1DU2A

Solution structure of the theta subunit of dna polymerase iii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the theta subunit of DNA polymerase III from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA POLYMERASE III
total genus 7
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 1du2A00
2AXDS 2XY8B 2AE9A 1DU2A 1SE7A 2IDOB
chains in the Genus database with same CATH superfamily
3QB5A 1ZV4X 4PNIA 3NWIA 2WMNA 4QKNA 1VCTA 3KV4A 1XZYA 2W00A 1BR1A 3ZMTB 4H9OC 4TWFA 4CI3B 1J1JA 1HG2A 3V5UA 4AKHA 5TAOA 3NZQA 4OYKA 2CRBA 3L8RA 4IE4A 4Z90A 4TN7B 4ZZBA 2OLTA 3LFMA 4YFSA 4HEAA 5LOVE 3VKHA 3SRZA 3EI0A 2BG9E 2H7VC 2JMKA 2NTYA 3UU3A 2HH7A 4CXXA 3KV6A 4ZI3D 5LJNA 3QNUA 4EYUA 1I94T 3GMIA 4E7ZA 4H9RC 2EHOA 4ZOLE 2LHRA 4PK6A 2NTXA 2KXPB 2VASA 3OVUA 3ZCIA 4AQFC 2LHNA 5LHGB 2V7IA 1I6ZA 3VRBA 5J0ZA 2E5VA 3BQKA 1UX4A 1X79A 3HKEE 1IZNB 5HXSA 3CKDA 4AKIA 3UFGA 2E8IA 2QYWA 2BVMA 3UU6A 2WQYA 5BR8T 3HR0A 5L47A 4JI2T 3E0ZA 1HG5A 2N9DA 2X9XA 4CI1B 1LVKA 4WBOA 5L4HA 4KMCA 1D1BA 5FP3A 2NW9A 2FJAA 5JR9C 3PJAA 4ZS2A 2NP9A 3FXEB 3PE0A 4IDPA 4PJLA 4UVCB 3JCFA 2X0YA 4HFHA 4UIGA 4UVBB 4AKRB 4X64T 3F31A 1Z8UA 4PW8A 2CEAA 5LB7B 3OBVE 3M65A 2DWKA 3IBPA 5HCMA 3AA0B 4YSZA 2CA5A 3RC8A 3LSVA 1KNZA 4QWNB 2FUPA 2KNDA 3G06A 2CWOA 3HKCE 4ZZCA 4HFEA 3PDYA 3UU8A 2XAHB 3AE9A 1HX1B 1WR6A 4HGAA 4YT0A 4O4IE 4IHJE 4HWFA 1V9DA 5M4YA 5GONE 1HNZT 3AECA 3GA8A 1D1CA 2J47A 2K5BB 4I43B 1N36T 4IDNA 1WYCA 3LK42 4COFA 3M3ZB 2IW5B 4P0AA 4GK5E 2ACZA 5L3BB 4H9NC 4BJNA 5JDFA 4I0UA 2CXDA 2KWIB 3AAIA 2X68A 4U2ZA 5FY1A 2D9DA 2OV9A 3K3OA 4WYVA 3FXDB 5FL0A 4LF8T 3CMLA 2ACXA 2DWGA 3LK2B 1N32T 2LSIA 2JQKA 5FXWA 3ZLIA 1NEKA 1WCRA 5H6RB 5LXTE 3PUZF 3E08A 2D0UA 2BS4A 2Y6XA 3CQGB 4DV6T 3AE6A 1CHUA 3FBZA 4NUUA 3K8PC 1HTJF 4QX8B 1FEWA 5ADXL 4EEBA 3GWHA 4DUZT 2DNXA 4M1PA 2BG9B 1LRZA 2OA5A 2JRKA 3KBUA 3J9X1 4OHFA 2C5JA 3LBXB 1B7TA 4O2BE 2W62A 4UV8B 3RRWA 3FZMB 2XSBA 4AQYT 3NZPA 4IL4A 5JRCA 5LMNT 3MA9A 4PK5A 1M7KA 4X1YE 3RYFE 2ZM6T 3RF1A 2H89A 2ZLYA 1FMWA 3TLSA 4JI6T 3EABA 5FNVE 4ILBA 2K9AA 2D5UA 2M6BA 4ISSA 5JDGA 2MBGA 3QUJA 1US7B 3FZFB 2LJLA 4TUYE 3ZJ1A 3LDQB 5AQNB 3IF8B 3AE7A 2BKOA 3N2GE 4ZS3A 5HWYA 2XAFB 3CX8B 4JI5T 5FVLA 5C2TA 5JR9B 3RIUC 4LF9T 4F8HA 2VVNA 2VKDA 2IDOB 2YU1A 5JREA 2QVAA 3PUSA 2IC6A 3DJBA 5AQGB 5AQLB 5C8YE 1W0BA 4K0UA 2CXFA 4EGWA 1OXZA 3Q5EA 2B1EA 3E22E 3BK9A 4PJMA 2M6IA 3O9XA 3FBLA 3ANWB 4NUVA 4U7YA 3AVRA 4X20E 5CGMA 3UQ7A 2M67A 2XQ4A 2I59A 3FHNA 3PUAA 4H63V 4EXTA 1KK7A 4A5XA 4DR2T 4NXMT 4GKKT 2PFVA 3I9YA 2A3DA 2EHOB 2BDEA 3RC3A 3RRCA 3TLVA 3VR9A 4DO0A 2X9YA 2E9XC 5J2TE 2WZIA 4ZI2C 3UUXB 4B3RT 3H3AA 2EHOD 1CUNA 2NWBA 3T8OA 3ZYLA 3RQUA 4QX7B 2I6HA 3AVSA 4ADZA 2VURA 4AI6A 2B76A 2VL8A 1SA0E 2LOPA 2YDQA 2CLYC 3N9PA 4ZI2D 4HWDA 5CA0E 4ILAA 2E9XB 2YINA 2UXDT 5AQPB 1HCIA 1WYBA 4CZZB 4DMWA 3VKGA 3GN5B 3AXJB 4YLHA 4EZHA 4OFZA 1W0AA 3AEDA 4JI0T 4F6RC 2RP4A 1D1AA 2V8SV 2XHEB 2WDRA 1YKHB 3RX6A 4X5TA 5LMUT 3AE2A 3Q5WA 1ZKEA 4PFOA 2E2AA 2CE7A 2MTQA 2SPCA 1S35A 4DBQA 5BMVE 5CA1E 2X66A 3ZC0A 4IDQA 2X51A 3ONLC 1N34T 2KT9A 1LVFA 4U33A 2A9UA 4IT4A 4YTMA 2W66A 4EV6A 4YTPA 1EZ3A 1W9RA 2XAQB 5AQVB 5JQGE 5F3JA 4HFVA 2C5KT 2A2FX 1XWMA 4IE5A 2VQET 4GYRA 4IE0A 4UV9B 4B3MT 4GYSA 1WRDA 2VB6A 3FB2A 1YKEB 1SUMB 3Q5DA 3K1SA 4L0RA 4YSYA 4FJOA 2W61A 2X67A 1J5ET 1YQ3A 2YN6A 2LM9A 4AQFA 3RKOA 3AA1B 4ISTA 4IL9A 3LJCA 4TNWA 3ANWA 4GOUA 4UR9A 3RLFF 3J7Yq 3EVYA 3P4QA 3ETVA 1YD8G 4MLKA 4WZXA 5E0OA 4ZI3C 3TLUA 1S94A 5LGNB 4HFDA 1KFYA 2XJ7A 2FJDA 2YOEA 3RIFA 3LBXA 3RYHE 3WI3A 2QRXA 5F8PA 2NW8A 3PUWF 2ZM0A 3AEEA 4KBMB 1QLBA 4P1NA 4O4JE 5LG3A 4AXPA 5JDHA 2W0GA 3N9MA 3ZMSB 2XAGB 2V7KA 4IDZA 3RH3A 3H37A 3K3NA 3C4WA 2PTFA 3P4PA 4HE8A 2JIWA 2AXDS 4IIJE 4EB6E 3AEAA 4C90A 5LHHB 1HNXT 3HKBE 5DJQC 2JQ9A 5EZYE 5LCYA 4BJMA 1HNWT 2NW7A 3CQXC 3WAJA 2BVLA 3PTRB 4U3CA 3AXJA 4HKAA 4Z91A 5DQWA 1Y64B 3HL6A 5HEUA 3NRXA 5IHYA 2C5IT 2C0SA 2UXXB 3MZKB 1G73A 2N2NA 5HEGA 3UT5E 4K0KT 5AFUL 2Q9QD 5LBQB 4LF4T 1XDOA 2XUEA 3MXZA 1ZOYA 2MYSA 3I0OA 3KFWX 4Q25A 4YJ3E 2BKNA 2LKHA 1UCUA 5JVDE 3RQWA 3C98B 1IAPA 4YJ2E 2JMHA 2Q9QB 2BS2A 1ZEEA 3P4RA 1MMGA 1WFDA 4TV9E 3UU5A 2KZ7B 4X65T 3CVRA 4JV5T 4DBRA 4L9IA 3PUGA 3CPZA 4G2AA 4HWHA 5HEJA 4A56A 2VKOA 4IE6A 3SWHA 2KWHA 3A8YC 4Z8XA 4GK0E 4HFCA 2WDQA 3PU3A 2W67A 4LMLA 2XQYA 3CX6B 5LHIB 4YXDA 5AQIB 4LFCT 5L3GB 4QXCB 2A72A 4PJJA 2PBIA 2X9HA 3F2EA 2JQQA 1G8XA 3UQ4A 4BAYB 4ERRA 5KDMC 1L0VA 3I1AA 4O4LE 1XNRT 4JYAT 2HPLA 4N78D 3AAEB 2XQ5A 3S4UA 2J1DG 1MIYA 1OEDC 3AA7B 4DV7T 2HN1A 3RIAA 5L3EB 5L3FB 4NXNT 3ONXA 2W4XA 2WM9A 4UEMA 3P7IA 2YDSA 4C91A 5J2UE 3EAMA 5LP6E 3ZYMA 3U78A 4L5GA 4QH1A 3OKQA 5AQMB 2VKJA 2UUBT 4PJNA 3ZN0B 3I0QA 3ZT7A 3ZSTA 1MIWA 3AAAB 2FJBA 1E7PA 2ZM8A 1HF8A 4DV1T 4ZXLA 4CXWA 4TWHA 3RGLA 4DV4T 3QK6A 3FZHB 3IHRA 2UUCT 4DR3T 4KHPT 4EEDA 3MKDA 3C51A 3C50A 3MACA 4HFIA 1E1HB 5HXHA 4ILUA 4QH5A 4IE7A 3UFEA 4MALA 4AIUA 3UUNA 3N9OA 5HEHA 2CXLA 2V5DA 5A1LA 4DR6T 2WMOA 3JADA 3V5SA 3ZC1A 1BR2A 4J2CA 3R84B 4AKGA 1T8BA 4O2AE 3ZMZB 5CFBA 1JNZA 3Q5XA 1QUUA 2V6YA 1HFAA 2BKPA 4XBFB 3MK7C 3ESLA 4KHZF 3HKDE 3DP7A 1IBLT 1DU2A 3N5LA 4LFAT 3MJXA 5F5WA 3UTKA 2XTLA 2IAKA 2Y48B 1HX8A 5IYZE 4YHHT 3SOLA 1NENA 2XQ9A 4CN4A 2E9XA 5LG4A 1KNPA 1T98A 2XQAA 4H9QC 1SE7A 2DI4A 2XSAA 3HI2A 1VRBA 1NWMX 3UUMA 3AE1A 2CLYB 3VHLA 5EK4A 5JTGA 3OYZA 4JLEA 3O1HA 4HTEA 2J62A 3PJAJ 3N9LA 1R8IA 3L39A 5JRCB 1M62A 5JDNA 2UXBT 3KVAA 3N2KE 3KVBA 4X1IE 2Q9QA 3CIRA 4DV2T 5CJ5A 2CBIA 2XQ6A 4CN6A 4IDOA 2XY8B 4EYYR 4HN9A 5AQFB 2BG9C 5HXCA 2LSYA 2VWAA 5HCJA 5JR9A 4JI4T 4U74A 3A7MA 4LF6T 1J5WA 2ES0A 2V5CA 2F4VT 4E7SA 5HXRA 4B3ST 2LSKA 3UUBA 2LSGA 2CM0A 5KMGP 2CPTA 3O4XE 4NIQA 3LK3B 4X62T 2LT3A 4IREA 5FMNA 2MOZA 1YXRA 1UGOA 2XPKA 3KV5A 4DR4T 4AKLA 3C4XA 2CHNA 3DTOA 4TNVA 2KINB 4DR1T 4MBQA 4DV0T 2K48A 2K24A 3KINB 1D0XA 2FBWA 2V7LA 3AE5A 2UUAT 5LA6E 3P8CD 4U7IA 3KBTA 3ZN1B 3TKLB 4A97A 2IMLA 3N2OA 4TWDA 2WCAA 1MMNA 4QXBB 3RHWA 3QOFA 4TV8E 3CX7B 4UXNB 3EHZA 4ILCA 2V6XA 1OWAA 5L3DB 1U4QA 2W63A 1OEDE 4OX9T 2D2SA 1MNDA 2BS3A 3C64A 5L3CB 4P09A 4YHJA 4AISA 4HWCA 2LOSA 5IWAT 1T72A 3FZKB 2MPKA 4EIWA 5KXJA 3NRYA 4QXHB 5KX5E 2YK0A 1U5PA 2DL1A 2IC9A 2JQHA 3BQLA 4HWIB 3D0TA 3VR8A 4ASKA 4U72A 2YDRA 4GKJT 4B6XA 2YEVC 1MMDA 3BQIA 1Y01A 3CK6A 4LMKA 2W2UA 2UXCT 4JUYA 2I0MA 1IJ5A 3GN5A 4OK0A 2KMFA 2WAUA 5FL1A 5AQKB 5AQHB 3R6NA 1H7CA 3N9QA 4WBNE 2QGSA 2G0UA 2V7MA 3PUVF 5AQOB 3B13A 1NAFA 2CBJA 3CWZB 1YW0A 3IEEA 4PAGA 2MAWA 2P9BA 2J4GA 4QHOA 2GK9A 5LBMA 3RYIE 3QB5K 3UULA 2DLRA 2FJEA 3O1JA 3OJAA 3ZYKA 1HS7A 3JC6C 1LKXA 5LNKA 1MMAA 2VL0A 1UURA 2Q9QC 3SS1A 2V1DB 3PUQA 4YTNA 5JDQA 5AQQB 1XMOT 4B3TT 2XQ8A 2RA1A 4H9SE 5AQJB 5JDMA 3ZSSA 2BBHA 2KLQA 4A98A 5HEOA 3B5MA 5HWXA 4JEHB 3AB3B 2AE9A 5IUXA 2WY2A 4WNKA 5C3JA 1IBKT 1WLXA 4FI5A 4EZ4A 2XM1A 3UU4A 2L8KA 2QA7A 1KF6A 4H63H 4UVAB 3WAKA 3AE8A 1XDPA 2NOXA 3IA3A 1OEDB 1SHZC 2BZBA 2XAJB 2HPJA 2Z6EA 3ETUA 3LG7A 4QH4A 3C4ZA 3RKGA 3ZMVB 3EUHA 2WBLA 5FXXA 3HA4A 4PFPA 4UF0B 4BA9A 3KV9A 3N9NA 2CWYA 3A5XA 1D0ZA 3AEGA 1O3XA 4I55E 4P0BA 4CQIA 1E2AA 5FY0A 3OTOT 5AQSB 3T1YT 4U31A 4JI1T 1N33T 1OEDA 1WR0A 4DV3T 4G63A 3P4WA 4I50E 1UX5A 2WP9A 2WZHA 2ZM2A 4LMJA 2LEHA 4IGUA 5CB4E 5EK2A 2VK9A 5JDLA 1XNQT 2UXNB 3L3PA 4ANJA 3B57A 3JC6D 3KDSE 2V26A 5H6QB 2WU2A 4KI0F 4ZI7E 1X9BA 2H3RA 2YU2A 1KNRA 2D0TA 4LF5T 3K3QC 4H9PC 1YQ4A 3OYXA 4XAXB 2VQFT 2WB5A 5EK3A 4YSXA 4EOZB 2N1GA 2BG9A 2JJ9A 2XQ3A 4DVDA 5JH7E 1FJGT 3ZPOA 3ZT6A 4GIWA 3JAEA 1KEYA 4DMVA 2K3WA 2X0LB 3TLWA 4XZCA 4HFBA 2CMRA 2WSSV 4TX5A 1VOMA 2WU5A 5DQVA 2WWVA 3AE4A 4KX6A 4MHCA 4DV5T 2LRKA 2ODUA 5FXZA 5ABHA 3JAFA 2VKHA 4U2YA 3PUYF 3AEFA 2L3LA 4OYJA 3U3IA 2PJQA 4ZEYA 2XASB 3Q2MA 3T1HT 1GQEA 2CHOA 3FZLB 4NPPA 5ABEA 4LFBT 3ABVA 2UU9T 2WDVA 3RYCE 5ABFB 1HR0T 2L9QA 3P50A 3OPCA 5AQTB 3RI5A 2LM2A 5FVKA 5FKYA 3SFEA 3PURA 3ZMUB 4I4TE 2XM2A 2YKSA 5L4EA 5HAXA 4DUYT 2EHOC 2VVSA 1MIVA 2LE8A 1MNEA 2WS3A 5FY7A 2E9XD 1UUSA 4JEUB 5AQRB 3L09A 5ETWA 3TLTA 3VU7H 1XMQT 4JI8T 2IHR1 3QC9A 4ZHQE 4TZ4C 3W15B 2PG8A 2E5LT 5FXVA 4DIDB 3ZT5A 3ZJ2A 4X66T 3EDVA 2DCFA 4UF0A 4KP3C 3RIUA 3ZCJA 1UK5A 2R6GF 1BR4A 5AQUB 2HHHT 4YY3T 2JPFA 1IJ6A 3I9WA 2X9WA 2V6YB 1VCSA 1FMVA 3Q9DA 4KUMB 2H88A 3NBXX 5LYJE 4JI3T 1ZP0A 4WW0A 4JI7T 3PV0F 2X0HA 1D0YA 4O4HE 2LSJA 1Z0PA 2CCQA 5FYMA 1T7SA 4X1KE 5ABGA 2RPAA 4O8SA 1W09A 4PK4A 5L2LA 3CQCB 2KSRA 2XQ7A 3AEBA 2ZMAA 3P4SA 2BBJA 5J1GA 4DR7T 3O1IA 4V1Av 3NVOA 2NR4A 3SFDA 4CI2B 4DR5T 3ONJA 4JBWF 1FIOA 3RPUA 4DNDA 3PUXF 5LGUB 2H7OA 4EAHA 4UELA 2IIUA 2IUBA 2LKGA 3F57A 5LJMA 3EDUA 3X1DA 4CN1A 2LRLA 5HYAA 1JNRA 3ZEFB 1AJ3A 2WWUA 1IBMT 3ZKRA 3VRAA 2XZEA 2DHRA 3AE3A 4MFRA 3NKZA 5DABA 4CXYA 1QSDA 2HN2A 2Y8DA 3PU8A 2LLYA 2V7JA 1BR0A 2ODVA 5LGTB 3H3MA 4AQGA 5ABFA 5HXEA 4LF7T 1ZHCA 3AA6B
chains in the Genus database with same CATH topology
2AXDS 2XY8B 2AE9A 1DU2A 1SE7A 2IDOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXD S;  2XY8 B;  2AE9 A;  1DU2 A;  1SE7 A;  2IDO B; 
#chains in the Genus database with same CATH topology
 3QB5 A;  1ZV4 X;  4PNI A;  3NWI A;  2WMN A;  4QKN A;  1VCT A;  3KV4 A;  1XZY A;  2W00 A;  1BR1 A;  3ZMT B;  4H9O C;  4TWF A;  4CI3 B;  1J1J A;  1HG2 A;  3V5U A;  4AKH A;  5TAO A;  3NZQ A;  4OYK A;  2CRB A;  3L8R A;  4IE4 A;  4Z90 A;  4TN7 B;  4ZZB A;  2OLT A;  3LFM A;  4YFS A;  4HEA A;  5LOV E;  3VKH A;  3SRZ A;  3EI0 A;  2BG9 E;  2H7V C;  2JMK A;  2NTY A;  3UU3 A;  2HH7 A;  4CXX A;  3KV6 A;  4ZI3 D;  5LJN A;  3QNU A;  4EYU A;  1I94 T;  3GMI A;  4E7Z A;  4H9R C;  2EHO A;  4ZOL E;  2LHR A;  4PK6 A;  2NTX A;  2KXP B;  2VAS A;  3OVU A;  3ZCI A;  4AQF C;  2LHN A;  5LHG B;  2V7I A;  1I6Z A;  3VRB A;  5J0Z A;  2E5V A;  3BQK A;  1UX4 A;  1X79 A;  3HKE E;  1IZN B;  5HXS A;  3CKD A;  4AKI A;  3UFG A;  2E8I A;  2QYW A;  2BVM A;  3UU6 A;  2WQY A;  5BR8 T;  3HR0 A;  5L47 A;  4JI2 T;  3E0Z A;  1HG5 A;  2N9D A;  2X9X A;  4CI1 B;  1LVK A;  4WBO A;  5L4H A;  4KMC A;  1D1B A;  5FP3 A;  2NW9 A;  2FJA A;  5JR9 C;  3PJA A;  4ZS2 A;  2NP9 A;  3FXE B;  3PE0 A;  4IDP A;  4PJL A;  4UVC B;  3JCF A;  2X0Y A;  4HFH A;  4UIG A;  4UVB B;  4AKR B;  4X64 T;  3F31 A;  1Z8U A;  4PW8 A;  2CEA A;  5LB7 B;  3OBV E;  3M65 A;  2DWK A;  3IBP A;  5HCM A;  3AA0 B;  4YSZ A;  2CA5 A;  3RC8 A;  3LSV A;  1KNZ A;  4QWN B;  2FUP A;  2KND A;  3G06 A;  2CWO A;  3HKC E;  4ZZC A;  4HFE A;  3PDY A;  3UU8 A;  2XAH B;  3AE9 A;  1HX1 B;  1WR6 A;  4HGA A;  4YT0 A;  4O4I E;  4IHJ E;  4HWF A;  1V9D A;  5M4Y A;  5GON E;  1HNZ T;  3AEC A;  3GA8 A;  1D1C A;  2J47 A;  2K5B B;  4I43 B;  1N36 T;  4IDN A;  1WYC A;  3LK4 2;  4COF A;  3M3Z B;  2IW5 B;  4P0A A;  4GK5 E;  2ACZ A;  5L3B B;  4H9N C;  4BJN A;  5JDF A;  4I0U A;  2CXD A;  2KWI B;  3AAI A;  2X68 A;  4U2Z A;  5FY1 A;  2D9D A;  2OV9 A;  3K3O A;  4WYV A;  3FXD B;  5FL0 A;  4LF8 T;  3CML A;  2ACX A;  2DWG A;  3LK2 B;  1N32 T;  2LSI A;  2JQK A;  5FXW A;  3ZLI A;  1NEK A;  1WCR A;  5H6R B;  5LXT E;  3PUZ F;  3E08 A;  2D0U A;  2BS4 A;  2Y6X A;  3CQG B;  4DV6 T;  3AE6 A;  1CHU A;  3FBZ A;  4NUU A;  3K8P C;  1HTJ F;  4QX8 B;  1FEW A;  5ADX L;  4EEB A;  3GWH A;  4DUZ T;  2DNX A;  4M1P A;  2BG9 B;  1LRZ A;  2OA5 A;  2JRK A;  3KBU A;  3J9X 1;  4OHF A;  2C5J A;  3LBX B;  1B7T A;  4O2B E;  2W62 A;  4UV8 B;  3RRW A;  3FZM B;  2XSB A;  4AQY T;  3NZP A;  4IL4 A;  5JRC A;  5LMN T;  3MA9 A;  4PK5 A;  1M7K A;  4X1Y E;  3RYF E;  2ZM6 T;  3RF1 A;  2H89 A;  2ZLY A;  1FMW A;  3TLS A;  4JI6 T;  3EAB A;  5FNV E;  4ILB A;  2K9A A;  2D5U A;  2M6B A;  4ISS A;  5JDG A;  2MBG A;  3QUJ A;  1US7 B;  3FZF B;  2LJL A;  4TUY E;  3ZJ1 A;  3LDQ B;  5AQN B;  3IF8 B;  3AE7 A;  2BKO A;  3N2G E;  4ZS3 A;  5HWY A;  2XAF B;  3CX8 B;  4JI5 T;  5FVL A;  5C2T A;  5JR9 B;  3RIU C;  4LF9 T;  4F8H A;  2VVN A;  2VKD A;  2IDO B;  2YU1 A;  5JRE A;  2QVA A;  3PUS A;  2IC6 A;  3DJB A;  5AQG B;  5AQL B;  5C8Y E;  1W0B A;  4K0U A;  2CXF A;  4EGW A;  1OXZ A;  3Q5E A;  2B1E A;  3E22 E;  3BK9 A;  4PJM A;  2M6I A;  3O9X A;  3FBL A;  3ANW B;  4NUV A;  4U7Y A;  3AVR A;  4X20 E;  5CGM A;  3UQ7 A;  2M67 A;  2XQ4 A;  2I59 A;  3FHN A;  3PUA A;  4H63 V;  4EXT A;  1KK7 A;  4A5X A;  4DR2 T;  4NXM T;  4GKK T;  2PFV A;  3I9Y A;  2A3D A;  2EHO B;  2BDE A;  3RC3 A;  3RRC A;  3TLV A;  3VR9 A;  4DO0 A;  2X9Y A;  2E9X C;  5J2T E;  2WZI A;  4ZI2 C;  3UUX B;  4B3R T;  3H3A A;  2EHO D;  1CUN A;  2NWB A;  3T8O A;  3ZYL A;  3RQU A;  4QX7 B;  2I6H A;  3AVS A;  4ADZ A;  2VUR A;  4AI6 A;  2B76 A;  2VL8 A;  1SA0 E;  2LOP A;  2YDQ A;  2CLY C;  3N9P A;  4ZI2 D;  4HWD A;  5CA0 E;  4ILA A;  2E9X B;  2YIN A;  2UXD T;  5AQP B;  1HCI A;  1WYB A;  4CZZ B;  4DMW A;  3VKG A;  3GN5 B;  3AXJ B;  4YLH A;  4EZH A;  4OFZ A;  1W0A A;  3AED A;  4JI0 T;  4F6R C;  2RP4 A;  1D1A A;  2V8S V;  2XHE B;  2WDR A;  1YKH B;  3RX6 A;  4X5T A;  5LMU T;  3AE2 A;  3Q5W A;  1ZKE A;  4PFO A;  2E2A A;  2CE7 A;  2MTQ A;  2SPC A;  1S35 A;  4DBQ A;  5BMV E;  5CA1 E;  2X66 A;  3ZC0 A;  4IDQ A;  2X51 A;  3ONL C;  1N34 T;  2KT9 A;  1LVF A;  4U33 A;  2A9U A;  4IT4 A;  4YTM A;  2W66 A;  4EV6 A;  4YTP A;  1EZ3 A;  1W9R A;  2XAQ B;  5AQV B;  5JQG E;  5F3J A;  4HFV A;  2C5K T;  2A2F X;  1XWM A;  4IE5 A;  2VQE T;  4GYR A;  4IE0 A;  4UV9 B;  4B3M T;  4GYS A;  1WRD A;  2VB6 A;  3FB2 A;  1YKE B;  1SUM B;  3Q5D A;  3K1S A;  4L0R A;  4YSY A;  4FJO A;  2W61 A;  2X67 A;  1J5E T;  1YQ3 A;  2YN6 A;  2LM9 A;  4AQF A;  3RKO A;  3AA1 B;  4IST A;  4IL9 A;  3LJC A;  4TNW A;  3ANW A;  4GOU A;  4UR9 A;  3RLF F;  3J7Y q;  3EVY A;  3P4Q A;  3ETV A;  1YD8 G;  4MLK A;  4WZX A;  5E0O A;  4ZI3 C;  3TLU A;  1S94 A;  5LGN B;  4HFD A;  1KFY A;  2XJ7 A;  2FJD A;  2YOE A;  3RIF A;  3LBX A;  3RYH E;  3WI3 A;  2QRX A;  5F8P A;  2NW8 A;  3PUW F;  2ZM0 A;  3AEE A;  4KBM B;  1QLB A;  4P1N A;  4O4J E;  5LG3 A;  4AXP A;  5JDH A;  2W0G A;  3N9M A;  3ZMS B;  2XAG B;  2V7K A;  4IDZ A;  3RH3 A;  3H37 A;  3K3N A;  3C4W A;  2PTF A;  3P4P A;  4HE8 A;  2JIW A;  2AXD S;  4IIJ E;  4EB6 E;  3AEA A;  4C90 A;  5LHH B;  1HNX T;  3HKB E;  5DJQ C;  2JQ9 A;  5EZY E;  5LCY A;  4BJM A;  1HNW T;  2NW7 A;  3CQX C;  3WAJ A;  2BVL A;  3PTR B;  4U3C A;  3AXJ A;  4HKA A;  4Z91 A;  5DQW A;  1Y64 B;  3HL6 A;  5HEU A;  3NRX A;  5IHY A;  2C5I T;  2C0S A;  2UXX B;  3MZK B;  1G73 A;  2N2N A;  5HEG A;  3UT5 E;  4K0K T;  5AFU L;  2Q9Q D;  5LBQ B;  4LF4 T;  1XDO A;  2XUE A;  3MXZ A;  1ZOY A;  2MYS A;  3I0O A;  3KFW X;  4Q25 A;  4YJ3 E;  2BKN A;  2LKH A;  1UCU A;  5JVD E;  3RQW A;  3C98 B;  1IAP A;  4YJ2 E;  2JMH A;  2Q9Q B;  2BS2 A;  1ZEE A;  3P4R A;  1MMG A;  1WFD A;  4TV9 E;  3UU5 A;  2KZ7 B;  4X65 T;  3CVR A;  4JV5 T;  4DBR A;  4L9I A;  3PUG A;  3CPZ A;  4G2A A;  4HWH A;  5HEJ A;  4A56 A;  2VKO A;  4IE6 A;  3SWH A;  2KWH A;  3A8Y C;  4Z8X A;  4GK0 E;  4HFC A;  2WDQ A;  3PU3 A;  2W67 A;  4LML A;  2XQY A;  3CX6 B;  5LHI B;  4YXD A;  5AQI B;  4LFC T;  5L3G B;  4QXC B;  2A72 A;  4PJJ A;  2PBI A;  2X9H A;  3F2E A;  2JQQ A;  1G8X A;  3UQ4 A;  4BAY B;  4ERR A;  5KDM C;  1L0V A;  3I1A A;  4O4L E;  1XNR T;  4JYA T;  2HPL A;  4N78 D;  3AAE B;  2XQ5 A;  3S4U A;  2J1D G;  1MIY A;  1OED C;  3AA7 B;  4DV7 T;  2HN1 A;  3RIA A;  5L3E B;  5L3F B;  4NXN T;  3ONX A;  2W4X A;  2WM9 A;  4UEM A;  3P7I A;  2YDS A;  4C91 A;  5J2U E;  3EAM A;  5LP6 E;  3ZYM A;  3U78 A;  4L5G A;  4QH1 A;  3OKQ A;  5AQM B;  2VKJ A;  2UUB T;  4PJN A;  3ZN0 B;  3I0Q A;  3ZT7 A;  3ZST A;  1MIW A;  3AAA B;  2FJB A;  1E7P A;  2ZM8 A;  1HF8 A;  4DV1 T;  4ZXL A;  4CXW A;  4TWH A;  3RGL A;  4DV4 T;  3QK6 A;  3FZH B;  3IHR A;  2UUC T;  4DR3 T;  4KHP T;  4EED A;  3MKD A;  3C51 A;  3C50 A;  3MAC A;  4HFI A;  1E1H B;  5HXH A;  4ILU A;  4QH5 A;  4IE7 A;  3UFE A;  4MAL A;  4AIU A;  3UUN A;  3N9O A;  5HEH A;  2CXL A;  2V5D A;  5A1L A;  4DR6 T;  2WMO A;  3JAD A;  3V5S A;  3ZC1 A;  1BR2 A;  4J2C A;  3R84 B;  4AKG A;  1T8B A;  4O2A E;  3ZMZ B;  5CFB A;  1JNZ A;  3Q5X A;  1QUU A;  2V6Y A;  1HFA A;  2BKP A;  4XBF B;  3MK7 C;  3ESL A;  4KHZ F;  3HKD E;  3DP7 A;  1IBL T;  1DU2 A;  3N5L A;  4LFA T;  3MJX A;  5F5W A;  3UTK A;  2XTL A;  2IAK A;  2Y48 B;  1HX8 A;  5IYZ E;  4YHH T;  3SOL A;  1NEN A;  2XQ9 A;  4CN4 A;  2E9X A;  5LG4 A;  1KNP A;  1T98 A;  2XQA A;  4H9Q C;  1SE7 A;  2DI4 A;  2XSA A;  3HI2 A;  1VRB A;  1NWM X;  3UUM A;  3AE1 A;  2CLY B;  3VHL A;  5EK4 A;  5JTG A;  3OYZ A;  4JLE A;  3O1H A;  4HTE A;  2J62 A;  3PJA J;  3N9L A;  1R8I A;  3L39 A;  5JRC B;  1M62 A;  5JDN A;  2UXB T;  3KVA A;  3N2K E;  3KVB A;  4X1I E;  2Q9Q A;  3CIR A;  4DV2 T;  5CJ5 A;  2CBI A;  2XQ6 A;  4CN6 A;  4IDO A;  2XY8 B;  4EYY R;  4HN9 A;  5AQF B;  2BG9 C;  5HXC A;  2LSY A;  2VWA A;  5HCJ A;  5JR9 A;  4JI4 T;  4U74 A;  3A7M A;  4LF6 T;  1J5W A;  2ES0 A;  2V5C A;  2F4V T;  4E7S A;  5HXR A;  4B3S T;  2LSK A;  3UUB A;  2LSG A;  2CM0 A;  5KMG P;  2CPT A;  3O4X E;  4NIQ A;  3LK3 B;  4X62 T;  2LT3 A;  4IRE A;  5FMN A;  2MOZ A;  1YXR A;  1UGO A;  2XPK A;  3KV5 A;  4DR4 T;  4AKL A;  3C4X A;  2CHN A;  3DTO A;  4TNV A;  2KIN B;  4DR1 T;  4MBQ A;  4DV0 T;  2K48 A;  2K24 A;  3KIN B;  1D0X A;  2FBW A;  2V7L A;  3AE5 A;  2UUA T;  5LA6 E;  3P8C D;  4U7I A;  3KBT A;  3ZN1 B;  3TKL B;  4A97 A;  2IML A;  3N2O A;  4TWD A;  2WCA A;  1MMN A;  4QXB B;  3RHW A;  3QOF A;  4TV8 E;  3CX7 B;  4UXN B;  3EHZ A;  4ILC A;  2V6X A;  1OWA A;  5L3D B;  1U4Q A;  2W63 A;  1OED E;  4OX9 T;  2D2S A;  1MND A;  2BS3 A;  3C64 A;  5L3C B;  4P09 A;  4YHJ A;  4AIS A;  4HWC A;  2LOS A;  5IWA T;  1T72 A;  3FZK B;  2MPK A;  4EIW A;  5KXJ A;  3NRY A;  4QXH B;  5KX5 E;  2YK0 A;  1U5P A;  2DL1 A;  2IC9 A;  2JQH A;  3BQL A;  4HWI B;  3D0T A;  3VR8 A;  4ASK A;  4U72 A;  2YDR A;  4GKJ T;  4B6X A;  2YEV C;  1MMD A;  3BQI A;  1Y01 A;  3CK6 A;  4LMK A;  2W2U A;  2UXC T;  4JUY A;  2I0M A;  1IJ5 A;  3GN5 A;  4OK0 A;  2KMF A;  2WAU A;  5FL1 A;  5AQK B;  5AQH B;  3R6N A;  1H7C A;  3N9Q A;  4WBN E;  2QGS A;  2G0U A;  2V7M A;  3PUV F;  5AQO B;  3B13 A;  1NAF A;  2CBJ A;  3CWZ B;  1YW0 A;  3IEE A;  4PAG A;  2MAW A;  2P9B A;  2J4G A;  4QHO A;  2GK9 A;  5LBM A;  3RYI E;  3QB5 K;  3UUL A;  2DLR A;  2FJE A;  3O1J A;  3OJA A;  3ZYK A;  1HS7 A;  3JC6 C;  1LKX A;  5LNK A;  1MMA A;  2VL0 A;  1UUR A;  2Q9Q C;  3SS1 A;  2V1D B;  3PUQ A;  4YTN A;  5JDQ A;  5AQQ B;  1XMO T;  4B3T T;  2XQ8 A;  2RA1 A;  4H9S E;  5AQJ B;  5JDM A;  3ZSS A;  2BBH A;  2KLQ A;  4A98 A;  5HEO A;  3B5M A;  5HWX A;  4JEH B;  3AB3 B;  2AE9 A;  5IUX A;  2WY2 A;  4WNK A;  5C3J A;  1IBK T;  1WLX A;  4FI5 A;  4EZ4 A;  2XM1 A;  3UU4 A;  2L8K A;  2QA7 A;  1KF6 A;  4H63 H;  4UVA B;  3WAK A;  3AE8 A;  1XDP A;  2NOX A;  3IA3 A;  1OED B;  1SHZ C;  2BZB A;  2XAJ B;  2HPJ A;  2Z6E A;  3ETU A;  3LG7 A;  4QH4 A;  3C4Z A;  3RKG A;  3ZMV B;  3EUH A;  2WBL A;  5FXX A;  3HA4 A;  4PFP A;  4UF0 B;  4BA9 A;  3KV9 A;  3N9N A;  2CWY A;  3A5X A;  1D0Z A;  3AEG A;  1O3X A;  4I55 E;  4P0B A;  4CQI A;  1E2A A;  5FY0 A;  3OTO T;  5AQS B;  3T1Y T;  4U31 A;  4JI1 T;  1N33 T;  1OED A;  1WR0 A;  4DV3 T;  4G63 A;  3P4W A;  4I50 E;  1UX5 A;  2WP9 A;  2WZH A;  2ZM2 A;  4LMJ A;  2LEH A;  4IGU A;  5CB4 E;  5EK2 A;  2VK9 A;  5JDL A;  1XNQ T;  2UXN B;  3L3P A;  4ANJ A;  3B57 A;  3JC6 D;  3KDS E;  2V26 A;  5H6Q B;  2WU2 A;  4KI0 F;  4ZI7 E;  1X9B A;  2H3R A;  2YU2 A;  1KNR A;  2D0T A;  4LF5 T;  3K3Q C;  4H9P C;  1YQ4 A;  3OYX A;  4XAX B;  2VQF T;  2WB5 A;  5EK3 A;  4YSX A;  4EOZ B;  2N1G A;  2BG9 A;  2JJ9 A;  2XQ3 A;  4DVD A;  5JH7 E;  1FJG T;  3ZPO A;  3ZT6 A;  4GIW A;  3JAE A;  1KEY A;  4DMV A;  2K3W A;  2X0L B;  3TLW A;  4XZC A;  4HFB A;  2CMR A;  2WSS V;  4TX5 A;  1VOM A;  2WU5 A;  5DQV A;  2WWV A;  3AE4 A;  4KX6 A;  4MHC A;  4DV5 T;  2LRK A;  2ODU A;  5FXZ A;  5ABH A;  3JAF A;  2VKH A;  4U2Y A;  3PUY F;  3AEF A;  2L3L A;  4OYJ A;  3U3I A;  2PJQ A;  4ZEY A;  2XAS B;  3Q2M A;  3T1H T;  1GQE A;  2CHO A;  3FZL B;  4NPP A;  5ABE A;  4LFB T;  3ABV A;  2UU9 T;  2WDV A;  3RYC E;  5ABF B;  1HR0 T;  2L9Q A;  3P50 A;  3OPC A;  5AQT B;  3RI5 A;  2LM2 A;  5FVK A;  5FKY A;  3SFE A;  3PUR A;  3ZMU B;  4I4T E;  2XM2 A;  2YKS A;  5L4E A;  5HAX A;  4DUY T;  2EHO C;  2VVS A;  1MIV A;  2LE8 A;  1MNE A;  2WS3 A;  5FY7 A;  2E9X D;  1UUS A;  4JEU B;  5AQR B;  3L09 A;  5ETW A;  3TLT A;  3VU7 H;  1XMQ T;  4JI8 T;  2IHR 1;  3QC9 A;  4ZHQ E;  4TZ4 C;  3W15 B;  2PG8 A;  2E5L T;  5FXV A;  4DID B;  3ZT5 A;  3ZJ2 A;  4X66 T;  3EDV A;  2DCF A;  4UF0 A;  4KP3 C;  3RIU A;  3ZCJ A;  1UK5 A;  2R6G F;  1BR4 A;  5AQU B;  2HHH T;  4YY3 T;  2JPF A;  1IJ6 A;  3I9W A;  2X9W A;  2V6Y B;  1VCS A;  1FMV A;  3Q9D A;  4KUM B;  2H88 A;  3NBX X;  5LYJ E;  4JI3 T;  1ZP0 A;  4WW0 A;  4JI7 T;  3PV0 F;  2X0H A;  1D0Y A;  4O4H E;  2LSJ A;  1Z0P A;  2CCQ A;  5FYM A;  1T7S A;  4X1K E;  5ABG A;  2RPA A;  4O8S A;  1W09 A;  4PK4 A;  5L2L A;  3CQC B;  2KSR A;  2XQ7 A;  3AEB A;  2ZMA A;  3P4S A;  2BBJ A;  5J1G A;  4DR7 T;  3O1I A;  4V1A v;  3NVO A;  2NR4 A;  3SFD A;  4CI2 B;  4DR5 T;  3ONJ A;  4JBW F;  1FIO A;  3RPU A;  4DND A;  3PUX F;  5LGU B;  2H7O A;  4EAH A;  4UEL A;  2IIU A;  2IUB A;  2LKG A;  3F57 A;  5LJM A;  3EDU A;  3X1D A;  4CN1 A;  2LRL A;  5HYA A;  1JNR A;  3ZEF B;  1AJ3 A;  2WWU A;  1IBM T;  3ZKR A;  3VRA A;  2XZE A;  2DHR A;  3AE3 A;  4MFR A;  3NKZ A;  5DAB A;  4CXY A;  1QSD A;  2HN2 A;  2Y8D A;  3PU8 A;  2LLY A;  2V7J A;  1BR0 A;  2ODV A;  5LGT B;  3H3M A;  4AQG A;  5ABF A;  5HXE A;  4LF7 T;  1ZHC A;  3AA6 B; 
#chains in the Genus database with same CATH homology
 2AXD S;  2XY8 B;  2AE9 A;  1DU2 A;  1SE7 A;  2IDO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...