1UK5A

Solution structure of the murine bag domain of bcl2-associated athanogene 3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
111
structure length
111
Chain Sequence
GSSGSSGAPAEPAAPKSGEAETPPKHPGVLKVEAILEKVQGLEQAVDSFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG-family molecular chaperone regulator-3
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 31
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1uk5A00
3LDQB 1M62A 3FZFB 5AQRB 5AQJB 1HX1B 3M3ZB 5AQHB 4HWCA 1M7KA 5AQPB 2D9DA 5AQUB 5AQQB 5AQTB 5AQLB 1UGOA 5AQSB 3FZLB 3A8YC 5AQNB 1T7SA 4HWHA 5AQOB 3FZHB 5AQKB 5AQVB 5AQFB 4HWIB 5AQMB 1UK5A 5AQIB 5AQGB 1I6ZA 4HWDA 4HWFA 3FZKB 3FZMB
chains in the Genus database with same CATH superfamily
2PFVA 5LG3A 4BJNA 2JQ9A 4UV8B 3NZPA 2RPAA 1HR0T 2Q9QA 1XDOA 2QA7A 3CIRA 3PUGA 4ZI2D 4HKAA 3ZMSB 1CUNA 5FXXA 3ZPOA 4FI5A 1YKHB 3QNUA 4IE0A 1HG5A 1E1HB 2ACXA 4KI0F 4A5XA 3LK3B 4OYJA 5FYMA 2VQET 3I0QA 1IBLT 2W66A 1E2AA 3ZKRA 2HN2A 3VHLA 4G2AA 1T8BA 2Q9QB 4O4JE 3RGLA 1KEYA 3UU4A 4GIWA 5JDQA 2BBJA 2XPKA 3PJAJ 3BQKA 5FKYA 4HWCA 5LBQB 4EEDA 2X9WA 4CI1B 3P7IA 3SFDA 5H6QB 4GYSA 4TV8E 1XZYA 1YQ4A 2FUPA 3CKDA 5LOVE 2ZM0A 2JJ9A 1MMDA 1BR4A 4X64T 5FNVE 2IIUA 4LF6T 4DBRA 3ZT5A 2XQ3A 4L0RA 2HN1A 2YEVC 4NUUA 2QYWA 3EI0A 4TNWA 1CHUA 3V5SA 3CWZB 3Q5EA 2V7KA 4YHHT 1S35A 1WRDA 1WR6A 4PJLA 3HL6A 3FZLB 5IHYA 3FB2A 2V7IA 3KV9A 3AEDA 3IEEA 3RKOA 4YHJA 2K9AA 2NWBA 5LMNT 4EOZB 1SUMB 2DWGA 2X9YA 3WAJA 3NRYA 2NTYA 3W15B 3ZN1B 3C51A 4DNDA 5JREA 4YSYA 4QHOA 4DUZT 3KBTA 4QH1A 4O4LE 2K48A 2LSYA 1J5ET 1MIYA 3UULA 2CXDA 4C91A 5LCYA 5BMVE 3UU8A 4IREA 3N2OA 3SOLA 3CX6B 1Z0PA 4NXMT 2W62A 4H9PC 5LA6E 3AA6B 5J0ZA 2QVAA 2KINB 3QOFA 2BKPA 1O3XA 5AQQB 4PK4A 3PUSA 5F8PA 2UXXB 4JEUB 1HNWT 4COFA 4QX7B 2Y8DA 4HFEA 4E7SA 2ACZA 2D2SA 1HX1B 1U4QA 4JI5T 4OX9T 2XJ7A 2LSGA 1OXZA 4F8HA 3AAIA 3UUXB 4ZZBA 1N36T 1LRZA 2RP4A 2E5VA 5HCJA 4A98A 2V8SV 3VU7H 4X66T 3FZMB 4AISA 4EGWA 1HF8A 3CX7B 3OYXA 2Y6XA 1W0AA 4EZ4A 2XQ7A 4UIGA 1XMQT 3MKDA 2ODUA 2BS2A 2JMKA 4HFIA 2SPCA 3EDVA 3OKQA 4JI6T 4H9OC 1WYCA 4AKIA 4FJOA 2PG8A 5C2TA 3AVSA 3E0ZA 3NBXX 2V6YB 2K5BB 5AQPB 4X1KE 3TKLB 4GOUA 4ZZCA 4NXNT 4IDNA 3ONXA 1NEKA 5JDMA 1B7TA 2DLRA 5HCMA 1IJ6A 3I9WA 4TWHA 3U78A 3AE1A 4TUYE 3EHZA 3SFEA 1YW0A 2C5KT 2LM9A 3AEAA 3N9OA 4B3RT 4MLKA 3LK2B 2Y48B 2XAFB 2NW8A 4K0KT 1X79A 2BZBA 4H9SE 3KVBA 3TLWA 1UX5A 4QXHB 4P0AA 2N9DA 2IAKA 4CI2B 4Z91A 5FL1A 3AXJB 4CN4A 5AQFB 4ADZA 4GYRA 4YY3T 3WI3A 3T1HT 3KFWX 1Z8UA 5GONE 2HH7A 4B3TT 3N9MA 4ZHQE 4TZ4C 1N32T 2WDQA 4PJNA 5IYZE 2G0UA 2BS3A 1W0BA 2CMRA 4ZI3D 4IL4A 3FZFB 2YDRA 2WB5A 3AB3B 1WR0A 2WQYA 4CN1A 1H7CA 4BJMA 2Q9QD 1T7SA 5LP6E 3U3IA 4TX5A 2VB6A 4HEAA 3HA4A 3R84B 2E9XA 5ABEA 2KLQA 3JC6D 4MALA 3O1HA 2XAJB 1QSDA 1JNRA 4JI2T 4QXBB 3FBZA 2KMFA 2IUBA 2I0MA 2NP9A 2JPFA 3RYCE 3G06A 2H7OA 5FY7A 2MAWA 5ABHA 2BS4A 4KX6A 5FL0A 1N34T 4IIJE 4TN7B 2E2AA 3O1JA 5FVKA 4TV9E 1KK7A 4LF8T 4WZXA 3UU3A 2EHOD 2H3RA 2YDQA 3N2GE 4UELA 3NVOA 4EYUA 1ZV4X 5DJQC 2YU1A 4HWFA 4HFBA 2E9XB 4DV4T 4YSXA 1VOMA 2W61A 4IDZA 2PTFA 2BVMA 5E0OA 1D0ZA 3ZCJA 2DL1A 4ZOLE 3K3OA 1OEDA 4IT4A 4P09A 2KZ7B 2VKJA 3R6NA 2CHNA 1G8XA 3F2EA 3IHRA 3ZYLA 2M6IA 4U31A 4JUYA 3HKEE 3OTOT 4CI3B 2CM0A 3EUHA 2BG9A 2WZHA 3N9QA 3K8PC 4IDPA 5HWXA 2C0SA 3V5UA 3AA1B 5AQGB 4LF4T 1HFAA 3CK6A 2CXFA 4H63H 2V1DB 4PFOA 4DMVA 4U2ZA 4A97A 3HI2A 5A1LA 2C5JA 4BAYB 2IHR1 1OEDB 5H6RB 1YQ3A 3QB5A 4YLHA 5HEUA 3NZQA 3PUQA 4PFPA 3PDYA 5M4YA 3ZCIA 2LOPA 3MZKB 4QKNA 2CHOA 1BR2A 1X9BA 1LKXA 4CZZB 2BG9B 5L3FB 2D0UA 2WDVA 2HPJA 4DBQA 4DV6T 5LG4A 3ZSSA 2BKOA 1ZOYA 3SRZA 2V5DA 5AQUB 3GN5B 4AQFC 4O4HE 2R6GF 4X1IE 2W63A 4PJMA 2A2FX 2KSRA 5HXHA 4PK6A 2IDOB 2V26A 4KP3C 4QWNB 3ZLIA 4X62T 1HG2A 4LMJA 2VKHA 5JQGE 4ZXLA 5L4HA 2YINA 3GWHA 2A3DA 3ZSTA 3T1YT 2XAQB 3L8RA 1W9RA 1G73A 1LVKA 5CA1E 2A9UA 4WBOA 4MFRA 1XNRT 2CBJA 5AQNB 2OLTA 5JR9C 2XSAA 4HWHA 2B1EA 4IL9A 5J2TE 4B3ST 5HEGA 4YFSA 1MIWA 5EZYE 5AFUL 4JI8T 2FJAA 1OWAA 5JVDE 2X51A 2CWOA 2WP9A 2W2UA 2CA5A 2XQ8A 3TLTA 3OYZA 3Q5WA 4EAHA 3EABA 3VR9A 3K3NA 2JQHA 4LFAT 4PJJA 2K24A 3RIUC 1YKEB 4L9IA 5IWAT 5KX5E 2F4VT 3PU3A 3C64A 1SA0E 5FP3A 4BA9A 2ZLYA 1KF6A 3RIUA 4YXDA 2QRXA 3KV5A 3LDQB 3PTRB 3LJCA 4U33A 3HR0A 2XY8B 5KDMC 3Q5XA 2XQ9A 5IUXA 1ZP0A 1YD8G 2XSBA 4N78D 1L0VA 4ISTA 5LXTE 2UXDT 2X9HA 1MMNA 1XNQT 4CQIA 2J47A 4ZI2C 2CRBA 2DI4A 3D0TA 4TWFA 3UQ4A 1JNZA 5CB4E 5AQKB 2J1DG 3RIAA 5J2UE 4X20E 4DV3T 3P4RA 3J9X1 2XQYA 1M7KA 1IJ5A 2ES0A 3ZT6A 2XQAA 2H7VC 3HKBE 3JADA 4OHFA 4UVAB 4YTNA 3JAFA 5HXCA 4AQYT 3VKHA 3JAEA 1M62A 5F3JA 3CX8B 3AE4A 2WWVA 4I43B 3I9YA 3CPZA 1S94A 2V6YA 4UEMA 4LF7T 3PV0F 4PW8A 4HFCA 4JI3T 3UFEA 5DQVA 4Z90A 1MIVA 3KV6A 4U7YA 4LMKA 4IE7A 4PK5A 2WY2A 3L39A 5HEJA 2YDSA 4AKLA 5LGTB 2W0GA 5FMNA 3F57A 3NKZA 5DQWA 3RX6A 5AQMB 2V5CA 3VRAA 2E8IA 3LBXA 3RHWA 2YKSA 1KNRA 1U5PA 2WMOA 2YN6A 3ZJ1A 2LHNA 2D9DA 1NENA 2HHHT 1D1CA 4ISSA 2FJDA 2VL8A 2X67A 1UCUA 3AXJA 2UUAT 3MA9A 2BDEA 5C3JA 2VWAA 4I4TE 1US7B 1HNZT 3AA7B 4CN6A 1XWMA 5HAXA 4F6RC 3OPCA 4ZI7E 2XAHB 1D1AA 3DJBA 5JRCB 3BQIA 3PUVF 3LBXB 3UQ7A 2NTXA 3B13A 3L3PA 1HS7A 3ONJA 2VKDA 2LHRA 3K3QC 1Y64B 3JCFA 2DHRA 4U74A 5EK2A 4ILCA 3N9NA 3RQUA 5LNKA 3KV4A 3LK42 5AQSB 4U3CA 2AXDS 5L4EA 2NW7A 1UUSA 5AQVB 4KHPT 3P50A 4X5TA 4IHJE 3FZKB 3RYHE 3BK9A 3I0OA 3EAMA 4NUVA 3P4QA 1MMAA 1MMGA 2WWUA 4KBMB 5HXRA 5TAOA 5ABFA 3E08A 4DR6T 2XUEA 1SE7A 3ONLC 5J1GA 4QX8B 5LHGB 2AE9A 4AIUA 4JEHB 5LBMA 1IBMT 4UF0A 1NAFA 3RI5A 3UFGA 2I6HA 4MBQA 2V7JA 4EZHA 5FXWA 3GMIA 3MXZA 2LSKA 4O8SA 2ZM6T 5AQTB 2MOZA 1XMOT 4NIQA 3RYFE 4DV0T 3ZYKA 5LB7B 1WFDA 4EXTA 1I6ZA 4X1YE 5HWYA 3K1SA 4YTPA 3I1AA 4DV5T 2LEHA 4LF5T 2LOSA 5ABFB 3MACA 4GKKT 3ABVA 3UT5E 4U72A 2WU2A 1DU2A 2W67A 4C90A 4E7ZA 5JDGA 3ZC0A 4UF0B 3RC3A 5JDHA 2X9XA 2WBLA 5JDNA 5L3CB 2IW5B 4Q25A 2XQ6A 3P4WA 4ANJA 1VCTA 5ABGA 3FZHB 2VKOA 3P4SA 2E5LT 2C5IT 3IF8B 4LFBT 3AEFA 2NR4A 2KNDA 5HYAA 3CQXC 1D0YA 1UX4A 2VASA 1QLBA 4JI1T 1GQEA 5ADXL 3N9PA 4DR4T 4IDOA 4JLEA 2UUBT 3S4UA 3AVRA 3H3MA 3H37A 2V7MA 3C4WA 2CWYA 2VURA 4O2BE 2NOXA 3SS1A 3QB5K 2H88A 1MNDA 5BR8T 3PJAA 1HTJF 3T8OA 3EDUA 2Z6EA 3CQGB 2RA1A 3TLVA 4DV2T 2I59A 4EV6A 3N5LA 4H9NC 3ZEFB 2VQFT 3RYIE 3GN5A 3UU6A 4P1NA 4ERRA 3O1IA 4LFCT 4L5GA 4HN9A 3AE6A 4QH5A 4AKRB 2LSIA 1SHZC 4O2AE 4U2YA 4XBFB 4WBNE 3DTOA 4ZI3C 4ASKA 3FBLA 3RRCA 3IA3A 5JTGA 2XHEB 4YSZA 2XQ4A 2Q9QC 4TNVA 5CA0E 2LSJA 2LLYA 4OFZA 3KBUA 4CXXA 4NPPA 3NWIA 5LJMA 3JC6C 4U7IA 5LJNA 2BVLA 2D5UA 1HCIA 4JI4T 3WAKA 5LGNB 4HFHA 1XDPA 4AQFA 5F5WA 2L8KA 3ANWA 3H3AA 2D0TA 3FXDB 2HPLA 3A7MA 3VKGA 4UVCB 3RKGA 3C4ZA 1UURA 2V7LA 4H9RC 1FMVA 3RH3A 2CEAA 4J2CA 1KFYA 3BQLA 4K0UA 3OJAA 5FXZA 2CLYC 1T72A 2KWHA 2EHOC 3PU8A 3FXEB 4YTMA 4HFDA 3AE5A 3P4PA 2JRKA 5LYJE 2WZIA 4HGAA 5HEHA 2EHOA 2XM1A 1UK5A 4I55E 5LHIB 2FBWA 2B76A 4Z8XA 5JR9A 4AKGA 3QUJA 4A56A 3ZT7A 4UXNB 1E7PA 3ANWB 4IE5A 5LMUT 2PBIA 4P0BA 4TWDA 4OYKA 1T98A 3VR8A 1LVFA 4HFVA 4WNKA 1KNPA 5FY1A 3AE8A 4AQGA 1HNXT 4OK0A 2W4XA 4EB6E 4IE4A 4M1PA 2VVSA 2CLYB 1OEDE 4DR3T 1WLXA 3AAAB 3AEGA 2EHOB 2JMHA 5HEOA 3PUXF 3RF1A 1IZNB 2M67A 4MHCA 4QH4A 3X1DA 5JR9B 5AQHB 3AAEB 2UU9T 1Y01A 2XAGB 2WM9A 3O4XE 2LRLA 3AE7A 2MTQA 2XTLA 4LF9T 2BG9E 3GA8A 2YU2A 2DCFA 2PJQA 2JQQA 2KWIB 4G63A 2IC9A 4JI0T 2KXPB 4ILBA 4LMLA 4EIWA 2WAUA 2A72A 4DUYT 4JYAT 1FEWA 3ESLA 1FMWA 4XZCA 2M6BA 1BR1A 2P9BA 3EVYA 3UUBA 1J1JA 3C50A 3UUNA 4KUMB 3RRWA 5LGUB 3A5XA 3AEBA 3RC8A 5HXSA 2CCQA 3ETUA 3B57A 2OV9A 3ZMTB 2JIWA 2CE7A 2WS3A 4DR2T 5AQIB 4HWDA 3UUMA 2E9XD 4ZEYA 5JDLA 2MPKA 4UR9A 3AEEA 4B6XA 3M3ZB 2BKNA 3LFMA 3VRBA 2DNXA 4JBWF 3CVRA 5LHHB 3AE3A 2J4GA 2LKHA 5JRCA 4UVBB 5JH7E 4ZS2A 3ZJ2A 3HKCE 5AQJB 5L47A 3IBPA 1ZHCA 5L3DB 3L09A 3RPUA 5KXJA 4CXWA 4DO0A 3PUWF 4AKHA 3F31A 2ZM2A 3Q2MA 2XM2A 1N33T 3RQWA 4EEBA 5EK4A 2N1GA 2J62A 3AE2A 2X68A 4QXCB 3P8CD 2QGSA 2LKGA 1ZKEA 4KHZF 3J7Yq 4WYVA 2NW9A 2ODVA 4YT0A 3AA0B 3O9XA 5AQRB 5L2LA 4H9QC 2WDRA 3Q9DA 1I94T 4ILAA 3RLFF 2ZM8A 1FIOA 4JV5T 3TLUA 5AQOB 2YK0A 4PAGA 2BBHA 4GK5E 1QUUA 4GKJT 4DV7T 3FHNA 1HX8A 3C98B 3CQCB 2UUCT 4DIDB 3ZN0B 2XQ5A 2VL0A 2VK9A 4X65T 3A8YC 2IMLA 2YOEA 3NRXA 3CMLA 2H89A 5FXVA 3E22E 2FJBA 5KMGP 3C4XA 5DABA 2LRKA 1ZEEA 3KINB 3MK7C 1EZ3A 1WCRA 5FY0A 2V6XA 5ETWA 2UXCT 4DV1T 5C8YE 1W09A 3SWHA 1J5WA 3ETVA 2LE8A 4HTEA 3QK6A 2CXLA 2XASB 1VRBA 1MNEA 3N2KE 1FJGT 3ZYMA 2E9XC 3RIFA 3M65A 2LT3A 1KNZA 1D0XA 3OVUA 1V9DA 2N2NA 3DP7A 2WU5A 5JDFA 5L3GB 3Q5DA 5CFBA 3PURA 2W00A 4UV9B 1D1BA 1YXRA 3ZMVB 4DVDA 4CXYA 3KVAA 2JQKA 4IGUA 4GK0E 3HKDE 1IBKT 3B5MA 3KDSE 1AJ3A 2XZEA 2L9QA 2CPTA 4AXPA 3PUAA 2UXBT 4PNIA 2VVNA 4WW0A 4DR5T 2X66A 3OBVE 5L3EB 2X0YA 2UXNB 2LJLA 2OA5A 4YJ2E 1OEDC 2GK9A 3PE0A 4V1Av 3LG7A 4I50E 4H63V 4YJ3E 4IDQA 5AQLB 4B3MT 2IC6A 3ZMZB 3UTKA 5CJ5A 2L3LA 5L3BB 2WMNA 3AE9A 2X0LB 4HWIB 3TLSA 4JI7T 1BR0A 5FVLA 3ZC1A 2BG9C 4KMCA 3LSVA 4O4IE 3MJXA 2X0HA 3N9LA 5CGMA 1WYBA 1NWMX 1VCSA 5EK3A 2WSSV 1UGOA 3QC9A 3ZMUB 2K3WA 1IAPA 2MBGA 2LM2A 4EYYR 3UU5A 4AI6A 3PUYF 3PUZF 5HXEA 2KT9A 3AECA 1R8IA 4DMWA 2FJEA 2CBIA 2MYSA 4HE8A 2DWKA 4I0UA 4DR7T 2ZMAA 4ILUA 4XAXB 4IE6A 4ZS3A 4DR1T 2WCAA
chains in the Genus database with same CATH topology
3LDQB 1M62A 3FZFB 5AQRB 5AQJB 1HX1B 3M3ZB 5AQHB 4HWCA 1M7KA 5AQPB 2D9DA 5AQUB 5AQQB 5AQTB 5AQLB 1UGOA 5AQSB 3FZLB 3A8YC 5AQNB 1T7SA 4HWHA 5AQOB 3FZHB 5AQKB 5AQVB 5AQFB 4HWIB 5AQMB 1UK5A 5AQIB 5AQGB 1I6ZA 4HWDA 4HWFA 3FZKB 3FZMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDQ B;  1M62 A;  3FZF B;  5AQR B;  5AQJ B;  1HX1 B;  3M3Z B;  5AQH B;  4HWC A;  1M7K A;  5AQP B;  2D9D A;  5AQU B;  5AQQ B;  5AQT B;  5AQL B;  1UGO A;  5AQS B;  3FZL B;  3A8Y C;  5AQN B;  1T7S A;  4HWH A;  5AQO B;  3FZH B;  5AQK B;  5AQV B;  5AQF B;  4HWI B;  5AQM B;  1UK5 A;  5AQI B;  5AQG B;  1I6Z A;  4HWD A;  4HWF A;  3FZK B;  3FZM B; 
#chains in the Genus database with same CATH topology
 2PFV A;  5LG3 A;  4BJN A;  2JQ9 A;  4UV8 B;  3NZP A;  2RPA A;  1HR0 T;  2Q9Q A;  1XDO A;  2QA7 A;  3CIR A;  3PUG A;  4ZI2 D;  4HKA A;  3ZMS B;  1CUN A;  5FXX A;  3ZPO A;  4FI5 A;  1YKH B;  3QNU A;  4IE0 A;  1HG5 A;  1E1H B;  2ACX A;  4KI0 F;  4A5X A;  3LK3 B;  4OYJ A;  5FYM A;  2VQE T;  3I0Q A;  1IBL T;  2W66 A;  1E2A A;  3ZKR A;  2HN2 A;  3VHL A;  4G2A A;  1T8B A;  2Q9Q B;  4O4J E;  3RGL A;  1KEY A;  3UU4 A;  4GIW A;  5JDQ A;  2BBJ A;  2XPK A;  3PJA J;  3BQK A;  5FKY A;  4HWC A;  5LBQ B;  4EED A;  2X9W A;  4CI1 B;  3P7I A;  3SFD A;  5H6Q B;  4GYS A;  4TV8 E;  1XZY A;  1YQ4 A;  2FUP A;  3CKD A;  5LOV E;  2ZM0 A;  2JJ9 A;  1MMD A;  1BR4 A;  4X64 T;  5FNV E;  2IIU A;  4LF6 T;  4DBR A;  3ZT5 A;  2XQ3 A;  4L0R A;  2HN1 A;  2YEV C;  4NUU A;  2QYW A;  3EI0 A;  4TNW A;  1CHU A;  3V5S A;  3CWZ B;  3Q5E A;  2V7K A;  4YHH T;  1S35 A;  1WRD A;  1WR6 A;  4PJL A;  3HL6 A;  3FZL B;  5IHY A;  3FB2 A;  2V7I A;  3KV9 A;  3AED A;  3IEE A;  3RKO A;  4YHJ A;  2K9A A;  2NWB A;  5LMN T;  4EOZ B;  1SUM B;  2DWG A;  2X9Y A;  3WAJ A;  3NRY A;  2NTY A;  3W15 B;  3ZN1 B;  3C51 A;  4DND A;  5JRE A;  4YSY A;  4QHO A;  4DUZ T;  3KBT A;  4QH1 A;  4O4L E;  2K48 A;  2LSY A;  1J5E T;  1MIY A;  3UUL A;  2CXD A;  4C91 A;  5LCY A;  5BMV E;  3UU8 A;  4IRE A;  3N2O A;  3SOL A;  3CX6 B;  1Z0P A;  4NXM T;  2W62 A;  4H9P C;  5LA6 E;  3AA6 B;  5J0Z A;  2QVA A;  2KIN B;  3QOF A;  2BKP A;  1O3X A;  5AQQ B;  4PK4 A;  3PUS A;  5F8P A;  2UXX B;  4JEU B;  1HNW T;  4COF A;  4QX7 B;  2Y8D A;  4HFE A;  4E7S A;  2ACZ A;  2D2S A;  1HX1 B;  1U4Q A;  4JI5 T;  4OX9 T;  2XJ7 A;  2LSG A;  1OXZ A;  4F8H A;  3AAI A;  3UUX B;  4ZZB A;  1N36 T;  1LRZ A;  2RP4 A;  2E5V A;  5HCJ A;  4A98 A;  2V8S V;  3VU7 H;  4X66 T;  3FZM B;  4AIS A;  4EGW A;  1HF8 A;  3CX7 B;  3OYX A;  2Y6X A;  1W0A A;  4EZ4 A;  2XQ7 A;  4UIG A;  1XMQ T;  3MKD A;  2ODU A;  2BS2 A;  2JMK A;  4HFI A;  2SPC A;  3EDV A;  3OKQ A;  4JI6 T;  4H9O C;  1WYC A;  4AKI A;  4FJO A;  2PG8 A;  5C2T A;  3AVS A;  3E0Z A;  3NBX X;  2V6Y B;  2K5B B;  5AQP B;  4X1K E;  3TKL B;  4GOU A;  4ZZC A;  4NXN T;  4IDN A;  3ONX A;  1NEK A;  5JDM A;  1B7T A;  2DLR A;  5HCM A;  1IJ6 A;  3I9W A;  4TWH A;  3U78 A;  3AE1 A;  4TUY E;  3EHZ A;  3SFE A;  1YW0 A;  2C5K T;  2LM9 A;  3AEA A;  3N9O A;  4B3R T;  4MLK A;  3LK2 B;  2Y48 B;  2XAF B;  2NW8 A;  4K0K T;  1X79 A;  2BZB A;  4H9S E;  3KVB A;  3TLW A;  1UX5 A;  4QXH B;  4P0A A;  2N9D A;  2IAK A;  4CI2 B;  4Z91 A;  5FL1 A;  3AXJ B;  4CN4 A;  5AQF B;  4ADZ A;  4GYR A;  4YY3 T;  3WI3 A;  3T1H T;  3KFW X;  1Z8U A;  5GON E;  2HH7 A;  4B3T T;  3N9M A;  4ZHQ E;  4TZ4 C;  1N32 T;  2WDQ A;  4PJN A;  5IYZ E;  2G0U A;  2BS3 A;  1W0B A;  2CMR A;  4ZI3 D;  4IL4 A;  3FZF B;  2YDR A;  2WB5 A;  3AB3 B;  1WR0 A;  2WQY A;  4CN1 A;  1H7C A;  4BJM A;  2Q9Q D;  1T7S A;  5LP6 E;  3U3I A;  4TX5 A;  2VB6 A;  4HEA A;  3HA4 A;  3R84 B;  2E9X A;  5ABE A;  2KLQ A;  3JC6 D;  4MAL A;  3O1H A;  2XAJ B;  1QSD A;  1JNR A;  4JI2 T;  4QXB B;  3FBZ A;  2KMF A;  2IUB A;  2I0M A;  2NP9 A;  2JPF A;  3RYC E;  3G06 A;  2H7O A;  5FY7 A;  2MAW A;  5ABH A;  2BS4 A;  4KX6 A;  5FL0 A;  1N34 T;  4IIJ E;  4TN7 B;  2E2A A;  3O1J A;  5FVK A;  4TV9 E;  1KK7 A;  4LF8 T;  4WZX A;  3UU3 A;  2EHO D;  2H3R A;  2YDQ A;  3N2G E;  4UEL A;  3NVO A;  4EYU A;  1ZV4 X;  5DJQ C;  2YU1 A;  4HWF A;  4HFB A;  2E9X B;  4DV4 T;  4YSX A;  1VOM A;  2W61 A;  4IDZ A;  2PTF A;  2BVM A;  5E0O A;  1D0Z A;  3ZCJ A;  2DL1 A;  4ZOL E;  3K3O A;  1OED A;  4IT4 A;  4P09 A;  2KZ7 B;  2VKJ A;  3R6N A;  2CHN A;  1G8X A;  3F2E A;  3IHR A;  3ZYL A;  2M6I A;  4U31 A;  4JUY A;  3HKE E;  3OTO T;  4CI3 B;  2CM0 A;  3EUH A;  2BG9 A;  2WZH A;  3N9Q A;  3K8P C;  4IDP A;  5HWX A;  2C0S A;  3V5U A;  3AA1 B;  5AQG B;  4LF4 T;  1HFA A;  3CK6 A;  2CXF A;  4H63 H;  2V1D B;  4PFO A;  4DMV A;  4U2Z A;  4A97 A;  3HI2 A;  5A1L A;  2C5J A;  4BAY B;  2IHR 1;  1OED B;  5H6R B;  1YQ3 A;  3QB5 A;  4YLH A;  5HEU A;  3NZQ A;  3PUQ A;  4PFP A;  3PDY A;  5M4Y A;  3ZCI A;  2LOP A;  3MZK B;  4QKN A;  2CHO A;  1BR2 A;  1X9B A;  1LKX A;  4CZZ B;  2BG9 B;  5L3F B;  2D0U A;  2WDV A;  2HPJ A;  4DBQ A;  4DV6 T;  5LG4 A;  3ZSS A;  2BKO A;  1ZOY A;  3SRZ A;  2V5D A;  5AQU B;  3GN5 B;  4AQF C;  4O4H E;  2R6G F;  4X1I E;  2W63 A;  4PJM A;  2A2F X;  2KSR A;  5HXH A;  4PK6 A;  2IDO B;  2V26 A;  4KP3 C;  4QWN B;  3ZLI A;  4X62 T;  1HG2 A;  4LMJ A;  2VKH A;  5JQG E;  4ZXL A;  5L4H A;  2YIN A;  3GWH A;  2A3D A;  3ZST A;  3T1Y T;  2XAQ B;  3L8R A;  1W9R A;  1G73 A;  1LVK A;  5CA1 E;  2A9U A;  4WBO A;  4MFR A;  1XNR T;  2CBJ A;  5AQN B;  2OLT A;  5JR9 C;  2XSA A;  4HWH A;  2B1E A;  4IL9 A;  5J2T E;  4B3S T;  5HEG A;  4YFS A;  1MIW A;  5EZY E;  5AFU L;  4JI8 T;  2FJA A;  1OWA A;  5JVD E;  2X51 A;  2CWO A;  2WP9 A;  2W2U A;  2CA5 A;  2XQ8 A;  3TLT A;  3OYZ A;  3Q5W A;  4EAH A;  3EAB A;  3VR9 A;  3K3N A;  2JQH A;  4LFA T;  4PJJ A;  2K24 A;  3RIU C;  1YKE B;  4L9I A;  5IWA T;  5KX5 E;  2F4V T;  3PU3 A;  3C64 A;  1SA0 E;  5FP3 A;  4BA9 A;  2ZLY A;  1KF6 A;  3RIU A;  4YXD A;  2QRX A;  3KV5 A;  3LDQ B;  3PTR B;  3LJC A;  4U33 A;  3HR0 A;  2XY8 B;  5KDM C;  3Q5X A;  2XQ9 A;  5IUX A;  1ZP0 A;  1YD8 G;  2XSB A;  4N78 D;  1L0V A;  4IST A;  5LXT E;  2UXD T;  2X9H A;  1MMN A;  1XNQ T;  4CQI A;  2J47 A;  4ZI2 C;  2CRB A;  2DI4 A;  3D0T A;  4TWF A;  3UQ4 A;  1JNZ A;  5CB4 E;  5AQK B;  2J1D G;  3RIA A;  5J2U E;  4X20 E;  4DV3 T;  3P4R A;  3J9X 1;  2XQY A;  1M7K A;  1IJ5 A;  2ES0 A;  3ZT6 A;  2XQA A;  2H7V C;  3HKB E;  3JAD A;  4OHF A;  4UVA B;  4YTN A;  3JAF A;  5HXC A;  4AQY T;  3VKH A;  3JAE A;  1M62 A;  5F3J A;  3CX8 B;  3AE4 A;  2WWV A;  4I43 B;  3I9Y A;  3CPZ A;  1S94 A;  2V6Y A;  4UEM A;  4LF7 T;  3PV0 F;  4PW8 A;  4HFC A;  4JI3 T;  3UFE A;  5DQV A;  4Z90 A;  1MIV A;  3KV6 A;  4U7Y A;  4LMK A;  4IE7 A;  4PK5 A;  2WY2 A;  3L39 A;  5HEJ A;  2YDS A;  4AKL A;  5LGT B;  2W0G A;  5FMN A;  3F57 A;  3NKZ A;  5DQW A;  3RX6 A;  5AQM B;  2V5C A;  3VRA A;  2E8I A;  3LBX A;  3RHW A;  2YKS A;  1KNR A;  1U5P A;  2WMO A;  2YN6 A;  3ZJ1 A;  2LHN A;  2D9D A;  1NEN A;  2HHH T;  1D1C A;  4ISS A;  2FJD A;  2VL8 A;  2X67 A;  1UCU A;  3AXJ A;  2UUA T;  3MA9 A;  2BDE A;  5C3J A;  2VWA A;  4I4T E;  1US7 B;  1HNZ T;  3AA7 B;  4CN6 A;  1XWM A;  5HAX A;  4F6R C;  3OPC A;  4ZI7 E;  2XAH B;  1D1A A;  3DJB A;  5JRC B;  3BQI A;  3PUV F;  3LBX B;  3UQ7 A;  2NTX A;  3B13 A;  3L3P A;  1HS7 A;  3ONJ A;  2VKD A;  2LHR A;  3K3Q C;  1Y64 B;  3JCF A;  2DHR A;  4U74 A;  5EK2 A;  4ILC A;  3N9N A;  3RQU A;  5LNK A;  3KV4 A;  3LK4 2;  5AQS B;  4U3C A;  2AXD S;  5L4E A;  2NW7 A;  1UUS A;  5AQV B;  4KHP T;  3P50 A;  4X5T A;  4IHJ E;  3FZK B;  3RYH E;  3BK9 A;  3I0O A;  3EAM A;  4NUV A;  3P4Q A;  1MMA A;  1MMG A;  2WWU A;  4KBM B;  5HXR A;  5TAO A;  5ABF A;  3E08 A;  4DR6 T;  2XUE A;  1SE7 A;  3ONL C;  5J1G A;  4QX8 B;  5LHG B;  2AE9 A;  4AIU A;  4JEH B;  5LBM A;  1IBM T;  4UF0 A;  1NAF A;  3RI5 A;  3UFG A;  2I6H A;  4MBQ A;  2V7J A;  4EZH A;  5FXW A;  3GMI A;  3MXZ A;  2LSK A;  4O8S A;  2ZM6 T;  5AQT B;  2MOZ A;  1XMO T;  4NIQ A;  3RYF E;  4DV0 T;  3ZYK A;  5LB7 B;  1WFD A;  4EXT A;  1I6Z A;  4X1Y E;  5HWY A;  3K1S A;  4YTP A;  3I1A A;  4DV5 T;  2LEH A;  4LF5 T;  2LOS A;  5ABF B;  3MAC A;  4GKK T;  3ABV A;  3UT5 E;  4U72 A;  2WU2 A;  1DU2 A;  2W67 A;  4C90 A;  4E7Z A;  5JDG A;  3ZC0 A;  4UF0 B;  3RC3 A;  5JDH A;  2X9X A;  2WBL A;  5JDN A;  5L3C B;  2IW5 B;  4Q25 A;  2XQ6 A;  3P4W A;  4ANJ A;  1VCT A;  5ABG A;  3FZH B;  2VKO A;  3P4S A;  2E5L T;  2C5I T;  3IF8 B;  4LFB T;  3AEF A;  2NR4 A;  2KND A;  5HYA A;  3CQX C;  1D0Y A;  1UX4 A;  2VAS A;  1QLB A;  4JI1 T;  1GQE A;  5ADX L;  3N9P A;  4DR4 T;  4IDO A;  4JLE A;  2UUB T;  3S4U A;  3AVR A;  3H3M A;  3H37 A;  2V7M A;  3C4W A;  2CWY A;  2VUR A;  4O2B E;  2NOX A;  3SS1 A;  3QB5 K;  2H88 A;  1MND A;  5BR8 T;  3PJA A;  1HTJ F;  3T8O A;  3EDU A;  2Z6E A;  3CQG B;  2RA1 A;  3TLV A;  4DV2 T;  2I59 A;  4EV6 A;  3N5L A;  4H9N C;  3ZEF B;  2VQF T;  3RYI E;  3GN5 A;  3UU6 A;  4P1N A;  4ERR A;  3O1I A;  4LFC T;  4L5G A;  4HN9 A;  3AE6 A;  4QH5 A;  4AKR B;  2LSI A;  1SHZ C;  4O2A E;  4U2Y A;  4XBF B;  4WBN E;  3DTO A;  4ZI3 C;  4ASK A;  3FBL A;  3RRC A;  3IA3 A;  5JTG A;  2XHE B;  4YSZ A;  2XQ4 A;  2Q9Q C;  4TNV A;  5CA0 E;  2LSJ A;  2LLY A;  4OFZ A;  3KBU A;  4CXX A;  4NPP A;  3NWI A;  5LJM A;  3JC6 C;  4U7I A;  5LJN A;  2BVL A;  2D5U A;  1HCI A;  4JI4 T;  3WAK A;  5LGN B;  4HFH A;  1XDP A;  4AQF A;  5F5W A;  2L8K A;  3ANW A;  3H3A A;  2D0T A;  3FXD B;  2HPL A;  3A7M A;  3VKG A;  4UVC B;  3RKG A;  3C4Z A;  1UUR A;  2V7L A;  4H9R C;  1FMV A;  3RH3 A;  2CEA A;  4J2C A;  1KFY A;  3BQL A;  4K0U A;  3OJA A;  5FXZ A;  2CLY C;  1T72 A;  2KWH A;  2EHO C;  3PU8 A;  3FXE B;  4YTM A;  4HFD A;  3AE5 A;  3P4P A;  2JRK A;  5LYJ E;  2WZI A;  4HGA A;  5HEH A;  2EHO A;  2XM1 A;  1UK5 A;  4I55 E;  5LHI B;  2FBW A;  2B76 A;  4Z8X A;  5JR9 A;  4AKG A;  3QUJ A;  4A56 A;  3ZT7 A;  4UXN B;  1E7P A;  3ANW B;  4IE5 A;  5LMU T;  2PBI A;  4P0B A;  4TWD A;  4OYK A;  1T98 A;  3VR8 A;  1LVF A;  4HFV A;  4WNK A;  1KNP A;  5FY1 A;  3AE8 A;  4AQG A;  1HNX T;  4OK0 A;  2W4X A;  4EB6 E;  4IE4 A;  4M1P A;  2VVS A;  2CLY B;  1OED E;  4DR3 T;  1WLX A;  3AAA B;  3AEG A;  2EHO B;  2JMH A;  5HEO A;  3PUX F;  3RF1 A;  1IZN B;  2M67 A;  4MHC A;  4QH4 A;  3X1D A;  5JR9 B;  5AQH B;  3AAE B;  2UU9 T;  1Y01 A;  2XAG B;  2WM9 A;  3O4X E;  2LRL A;  3AE7 A;  2MTQ A;  2XTL A;  4LF9 T;  2BG9 E;  3GA8 A;  2YU2 A;  2DCF A;  2PJQ A;  2JQQ A;  2KWI B;  4G63 A;  2IC9 A;  4JI0 T;  2KXP B;  4ILB A;  4LML A;  4EIW A;  2WAU A;  2A72 A;  4DUY T;  4JYA T;  1FEW A;  3ESL A;  1FMW A;  4XZC A;  2M6B A;  1BR1 A;  2P9B A;  3EVY A;  3UUB A;  1J1J A;  3C50 A;  3UUN A;  4KUM B;  3RRW A;  5LGU B;  3A5X A;  3AEB A;  3RC8 A;  5HXS A;  2CCQ A;  3ETU A;  3B57 A;  2OV9 A;  3ZMT B;  2JIW A;  2CE7 A;  2WS3 A;  4DR2 T;  5AQI B;  4HWD A;  3UUM A;  2E9X D;  4ZEY A;  5JDL A;  2MPK A;  4UR9 A;  3AEE A;  4B6X A;  3M3Z B;  2BKN A;  3LFM A;  3VRB A;  2DNX A;  4JBW F;  3CVR A;  5LHH B;  3AE3 A;  2J4G A;  2LKH A;  5JRC A;  4UVB B;  5JH7 E;  4ZS2 A;  3ZJ2 A;  3HKC E;  5AQJ B;  5L47 A;  3IBP A;  1ZHC A;  5L3D B;  3L09 A;  3RPU A;  5KXJ A;  4CXW A;  4DO0 A;  3PUW F;  4AKH A;  3F31 A;  2ZM2 A;  3Q2M A;  2XM2 A;  1N33 T;  3RQW A;  4EEB A;  5EK4 A;  2N1G A;  2J62 A;  3AE2 A;  2X68 A;  4QXC B;  3P8C D;  2QGS A;  2LKG A;  1ZKE A;  4KHZ F;  3J7Y q;  4WYV A;  2NW9 A;  2ODV A;  4YT0 A;  3AA0 B;  3O9X A;  5AQR B;  5L2L A;  4H9Q C;  2WDR A;  3Q9D A;  1I94 T;  4ILA A;  3RLF F;  2ZM8 A;  1FIO A;  4JV5 T;  3TLU A;  5AQO B;  2YK0 A;  4PAG A;  2BBH A;  4GK5 E;  1QUU A;  4GKJ T;  4DV7 T;  3FHN A;  1HX8 A;  3C98 B;  3CQC B;  2UUC T;  4DID B;  3ZN0 B;  2XQ5 A;  2VL0 A;  2VK9 A;  4X65 T;  3A8Y C;  2IML A;  2YOE A;  3NRX A;  3CML A;  2H89 A;  5FXV A;  3E22 E;  2FJB A;  5KMG P;  3C4X A;  5DAB A;  2LRK A;  1ZEE A;  3KIN B;  3MK7 C;  1EZ3 A;  1WCR A;  5FY0 A;  2V6X A;  5ETW A;  2UXC T;  4DV1 T;  5C8Y E;  1W09 A;  3SWH A;  1J5W A;  3ETV A;  2LE8 A;  4HTE A;  3QK6 A;  2CXL A;  2XAS B;  1VRB A;  1MNE A;  3N2K E;  1FJG T;  3ZYM A;  2E9X C;  3RIF A;  3M65 A;  2LT3 A;  1KNZ A;  1D0X A;  3OVU A;  1V9D A;  2N2N A;  3DP7 A;  2WU5 A;  5JDF A;  5L3G B;  3Q5D A;  5CFB A;  3PUR A;  2W00 A;  4UV9 B;  1D1B A;  1YXR A;  3ZMV B;  4DVD A;  4CXY A;  3KVA A;  2JQK A;  4IGU A;  4GK0 E;  3HKD E;  1IBK T;  3B5M A;  3KDS E;  1AJ3 A;  2XZE A;  2L9Q A;  2CPT A;  4AXP A;  3PUA A;  2UXB T;  4PNI A;  2VVN A;  4WW0 A;  4DR5 T;  2X66 A;  3OBV E;  5L3E B;  2X0Y A;  2UXN B;  2LJL A;  2OA5 A;  4YJ2 E;  1OED C;  2GK9 A;  3PE0 A;  4V1A v;  3LG7 A;  4I50 E;  4H63 V;  4YJ3 E;  4IDQ A;  5AQL B;  4B3M T;  2IC6 A;  3ZMZ B;  3UTK A;  5CJ5 A;  2L3L A;  5L3B B;  2WMN A;  3AE9 A;  2X0L B;  4HWI B;  3TLS A;  4JI7 T;  1BR0 A;  5FVL A;  3ZC1 A;  2BG9 C;  4KMC A;  3LSV A;  4O4I E;  3MJX A;  2X0H A;  3N9L A;  5CGM A;  1WYB A;  1NWM X;  1VCS A;  5EK3 A;  2WSS V;  1UGO A;  3QC9 A;  3ZMU B;  2K3W A;  1IAP A;  2MBG A;  2LM2 A;  4EYY R;  3UU5 A;  4AI6 A;  3PUY F;  3PUZ F;  5HXE A;  2KT9 A;  3AEC A;  1R8I A;  4DMW A;  2FJE A;  2CBI A;  2MYS A;  4HE8 A;  2DWK A;  4I0U A;  4DR7 T;  2ZMA A;  4ILU A;  4XAX B;  4IE6 A;  4ZS3 A;  4DR1 T;  2WCA A; 
#chains in the Genus database with same CATH homology
 3LDQ B;  1M62 A;  3FZF B;  5AQR B;  5AQJ B;  1HX1 B;  3M3Z B;  5AQH B;  4HWC A;  1M7K A;  5AQP B;  2D9D A;  5AQU B;  5AQQ B;  5AQT B;  5AQL B;  1UGO A;  5AQS B;  3FZL B;  3A8Y C;  5AQN B;  1T7S A;  4HWH A;  5AQO B;  3FZH B;  5AQK B;  5AQV B;  5AQF B;  4HWI B;  5AQM B;  1UK5 A;  5AQI B;  5AQG B;  1I6Z A;  4HWD A;  4HWF A;  3FZK B;  3FZM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...