2M67A

Full-length mercury transporter protein merf in lipid bilayer membranes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
MKDPKTLLRVSIIGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASSTPKFNGVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords MerF
publication title The Structure of the Mercury Transporter MerF in Phospholipid Bilayers: A Large Conformational Rearrangement Results from N-Terminal Truncation.
pubmed doi rcsb
source organism Morganella morganii
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2m67A00
2M67A 2MOZA
chains in the Genus database with same CATH superfamily
3N9OA 1QSDA 2MTQA 4DR4T 3V5SA 4GK5E 4GK0E 2K5BB 4CN1A 1D0XA 2LSJA 1HCIA 3ESLA 4X1YE 4JI4T 3ZMTB 1XZYA 3FBZA 2WDVA 3CKDA 2BZBA 2R6GF 4LMLA 4TWHA 4O4HE 4DR2T 1LRZA 2QYWA 4A98A 4YTNA 4HFDA 3BK9A 3U3IA 3GN5A 3FZLB 2V8SV 2XAGB 5GONE 1FMWA 5JDNA 3BQKA 3TLUA 3ZSSA 4AKRB 1WYCA 3ZYKA 3ZKRA 4OK0A 3ZPOA 4O2BE 4YY3T 2BS2A 2BG9B 1EZ3A 2V7LA 4CQIA 2WP9A 5LMUT 1LKXA 3OYZA 4H63V 4H9NC 1MMAA 2BDEA 3L3PA 5AQTB 3EI0A 4F8HA 4U7YA 5LP6E 5ABHA 4JI5T 4PFOA 1HG5A 4HFEA 4PFPA 3QB5A 3FXDB 3AEBA 5JDQA 4YLHA 3B57A 2F4VT 4AISA 1ZHCA 2XAJB 1H7CA 2YOEA 2ZLYA 4EV6A 4PAGA 5HEHA 2VKHA 3M65A 1I6ZA 2J4GA 2V5CA 5FL0A 1AJ3A 2XPKA 3QUJA 2PFVA 3KV4A 3AEFA 5AQIB 3AVSA 3K8PC 2CEAA 3QOFA 4GYSA 3RIUC 4NPPA 1HTJF 4I50E 2MBGA 3AB3B 3PE0A 1ZOYA 4LF4T 4DBQA 3RHWA 4QWNB 2H7VC 2W62A 5FXZA 3AE7A 3T1HT 4JI3T 4ZHQE 4LF6T 3P4QA 5JVDE 1NWMX 3PUWF 2VURA 5KX5E 1IBMT 5L3FB 4CN6A 5CGMA 2HHHT 3PTRB 2CWOA 4HFBA 3I9YA 2VK9A 4UR9A 4HWFA 5FL1A 4ZZBA 3MXZA 4P0BA 4TUYE 3LK42 4IE4A 4KBMB 3J7Yq 4JI1T 2ZMAA 3IF8B 5L3EB 4MLKA 2XTLA 2XASB 3CK6A 3AE4A 4U7IA 2YEVC 2WY2A 4EGWA 2V26A 3QB5K 2W4XA 4O4IE 3HA4A 3E0ZA 1OEDB 4UF0B 4LF7T 2XQ3A 4DR6T 2LSYA 4ZOLE 3PU3A 1HNWT 3CVRA 2YDSA 4IGUA 2H88A 2NP9A 3P4SA 2N1GA 5H6RB 2C5KT 4N78D 2E8IA 5EZYE 2BVLA 1M62A 1WRDA 3MKDA 2VKJA 3PUZF 3EABA 2HH7A 3CX8B 4Z8XA 3A8YC 1ZKEA 5EK4A 1FEWA 4CI3B 2K24A 1KNZA 4OX9T 2BG9E 3ANWA 4UIGA 4U31A 3AEAA 3UUMA 4H9SE 3SFEA 3VKGA 5JR9A 2E5VA 3ZSTA 4X20E 4TX5A 3ZJ2A 1IZNB 1YQ3A 3C4WA 3A5XA 2MPKA 5AFUL 4U72A 1YKEB 1KEYA 5IYZE 1XDPA 1E7PA 5LBQB 4O8SA 4PW8A 4ZS2A 2OA5A 2ZM2A 2YKSA 2YU1A 2CHNA 3GA8A 1N36T 4DV7T 1X9BA 3L09A 3Q5DA 4FI5A 4QH4A 2KT9A 1UK5A 2UXBT 4I4TE 1XMOT 5L47A 1YQ4A 2Y6XA 2BG9A 2Q9QB 4EYYR 2ACZA 2KWIB 4O4JE 2V6XA 4B3RT 3O4XE 4ILBA 4OYKA 4QXBB 4YSXA 4TNVA 1HG2A 5L3BB 2FJAA 2D5UA 3TLVA 2KZ7B 5H6QB 3MA9A 3UT5E 3PV0F 2NWBA 4DV5T 2I59A 1JNZA 1NEKA 3N5LA 3AAEB 2X9XA 5HEOA 1T8BA 2XY8B 3OYXA 4K0UA 3UU4A 2LSGA 4UV8B 3I1AA 3VR8A 4L0RA 4QKNA 2EHOC 3ZLIA 3A7MA 3CQXC 3RPUA 3N9NA 1BR4A 2UXDT 5BMVE 1YKHB 3E22E 3Q5XA 2J62A 4QX8B 1MNDA 3T1YT 3F31A 4IE7A 2E5LT 2Q9QD 1S35A 2X68A 5LGUB 3RYHE 3FBLA 5LGTB 3JADA 1L0VA 5AQJB 5LNKA 1MMNA 3LG7A 4IE0A 4Q25A 4ISTA 3PJAJ 5LBMA 5FYMA 2B76A 3R6NA 3JCFA 4GKKT 5J2UE 3EDVA 4ZI2C 1NENA 4GKJT 1WFDA 3ZC0A 5LMNT 4ZI7E 3ZCIA 4PJJA 4ZS3A 1MIWA 2VVSA 2M6BA 4ILAA 5M4YA 2KLQA 3K3NA 3UUNA 2VB6A 4YT0A 4DV6T 2L3LA 2XQ6A 1R8IA 4XBFB 3ZEFB 3CX6B 2ES0A 3C50A 3KBUA 2XQ5A 2CLYC 3ABVA 2D0UA 3OTOT 2V7KA 4ISSA 3OJAA 4HEAA 2PTFA 3KDSE 2NW9A 1OEDA 4UF0A 5E0OA 3DP7A 1CHUA 3N9LA 3UTKA 4BJMA 4C91A 2WDRA 2WWUA 2WM9A 5HWYA 5LJMA 2QRXA 2X0LB 5HEGA 3ZC1A 3PUGA 4B3ST 1SA0E 4BA9A 1KK7A 1V9DA 3S4UA 3K3OA 5L3DB 4IREA 4H9QC 2XQ9A 2YN6A 3G06A 3UU8A 3PU8A 2XSBA 1IAPA 1BR0A 3ETUA 2LKHA 4EZ4A 2K3WA 1HS7A 3IEEA 4WZXA 1FMVA 1U5PA 3PUAA 4TZ4C 3NZPA 5HXHA 3JC6D 5HWXA 3RH3A 1HX1B 4MBQA 5FVKA 3O9XA 1W9RA 4ILCA 1WR0A 3NRYA 5HEJA 1SE7A 1SUMB 2YU2A 5FMNA 3H3AA 1JNRA 2D2SA 2BKPA 1MMDA 1WR6A 3JAEA 5AQFB 2CXLA 3N2GE 1YD8G 2IDOB 3QNUA 4QX7B 5AQHB 5EK2A 2WU2A 2DWKA 2C5IT 5FP3A 2VKOA 1QUUA 3C51A 2Q9QA 4CI1B 1KFYA 2WMNA 5AQVB 2A72A 1VCSA 4HWCA 2ZM6T 4TV9E 2IMLA 4P0AA 1OWAA 1UX4A 4AKIA 4QXCB 1N32T 4KUMB 3RIAA 5JH7E 3Q5WA 4EOZB 1MNEA 2JQKA 4DUZT 2DHRA 5LGNB 5LJNA 4EEDA 2IIUA 5KDMC 2Y8DA 1LVKA 3ZYLA 3L39A 2DLRA 4TWFA 2KMFA 2HPLA 2NTYA 4X65T 4B3TT 3MJXA 4H63H 5EK3A 5HCJA 4I0UA 5LHHB 5HXSA 3EAMA 5AQRB 4PK4A 5JRCB 2W66A 4ZZCA 4X1IE 3VKHA 2HN1A 2WDQA 3AE9A 4ASKA 2JPFA 4CXWA 2CBJA 2CWYA 2I0MA 2BBHA 2UU9T 3NWIA 2K48A 5ABFB 3JAFA 5IWAT 1WLXA 3W15B 3AE1A 3ZYMA 4LF5T 3RQUA 4YHHT 2XHEB 1Z8UA 5HEUA 3TLTA 1MIVA 3AA0B 3C4ZA 3X1DA 2SPCA 4DMVA 4IE6A 4LMKA 3KINB 5AQLB 3ONXA 2WS3A 2WZIA 3FZKB 3O1JA 4YXDA 2LEHA 1Z0PA 3F2EA 5HYAA 3ZMUB 1UCUA 4QHOA 4AKGA 2DCFA 4ADZA 3ZN1B 4OFZA 5LYJE 3SOLA 2RPAA 4PK5A 4C90A 2A2FX 2KSRA 4JI8T 1YXRA 1VRBA 3RC8A 5FY0A 2BKNA 4AQFC 3EDUA 4FJOA 1XMQT 2XM2A 3RYIE 4OHFA 4KMCA 4JI7T 2VASA 3QC9A 2N2NA 3RGLA 3HKDE 5JDGA 4PJMA 2W61A 3CWZB 4DVDA 4UVAB 3HR0A 3EUHA 5AQOB 3UFGA 3AE3A 4NIQA 2CCQA 2KNDA 5DJQC 2H7OA 3IA3A 5ETWA 2JQQA 2IHR1 4IL9A 4EEBA 4PJLA 3BQIA 4IE5A 4KP3C 1FIOA 2CXFA 5F8PA 4LFCT 4CZZB 1D0YA 3OVUA 4HFIA 2FBWA 4GOUA 3NKZA 5J1GA 4U74A 3N2KE 1I94T 2V7MA 4P1NA 1HNXT 4HE8A 1W0AA 1HNZT 4KX6A 1KNRA 2W67A 2X9WA 4M1PA 5ABGA 3BQLA 3N2OA 1T98A 2LHNA 4DR5T 3GMIA 3C4XA 3OKQA 3ONLC 2MYSA 2CA5A 3LK3B 4MHCA 3ETVA 2PG8A 3RKGA 4DV1T 3P7IA 3KBTA 3KV6A 4YJ3E 4V1Av 4QH1A 2MOZA 4CN4A 2XAQB 2MAWA 4MALA 5F3JA 3FZHB 1MIYA 2X66A 3WAKA 4EYUA 3ZN0B 4TN7B 4WNKA 4ZI3C 4ANJA 3RKOA 5JRCA 5DABA 4COFA 2Z6EA 4JI2T 2IUBA 1T72A 1IBLT 2G0UA 5FNVE 5L4HA 3I9WA 2XQ7A 2I6HA 3KVAA 3VHLA 2AE9A 4DV0T 3DTOA 4BJNA 3VRAA 1IBKT 4ZXLA 2QVAA 5ABEA 4NXMT 3CX7B 2Y48B 3WI3A 5ABFA 2JQ9A 2BVMA 5AQSB 4HKAA 2KXPB 1HFAA 4GIWA 3WAJA 2NW7A 1J1JA 2WAUA 4X66T 2JMHA 5LOVE 2WWVA 1O3XA 1Y64B 3HKBE 1XNRT 4HWHA 2V7IA 3AE2A 3NZQA 3CIRA 4CXYA 2BS4A 1VOMA 3HL6A 3RQWA 4AQGA 1HF8A 3O1IA 2BKOA 2E2AA 2LRKA 1KNPA 3AEDA 3CMLA 4A97A 1E1HB 4H9RC 4U33A 5AQMB 4X64T 4IL4A 1J5ET 2EHOB 2E9XC 2GK9A 5LHGB 3V5UA 1N33T 2FJEA 3P4RA 2WB5A 5LG4A 4WW0A 4TNWA 2NW8A 3RIUA 2IC9A 1G73A 2J47A 2V5DA 3AA6B 1OXZA 5L4EA 1LVFA 2VQFT 5JTGA 4JYAT 5L2LA 3SRZA 3FZFB 5BR8T 4IDNA 1W0BA 3FHNA 3D0TA 3UQ4A 4IHJE 2LHRA 4YTMA 4X62T 3VRBA 2M67A 5JR9C 3PUYF 2LKGA 2N9DA 2EHOD 4A5XA 2H3RA 3MK7C 2W63A 3PJAA 3Q5EA 4PK6A 5AQGB 1WCRA 3HI2A 3CQGB 5A1LA 2CLYB 4HFCA 2YDRA 3AXJB 4KHZF 5L3CB 3ZT6A 3IHRA 4LF8T 4I43B 2LSKA 2NTXA 1VCTA 1HX8A 4F6RC 4O2AE 4J2CA 4XAXB 3PUSA 5CA1E 1WYBA 1G8XA 2BG9C 2CXDA 4ZI2D 3RYFE 3ZMSB 3PURA 3RIFA 4DUYT 4UXNB 4PNIA 2UUBT 2E9XD 4DV4T 4EIWA 1M7KA 3I0QA 4L9IA 1D0ZA 5FVLA 2ODUA 2PJQA 4HFHA 3B13A 5HCMA 1UGOA 3AEEA 3LK2B 1ZP0A 3IBPA 3EVYA 2PBIA 2V6YB 1B7TA 2X51A 2WQYA 4YSYA 2HPJA 4HTEA 2LT3A 2UXXB 3AAIA 3TLSA 5F5WA 4NUVA 4DR3T 4UELA 2ZM8A 2CMRA 3M3ZB 1YW0A 4HFVA 4UV9B 4IDPA 3EHZA 3SS1A 2IW5B 2HN2A 2BS3A 4B6XA 2VWAA 3ZJ1A 3MACA 2XQ8A 3UUXB 4ZEYA 1Y01A 3B5MA 1ZEEA 4AQYT 3FXEB 1W09A 4YSZA 3RF1A 2DNXA 3UULA 2W00A 2XSAA 2VVNA 4WBNE 3RX6A 2WSSV 5C8YE 2H89A 3UU3A 3LBXB 1BR2A 5FKYA 3PUXF 2XAFB 2D0TA 3GWHA 3N9PA 4AXPA 4UVCB 4IDZA 3MZKB 2D9DA 2KINB 4YFSA 2EHOA 3J9X1 4WBOA 4JEHB 3AA7B 2DI4A 1XWMA 4JV5T 2NR4A 3SWHA 2CBIA 3RRCA 5KXJA 3FZMB 1OEDC 5TAOA 2LOSA 4UEMA 2A3DA 2CPTA 4JI6T 1GQEA 4G2AA 2ZM0A 4YHJA 3DJBA 2YK0A 1ZV4X 4X5TA 2K9AA 2L9QA 4DMWA 2CE7A 2XUEA 1IJ5A 4DBRA 3HKCE 2LRLA 2IC6A 4DIDB 2C5JA 3KFWX 5CA0E 5FXXA 4HGAA 1BR1A 4LMJA 5JQGE 1D1AA 2JMKA 4AKHA 4AIUA 4DNDA 5CB4E 2XQYA 2E9XA 4PJNA 2X0HA 2BBJA 2LE8A 4K0KT 3OBVE 1QLBA 3CQCB 5C3JA 4CI2B 2QGSA 4I55E 4E7ZA 3CPZA 4UVBB 5LA6E 2W0GA 3RC3A 3P50A 3AXJA 3N9QA 5JDHA 4H9PC 1XNQT 2NOXA 2XQAA 3TLWA 2VKDA 4H9OC 2LOPA 2JIWA 4B3MT 2VL8A 4IDQA 2OV9A 5HAXA 2JJ9A 4NUUA 3P8CD 4TV8E 2YINA 1J5WA 4AKLA 3RYCE 2Q9QC 2WBLA 2YDQA 4GYRA 4QXHB 3L8RA 4LF9T 2W2UA 1DU2A 3UU6A 3I0OA 4JEUB 2ACXA 2XJ7A 4U3CA 2V1DB 2XM1A 4EAHA 3C64A 4O4LE 2P9BA 3O1HA 1FJGT 3K3QC 2M6IA 2C0SA 1D1CA 3R84B 4TWDA 2V6YA 4EXTA 2CM0A 2A9UA 2WMOA 5LG3A 3Q2MA 5AQPB 3TKLB 3FB2A 4JLEA 3P4WA 1X79A 2UUAT 4MFRA 4DO0A 4LFBT 3U78A 4DV3T 2WCAA 1N34T 4IT4A 3NRXA 3ONJA 3ZMZB 5HXRA 4EB6E 5JREA 3AAAB 2LSIA 3AEGA 3GN5B 3F57A 3NVOA 4OYJA 4LFAT 4AI6A 2CRBA 2JRKA 2LM2A 1T7SA 3OPCA 2LJLA 2KWHA 3T8OA 1U4QA 3UU5A 2UUCT 3UQ7A 3AA1B 5IHYA 2OLTA 4ERRA 3LBXA 2QA7A 4L5GA 4EZHA 5AQQB 5LCYA 2XQ4A 2ODVA 2X9HA 3NBXX 5CJ5A 1S94A 4IDOA 2AXDS 2UXCT 5HXCA 3UFEA 3JC6C 4YJ2E 2IAKA 3AE5A 3VR9A 4JUYA 3ZT7A 1SHZC 1OEDE 4BAYB 3ZMVB 5KMGP 5AQKB 2JQHA 4E7SA 5J2TE 2RP4A 3H3MA 3AVRA 1MMGA 5C2TA 1UURA 5ADXL 2FJBA 3RRWA 5FY7A 3VU7H 3LDQB 4HWIB 1UX5A 5FXWA 4WYVA 4NXNT 4KHPT 5IUXA 2X67A 3H37A 3AE6A 2V7JA 3SFDA 5HXEA 4HN9A 2X0YA 3K1SA 3PUQA 3LSVA 4KI0F 4DR7T 5FXVA 3KVBA 2FJDA 1IJ6A 2XAHB 4G63A 4U2YA 1UUSA 4CXXA 3P4PA 3QK6A 2VQET 1CUNA 4ZI3D 3LJCA 4DR1T 4XZCA 4A56A 1US7B 3RI5A 2WZHA 2LLYA 5JDLA 3C98B 5LHIB 2CHOA 4ILUA 2E9XB 3HKEE 3UUBA 5AQUB 2XZEA 4AQFA 3RLFF 3ZCJA 3AECA 5LXTE 2L8KA 4QH5A 3Q9DA 2FUPA 5LB7B 4JI0T 1HR0T 5AQNB 3LFMA 4X1KE 2DL1A 1E2AA 2UXNB 2DWGA 4JBWF 5JDMA 2B1EA 1KF6A 5JDFA 4Z90A 1XDOA 2RA1A 4DV2T 1NAFA 2LM9A 3E08A 4P09A 3KV5A 3N9MA 3ZT5A 5J0ZA 2X9YA 5CFBA 4IIJE 2J1DG 3AE8A 5DQVA 5FY1A 3ANWB 4HWDA 3PDYA 5DQWA 2WU5A 3KV9A 5L3GB 1D1BA 3PUVF 4Z91A 5JR9B 4YTPA 4U2ZA 2VL0A
chains in the Genus database with same CATH topology
5FYMA 3N9OA 1QSDA 4M1PA 2X9WA 3SWHA 2MTQA 3R6NA 3BQLA 3RRCA 3N2OA 1T98A 3V5SA 2LHNA 4GK5E 5J2UE 4GK0E 3EDVA 5TAOA 2K5BB 5LBMA 4ZI2C 3GMIA 1D0XA 2LOSA 2LSJA 1HCIA 3ZC0A 3C4XA 4UEMA 2A3DA 3OKQA 2MYSA 3ESLA 4ZI7E 3ZCIA 4PJJA 2CA5A 3LK3B 4MHCA 4X1YE 3ETVA 4ZS3A 1MIWA 4G2AA 2ZM0A 3ZMTB 5M4YA 2KLQA 3K3NA 3UUNA 2VB6A 2PG8A 3FBZA 4YHJA 3DJBA 2L3LA 4XBFB 3CKDA 2YK0A 2BZBA 1ZV4X 3P7IA 3ZEFB 3CX6B 2ES0A 4O4HE 3C50A 3KBTA 3KV6A 1LRZA 3KBUA 4YJ3E 2CLYC 2K9AA 4V1Av 2L9QA 2MOZA 4DMWA 2D0UA 2XAQB 3BK9A 2CE7A 2V7KA 4ISSA 3GN5A 3U3IA 2XUEA 1IJ5A 4MALA 3OJAA 4DBRA 3HKCE 5F3JA 1MIYA 2XAGB 5GONE 2X66A 1FMWA 3WAKA 4EYUA 2IC6A 4HEAA 5JDNA 3ZN0B 3BQKA 4TN7B 3KDSE 2C5JA 3KFWX 2NW9A 5FXXA 4WNKA 4HGAA 1BR1A 1WYCA 3ZYKA 4AKRB 5CA0E 4UF0A 5E0OA 3ZPOA 3DP7A 4OK0A 4O2BE 3N9LA 1D1AA 5JQGE 2JMKA 1EZ3A 3UTKA 4AKHA 4DNDA 2V7LA 4ZI3C 4ANJA 3RKOA 4BJMA 4CQIA 5JRCA 5DABA 4C91A 1LKXA 2WWUA 2Z6EA 3OYZA 2WM9A 2XQYA 4H63V 4H9NC 1MMAA 5CB4E 2G0UA 5FNVE 2BDEA 2E9XA 4PJNA 3L3PA 5HWYA 2LE8A 5LJMA 3I9WA 2X0LB 3ZC1A 3OBVE 3PUGA 1SA0E 5LP6E 3KVAA 3CQCB 4BA9A 1KK7A 4PFOA 3VHLA 2QGSA 4CI2B 1HG5A 1V9DA 3DTOA 4PFPA 3S4UA 4BJNA 4I55E 3K3OA 5L3DB 3FXDB 4H9QC 3CX7B 2Y48B 4E7ZA 3CPZA 5JDQA 4YLHA 3PU8A 4UVBB 5LA6E 2W0GA 3WI3A 2BVMA 3B57A 3RC3A 1IAPA 1BR0A 3ETUA 4EZ4A 4HKAA 2KXPB 3N9QA 1ZHCA 5JDHA 1HS7A 1HFAA 2XAJB 1H7CA 4H9PC 2ZLYA 2NOXA 3IEEA 4PAGA 4GIWA 3WAJA 2VKHA 3M65A 2VKDA 2NW7A 4H9OC 2LOPA 2WAUA 2JMHA 5LOVE 1FMVA 1U5PA 3PUAA 4TZ4C 1AJ3A 3NZPA 5HXHA 3JC6D 3QUJA 1O3XA 2VL8A 5HWXA 1Y64B 3HKBE 3RH3A 5HAXA 2PFVA 2JJ9A 3KV4A 4MBQA 4NUUA 3P8CD 2V7IA 4TV8E 3O9XA 3NZQA 4CXYA 2YINA 3RYCE 3HL6A 1VOMA 2Q9QC 3AVSA 3K8PC 4AKLA 2CEAA 2WBLA 4AQGA 3NRYA 4GYRA 4QXHB 4GYSA 1HF8A 3O1IA 1HTJF 2YU2A 4I50E 2MBGA 3AB3B 5FMNA 3PE0A 3H3AA 3I0OA 4DBQA 2D2SA 4JEUB 2ACXA 4QWNB 1MMDA 3CMLA 1WR6A 2H7VC 2W62A 2V1DB 5FXZA 4EAHA 1E1HB 3C64A 4H9RC 4ZHQE 4O4LE 2CXLA 2P9BA 3O1HA 3N2GE 5JVDE 1NWMX 2EHOB 2E9XC 2GK9A 5KX5E 5L3FB 5LHGB 1YD8G 3K3QC 3V5UA 2C0SA 1D1CA 4QX7B 3R84B 4EXTA 3PTRB 5EK2A 2DWKA 2C5IT 2CM0A 2CWOA 5FP3A 2WMOA 2VKOA 1QUUA 3C51A 3Q2MA 5LG4A 4WW0A 2Q9QA 3I9YA 3TKLB 3FB2A 4CI1B 2VK9A 4JLEA 2NW8A 2WMNA 1X79A 2IC9A 1G73A 2A72A 3MXZA 4MFRA 4DO0A 4P0BA 4TV9E 4TUYE 3LK42 4IE4A 4KBMB 3U78A 3J7Yq 4P0AA 2ZMAA 3AA6B 1OWAA 1OXZA 1UX4A 4AKIA 4QXCB 1LVFA 3IF8B 5L3EB 3NRXA 4KUMB 4MLKA 2XTLA 5JH7E 3Q5WA 2XASB 4EOZB 1MNEA 3ZMZB 5HXRA 4EB6E 5L2LA 3SRZA 5JREA 3AAAB 2LSIA 2DHRA 2YEVC 5LGNB 3GN5B 3F57A 5LJNA 2V26A 4OYJA 5KDMC 2Y8DA 1LVKA 3FHNA 3D0TA 2DLRA 4O4IE 2KMFA 2HPLA 2NTYA 3HA4A 3E0ZA 3ZYLA 3MJXA 4H63H 5EK3A 4IHJE 2LHRA 5LHHB 2JRKA 4UF0B 5HXSA 4PK4A 2LJLA 2KWHA 5JRCB 2LSYA 2M67A 4ZOLE 3T8OA 1U4QA 3PU3A 5JR9C 3CVRA 2N9DA 4IGUA 4X1IE 2EHOD 2H3RA 2NP9A 3MK7C 3VKHA 2W63A 2N1GA 5H6RB 3AA1B 2C5KT 4N78D 2E8IA 5EZYE 5IHYA 4PK6A 2BVLA 1WRDA 3MKDA 4ASKA 2JPFA 4CXWA 3HI2A 3CQGB 2CWYA 2VKJA 5A1LA 4ERRA 3LBXA 2CLYB 2QA7A 2HH7A 3CX8B 4L5GA 2K48A 4Z8XA 4EZHA 1ZKEA 5EK4A 1FEWA 1WLXA 5LCYA 3W15B 4CI3B 2K24A 1KNZA 3ZYMA 2ODVA 2X9HA 3NBXX 5L3CB 2XHEB 3ANWA 4UIGA 1S94A 3IHRA 5HXCA 4I43B 2LSKA 1MIVA 2NTXA 3AA0B 3C4ZA 3UUMA 3UFEA 4H9SE 1HX8A 4F6RC 2SPCA 3JC6C 4YJ2E 3VKGA 5JR9A 2IAKA 4DMVA 4IE6A 4JUYA 4J2CA 4O2AE 4XAXB 1SHZC 3KINB 4BAYB 3ZMVB 4X20E 4TX5A 5KMGP 3PUSA 3ONXA 5CA1E 3ZJ2A 4E7SA 5J2TE 2RP4A 1WYBA 3AVRA 1G8XA 1IZNB 1MMGA 3O1JA 2CXDA 5ADXL 3RRWA 3C4WA 4ZI2D 3A5XA 5FY7A 3VU7H 3RYFE 2LEHA 5AFUL 4U72A 1UX5A 1YKEB 5IYZE 3ZMSB 3PURA 5FXWA 1Z0PA 3F2EA 4UXNB 4PNIA 5LBQB 2X67A 5HYAA 4O8SA 4PW8A 3ZMUB 1UCUA 2E9XD 3H37A 4QHOA 4ZS2A 4EIWA 2OA5A 2ZM2A 2V7JA 3I0QA 2YU1A 4AKGA 2DCFA 3GA8A 4ADZA 5HXEA 4L9IA 3ZN1B 4OFZA 3L09A 1D0ZA 5LYJE 2ODUA 2PJQA 3B13A 3SOLA 4C90A 4PK5A 4HN9A 2A2FX 3PUQA 3LK2B 4FI5A 1VRBA 3RC8A 5FY0A 2KT9A 3IBPA 4AQFC 3EDUA 3EVYA 4FJOA 5FXVA 3KVBA 1IJ6A 2XAHB 2PBIA 3RYIE 4OHFA 4I4TE 4G63A 4KMCA 2VASA 1B7TA 2X51A 4CXXA 3QC9A 2Y6XA 4AI6A 2Q9QB 2N2NA 4EYYR 2HPJA 4HTEA 2KWIB 4O4JE 3QK6A 2LT3A 2UXXB 3AAIA 3O4XE 1CUNA 4ZI3D 3HKDE 4NUVA 5JDGA 3LJCA 4XZCA 4OYKA 4QXBB 4A56A 1HG2A 4PJMA 5L3BB 2D5UA 4UELA 2ZM8A 2KZ7B 5H6QB 2W61A 3MA9A 3CWZB 2CMRA 3UT5E 1US7B 4DVDA 5JDLA 1YW0A 4UVAB 3HR0A 3EUHA 2NWBA 3C98B 4HFVA 2I59A 5LHIB 3N5LA 4ILUA 2E9XB 3AAEB 3HKEE 4UV9B 2CCQA 2KNDA 5DJQC 3SS1A 2X9XA 4AQFA 2H7OA 2IW5B 3ZCJA 5LXTE 4B6XA 2VWAA 2L8KA 5ETWA 3Q9DA 3ZJ1A 3OYXA 2JQQA 4K0UA 2LSGA 3MACA 4UV8B 3I1AA 3LFMA 3UUXB 4X1KE 4L0RA 4QKNA 2EHOC 3CQXC 4PJLA 3ZLIA 3BQIA 4IE5A 4KP3C 3RPUA 1ZEEA 2UXNB 1FIOA 3N9NA 2CXFA 5F8PA 1BR4A 3FXEB 2DWGA 5BMVE 4CZZB 1D0YA 2DNXA 3UULA 1YKHB 3E22E 3Q5XA 5JDMA 2W00A 2B1EA 4WBNE 4QX8B 5JDFA 1MNDA 3RX6A 2WSSV 5C8YE 2RA1A 3F31A 3LBXB 4GOUA 4IE7A 1NAFA 2Q9QD 2LM9A 5J1GA 1BR2A 3E08A 4U74A 1S35A 2XAFB 2X68A 4P09A 3KV5A 2D0TA 3GWHA 3N2KE 3N9MA 5LGUB 3N9PA 2X9YA 3RYHE 4IIJE 3FBLA 2J1DG 4UVCB 2V7MA 4AXPA 5LGTB 5DQVA 5FY1A 4IDZA 3ANWB 3MZKB 4HE8A 3PDYA 5DQWA 2KINB 5LNKA 3KV9A 1MMNA 3LG7A 5L3GB 1D1BA 4IE0A 4YFSA 2EHOA 5JR9B 3J9X1 4ISTA 4WBOA 4JEHB 3AA7B 2DI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M67 A;  2MOZ A; 
#chains in the Genus database with same CATH topology
 3N9O A;  1QSD A;  2MTQ A;  4DR4 T;  3V5S A;  4GK5 E;  4GK0 E;  2K5B B;  4CN1 A;  1D0X A;  2LSJ A;  1HCI A;  3ESL A;  4X1Y E;  4JI4 T;  3ZMT B;  1XZY A;  3FBZ A;  2WDV A;  3CKD A;  2BZB A;  2R6G F;  4LML A;  4TWH A;  4O4H E;  4DR2 T;  1LRZ A;  2QYW A;  4A98 A;  4YTN A;  4HFD A;  3BK9 A;  3U3I A;  3GN5 A;  3FZL B;  2V8S V;  2XAG B;  5GON E;  1FMW A;  5JDN A;  3BQK A;  3TLU A;  3ZSS A;  4AKR B;  1WYC A;  3ZYK A;  3ZKR A;  4OK0 A;  3ZPO A;  4O2B E;  4YY3 T;  2BS2 A;  2BG9 B;  1EZ3 A;  2V7L A;  4CQI A;  2WP9 A;  5LMU T;  1LKX A;  3OYZ A;  4H63 V;  4H9N C;  1MMA A;  2BDE A;  3L3P A;  5AQT B;  3EI0 A;  4F8H A;  4U7Y A;  5LP6 E;  5ABH A;  4JI5 T;  4PFO A;  1HG5 A;  4HFE A;  4PFP A;  3QB5 A;  3FXD B;  3AEB A;  5JDQ A;  4YLH A;  3B57 A;  2F4V T;  4AIS A;  1ZHC A;  2XAJ B;  1H7C A;  2YOE A;  2ZLY A;  4EV6 A;  4PAG A;  5HEH A;  2VKH A;  3M65 A;  1I6Z A;  2J4G A;  2V5C A;  5FL0 A;  1AJ3 A;  2XPK A;  3QUJ A;  2PFV A;  3KV4 A;  3AEF A;  5AQI B;  3AVS A;  3K8P C;  2CEA A;  3QOF A;  4GYS A;  3RIU C;  4NPP A;  1HTJ F;  4I50 E;  2MBG A;  3AB3 B;  3PE0 A;  1ZOY A;  4LF4 T;  4DBQ A;  3RHW A;  4QWN B;  2H7V C;  2W62 A;  5FXZ A;  3AE7 A;  3T1H T;  4JI3 T;  4ZHQ E;  4LF6 T;  3P4Q A;  5JVD E;  1NWM X;  3PUW F;  2VUR A;  5KX5 E;  1IBM T;  5L3F B;  4CN6 A;  5CGM A;  2HHH T;  3PTR B;  2CWO A;  4HFB A;  3I9Y A;  2VK9 A;  4UR9 A;  4HWF A;  5FL1 A;  4ZZB A;  3MXZ A;  4P0B A;  4TUY E;  3LK4 2;  4IE4 A;  4KBM B;  3J7Y q;  4JI1 T;  2ZMA A;  3IF8 B;  5L3E B;  4MLK A;  2XTL A;  2XAS B;  3CK6 A;  3AE4 A;  4U7I A;  2YEV C;  2WY2 A;  4EGW A;  2V26 A;  3QB5 K;  2W4X A;  4O4I E;  3HA4 A;  3E0Z A;  1OED B;  4UF0 B;  4LF7 T;  2XQ3 A;  4DR6 T;  2LSY A;  4ZOL E;  3PU3 A;  1HNW T;  3CVR A;  2YDS A;  4IGU A;  2H88 A;  2NP9 A;  3P4S A;  2N1G A;  5H6R B;  2C5K T;  4N78 D;  2E8I A;  5EZY E;  2BVL A;  1M62 A;  1WRD A;  3MKD A;  2VKJ A;  3PUZ F;  3EAB A;  2HH7 A;  3CX8 B;  4Z8X A;  3A8Y C;  1ZKE A;  5EK4 A;  1FEW A;  4CI3 B;  2K24 A;  1KNZ A;  4OX9 T;  2BG9 E;  3ANW A;  4UIG A;  4U31 A;  3AEA A;  3UUM A;  4H9S E;  3SFE A;  3VKG A;  5JR9 A;  2E5V A;  3ZST A;  4X20 E;  4TX5 A;  3ZJ2 A;  1IZN B;  1YQ3 A;  3C4W A;  3A5X A;  2MPK A;  5AFU L;  4U72 A;  1YKE B;  1KEY A;  5IYZ E;  1XDP A;  1E7P A;  5LBQ B;  4O8S A;  4PW8 A;  4ZS2 A;  2OA5 A;  2ZM2 A;  2YKS A;  2YU1 A;  2CHN A;  3GA8 A;  1N36 T;  4DV7 T;  1X9B A;  3L09 A;  3Q5D A;  4FI5 A;  4QH4 A;  2KT9 A;  1UK5 A;  2UXB T;  4I4T E;  1XMO T;  5L47 A;  1YQ4 A;  2Y6X A;  2BG9 A;  2Q9Q B;  4EYY R;  2ACZ A;  2KWI B;  4O4J E;  2V6X A;  4B3R T;  3O4X E;  4ILB A;  4OYK A;  4QXB B;  4YSX A;  4TNV A;  1HG2 A;  5L3B B;  2FJA A;  2D5U A;  3TLV A;  2KZ7 B;  5H6Q B;  3MA9 A;  3UT5 E;  3PV0 F;  2NWB A;  4DV5 T;  2I59 A;  1JNZ A;  1NEK A;  3N5L A;  3AAE B;  2X9X A;  5HEO A;  1T8B A;  2XY8 B;  3OYX A;  4K0U A;  3UU4 A;  2LSG A;  4UV8 B;  3I1A A;  3VR8 A;  4L0R A;  4QKN A;  2EHO C;  3ZLI A;  3A7M A;  3CQX C;  3RPU A;  3N9N A;  1BR4 A;  2UXD T;  5BMV E;  1YKH B;  3E22 E;  3Q5X A;  2J62 A;  4QX8 B;  1MND A;  3T1Y T;  3F31 A;  4IE7 A;  2E5L T;  2Q9Q D;  1S35 A;  2X68 A;  5LGU B;  3RYH E;  3FBL A;  5LGT B;  3JAD A;  1L0V A;  5AQJ B;  5LNK A;  1MMN A;  3LG7 A;  4IE0 A;  4Q25 A;  4IST A;  3PJA J;  5LBM A;  5FYM A;  2B76 A;  3R6N A;  3JCF A;  4GKK T;  5J2U E;  3EDV A;  4ZI2 C;  1NEN A;  4GKJ T;  1WFD A;  3ZC0 A;  5LMN T;  4ZI7 E;  3ZCI A;  4PJJ A;  4ZS3 A;  1MIW A;  2VVS A;  2M6B A;  4ILA A;  5M4Y A;  2KLQ A;  3K3N A;  3UUN A;  2VB6 A;  4YT0 A;  4DV6 T;  2L3L A;  2XQ6 A;  1R8I A;  4XBF B;  3ZEF B;  3CX6 B;  2ES0 A;  3C50 A;  3KBU A;  2XQ5 A;  2CLY C;  3ABV A;  2D0U A;  3OTO T;  2V7K A;  4ISS A;  3OJA A;  4HEA A;  2PTF A;  3KDS E;  2NW9 A;  1OED A;  4UF0 A;  5E0O A;  3DP7 A;  1CHU A;  3N9L A;  3UTK A;  4BJM A;  4C91 A;  2WDR A;  2WWU A;  2WM9 A;  5HWY A;  5LJM A;  2QRX A;  2X0L B;  5HEG A;  3ZC1 A;  3PUG A;  4B3S T;  1SA0 E;  4BA9 A;  1KK7 A;  1V9D A;  3S4U A;  3K3O A;  5L3D B;  4IRE A;  4H9Q C;  2XQ9 A;  2YN6 A;  3G06 A;  3UU8 A;  3PU8 A;  2XSB A;  1IAP A;  1BR0 A;  3ETU A;  2LKH A;  4EZ4 A;  2K3W A;  1HS7 A;  3IEE A;  4WZX A;  1FMV A;  1U5P A;  3PUA A;  4TZ4 C;  3NZP A;  5HXH A;  3JC6 D;  5HWX A;  3RH3 A;  1HX1 B;  4MBQ A;  5FVK A;  3O9X A;  1W9R A;  4ILC A;  1WR0 A;  3NRY A;  5HEJ A;  1SE7 A;  1SUM B;  2YU2 A;  5FMN A;  3H3A A;  1JNR A;  2D2S A;  2BKP A;  1MMD A;  1WR6 A;  3JAE A;  5AQF B;  2CXL A;  3N2G E;  1YD8 G;  2IDO B;  3QNU A;  4QX7 B;  5AQH B;  5EK2 A;  2WU2 A;  2DWK A;  2C5I T;  5FP3 A;  2VKO A;  1QUU A;  3C51 A;  2Q9Q A;  4CI1 B;  1KFY A;  2WMN A;  5AQV B;  2A72 A;  1VCS A;  4HWC A;  2ZM6 T;  4TV9 E;  2IML A;  4P0A A;  1OWA A;  1UX4 A;  4AKI A;  4QXC B;  1N32 T;  4KUM B;  3RIA A;  5JH7 E;  3Q5W A;  4EOZ B;  1MNE A;  2JQK A;  4DUZ T;  2DHR A;  5LGN B;  5LJN A;  4EED A;  2IIU A;  5KDM C;  2Y8D A;  1LVK A;  3ZYL A;  3L39 A;  2DLR A;  4TWF A;  2KMF A;  2HPL A;  2NTY A;  4X65 T;  4B3T T;  3MJX A;  4H63 H;  5EK3 A;  5HCJ A;  4I0U A;  5LHH B;  5HXS A;  3EAM A;  5AQR B;  4PK4 A;  5JRC B;  2W66 A;  4ZZC A;  4X1I E;  3VKH A;  2HN1 A;  2WDQ A;  3AE9 A;  4ASK A;  2JPF A;  4CXW A;  2CBJ A;  2CWY A;  2I0M A;  2BBH A;  2UU9 T;  3NWI A;  2K48 A;  5ABF B;  3JAF A;  5IWA T;  1WLX A;  3W15 B;  3AE1 A;  3ZYM A;  4LF5 T;  3RQU A;  4YHH T;  2XHE B;  1Z8U A;  5HEU A;  3TLT A;  1MIV A;  3AA0 B;  3C4Z A;  3X1D A;  2SPC A;  4DMV A;  4IE6 A;  4LMK A;  3KIN B;  5AQL B;  3ONX A;  2WS3 A;  2WZI A;  3FZK B;  3O1J A;  4YXD A;  2LEH A;  1Z0P A;  3F2E A;  5HYA A;  3ZMU B;  1UCU A;  4QHO A;  4AKG A;  2DCF A;  4ADZ A;  3ZN1 B;  4OFZ A;  5LYJ E;  3SOL A;  2RPA A;  4PK5 A;  4C90 A;  2A2F X;  2KSR A;  4JI8 T;  1YXR A;  1VRB A;  3RC8 A;  5FY0 A;  2BKN A;  4AQF C;  3EDU A;  4FJO A;  1XMQ T;  2XM2 A;  3RYI E;  4OHF A;  4KMC A;  4JI7 T;  2VAS A;  3QC9 A;  2N2N A;  3RGL A;  3HKD E;  5JDG A;  4PJM A;  2W61 A;  3CWZ B;  4DVD A;  4UVA B;  3HR0 A;  3EUH A;  5AQO B;  3UFG A;  3AE3 A;  4NIQ A;  2CCQ A;  2KND A;  5DJQ C;  2H7O A;  3IA3 A;  5ETW A;  2JQQ A;  2IHR 1;  4IL9 A;  4EEB A;  4PJL A;  3BQI A;  4IE5 A;  4KP3 C;  1FIO A;  2CXF A;  5F8P A;  4LFC T;  4CZZ B;  1D0Y A;  3OVU A;  4HFI A;  2FBW A;  4GOU A;  3NKZ A;  5J1G A;  4U74 A;  3N2K E;  1I94 T;  2V7M A;  4P1N A;  1HNX T;  4HE8 A;  1W0A A;  1HNZ T;  4KX6 A;  1KNR A;  2W67 A;  2X9W A;  4M1P A;  5ABG A;  3BQL A;  3N2O A;  1T98 A;  2LHN A;  4DR5 T;  3GMI A;  3C4X A;  3OKQ A;  3ONL C;  2MYS A;  2CA5 A;  3LK3 B;  4MHC A;  3ETV A;  2PG8 A;  3RKG A;  4DV1 T;  3P7I A;  3KBT A;  3KV6 A;  4YJ3 E;  4V1A v;  4QH1 A;  2MOZ A;  4CN4 A;  2XAQ B;  2MAW A;  4MAL A;  5F3J A;  3FZH B;  1MIY A;  2X66 A;  3WAK A;  4EYU A;  3ZN0 B;  4TN7 B;  4WNK A;  4ZI3 C;  4ANJ A;  3RKO A;  5JRC A;  5DAB A;  4COF A;  2Z6E A;  4JI2 T;  2IUB A;  1T72 A;  1IBL T;  2G0U A;  5FNV E;  5L4H A;  3I9W A;  2XQ7 A;  2I6H A;  3KVA A;  3VHL A;  2AE9 A;  4DV0 T;  3DTO A;  4BJN A;  3VRA A;  1IBK T;  4ZXL A;  2QVA A;  5ABE A;  4NXM T;  3CX7 B;  2Y48 B;  3WI3 A;  5ABF A;  2JQ9 A;  2BVM A;  5AQS B;  4HKA A;  2KXP B;  1HFA A;  4GIW A;  3WAJ A;  2NW7 A;  1J1J A;  2WAU A;  4X66 T;  2JMH A;  5LOV E;  2WWV A;  1O3X A;  1Y64 B;  3HKB E;  1XNR T;  4HWH A;  2V7I A;  3AE2 A;  3NZQ A;  3CIR A;  4CXY A;  2BS4 A;  1VOM A;  3HL6 A;  3RQW A;  4AQG A;  1HF8 A;  3O1I A;  2BKO A;  2E2A A;  2LRK A;  1KNP A;  3AED A;  3CML A;  4A97 A;  1E1H B;  4H9R C;  4U33 A;  5AQM B;  4X64 T;  4IL4 A;  1J5E T;  2EHO B;  2E9X C;  2GK9 A;  5LHG B;  3V5U A;  1N33 T;  2FJE A;  3P4R A;  2WB5 A;  5LG4 A;  4WW0 A;  4TNW A;  2NW8 A;  3RIU A;  2IC9 A;  1G73 A;  2J47 A;  2V5D A;  3AA6 B;  1OXZ A;  5L4E A;  1LVF A;  2VQF T;  5JTG A;  4JYA T;  5L2L A;  3SRZ A;  3FZF B;  5BR8 T;  4IDN A;  1W0B A;  3FHN A;  3D0T A;  3UQ4 A;  4IHJ E;  2LHR A;  4YTM A;  4X62 T;  3VRB A;  2M67 A;  5JR9 C;  3PUY F;  2LKG A;  2N9D A;  2EHO D;  4A5X A;  2H3R A;  3MK7 C;  2W63 A;  3PJA A;  3Q5E A;  4PK6 A;  5AQG B;  1WCR A;  3HI2 A;  3CQG B;  5A1L A;  2CLY B;  4HFC A;  2YDR A;  3AXJ B;  4KHZ F;  5L3C B;  3ZT6 A;  3IHR A;  4LF8 T;  4I43 B;  2LSK A;  2NTX A;  1VCT A;  1HX8 A;  4F6R C;  4O2A E;  4J2C A;  4XAX B;  3PUS A;  5CA1 E;  1WYB A;  1G8X A;  2BG9 C;  2CXD A;  4ZI2 D;  3RYF E;  3ZMS B;  3PUR A;  3RIF A;  4DUY T;  4UXN B;  4PNI A;  2UUB T;  2E9X D;  4DV4 T;  4EIW A;  1M7K A;  3I0Q A;  4L9I A;  1D0Z A;  5FVL A;  2ODU A;  2PJQ A;  4HFH A;  3B13 A;  5HCM A;  1UGO A;  3AEE A;  3LK2 B;  1ZP0 A;  3IBP A;  3EVY A;  2PBI A;  2V6Y B;  1B7T A;  2X51 A;  2WQY A;  4YSY A;  2HPJ A;  4HTE A;  2LT3 A;  2UXX B;  3AAI A;  3TLS A;  5F5W A;  4NUV A;  4DR3 T;  4UEL A;  2ZM8 A;  2CMR A;  3M3Z B;  1YW0 A;  4HFV A;  4UV9 B;  4IDP A;  3EHZ A;  3SS1 A;  2IW5 B;  2HN2 A;  2BS3 A;  4B6X A;  2VWA A;  3ZJ1 A;  3MAC A;  2XQ8 A;  3UUX B;  4ZEY A;  1Y01 A;  3B5M A;  1ZEE A;  4AQY T;  3FXE B;  1W09 A;  4YSZ A;  3RF1 A;  2DNX A;  3UUL A;  2W00 A;  2XSA A;  2VVN A;  4WBN E;  3RX6 A;  2WSS V;  5C8Y E;  2H89 A;  3UU3 A;  3LBX B;  1BR2 A;  5FKY A;  3PUX F;  2XAF B;  2D0T A;  3GWH A;  3N9P A;  4AXP A;  4UVC B;  4IDZ A;  3MZK B;  2D9D A;  2KIN B;  4YFS A;  2EHO A;  3J9X 1;  4WBO A;  4JEH B;  3AA7 B;  2DI4 A;  1XWM A;  4JV5 T;  2NR4 A;  3SWH A;  2CBI A;  3RRC A;  5KXJ A;  3FZM B;  1OED C;  5TAO A;  2LOS A;  4UEM A;  2A3D A;  2CPT A;  4JI6 T;  1GQE A;  4G2A A;  2ZM0 A;  4YHJ A;  3DJB A;  2YK0 A;  1ZV4 X;  4X5T A;  2K9A A;  2L9Q A;  4DMW A;  2CE7 A;  2XUE A;  1IJ5 A;  4DBR A;  3HKC E;  2LRL A;  2IC6 A;  4DID B;  2C5J A;  3KFW X;  5CA0 E;  5FXX A;  4HGA A;  1BR1 A;  4LMJ A;  5JQG E;  1D1A A;  2JMK A;  4AKH A;  4AIU A;  4DND A;  5CB4 E;  2XQY A;  2E9X A;  4PJN A;  2X0H A;  2BBJ A;  2LE8 A;  4K0K T;  3OBV E;  1QLB A;  3CQC B;  5C3J A;  4CI2 B;  2QGS A;  4I55 E;  4E7Z A;  3CPZ A;  4UVB B;  5LA6 E;  2W0G A;  3RC3 A;  3P50 A;  3AXJ A;  3N9Q A;  5JDH A;  4H9P C;  1XNQ T;  2NOX A;  2XQA A;  3TLW A;  2VKD A;  4H9O C;  2LOP A;  2JIW A;  4B3M T;  2VL8 A;  4IDQ A;  2OV9 A;  5HAX A;  2JJ9 A;  4NUU A;  3P8C D;  4TV8 E;  2YIN A;  1J5W A;  4AKL A;  3RYC E;  2Q9Q C;  2WBL A;  2YDQ A;  4GYR A;  4QXH B;  3L8R A;  4LF9 T;  2W2U A;  1DU2 A;  3UU6 A;  3I0O A;  4JEU B;  2ACX A;  2XJ7 A;  4U3C A;  2V1D B;  2XM1 A;  4EAH A;  3C64 A;  4O4L E;  2P9B A;  3O1H A;  1FJG T;  3K3Q C;  2M6I A;  2C0S A;  1D1C A;  3R84 B;  4TWD A;  2V6Y A;  4EXT A;  2CM0 A;  2A9U A;  2WMO A;  5LG3 A;  3Q2M A;  5AQP B;  3TKL B;  3FB2 A;  4JLE A;  3P4W A;  1X79 A;  2UUA T;  4MFR A;  4DO0 A;  4LFB T;  3U78 A;  4DV3 T;  2WCA A;  1N34 T;  4IT4 A;  3NRX A;  3ONJ A;  3ZMZ B;  5HXR A;  4EB6 E;  5JRE A;  3AAA B;  2LSI A;  3AEG A;  3GN5 B;  3F57 A;  3NVO A;  4OYJ A;  4LFA T;  4AI6 A;  2CRB A;  2JRK A;  2LM2 A;  1T7S A;  3OPC A;  2LJL A;  2KWH A;  3T8O A;  1U4Q A;  3UU5 A;  2UUC T;  3UQ7 A;  3AA1 B;  5IHY A;  2OLT A;  4ERR A;  3LBX A;  2QA7 A;  4L5G A;  4EZH A;  5AQQ B;  5LCY A;  2XQ4 A;  2ODV A;  2X9H A;  3NBX X;  5CJ5 A;  1S94 A;  4IDO A;  2AXD S;  2UXC T;  5HXC A;  3UFE A;  3JC6 C;  4YJ2 E;  2IAK A;  3AE5 A;  3VR9 A;  4JUY A;  3ZT7 A;  1SHZ C;  1OED E;  4BAY B;  3ZMV B;  5KMG P;  5AQK B;  2JQH A;  4E7S A;  5J2T E;  2RP4 A;  3H3M A;  3AVR A;  1MMG A;  5C2T A;  1UUR A;  5ADX L;  2FJB A;  3RRW A;  5FY7 A;  3VU7 H;  3LDQ B;  4HWI B;  1UX5 A;  5FXW A;  4WYV A;  4NXN T;  4KHP T;  5IUX A;  2X67 A;  3H37 A;  3AE6 A;  2V7J A;  3SFD A;  5HXE A;  4HN9 A;  2X0Y A;  3K1S A;  3PUQ A;  3LSV A;  4KI0 F;  4DR7 T;  5FXV A;  3KVB A;  2FJD A;  1IJ6 A;  2XAH B;  4G63 A;  4U2Y A;  1UUS A;  4CXX A;  3P4P A;  3QK6 A;  2VQE T;  1CUN A;  4ZI3 D;  3LJC A;  4DR1 T;  4XZC A;  4A56 A;  1US7 B;  3RI5 A;  2WZH A;  2LLY A;  5JDL A;  3C98 B;  5LHI B;  2CHO A;  4ILU A;  2E9X B;  3HKE E;  3UUB A;  5AQU B;  2XZE A;  4AQF A;  3RLF F;  3ZCJ A;  3AEC A;  5LXT E;  2L8K A;  4QH5 A;  3Q9D A;  2FUP A;  5LB7 B;  4JI0 T;  1HR0 T;  5AQN B;  3LFM A;  4X1K E;  2DL1 A;  1E2A A;  2UXN B;  2DWG A;  4JBW F;  5JDM A;  2B1E A;  1KF6 A;  5JDF A;  4Z90 A;  1XDO A;  2RA1 A;  4DV2 T;  1NAF A;  2LM9 A;  3E08 A;  4P09 A;  3KV5 A;  3N9M A;  3ZT5 A;  5J0Z A;  2X9Y A;  5CFB A;  4IIJ E;  2J1D G;  3AE8 A;  5DQV A;  5FY1 A;  3ANW B;  4HWD A;  3PDY A;  5DQW A;  2WU5 A;  3KV9 A;  5L3G B;  1D1B A;  3PUV F;  4Z91 A;  5JR9 B;  4YTP A;  4U2Z A;  2VL0 A; 
#chains in the Genus database with same CATH homology
 5FYM A;  3N9O A;  1QSD A;  4M1P A;  2X9W A;  3SWH A;  2MTQ A;  3R6N A;  3BQL A;  3RRC A;  3N2O A;  1T98 A;  3V5S A;  2LHN A;  4GK5 E;  5J2U E;  4GK0 E;  3EDV A;  5TAO A;  2K5B B;  5LBM A;  4ZI2 C;  3GMI A;  1D0X A;  2LOS A;  2LSJ A;  1HCI A;  3ZC0 A;  3C4X A;  4UEM A;  2A3D A;  3OKQ A;  2MYS A;  3ESL A;  4ZI7 E;  3ZCI A;  4PJJ A;  2CA5 A;  3LK3 B;  4MHC A;  4X1Y E;  3ETV A;  4ZS3 A;  1MIW A;  4G2A A;  2ZM0 A;  3ZMT B;  5M4Y A;  2KLQ A;  3K3N A;  3UUN A;  2VB6 A;  2PG8 A;  3FBZ A;  4YHJ A;  3DJB A;  2L3L A;  4XBF B;  3CKD A;  2YK0 A;  2BZB A;  1ZV4 X;  3P7I A;  3ZEF B;  3CX6 B;  2ES0 A;  4O4H E;  3C50 A;  3KBT A;  3KV6 A;  1LRZ A;  3KBU A;  4YJ3 E;  2CLY C;  2K9A A;  4V1A v;  2L9Q A;  2MOZ A;  4DMW A;  2D0U A;  2XAQ B;  3BK9 A;  2CE7 A;  2V7K A;  4ISS A;  3GN5 A;  3U3I A;  2XUE A;  1IJ5 A;  4MAL A;  3OJA A;  4DBR A;  3HKC E;  5F3J A;  1MIY A;  2XAG B;  5GON E;  2X66 A;  1FMW A;  3WAK A;  4EYU A;  2IC6 A;  4HEA A;  5JDN A;  3ZN0 B;  3BQK A;  4TN7 B;  3KDS E;  2C5J A;  3KFW X;  2NW9 A;  5FXX A;  4WNK A;  4HGA A;  1BR1 A;  1WYC A;  3ZYK A;  4AKR B;  5CA0 E;  4UF0 A;  5E0O A;  3ZPO A;  3DP7 A;  4OK0 A;  4O2B E;  3N9L A;  1D1A A;  5JQG E;  2JMK A;  1EZ3 A;  3UTK A;  4AKH A;  4DND A;  2V7L A;  4ZI3 C;  4ANJ A;  3RKO A;  4BJM A;  4CQI A;  5JRC A;  5DAB A;  4C91 A;  1LKX A;  2WWU A;  2Z6E A;  3OYZ A;  2WM9 A;  2XQY A;  4H63 V;  4H9N C;  1MMA A;  5CB4 E;  2G0U A;  5FNV E;  2BDE A;  2E9X A;  4PJN A;  3L3P A;  5HWY A;  2LE8 A;  5LJM A;  3I9W A;  2X0L B;  3ZC1 A;  3OBV E;  3PUG A;  1SA0 E;  5LP6 E;  3KVA A;  3CQC B;  4BA9 A;  1KK7 A;  4PFO A;  3VHL A;  2QGS A;  4CI2 B;  1HG5 A;  1V9D A;  3DTO A;  4PFP A;  3S4U A;  4BJN A;  4I55 E;  3K3O A;  5L3D B;  3FXD B;  4H9Q C;  3CX7 B;  2Y48 B;  4E7Z A;  3CPZ A;  5JDQ A;  4YLH A;  3PU8 A;  4UVB B;  5LA6 E;  2W0G A;  3WI3 A;  2BVM A;  3B57 A;  3RC3 A;  1IAP A;  1BR0 A;  3ETU A;  4EZ4 A;  4HKA A;  2KXP B;  3N9Q A;  1ZHC A;  5JDH A;  1HS7 A;  1HFA A;  2XAJ B;  1H7C A;  4H9P C;  2ZLY A;  2NOX A;  3IEE A;  4PAG A;  4GIW A;  3WAJ A;  2VKH A;  3M65 A;  2VKD A;  2NW7 A;  4H9O C;  2LOP A;  2WAU A;  2JMH A;  5LOV E;  1FMV A;  1U5P A;  3PUA A;  4TZ4 C;  1AJ3 A;  3NZP A;  5HXH A;  3JC6 D;  3QUJ A;  1O3X A;  2VL8 A;  5HWX A;  1Y64 B;  3HKB E;  3RH3 A;  5HAX A;  2PFV A;  2JJ9 A;  3KV4 A;  4MBQ A;  4NUU A;  3P8C D;  2V7I A;  4TV8 E;  3O9X A;  3NZQ A;  4CXY A;  2YIN A;  3RYC E;  3HL6 A;  1VOM A;  2Q9Q C;  3AVS A;  3K8P C;  4AKL A;  2CEA A;  2WBL A;  4AQG A;  3NRY A;  4GYR A;  4QXH B;  4GYS A;  1HF8 A;  3O1I A;  1HTJ F;  2YU2 A;  4I50 E;  2MBG A;  3AB3 B;  5FMN A;  3PE0 A;  3H3A A;  3I0O A;  4DBQ A;  2D2S A;  4JEU B;  2ACX A;  4QWN B;  1MMD A;  3CML A;  1WR6 A;  2H7V C;  2W62 A;  2V1D B;  5FXZ A;  4EAH A;  1E1H B;  3C64 A;  4H9R C;  4ZHQ E;  4O4L E;  2CXL A;  2P9B A;  3O1H A;  3N2G E;  5JVD E;  1NWM X;  2EHO B;  2E9X C;  2GK9 A;  5KX5 E;  5L3F B;  5LHG B;  1YD8 G;  3K3Q C;  3V5U A;  2C0S A;  1D1C A;  4QX7 B;  3R84 B;  4EXT A;  3PTR B;  5EK2 A;  2DWK A;  2C5I T;  2CM0 A;  2CWO A;  5FP3 A;  2WMO A;  2VKO A;  1QUU A;  3C51 A;  3Q2M A;  5LG4 A;  4WW0 A;  2Q9Q A;  3I9Y A;  3TKL B;  3FB2 A;  4CI1 B;  2VK9 A;  4JLE A;  2NW8 A;  2WMN A;  1X79 A;  2IC9 A;  1G73 A;  2A72 A;  3MXZ A;  4MFR A;  4DO0 A;  4P0B A;  4TV9 E;  4TUY E;  3LK4 2;  4IE4 A;  4KBM B;  3U78 A;  3J7Y q;  4P0A A;  2ZMA A;  3AA6 B;  1OWA A;  1OXZ A;  1UX4 A;  4AKI A;  4QXC B;  1LVF A;  3IF8 B;  5L3E B;  3NRX A;  4KUM B;  4MLK A;  2XTL A;  5JH7 E;  3Q5W A;  2XAS B;  4EOZ B;  1MNE A;  3ZMZ B;  5HXR A;  4EB6 E;  5L2L A;  3SRZ A;  5JRE A;  3AAA B;  2LSI A;  2DHR A;  2YEV C;  5LGN B;  3GN5 B;  3F57 A;  5LJN A;  2V26 A;  4OYJ A;  5KDM C;  2Y8D A;  1LVK A;  3FHN A;  3D0T A;  2DLR A;  4O4I E;  2KMF A;  2HPL A;  2NTY A;  3HA4 A;  3E0Z A;  3ZYL A;  3MJX A;  4H63 H;  5EK3 A;  4IHJ E;  2LHR A;  5LHH B;  2JRK A;  4UF0 B;  5HXS A;  4PK4 A;  2LJL A;  2KWH A;  5JRC B;  2LSY A;  2M67 A;  4ZOL E;  3T8O A;  1U4Q A;  3PU3 A;  5JR9 C;  3CVR A;  2N9D A;  4IGU A;  4X1I E;  2EHO D;  2H3R A;  2NP9 A;  3MK7 C;  3VKH A;  2W63 A;  2N1G A;  5H6R B;  3AA1 B;  2C5K T;  4N78 D;  2E8I A;  5EZY E;  5IHY A;  4PK6 A;  2BVL A;  1WRD A;  3MKD A;  4ASK A;  2JPF A;  4CXW A;  3HI2 A;  3CQG B;  2CWY A;  2VKJ A;  5A1L A;  4ERR A;  3LBX A;  2CLY B;  2QA7 A;  2HH7 A;  3CX8 B;  4L5G A;  2K48 A;  4Z8X A;  4EZH A;  1ZKE A;  5EK4 A;  1FEW A;  1WLX A;  5LCY A;  3W15 B;  4CI3 B;  2K24 A;  1KNZ A;  3ZYM A;  2ODV A;  2X9H A;  3NBX X;  5L3C B;  2XHE B;  3ANW A;  4UIG A;  1S94 A;  3IHR A;  5HXC A;  4I43 B;  2LSK A;  1MIV A;  2NTX A;  3AA0 B;  3C4Z A;  3UUM A;  3UFE A;  4H9S E;  1HX8 A;  4F6R C;  2SPC A;  3JC6 C;  4YJ2 E;  3VKG A;  5JR9 A;  2IAK A;  4DMV A;  4IE6 A;  4JUY A;  4J2C A;  4O2A E;  4XAX B;  1SHZ C;  3KIN B;  4BAY B;  3ZMV B;  4X20 E;  4TX5 A;  5KMG P;  3PUS A;  3ONX A;  5CA1 E;  3ZJ2 A;  4E7S A;  5J2T E;  2RP4 A;  1WYB A;  3AVR A;  1G8X A;  1IZN B;  1MMG A;  3O1J A;  2CXD A;  5ADX L;  3RRW A;  3C4W A;  4ZI2 D;  3A5X A;  5FY7 A;  3VU7 H;  3RYF E;  2LEH A;  5AFU L;  4U72 A;  1UX5 A;  1YKE B;  5IYZ E;  3ZMS B;  3PUR A;  5FXW A;  1Z0P A;  3F2E A;  4UXN B;  4PNI A;  5LBQ B;  2X67 A;  5HYA A;  4O8S A;  4PW8 A;  3ZMU B;  1UCU A;  2E9X D;  3H37 A;  4QHO A;  4ZS2 A;  4EIW A;  2OA5 A;  2ZM2 A;  2V7J A;  3I0Q A;  2YU1 A;  4AKG A;  2DCF A;  3GA8 A;  4ADZ A;  5HXE A;  4L9I A;  3ZN1 B;  4OFZ A;  3L09 A;  1D0Z A;  5LYJ E;  2ODU A;  2PJQ A;  3B13 A;  3SOL A;  4C90 A;  4PK5 A;  4HN9 A;  2A2F X;  3PUQ A;  3LK2 B;  4FI5 A;  1VRB A;  3RC8 A;  5FY0 A;  2KT9 A;  3IBP A;  4AQF C;  3EDU A;  3EVY A;  4FJO A;  5FXV A;  3KVB A;  1IJ6 A;  2XAH B;  2PBI A;  3RYI E;  4OHF A;  4I4T E;  4G63 A;  4KMC A;  2VAS A;  1B7T A;  2X51 A;  4CXX A;  3QC9 A;  2Y6X A;  4AI6 A;  2Q9Q B;  2N2N A;  4EYY R;  2HPJ A;  4HTE A;  2KWI B;  4O4J E;  3QK6 A;  2LT3 A;  2UXX B;  3AAI A;  3O4X E;  1CUN A;  4ZI3 D;  3HKD E;  4NUV A;  5JDG A;  3LJC A;  4XZC A;  4OYK A;  4QXB B;  4A56 A;  1HG2 A;  4PJM A;  5L3B B;  2D5U A;  4UEL A;  2ZM8 A;  2KZ7 B;  5H6Q B;  2W61 A;  3MA9 A;  3CWZ B;  2CMR A;  3UT5 E;  1US7 B;  4DVD A;  5JDL A;  1YW0 A;  4UVA B;  3HR0 A;  3EUH A;  2NWB A;  3C98 B;  4HFV A;  2I59 A;  5LHI B;  3N5L A;  4ILU A;  2E9X B;  3AAE B;  3HKE E;  4UV9 B;  2CCQ A;  2KND A;  5DJQ C;  3SS1 A;  2X9X A;  4AQF A;  2H7O A;  2IW5 B;  3ZCJ A;  5LXT E;  4B6X A;  2VWA A;  2L8K A;  5ETW A;  3Q9D A;  3ZJ1 A;  3OYX A;  2JQQ A;  4K0U A;  2LSG A;  3MAC A;  4UV8 B;  3I1A A;  3LFM A;  3UUX B;  4X1K E;  4L0R A;  4QKN A;  2EHO C;  3CQX C;  4PJL A;  3ZLI A;  3BQI A;  4IE5 A;  4KP3 C;  3RPU A;  1ZEE A;  2UXN B;  1FIO A;  3N9N A;  2CXF A;  5F8P A;  1BR4 A;  3FXE B;  2DWG A;  5BMV E;  4CZZ B;  1D0Y A;  2DNX A;  3UUL A;  1YKH B;  3E22 E;  3Q5X A;  5JDM A;  2W00 A;  2B1E A;  4WBN E;  4QX8 B;  5JDF A;  1MND A;  3RX6 A;  2WSS V;  5C8Y E;  2RA1 A;  3F31 A;  3LBX B;  4GOU A;  4IE7 A;  1NAF A;  2Q9Q D;  2LM9 A;  5J1G A;  1BR2 A;  3E08 A;  4U74 A;  1S35 A;  2XAF B;  2X68 A;  4P09 A;  3KV5 A;  2D0T A;  3GWH A;  3N2K E;  3N9M A;  5LGU B;  3N9P A;  2X9Y A;  3RYH E;  4IIJ E;  3FBL A;  2J1D G;  4UVC B;  2V7M A;  4AXP A;  5LGT B;  5DQV A;  5FY1 A;  4IDZ A;  3ANW B;  3MZK B;  4HE8 A;  3PDY A;  5DQW A;  2KIN B;  5LNK A;  3KV9 A;  1MMN A;  3LG7 A;  5L3G B;  1D1B A;  4IE0 A;  4YFS A;  2EHO A;  5JR9 B;  3J9X 1;  4IST A;  4WBO A;  4JEH B;  3AA7 B;  2DI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...