3CX8B

Crystal structure of pdzrhogef rgrgs domain in a complex with galpha-13 bound to gtp-gamma-s
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
193
Chain Sequence
LIIGPEEDYDPGNESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFYLCSEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein alpha-13 subunit
publication title Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
pubmed doi rcsb
source organism Mus musculus
total genus 64
structure length 193
sequence length 196
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cx8B00
4L9IA 4GOUA 2I59A 3CX6B 4IGUA 4WNKA 3C50A 4WBOA 2A72A 1IAPA 3C4XA 2PBIA 3QC9A 3C4WA 3CX7B 2ACXA 1ZV4X 1HTJF 3C51A 2DLRA 1SHZC 3C4ZA 2ES0A 3CX8B 4PNIA 3T8OA 4YHJA 3AB3B
chains in the Genus database with same CATH superfamily
3AAEB 4BJNA 2A72A 5J2TE 2CEAA 4LF8T 5C2TA 2CBJA 4LFCT 3ZC0A 1D0YA 4C90A 4DR5T 4HEAA 4KHPT 4EGWA 4ANJA 2W63A 3FBLA 4QXCB 2V1DB 3F2EA 3TKLB 5AFUL 2H7OA 1YKEB 2BBJA 5ABFB 2YDSA 5M4YA 3H3MA 3I1AA 2HN1A 4LF7T 5DJQC 2KZ7B 2XSBA 3K8PC 2FJBA 4WYVA 3AAAB 3AVSA 3ESLA 4CXYA 2BDEA 5JDFA 2W62A 4NIQA 5C3JA 4YHHT 4DV3T 2ES0A 4QX7B 2WZIA 2YN6A 2XQYA 4JI7T 3HA4A 3ZYKA 4HWDA 4JI6T 4X20E 5LBQB 4EAHA 4PK5A 5AQNB 4NPPA 3LBXB 4Z91A 2WDRA 2WMOA 2VKOA 5HAXA 3T8OA 2J1DG 2V6XA 4DMWA 4P09A 2YOEA 1YQ3A 2QYWA 2IMLA 3VRBA 2W0GA 5AQLB 4B3ST 3PUWF 4WBNE 5FP3A 3UU4A 1WYCA 2XPKA 4TV9E 2WWUA 5L3FB 2ZM8A 1AJ3A 2WZHA 2H3RA 1OEDC 2XQ3A 5LB7B 1WYBA 3HKEE 4XZCA 3MKDA 1HX8A 3AE4A 3WAJA 1UGOA 4JI1T 1IBLT 4O4LE 4EOZB 1BR0A 1FMWA 4LMKA 4ZXLA 2XASB 2OV9A 2CXDA 3PV0F 2IC6A 4JI5T 2E2AA 5JDQA 5LCYA 2BG9C 5L4HA 2I6HA 4JLEA 2WS3A 4P0BA 5LNKA 3RX6A 5HWYA 4PJJA 3RF1A 4IE4A 4U2ZA 3ZEFB 4OFZA 3B57A 4OYKA 4JI8T 1R8IA 5F8PA 4A5XA 3PUSA 5L2LA 5H6QB 3PDYA 4JI3T 3SOLA 2KSRA 4ILAA 4XAXB 5L47A 2CCQA 2WWVA 3RI5A 2L9QA 5FVKA 4YJ3E 3ZLIA 2FJAA 4TN7B 2V7MA 4UVAB 4TX5A 1IBKT 3LG7A 3FXEB 4X1IE 3CIRA 3CQXC 1OEDA 4B3MT 3O1IA 3ONXA 2QGSA 2VB6A 3HKBE 3MZKB 1T98A 1IZNB 4I0UA 4KI0F 3ZJ2A 1MNEA 1MMGA 1HG2A 4CN1A 2WQYA 5AQFB 5GONE 2IW5B 3QUJA 4AKLA 5JVDE 2Y6XA 3ZT7A 3RYCE 2K3WA 1M7KA 3BQLA 4JI2T 2BG9A 3C51A 4LF6T 2WSSV 3A7MA 2D0TA 4TWFA 3RPUA 2AXDS 3JAFA 4DBRA 3RIUA 4DO0A 4EEDA 1D1AA 4UR9A 5FY7A 2Z6EA 2NR4A 1G8XA 4MLKA 3RKGA 4DV0T 3AE5A 3L39A 1CHUA 3F31A 5LYJE 2UXXB 4MALA 4B3RT 4YSXA 2NP9A 2C0SA 3IA3A 1WR6A 2YDQA 1LVFA 3KVBA 4A98A 3Q5EA 2LSYA 3AE1A 4EZ4A 4PK4A 4O8SA 2NW9A 3UTKA 2LM9A 4YFSA 3I0QA 1HS7A 3ANWB 2XZEA 5FL0A 3KV5A 4UF0A 1D1BA 1XZYA 2DL1A 3BK9A 5LGUB 2R6GF 2CRBA 1KNRA 3AVRA 4E7ZA 4BAYB 2E9XB 2XHEB 3QOFA 3RYIE 1Y01A 4IDZA 3PUGA 3RQWA 5JDLA 3LJCA 2CLYB 4IDPA 5KMGP 5JR9B 4CI1B 2DHRA 2SPCA 4JYAT 3ZN0B 4HFVA 1ZHCA 3EAMA 4GYSA 3MACA 5ABGA 3I9YA 3W15B 3CWZB 2X66A 1X9BA 3P4QA 5HEUA 3AA6B 2JMKA 3H37A 4GK5E 3AA7B 3UU3A 2BS4A 2H88A 2LSKA 5JRCA 5IYZE 3QB5K 2LHNA 2XY8B 4X1KE 3KVAA 2V7KA 2V26A 5E0OA 4PJLA 4MFRA 4IE6A 3RYFE 3NWIA 2ACXA 1HR0T 3KV6A 2JJ9A 3HR0A 3UUBA 5CA0E 2GK9A 4KHZF 1V9DA 4X5TA 3CQCB 4CN4A 4UIGA 2L8KA 4YTNA 1QUUA 3AEFA 2YU2A 1MIYA 2A2FX 5CJ5A 3PUXF 2LT3A 3UUNA 4ILUA 3GN5A 4DR6T 1EZ3A 5AQHB 1N34T 4AISA 2C5KT 3F57A 3JCFA 3CK6A 4L9IA 3LBXA 2ZM6T 3CQGB 3O4XE 4DR4T 2IDOB 2XQ4A 3TLVA 4EIWA 4YSYA 2N9DA 4MBQA 3RC3A 3UUMA 3DJBA 1YW0A 4O4JE 5AQJB 4EYYR 2X0LB 5HXEA 1J5ET 3HKDE 5DQWA 4BA9A 3SFDA 2XQ5A 2HPLA 5HEHA 4F6RC 4AQFC 1YXRA 5KX5E 1W9RA 4QWNB 3S4UA 2BS2A 2WAUA 1BR4A 1KK7A 1MMNA 4J2CA 1FJGT 4HWCA 3VKHA 4HWFA 3P4RA 3RKOA 2DWGA 4WW0A 4CQIA 3N2KE 2IAKA 3V5SA 5ETWA 2W66A 2CHNA 4JEUB 5JQGE 1LRZA 1NEKA 4X1YE 4DIDB 4KX6A 3RIFA 2VQFT 4H9OC 3TLTA 4DV2T 4GYRA 1D0XA 3TLSA 1KNPA 1VOMA 2EHOB 2VKJA 4ZS2A 3VR8A 1I94T 4IDOA 2JRKA 3UFGA 2FUPA 2YINA 1Y64B 3C50A 5BMVE 5AQUB 5FKYA 3ZMSB 2LJLA 3UQ7A 4YTPA 3P4PA 2XQ7A 2RPAA 3EUHA 5AQQB 4AQFA 3K3OA 2MPKA 5LBMA 5JH7E 4UXNB 3TLUA 4PJNA 1LKXA 4H63H 3C64A 4HFHA 5JDHA 2KMFA 5AQPB 2ZM2A 2VL0A 1OXZA 2UUBT 1NWMX 4ZHQE 2UUCT 2WP9A 3N5LA 3ZC1A 2Q9QD 3Q5WA 5L3EB 2CWOA 4PAGA 2B1EA 3Q5XA 1WRDA 4U7IA 4AKIA 4HFEA 4HKAA 3AECA 5LJNA 2Q9QC 2VKHA 3R6NA 3KBTA 2V6YA 3FHNA 1XNRT 2NW8A 5L3CB 4C91A 2BS3A 5F5WA 3RRCA 2OLTA 4HFCA 4ZI7E 3MXZA 3D0TA 2D2SA 3PU3A 5HYAA 3P7IA 4IREA 1IBMT 3ANWA 3HKCE 3ZN1B 2H89A 4F8HA 1U4QA 1IJ5A 3SFEA 2UXNB 3LSVA 2XQ9A 4A56A 1ZEEA 2VASA 4CZZB 2DI4A 1UUSA 2QRXA 4UVBB 5EK4A 4QH1A 5AQOB 3RRWA 4DR2T 4G2AA 3OPCA 5FXWA 5AQRB 5JREA 4IDQA 2M6BA 2Y8DA 5KDMC 3SWHA 1HX1B 2ZLYA 4TUYE 3DP7A 5L3BB 2VWAA 2Q9QA 4EYUA 2XJ7A 2WB5A 2XM2A 2YDRA 5FVLA 1VCTA 2KNDA 1Z0PA 3RIUC 2K9AA 3EHZA 4ZI3D 2G0UA 2VK9A 2XSAA 2X9YA 5DABA 2KWHA 3AE3A 1KFYA 1UK5A 4Z8XA 4YSZA 5FY1A 4JBWF 3N2GE 1MIWA 3ETUA 4COFA 3O9XA 1GQEA 3AXJB 2LHRA 2JQQA 2VVSA 2UXBT 2W61A 3FZHB 4AIUA 2UU9T 2ACZA 3UU8A 3ZCIA 2XAHB 2KWIB 4IL4A 2X51A 3AE9A 3AEAA 2LSJA 2XAGB 4TWDA 2FJEA 4YTMA 5AQKB 2CXFA 3ZMVB 2WDVA 3P50A 5IWAT 2UUAT 3FB2A 4LF9T 3LK42 4DUYT 2BKNA 5FY0A 3WAKA 3AAIA 2CBIA 3RYHE 2FBWA 3L3PA 3CPZA 3PTRB 1FIOA 4JI4T 1S35A 3HL6A 2UXCT 4AI6A 1FMVA 2PBIA 1UX4A 2IC9A 2YK0A 2NTXA 3LK3B 5KXJA 4AQYT 2ZM0A 2V7LA 4UV8B 5AQSB 4LMJA 1XDPA 1HG5A 3CMLA 4TWHA 3ZMZB 4EZHA 5HXCA 4X64T 4UELA 4EXTA 4AXPA 3B5MA 5LHIB 4X65T 4HTEA 3A5XA 4DV5T 1N33T 3K3NA 3N9OA 3L8RA 3N9QA 3CKDA 3ZT5A 4U74A 2W67A 5J2UE 5LGTB 4IE0A 5HEOA 2WBLA 2CM0A 5ADXL 3CX8B 1VCSA 2V7IA 5LG4A 4H9NC 2X68A 1US7B 2A3DA 1QSDA 2ZMAA 3G06A 5CGMA 4DV6T 4LFBT 1D1CA 2VQET 2H7VC 3QK6A 1XMOT 1XNQT 4KUMB 2CPTA 2QVAA 4KP3C 2OA5A 3PURA 4AKGA 3ONJA 1T8BA 5JTGA 4TZ4C 4E7SA 5HXHA 2VKDA 2JMHA 2J4GA 1HCIA 4DV1T 3KDSE 3UT5E 2YKSA 3SRZA 4LF4T 1T72A 5ABFA 3AEDA 2BZBA 5LA6E 4IGUA 5CB4E 3ZT6A 2WM9A 1MNDA 4LMLA 4TNWA 3C4WA 3CX7B 4U72A 1WLXA 1HTJF 3UUXB 4JI0T 4H63V 2CA5A 2L3LA 5FXZA 2XAQB 1BR2A 2K5BB 3U3IA 3UULA 4YJ2E 4DV7T 2MOZA 5LP6E 4IT4A 2D9DA 5LXTE 3C4ZA 3J9X1 1OEDB 3CVRA 3OYXA 4ZZBA 3GWHA 5HEGA 4P0AA 4IE7A 2XAJB 2A9UA 4FI5A 3VHLA 1E7PA 2C5JA 4NXMT 4UEMA 1HNWT 4PW8A 3H3AA 5J0ZA 2CE7A 2LOSA 1ZOYA 3I9WA 3NRYA 4IL9A 2BG9B 1N32T 5L4EA 4OHFA 3RH3A 2I0MA 4H9PC 4JV5T 4U2YA 3LDQB 4I43B 3LK2B 1W0BA 4WZXA 4QXHB 4B3TT 3UU5A 3PUAA 5L3DB 4DVDA 2X9XA 3AEBA 1NENA 2VL8A 4ADZA 3HI2A 4ILBA 1KNZA 3N9LA 4NUUA 4ZI2D 1XWMA 2B76A 3AA0B 3N9PA 2V7JA 3NKZA 5IHYA 2X0HA 4ZI2C 3Q5DA 3RQUA 1WFDA 2DLRA 5FYMA 3B13A 2V5CA 4PNIA 2X67A 3FZLB 4YXDA 3VR9A 4WBOA 4B6XA 3Q2MA 5HWXA 1W09A 2LKGA 4NUVA 4IDNA 2E9XD 4ZEYA 5ABEA 3FBZA 1H7CA 2Y48B 4EEBA 2E5LT 3IHRA 4DR1T 2WU5A 3N9NA 2E9XC 2RA1A 3ZSTA 4LF5T 1YKHB 2J47A 5JDGA 4IHJE 4LFAT 3ETVA 4HFIA 3RIAA 1IJ6A 5LGNB 4YHJA 4GIWA 2PFVA 3KV9A 2CLYC 2PTFA 4ISSA 3E22E 3ZMTB 1WCRA 3RC8A 5JRCB 5JR9C 2D0UA 4CN6A 3IF8B 2JIWA 1VRBA 2LM2A 3GA8A 3NVOA 4ZZCA 1W0AA 2JQKA 3AEEA 3VU7H 3R84B 3O1JA 2PG8A 2WU2A 4CXXA 5BR8T 3AE7A 4K0UA 4DBQA 4HE8A 3MA9A 3OYZA 5HEJA 3TLWA 2C5IT 2WMNA 4HWHA 3PUYF 1DU2A 2P9BA 3AA1B 2J62A 2NWBA 3T1HT 3GN5B 3KV4A 3OKQA 1XMQT 2UXDT 2I59A 3AE2A 3EDUA 5LJMA 1J1JA 2DWKA 3M3ZB 3E0ZA 1UCUA 4HWIB 3O1HA 3C98B 2E8IA 5JDMA 2E9XA 2M67A 3OBVE 3ONLC 2HPJA 3EDVA 5AQVB 3SS1A 4U33A 2PJQA 4CXWA 3FZMB 4JEHB 1X79A 2JQHA 3ZYLA 2KT9A 5JR9A 4YT0A 1SE7A 5FXVA 4H9RC 5LOVE 2E5VA 4G63A 4U7YA 2HN2A 2V8SV 5J1GA 1IAPA 1Z8UA 1D0ZA 3PUQA 4DR3T 3ZSSA 2W2UA 5LHHB 2BKPA 3M65A 4V1Av 4PFOA 2KLQA 2XAFB 2XQ6A 5FNVE 4ZS3A 1YD8G 3AEGA 3A8YC 2FJDA 4ZI3C 2LOPA 4HN9A 5FL1A 2QA7A 3AE6A 4ISTA 3KFWX 4KMCA 2XUEA 2W4XA 4X62T 4U31A 2NW7A 4L5GA 3IBPA 1ZP0A 5HXRA 1HF8A 2ODVA 3N9MA 4WNKA 4CI3B 1MMDA 3OTOT 1ZV4X 3P4WA 4O2AE 5C8YE 4A97A 1BR1A 3K1SA 1B7TA 4X66T 2LSIA 2VURA 1OEDE 3U78A 4UV9B 3PJAJ 4I55E 4OX9T 2YEVC 5AQTB 1T7SA 4L0RA 1E2AA 4YLHA 2EHOD 2D5UA 2NTYA 3NZQA 3I0OA 4ZOLE 3JADA 4U3CA 5EK3A 5EZYE 3QB5A 2BKOA 2EHOC 4QH5A 4GOUA 2LEHA 4PFPA 1E1HB 2BG9E 1UURA 2MAWA 5A1LA 3QC9A 1KEYA 4IE5A 4KBMB 4TV8E 1SA0E 4QH4A 1HFAA 1JNZA 4GKJT 3UU6A 3EABA 1NAFA 2LKHA 2LLYA 3PUZF 2M6IA 3J7Yq 3UFEA 2IUBA 2NOXA 1LVKA 2V6YB 1J5WA 4M1PA 2LRKA 3E08A 5ABHA 1HNZT 4I50E 3JAEA 3FZKB 1QLBA 3P4SA 2CMRA 5EK2A 3C4XA 1UX5A 3EI0A 4ILCA 4GK0E 3ZJ1A 3UQ4A 1L0VA 5FXXA 5HXSA 3MJXA 4UVCB 2MBGA 1HNXT 2DCFA 5LG3A 5LMNT 3WI3A 2X0YA 5HCJA 4YY3T 4OK0A 4GKKT 3BQIA 2EHOA 1CUNA 3NBXX 2N2NA 2K48A 1WR0A 3FXDB 1SHZC 4JUYA 1YQ4A 3JC6D 5AQIB 3RLFF 4HFDA 3K3QC 4OYJA 1OWAA 3AB3B 5L3GB 2IIUA 4ASKA 4AKHA 4O2BE 5IUXA 3JC6C 1MIVA 2Q9QB 3GMIA 2XQ8A 3OJAA 2BBHA 4ERRA 1FEWA 3X1DA 4O4IE 3ZKRA 4P1NA 3PU8A 2DNXA 4H9SE 4DUZT 3DTOA 3PUVF 5F3JA 2CHOA 5FMNA 2WDQA 4I4TE 2BVLA 3OVUA 4MHCA 4QHOA 3VKGA 2JQ9A 4K0KT 4Q25A 2ODUA 4PJMA 5TAOA 1G73A 4DMVA 5JDNA 4NXNT 3EVYA 3PJAA 5H6RB 3PE0A 3QNUA 4EB6E 2AE9A 2IHR1 3V5UA 1U5PA 2W00A 3CX6B 3NZPA 4BJMA 4HGAA 4DNDA 5CA1E 2VVNA 2YU1A 4TNVA 4Z90A 3KBUA 2WCAA 2N1GA 4QKNA 1M62A 1N36T 3VRAA 3LFMA 2MTQA 3KINB 2MYSA 3T1YT 3IEEA 2K24A 1O3XA 3ZCJA 4HFBA 4CI2B 5LHGB 4QXBB 5CFBA 2XTLA 3RHWA 3NRXA 2X9WA 4H9QC 4EV6A 2LE8A 2CWYA 3FZFB 5LMUT 1SUMB 2WY2A 4O4HE 2CXLA 3AE8A 2HH7A 4IIJE 3RGLA 2HHHT 3ZYMA 1ZKEA 2F4VT 1JNRA 4UF0B 2V5DA 1KF6A 2JPFA 3ABVA 2KINB 4AQGA 1I6ZA 2RP4A 4PK6A 1MMAA 2X9HA 3L09A 5DQVA 3AXJA 4QX8B 4N78D 5HCMA 4DV4T 2XQAA 3N2OA 4FJOA 3MK7C 3ZPOA 3BQKA 3ZMUB 4DR7T 2KXPB 4XBFB 2LSGA 2XM1A 1S94A 2BVMA 1XDOA 3Q9DA 2LRLA 5AQMB 5AQGB 3P8CD 4AKRB
chains in the Genus database with same CATH topology
1QUUA 3AAEB 4G63A 4BJNA 1HG5A 2YU2A 3CMLA 1MIYA 2A72A 5J2TE 5J1GA 2A2FX 1IAPA 3ZMZB 2LT3A 4EZHA 5HXCA 3UUNA 4ILUA 2CEAA 3GN5A 1D0ZA 1EZ3A 3PUQA 4UELA 4EXTA 4AXPA 5LHIB 5LHHB 2C5KT 3M65A 4V1Av 4HTEA 3ZC0A 4PFOA 1D0YA 3A5XA 4C90A 3F57A 2KLQA 4HEAA 3K3NA 3N9OA 2XAFB 4L9IA 4ANJA 5FNVE 2W63A 3FBLA 1YD8G 3LBXA 4ZS3A 4QXCB 2V1DB 3N9QA 3F2EA 3CKDA 3TKLB 3CQGB 3O4XE 5AFUL 2H7OA 4ZI3C 2LOPA 4HN9A 4U74A 5J2UE 1YKEB 5LGTB 2QA7A 4IE0A 5M4YA 2WBLA 4ISTA 3I1AA 3KFWX 4KMCA 2CM0A 2XUEA 5ADXL 3CX8B 5DJQC 4EIWA 2KZ7B 2V7IA 5LG4A 2N9DA 4H9NC 4MBQA 2X68A 3K8PC 3RC3A 1US7B 3UUMA 3DJBA 1YW0A 2A3DA 2NW7A 4L5GA 1QSDA 2ZMAA 3IBPA 4O4JE 5HXRA 1D1CA 1HF8A 2ODVA 3N9MA 4EYYR 3AAAB 4WNKA 2X0LB 5HXEA 3AVSA 3ESLA 3HKDE 5DQWA 4BA9A 2H7VC 4CXYA 3QK6A 4CI3B 2HPLA 1MMDA 2BDEA 5JDFA 4F6RC 4AQFC 1ZV4X 2W62A 4O2AE 5C8YE 5KX5E 1BR1A 4QWNB 3S4UA 4KUMB 1B7TA 2ES0A 2WAUA 4QX7B 1BR4A 4KP3C 1KK7A 2LSIA 2OA5A 3PURA 4AKGA 1MMNA 2XQYA 3U78A 3HA4A 3ZYKA 4UV9B 4J2CA 4I55E 4TZ4C 2YEVC 3VKHA 4L0RA 4E7SA 4X20E 4YLHA 5HXHA 2EHOD 2VKDA 2JMHA 5LBQB 3RKOA 1HCIA 4EAHA 2D5UA 2DWGA 4WW0A 3KDSE 2NTYA 3NZQA 3I0OA 4ZOLE 3UT5E 4CQIA 3N2KE 2IAKA 4PK5A 5ETWA 3V5SA 3LBXB 3SRZA 2WMOA 2VKOA 5EK3A 5HAXA 2J1DG 5EZYE 3T8OA 4JEUB 2EHOC 4DMWA 4GOUA 2LEHA 1LRZA 2BZBA 5LA6E 5JQGE 4PFPA 1E1HB 4IGUA 4P09A 2WM9A 4X1YE 5CB4E 1MNDA 5A1LA 3QC9A 2W0GA 4IE5A 4KBMB 3C4WA 3CX7B 4H9OC 4TV8E 1SA0E 4U72A 4GYRA 1WLXA 1D0XA 4WBNE 1HTJF 5FP3A 3UUXB 4H63V 1WYCA 1HFAA 2CA5A 1VOMA 4TV9E 2WWUA 2EHOB 2L3LA 2VKJA 2ZM8A 4ZS2A 5FXZA 2XAQB 5L3FB 1AJ3A 2H3RA 2JRKA 1BR2A 2K5BB 3U3IA 1NAFA 2YINA 3UULA 1WYBA 1Y64B 3J7Yq 3HKEE 4XZCA 3C50A 3MKDA 3UFEA 2NOXA 5BMVE 3ZMSB 2LJLA 1LVKA 4YJ2E 1HX8A 3WAJA 2MOZA 5LP6E 4M1PA 5LXTE 4O4LE 3E08A 3EUHA 4EOZB 3C4ZA 1BR0A 1FMWA 4I50E 3J9X1 2XASB 4AQFA 2CXDA 3CVRA 3K3OA 3OYXA 2IC6A 3GWHA 5LBMA 5JDQA 4P0AA 5JH7E 4IE7A 2XAJB 4UXNB 2CMRA 5LCYA 4PJNA 1LKXA 4H63H 5EK2A 3C64A 3C4XA 1UX5A 4JLEA 4GK0E 4FI5A 4P0BA 3VHLA 3ZJ1A 2C5JA 2KMFA 5JDHA 5LNKA 2ZM2A 3RX6A 5FXXA 1OXZA 5HWYA 4UEMA 5HXSA 4PJJA 3MJXA 4PW8A 3H3AA 4UVCB 1NWMX 4ZHQE 2MBGA 2CE7A 4IE4A 2LOSA 3ZEFB 3I9WA 2DCFA 3NRYA 4OFZA 3N5LA 3ZC1A 3B57A 4OYKA 3WI3A 2Q9QD 3Q5WA 4OHFA 5F8PA 4OK0A 5L3EB 3BQIA 2CWOA 4PAGA 2EHOA 3RH3A 1CUNA 2B1EA 3NBXX 3PUSA 2N2NA 5L2LA 3Q5XA 1WRDA 5H6QB 2K48A 3PDYA 4H9PC 3FXDB 4AKIA 1SHZC 3SOLA 4HKAA 4JUYA 4XAXB 4I43B 3JC6D 3LK2B 5LJNA 2CCQA 2Q9QC 4QXHB 2VKHA 3R6NA 3K3QC 3KBTA 4OYJA 2L9QA 3FHNA 1OWAA 4YJ3E 3ZLIA 3AB3B 3PUAA 5L3GB 5L3DB 2NW8A 4DVDA 4TN7B 5L3CB 2V7MA 4UVAB 2X9XA 4TX5A 4C91A 3LG7A 3FXEB 4X1IE 4ASKA 4AKHA 2VL8A 4O2BE 3HI2A 4ADZA 3CQXC 3RRCA 3O1IA 3JC6C 1MIVA 1KNZA 3ONXA 2QGSA 4ZI7E 3MXZA 3N9LA 3D0TA 2VB6A 4NUUA 2D2SA 2Q9QB 3HKBE 3MZKB 1T98A 3PU3A 5HYAA 4ZI2D 1IZNB 3GMIA 3OJAA 3AA0B 3ZJ2A 1MNEA 3P7IA 1MMGA 3N9PA 2V7JA 1HG2A 4ERRA 3ANWA 1FEWA 4O4IE 3HKCE 3ZN1B 3PU8A 2DNXA 5GONE 2IW5B 4H9SE 3QUJA 4AKLA 5JVDE 1U4QA 1IJ5A 2Y6XA 3DTOA 5IHYA 2UXNB 3RYCE 4ZI2C 5F3JA 5FMNA 4A56A 1ZEEA 3BQLA 2VASA 3C51A 2DLRA 2WSSV 2D0TA 5FYMA 3B13A 3RPUA 4I4TE 2BVLA 4DBRA 4CZZB 4MHCA 4PNIA 4QHOA 4DO0A 2DI4A 2X67A 3VKGA 1D1AA 5FY7A 4UVBB 5EK4A 2Z6EA 3RRWA 1G8XA 2ODUA 4MLKA 1G73A 4PJMA 4WBOA 5TAOA 4DMVA 4G2AA 4B6XA 3F31A 3Q2MA 5JDNA 5LYJE 5HWXA 2UXXB 4MALA 5FXWA 3EVYA 2NP9A 2C0SA 5JREA 1WR6A 5H6RB 4NUVA 3PE0A 1LVFA 3KVBA 2Y8DA 4EB6E 2E9XD 5KDMC 3FBZA 3SWHA 1H7CA 2Y48B 3V5UA 2ZLYA 4TUYE 1U5PA 3DP7A 5L3BB 2W00A 2VWAA 3CX6B 2LSYA 2Q9QA 4EZ4A 4PK4A 4EYUA 3NZPA 4BJMA 4O8SA 2NW9A 3UTKA 3IHRA 2LM9A 4YFSA 2KNDA 3N9NA 1Z0PA 2RA1A 2E9XC 3I0QA 1HS7A 2K9AA 3ANWB 4ZI3D 1YKHB 2G0UA 4HGAA 4DNDA 5CA1E 2VK9A 2YU1A 3KV5A 4IHJE 5JDGA 2X9YA 3ETVA 4UF0A 5DABA 1IJ6A 2KWHA 1D1BA 3KBUA 5LGNB 4YHJA 4GIWA 3BK9A 5LGUB 4Z8XA 2PFVA 3KV9A 2CLYC 4ISSA 5FY1A 3AVRA 3E22E 3ZMTB 3RC8A 5JRCB 5JR9C 2N1GA 3N2GE 1MIWA 2D0UA 4E7ZA 3ETUA 4QKNA 4BAYB 3O9XA 2E9XB 3IF8B 2XHEB 3LFMA 2MTQA 3KINB 1VRBA 2JQQA 2LHRA 3RYIE 3GA8A 4IDZA 2W61A 2MYSA 3PUGA 3IEEA 2K24A 1O3XA 3ZCJA 3VU7H 4CI2B 5LHGB 5JDLA 3R84B 3LJCA 2CLYB 3O1JA 4QXBB 2PG8A 2XAHB 3ZCIA 5JR9B 5KMGP 2KWIB 2XTLA 4CXXA 2X51A 4CI1B 2DHRA 3NRXA 2SPCA 2X9WA 4H9QC 2LSJA 2XAGB 2LE8A 2CWYA 4K0UA 4DBQA 4HE8A 3ZN0B 3MA9A 3OYZA 2C5IT 2WMNA 4HFVA 4O4HE 2CXFA 1ZHCA 2P9BA 3AA1B 4GYSA 3ZMVB 2CXLA 3MACA 2NWBA 2HH7A 3GN5B 4IIJE 3I9YA 3W15B 3KV4A 3OKQA 3CWZB 3ZYMA 2X66A 1ZKEA 2I59A 3EDUA 3FB2A 3AA6B 2JMKA 5LJMA 4UF0B 3H37A 4GK5E 3AA7B 3LK42 2DWKA 3E0ZA 5FY0A 1UCUA 3WAKA 2JPFA 2KINB 3AAIA 4AQGA 2LSKA 2RP4A 5JRCA 3O1HA 5IYZE 3C98B 2LHNA 2E8IA 3RYHE 4PK6A 5JDMA 1MMAA 3L3PA 2X9HA 2E9XA 3L09A 5DQVA 3CPZA 4X1KE 2M67A 3KVAA 2V7KA 2V26A 3PTRB 3OBVE 2HPJA 4QX8B 4N78D 3EDVA 5E0OA 1FIOA 3N2OA 4PJLA 1S35A 4FJOA 4MFRA 4IE6A 3SS1A 3HL6A 3MK7C 3ZPOA 4AI6A 1FMVA 2PBIA 3BQKA 3RYFE 3ZMUB 2PJQA 4CXWA 2ACXA 4JEHB 2KXPB 1X79A 3KV6A 1UX4A 4XBFB 2JJ9A 2IC9A 2LSGA 3HR0A 3ZYLA 5CA0E 2YK0A 2NTXA 2KT9A 1S94A 2BVMA 5JR9A 2GK9A 3LK3B 3Q9DA 1V9DA 3CQCB 2ZM0A 4UIGA 2V7LA 2L8KA 4H9RC 4UV8B 5FXVA 5LOVE 3P8CD 4AKRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9I A;  4GOU A;  2I59 A;  3CX6 B;  4IGU A;  4WNK A;  3C50 A;  4WBO A;  2A72 A;  1IAP A;  3C4X A;  2PBI A;  3QC9 A;  3C4W A;  3CX7 B;  2ACX A;  1ZV4 X;  1HTJ F;  3C51 A;  2DLR A;  1SHZ C;  3C4Z A;  2ES0 A;  3CX8 B;  4PNI A;  3T8O A;  4YHJ A;  3AB3 B; 
#chains in the Genus database with same CATH topology
 3AAE B;  4BJN A;  2A72 A;  5J2T E;  2CEA A;  4LF8 T;  5C2T A;  2CBJ A;  4LFC T;  3ZC0 A;  1D0Y A;  4C90 A;  4DR5 T;  4HEA A;  4KHP T;  4EGW A;  4ANJ A;  2W63 A;  3FBL A;  4QXC B;  2V1D B;  3F2E A;  3TKL B;  5AFU L;  2H7O A;  1YKE B;  2BBJ A;  5ABF B;  2YDS A;  5M4Y A;  3H3M A;  3I1A A;  2HN1 A;  4LF7 T;  5DJQ C;  2KZ7 B;  2XSB A;  3K8P C;  2FJB A;  4WYV A;  3AAA B;  3AVS A;  3ESL A;  4CXY A;  2BDE A;  5JDF A;  2W62 A;  4NIQ A;  5C3J A;  4YHH T;  4DV3 T;  2ES0 A;  4QX7 B;  2WZI A;  2YN6 A;  2XQY A;  4JI7 T;  3HA4 A;  3ZYK A;  4HWD A;  4JI6 T;  4X20 E;  5LBQ B;  4EAH A;  4PK5 A;  5AQN B;  4NPP A;  3LBX B;  4Z91 A;  2WDR A;  2WMO A;  2VKO A;  5HAX A;  3T8O A;  2J1D G;  2V6X A;  4DMW A;  4P09 A;  2YOE A;  1YQ3 A;  2QYW A;  2IML A;  3VRB A;  2W0G A;  5AQL B;  4B3S T;  3PUW F;  4WBN E;  5FP3 A;  3UU4 A;  1WYC A;  2XPK A;  4TV9 E;  2WWU A;  5L3F B;  2ZM8 A;  1AJ3 A;  2WZH A;  2H3R A;  1OED C;  2XQ3 A;  5LB7 B;  1WYB A;  3HKE E;  4XZC A;  3MKD A;  1HX8 A;  3AE4 A;  3WAJ A;  1UGO A;  4JI1 T;  1IBL T;  4O4L E;  4EOZ B;  1BR0 A;  1FMW A;  4LMK A;  4ZXL A;  2XAS B;  2OV9 A;  2CXD A;  3PV0 F;  2IC6 A;  4JI5 T;  2E2A A;  5JDQ A;  5LCY A;  2BG9 C;  5L4H A;  2I6H A;  4JLE A;  2WS3 A;  4P0B A;  5LNK A;  3RX6 A;  5HWY A;  4PJJ A;  3RF1 A;  4IE4 A;  4U2Z A;  3ZEF B;  4OFZ A;  3B57 A;  4OYK A;  4JI8 T;  1R8I A;  5F8P A;  4A5X A;  3PUS A;  5L2L A;  5H6Q B;  3PDY A;  4JI3 T;  3SOL A;  2KSR A;  4ILA A;  4XAX B;  5L47 A;  2CCQ A;  2WWV A;  3RI5 A;  2L9Q A;  5FVK A;  4YJ3 E;  3ZLI A;  2FJA A;  4TN7 B;  2V7M A;  4UVA B;  4TX5 A;  1IBK T;  3LG7 A;  3FXE B;  4X1I E;  3CIR A;  3CQX C;  1OED A;  4B3M T;  3O1I A;  3ONX A;  2QGS A;  2VB6 A;  3HKB E;  3MZK B;  1T98 A;  1IZN B;  4I0U A;  4KI0 F;  3ZJ2 A;  1MNE A;  1MMG A;  1HG2 A;  4CN1 A;  2WQY A;  5AQF B;  5GON E;  2IW5 B;  3QUJ A;  4AKL A;  5JVD E;  2Y6X A;  3ZT7 A;  3RYC E;  2K3W A;  1M7K A;  3BQL A;  4JI2 T;  2BG9 A;  3C51 A;  4LF6 T;  2WSS V;  3A7M A;  2D0T A;  4TWF A;  3RPU A;  2AXD S;  3JAF A;  4DBR A;  3RIU A;  4DO0 A;  4EED A;  1D1A A;  4UR9 A;  5FY7 A;  2Z6E A;  2NR4 A;  1G8X A;  4MLK A;  3RKG A;  4DV0 T;  3AE5 A;  3L39 A;  1CHU A;  3F31 A;  5LYJ E;  2UXX B;  4MAL A;  4B3R T;  4YSX A;  2NP9 A;  2C0S A;  3IA3 A;  1WR6 A;  2YDQ A;  1LVF A;  3KVB A;  4A98 A;  3Q5E A;  2LSY A;  3AE1 A;  4EZ4 A;  4PK4 A;  4O8S A;  2NW9 A;  3UTK A;  2LM9 A;  4YFS A;  3I0Q A;  1HS7 A;  3ANW B;  2XZE A;  5FL0 A;  3KV5 A;  4UF0 A;  1D1B A;  1XZY A;  2DL1 A;  3BK9 A;  5LGU B;  2R6G F;  2CRB A;  1KNR A;  3AVR A;  4E7Z A;  4BAY B;  2E9X B;  2XHE B;  3QOF A;  3RYI E;  1Y01 A;  4IDZ A;  3PUG A;  3RQW A;  5JDL A;  3LJC A;  2CLY B;  4IDP A;  5KMG P;  5JR9 B;  4CI1 B;  2DHR A;  2SPC A;  4JYA T;  3ZN0 B;  4HFV A;  1ZHC A;  3EAM A;  4GYS A;  3MAC A;  5ABG A;  3I9Y A;  3W15 B;  3CWZ B;  2X66 A;  1X9B A;  3P4Q A;  5HEU A;  3AA6 B;  2JMK A;  3H37 A;  4GK5 E;  3AA7 B;  3UU3 A;  2BS4 A;  2H88 A;  2LSK A;  5JRC A;  5IYZ E;  3QB5 K;  2LHN A;  2XY8 B;  4X1K E;  3KVA A;  2V7K A;  2V26 A;  5E0O A;  4PJL A;  4MFR A;  4IE6 A;  3RYF E;  3NWI A;  2ACX A;  1HR0 T;  3KV6 A;  2JJ9 A;  3HR0 A;  3UUB A;  5CA0 E;  2GK9 A;  4KHZ F;  1V9D A;  4X5T A;  3CQC B;  4CN4 A;  4UIG A;  2L8K A;  4YTN A;  1QUU A;  3AEF A;  2YU2 A;  1MIY A;  2A2F X;  5CJ5 A;  3PUX F;  2LT3 A;  3UUN A;  4ILU A;  3GN5 A;  4DR6 T;  1EZ3 A;  5AQH B;  1N34 T;  4AIS A;  2C5K T;  3F57 A;  3JCF A;  3CK6 A;  4L9I A;  3LBX A;  2ZM6 T;  3CQG B;  3O4X E;  4DR4 T;  2IDO B;  2XQ4 A;  3TLV A;  4EIW A;  4YSY A;  2N9D A;  4MBQ A;  3RC3 A;  3UUM A;  3DJB A;  1YW0 A;  4O4J E;  5AQJ B;  4EYY R;  2X0L B;  5HXE A;  1J5E T;  3HKD E;  5DQW A;  4BA9 A;  3SFD A;  2XQ5 A;  2HPL A;  5HEH A;  4F6R C;  4AQF C;  1YXR A;  5KX5 E;  1W9R A;  4QWN B;  3S4U A;  2BS2 A;  2WAU A;  1BR4 A;  1KK7 A;  1MMN A;  4J2C A;  1FJG T;  4HWC A;  3VKH A;  4HWF A;  3P4R A;  3RKO A;  2DWG A;  4WW0 A;  4CQI A;  3N2K E;  2IAK A;  3V5S A;  5ETW A;  2W66 A;  2CHN A;  4JEU B;  5JQG E;  1LRZ A;  1NEK A;  4X1Y E;  4DID B;  4KX6 A;  3RIF A;  2VQF T;  4H9O C;  3TLT A;  4DV2 T;  4GYR A;  1D0X A;  3TLS A;  1KNP A;  1VOM A;  2EHO B;  2VKJ A;  4ZS2 A;  3VR8 A;  1I94 T;  4IDO A;  2JRK A;  3UFG A;  2FUP A;  2YIN A;  1Y64 B;  3C50 A;  5BMV E;  5AQU B;  5FKY A;  3ZMS B;  2LJL A;  3UQ7 A;  4YTP A;  3P4P A;  2XQ7 A;  2RPA A;  3EUH A;  5AQQ B;  4AQF A;  3K3O A;  2MPK A;  5LBM A;  5JH7 E;  4UXN B;  3TLU A;  4PJN A;  1LKX A;  4H63 H;  3C64 A;  4HFH A;  5JDH A;  2KMF A;  5AQP B;  2ZM2 A;  2VL0 A;  1OXZ A;  2UUB T;  1NWM X;  4ZHQ E;  2UUC T;  2WP9 A;  3N5L A;  3ZC1 A;  2Q9Q D;  3Q5W A;  5L3E B;  2CWO A;  4PAG A;  2B1E A;  3Q5X A;  1WRD A;  4U7I A;  4AKI A;  4HFE A;  4HKA A;  3AEC A;  5LJN A;  2Q9Q C;  2VKH A;  3R6N A;  3KBT A;  2V6Y A;  3FHN A;  1XNR T;  2NW8 A;  5L3C B;  4C91 A;  2BS3 A;  5F5W A;  3RRC A;  2OLT A;  4HFC A;  4ZI7 E;  3MXZ A;  3D0T A;  2D2S A;  3PU3 A;  5HYA A;  3P7I A;  4IRE A;  1IBM T;  3ANW A;  3HKC E;  3ZN1 B;  2H89 A;  4F8H A;  1U4Q A;  1IJ5 A;  3SFE A;  2UXN B;  3LSV A;  2XQ9 A;  4A56 A;  1ZEE A;  2VAS A;  4CZZ B;  2DI4 A;  1UUS A;  2QRX A;  4UVB B;  5EK4 A;  4QH1 A;  5AQO B;  3RRW A;  4DR2 T;  4G2A A;  3OPC A;  5FXW A;  5AQR B;  5JRE A;  4IDQ A;  2M6B A;  2Y8D A;  5KDM C;  3SWH A;  1HX1 B;  2ZLY A;  4TUY E;  3DP7 A;  5L3B B;  2VWA A;  2Q9Q A;  4EYU A;  2XJ7 A;  2WB5 A;  2XM2 A;  2YDR A;  5FVL A;  1VCT A;  2KND A;  1Z0P A;  3RIU C;  2K9A A;  3EHZ A;  4ZI3 D;  2G0U A;  2VK9 A;  2XSA A;  2X9Y A;  5DAB A;  2KWH A;  3AE3 A;  1KFY A;  1UK5 A;  4Z8X A;  4YSZ A;  5FY1 A;  4JBW F;  3N2G E;  1MIW A;  3ETU A;  4COF A;  3O9X A;  1GQE A;  3AXJ B;  2LHR A;  2JQQ A;  2VVS A;  2UXB T;  2W61 A;  3FZH B;  4AIU A;  2UU9 T;  2ACZ A;  3UU8 A;  3ZCI A;  2XAH B;  2KWI B;  4IL4 A;  2X51 A;  3AE9 A;  3AEA A;  2LSJ A;  2XAG B;  4TWD A;  2FJE A;  4YTM A;  5AQK B;  2CXF A;  3ZMV B;  2WDV A;  3P50 A;  5IWA T;  2UUA T;  3FB2 A;  4LF9 T;  3LK4 2;  4DUY T;  2BKN A;  5FY0 A;  3WAK A;  3AAI A;  2CBI A;  3RYH E;  2FBW A;  3L3P A;  3CPZ A;  3PTR B;  1FIO A;  4JI4 T;  1S35 A;  3HL6 A;  2UXC T;  4AI6 A;  1FMV A;  2PBI A;  1UX4 A;  2IC9 A;  2YK0 A;  2NTX A;  3LK3 B;  5KXJ A;  4AQY T;  2ZM0 A;  2V7L A;  4UV8 B;  5AQS B;  4LMJ A;  1XDP A;  1HG5 A;  3CML A;  4TWH A;  3ZMZ B;  4EZH A;  5HXC A;  4X64 T;  4UEL A;  4EXT A;  4AXP A;  3B5M A;  5LHI B;  4X65 T;  4HTE A;  3A5X A;  4DV5 T;  1N33 T;  3K3N A;  3N9O A;  3L8R A;  3N9Q A;  3CKD A;  3ZT5 A;  4U74 A;  2W67 A;  5J2U E;  5LGT B;  4IE0 A;  5HEO A;  2WBL A;  2CM0 A;  5ADX L;  3CX8 B;  1VCS A;  2V7I A;  5LG4 A;  4H9N C;  2X68 A;  1US7 B;  2A3D A;  1QSD A;  2ZMA A;  3G06 A;  5CGM A;  4DV6 T;  4LFB T;  1D1C A;  2VQE T;  2H7V C;  3QK6 A;  1XMO T;  1XNQ T;  4KUM B;  2CPT A;  2QVA A;  4KP3 C;  2OA5 A;  3PUR A;  4AKG A;  3ONJ A;  1T8B A;  5JTG A;  4TZ4 C;  4E7S A;  5HXH A;  2VKD A;  2JMH A;  2J4G A;  1HCI A;  4DV1 T;  3KDS E;  3UT5 E;  2YKS A;  3SRZ A;  4LF4 T;  1T72 A;  5ABF A;  3AED A;  2BZB A;  5LA6 E;  4IGU A;  5CB4 E;  3ZT6 A;  2WM9 A;  1MND A;  4LML A;  4TNW A;  3C4W A;  3CX7 B;  4U72 A;  1WLX A;  1HTJ F;  3UUX B;  4JI0 T;  4H63 V;  2CA5 A;  2L3L A;  5FXZ A;  2XAQ B;  1BR2 A;  2K5B B;  3U3I A;  3UUL A;  4YJ2 E;  4DV7 T;  2MOZ A;  5LP6 E;  4IT4 A;  2D9D A;  5LXT E;  3C4Z A;  3J9X 1;  1OED B;  3CVR A;  3OYX A;  4ZZB A;  3GWH A;  5HEG A;  4P0A A;  4IE7 A;  2XAJ B;  2A9U A;  4FI5 A;  3VHL A;  1E7P A;  2C5J A;  4NXM T;  4UEM A;  1HNW T;  4PW8 A;  3H3A A;  5J0Z A;  2CE7 A;  2LOS A;  1ZOY A;  3I9W A;  3NRY A;  4IL9 A;  2BG9 B;  1N32 T;  5L4E A;  4OHF A;  3RH3 A;  2I0M A;  4H9P C;  4JV5 T;  4U2Y A;  3LDQ B;  4I43 B;  3LK2 B;  1W0B A;  4WZX A;  4QXH B;  4B3T T;  3UU5 A;  3PUA A;  5L3D B;  4DVD A;  2X9X A;  3AEB A;  1NEN A;  2VL8 A;  4ADZ A;  3HI2 A;  4ILB A;  1KNZ A;  3N9L A;  4NUU A;  4ZI2 D;  1XWM A;  2B76 A;  3AA0 B;  3N9P A;  2V7J A;  3NKZ A;  5IHY A;  2X0H A;  4ZI2 C;  3Q5D A;  3RQU A;  1WFD A;  2DLR A;  5FYM A;  3B13 A;  2V5C A;  4PNI A;  2X67 A;  3FZL B;  4YXD A;  3VR9 A;  4WBO A;  4B6X A;  3Q2M A;  5HWX A;  1W09 A;  2LKG A;  4NUV A;  4IDN A;  2E9X D;  4ZEY A;  5ABE A;  3FBZ A;  1H7C A;  2Y48 B;  4EEB A;  2E5L T;  3IHR A;  4DR1 T;  2WU5 A;  3N9N A;  2E9X C;  2RA1 A;  3ZST A;  4LF5 T;  1YKH B;  2J47 A;  5JDG A;  4IHJ E;  4LFA T;  3ETV A;  4HFI A;  3RIA A;  1IJ6 A;  5LGN B;  4YHJ A;  4GIW A;  2PFV A;  3KV9 A;  2CLY C;  2PTF A;  4ISS A;  3E22 E;  3ZMT B;  1WCR A;  3RC8 A;  5JRC B;  5JR9 C;  2D0U A;  4CN6 A;  3IF8 B;  2JIW A;  1VRB A;  2LM2 A;  3GA8 A;  3NVO A;  4ZZC A;  1W0A A;  2JQK A;  3AEE A;  3VU7 H;  3R84 B;  3O1J A;  2PG8 A;  2WU2 A;  4CXX A;  5BR8 T;  3AE7 A;  4K0U A;  4DBQ A;  4HE8 A;  3MA9 A;  3OYZ A;  5HEJ A;  3TLW A;  2C5I T;  2WMN A;  4HWH A;  3PUY F;  1DU2 A;  2P9B A;  3AA1 B;  2J62 A;  2NWB A;  3T1H T;  3GN5 B;  3KV4 A;  3OKQ A;  1XMQ T;  2UXD T;  2I59 A;  3AE2 A;  3EDU A;  5LJM A;  1J1J A;  2DWK A;  3M3Z B;  3E0Z A;  1UCU A;  4HWI B;  3O1H A;  3C98 B;  2E8I A;  5JDM A;  2E9X A;  2M67 A;  3OBV E;  3ONL C;  2HPJ A;  3EDV A;  5AQV B;  3SS1 A;  4U33 A;  2PJQ A;  4CXW A;  3FZM B;  4JEH B;  1X79 A;  2JQH A;  3ZYL A;  2KT9 A;  5JR9 A;  4YT0 A;  1SE7 A;  5FXV A;  4H9R C;  5LOV E;  2E5V A;  4G63 A;  4U7Y A;  2HN2 A;  2V8S V;  5J1G A;  1IAP A;  1Z8U A;  1D0Z A;  3PUQ A;  4DR3 T;  3ZSS A;  2W2U A;  5LHH B;  2BKP A;  3M65 A;  4V1A v;  4PFO A;  2KLQ A;  2XAF B;  2XQ6 A;  5FNV E;  4ZS3 A;  1YD8 G;  3AEG A;  3A8Y C;  2FJD A;  4ZI3 C;  2LOP A;  4HN9 A;  5FL1 A;  2QA7 A;  3AE6 A;  4IST A;  3KFW X;  4KMC A;  2XUE A;  2W4X A;  4X62 T;  4U31 A;  2NW7 A;  4L5G A;  3IBP A;  1ZP0 A;  5HXR A;  1HF8 A;  2ODV A;  3N9M A;  4WNK A;  4CI3 B;  1MMD A;  3OTO T;  1ZV4 X;  3P4W A;  4O2A E;  5C8Y E;  4A97 A;  1BR1 A;  3K1S A;  1B7T A;  4X66 T;  2LSI A;  2VUR A;  1OED E;  3U78 A;  4UV9 B;  3PJA J;  4I55 E;  4OX9 T;  2YEV C;  5AQT B;  1T7S A;  4L0R A;  1E2A A;  4YLH A;  2EHO D;  2D5U A;  2NTY A;  3NZQ A;  3I0O A;  4ZOL E;  3JAD A;  4U3C A;  5EK3 A;  5EZY E;  3QB5 A;  2BKO A;  2EHO C;  4QH5 A;  4GOU A;  2LEH A;  4PFP A;  1E1H B;  2BG9 E;  1UUR A;  2MAW A;  5A1L A;  3QC9 A;  1KEY A;  4IE5 A;  4KBM B;  4TV8 E;  1SA0 E;  4QH4 A;  1HFA A;  1JNZ A;  4GKJ T;  3UU6 A;  3EAB A;  1NAF A;  2LKH A;  2LLY A;  3PUZ F;  2M6I A;  3J7Y q;  3UFE A;  2IUB A;  2NOX A;  1LVK A;  2V6Y B;  1J5W A;  4M1P A;  2LRK A;  3E08 A;  5ABH A;  1HNZ T;  4I50 E;  3JAE A;  3FZK B;  1QLB A;  3P4S A;  2CMR A;  5EK2 A;  3C4X A;  1UX5 A;  3EI0 A;  4ILC A;  4GK0 E;  3ZJ1 A;  3UQ4 A;  1L0V A;  5FXX A;  5HXS A;  3MJX A;  4UVC B;  2MBG A;  1HNX T;  2DCF A;  5LG3 A;  5LMN T;  3WI3 A;  2X0Y A;  5HCJ A;  4YY3 T;  4OK0 A;  4GKK T;  3BQI A;  2EHO A;  1CUN A;  3NBX X;  2N2N A;  2K48 A;  1WR0 A;  3FXD B;  1SHZ C;  4JUY A;  1YQ4 A;  3JC6 D;  5AQI B;  3RLF F;  4HFD A;  3K3Q C;  4OYJ A;  1OWA A;  3AB3 B;  5L3G B;  2IIU A;  4ASK A;  4AKH A;  4O2B E;  5IUX A;  3JC6 C;  1MIV A;  2Q9Q B;  3GMI A;  2XQ8 A;  3OJA A;  2BBH A;  4ERR A;  1FEW A;  3X1D A;  4O4I E;  3ZKR A;  4P1N A;  3PU8 A;  2DNX A;  4H9S E;  4DUZ T;  3DTO A;  3PUV F;  5F3J A;  2CHO A;  5FMN A;  2WDQ A;  4I4T E;  2BVL A;  3OVU A;  4MHC A;  4QHO A;  3VKG A;  2JQ9 A;  4K0K T;  4Q25 A;  2ODU A;  4PJM A;  5TAO A;  1G73 A;  4DMV A;  5JDN A;  4NXN T;  3EVY A;  3PJA A;  5H6R B;  3PE0 A;  3QNU A;  4EB6 E;  2AE9 A;  2IHR 1;  3V5U A;  1U5P A;  2W00 A;  3CX6 B;  3NZP A;  4BJM A;  4HGA A;  4DND A;  5CA1 E;  2VVN A;  2YU1 A;  4TNV A;  4Z90 A;  3KBU A;  2WCA A;  2N1G A;  4QKN A;  1M62 A;  1N36 T;  3VRA A;  3LFM A;  2MTQ A;  3KIN B;  2MYS A;  3T1Y T;  3IEE A;  2K24 A;  1O3X A;  3ZCJ A;  4HFB A;  4CI2 B;  5LHG B;  4QXB B;  5CFB A;  2XTL A;  3RHW A;  3NRX A;  2X9W A;  4H9Q C;  4EV6 A;  2LE8 A;  2CWY A;  3FZF B;  5LMU T;  1SUM B;  2WY2 A;  4O4H E;  2CXL A;  3AE8 A;  2HH7 A;  4IIJ E;  3RGL A;  2HHH T;  3ZYM A;  1ZKE A;  2F4V T;  1JNR A;  4UF0 B;  2V5D A;  1KF6 A;  2JPF A;  3ABV A;  2KIN B;  4AQG A;  1I6Z A;  2RP4 A;  4PK6 A;  1MMA A;  2X9H A;  3L09 A;  5DQV A;  3AXJ A;  4QX8 B;  4N78 D;  5HCM A;  4DV4 T;  2XQA A;  3N2O A;  4FJO A;  3MK7 C;  3ZPO A;  3BQK A;  3ZMU B;  4DR7 T;  2KXP B;  4XBF B;  2LSG A;  2XM1 A;  1S94 A;  2BVM A;  1XDO A;  3Q9D A;  2LRL A;  5AQM B;  5AQG B;  3P8C D;  4AKR B; 
#chains in the Genus database with same CATH homology
 1QUU A;  3AAE B;  4G63 A;  4BJN A;  1HG5 A;  2YU2 A;  3CML A;  1MIY A;  2A72 A;  5J2T E;  5J1G A;  2A2F X;  1IAP A;  3ZMZ B;  2LT3 A;  4EZH A;  5HXC A;  3UUN A;  4ILU A;  2CEA A;  3GN5 A;  1D0Z A;  1EZ3 A;  3PUQ A;  4UEL A;  4EXT A;  4AXP A;  5LHI B;  5LHH B;  2C5K T;  3M65 A;  4V1A v;  4HTE A;  3ZC0 A;  4PFO A;  1D0Y A;  3A5X A;  4C90 A;  3F57 A;  2KLQ A;  4HEA A;  3K3N A;  3N9O A;  2XAF B;  4L9I A;  4ANJ A;  5FNV E;  2W63 A;  3FBL A;  1YD8 G;  3LBX A;  4ZS3 A;  4QXC B;  2V1D B;  3N9Q A;  3F2E A;  3CKD A;  3TKL B;  3CQG B;  3O4X E;  5AFU L;  2H7O A;  4ZI3 C;  2LOP A;  4HN9 A;  4U74 A;  5J2U E;  1YKE B;  5LGT B;  2QA7 A;  4IE0 A;  5M4Y A;  2WBL A;  4IST A;  3I1A A;  3KFW X;  4KMC A;  2CM0 A;  2XUE A;  5ADX L;  3CX8 B;  5DJQ C;  4EIW A;  2KZ7 B;  2V7I A;  5LG4 A;  2N9D A;  4H9N C;  4MBQ A;  2X68 A;  3K8P C;  3RC3 A;  1US7 B;  3UUM A;  3DJB A;  1YW0 A;  2A3D A;  2NW7 A;  4L5G A;  1QSD A;  2ZMA A;  3IBP A;  4O4J E;  5HXR A;  1D1C A;  1HF8 A;  2ODV A;  3N9M A;  4EYY R;  3AAA B;  4WNK A;  2X0L B;  5HXE A;  3AVS A;  3ESL A;  3HKD E;  5DQW A;  4BA9 A;  2H7V C;  4CXY A;  3QK6 A;  4CI3 B;  2HPL A;  1MMD A;  2BDE A;  5JDF A;  4F6R C;  4AQF C;  1ZV4 X;  2W62 A;  4O2A E;  5C8Y E;  5KX5 E;  1BR1 A;  4QWN B;  3S4U A;  4KUM B;  1B7T A;  2ES0 A;  2WAU A;  4QX7 B;  1BR4 A;  4KP3 C;  1KK7 A;  2LSI A;  2OA5 A;  3PUR A;  4AKG A;  1MMN A;  2XQY A;  3U78 A;  3HA4 A;  3ZYK A;  4UV9 B;  4J2C A;  4I55 E;  4TZ4 C;  2YEV C;  3VKH A;  4L0R A;  4E7S A;  4X20 E;  4YLH A;  5HXH A;  2EHO D;  2VKD A;  2JMH A;  5LBQ B;  3RKO A;  1HCI A;  4EAH A;  2D5U A;  2DWG A;  4WW0 A;  3KDS E;  2NTY A;  3NZQ A;  3I0O A;  4ZOL E;  3UT5 E;  4CQI A;  3N2K E;  2IAK A;  4PK5 A;  5ETW A;  3V5S A;  3LBX B;  3SRZ A;  2WMO A;  2VKO A;  5EK3 A;  5HAX A;  2J1D G;  5EZY E;  3T8O A;  4JEU B;  2EHO C;  4DMW A;  4GOU A;  2LEH A;  1LRZ A;  2BZB A;  5LA6 E;  5JQG E;  4PFP A;  1E1H B;  4IGU A;  4P09 A;  2WM9 A;  4X1Y E;  5CB4 E;  1MND A;  5A1L A;  3QC9 A;  2W0G A;  4IE5 A;  4KBM B;  3C4W A;  3CX7 B;  4H9O C;  4TV8 E;  1SA0 E;  4U72 A;  4GYR A;  1WLX A;  1D0X A;  4WBN E;  1HTJ F;  5FP3 A;  3UUX B;  4H63 V;  1WYC A;  1HFA A;  2CA5 A;  1VOM A;  4TV9 E;  2WWU A;  2EHO B;  2L3L A;  2VKJ A;  2ZM8 A;  4ZS2 A;  5FXZ A;  2XAQ B;  5L3F B;  1AJ3 A;  2H3R A;  2JRK A;  1BR2 A;  2K5B B;  3U3I A;  1NAF A;  2YIN A;  3UUL A;  1WYB A;  1Y64 B;  3J7Y q;  3HKE E;  4XZC A;  3C50 A;  3MKD A;  3UFE A;  2NOX A;  5BMV E;  3ZMS B;  2LJL A;  1LVK A;  4YJ2 E;  1HX8 A;  3WAJ A;  2MOZ A;  5LP6 E;  4M1P A;  5LXT E;  4O4L E;  3E08 A;  3EUH A;  4EOZ B;  3C4Z A;  1BR0 A;  1FMW A;  4I50 E;  3J9X 1;  2XAS B;  4AQF A;  2CXD A;  3CVR A;  3K3O A;  3OYX A;  2IC6 A;  3GWH A;  5LBM A;  5JDQ A;  4P0A A;  5JH7 E;  4IE7 A;  2XAJ B;  4UXN B;  2CMR A;  5LCY A;  4PJN A;  1LKX A;  4H63 H;  5EK2 A;  3C64 A;  3C4X A;  1UX5 A;  4JLE A;  4GK0 E;  4FI5 A;  4P0B A;  3VHL A;  3ZJ1 A;  2C5J A;  2KMF A;  5JDH A;  5LNK A;  2ZM2 A;  3RX6 A;  5FXX A;  1OXZ A;  5HWY A;  4UEM A;  5HXS A;  4PJJ A;  3MJX A;  4PW8 A;  3H3A A;  4UVC B;  1NWM X;  4ZHQ E;  2MBG A;  2CE7 A;  4IE4 A;  2LOS A;  3ZEF B;  3I9W A;  2DCF A;  3NRY A;  4OFZ A;  3N5L A;  3ZC1 A;  3B57 A;  4OYK A;  3WI3 A;  2Q9Q D;  3Q5W A;  4OHF A;  5F8P A;  4OK0 A;  5L3E B;  3BQI A;  2CWO A;  4PAG A;  2EHO A;  3RH3 A;  1CUN A;  2B1E A;  3NBX X;  3PUS A;  2N2N A;  5L2L A;  3Q5X A;  1WRD A;  5H6Q B;  2K48 A;  3PDY A;  4H9P C;  3FXD B;  4AKI A;  1SHZ C;  3SOL A;  4HKA A;  4JUY A;  4XAX B;  4I43 B;  3JC6 D;  3LK2 B;  5LJN A;  2CCQ A;  2Q9Q C;  4QXH B;  2VKH A;  3R6N A;  3K3Q C;  3KBT A;  4OYJ A;  2L9Q A;  3FHN A;  1OWA A;  4YJ3 E;  3ZLI A;  3AB3 B;  3PUA A;  5L3G B;  5L3D B;  2NW8 A;  4DVD A;  4TN7 B;  5L3C B;  2V7M A;  4UVA B;  2X9X A;  4TX5 A;  4C91 A;  3LG7 A;  3FXE B;  4X1I E;  4ASK A;  4AKH A;  2VL8 A;  4O2B E;  3HI2 A;  4ADZ A;  3CQX C;  3RRC A;  3O1I A;  3JC6 C;  1MIV A;  1KNZ A;  3ONX A;  2QGS A;  4ZI7 E;  3MXZ A;  3N9L A;  3D0T A;  2VB6 A;  4NUU A;  2D2S A;  2Q9Q B;  3HKB E;  3MZK B;  1T98 A;  3PU3 A;  5HYA A;  4ZI2 D;  1IZN B;  3GMI A;  3OJA A;  3AA0 B;  3ZJ2 A;  1MNE A;  3P7I A;  1MMG A;  3N9P A;  2V7J A;  1HG2 A;  4ERR A;  3ANW A;  1FEW A;  4O4I E;  3HKC E;  3ZN1 B;  3PU8 A;  2DNX A;  5GON E;  2IW5 B;  4H9S E;  3QUJ A;  4AKL A;  5JVD E;  1U4Q A;  1IJ5 A;  2Y6X A;  3DTO A;  5IHY A;  2UXN B;  3RYC E;  4ZI2 C;  5F3J A;  5FMN A;  4A56 A;  1ZEE A;  3BQL A;  2VAS A;  3C51 A;  2DLR A;  2WSS V;  2D0T A;  5FYM A;  3B13 A;  3RPU A;  4I4T E;  2BVL A;  4DBR A;  4CZZ B;  4MHC A;  4PNI A;  4QHO A;  4DO0 A;  2DI4 A;  2X67 A;  3VKG A;  1D1A A;  5FY7 A;  4UVB B;  5EK4 A;  2Z6E A;  3RRW A;  1G8X A;  2ODU A;  4MLK A;  1G73 A;  4PJM A;  4WBO A;  5TAO A;  4DMV A;  4G2A A;  4B6X A;  3F31 A;  3Q2M A;  5JDN A;  5LYJ E;  5HWX A;  2UXX B;  4MAL A;  5FXW A;  3EVY A;  2NP9 A;  2C0S A;  5JRE A;  1WR6 A;  5H6R B;  4NUV A;  3PE0 A;  1LVF A;  3KVB A;  2Y8D A;  4EB6 E;  2E9X D;  5KDM C;  3FBZ A;  3SWH A;  1H7C A;  2Y48 B;  3V5U A;  2ZLY A;  4TUY E;  1U5P A;  3DP7 A;  5L3B B;  2W00 A;  2VWA A;  3CX6 B;  2LSY A;  2Q9Q A;  4EZ4 A;  4PK4 A;  4EYU A;  3NZP A;  4BJM A;  4O8S A;  2NW9 A;  3UTK A;  3IHR A;  2LM9 A;  4YFS A;  2KND A;  3N9N A;  1Z0P A;  2RA1 A;  2E9X C;  3I0Q A;  1HS7 A;  2K9A A;  3ANW B;  4ZI3 D;  1YKH B;  2G0U A;  4HGA A;  4DND A;  5CA1 E;  2VK9 A;  2YU1 A;  3KV5 A;  4IHJ E;  5JDG A;  2X9Y A;  3ETV A;  4UF0 A;  5DAB A;  1IJ6 A;  2KWH A;  1D1B A;  3KBU A;  5LGN B;  4YHJ A;  4GIW A;  3BK9 A;  5LGU B;  4Z8X A;  2PFV A;  3KV9 A;  2CLY C;  4ISS A;  5FY1 A;  3AVR A;  3E22 E;  3ZMT B;  3RC8 A;  5JRC B;  5JR9 C;  2N1G A;  3N2G E;  1MIW A;  2D0U A;  4E7Z A;  3ETU A;  4QKN A;  4BAY B;  3O9X A;  2E9X B;  3IF8 B;  2XHE B;  3LFM A;  2MTQ A;  3KIN B;  1VRB A;  2JQQ A;  2LHR A;  3RYI E;  3GA8 A;  4IDZ A;  2W61 A;  2MYS A;  3PUG A;  3IEE A;  2K24 A;  1O3X A;  3ZCJ A;  3VU7 H;  4CI2 B;  5LHG B;  5JDL A;  3R84 B;  3LJC A;  2CLY B;  3O1J A;  4QXB B;  2PG8 A;  2XAH B;  3ZCI A;  5JR9 B;  5KMG P;  2KWI B;  2XTL A;  4CXX A;  2X51 A;  4CI1 B;  2DHR A;  3NRX A;  2SPC A;  2X9W A;  4H9Q C;  2LSJ A;  2XAG B;  2LE8 A;  2CWY A;  4K0U A;  4DBQ A;  4HE8 A;  3ZN0 B;  3MA9 A;  3OYZ A;  2C5I T;  2WMN A;  4HFV A;  4O4H E;  2CXF A;  1ZHC A;  2P9B A;  3AA1 B;  4GYS A;  3ZMV B;  2CXL A;  3MAC A;  2NWB A;  2HH7 A;  3GN5 B;  4IIJ E;  3I9Y A;  3W15 B;  3KV4 A;  3OKQ A;  3CWZ B;  3ZYM A;  2X66 A;  1ZKE A;  2I59 A;  3EDU A;  3FB2 A;  3AA6 B;  2JMK A;  5LJM A;  4UF0 B;  3H37 A;  4GK5 E;  3AA7 B;  3LK4 2;  2DWK A;  3E0Z A;  5FY0 A;  1UCU A;  3WAK A;  2JPF A;  2KIN B;  3AAI A;  4AQG A;  2LSK A;  2RP4 A;  5JRC A;  3O1H A;  5IYZ E;  3C98 B;  2LHN A;  2E8I A;  3RYH E;  4PK6 A;  5JDM A;  1MMA A;  3L3P A;  2X9H A;  2E9X A;  3L09 A;  5DQV A;  3CPZ A;  4X1K E;  2M67 A;  3KVA A;  2V7K A;  2V26 A;  3PTR B;  3OBV E;  2HPJ A;  4QX8 B;  4N78 D;  3EDV A;  5E0O A;  1FIO A;  3N2O A;  4PJL A;  1S35 A;  4FJO A;  4MFR A;  4IE6 A;  3SS1 A;  3HL6 A;  3MK7 C;  3ZPO A;  4AI6 A;  1FMV A;  2PBI A;  3BQK A;  3RYF E;  3ZMU B;  2PJQ A;  4CXW A;  2ACX A;  4JEH B;  2KXP B;  1X79 A;  3KV6 A;  1UX4 A;  4XBF B;  2JJ9 A;  2IC9 A;  2LSG A;  3HR0 A;  3ZYL A;  5CA0 E;  2YK0 A;  2NTX A;  2KT9 A;  1S94 A;  2BVM A;  5JR9 A;  2GK9 A;  3LK3 B;  3Q9D A;  1V9D A;  3CQC B;  2ZM0 A;  4UIG A;  2V7L A;  2L8K A;  4H9R C;  4UV8 B;  5FXV A;  5LOV E;  3P8C D;  4AKR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...