3AE9 A;  3HA4 A;  4YT0 A;  4AKH A;  2IDO B;  3LBX A;  2FJE A;  1FMV A;  3AVS A;  1I94 T;  3ZPO A;  2FUP A;  2AXD S;  3UQ7 A;  5LMN T;  1X79 A;  4NIQ A;  5HCJ A;  1Y01 A;  3UTK A;  2JRK A;  5LMU T;  3E0Z A;  3UT5 E;  3RRC A;  3OBV E;  3RYH E;  1WR0 A;  5C8Y E;  4YSZ A;  2W00 A;  3B57 A;  4AIU A;  3KV4 A;  4HE8 A;  4FI5 A;  2K24 A;  4QHO A;  2XQA A;  3OTO T;  2FJD A;  2KWI B;  3AE7 A;  4QKN A;  5H6R B;  2YKS A;  3QC9 A;  1HCI A;  4GKJ T;  4JI1 T;  2KWH A;  4PJL A;  2KIN B;  3UFE A;  4LFA T;  3LSV A;  4WNK A;  4ZZC A;  3PUZ F;  4X20 E;  3MJX A;  2BVM A;  2WWV A;  3H3M A;  4OYK A;  3IHR A;  4JUY A;  4DR4 T;  2E9X C;  2QGS A;  3F31 A;  4J2C A;  4M1P A;  4HFB A;  4ERR A;  2G0U A;  3ZMU B;  2JQK A;  5HXS A;  3UU5 A;  2VUR A;  3ANW A;  4YTP A;  1VRB A;  3FBZ A;  2XAF B;  5FY1 A;  3CQX C;  2V6Y B;  4O4L E;  3KV6 A;  2XZE A;  4UF0 A;  4UVA B;  2X0Y A;  2MOZ A;  4UVC B;  5E0O A;  1FIO A;  5LG4 A;  5LHH B;  5J2U E;  1E1H B;  1W9R A;  2Y6X A;  4DV0 T;  3ZN0 B;  4UV8 B;  3A7M A;  4AIS A;  2PTF A;  2XQ9 A;  4LMJ A;  5H6Q B;  3VHL A;  3KIN B;  4WYV A;  3UUN A;  3M65 A;  3NBX X;  2KXP B;  4OK0 A;  4PW8 A;  4HWH A;  5HXC A;  3ZYL A;  2LSY A;  2CLY B;  4BJN A;  3P50 A;  3T1Y T;  2DWK A;  2C5K T;  2D2S A;  5FKY A;  3PDY A;  3LK4 2;  5DQW A;  3AAE B;  3SFE A;  2CRB A;  2IAK A;  2WAU A;  3ZT7 A;  5CFB A;  4DV6 T;  3GN5 A;  5HAX A;  1D1C A;  2MBG A;  5FY0 A;  4JI5 T;  5ABE A;  3ETU A;  4MAL A;  3IEE A;  3MK7 C;  5FVL A;  5GON E;  3I9W A;  3L39 A;  3BQL A;  3P4P A;  5LJM A;  2YDS A;  1XDO A;  5LJN A;  3VR8 A;  4A98 A;  2V6X A;  2DHR A;  1HG5 A;  4CN6 A;  4IL4 A;  3CKD A;  2KT9 A;  2LE8 A;  3TLU A;  1MMD A;  3N9L A;  4IT4 A;  3QUJ A;  3SWH A;  5AQQ B;  2E9X A;  3JC6 C;  4A97 A;  3PV0 F;  4YHJ A;  1D1B A;  2UXC T;  4A56 A;  3LBX B;  2W0G A;  4QXB B;  4LF7 T;  2IC9 A;  3AEB A;  1KK7 A;  1S35 A;  2XAG B;  3ZYM A;  2FJB A;  4HGA A;  5AQS B;  1OED C;  4E7S A;  2XTL A;  2I0M A;  3EAB A;  3ZC0 A;  4CXY A;  4AQG A;  1B7T A;  2D0U A;  4U72 A;  1T72 A;  5HEJ A;  1LVF A;  3MAC A;  4KX6 A;  4ANJ A;  4UEL A;  4ZHQ E;  1W0A A;  3KVB A;  3TLT A;  1YQ4 A;  2BDE A;  3ZST A;  3MA9 A;  3E22 E; 
#chains in the Genus database with same CATH homology
 4QWN B;  4EB6 E;  2WMN A;  2DNX A;  4ASK A;  4QXC B;  3O1I A;  2V26 A;  5EK3 A;  2RA1 A;  5LBQ B;  3UUL A;  5JR9 C;  3RYI E;  3P8C D;  3R84 B;  5EK2 A;  1MMA A;  4CI2 B;  2XQY A;  2X9Y A;  4DBQ A;  4H9R C;  2ZM0 A;  2EHO B;  3VKH A;  4UVB B;  2YK0 A;  3PUR A;  5IHY A;  3N9O A;  3OYX A;  3C64 A;  4EZH A;  3N2K E;  3CX7 B;  2HH7 A;  3HKB E;  2WMO A;  4IE7 A;  3O4X E;  4MLK A;  5FP3 A;  2KMF A;  5LYJ E;  4EOZ B;  4N78 D;  4G63 A;  2MTQ A;  1IJ6 A;  4AI6 A;  1OXZ A;  4XBF B;  4AKG A;  5KMG P;  1HX8 A;  2NW9 A;  2B1E A;  1MND A;  3LK2 B;  3K3O A;  2IC6 A;  4XAX B;  2ZM8 A;  4U74 A;  4WW0 A;  2DLR A;  1YKE B;  3K3Q C;  3J7Y q;  2LSJ A;  4OFZ A;  3C4W A;  5L3D B;  4JEH B;  2NW8 A;  4ZS2 A;  4IST A;  3MXZ A;  5AFU L;  4PK5 A;  3CVR A;  3ESL A;  4GYR A;  5LA6 E;  4PK6 A;  5JH7 E;  2A72 A;  2CWO A;  4O8S A;  5F3J A;  4G2A A;  5L3F B;  4EYU A;  2D5U A;  2YU1 A;  4TV8 E;  2VL8 A;  3FBL A;  3PE0 A;  4WBN E;  3KV5 A;  2VWA A;  1G73 A;  3HI2 A;  2N2N A;  2K48 A;  2YEV C;  2H7V C;  3RYC E;  4CXW A;  1UX5 A;  2NP9 A;  1HFA A;  1WYB A;  4P0A A;  2EHO A;  3WAJ A;  2CXD A;  4UIG A;  2V7K A;  1V9D A;  5F8P A;  5EK4 A;  5JRC B;  3AA1 B;  3CQG B;  1H7C A;  3H3A A;  3SS1 A;  3D0T A;  3KBU A;  4AQF A;  5KDM C;  2NTY A;  1VOM A;  2JMH A;  2ZM2 A;  1IAP A;  4DMW A;  4H63 H;  1FMW A;  3WAK A;  5A1L A;  3NRX A;  4EZ4 A;  3RYF E;  2Q9Q B;  3ZMV B;  2CWY A;  5JVD E;  3Q5X A;  3RC3 A;  4OHF A;  3ZEF B;  4H9S E;  2V7L A;  2UXN B;  3GWH A;  4L0R A;  1YKH B;  1MNE A;  2KLQ A;  4IE5 A;  1NAF A;  3Q2M A;  5IYZ E;  3MZK B;  5LHG B;  3KBT A;  2YU2 A;  3NZP A;  4EAH A;  3LJC A;  3V5S A;  1QSD A;  3H37 A;  3Q9D A;  4CZZ B;  3PUQ A;  2H7O A;  5JDF A;  3O1H A;  4AKL A;  3PTR B;  2XAS B;  2CXF A;  2RP4 A;  4L5G A;  2NTX A;  3UUM A;  3FHN A;  3ZMS B;  1SA0 E;  3BK9 A;  4H9N C;  5LBM A;  3ZJ1 A;  3W15 B;  3CWZ B;  2N1G A;  4DBR A;  1ZKE A;  2EHO D;  1WRD A;  4KP3 C;  1D0X A;  2PBI A;  2L9Q A;  3JC6 D;  5JDH A;  4CI3 B;  2CCQ A;  3PU3 A;  3ZMT B;  1LKX A;  2N9D A;  3DTO A;  4GK5 E;  3ONX A;  4OYJ A;  1ZV4 X;  5FXX A;  4CXX A;  4ZS3 A;  2WSS V;  1MIV A;  2GK9 A;  3C51 A;  3ZC1 A;  5L3B B;  2VAS A;  5HXE A;  4CI1 B;  3LK3 B;  4PK4 A;  2LSG A;  5JR9 A;  4GYS A;  2MYS A;  5LXT E;  5JRC A;  1OWA A;  2CMR A;  3HA4 A;  4V1A v;  4AKH A;  3LFM A;  2QA7 A;  2UXX B;  4I4T E;  3K8P C;  5JDN A;  3LBX A;  1FMV A;  2V7M A;  3AVS A;  3OYZ A;  3PU8 A;  3U78 A;  3AAI A;  2VKH A;  2Q9Q C;  2CEA A;  3R6N A;  3KVA A;  2NW7 A;  3RRW A;  2I59 A;  3ZPO A;  4TZ4 C;  4TV9 E;  2C0S A;  4ZI3 D;  2W63 A;  4O2B E;  3F57 A;  4ZI2 D;  1D0Y A;  1X79 A;  3BQI A;  1BR4 A;  2XAJ B;  3I0O A;  4IGU A;  5HYA A;  4BAY B;  3PUA A;  1S94 A;  3UTK A;  2JRK A;  3A5X A;  3RH3 A;  5L3C B;  4BA9 A;  2L8K A;  2X9W A;  5CA0 E;  5FXW A;  5DQV A;  3E0Z A;  3UT5 E;  1MMG A;  3RRC A;  3EVY A;  2LHR A;  3OBV E;  3RYH E;  1UX4 A;  3FXE B;  5J2T E;  5C8Y E;  2W00 A;  2LOP A;  1QUU A;  3B57 A;  1BR2 A;  2W62 A;  4YFS A;  3NRY A;  4GIW A;  3ANW B;  3KV4 A;  5ETW A;  1LVK A;  3ZJ2 A;  4HE8 A;  2WM9 A;  4FI5 A;  2K24 A;  3N9Q A;  2X66 A;  3O1J A;  4QHO A;  3I0Q A;  5FMN A;  2KWI B;  4I55 E;  2HPL A;  4NUV A;  1Z0P A;  4QKN A;  1BR0 A;  2PFV A;  4PFP A;  5H6R B;  4UF0 B;  4O4I E;  2VB6 A;  2V7I A;  3QC9 A;  5HWY A;  4WBO A;  2CA5 A;  1HCI A;  1LRZ A;  5HXH A;  3C50 A;  2ODU A;  3AA7 B;  2LOS A;  5FXV A;  2ACX A;  1HTJ F;  3N2O A;  1IZN B;  2VKD A;  2KWH A;  4PJL A;  4C90 A;  3F2E A;  3RKO A;  2KIN B;  3CQC B;  3I9Y A;  3UFE A;  1EZ3 A;  4WNK A;  4UV9 B;  3ZLI A;  3KV9 A;  3QK6 A;  4X20 E;  3N9M A;  2PJQ A;  3MJX A;  5JDL A;  2BVM A;  2LJL A;  2JJ9 A;  2LSK A;  4UEM A;  5JDM A;  3EDU A;  4OYK A;  3KFW X;  2X51 A;  4ZI7 E;  2LT3 A;  3IHR A;  3RC8 A;  2M67 A;  4JUY A;  3J9X 1;  5ADX L;  5JQG E;  2K9A A;  4I50 E;  2C5I T;  4KUM B;  4MFR A;  4H63 V;  3L09 A;  2E9X C;  4UXN B;  2QGS A;  5L3E B;  3F31 A;  3BQK A;  4PJJ A;  2X9X A;  2BZB A;  4J2C A;  4HKA A;  4X1I E;  4M1P A;  3GMI A;  2NOX A;  3DJB A;  2E8I A;  3T8O A;  3SRZ A;  3U3I A;  3FXD B;  4ERR A;  3HKE E;  1ZHC A;  5FY7 A;  3K3N A;  4IDZ A;  4AKI A;  2G0U A;  3N2G E;  4QX8 B;  3ZMU B;  2Y8D A;  1T98 A;  5HXS A;  5FXZ A;  3RPU A;  2P9B A;  3EUH A;  2DWG A;  5LOV E;  5LHI B;  1MMN A;  1MIY A;  4IIJ E;  3ANW A;  4PFO A;  2DI4 A;  4DO0 A;  2JMK A;  1VRB A;  4X1Y E;  3FBZ A;  4ZOL E;  2XAF B;  5FY1 A;  3TKL B;  3CQX C;  2A2F X;  2JPF A;  4JEU B;  1MIW A;  5TAO A;  2CE7 A;  4O4L E;  5EZY E;  3NZQ A;  3KV6 A;  2CM0 A;  3C4X A;  4UF0 A;  1NWM X;  4FJO A;  4UVA B;  2OA5 A;  2MOZ A;  4YLH A;  3GN5 B;  4UVC B;  3V5U A;  4QXH B;  4O4H E;  5E0O A;  1FIO A;  2XHE B;  4ISS A;  5LG4 A;  4ADZ A;  3ZCI A;  4O4J E;  5J2U E;  5LHH B;  1E1H B;  2Y6X A;  4PJN A;  5JDG A;  1YW0 A;  2LHN A;  3HKD E;  2VKO A;  1D1A A;  2WWU A;  3ZN0 B;  5DJQ C;  4MBQ A;  4UV8 B;  4CQI A;  3ZYK A;  5BMV E;  3UUX B;  3CPZ A;  5H6Q B;  3SOL A;  3VHL A;  2J1D G;  3KIN B;  4HN9 A;  3VKG A;  3L3P A;  1AJ3 A;  3Q5W A;  3B13 A;  4IHJ E;  2Q9Q A;  4L9I A;  4AXP A;  4P09 A;  2IW5 B;  3UUN A;  4IE4 A;  4PNI A;  4GOU A;  3M65 A;  4DMV A;  1WLX A;  2XAH B;  4TX5 A;  3NBX X;  2KXP B;  4OK0 A;  4PW8 A;  4EXT A;  3ZMZ B;  4DVD A;  2ZLY A;  3OKQ A;  2V7J A;  2ZMA A;  1WYC A;  5HXC A;  2E9X B;  1U4Q A;  3ZYL A;  2LSY A;  2CLY B;  4BJN A;  2DWK A;  4H9Q C;  2C5K T;  2Y48 B;  2Z6E A;  5LGN B;  2X0L B;  3KDS E;  2D2S A;  5LCY A;  4E7Z A;  3EDV A;  3PDY A;  3VU7 H;  1U5P A;  3LK4 2;  4Z8X A;  3PUG A;  5DQW A;  2JQQ A;  4NUU A;  4TN7 B;  3AAE B;  4F6R C;  1ZEE A;  4BJM A;  3CML A;  5JDQ A;  2XAQ B;  3E08 A;  3FB2 A;  2IAK A;  2WAU A;  2XUE A;  3C4Z A;  3AAA B;  3GN5 A;  5HAX A;  2LM9 A;  1D1C A;  2D0T A;  4AKR B;  2MBG A;  3CX8 B;  3GA8 A;  5FY0 A;  5HWX A;  2LSI A;  3ETU A;  4MAL A;  3IEE A;  3MK7 C;  3PUS A;  1BR1 A;  4TUY E;  5GON E;  3N9P A;  4IE0 A;  2Q9Q D;  1IJ5 A;  3I9W A;  4GK0 E;  3BQL A;  3CX6 B;  5LJM A;  2V1D B;  1UCU A;  1FEW A;  3OJA A;  4XZC A;  5LJN A;  5HXR A;  2DHR A;  2VKJ A;  3AVR A;  2H3R A;  1HG5 A;  3HKC E;  2SPC A;  5FNV E;  5L3G B;  2X67 A;  5JRE A;  2NWB A;  1D0Z A;  5J1G A;  3WI3 A;  5CA1 E;  4H9O C;  1YD8 G;  3CKD A;  2KT9 A;  5LGT B;  2LE8 A;  3P7I A;  5DAB A;  4PJM A;  4KBM B;  1MMD A;  3N9L A;  3QUJ A;  3SWH A;  3I1A A;  2EHO C;  3N5L A;  2A3D A;  1US7 B;  2E9X A;  2CLY C;  4ILU A;  4O2A E;  4DND A;  3JC6 C;  2X68 A;  5FYM A;  1G8X A;  4YHJ A;  5JR9 B;  3IBP A;  5LGU B;  4I43 B;  5CB4 E;  5LP6 E;  5M4Y A;  4AQF C;  1D1B A;  4A56 A;  4PAG A;  3N9N A;  3HR0 A;  3LBX B;  4YJ2 E;  2W0G A;  1HS7 A;  1HF8 A;  4QXB B;  3RX6 A;  4MHC A;  1SHZ C;  2IC9 A;  1CUN A;  1KK7 A;  2YIN A;  1S35 A;  3C98 B;  1KNZ A;  2HPJ A;  2XAG B;  2PG8 A;  2DCF A;  3ZYM A;  2W61 A;  3ZN1 B;  4B6X A;  3AA0 B;  4HGA A;  3ZCJ A;  4EIW A;  4HTE A;  1Y64 B;  1WR6 A;  2ES0 A;  4IE6 A;  3S4U A;  4E7S A;  2BVL A;  1O3X A;  2XTL A;  4HEA A;  4JLE A;  3MKD A;  3ZC0 A;  4ZI3 C;  4K0U A;  3DP7 A;  2WBL A;  2C5J A;  2K5B B;  2L3L A;  4ZI2 C;  4CXY A;  3AA6 B;  4AQG A;  5L2L A;  1B7T A;  3HL6 A;  2VK9 A;  3LG7 A;  2D0U A;  5KX5 E;  2LEH A;  4U72 A;  3O9X A;  2KND A;  4KMC A;  2CXL A;  5LNK A;  3ETV A;  1LVF A;  3MAC A;  2ODV A;  4YJ3 E;  2E9X D;  4ANJ A;  4C91 A;  4H9P C;  2KZ7 B;  4UEL A;  4ZHQ E;  4HFV A;  4P0B A;  4X1K E;  1HG2 A;  2X9H A;  3KVB A;  3AB3 B;  4QX7 B;  2BDE A;  3IF8 B;  3MA9 A;  3E22 E;  4EYY R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...