3CX8B

Crystal structure of pdzrhogef rgrgs domain in a complex with galpha-13 bound to gtp-gamma-s
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
193
Chain Sequence
LIIGPEEDYDPGNESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFYLCSEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Guanine nucleotide-binding protein alpha-13 subunit
publication title Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 64
structure length 193
sequence length 196
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cx8B00
4GOUA 1ZV4X 1SHZC 1HTJF 1IAPA 4L9IA 3CX6B 4WBOA 3T8OA 2A72A 3CX8B 2ACXA 4YHJA 3QC9A 3CX7B 4PNIA 3AB3B 2DLRA 2PBIA 2I59A 3C4ZA 3C50A 3C4WA 4WNKA 2ES0A 3C4XA 4IGUA 3C51A
chains in the Genus database with same CATH superfamily
4TNVA 5LHHB 4P09A 4H9NC 4H9QC 4I0UA 3ZN0B 4UV8B 1UK5A 3ANWB 3RIFA 3EABA 4V1Av 2QRXA 3L39A 3EDVA 3I0OA 4UEMA 4HFHA 3VU7H 3HA4A 3KV4A 2XQ4A 4BA9A 4DBQA 1CHUA 3AB3B 5ABGA 3UQ7A 2VASA 5LB7B 3OYXA 3RX6A 2LHRA 4AKIA 2YN6A 2JQ9A 3NZPA 3RYIE 3ZT5A 3MKDA 5IWAT 4EB6E 2HN1A 2J47A 2K48A 4E7ZA 5FXZA 1ZV4X 2VK9A 1OXZA 3C64A 2IC6A 3MZKB 4ZZCA 2WP9A 2IDOB 3J9X1 2X68A 2I0MA 1N32T 1BR1A 2CHNA 2X0YA 2XAFB 3VRBA 2JJ9A 1HR0T 3AE6A 3Q9DA 5HWXA 3NRXA 4H9SE 2Z6EA 1I94T 4CZZB 4XAXB 5BR8T 1MIWA 4TN7B 2MBGA 4CI1B 2LSJA 3RRCA 2V5CA 4HWFA 3TLVA 2AE9A 3RLFF 5AQHB 1XMQT 4CI3B 2UUBT 3H37A 1FJGT 2DWKA 3GN5A 2WU5A 1T8BA 3UU8A 1BR2A 3R84B 5EK2A 4BJMA 5JDMA 2X9WA 3F2EA 1NENA 2KWHA 5ABFB 3UUBA 4G2AA 4X65T 5HXCA 4ADZA 1SE7A 4ILUA 2ZM0A 2VKDA 5EK3A 2IC9A 5AQJB 3ZCJA 2YDRA 4YT0A 3UU5A 4CXWA 4GKKT 1XMOT 4PW8A 4JI7T 3A5XA 2WQYA 2JMHA 4CN4A 4I43B 2LOSA 1KF6A 5LG4A 2W4XA 1DU2A 1G8XA 2EHOD 2XSBA 1E7PA 1Z8UA 3RQUA 1ZOYA 3PJAJ 2V7JA 3NZQA 3EUHA 2QYWA 2XM2A 2FJAA 1ZKEA 3C50A 3C4WA 1HCIA 4HWCA 1FMVA 3B5MA 3QB5K 1IAPA 2WZIA 5C3JA 2H7OA 3AXJA 2JRKA 3FBLA 3PUXF 3EI0A 3BQLA 2FUPA 2YOEA 3ZSSA 2LSKA 3ZEFB 2JQKA 3ZKRA 4O4IE 2LRLA 4XBFB 2B1EA 1HFAA 2EHOB 3PUYF 4AI6A 5LYJE 2WMNA 4GK0E 4ZHQE 2L3LA 3UU6A 4ZI2D 4H63V 4AKLA 3N5LA 3NBXX 3SWHA 3UTKA 3IEEA 4AKRB 3IA3A 3ZMZB 2IUBA 5ADXL 1JNRA 2XAJB 4F8HA 1HF8A 1W09A 3PUQA 2V5DA 3L09A 4EZHA 5FY0A 2KWIB 4UF0B 3RH3A 3N9QA 3FZHB 3P4SA 4I4TE 4ZZBA 2XQYA 4YY3T 1YQ3A 5HCJA 2W0GA 3JAFA 4PK5A 5FNVE 1LVKA 3KBTA 4U7YA 1D1BA 4QH5A 3QK6A 2ES0A 5KMGP 2K24A 2MTQA 5H6RB 5GONE 2CLYB 4DR1T 4NUVA 2MYSA 4AIUA 2W61A 2EHOC 4HE8A 2CXFA 1MMGA 5ABFA 5L47A 3JAEA 4YTPA 3BK9A 3AE3A 2PBIA 2LE8A 2WDVA 2V6XA 5JREA 4DR6T 4IT4A 4EAHA 1UX5A 1WFDA 3CX8B 3AA7B 3LK2B 5DABA 1HG2A 3AEAA 4KHZF 1ZP0A 4GYRA 5FKYA 2ODUA 2WBLA 2Y6XA 4PJNA 3P4WA 4COFA 4YTMA 3B13A 1MNDA 2IAKA 4ILCA 3AE7A 2IMLA 4ZI2C 4DV5T 2XQ5A 3RYFE 2W66A 4FJOA 3K3NA 1YKHB 1OEDE 4B3MT 2WDRA 4A5XA 2H3RA 5IHYA 2LHNA 3W15B 2DHRA 5FMNA 3E22E 4QX8B 2E5VA 4LF5T 3CPZA 1L0VA 1D0ZA 3AEFA 4IL9A 1HNWT 3FXEB 4U33A 2EHOA 2Q9QD 3RRWA 3TLSA 2E5LT 2J4GA 3CQCB 3N9MA 5JR9C 4HFCA 2LRKA 2JMKA 5F8PA 4C90A 2BBJA 2Y8DA 2YINA 3CX7B 2MOZA 5JDNA 5C2TA 2XY8B 4LF7T 2W67A 1AJ3A 4C91A 1HS7A 3OKQA 4EOZB 4DIDB 3QUJA 4X66T 3IBPA 3RHWA 4CQIA 4QXBB 4AKGA 1Y01A 1FIOA 1R8IA 5LJNA 1YD8G 4IE6A 2K9AA 1MMNA 5C8YE 4EZ4A 3HKBE 3PTRB 3ETVA 2HPJA 4ZS2A 2V7LA 4EYUA 5EK4A 2VVSA 3N9PA 3PU8A 4JEUB 1J1JA 4KHPT 4U72A 2M6BA 5LCYA 2YDSA 3FZFB 2WM9A 1QUUA 3A7MA 5DQWA 2X0LB 4O4LE 5JDHA 4XZCA 5HAXA 1IJ6A 2VL8A 3AA6B 3F57A 2YEVC 3AEGA 4AISA 3UUNA 4IL4A 4DV2T 1M62A 4HTEA 5JR9A 4QH4A 4PFOA 2LKGA 4MALA 3Q5EA 4U3CA 3AEEA 1EZ3A 2XQ8A 2XQ7A 4QWNB 1WRDA 2CE7A 2V26A 4HFVA 4EV6A 4U2ZA 4JBWF 2LM2A 5JDQA 4OHFA 2Q9QC 2PTFA 4EGWA 1WR0A 3LFMA 1X9BA 4KUMB 2X67A 4LMKA 3OJAA 2YKSA 1WYCA 4L0RA 2NW9A 4O2AE 4MLKA 2V1DB 3PV0F 4UELA 1UURA 4IE4A 5CA0E 4O4JE 3DJBA 4PNIA 3SS1A 4YSZA 3C4ZA 1ZEEA 4DV6T 2BZBA 1HX8A 4HWHA 2V8SV 3O1JA 2CEAA 5HXHA 2LLYA 4PJMA 2KXPB 1BR4A 5L3FB 5JDFA 3ZT7A 4IE7A 4DMVA 1WCRA 4YSYA 4ZEYA 2N9DA 2X0HA 4ZI3D 2BVLA 2I59A 3AXJB 3C4XA 1XDPA 1LKXA 3M3ZB 3RIUC 4ANJA 4HN9A 4G63A 5JVDE 4CN6A 2PG8A 2X9YA 2VURA 1XWMA 5AQOB 4UVAB 2CRBA 2CBJA 4QKNA 4DV0T 2NTYA 3FZKB 5FXWA 5L3BB 3ESLA 2Q9QA 1WR6A 3OBVE 2N1GA 2IIUA 2LSIA 1CUNA 5LMUT 1OEDC 5LXTE 4CN1A 3QNUA 3LK3B 2H7VC 4DBRA 2LOPA 4A56A 2C5JA 3RKOA 5HWYA 2FJBA 2H88A 4HFEA 5AQIB 2IHR1 1LRZA 5E0OA 2XHEB 3EHZA 1KNPA 4JI4T 3RKGA 1KFYA 3PUGA 2NW7A 5LBMA 3ZC0A 4U74A 5AQGB 5AQNB 2OV9A 4EEDA 2X66A 3AE2A 2DI4A 3PE0A 3RIUA 4YSXA 4QXHB 2D0UA 5AQKB 4U31A 3ZLIA 5FP3A 2QVAA 2CMRA 5AFUL 3I0QA 4JUYA 4P1NA 5LMNT 3CIRA 4ZI3C 4YTNA 2V7MA 5ABEA 1X79A 4HFDA 2HHHT 3M65A 2MAWA 2VQFT 4JLEA 3ZN1B 3T1YT 2QA7A 4PJJA 4TWFA 5LHIB 1OEDA 5EZYE 3D0TA 2XAGB 3LK42 5HEJA 1MMAA 3UU3A 4IE5A 2WU2A 1I6ZA 2BKNA 3ONLC 3Q5XA 2BG9C 2K5BB 5HEUA 4TX5A 3ZYKA 4QHOA 2Y48B 2V7IA 2HH7A 4WZXA 1O3XA 3PUAA 5ETWA 2ODVA 1SHZC 2E9XC 2OA5A 3I9YA 4K0KT 5J2UE 4UR9A 2XSAA 3P7IA 4TWHA 1KNRA 4IDQA 1W9RA 1D1AA 5L3DB 3JCFA 4PK6A 3CMLA 1T72A 4TZ4C 5LG3A 2BVMA 3ZYMA 3BQIA 3ONJA 2XQ9A 2D9DA 4JI0T 5HXSA 3CWZB 5H6QB 5L3EB 1IJ5A 3RI5A 4X64T 4OX9T 3A8YC 1KEYA 4KMCA 5JH7E 2VKHA 2DNXA 4DV1T 1VCSA 3NVOA 4LF9T 5BMVE 3ZSTA 5ABHA 2FBWA 3Q5WA 3CVRA 3F31A 4IREA 4A97A 5JDGA 2UXNB 3HKDE 3P50A 2BG9A 4IHJE 4E7SA 4U7IA 1US7B 1NAFA 2XUEA 3DTOA 1D0YA 2WCAA 1H7CA 2KZ7B 2E9XA 2WSSV 5CFBA 2UXDT 2YDQA 5LBQB 3RYCE 2LEHA 4IGUA 3AECA 3ZYLA 5AQMB 4BJNA 2XAHB 3EDUA 3VHLA 5KXJA 3UULA 4DUZT 2WS3A 2VKOA 4DR5T 2M67A 4DVDA 2A3DA 3GMIA 2XASB 2BS3A 5AQSB 5JR9B 3MK7C 5J2TE 4YFSA 5FY1A 4ZI7E 5LGUB 3AE8A 2J62A 1HNXT 4KBMB 4UV9B 3R6NA 1KNZA 5AQQB 3V5SA 3JADA 3KINB 4HFBA 5FXXA 1VRBA 3ZMVB 4H9RC 3AAAB 2LSGA 4CXYA 3PUZF 2ACZA 4AKHA 5DQVA 3RC3A 3TLUA 2A72A 3S4UA 3UU4A 2JQQA 1WYBA 2CWYA 4DMWA 3WAJA 3VKHA 2RP4A 2A2FX 2UXCT 4YJ2E 2CA5A 2LM9A 4GYSA 5JDLA 3U3IA 4EXTA 2G0UA 3AE5A 2J1DG 3K3QC 3NRYA 3PURA 1T7SA 2KNDA 4HWDA 4J2CA 2X9XA 3VR9A 2JIWA 4L5GA 5IYZE 2MPKA 2FJEA 3SFEA 5AQPB 5LGTB 3AAEB 1YKEB 2DWGA 4KX6A 4ISTA 3AA0B 3FB2A 4F6RC 4WNKA 3E0ZA 3ZJ1A 3X1DA 2N2NA 4B3ST 2XQ6A 4X20E 5JRCA 4NXMT 1XNQT 1NWMX 4I55E 4LFCT 5LA6E 1M7KA 3N9NA 4IDPA 3UQ4A 1D1CA 4IIJE 3MA9A 3ETUA 4TUYE 2CBIA 4H63H 2CWOA 4N78D 4B6XA 2RA1A 4GOUA 4ILBA 2XZEA 3L3PA 5L2LA 5FVKA 2CM0A 4DO0A 2A9UA 2QGSA 3O9XA 2Q9QB 4M1PA 1IZNB 1VOMA 3OPCA 5IUXA 1SA0E 3HI2A 5LNKA 3UT5E 2VB6A 4LFAT 1HTJF 3LSVA 3SRZA 4Q25A 2KINB 3GA8A 4DR4T 1QLBA 3FBZA 1J5WA 4YXDA 3AAIA 3FHNA 4FI5A 2RPAA 4U2YA 5FY7A 4AXPA 4PK4A 3AE1A 1YQ4A 3RGLA 1ZHCA 4H9OC 3MXZA 2NR4A 3HKCE 4NIQA 3RYHE 2KMFA 4TNWA 4ZXLA 2NTXA 1IBMT 3LG7A 1D0XA 2W62A 5FXVA 4QX7B 4YHHT 3TLTA 4GIWA 4JI1T 2CXLA 3AVSA 3BQKA 3ZCIA 5JQGE 1VCTA 2UUAT 1B7TA 1WLXA 1Y64B 4O4HE 3UFGA 5HYAA 1N34T 3Q5DA 3WAKA 5HXRA 3TKLB 3UUMA 3FZMB 3ONXA 5J1GA 5LJMA 4EYYR 4MBQA 1OEDB 2FJDA 2XAQB 3B57A 1MMDA 5LOVE 2XTLA 1QSDA 3UFEA 1W0BA 4PFPA 1BR0A 5DJQC 4OYJA 4ZS3A 3G06A 3IF8B 1N36T 4B3TT 2X9HA 2L9QA 2BS2A 3LBXA 2KT9A 3KDSE 2VQET 2NWBA 5J0ZA 3CQXC 3NKZA 1Z0PA 2ZM6T 3EAMA 3VKGA 2LT3A 4I50E 3H3AA 4YHJA 1FEWA 2ZM2A 3H3MA 3RQWA 3ZT6A 5F5WA 2XQAA 2H89A 4DV7T 3JC6D 4L9IA 4X5TA 3K1SA 5HEGA 3IHRA 4UIGA 4LF8T 2K3WA 2W63A 4K0UA 2E9XD 5HXEA 4IDNA 5L3GB 3CQGB 1LVFA 2D5UA 2KSRA 2ZM8A 1S94A 3ABVA 3QC9A 3FZLB 2BG9B 4ZOLE 2XJ7A 5L3CB 3QOFA 4OFZA 4MHCA 3C98B 3N2GE 1OWAA 2LJLA 3MJXA 4DR3T 5AQLB 2LKHA 2YU2A 2E9XB 4JI8T 2CPTA 2DL1A 3V5UA 3CX6B 4Z90A 2WMOA 3U78A 2V6YA 3EVYA 5LHGB 4EEBA 2IW5B 3PUSA 2XQ3A 4X62T 4AQGA 5L4EA 4ASKA 1YW0A 3E08A 1G73A 2YU1A 1HG5A 5HCMA 5JTGA 5AQTB 3RPUA 3ZPOA 3SFDA 3HL6A 1UX4A 4P0AA 5FYMA 2UXXB 4X1YE 1XDOA 5FL1A 1GQEA 1FMWA 3ANWA 1IBLT 4HKAA 5L4HA 4JI3T 4IDOA 3N9LA 3HKEE 4KI0F 2VWAA 1U4QA 2CCQA 3ZJ2A 5TAOA 1UGOA 2UU9T 1N33T 4OYKA 4PJLA 4MFRA 4HEAA 3ZMSB 3JC6C 5AQFB 4JI6T 3O1HA 4HFIA 4OK0A 2ZMAA 2ZLYA 2GK9A 4GK5E 2YK0A 4ERRA 3AEBA 2DCFA 4IDZA 2M6IA 3I9WA 3RC8A 2VKJA 3L8RA 5JRCB 3LJCA 2NP9A 2C5KT 2E8IA 3ZC1A 3P4RA 2DLRA 2HN2A 2C5IT 2WWUA 3N2OA 3UUXB 3RF1A 3I1AA 5AQVB 3LDQB 2SPCA 2V7KA 1SUMB 5A1LA 4LF4T 3RIAA 5CJ5A 4QH1A 2WWVA 3OTOT 4NPPA 3KFWX 4JV5T 4YLHA 1NEKA 5CA1E 4DR2T 4B3RT 5M4YA 2PFVA 4UXNB 4O8SA 4DV3T 4IE0A 5LGNB 1S35A 1HX1B 1V9DA 3QB5A 5FL0A 3VRAA 4TWDA 2WAUA 5AQRB 1UCUA 4YJ3E 4WBOA 5KDMC 4HGAA 2LSYA 4X1KE 2VVNA 3OYZA 1J5ET 1HNZT 3AE4A 3O4XE 2D0TA 1JNZA 4AQFC 2JPFA 4P0BA 5LP6E 1W0AA 1YXRA 3PJAA 3WI3A 2E2AA 3DP7A 2R6GF 4LMLA 4CXXA 4LMJA 3KVBA 1KK7A 1T98A 2BBHA 3T1HT 3N9OA 4DR7T 4ISSA 3P8CD 2W2UA 3ZMUB 4EIWA 3AEDA 4CI2B 4DUYT 3KVAA 5AQUB 3KV9A 5HEHA 1MIYA 3SOLA 5F3JA 1MIVA 3PDYA 4HWIB 3ZMTB 3MACA 3PUWF 4WW0A 5CB4E 3T8OA 1IBKT 4UVCB 2F4VT 3PU3A 2BDEA 2NOXA 4LF6T 1MNEA 4NUUA 2CXDA 4DV4T 3OVUA 2CLYC 3LBXB 4O2BE 4NXNT 2VL0A 3CKDA 4JI5T 2ACXA 4AQFA 3KV5A 3NWIA 4PAGA 3GWHA 2WDQA 2B76A 3K3OA 3CK6A 2PJQA 1UUSA 2AXDS 4X1IE 4QXCB 2L8KA 2HPLA 2WY2A 3FXDB 2OLTA 3O1IA 4JEHB 4AQYT 2P9BA 3P4QA 5KX5E 3KV6A 4TV9E 5HEOA 3AE9A 3J7Yq 2JQHA 3AVRA 4Z91A 4Z8XA 4A98A 3AA1B 2BKPA 2D2SA 4KP3C 4UF0A 1E2AA 2UUCT 2X51A 1XNRT 2WB5A 2W00A 2XPKA 2XM1A 3Q2MA 3K8PC 2UXBT 4WYVA 2BKOA 2C0SA 2NW8A 3HR0A 3PUVF 4UVBB 5FVLA 1E1HB 3VR8A 4JI2T 5CGMA 1U5PA 2BG9E 2KLQA 4H9PC 3KBUA 4GKJT 3C51A 4DNDA 2V6YB 4JYAT 4TV8E 1XZYA 2BS4A 3P4PA 3GN5B 4LFBT 2I6HA 4BAYB 2WZHA 4ILAA 2CHOA 3N2KE 3TLWA 4WBNE
chains in the Genus database with same CATH topology
2DHRA 5FMNA 3E22E 4QX8B 2E9XB 3CPZA 5LHHB 5BMVE 4P09A 3V5UA 3CX6B 4H9NC 4H9QC 1D0ZA 3ZN0B 4UV8B 2WMOA 3U78A 3ANWB 3Q5WA 3CVRA 3F31A 3EVYA 3FXEB 5LHGB 2IW5B 2EHOA 2Q9QD 3PUSA 3RRWA 4V1Av 3EDVA 4AQGA 4ASKA 3CQCB 3N9MA 5JDGA 1YW0A 3E08A 5JR9C 1G73A 2UXNB 3HKDE 3I0OA 2JMKA 4UEMA 5F8PA 4IHJE 2YU1A 1HG5A 3VU7H 4C90A 4E7SA 3HA4A 1US7B 3RPUA 3ZPOA 1NAFA 2XUEA 3DTOA 2Y8DA 2YINA 3HL6A 1D0YA 1UX4A 4P0AA 3CX7B 3KV4A 5FYMA 2MOZA 5JDNA 4BA9A 2UXXB 4DBQA 1H7CA 2KZ7B 4X1YE 2E9XA 2WSSV 3AB3B 5LBQB 3RYCE 1AJ3A 4C91A 1HS7A 2LEHA 4IGUA 3OKQA 1FMWA 3ANWA 4EOZB 2VASA 3ZYLA 4HKAA 3QUJA 3IBPA 4BJNA 2XAHB 3EDUA 3N9LA 3OYXA 3RX6A 3HKEE 4CQIA 4QXBB 3VHLA 2LHRA 4AKIA 4AKGA 2VWAA 1U4QA 2CCQA 3NZPA 3RYIE 3ZJ2A 5TAOA 1FIOA 3UULA 5LJNA 2VKOA 2M67A 1YD8G 4IE6A 2K9AA 4DVDA 2A3DA 3GMIA 2XASB 1MMNA 4OYKA 3MKDA 4PJLA 4EB6E 4MFRA 5C8YE 4EZ4A 4HEAA 3ZMSB 3JC6C 3HKBE 5JR9B 3MK7C 5J2TE 3PTRB 3ETVA 4YFSA 2K48A 4E7ZA 2HPJA 5FY1A 5FXZA 3O1HA 4ZS2A 4ZI7E 1ZV4X 2V7LA 4EYUA 5LGUB 2VK9A 1OXZA 4OK0A 2ZMAA 5EK4A 3C64A 2ZLYA 2IC6A 3N9PA 3PU8A 4JEUB 4KBMB 4UV9B 3R6NA 3MZKB 1KNZA 2GK9A 3V5SA 4GK5E 2YK0A 4U72A 4ERRA 5LCYA 3KINB 2DCFA 4IDZA 5FXXA 2WM9A 1QUUA 1VRBA 3J9X1 5DQWA 3ZMVB 2X0LB 2X68A 4O4LE 3I9WA 3AAAB 4H9RC 3RC8A 2LSGA 5JDHA 4XZCA 5HAXA 1IJ6A 2VL8A 4CXYA 1BR1A 3AA6B 3F57A 2YEVC 2XAFB 4AKHA 3UUNA 5DQVA 3RC3A 2VKJA 2A72A 2JJ9A 4HTEA 5JRCB 5JR9A 4PFOA 3LJCA 2NP9A 3S4UA 2C5KT 3Q9DA 4MALA 2E8IA 1WYBA 2CWYA 2JQQA 3ZC1A 5HWXA 3NRXA 4DMWA 4H9SE 2DLRA 2Z6EA 1EZ3A 4CZZB 4XAXB 3WAJA 4QWNB 3VKHA 2RP4A 2A2FX 1WRDA 4YJ2E 2CA5A 2LM9A 1MIWA 4GYSA 5JDLA 3U3IA 4EXTA 2CE7A 2C5IT 4TN7B 2V26A 2G0UA 2WWUA 4HFVA 2J1DG 3K3QC 3NRYA 3PURA 3N2OA 3UUXB 2KNDA 5JDQA 2MBGA 4CI1B 4J2CA 2X9XA 4L5GA 4OHFA 5IYZE 2LSJA 3I1AA 2Q9QC 3RRCA 2SPCA 5LGTB 2V7KA 3AAEB 5A1LA 1YKEB 2DWGA 3LFMA 4KUMB 2X67A 4ISTA 3OJAA 3AA0B 1WYCA 3FB2A 4F6RC 4WNKA 3E0ZA 3ZJ1A 4CI3B 2N2NA 4L0RA 2NW9A 4O2AE 3H37A 4X20E 4MLKA 5JRCA 2DWKA 2V1DB 1NWMX 3GN5A 4I55E 5LA6E 4UELA 3KFWX 1BR2A 4YLHA 5CA1E 3N9NA 4IE4A 3R84B 5M4YA 2PFVA 4UXNB 5CA0E 4O8SA 5EK2A 4O4JE 4IE0A 4BJMA 5JDMA 1D1CA 2X9WA 3DJBA 3F2EA 4IIJE 4PNIA 5LGNB 3MA9A 3SS1A 2KWHA 3ETUA 4TUYE 4H63H 1S35A 2CWOA 3C4ZA 1ZEEA 2BZBA 1V9DA 4G2AA 4N78D 1HX8A 4B6XA 2RA1A 5HXCA 3O1JA 4ADZA 4ILUA 2WAUA 2ZM0A 2CEAA 4GOUA 5HXHA 2VKDA 5EK3A 4PJMA 2KXPB 3L3PA 1BR4A 1UCUA 4YJ3E 5L2LA 5L3FB 2IC9A 4WBOA 5KDMC 2CM0A 4DO0A 4HGAA 3ZCJA 2QGSA 5JDFA 3O9XA 2LSYA 4X1KE 2Q9QB 4IE7A 4CXWA 4DMVA 3OYZA 4M1PA 4PW8A 1IZNB 1VOMA 1SA0E 3HI2A 2N9DA 3A5XA 4ZI3D 2BVLA 2I59A 3O4XE 2D0TA 2JMHA 3C4XA 4AQFC 5LNKA 2JPFA 1LKXA 4P0BA 5LP6E 4I43B 2LOSA 3UT5E 5LG4A 2VB6A 3WI3A 4ANJA 1G8XA 4HN9A 1HTJF 3SRZA 4G63A 5JVDE 2KINB 3GA8A 2PG8A 3DP7A 2X9YA 3FBZA 2EHOD 4UVAB 3AAIA 3FHNA 4FI5A 4CXXA 4AXPA 5FY7A 2V7JA 3KVBA 4PK4A 1KK7A 4QKNA 3NZQA 3EUHA 1T98A 1ZKEA 2NTYA 3C50A 3C4WA 1HCIA 1FMVA 3N9OA 5FXWA 5L3BB 3ESLA 2Q9QA 4ISSA 1ZHCA 4H9OC 1WR6A 3MXZA 3OBVE 1IAPA 3P8CD 2N1GA 2H7OA 3HKCE 2LSIA 1CUNA 3ZMUB 2JRKA 3RYHE 3FBLA 4EIWA 5LXTE 2KMFA 4CI2B 3BQLA 3KVAA 3KV9A 3LK3B 1MIYA 3SOLA 2LSKA 2NTXA 2H7VC 5F3JA 4DBRA 3LG7A 1MIVA 3ZEFB 2LOPA 3PDYA 1D0XA 2W62A 5FXVA 4A56A 4O4IE 2C5JA 4QX7B 3RKOA 4GIWA 2B1EA 1HFAA 3ZMTB 2CXLA 3AVSA 4XBFB 2EHOB 3MACA 3BQKA 5HWYA 4AI6A 5LYJE 3ZCIA 4WW0A 2WMNA 5CB4E 3T8OA 4GK0E 5JQGE 4ZHQE 1B7TA 1LRZA 1WLXA 4UVCB 2L3LA 5E0OA 1Y64B 4ZI2D 4O4HE 2XHEB 3PU3A 4H63V 4AKLA 3N5LA 2BDEA 3NBXX 2NOXA 5HYAA 3SWHA 3UTKA 1MNEA 3IEEA 4NUUA 2CXDA 3PUGA 3WAKA 4AKRB 2NW7A 5LBMA 5HXRA 3TKLB 3UUMA 3ZMZB 2CLYC 3ZC0A 3LBXB 3ONXA 4U74A 5J1GA 5LJMA 4EYYR 4O2BE 5ADXL 3CKDA 4MBQA 2X66A 2ACXA 2XAJB 4AQFA 3KV5A 2XAQB 3B57A 2DI4A 3PE0A 1MMDA 1HF8A 4PAGA 4QXHB 3PUQA 2D0UA 3GWHA 3L09A 4EZHA 5LOVE 2XTLA 5FY0A 1QSDA 3UFEA 4PFPA 1BR0A 3ZLIA 2KWIB 4UF0B 3K3OA 3RH3A 5DJQC 3N9QA 2PJQA 5FP3A 2CMRA 4X1IE 4QXCB 4I4TE 4OYJA 4ZS3A 2XQYA 2L8KA 2HPLA 5AFUL 3I0QA 3IF8B 4JUYA 3FXDB 2W0GA 3O1IA 4JEHB 4ZI3C 2X9HA 2V7MA 4PK5A 1X79A 2L9QA 2P9BA 5FNVE 1LVKA 3LBXA 3M65A 3KBTA 1D1BA 5KX5E 4JLEA 2KT9A 3ZN1B 2QA7A 4PJJA 3KDSE 3QK6A 3KV6A 4TV9E 2ES0A 5KMGP 2K24A 5LHIB 2MTQA 5EZYE 5H6RB 3J7Yq 2NWBA 2CLYB 3D0TA 5GONE 2XAGB 4NUVA 2MYSA 3CQXC 3AVRA 3LK42 2W61A 4Z8XA 1Z0PA 3AA1B 1MMAA 2EHOC 2D2SA 4HE8A 3VKGA 4IE5A 2LT3A 4I50E 2CXFA 3H3AA 4YHJA 1FEWA 1MMGA 4KP3C 2ZM2A 4UF0A 3BK9A 3Q5XA 2K5BB 2X51A 4TX5A 2W00A 3ZYKA 4QHOA 2PBIA 2LE8A 2Y48B 2V7IA 3Q2MA 2HH7A 3K8PC 1O3XA 5JREA 3PUAA 5ETWA 4EAHA 1UX5A 2ODVA 1SHZC 2E9XC 2OA5A 3I9YA 2C0SA 3JC6D 2NW8A 3HR0A 5J2UE 4L9IA 3P7IA 3IHRA 4UVBB 1E1HB 3CX8B 4UIGA 3AA7B 2W63A 4K0UA 2E9XD 3LK2B 5DABA 5HXEA 1D1AA 1HG2A 5L3DB 5L3GB 4GYRA 1U5PA 4PK6A 2KLQA 2ODUA 2WBLA 2Y6XA 3CMLA 4PJNA 3CQGB 4H9PC 1LVFA 3KBUA 2D5UA 3B13A 4TZ4C 1MNDA 2IAKA 3C51A 4DNDA 2BVMA 4TV8E 3ZYMA 3BQIA 2ZM8A 1S94A 4ZI2C 3RYFE 5HXSA 3QC9A 3GN5B 4FJOA 3K3NA 3CWZB 4ZOLE 1YKHB 5H6QB 5L3CB 4BAYB 5L3EB 1IJ5A 4OFZA 4MHCA 3C98B 3N2GE 1OWAA 2H3RA 2LJLA 3MJXA 3N2KE 4KMCA 5JH7E 2VKHA 5IHYA 2LHNA 2DNXA 3W15B 2YU2A 4WBNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOU A;  1ZV4 X;  1SHZ C;  1HTJ F;  1IAP A;  4L9I A;  3CX6 B;  4WBO A;  3T8O A;  2A72 A;  3CX8 B;  2ACX A;  4YHJ A;  3QC9 A;  3CX7 B;  4PNI A;  3AB3 B;  2DLR A;  2PBI A;  2I59 A;  3C4Z A;  3C50 A;  3C4W A;  4WNK A;  2ES0 A;  3C4X A;  4IGU A;  3C51 A; 
#chains in the Genus database with same CATH topology
 4TNV A;  5LHH B;  4P09 A;  4H9N C;  4H9Q C;  4I0U A;  3ZN0 B;  4UV8 B;  1UK5 A;  3ANW B;  3RIF A;  3EAB A;  4V1A v;  2QRX A;  3L39 A;  3EDV A;  3I0O A;  4UEM A;  4HFH A;  3VU7 H;  3HA4 A;  3KV4 A;  2XQ4 A;  4BA9 A;  4DBQ A;  1CHU A;  3AB3 B;  5ABG A;  3UQ7 A;  2VAS A;  5LB7 B;  3OYX A;  3RX6 A;  2LHR A;  4AKI A;  2YN6 A;  2JQ9 A;  3NZP A;  3RYI E;  3ZT5 A;  3MKD A;  5IWA T;  4EB6 E;  2HN1 A;  2J47 A;  2K48 A;  4E7Z A;  5FXZ A;  1ZV4 X;  2VK9 A;  1OXZ A;  3C64 A;  2IC6 A;  3MZK B;  4ZZC A;  2WP9 A;  2IDO B;  3J9X 1;  2X68 A;  2I0M A;  1N32 T;  1BR1 A;  2CHN A;  2X0Y A;  2XAF B;  3VRB A;  2JJ9 A;  1HR0 T;  3AE6 A;  3Q9D A;  5HWX A;  3NRX A;  4H9S E;  2Z6E A;  1I94 T;  4CZZ B;  4XAX B;  5BR8 T;  1MIW A;  4TN7 B;  2MBG A;  4CI1 B;  2LSJ A;  3RRC A;  2V5C A;  4HWF A;  3TLV A;  2AE9 A;  3RLF F;  5AQH B;  1XMQ T;  4CI3 B;  2UUB T;  3H37 A;  1FJG T;  2DWK A;  3GN5 A;  2WU5 A;  1T8B A;  3UU8 A;  1BR2 A;  3R84 B;  5EK2 A;  4BJM A;  5JDM A;  2X9W A;  3F2E A;  1NEN A;  2KWH A;  5ABF B;  3UUB A;  4G2A A;  4X65 T;  5HXC A;  4ADZ A;  1SE7 A;  4ILU A;  2ZM0 A;  2VKD A;  5EK3 A;  2IC9 A;  5AQJ B;  3ZCJ A;  2YDR A;  4YT0 A;  3UU5 A;  4CXW A;  4GKK T;  1XMO T;  4PW8 A;  4JI7 T;  3A5X A;  2WQY A;  2JMH A;  4CN4 A;  4I43 B;  2LOS A;  1KF6 A;  5LG4 A;  2W4X A;  1DU2 A;  1G8X A;  2EHO D;  2XSB A;  1E7P A;  1Z8U A;  3RQU A;  1ZOY A;  3PJA J;  2V7J A;  3NZQ A;  3EUH A;  2QYW A;  2XM2 A;  2FJA A;  1ZKE A;  3C50 A;  3C4W A;  1HCI A;  4HWC A;  1FMV A;  3B5M A;  3QB5 K;  1IAP A;  2WZI A;  5C3J A;  2H7O A;  3AXJ A;  2JRK A;  3FBL A;  3PUX F;  3EI0 A;  3BQL A;  2FUP A;  2YOE A;  3ZSS A;  2LSK A;  3ZEF B;  2JQK A;  3ZKR A;  4O4I E;  2LRL A;  4XBF B;  2B1E A;  1HFA A;  2EHO B;  3PUY F;  4AI6 A;  5LYJ E;  2WMN A;  4GK0 E;  4ZHQ E;  2L3L A;  3UU6 A;  4ZI2 D;  4H63 V;  4AKL A;  3N5L A;  3NBX X;  3SWH A;  3UTK A;  3IEE A;  4AKR B;  3IA3 A;  3ZMZ B;  2IUB A;  5ADX L;  1JNR A;  2XAJ B;  4F8H A;  1HF8 A;  1W09 A;  3PUQ A;  2V5D A;  3L09 A;  4EZH A;  5FY0 A;  2KWI B;  4UF0 B;  3RH3 A;  3N9Q A;  3FZH B;  3P4S A;  4I4T E;  4ZZB A;  2XQY A;  4YY3 T;  1YQ3 A;  5HCJ A;  2W0G A;  3JAF A;  4PK5 A;  5FNV E;  1LVK A;  3KBT A;  4U7Y A;  1D1B A;  4QH5 A;  3QK6 A;  2ES0 A;  5KMG P;  2K24 A;  2MTQ A;  5H6R B;  5GON E;  2CLY B;  4DR1 T;  4NUV A;  2MYS A;  4AIU A;  2W61 A;  2EHO C;  4HE8 A;  2CXF A;  1MMG A;  5ABF A;  5L47 A;  3JAE A;  4YTP A;  3BK9 A;  3AE3 A;  2PBI A;  2LE8 A;  2WDV A;  2V6X A;  5JRE A;  4DR6 T;  4IT4 A;  4EAH A;  1UX5 A;  1WFD A;  3CX8 B;  3AA7 B;  3LK2 B;  5DAB A;  1HG2 A;  3AEA A;  4KHZ F;  1ZP0 A;  4GYR A;  5FKY A;  2ODU A;  2WBL A;  2Y6X A;  4PJN A;  3P4W A;  4COF A;  4YTM A;  3B13 A;  1MND A;  2IAK A;  4ILC A;  3AE7 A;  2IML A;  4ZI2 C;  4DV5 T;  2XQ5 A;  3RYF E;  2W66 A;  4FJO A;  3K3N A;  1YKH B;  1OED E;  4B3M T;  2WDR A;  4A5X A;  2H3R A;  5IHY A;  2LHN A;  3W15 B;  2DHR A;  5FMN A;  3E22 E;  4QX8 B;  2E5V A;  4LF5 T;  3CPZ A;  1L0V A;  1D0Z A;  3AEF A;  4IL9 A;  1HNW T;  3FXE B;  4U33 A;  2EHO A;  2Q9Q D;  3RRW A;  3TLS A;  2E5L T;  2J4G A;  3CQC B;  3N9M A;  5JR9 C;  4HFC A;  2LRK A;  2JMK A;  5F8P A;  4C90 A;  2BBJ A;  2Y8D A;  2YIN A;  3CX7 B;  2MOZ A;  5JDN A;  5C2T A;  2XY8 B;  4LF7 T;  2W67 A;  1AJ3 A;  4C91 A;  1HS7 A;  3OKQ A;  4EOZ B;  4DID B;  3QUJ A;  4X66 T;  3IBP A;  3RHW A;  4CQI A;  4QXB B;  4AKG A;  1Y01 A;  1FIO A;  1R8I A;  5LJN A;  1YD8 G;  4IE6 A;  2K9A A;  1MMN A;  5C8Y E;  4EZ4 A;  3HKB E;  3PTR B;  3ETV A;  2HPJ A;  4ZS2 A;  2V7L A;  4EYU A;  5EK4 A;  2VVS A;  3N9P A;  3PU8 A;  4JEU B;  1J1J A;  4KHP T;  4U72 A;  2M6B A;  5LCY A;  2YDS A;  3FZF B;  2WM9 A;  1QUU A;  3A7M A;  5DQW A;  2X0L B;  4O4L E;  5JDH A;  4XZC A;  5HAX A;  1IJ6 A;  2VL8 A;  3AA6 B;  3F57 A;  2YEV C;  3AEG A;  4AIS A;  3UUN A;  4IL4 A;  4DV2 T;  1M62 A;  4HTE A;  5JR9 A;  4QH4 A;  4PFO A;  2LKG A;  4MAL A;  3Q5E A;  4U3C A;  3AEE A;  1EZ3 A;  2XQ8 A;  2XQ7 A;  4QWN B;  1WRD A;  2CE7 A;  2V26 A;  4HFV A;  4EV6 A;  4U2Z A;  4JBW F;  2LM2 A;  5JDQ A;  4OHF A;  2Q9Q C;  2PTF A;  4EGW A;  1WR0 A;  3LFM A;  1X9B A;  4KUM B;  2X67 A;  4LMK A;  3OJA A;  2YKS A;  1WYC A;  4L0R A;  2NW9 A;  4O2A E;  4MLK A;  2V1D B;  3PV0 F;  4UEL A;  1UUR A;  4IE4 A;  5CA0 E;  4O4J E;  3DJB A;  4PNI A;  3SS1 A;  4YSZ A;  3C4Z A;  1ZEE A;  4DV6 T;  2BZB A;  1HX8 A;  4HWH A;  2V8S V;  3O1J A;  2CEA A;  5HXH A;  2LLY A;  4PJM A;  2KXP B;  1BR4 A;  5L3F B;  5JDF A;  3ZT7 A;  4IE7 A;  4DMV A;  1WCR A;  4YSY A;  4ZEY A;  2N9D A;  2X0H A;  4ZI3 D;  2BVL A;  2I59 A;  3AXJ B;  3C4X A;  1XDP A;  1LKX A;  3M3Z B;  3RIU C;  4ANJ A;  4HN9 A;  4G63 A;  5JVD E;  4CN6 A;  2PG8 A;  2X9Y A;  2VUR A;  1XWM A;  5AQO B;  4UVA B;  2CRB A;  2CBJ A;  4QKN A;  4DV0 T;  2NTY A;  3FZK B;  5FXW A;  5L3B B;  3ESL A;  2Q9Q A;  1WR6 A;  3OBV E;  2N1G A;  2IIU A;  2LSI A;  1CUN A;  5LMU T;  1OED C;  5LXT E;  4CN1 A;  3QNU A;  3LK3 B;  2H7V C;  4DBR A;  2LOP A;  4A56 A;  2C5J A;  3RKO A;  5HWY A;  2FJB A;  2H88 A;  4HFE A;  5AQI B;  2IHR 1;  1LRZ A;  5E0O A;  2XHE B;  3EHZ A;  1KNP A;  4JI4 T;  3RKG A;  1KFY A;  3PUG A;  2NW7 A;  5LBM A;  3ZC0 A;  4U74 A;  5AQG B;  5AQN B;  2OV9 A;  4EED A;  2X66 A;  3AE2 A;  2DI4 A;  3PE0 A;  3RIU A;  4YSX A;  4QXH B;  2D0U A;  5AQK B;  4U31 A;  3ZLI A;  5FP3 A;  2QVA A;  2CMR A;  5AFU L;  3I0Q A;  4JUY A;  4P1N A;  5LMN T;  3CIR A;  4ZI3 C;  4YTN A;  2V7M A;  5ABE A;  1X79 A;  4HFD A;  2HHH T;  3M65 A;  2MAW A;  2VQF T;  4JLE A;  3ZN1 B;  3T1Y T;  2QA7 A;  4PJJ A;  4TWF A;  5LHI B;  1OED A;  5EZY E;  3D0T A;  2XAG B;  3LK4 2;  5HEJ A;  1MMA A;  3UU3 A;  4IE5 A;  2WU2 A;  1I6Z A;  2BKN A;  3ONL C;  3Q5X A;  2BG9 C;  2K5B B;  5HEU A;  4TX5 A;  3ZYK A;  4QHO A;  2Y48 B;  2V7I A;  2HH7 A;  4WZX A;  1O3X A;  3PUA A;  5ETW A;  2ODV A;  1SHZ C;  2E9X C;  2OA5 A;  3I9Y A;  4K0K T;  5J2U E;  4UR9 A;  2XSA A;  3P7I A;  4TWH A;  1KNR A;  4IDQ A;  1W9R A;  1D1A A;  5L3D B;  3JCF A;  4PK6 A;  3CML A;  1T72 A;  4TZ4 C;  5LG3 A;  2BVM A;  3ZYM A;  3BQI A;  3ONJ A;  2XQ9 A;  2D9D A;  4JI0 T;  5HXS A;  3CWZ B;  5H6Q B;  5L3E B;  1IJ5 A;  3RI5 A;  4X64 T;  4OX9 T;  3A8Y C;  1KEY A;  4KMC A;  5JH7 E;  2VKH A;  2DNX A;  4DV1 T;  1VCS A;  3NVO A;  4LF9 T;  5BMV E;  3ZST A;  5ABH A;  2FBW A;  3Q5W A;  3CVR A;  3F31 A;  4IRE A;  4A97 A;  5JDG A;  2UXN B;  3HKD E;  3P50 A;  2BG9 A;  4IHJ E;  4E7S A;  4U7I A;  1US7 B;  1NAF A;  2XUE A;  3DTO A;  1D0Y A;  2WCA A;  1H7C A;  2KZ7 B;  2E9X A;  2WSS V;  5CFB A;  2UXD T;  2YDQ A;  5LBQ B;  3RYC E;  2LEH A;  4IGU A;  3AEC A;  3ZYL A;  5AQM B;  4BJN A;  2XAH B;  3EDU A;  3VHL A;  5KXJ A;  3UUL A;  4DUZ T;  2WS3 A;  2VKO A;  4DR5 T;  2M67 A;  4DVD A;  2A3D A;  3GMI A;  2XAS B;  2BS3 A;  5AQS B;  5JR9 B;  3MK7 C;  5J2T E;  4YFS A;  5FY1 A;  4ZI7 E;  5LGU B;  3AE8 A;  2J62 A;  1HNX T;  4KBM B;  4UV9 B;  3R6N A;  1KNZ A;  5AQQ B;  3V5S A;  3JAD A;  3KIN B;  4HFB A;  5FXX A;  1VRB A;  3ZMV B;  4H9R C;  3AAA B;  2LSG A;  4CXY A;  3PUZ F;  2ACZ A;  4AKH A;  5DQV A;  3RC3 A;  3TLU A;  2A72 A;  3S4U A;  3UU4 A;  2JQQ A;  1WYB A;  2CWY A;  4DMW A;  3WAJ A;  3VKH A;  2RP4 A;  2A2F X;  2UXC T;  4YJ2 E;  2CA5 A;  2LM9 A;  4GYS A;  5JDL A;  3U3I A;  4EXT A;  2G0U A;  3AE5 A;  2J1D G;  3K3Q C;  3NRY A;  3PUR A;  1T7S A;  2KND A;  4HWD A;  4J2C A;  2X9X A;  3VR9 A;  2JIW A;  4L5G A;  5IYZ E;  2MPK A;  2FJE A;  3SFE A;  5AQP B;  5LGT B;  3AAE B;  1YKE B;  2DWG A;  4KX6 A;  4IST A;  3AA0 B;  3FB2 A;  4F6R C;  4WNK A;  3E0Z A;  3ZJ1 A;  3X1D A;  2N2N A;  4B3S T;  2XQ6 A;  4X20 E;  5JRC A;  4NXM T;  1XNQ T;  1NWM X;  4I55 E;  4LFC T;  5LA6 E;  1M7K A;  3N9N A;  4IDP A;  3UQ4 A;  1D1C A;  4IIJ E;  3MA9 A;  3ETU A;  4TUY E;  2CBI A;  4H63 H;  2CWO A;  4N78 D;  4B6X A;  2RA1 A;  4GOU A;  4ILB A;  2XZE A;  3L3P A;  5L2L A;  5FVK A;  2CM0 A;  4DO0 A;  2A9U A;  2QGS A;  3O9X A;  2Q9Q B;  4M1P A;  1IZN B;  1VOM A;  3OPC A;  5IUX A;  1SA0 E;  3HI2 A;  5LNK A;  3UT5 E;  2VB6 A;  4LFA T;  1HTJ F;  3LSV A;  3SRZ A;  4Q25 A;  2KIN B;  3GA8 A;  4DR4 T;  1QLB A;  3FBZ A;  1J5W A;  4YXD A;  3AAI A;  3FHN A;  4FI5 A;  2RPA A;  4U2Y A;  5FY7 A;  4AXP A;  4PK4 A;  3AE1 A;  1YQ4 A;  3RGL A;  1ZHC A;  4H9O C;  3MXZ A;  2NR4 A;  3HKC E;  4NIQ A;  3RYH E;  2KMF A;  4TNW A;  4ZXL A;  2NTX A;  1IBM T;  3LG7 A;  1D0X A;  2W62 A;  5FXV A;  4QX7 B;  4YHH T;  3TLT A;  4GIW A;  4JI1 T;  2CXL A;  3AVS A;  3BQK A;  3ZCI A;  5JQG E;  1VCT A;  2UUA T;  1B7T A;  1WLX A;  1Y64 B;  4O4H E;  3UFG A;  5HYA A;  1N34 T;  3Q5D A;  3WAK A;  5HXR A;  3TKL B;  3UUM A;  3FZM B;  3ONX A;  5J1G A;  5LJM A;  4EYY R;  4MBQ A;  1OED B;  2FJD A;  2XAQ B;  3B57 A;  1MMD A;  5LOV E;  2XTL A;  1QSD A;  3UFE A;  1W0B A;  4PFP A;  1BR0 A;  5DJQ C;  4OYJ A;  4ZS3 A;  3G06 A;  3IF8 B;  1N36 T;  4B3T T;  2X9H A;  2L9Q A;  2BS2 A;  3LBX A;  2KT9 A;  3KDS E;  2VQE T;  2NWB A;  5J0Z A;  3CQX C;  3NKZ A;  1Z0P A;  2ZM6 T;  3EAM A;  3VKG A;  2LT3 A;  4I50 E;  3H3A A;  4YHJ A;  1FEW A;  2ZM2 A;  3H3M A;  3RQW A;  3ZT6 A;  5F5W A;  2XQA A;  2H89 A;  4DV7 T;  3JC6 D;  4L9I A;  4X5T A;  3K1S A;  5HEG A;  3IHR A;  4UIG A;  4LF8 T;  2K3W A;  2W63 A;  4K0U A;  2E9X D;  5HXE A;  4IDN A;  5L3G B;  3CQG B;  1LVF A;  2D5U A;  2KSR A;  2ZM8 A;  1S94 A;  3ABV A;  3QC9 A;  3FZL B;  2BG9 B;  4ZOL E;  2XJ7 A;  5L3C B;  3QOF A;  4OFZ A;  4MHC A;  3C98 B;  3N2G E;  1OWA A;  2LJL A;  3MJX A;  4DR3 T;  5AQL B;  2LKH A;  2YU2 A;  2E9X B;  4JI8 T;  2CPT A;  2DL1 A;  3V5U A;  3CX6 B;  4Z90 A;  2WMO A;  3U78 A;  2V6Y A;  3EVY A;  5LHG B;  4EEB A;  2IW5 B;  3PUS A;  2XQ3 A;  4X62 T;  4AQG A;  5L4E A;  4ASK A;  1YW0 A;  3E08 A;  1G73 A;  2YU1 A;  1HG5 A;  5HCM A;  5JTG A;  5AQT B;  3RPU A;  3ZPO A;  3SFD A;  3HL6 A;  1UX4 A;  4P0A A;  5FYM A;  2UXX B;  4X1Y E;  1XDO A;  5FL1 A;  1GQE A;  1FMW A;  3ANW A;  1IBL T;  4HKA A;  5L4H A;  4JI3 T;  4IDO A;  3N9L A;  3HKE E;  4KI0 F;  2VWA A;  1U4Q A;  2CCQ A;  3ZJ2 A;  5TAO A;  1UGO A;  2UU9 T;  1N33 T;  4OYK A;  4PJL A;  4MFR A;  4HEA A;  3ZMS B;  3JC6 C;  5AQF B;  4JI6 T;  3O1H A;  4HFI A;  4OK0 A;  2ZMA A;  2ZLY A;  2GK9 A;  4GK5 E;  2YK0 A;  4ERR A;  3AEB A;  2DCF A;  4IDZ A;  2M6I A;  3I9W A;  3RC8 A;  2VKJ A;  3L8R A;  5JRC B;  3LJC A;  2NP9 A;  2C5K T;  2E8I A;  3ZC1 A;  3P4R A;  2DLR A;  2HN2 A;  2C5I T;  2WWU A;  3N2O A;  3UUX B;  3RF1 A;  3I1A A;  5AQV B;  3LDQ B;  2SPC A;  2V7K A;  1SUM B;  5A1L A;  4LF4 T;  3RIA A;  5CJ5 A;  4QH1 A;  2WWV A;  3OTO T;  4NPP A;  3KFW X;  4JV5 T;  4YLH A;  1NEK A;  5CA1 E;  4DR2 T;  4B3R T;  5M4Y A;  2PFV A;  4UXN B;  4O8S A;  4DV3 T;  4IE0 A;  5LGN B;  1S35 A;  1HX1 B;  1V9D A;  3QB5 A;  5FL0 A;  3VRA A;  4TWD A;  2WAU A;  5AQR B;  1UCU A;  4YJ3 E;  4WBO A;  5KDM C;  4HGA A;  2LSY A;  4X1K E;  2VVN A;  3OYZ A;  1J5E T;  1HNZ T;  3AE4 A;  3O4X E;  2D0T A;  1JNZ A;  4AQF C;  2JPF A;  4P0B A;  5LP6 E;  1W0A A;  1YXR A;  3PJA A;  3WI3 A;  2E2A A;  3DP7 A;  2R6G F;  4LML A;  4CXX A;  4LMJ A;  3KVB A;  1KK7 A;  1T98 A;  2BBH A;  3T1H T;  3N9O A;  4DR7 T;  4ISS A;  3P8C D;  2W2U A;  3ZMU B;  4EIW A;  3AED A;  4CI2 B;  4DUY T;  3KVA A;  5AQU B;  3KV9 A;  5HEH A;  1MIY A;  3SOL A;  5F3J A;  1MIV A;  3PDY A;  4HWI B;  3ZMT B;  3MAC A;  3PUW F;  4WW0 A;  5CB4 E;  3T8O A;  1IBK T;  4UVC B;  2F4V T;  3PU3 A;  2BDE A;  2NOX A;  4LF6 T;  1MNE A;  4NUU A;  2CXD A;  4DV4 T;  3OVU A;  2CLY C;  3LBX B;  4O2B E;  4NXN T;  2VL0 A;  3CKD A;  4JI5 T;  2ACX A;  4AQF A;  3KV5 A;  3NWI A;  4PAG A;  3GWH A;  2WDQ A;  2B76 A;  3K3O A;  3CK6 A;  2PJQ A;  1UUS A;  2AXD S;  4X1I E;  4QXC B;  2L8K A;  2HPL A;  2WY2 A;  3FXD B;  2OLT A;  3O1I A;  4JEH B;  4AQY T;  2P9B A;  3P4Q A;  5KX5 E;  3KV6 A;  4TV9 E;  5HEO A;  3AE9 A;  3J7Y q;  2JQH A;  3AVR A;  4Z91 A;  4Z8X A;  4A98 A;  3AA1 B;  2BKP A;  2D2S A;  4KP3 C;  4UF0 A;  1E2A A;  2UUC T;  2X51 A;  1XNR T;  2WB5 A;  2W00 A;  2XPK A;  2XM1 A;  3Q2M A;  3K8P C;  2UXB T;  4WYV A;  2BKO A;  2C0S A;  2NW8 A;  3HR0 A;  3PUV F;  4UVB B;  5FVL A;  1E1H B;  3VR8 A;  4JI2 T;  5CGM A;  1U5P A;  2BG9 E;  2KLQ A;  4H9P C;  3KBU A;  4GKJ T;  3C51 A;  4DND A;  2V6Y B;  4JYA T;  4TV8 E;  1XZY A;  2BS4 A;  3P4P A;  3GN5 B;  4LFB T;  2I6H A;  4BAY B;  2WZH A;  4ILA A;  2CHO A;  3N2K E;  3TLW A;  4WBN E; 
#chains in the Genus database with same CATH homology
 2DHR A;  5FMN A;  3E22 E;  4QX8 B;  2E9X B;  3CPZ A;  5LHH B;  5BMV E;  4P09 A;  3V5U A;  3CX6 B;  4H9N C;  4H9Q C;  1D0Z A;  3ZN0 B;  4UV8 B;  2WMO A;  3U78 A;  3ANW B;  3Q5W A;  3CVR A;  3F31 A;  3EVY A;  3FXE B;  5LHG B;  2IW5 B;  2EHO A;  2Q9Q D;  3PUS A;  3RRW A;  4V1A v;  3EDV A;  4AQG A;  4ASK A;  3CQC B;  3N9M A;  5JDG A;  1YW0 A;  3E08 A;  5JR9 C;  1G73 A;  2UXN B;  3HKD E;  3I0O A;  2JMK A;  4UEM A;  5F8P A;  4IHJ E;  2YU1 A;  1HG5 A;  3VU7 H;  4C90 A;  4E7S A;  3HA4 A;  1US7 B;  3RPU A;  3ZPO A;  1NAF A;  2XUE A;  3DTO A;  2Y8D A;  2YIN A;  3HL6 A;  1D0Y A;  1UX4 A;  4P0A A;  3CX7 B;  3KV4 A;  5FYM A;  2MOZ A;  5JDN A;  4BA9 A;  2UXX B;  4DBQ A;  1H7C A;  2KZ7 B;  4X1Y E;  2E9X A;  2WSS V;  3AB3 B;  5LBQ B;  3RYC E;  1AJ3 A;  4C91 A;  1HS7 A;  2LEH A;  4IGU A;  3OKQ A;  1FMW A;  3ANW A;  4EOZ B;  2VAS A;  3ZYL A;  4HKA A;  3QUJ A;  3IBP A;  4BJN A;  2XAH B;  3EDU A;  3N9L A;  3OYX A;  3RX6 A;  3HKE E;  4CQI A;  4QXB B;  3VHL A;  2LHR A;  4AKI A;  4AKG A;  2VWA A;  1U4Q A;  2CCQ A;  3NZP A;  3RYI E;  3ZJ2 A;  5TAO A;  1FIO A;  3UUL A;  5LJN A;  2VKO A;  2M67 A;  1YD8 G;  4IE6 A;  2K9A A;  4DVD A;  2A3D A;  3GMI A;  2XAS B;  1MMN A;  4OYK A;  3MKD A;  4PJL A;  4EB6 E;  4MFR A;  5C8Y E;  4EZ4 A;  4HEA A;  3ZMS B;  3JC6 C;  3HKB E;  5JR9 B;  3MK7 C;  5J2T E;  3PTR B;  3ETV A;  4YFS A;  2K48 A;  4E7Z A;  2HPJ A;  5FY1 A;  5FXZ A;  3O1H A;  4ZS2 A;  4ZI7 E;  1ZV4 X;  2V7L A;  4EYU A;  5LGU B;  2VK9 A;  1OXZ A;  4OK0 A;  2ZMA A;  5EK4 A;  3C64 A;  2ZLY A;  2IC6 A;  3N9P A;  3PU8 A;  4JEU B;  4KBM B;  4UV9 B;  3R6N A;  3MZK B;  1KNZ A;  2GK9 A;  3V5S A;  4GK5 E;  2YK0 A;  4U72 A;  4ERR A;  5LCY A;  3KIN B;  2DCF A;  4IDZ A;  5FXX A;  2WM9 A;  1QUU A;  1VRB A;  3J9X 1;  5DQW A;  3ZMV B;  2X0L B;  2X68 A;  4O4L E;  3I9W A;  3AAA B;  4H9R C;  3RC8 A;  2LSG A;  5JDH A;  4XZC A;  5HAX A;  1IJ6 A;  2VL8 A;  4CXY A;  1BR1 A;  3AA6 B;  3F57 A;  2YEV C;  2XAF B;  4AKH A;  3UUN A;  5DQV A;  3RC3 A;  2VKJ A;  2A72 A;  2JJ9 A;  4HTE A;  5JRC B;  5JR9 A;  4PFO A;  3LJC A;  2NP9 A;  3S4U A;  2C5K T;  3Q9D A;  4MAL A;  2E8I A;  1WYB A;  2CWY A;  2JQQ A;  3ZC1 A;  5HWX A;  3NRX A;  4DMW A;  4H9S E;  2DLR A;  2Z6E A;  1EZ3 A;  4CZZ B;  4XAX B;  3WAJ A;  4QWN B;  3VKH A;  2RP4 A;  2A2F X;  1WRD A;  4YJ2 E;  2CA5 A;  2LM9 A;  1MIW A;  4GYS A;  5JDL A;  3U3I A;  4EXT A;  2CE7 A;  2C5I T;  4TN7 B;  2V26 A;  2G0U A;  2WWU A;  4HFV A;  2J1D G;  3K3Q C;  3NRY A;  3PUR A;  3N2O A;  3UUX B;  2KND A;  5JDQ A;  2MBG A;  4CI1 B;  4J2C A;  2X9X A;  4L5G A;  4OHF A;  5IYZ E;  2LSJ A;  3I1A A;  2Q9Q C;  3RRC A;  2SPC A;  5LGT B;  2V7K A;  3AAE B;  5A1L A;  1YKE B;  2DWG A;  3LFM A;  4KUM B;  2X67 A;  4IST A;  3OJA A;  3AA0 B;  1WYC A;  3FB2 A;  4F6R C;  4WNK A;  3E0Z A;  3ZJ1 A;  4CI3 B;  2N2N A;  4L0R A;  2NW9 A;  4O2A E;  3H37 A;  4X20 E;  4MLK A;  5JRC A;  2DWK A;  2V1D B;  1NWM X;  3GN5 A;  4I55 E;  5LA6 E;  4UEL A;  3KFW X;  1BR2 A;  4YLH A;  5CA1 E;  3N9N A;  4IE4 A;  3R84 B;  5M4Y A;  2PFV A;  4UXN B;  5CA0 E;  4O8S A;  5EK2 A;  4O4J E;  4IE0 A;  4BJM A;  5JDM A;  1D1C A;  2X9W A;  3DJB A;  3F2E A;  4IIJ E;  4PNI A;  5LGN B;  3MA9 A;  3SS1 A;  2KWH A;  3ETU A;  4TUY E;  4H63 H;  1S35 A;  2CWO A;  3C4Z A;  1ZEE A;  2BZB A;  1V9D A;  4G2A A;  4N78 D;  1HX8 A;  4B6X A;  2RA1 A;  5HXC A;  3O1J A;  4ADZ A;  4ILU A;  2WAU A;  2ZM0 A;  2CEA A;  4GOU A;  5HXH A;  2VKD A;  5EK3 A;  4PJM A;  2KXP B;  3L3P A;  1BR4 A;  1UCU A;  4YJ3 E;  5L2L A;  5L3F B;  2IC9 A;  4WBO A;  5KDM C;  2CM0 A;  4DO0 A;  4HGA A;  3ZCJ A;  2QGS A;  5JDF A;  3O9X A;  2LSY A;  4X1K E;  2Q9Q B;  4IE7 A;  4CXW A;  4DMV A;  3OYZ A;  4M1P A;  4PW8 A;  1IZN B;  1VOM A;  1SA0 E;  3HI2 A;  2N9D A;  3A5X A;  4ZI3 D;  2BVL A;  2I59 A;  3O4X E;  2D0T A;  2JMH A;  3C4X A;  4AQF C;  5LNK A;  2JPF A;  1LKX A;  4P0B A;  5LP6 E;  4I43 B;  2LOS A;  3UT5 E;  5LG4 A;  2VB6 A;  3WI3 A;  4ANJ A;  1G8X A;  4HN9 A;  1HTJ F;  3SRZ A;  4G63 A;  5JVD E;  2KIN B;  3GA8 A;  2PG8 A;  3DP7 A;  2X9Y A;  3FBZ A;  2EHO D;  4UVA B;  3AAI A;  3FHN A;  4FI5 A;  4CXX A;  4AXP A;  5FY7 A;  2V7J A;  3KVB A;  4PK4 A;  1KK7 A;  4QKN A;  3NZQ A;  3EUH A;  1T98 A;  1ZKE A;  2NTY A;  3C50 A;  3C4W A;  1HCI A;  1FMV A;  3N9O A;  5FXW A;  5L3B B;  3ESL A;  2Q9Q A;  4ISS A;  1ZHC A;  4H9O C;  1WR6 A;  3MXZ A;  3OBV E;  1IAP A;  3P8C D;  2N1G A;  2H7O A;  3HKC E;  2LSI A;  1CUN A;  3ZMU B;  2JRK A;  3RYH E;  3FBL A;  4EIW A;  5LXT E;  2KMF A;  4CI2 B;  3BQL A;  3KVA A;  3KV9 A;  3LK3 B;  1MIY A;  3SOL A;  2LSK A;  2NTX A;  2H7V C;  5F3J A;  4DBR A;  3LG7 A;  1MIV A;  3ZEF B;  2LOP A;  3PDY A;  1D0X A;  2W62 A;  5FXV A;  4A56 A;  4O4I E;  2C5J A;  4QX7 B;  3RKO A;  4GIW A;  2B1E A;  1HFA A;  3ZMT B;  2CXL A;  3AVS A;  4XBF B;  2EHO B;  3MAC A;  3BQK A;  5HWY A;  4AI6 A;  5LYJ E;  3ZCI A;  4WW0 A;  2WMN A;  5CB4 E;  3T8O A;  4GK0 E;  5JQG E;  4ZHQ E;  1B7T A;  1LRZ A;  1WLX A;  4UVC B;  2L3L A;  5E0O A;  1Y64 B;  4ZI2 D;  4O4H E;  2XHE B;  3PU3 A;  4H63 V;  4AKL A;  3N5L A;  2BDE A;  3NBX X;  2NOX A;  5HYA A;  3SWH A;  3UTK A;  1MNE A;  3IEE A;  4NUU A;  2CXD A;  3PUG A;  3WAK A;  4AKR B;  2NW7 A;  5LBM A;  5HXR A;  3TKL B;  3UUM A;  3ZMZ B;  2CLY C;  3ZC0 A;  3LBX B;  3ONX A;  4U74 A;  5J1G A;  5LJM A;  4EYY R;  4O2B E;  5ADX L;  3CKD A;  4MBQ A;  2X66 A;  2ACX A;  2XAJ B;  4AQF A;  3KV5 A;  2XAQ B;  3B57 A;  2DI4 A;  3PE0 A;  1MMD A;  1HF8 A;  4PAG A;  4QXH B;  3PUQ A;  2D0U A;  3GWH A;  3L09 A;  4EZH A;  5LOV E;  2XTL A;  5FY0 A;  1QSD A;  3UFE A;  4PFP A;  1BR0 A;  3ZLI A;  2KWI B;  4UF0 B;  3K3O A;  3RH3 A;  5DJQ C;  3N9Q A;  2PJQ A;  5FP3 A;  2CMR A;  4X1I E;  4QXC B;  4I4T E;  4OYJ A;  4ZS3 A;  2XQY A;  2L8K A;  2HPL A;  5AFU L;  3I0Q A;  3IF8 B;  4JUY A;  3FXD B;  2W0G A;  3O1I A;  4JEH B;  4ZI3 C;  2X9H A;  2V7M A;  4PK5 A;  1X79 A;  2L9Q A;  2P9B A;  5FNV E;  1LVK A;  3LBX A;  3M65 A;  3KBT A;  1D1B A;  5KX5 E;  4JLE A;  2KT9 A;  3ZN1 B;  2QA7 A;  4PJJ A;  3KDS E;  3QK6 A;  3KV6 A;  4TV9 E;  2ES0 A;  5KMG P;  2K24 A;  5LHI B;  2MTQ A;  5EZY E;  5H6R B;  3J7Y q;  2NWB A;  2CLY B;  3D0T A;  5GON E;  2XAG B;  4NUV A;  2MYS A;  3CQX C;  3AVR A;  3LK4 2;  2W61 A;  4Z8X A;  1Z0P A;  3AA1 B;  1MMA A;  2EHO C;  2D2S A;  4HE8 A;  3VKG A;  4IE5 A;  2LT3 A;  4I50 E;  2CXF A;  3H3A A;  4YHJ A;  1FEW A;  1MMG A;  4KP3 C;  2ZM2 A;  4UF0 A;  3BK9 A;  3Q5X A;  2K5B B;  2X51 A;  4TX5 A;  2W00 A;  3ZYK A;  4QHO A;  2PBI A;  2LE8 A;  2Y48 B;  2V7I A;  3Q2M A;  2HH7 A;  3K8P C;  1O3X A;  5JRE A;  3PUA A;  5ETW A;  4EAH A;  1UX5 A;  2ODV A;  1SHZ C;  2E9X C;  2OA5 A;  3I9Y A;  2C0S A;  3JC6 D;  2NW8 A;  3HR0 A;  5J2U E;  4L9I A;  3P7I A;  3IHR A;  4UVB B;  1E1H B;  3CX8 B;  4UIG A;  3AA7 B;  2W63 A;  4K0U A;  2E9X D;  3LK2 B;  5DAB A;  5HXE A;  1D1A A;  1HG2 A;  5L3D B;  5L3G B;  4GYR A;  1U5P A;  4PK6 A;  2KLQ A;  2ODU A;  2WBL A;  2Y6X A;  3CML A;  4PJN A;  3CQG B;  4H9P C;  1LVF A;  3KBU A;  2D5U A;  3B13 A;  4TZ4 C;  1MND A;  2IAK A;  3C51 A;  4DND A;  2BVM A;  4TV8 E;  3ZYM A;  3BQI A;  2ZM8 A;  1S94 A;  4ZI2 C;  3RYF E;  5HXS A;  3QC9 A;  3GN5 B;  4FJO A;  3K3N A;  3CWZ B;  4ZOL E;  1YKH B;  5H6Q B;  5L3C B;  4BAY B;  5L3E B;  1IJ5 A;  4OFZ A;  4MHC A;  3C98 B;  3N2G E;  1OWA A;  2H3R A;  2LJL A;  3MJX A;  3N2K E;  4KMC A;  5JH7 E;  2VKH A;  5IHY A;  2LHN A;  2DNX A;  3W15 B;  2YU2 A;  4WBN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...