1UK5A

Solution structure of the murine bag domain of bcl2-associated athanogene 3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
111
structure length
111
Chain Sequence
b'GSSGSSGAPAEPAAPKSGEAETPPKHPGVLKVEAILEKVQGLEQAVDSFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG-family molecular chaperone regulator-3
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 31
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1uk5A00
3FZLB 5AQMB 4HWDA 4HWIB 3FZHB 5AQGB 5AQNB 5AQUB 5AQTB 4HWHA 3FZFB 3LDQB 1UK5A 5AQRB 2D9DA 5AQLB 1M7KA 3FZMB 1HX1B 1UGOA 5AQVB 3A8YC 1T7SA 1I6ZA 5AQHB 5AQIB 4HWCA 4HWFA 5AQFB 5AQPB 5AQSB 5AQKB 1M62A 5AQJB 5AQQB 3FZKB 5AQOB 3M3ZB
chains in the Genus database with same CATH superfamily
1V9DA 3C50A 4YTMA 4HWHA 4PK5A 1J5ET 2LHRA 3RRWA 2BBJA 4CXXA 2X67A 3ZEFB 5L2LA 3C64A 2WU2A 3ZCIA 3ZYMA 2JQ9A 4TWHA 2CHOA 4NXMT 4AI6A 5JDQA 3KBUA 2C0SA 2IUBA 3K3OA 1G8XA 2XAGB 4BJNA 3PURA 1Z0PA 2W67A 4O4JE 5HEHA 2CA5A 5LP6E 3AEEA 4PW8A 4DV3T 4YY3T 3NZQA 4IE5A 3U78A 4IDNA 2FUPA 2GK9A 5IHYA 1T7SA 5J0ZA 2XQ3A 1VCSA 1BR1A 5JRCA 1FJGT 5L4HA 4E7SA 3TLSA 2Y8DA 4YTNA 2A72A 4GKKT 3VKGA 1T98A 4GK0E 4AKIA 3IF8B 3ZC0A 2BG9E 5HXHA 4QXBB 4ZI7E 2V7LA 1VRBA 2WDRA 4JI4T 4JBWF 3Q9DA 5AFUL 2VK9A 4H9NC 3FZLB 3UU8A 2QGSA 3QOFA 2XQ6A 3CPZA 1W0BA 2K48A 4X5TA 4I43B 4JI6T 5ABGA 3M65A 2IAKA 5AQFB 4IDQA 4LMKA 4QWNB 5DJQC 2ZM2A 2JMHA 1HX8A 3UQ4A 1BR2A 1SHZC 3FZFB 4HFBA 3RIUA 1HG5A 5JR9A 4OHFA 3PUWF 4I55E 4AQFA 2IDOB 3ETVA 4ISSA 3PUQA 2IW5B 5HWXA 2K9AA 3EAMA 3Q5DA 5FY7A 2X9YA 5L3DB 3EI0A 3D0TA 4IE0A 2CWOA 2CHNA 3QB5K 1XZYA 2V1DB 4QH5A 3Q5EA 3I9YA 2KWHA 3KINB 1HG2A 5L3BB 4IREA 4J2CA 1U5PA 4COFA 3WAKA 2EHOD 2Q9QD 5JDMA 3PUGA 2WWUA 4IDZA 2NTYA 1XMQT 4HTEA 5FXWA 5J2UE 3K8PC 5AQSB 2Z6EA 2VVNA 2J1DG 2XASB 3CMLA 2WDVA 2LRLA 4F6RC 1KNPA 1XNQT 5JREA 1LKXA 3RIUC 3BK9A 5FVLA 3HR0A 5JR9C 2E5VA 3P8CD 4Z8XA 4AQFC 4U7IA 4MFRA 4JUYA 4O4HE 1HF8A 3AEBA 3DJBA 2WAUA 2DI4A 5HXSA 3N9OA 2WCAA 2QRXA 3LDQB 4IHJE 5JDGA 1MNDA 3RYFE 1UCUA 3CK6A 4EXTA 1YQ3A 2EHOA 2WSSV 2Q9QA 4WYVA 5LHIB 2UXNB 2B1EA 2XQ5A 4TN7B 3N9MA 3T1YT 4ZS3A 4DMVA 5CB4E 4KBMB 1KNRA 4OX9T 5BMVE 4QX7B 4G63A 5ABEA 2E9XD 2ZM6T 1O3XA 1U4QA 4H9SE 4H9OC 2JJ9A 4IT4A 2H3RA 4P09A 4LF6T 3F57A 4WW0A 4F8HA 1LVKA 1MMAA 2BKOA 4UXNB 3NKZA 3E08A 2CBIA 3UUNA 3MJXA 3EABA 5HXCA 2A9UA 2QVAA 2LSYA 3VRBA 4CZZB 3FZKB 5GONE 3ZMSB 4EYYR 2XAJB 4CI3B 4YHHT 4JI3T 2KWIB 4PK6A 3V5UA 3OYXA 5LHGB 3ZPOA 2UUAT 5HYAA 3E0ZA 4MBQA 2BS4A 4PJJA 1IJ5A 2VASA 2EHOC 2XPKA 2Q9QC 1IBKT 4I50E 3AA0B 3CQCB 4LF5T 3LFMA 2E9XA 3RKOA 1ZV4X 4DR3T 4JI0T 5FNVE 2D9DA 1VOMA 2K3WA 2XZEA 4H9RC 2G0UA 2MBGA 2J4GA 3B57A 4AKHA 4ZS2A 1N34T 4H63H 4EGWA 2RA1A 1XNRT 4KI0F 5JRCB 3DTOA 3TKLB 2CBJA 3G06A 4I0UA 2RP4A 4TV8E 5J2TE 2NW9A 3HKDE 5KMGP 3VKHA 3UUMA 4OYKA 4ZI2D 1D0YA 4IGUA 5FKYA 3TLWA 2V6YA 5A1LA 2FJEA 1IAPA 1NEKA 4ZZCA 3C4WA 5CA1E 5KDMC 2LSKA 3HKEE 1I94T 2LRKA 3RPUA 2WY2A 3MA9A 3NVOA 4EZHA 2E9XC 4A5XA 4AIUA 1KFYA 5LOVE 2XSAA 2WMOA 1HNZT 2YDQA 2CMRA 2LOSA 3EHZA 4O2AE 4TWFA 5JR9B 2CWYA 3KDSE 3LK3B 2MAWA 4DNDA 3A8YC 4QXHB 4OYJA 4HGAA 4IE6A 5AQRB 5JDFA 2W2UA 3SWHA 4KHPT 3C98B 2LOPA 2WWVA 5ADXL 2OV9A 1W9RA 3WI3A 3RLFF 5HXEA 2D5UA 2WU5A 3NWIA 2XAQB 4U31A 2V5CA 3ZT6A 3ZT7A 2W63A 1W09A 2BG9A 3FBLA 3N2GE 1UGOA 2YOEA 3CVRA 4CN4A 3UFGA 2V8SV 3CWZB 4ERRA 3AVRA 2VL8A 1DU2A 4P1NA 3RKGA 2BZBA 3HI2A 1WR0A 3RHWA 4EYUA 5C8YE 4DR2T 5FL1A 5AQLB 4ZI2C 4IL4A 3C4ZA 3CX7B 3MXZA 5M4YA 5ABHA 2M6IA 3SS1A 3ZSSA 5AQVB 2XTLA 2D0UA 3EDVA 4A97A 3AA1B 2ACXA 1WFDA 4UEMA 5EK2A 2YINA 1IZNB 2V5DA 3QNUA 3HL6A 4YJ3E 5LBMA 2EHOB 2Q9QB 4NPPA 1WR6A 4FJOA 3I0OA 1KEYA 2BG9C 2HN1A 1US7B 2HPLA 2WM9A 1X9BA 3L8RA 4DV4T 5AQIB 3ABVA 3UUXB 2C5JA 2JMKA 5AQOB 4ADZA 4UVAB 2FJDA 5IYZE 4BAYB 2VVSA 4ZZBA 3K3NA 2J62A 3UQ7A 3UFEA 4U72A 2FJAA 5LG3A 2CXFA 3ANWB 5AQJB 5AQQB 3RI5A 4UIGA 2RPAA 5FL0A 2JPFA 1MMGA 4CQIA 5IWAT 3CIRA 1I6ZA 3V5SA 1HCIA 2HHHT 2FBWA 2B76A 3QUJA 5ETWA 3SRZA 5ABFA 1G73A 3KV5A 5DABA 1HTJF 3CKDA 2YKSA 3FZHB 2E9XB 3MKDA 3KVBA 2KXPB 2NR4A 1UURA 2L9QA 2CM0A 3P50A 4YLHA 3QC9A 4DV1T 3O1HA 4JI7T 3MK7C 3PUYF 3LJCA 1Z8UA 2NWBA 3ZN0B 2X66A 1OEDB 1XDPA 3N9PA 2A2FX 3K1SA 4EV6A 1SUMB 4X65T 2LHNA 3ZKRA 5AQUB 4IDPA 2WB5A 4UV8B 3S4UA 3FBZA 4JI5T 2V26A 2W0GA 2DWGA 2JQQA 3PUXF 1N32T 3KV6A 1QLBA 4JI1T 3OPCA 5FY1A 2WP9A 3N9NA 4HFHA 4DO0A 2KNDA 4XAXB 1ZEEA 2X9WA 1VCTA 2XM2A 5LGTB 5TAOA 2CE7A 4LMLA 3LG7A 5HCMA 4UVCB 5L3CB 2DHRA 2LKGA 4WNKA 1ZOYA 3MACA 4YJ2E 4CN6A 3OVUA 4V1Av 5LA6E 2R6GF 4CI1B 1IBMT 4DR4T 1H7CA 4HKAA 2X51A 2IC9A 2ES0A 2WZIA 1D0XA 4L0RA 1Y64B 2LE8A 3ZJ2A 5HCJA 5HEUA 4UELA 4EZ4A 2XQ4A 1YXRA 3BQKA 2W62A 5AQPB 3EUHA 3AEGA 1ZP0A 4X20E 4KMCA 2ZLYA 3ONLC 4XBFB 2NOXA 4HWIB 5HXRA 5HEGA 2BBHA 2VURA 1OWAA 2LEHA 4UF0B 3RYCE 4X64T 2JRKA 3KV9A 1MMDA 1YQ4A 2DLRA 2XAFB 4AKRB 3ZYKA 1OXZA 4AQGA 3VHLA 2CXLA 4YTPA 5FXXA 3ZMVB 2NW7A 5L3GB 4TUYE 2VQFT 3PTRB 5C3JA 2X0LB 5FYMA 3C51A 2PJQA 5LJNA 1CUNA 5DQWA 3RC8A 2V7IA 4CXWA 2H7VC 4MALA 4GYRA 1D1BA 1E7PA 4EEDA 5H6RB 4GIWA 4KX6A 5AQGB 3ONJA 4DV7T 2M67A 3P4QA 4PFOA 4YHJA 4B3MT 3N9LA 1S35A 2X0YA 2W61A 4DR6T 2VL0A 3KBTA 5LMUT 2LJLA 2XJ7A 3PJAA 2QA7A 2XM1A 1N33T 4PJNA 1XWMA 1WCRA 2ZMAA 3AB3B 3L39A 3I1AA 2CEAA 3OTOT 2IIUA 2XQ9A 3F2EA 2LT3A 4YFSA 1KK7A 2UXBT 3LK42 3AE8A 2J47A 2X9HA 4XZCA 4QHOA 2CRBA 2UUBT 2V7MA 3TLVA 4ZEYA 4B6XA 2QYWA 3AE3A 2W4XA 3ZMTB 4UR9A 4EIWA 5CA0E 3P4SA 4EEBA 4P0AA 5ABFB 1D0ZA 4PAGA 4HFCA 2XAHB 2VQET 1BR0A 2ODVA 2I59A 2YU2A 4TX5A 4DV6T 4TV9E 2ACZA 1ZKEA 1QSDA 3FXEB 5CGMA 3TLTA 4X1KE 3RH3A 4AKGA 4LFBT 1R8IA 2V7KA 4LF4T 4PK4A 3I9WA 2UXXB 2NP9A 4U74A 3A5XA 4GK5E 4HFEA 3ETUA 2OLTA 4BJMA 1J5WA 3AA6B 2DWKA 5JDHA 4K0KT 1UK5A 5L47A 4A56A 3VU7H 4UVBB 5EK4A 5JVDE 3UU3A 4DIDB 2C5IT 1B7TA 3QB5A 4CI2B 3ZMUB 4FI5A 2XSBA 3M3ZB 3U3IA 2ODUA 3RGLA 3ZCJA 3CX8B 5JTGA 2WQYA 1L0VA 4ZOLE 1D1CA 3IA3A 5F8PA 2VKDA 4QX8B 5L4EA 4DV2T 3NZPA 5BR8T 1D1AA 4ILBA 2L3LA 4YT0A 3R84B 3UTKA 3PE0A 4WBNE 5F5WA 4JV5T 3UU6A 4MHCA 5H6QB 2LM2A 3EDUA 2MOZA 5LYJE 1WLXA 5AQMB 2M6BA 1MNEA 1UUSA 2NTXA 1HS7A 4H9QC 3AEFA 1Y01A 3AE6A 4HWFA 4DV0T 4NUVA 4Z90A 3PUVF 2N9DA 1FMVA 1JNRA 4DR7T 3PV0F 2PFVA 2XQ7A 3Q5WA 2HPJA 4LF9T 2K5BB 2XY8B 3J7Yq 4U33A 4UV9B 4X1YE 3RC3A 3RX6A 4CXYA 2XUEA 3AE9A 5AQNB 3N2OA 1OEDE 1WYCA 4TZ4C 4LFAT 3PU8A 2UUCT 2H89A 2W66A 1JNZA 3AXJA 3NBXX 3O1IA 4WZXA 4I4TE 4ILAA 5C2TA 4HEAA 4KHZF 2DL1A 3IHRA 4HFIA 5LGNB 2WS3A 4DV5T 4TNWA 1KF6A 3JCFA 5LJMA 1YW0A 3KV4A 2YK0A 4H9PC 3GMIA 3AEDA 3P4PA 4DMWA 4OFZA 2VKOA 4U2YA 3H37A 2BS3A 4ASKA 5F3JA 3VR9A 1HNWT 3PUZF 4QH4A 2IHR1 4M1PA 3T8OA 4NUUA 1MIVA 1FIOA 4U2ZA 3L09A 2YDRA 1LRZA 2LSJA 3P7IA 2LSIA 2XQAA 4JEUB 2H7OA 4BA9A 5FY0A 4JEHB 3NRXA 1X79A 3TLUA 3CQGB 5LB7B 2LSGA 3AECA 3ZYLA 2NW8A 1LVFA 2C5KT 3R6NA 4QXCB 1NAFA 3P4RA 3RIAA 5JDLA 3OJAA 3B13A 4C91A 1FMWA 3FZMB 3JAEA 1SA0E 2YU1A 3Q5XA 3ZC1A 3T1HT 2K24A 1E1HB 3OYZA 5L3FB 4O4LE 2CLYC 4ZHQE 4TWDA 3UU5A 3JC6D 4DBQA 4KUMB 5LCYA 2V6YB 4K0UA 2D0TA 3PUAA 2BDEA 4U7YA 1T72A 1XDOA 4GKJT 3GN5A 3OBVE 3E22E 5JQGE 4MLKA 1GQEA 2WZHA 4PJMA 5JH7E 1IBLT 3AAAB 1MIYA 3ZJ1A 3UT5E 3IBPA 3LBXA 2KSRA 1MIWA 3RYHE 3W15B 4LMJA 4ISTA 1QUUA 2Y6XA 3HKCE 4JYAT 5HEJA 2PBIA 4PNIA 4B3ST 3GWHA 2OA5A 5LXTE 4E7ZA 4AKLA 3OKQA 1T8BA 2P9BA 2PG8A 1EZ3A 5AQHB 5FXVA 1W0AA 2BVLA 5LGUB 3VRAA 4U3CA 3RRCA 3FXDB 2BS2A 3AE5A 4CN1A 2ZM0A 3VR8A 2A3DA 3LK2B 3RYIE 4OK0A 3HA4A 4H63V 2SPCA 2BG9B 5LBQB 2E8IA 3FB2A 2H88A 3ESLA 2BKPA 4GOUA 4HWDA 1ZHCA 4ILCA 1M7KA 3SFDA 2W00A 3RF1A 3ZMZB 1J1JA 4YSYA 5AQKB 1E2AA 3SFEA 2VB6A 2KINB 1AJ3A 4LF7T 3AEAA 3N2KE 2FJBA 2WDQA 4ZI3D 4NXNT 2VWAA 3ZLIA 5LMNT 4TNVA 4HFDA 3JC6C 5CJ5A 4C90A 4Q25A 4DVDA 1YD8G 4EAHA 2BVMA 4EB6E 1MMNA 2KMFA 3ZSTA 1S94A 2N1GA 2XHEB 3AXJB 4X62T 1HFAA 2WMNA 2JQKA 3C4XA 2F4VT 4O2BE 5FMNA 5FXZA 2AE9A 3A7MA 4N78D 4LFCT 1FEWA 3P4WA 3AAEB 2UU9T 5E0OA 5HWYA 3J9X1 3O1JA 3ANWA 2VKJA 4DR5T 3NRYA 4IDOA 2YEVC 4QKNA 2I0MA 3AE1A 1UX4A 4AISA 5KX5E 2BKNA 1YKEB 2CLYB 4YSXA 1IJ6A 1HX1B 2JQHA 1NWMX 5CFBA 3FHNA 4AQYT 2X0HA 2CCQA 3H3MA 5FVKA 3L3PA 5AQTB 3RQUA 2PTFA 3BQIA 1WYBA 3F31A 2CXDA 1BR4A 4IIJE 4JLEA 2YDSA 3JADA 4HWCA 3I0QA 4A98A 4L5GA 4HFVA 4P0BA 5IUXA 1KNZA 1OEDA 3AA7B 3QK6A 1XMOT 2XQ8A 1N36T 1CHUA 4JI2T 4ZI3C 3MZKB 3AE2A 3HKBE 2MTQA 4HE8A 2DNXA 4LF8T 1UX5A 2D2SA 2HH7A 5EZYE 4KP3C 3LSVA 2N2NA 5HEOA 5DQVA 1M62A 3H3AA 3GN5B 3UULA 3CX6B 2JIWA 2IMLA 4NIQA 2E5LT 1WRDA 2IC6A 1HNXT 2I6HA 4G2AA 1SE7A 5EK3A 4ANJA 4HN9A 4YXDA 3ONXA 2UXCT 4WBOA 3X1DA 2LLYA 5JDNA 1NENA 3LBXB 4Z91A 4X66T 4O8SA 3O4XE 1YKHB 2KT9A 2CPTA 1OEDC 3UU4A 3AAIA 3DP7A 1HR0T 3N5LA 4PFPA 2Y48B 3PU3A 2WBLA 2DCFA 3AE4A 2V6XA 2HN2A 3UUBA 4ZXLA 4DR1T 2KZ7B 5L3EB 4QH1A 2UXDT 3ZN1B 4JI8T 3SOLA 4DBRA 4DUZT 2LKHA 4IL9A 4O4IE 3K3QC 3EVYA 5KXJA 2YN6A 3AVSA 3IEEA 3PUSA 2MYSA 5LNKA 3RIFA 4UF0A 4GYSA 5LG4A 3AE7A 4EOZB 3PJAJ 4X1IE 3KFWX 3WAJA 4IE7A 4AXPA 4B3TT 5HAXA 2XQYA 3N9QA 2AXDS 2LM9A 4YSZA 4PJLA 2X68A 2X9XA 3GA8A 3JAFA 2ZM8A 2MPKA 2VKHA 3KVAA 3Q2MA 2L8KA 4ILUA 3ZT5A 4DUYT 3RQWA 3PDYA 2V7JA 5LHHB 5J1GA 3BQLA 4B3RT 2E2AA 4L9IA 5FP3A 3CQXC 3O9XA 4IE4A 3B5MA 2KLQA
chains in the Genus database with same CATH topology
3FZLB 5AQMB 4HWDA 4HWIB 3FZHB 5AQGB 5AQNB 5AQUB 5AQTB 4HWHA 3FZFB 3LDQB 1UK5A 5AQRB 2D9DA 5AQLB 1M7KA 3FZMB 1HX1B 1UGOA 5AQVB 3A8YC 1T7SA 1I6ZA 5AQHB 5AQIB 4HWCA 4HWFA 5AQFB 5AQPB 5AQSB 5AQKB 1M62A 5AQJB 5AQQB 3FZKB 5AQOB 3M3ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZL B;  5AQM B;  4HWD A;  4HWI B;  3FZH B;  5AQG B;  5AQN B;  5AQU B;  5AQT B;  4HWH A;  3FZF B;  3LDQ B;  1UK5 A;  5AQR B;  2D9D A;  5AQL B;  1M7K A;  3FZM B;  1HX1 B;  1UGO A;  5AQV B;  3A8Y C;  1T7S A;  1I6Z A;  5AQH B;  5AQI B;  4HWC A;  4HWF A;  5AQF B;  5AQP B;  5AQS B;  5AQK B;  1M62 A;  5AQJ B;  5AQQ B;  3FZK B;  5AQO B;  3M3Z B; 
#chains in the Genus database with same CATH topology
 1V9D A;  3C50 A;  4YTM A;  4HWH A;  4PK5 A;  1J5E T;  2LHR A;  3RRW A;  2BBJ A;  4CXX A;  2X67 A;  3ZEF B;  5L2L A;  3C64 A;  2WU2 A;  3ZCI A;  3ZYM A;  2JQ9 A;  4TWH A;  2CHO A;  4NXM T;  4AI6 A;  5JDQ A;  3KBU A;  2C0S A;  2IUB A;  3K3O A;  1G8X A;  2XAG B;  4BJN A;  3PUR A;  1Z0P A;  2W67 A;  4O4J E;  5HEH A;  2CA5 A;  5LP6 E;  3AEE A;  4PW8 A;  4DV3 T;  4YY3 T;  3NZQ A;  4IE5 A;  3U78 A;  4IDN A;  2FUP A;  2GK9 A;  5IHY A;  1T7S A;  5J0Z A;  2XQ3 A;  1VCS A;  1BR1 A;  5JRC A;  1FJG T;  5L4H A;  4E7S A;  3TLS A;  2Y8D A;  4YTN A;  2A72 A;  4GKK T;  3VKG A;  1T98 A;  4GK0 E;  4AKI A;  3IF8 B;  3ZC0 A;  2BG9 E;  5HXH A;  4QXB B;  4ZI7 E;  2V7L A;  1VRB A;  2WDR A;  4JI4 T;  4JBW F;  3Q9D A;  5AFU L;  2VK9 A;  4H9N C;  3FZL B;  3UU8 A;  2QGS A;  3QOF A;  2XQ6 A;  3CPZ A;  1W0B A;  2K48 A;  4X5T A;  4I43 B;  4JI6 T;  5ABG A;  3M65 A;  2IAK A;  5AQF B;  4IDQ A;  4LMK A;  4QWN B;  5DJQ C;  2ZM2 A;  2JMH A;  1HX8 A;  3UQ4 A;  1BR2 A;  1SHZ C;  3FZF B;  4HFB A;  3RIU A;  1HG5 A;  5JR9 A;  4OHF A;  3PUW F;  4I55 E;  4AQF A;  2IDO B;  3ETV A;  4ISS A;  3PUQ A;  2IW5 B;  5HWX A;  2K9A A;  3EAM A;  3Q5D A;  5FY7 A;  2X9Y A;  5L3D B;  3EI0 A;  3D0T A;  4IE0 A;  2CWO A;  2CHN A;  3QB5 K;  1XZY A;  2V1D B;  4QH5 A;  3Q5E A;  3I9Y A;  2KWH A;  3KIN B;  1HG2 A;  5L3B B;  4IRE A;  4J2C A;  1U5P A;  4COF A;  3WAK A;  2EHO D;  2Q9Q D;  5JDM A;  3PUG A;  2WWU A;  4IDZ A;  2NTY A;  1XMQ T;  4HTE A;  5FXW A;  5J2U E;  3K8P C;  5AQS B;  2Z6E A;  2VVN A;  2J1D G;  2XAS B;  3CML A;  2WDV A;  2LRL A;  4F6R C;  1KNP A;  1XNQ T;  5JRE A;  1LKX A;  3RIU C;  3BK9 A;  5FVL A;  3HR0 A;  5JR9 C;  2E5V A;  3P8C D;  4Z8X A;  4AQF C;  4U7I A;  4MFR A;  4JUY A;  4O4H E;  1HF8 A;  3AEB A;  3DJB A;  2WAU A;  2DI4 A;  5HXS A;  3N9O A;  2WCA A;  2QRX A;  3LDQ B;  4IHJ E;  5JDG A;  1MND A;  3RYF E;  1UCU A;  3CK6 A;  4EXT A;  1YQ3 A;  2EHO A;  2WSS V;  2Q9Q A;  4WYV A;  5LHI B;  2UXN B;  2B1E A;  2XQ5 A;  4TN7 B;  3N9M A;  3T1Y T;  4ZS3 A;  4DMV A;  5CB4 E;  4KBM B;  1KNR A;  4OX9 T;  5BMV E;  4QX7 B;  4G63 A;  5ABE A;  2E9X D;  2ZM6 T;  1O3X A;  1U4Q A;  4H9S E;  4H9O C;  2JJ9 A;  4IT4 A;  2H3R A;  4P09 A;  4LF6 T;  3F57 A;  4WW0 A;  4F8H A;  1LVK A;  1MMA A;  2BKO A;  4UXN B;  3NKZ A;  3E08 A;  2CBI A;  3UUN A;  3MJX A;  3EAB A;  5HXC A;  2A9U A;  2QVA A;  2LSY A;  3VRB A;  4CZZ B;  3FZK B;  5GON E;  3ZMS B;  4EYY R;  2XAJ B;  4CI3 B;  4YHH T;  4JI3 T;  2KWI B;  4PK6 A;  3V5U A;  3OYX A;  5LHG B;  3ZPO A;  2UUA T;  5HYA A;  3E0Z A;  4MBQ A;  2BS4 A;  4PJJ A;  1IJ5 A;  2VAS A;  2EHO C;  2XPK A;  2Q9Q C;  1IBK T;  4I50 E;  3AA0 B;  3CQC B;  4LF5 T;  3LFM A;  2E9X A;  3RKO A;  1ZV4 X;  4DR3 T;  4JI0 T;  5FNV E;  2D9D A;  1VOM A;  2K3W A;  2XZE A;  4H9R C;  2G0U A;  2MBG A;  2J4G A;  3B57 A;  4AKH A;  4ZS2 A;  1N34 T;  4H63 H;  4EGW A;  2RA1 A;  1XNR T;  4KI0 F;  5JRC B;  3DTO A;  3TKL B;  2CBJ A;  3G06 A;  4I0U A;  2RP4 A;  4TV8 E;  5J2T E;  2NW9 A;  3HKD E;  5KMG P;  3VKH A;  3UUM A;  4OYK A;  4ZI2 D;  1D0Y A;  4IGU A;  5FKY A;  3TLW A;  2V6Y A;  5A1L A;  2FJE A;  1IAP A;  1NEK A;  4ZZC A;  3C4W A;  5CA1 E;  5KDM C;  2LSK A;  3HKE E;  1I94 T;  2LRK A;  3RPU A;  2WY2 A;  3MA9 A;  3NVO A;  4EZH A;  2E9X C;  4A5X A;  4AIU A;  1KFY A;  5LOV E;  2XSA A;  2WMO A;  1HNZ T;  2YDQ A;  2CMR A;  2LOS A;  3EHZ A;  4O2A E;  4TWF A;  5JR9 B;  2CWY A;  3KDS E;  3LK3 B;  2MAW A;  4DND A;  3A8Y C;  4QXH B;  4OYJ A;  4HGA A;  4IE6 A;  5AQR B;  5JDF A;  2W2U A;  3SWH A;  4KHP T;  3C98 B;  2LOP A;  2WWV A;  5ADX L;  2OV9 A;  1W9R A;  3WI3 A;  3RLF F;  5HXE A;  2D5U A;  2WU5 A;  3NWI A;  2XAQ B;  4U31 A;  2V5C A;  3ZT6 A;  3ZT7 A;  2W63 A;  1W09 A;  2BG9 A;  3FBL A;  3N2G E;  1UGO A;  2YOE A;  3CVR A;  4CN4 A;  3UFG A;  2V8S V;  3CWZ B;  4ERR A;  3AVR A;  2VL8 A;  1DU2 A;  4P1N A;  3RKG A;  2BZB A;  3HI2 A;  1WR0 A;  3RHW A;  4EYU A;  5C8Y E;  4DR2 T;  5FL1 A;  5AQL B;  4ZI2 C;  4IL4 A;  3C4Z A;  3CX7 B;  3MXZ A;  5M4Y A;  5ABH A;  2M6I A;  3SS1 A;  3ZSS A;  5AQV B;  2XTL A;  2D0U A;  3EDV A;  4A97 A;  3AA1 B;  2ACX A;  1WFD A;  4UEM A;  5EK2 A;  2YIN A;  1IZN B;  2V5D A;  3QNU A;  3HL6 A;  4YJ3 E;  5LBM A;  2EHO B;  2Q9Q B;  4NPP A;  1WR6 A;  4FJO A;  3I0O A;  1KEY A;  2BG9 C;  2HN1 A;  1US7 B;  2HPL A;  2WM9 A;  1X9B A;  3L8R A;  4DV4 T;  5AQI B;  3ABV A;  3UUX B;  2C5J A;  2JMK A;  5AQO B;  4ADZ A;  4UVA B;  2FJD A;  5IYZ E;  4BAY B;  2VVS A;  4ZZB A;  3K3N A;  2J62 A;  3UQ7 A;  3UFE A;  4U72 A;  2FJA A;  5LG3 A;  2CXF A;  3ANW B;  5AQJ B;  5AQQ B;  3RI5 A;  4UIG A;  2RPA A;  5FL0 A;  2JPF A;  1MMG A;  4CQI A;  5IWA T;  3CIR A;  1I6Z A;  3V5S A;  1HCI A;  2HHH T;  2FBW A;  2B76 A;  3QUJ A;  5ETW A;  3SRZ A;  5ABF A;  1G73 A;  3KV5 A;  5DAB A;  1HTJ F;  3CKD A;  2YKS A;  3FZH B;  2E9X B;  3MKD A;  3KVB A;  2KXP B;  2NR4 A;  1UUR A;  2L9Q A;  2CM0 A;  3P50 A;  4YLH A;  3QC9 A;  4DV1 T;  3O1H A;  4JI7 T;  3MK7 C;  3PUY F;  3LJC A;  1Z8U A;  2NWB A;  3ZN0 B;  2X66 A;  1OED B;  1XDP A;  3N9P A;  2A2F X;  3K1S A;  4EV6 A;  1SUM B;  4X65 T;  2LHN A;  3ZKR A;  5AQU B;  4IDP A;  2WB5 A;  4UV8 B;  3S4U A;  3FBZ A;  4JI5 T;  2V26 A;  2W0G A;  2DWG A;  2JQQ A;  3PUX F;  1N32 T;  3KV6 A;  1QLB A;  4JI1 T;  3OPC A;  5FY1 A;  2WP9 A;  3N9N A;  4HFH A;  4DO0 A;  2KND A;  4XAX B;  1ZEE A;  2X9W A;  1VCT A;  2XM2 A;  5LGT B;  5TAO A;  2CE7 A;  4LML A;  3LG7 A;  5HCM A;  4UVC B;  5L3C B;  2DHR A;  2LKG A;  4WNK A;  1ZOY A;  3MAC A;  4YJ2 E;  4CN6 A;  3OVU A;  4V1A v;  5LA6 E;  2R6G F;  4CI1 B;  1IBM T;  4DR4 T;  1H7C A;  4HKA A;  2X51 A;  2IC9 A;  2ES0 A;  2WZI A;  1D0X A;  4L0R A;  1Y64 B;  2LE8 A;  3ZJ2 A;  5HCJ A;  5HEU A;  4UEL A;  4EZ4 A;  2XQ4 A;  1YXR A;  3BQK A;  2W62 A;  5AQP B;  3EUH A;  3AEG A;  1ZP0 A;  4X20 E;  4KMC A;  2ZLY A;  3ONL C;  4XBF B;  2NOX A;  4HWI B;  5HXR A;  5HEG A;  2BBH A;  2VUR A;  1OWA A;  2LEH A;  4UF0 B;  3RYC E;  4X64 T;  2JRK A;  3KV9 A;  1MMD A;  1YQ4 A;  2DLR A;  2XAF B;  4AKR B;  3ZYK A;  1OXZ A;  4AQG A;  3VHL A;  2CXL A;  4YTP A;  5FXX A;  3ZMV B;  2NW7 A;  5L3G B;  4TUY E;  2VQF T;  3PTR B;  5C3J A;  2X0L B;  5FYM A;  3C51 A;  2PJQ A;  5LJN A;  1CUN A;  5DQW A;  3RC8 A;  2V7I A;  4CXW A;  2H7V C;  4MAL A;  4GYR A;  1D1B A;  1E7P A;  4EED A;  5H6R B;  4GIW A;  4KX6 A;  5AQG B;  3ONJ A;  4DV7 T;  2M67 A;  3P4Q A;  4PFO A;  4YHJ A;  4B3M T;  3N9L A;  1S35 A;  2X0Y A;  2W61 A;  4DR6 T;  2VL0 A;  3KBT A;  5LMU T;  2LJL A;  2XJ7 A;  3PJA A;  2QA7 A;  2XM1 A;  1N33 T;  4PJN A;  1XWM A;  1WCR A;  2ZMA A;  3AB3 B;  3L39 A;  3I1A A;  2CEA A;  3OTO T;  2IIU A;  2XQ9 A;  3F2E A;  2LT3 A;  4YFS A;  1KK7 A;  2UXB T;  3LK4 2;  3AE8 A;  2J47 A;  2X9H A;  4XZC A;  4QHO A;  2CRB A;  2UUB T;  2V7M A;  3TLV A;  4ZEY A;  4B6X A;  2QYW A;  3AE3 A;  2W4X A;  3ZMT B;  4UR9 A;  4EIW A;  5CA0 E;  3P4S A;  4EEB A;  4P0A A;  5ABF B;  1D0Z A;  4PAG A;  4HFC A;  2XAH B;  2VQE T;  1BR0 A;  2ODV A;  2I59 A;  2YU2 A;  4TX5 A;  4DV6 T;  4TV9 E;  2ACZ A;  1ZKE A;  1QSD A;  3FXE B;  5CGM A;  3TLT A;  4X1K E;  3RH3 A;  4AKG A;  4LFB T;  1R8I A;  2V7K A;  4LF4 T;  4PK4 A;  3I9W A;  2UXX B;  2NP9 A;  4U74 A;  3A5X A;  4GK5 E;  4HFE A;  3ETU A;  2OLT A;  4BJM A;  1J5W A;  3AA6 B;  2DWK A;  5JDH A;  4K0K T;  1UK5 A;  5L47 A;  4A56 A;  3VU7 H;  4UVB B;  5EK4 A;  5JVD E;  3UU3 A;  4DID B;  2C5I T;  1B7T A;  3QB5 A;  4CI2 B;  3ZMU B;  4FI5 A;  2XSB A;  3M3Z B;  3U3I A;  2ODU A;  3RGL A;  3ZCJ A;  3CX8 B;  5JTG A;  2WQY A;  1L0V A;  4ZOL E;  1D1C A;  3IA3 A;  5F8P A;  2VKD A;  4QX8 B;  5L4E A;  4DV2 T;  3NZP A;  5BR8 T;  1D1A A;  4ILB A;  2L3L A;  4YT0 A;  3R84 B;  3UTK A;  3PE0 A;  4WBN E;  5F5W A;  4JV5 T;  3UU6 A;  4MHC A;  5H6Q B;  2LM2 A;  3EDU A;  2MOZ A;  5LYJ E;  1WLX A;  5AQM B;  2M6B A;  1MNE A;  1UUS A;  2NTX A;  1HS7 A;  4H9Q C;  3AEF A;  1Y01 A;  3AE6 A;  4HWF A;  4DV0 T;  4NUV A;  4Z90 A;  3PUV F;  2N9D A;  1FMV A;  1JNR A;  4DR7 T;  3PV0 F;  2PFV A;  2XQ7 A;  3Q5W A;  2HPJ A;  4LF9 T;  2K5B B;  2XY8 B;  3J7Y q;  4U33 A;  4UV9 B;  4X1Y E;  3RC3 A;  3RX6 A;  4CXY A;  2XUE A;  3AE9 A;  5AQN B;  3N2O A;  1OED E;  1WYC A;  4TZ4 C;  4LFA T;  3PU8 A;  2UUC T;  2H89 A;  2W66 A;  1JNZ A;  3AXJ A;  3NBX X;  3O1I A;  4WZX A;  4I4T E;  4ILA A;  5C2T A;  4HEA A;  4KHZ F;  2DL1 A;  3IHR A;  4HFI A;  5LGN B;  2WS3 A;  4DV5 T;  4TNW A;  1KF6 A;  3JCF A;  5LJM A;  1YW0 A;  3KV4 A;  2YK0 A;  4H9P C;  3GMI A;  3AED A;  3P4P A;  4DMW A;  4OFZ A;  2VKO A;  4U2Y A;  3H37 A;  2BS3 A;  4ASK A;  5F3J A;  3VR9 A;  1HNW T;  3PUZ F;  4QH4 A;  2IHR 1;  4M1P A;  3T8O A;  4NUU A;  1MIV A;  1FIO A;  4U2Z A;  3L09 A;  2YDR A;  1LRZ A;  2LSJ A;  3P7I A;  2LSI A;  2XQA A;  4JEU B;  2H7O A;  4BA9 A;  5FY0 A;  4JEH B;  3NRX A;  1X79 A;  3TLU A;  3CQG B;  5LB7 B;  2LSG A;  3AEC A;  3ZYL A;  2NW8 A;  1LVF A;  2C5K T;  3R6N A;  4QXC B;  1NAF A;  3P4R A;  3RIA A;  5JDL A;  3OJA A;  3B13 A;  4C91 A;  1FMW A;  3FZM B;  3JAE A;  1SA0 E;  2YU1 A;  3Q5X A;  3ZC1 A;  3T1H T;  2K24 A;  1E1H B;  3OYZ A;  5L3F B;  4O4L E;  2CLY C;  4ZHQ E;  4TWD A;  3UU5 A;  3JC6 D;  4DBQ A;  4KUM B;  5LCY A;  2V6Y B;  4K0U A;  2D0T A;  3PUA A;  2BDE A;  4U7Y A;  1T72 A;  1XDO A;  4GKJ T;  3GN5 A;  3OBV E;  3E22 E;  5JQG E;  4MLK A;  1GQE A;  2WZH A;  4PJM A;  5JH7 E;  1IBL T;  3AAA B;  1MIY A;  3ZJ1 A;  3UT5 E;  3IBP A;  3LBX A;  2KSR A;  1MIW A;  3RYH E;  3W15 B;  4LMJ A;  4IST A;  1QUU A;  2Y6X A;  3HKC E;  4JYA T;  5HEJ A;  2PBI A;  4PNI A;  4B3S T;  3GWH A;  2OA5 A;  5LXT E;  4E7Z A;  4AKL A;  3OKQ A;  1T8B A;  2P9B A;  2PG8 A;  1EZ3 A;  5AQH B;  5FXV A;  1W0A A;  2BVL A;  5LGU B;  3VRA A;  4U3C A;  3RRC A;  3FXD B;  2BS2 A;  3AE5 A;  4CN1 A;  2ZM0 A;  3VR8 A;  2A3D A;  3LK2 B;  3RYI E;  4OK0 A;  3HA4 A;  4H63 V;  2SPC A;  2BG9 B;  5LBQ B;  2E8I A;  3FB2 A;  2H88 A;  3ESL A;  2BKP A;  4GOU A;  4HWD A;  1ZHC A;  4ILC A;  1M7K A;  3SFD A;  2W00 A;  3RF1 A;  3ZMZ B;  1J1J A;  4YSY A;  5AQK B;  1E2A A;  3SFE A;  2VB6 A;  2KIN B;  1AJ3 A;  4LF7 T;  3AEA A;  3N2K E;  2FJB A;  2WDQ A;  4ZI3 D;  4NXN T;  2VWA A;  3ZLI A;  5LMN T;  4TNV A;  4HFD A;  3JC6 C;  5CJ5 A;  4C90 A;  4Q25 A;  4DVD A;  1YD8 G;  4EAH A;  2BVM A;  4EB6 E;  1MMN A;  2KMF A;  3ZST A;  1S94 A;  2N1G A;  2XHE B;  3AXJ B;  4X62 T;  1HFA A;  2WMN A;  2JQK A;  3C4X A;  2F4V T;  4O2B E;  5FMN A;  5FXZ A;  2AE9 A;  3A7M A;  4N78 D;  4LFC T;  1FEW A;  3P4W A;  3AAE B;  2UU9 T;  5E0O A;  5HWY A;  3J9X 1;  3O1J A;  3ANW A;  2VKJ A;  4DR5 T;  3NRY A;  4IDO A;  2YEV C;  4QKN A;  2I0M A;  3AE1 A;  1UX4 A;  4AIS A;  5KX5 E;  2BKN A;  1YKE B;  2CLY B;  4YSX A;  1IJ6 A;  1HX1 B;  2JQH A;  1NWM X;  5CFB A;  3FHN A;  4AQY T;  2X0H A;  2CCQ A;  3H3M A;  5FVK A;  3L3P A;  5AQT B;  3RQU A;  2PTF A;  3BQI A;  1WYB A;  3F31 A;  2CXD A;  1BR4 A;  4IIJ E;  4JLE A;  2YDS A;  3JAD A;  4HWC A;  3I0Q A;  4A98 A;  4L5G A;  4HFV A;  4P0B A;  5IUX A;  1KNZ A;  1OED A;  3AA7 B;  3QK6 A;  1XMO T;  2XQ8 A;  1N36 T;  1CHU A;  4JI2 T;  4ZI3 C;  3MZK B;  3AE2 A;  3HKB E;  2MTQ A;  4HE8 A;  2DNX A;  4LF8 T;  1UX5 A;  2D2S A;  2HH7 A;  5EZY E;  4KP3 C;  3LSV A;  2N2N A;  5HEO A;  5DQV A;  1M62 A;  3H3A A;  3GN5 B;  3UUL A;  3CX6 B;  2JIW A;  2IML A;  4NIQ A;  2E5L T;  1WRD A;  2IC6 A;  1HNX T;  2I6H A;  4G2A A;  1SE7 A;  5EK3 A;  4ANJ A;  4HN9 A;  4YXD A;  3ONX A;  2UXC T;  4WBO A;  3X1D A;  2LLY A;  5JDN A;  1NEN A;  3LBX B;  4Z91 A;  4X66 T;  4O8S A;  3O4X E;  1YKH B;  2KT9 A;  2CPT A;  1OED C;  3UU4 A;  3AAI A;  3DP7 A;  1HR0 T;  3N5L A;  4PFP A;  2Y48 B;  3PU3 A;  2WBL A;  2DCF A;  3AE4 A;  2V6X A;  2HN2 A;  3UUB A;  4ZXL A;  4DR1 T;  2KZ7 B;  5L3E B;  4QH1 A;  2UXD T;  3ZN1 B;  4JI8 T;  3SOL A;  4DBR A;  4DUZ T;  2LKH A;  4IL9 A;  4O4I E;  3K3Q C;  3EVY A;  5KXJ A;  2YN6 A;  3AVS A;  3IEE A;  3PUS A;  2MYS A;  5LNK A;  3RIF A;  4UF0 A;  4GYS A;  5LG4 A;  3AE7 A;  4EOZ B;  3PJA J;  4X1I E;  3KFW X;  3WAJ A;  4IE7 A;  4AXP A;  4B3T T;  5HAX A;  2XQY A;  3N9Q A;  2AXD S;  2LM9 A;  4YSZ A;  4PJL A;  2X68 A;  2X9X A;  3GA8 A;  3JAF A;  2ZM8 A;  2MPK A;  2VKH A;  3KVA A;  3Q2M A;  2L8K A;  4ILU A;  3ZT5 A;  4DUY T;  3RQW A;  3PDY A;  2V7J A;  5LHH B;  5J1G A;  3BQL A;  4B3R T;  2E2A A;  4L9I A;  5FP3 A;  3CQX C;  3O9X A;  4IE4 A;  3B5M A;  2KLQ A; 
#chains in the Genus database with same CATH homology
 3FZL B;  5AQM B;  4HWD A;  4HWI B;  3FZH B;  5AQG B;  5AQN B;  5AQU B;  5AQT B;  4HWH A;  3FZF B;  3LDQ B;  1UK5 A;  5AQR B;  2D9D A;  5AQL B;  1M7K A;  3FZM B;  1HX1 B;  1UGO A;  5AQV B;  3A8Y C;  1T7S A;  1I6Z A;  5AQH B;  5AQI B;  4HWC A;  4HWF A;  5AQF B;  5AQP B;  5AQS B;  5AQK B;  1M62 A;  5AQJ B;  5AQQ B;  3FZK B;  5AQO B;  3M3Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...