1DU2A

Solution structure of the theta subunit of dna polymerase iii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE III
publication title NMR solution structure of the theta subunit of DNA polymerase III from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 7
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 1du2A00
2AE9A 1DU2A 2AXDS 2XY8B 1SE7A 2IDOB
chains in the Genus database with same CATH superfamily
2M6IA 3LK42 4UV9B 4DR3T 3PUAA 4AKGA 3MXZA 1YW0A 3AAIA 5JH7E 4X1KE 2K48A 2DWKA 3AE8A 2QVAA 4ZXLA 2VL8A 5LMUT 5LCYA 2JQ9A 2PTFA 1XMQT 3L09A 2EHOA 1OWAA 2CLYC 2X9WA 2DWGA 2IIUA 3RLFF 4CXYA 5FKYA 5JDNA 5AQIB 4PFPA 5L3EB 3CWZB 5LA6E 4DO0A 4ISTA 4HN9A 3JAFA 4WZXA 4ZI2D 3O1IA 4JI8T 5TAOA 2UXDT 2W2UA 3N9LA 4DR1T 1MNDA 2KSRA 3ZMZB 4CN1A 1LVKA 1NEKA 1S35A 3E0ZA 3R84B 4AKHA 3L3PA 4DBRA 3U3IA 4YTMA 4ZZBA 5AQKB 5AQPB 3JC6C 3P4RA 3LJCA 4HKAA 4TV9E 2YU2A 4H9SE 5HEJA 2WDQA 1Z8UA 2LSJA 4IIJE 2OV9A 1UUSA 2WP9A 1FMVA 3C4WA 1IAPA 2Q9QB 3MKDA 2XQAA 2XAJB 2UXBT 5JRCA 2NW8A 4MFRA 3UU4A 3CK6A 2XM1A 3HI2A 3AAAB 4CI1B 2UXCT 3AAEB 1XMOT 1UX5A 5F8PA 4ILCA 2C0SA 3UTKA 4DV0T 1T72A 4OK0A 5AQTB 4EGWA 3CQXC 3LDQB 4GK5E 4JLEA 3LBXA 1WYCA 1E7PA 3KINB 4AI6A 2BBJA 4TWDA 5HYAA 4B3MT 3FZKB 4I50E 5ADXL 2ZMAA 2QA7A 4NXMT 4QX8B 2E8IA 4UIGA 4IE6A 3UU3A 2VQET 5KXJA 1H7CA 3F57A 2XZEA 5HXCA 4O2BE 4DUYT 2CBJA 4HEAA 2WU2A 1IBKT 2J1DG 2UXNB 3UULA 4KP3C 3F2EA 4UELA 4GYSA 2WY2A 4K0UA 2X9XA 5AQHB 4DMWA 3OPCA 4LF8T 1EZ3A 3ZC1A 3JAEA 5LGTB 2FBWA 4B3ST 4DR6T 3VRBA 3ZN0B 4EIWA 3PE0A 2CMRA 3K3OA 5JR9A 3UUNA 1J1JA 2MYSA 1ZKEA 4I55E 3QB5A 4P1NA 4JUYA 2E9XB 4HFCA 4EOZB 4QHOA 4JI1T 1HX8A 1S94A 1KF6A 3DP7A 2C5JA 4IDPA 2X51A 3IA3A 2MAWA 1VCTA 2ZM2A 4LMLA 2YN6A 2H3RA 3D0TA 3RIAA 2X66A 1XNRT 3HKCE 5ABFA 4DIDB 4JYAT 2RA1A 2CXFA 3GA8A 5J0ZA 3AEEA 4ZOLE 3UUMA 4AKRB 1YKEB 4X66T 3LK3B 4U3CA 2D9DA 1W9RA 4UVCB 2ZLYA 5LHHB 3S4UA 2XSAA 4QWNB 2ODVA 4DV1T 3CX8B 4HWFA 4IE0A 1D0YA 5F3JA 5LMNT 4J2CA 3O1JA 3UUBA 3PUWF 2ACZA 3UU5A 5JQGE 4ILAA 4JI3T 4C91A 4IDNA 5CA0E 2NR4A 4TNWA 1HNXT 4EYUA 2X68A 4O4IE 4CI2B 3B13A 2XSBA 3UQ4A 5AQMB 4ILBA 2YDSA 5JDFA 4CXXA 2IHR1 4KI0F 3NRXA 3CQCB 5LHGB 2DCFA 3P7IA 4IHJE 4QX7B 4JEHB 5BR8T 4X62T 1J5WA 3HKEE 4JBWF 2EHOB 2N9DA 1HCIA 3C4ZA 2K9AA 3N2GE 3SS1A 1HS7A 4O8SA 4PJNA 3SWHA 4A56A 4LF9T 3AE5A 4AQFA 2WB5A 1N36T 1GQEA 1N33T 4UR9A 2VKDA 1MMNA 3PU3A 1I94T 1V9DA 2IC6A 1VCSA 3RHWA 1XDPA 1WFDA 4OYKA 1N32T 1G73A 4GK0E 3ZPOA 3EAMA 2H89A 2DHRA 3ONXA 2VWAA 4MBQA 3T1YT 3T8OA 5EK3A 5AQUB 2BS2A 4E7SA 4F8HA 1MIYA 2PFVA 3K8PC 4JI2T 2M6BA 2I6HA 2LHRA 3R6NA 3AA7B 3IF8B 4X1YE 3ZT7A 2W66A 4IL9A 4YT0A 2VVSA 3FZLB 2X9HA 2ACXA 2LSGA 1WRDA 3AEGA 3NKZA 2NP9A 5JDQA 4OFZA 4JV5T 1BR0A 2PG8A 3LBXB 4LFBT 4I43B 2XUEA 2F4VT 2LOSA 2JIWA 1R8IA 1KNRA 1OEDE 1HNZT 5KX5E 4OX9T 1HFAA 3ZMVB 4A5XA 1YXRA 3T1HT 3TKLB 4HWHA 4IT4A 2UXXB 4YSZA 1DU2A 4HE8A 4ZI2C 1MMAA 3QOFA 4ANJA 3I1AA 3PDYA 4LF4T 4CZZB 2J4GA 3GMIA 3HKDE 2WQYA 1E2AA 2CXDA 4ADZA 4LF5T 3NZPA 2M67A 4PK5A 5LJMA 2LOPA 4AKIA 4B3TT 3CX6B 3N2OA 2X0YA 2V7LA 4DMVA 5EK4A 3IBPA 3AEFA 4YHHT 3RI5A 4DR7T 5JR9B 1D1BA 5C2TA 4PK4A 5LBMA 1ZEEA 3KV4A 4TV8E 4O4HE 3RKOA 4YSXA 2VL0A 2E5VA 5H6RB 1WYBA 5HWYA 3FBZA 2FJDA 4CQIA 3GN5B 4TZ4C 4QXBB 3VHLA 4QH5A 3PUGA 3G06A 2HN1A 5L4EA 2JQQA 2CE7A 3MK7C 1HG5A 3Q2MA 2JQHA 4OHFA 3GWHA 3CMLA 5LG3A 5IUXA 2UUAT 1UK5A 3ZSSA 5ABFB 3L8RA 5CB4E 5DQWA 3ZT6A 2IC9A 5J2TE 4MLKA 2CHOA 4FI5A 2JRKA 5FXXA 3BQIA 3H37A 2V7JA 2V6XA 1Y01A 4I4TE 3ZJ1A 4TNVA 3Q5WA 2UU9T 2MPKA 4QKNA 4DV6T 4HFIA 5LP6E 4UF0A 3RIFA 4XBFB 4DUZT 4U2YA 2KT9A 2XPKA 1MIWA 4EEDA 3P50A 2R6GF 1XZYA 1XNQT 3N9PA 3QK6A 2XQ4A 4JI6T 3RRWA 3RYIE 3B57A 2LRLA 1HTJF 2MBGA 2BKPA 2KLQA 3RC8A 3TLSA 3P4WA 2UUBT 2LM2A 2HPJA 5FL1A 1JNZA 2AXDS 1BR2A 3UQ7A 2XY8B 4KX6A 2YU1A 1X9BA 2E2AA 4EZ4A 2BG9C 3P8CD 2V7MA 5J2UE 4UV8B 3CPZA 5H6QB 5ABHA 1CHUA 2WWVA 4G2AA 3NBXX 2LKGA 4FJOA 4HTEA 3AVSA 3ZLIA 1BR4A 2CWOA 3Q5XA 1OEDC 3ANWA 4ZI3D 3FZFB 2D2SA 5ETWA 4X5TA 4Q25A 3ZMTB 2YINA 2Y8DA 5A1LA 3EHZA 2HN2A 5L3GB 2LKHA 4MHCA 2CXLA 1XWMA 3KV9A 4ISSA 2XQ8A 2C5KT 4P0BA 1MMGA 2KMFA 2N1GA 2L8KA 2A2FX 2XTLA 3ZKRA 3KVBA 1KK7A 2E9XD 5JDHA 2WU5A 2LHNA 3CQGB 4EZHA 5JREA 3HL6A 4DV4T 3RKGA 4HWCA 4O2AE 3ONJA 3N9NA 5AQJB 5FY7A 3EABA 5HXSA 3TLTA 3M3ZB 3NVOA 1LVFA 3ZYKA 3KBUA 2W63A 4XZCA 2XAQB 1T98A 2W0GA 4HWIB 3M65A 1WCRA 2YOEA 2CLYB 5LNKA 1QUUA 5JDLA 1D0XA 5AQNB 3P4PA 1FEWA 3UFEA 3QNUA 3AVRA 1UGOA 3BQKA 4C90A 2XQ9A 4E7ZA 3AE3A 4YFSA 1I6ZA 3VU7H 5HEOA 3I9WA 4U74A 3QC9A 2HH7A 2CHNA 4TUYE 3AXJA 3Q5DA 5FVLA 4XAXB 4H63H 4KHZF 4X20E 2LT3A 4GYRA 5C8YE 2NW7A 5J1GA 4QH1A 3QB5K 3OJAA 4ASKA 4U7IA 3W15B 4DR2T 2JMHA 3SOLA 1KNZA 5JTGA 4EYYR 2GK9A 3DJBA 3UFGA 1ZOYA 5CA1E 5AFUL 5JVDE 2CRBA 4YTNA 1M62A 4NPPA 4PNIA 3Q5EA 2XM2A 4AIUA 4BJNA 3K3QC 5HXHA 3RIUC 1FMWA 3FZMB 2D0UA 2G0UA 2XAHB 2WMOA 3LK2B 1FJGT 3IHRA 3QUJA 4JI5T 3RC3A 2C5IT 5EZYE 4NIQA 3I0QA 2B76A 3K1SA 3OTOT 1QSDA 5HEGA 3UU6A 3HKBE 2DNXA 4KBMB 4F6RC 5E0OA 2CA5A 5HWXA 3EDUA 4I0UA 4JI7T 3F31A 1B7TA 4L5GA 1YQ4A 2D5UA 4UF0B 4DBQA 1IBMT 5AQSB 3RH3A 3RGLA 4HWDA 4DR5T 4B3RT 5IWAT 2IAKA 2H7VC 2ZM8A 4H9QC 2IDOB 2KWHA 2W4XA 3KBTA 1X79A 4V1Av 4AISA 4IE5A 5HAXA 2VK9A 2J47A 2V5DA 1WR6A 3OKQA 2JJ9A 3PTRB 2CM0A 4YHJA 2Y6XA 3N2KE 3JCFA 5JRCB 2VASA 4UVAB 3AA1B 2HHHT 2BS3A 3O4XE 3FXEB 2XASB 3ZYLA 1IZNB 2V7KA 2NOXA 2VKHA 4YLHA 4YY3T 2BG9E 4DNDA 2OA5A 3RPUA 4QXCB 1ZHCA 3ANWB 4O4JE 3AECA 4A98A 5CJ5A 2VQFT 5DABA 5L3BB 3ETUA 3VR9A 2WAUA 1VRBA 2KWIB 4U31A 5KMGP 3J7Yq 5AQLB 4X64T 5FXWA 4LF7T 3C4XA 4HGAA 2Q9QC 5LXTE 3AE7A 3WAJA 4PJMA 2WS3A 5LG4A 2D0TA 2MOZA 2PBIA 2OLTA 3KDSE 5FNVE 3JADA 5BMVE 3TLVA 5AQRB 5HCJA 2QYWA 5JDMA 2VB6A 3OYXA 1U5PA 3PURA 4QH4A 3C50A 2WM9A 4H9PC 4P09A 4X65T 1BR1A 4NXNT 2BG9A 2LSKA 4TWHA 3KV5A 4YSYA 4HFEA 2VKOA 4YXDA 3PUZF 2QGSA 4PK6A 2WWUA 4YTPA 3PV0F 2NW9A 2DL1A 2I59A 3OVUA 5L3DB 1OEDA 4IGUA 3PUYF 5FP3A 4DV3T 4EAHA 3ZEFB 3SRZA 5L3FB 5AQOB 2LSYA 4DVDA 1CUNA 3U78A 3OBVE 4KHPT 1D1AA 4H9RC 4GIWA 2H7OA 3AXJB 2V6YA 4ZI3C 5LGUB 2WZIA 1U4QA 4ERRA 4M1PA 5FY1A 3PUQA 3VKGA 5M4YA 2Q9QD 4IDQA 3N5LA 1NAFA 4UXNB 5AQQB 1WLXA 2XHEB 3VR8A 5LB7B 1W0AA 3J9X1 3RF1A 5FMNA 5EK2A 3MACA 2E9XC 3PJAJ 2P9BA 1IBLT 2WDRA 4ZS2A 4GKKT 2FJEA 3N9QA 5L47A 2FJAA 3CKDA 1HR0T 3C98B 4H9OC 3NWIA 4ILUA 2BKNA 3RX6A 2Z6EA 5CGMA 3VKHA 3RRCA 2X0LB 3WI3A 3RQWA 3CVRA 4CI3B 4DR4T 4L9IA 4TX5A 4NUUA 4HFHA 2NWBA 1IJ6A 4ZS3A 1UX4A 4BAYB 1LRZA 1M7KA 2BKOA 1D1CA 4G63A 2FUPA 2ODUA 2YDQA 2BS4A 3B5MA 3C64A 1T7SA 3EUHA 3ZSTA 3NRYA 3N9MA 4HFDA 3KV6A 1D0ZA 4EV6A 1WR0A 3ZCIA 2WSSV 2Y48B 4DV7T 2A9UA 2XQ3A 2XAGB 2JMKA 2CEAA 2H88A 2LRKA 1YKHB 2CPTA 1VOMA 1Z0PA 3A7MA 3TLWA 4NUVA 1NWMX 1SE7A 1KEYA 3AA0B 4DV2T 3NZQA 3N9OA 1KNPA 5CFBA 5L3CB 4HFVA 4IDOA 4MALA 4AQGA 1O3XA 4Z8XA 5L4HA 4GKJT 2B1EA 2BBHA 3CX7B 3UUXB 4COFA 2KXPB 4UEMA 3RIUA 3FZHB 3LFMA 2V26A 2EHOC 3A5XA 2L9QA 4U72A 5ABGA 3RYFE 2X9YA 3C51A 4H63V 4IE7A 3A8YC 4U7YA 3UT5E 2V1DB 1HX1B 1YD8G 4KUMB 5DJQC 2I0MA 3O9XA 4QXHB 3JC6D 3DTOA 2QRXA 2A72A 1G8XA 3I9YA 3VRAA 2ES0A 2XQ7A 1HNWT 4LMJA 2E5LT 2V8SV 2XQYA 4PJLA 2VKJA 3BQLA 4N78D 4WYVA 4WNKA 4WBNE 3P4SA 1E1HB 2XQ6A 5AQVB 1J5ET 3MZKB 3GN5A 3MA9A 3AE9A 2IMLA 5HCMA 5HXRA 4DV5T 1HF8A 3AE2A 2CBIA 4BJMA 2K5BB 4LF6T 3RYCE 5HXEA 3AEDA 3RQUA 5KDMC 1SA0E 4A97A 2W61A 1OXZA 2FJBA 2LLYA 1LKXA 5HEUA 3ETVA 3K3NA 5IHYA 2XQ5A 3TLUA 5FXZA 3CIRA 2EHOD 3MJXA 2N2NA 4U33A 1N34T 4CN6A 4WW0A 2XAFB 2BG9B 1US7B 2RPAA 4EB6E 2CWYA 5C3JA 4WBOA 3FHNA 4ZEYA 4JI0T 3E22E 2BDEA 3AB3B 5IYZE 3PU8A 4P0AA 1OEDB 1MMDA 2JPFA 2LEHA 4U2ZA 4KMCA 5LJNA 3ZN1B 3AA6B 5F5WA 2IW5B 3WAKA 2KINB 4LFCT 2WMNA 3HA4A 1W09A 1ZV4X 1FIOA 1KFYA 5FL0A 2JQKA 3AE6A 2YDRA 2YKSA 2V6YB 3FB2A 2PJQA 2Q9QA 5GONE 1XDOA 2IUBA 2AE9A 2YEVC 3ESLA 5AQGB 4AXPA 1SHZC 5JR9C 4ZHQE 3H3MA 5L2LA 4ZI7E 4X1IE 2BZBA 2J62A 2NTXA 3PUSA 3PJAA 3OYZA 5FY0A 3RYHE 5DQVA 4PW8A 2BVMA 4CN4A 4YJ2E 3P4QA 2V5CA 2W67A 4B6XA 3ZT5A 2BVLA 3IEEA 4EXTA 3EDVA 1MNEA 3Q9DA 3ZYMA 3O1HA 3ZMUB 1T8BA 4TN7B 2NTYA 5AQFB 2W00A 1AJ3A 4BA9A 3V5SA 1YQ3A 3HR0A 5LHIB 4Z90A 2WBLA 2WCAA 1IJ5A 4HFBA 3FXDB 3AE1A 3UU8A 1ZP0A 3PUVF 2DI4A 4YJ3E 3PUXF 5LOVE 4UVBB 3AEBA 1Y64B 3ZJ2A 3AE4A 2WZHA 2VURA 3KFWX 2CCQA 4Z91A 3LSVA 3SFEA 2A3DA 4H9NC 4K0KT 2ZM6T 4LMKA 3SFDA 5LYJE 4JI4T 1W0BA 2X0HA 3EI0A 3BK9A 3H3AA 2WDVA 4CXWA 2VVNA 3LG7A 1L0VA 1HG2A 4IREA 2E9XA 4IE4A 3EVYA 3I0OA 4EEBA 3V5UA 2K24A 5FXVA 1QLBA 2RP4A 3X1DA 4L0RA 3FBLA 2LJLA 5LGNB 4JEUB 1MIVA 2XJ7A 3L39A 4IDZA 3ZC0A 5FYMA 2SPCA 5FVKA 4AKLA 2V7IA 2MTQA 4PFOA 4PAGA 4ZZCA 1JNRA 2KNDA 2ZM0A 2K3WA 4TWFA 4LFAT 1UURA 1SUMB 4AQFC 3AEAA 3ZCJA 3E08A 5LBQB 4O4LE 3ABVA 4GOUA 2X67A 5JDGA 1NENA 5ABEA 2DLRA 2LE8A 4AQYT 2LSIA 5HEHA 2L3LA 1UCUA 3ZMSB 4PJJA 2HPLA 3KVAA 4OYJA 2LM9A 2YK0A 3ONLC 4IL4A 2W62A 2KZ7B 2UUCT
chains in the Genus database with same CATH topology
2AE9A 1DU2A 2AXDS 2XY8B 1SE7A 2IDOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AE9 A;  1DU2 A;  2AXD S;  2XY8 B;  1SE7 A;  2IDO B; 
#chains in the Genus database with same CATH topology
 2M6I A;  3LK4 2;  4UV9 B;  4DR3 T;  3PUA A;  4AKG A;  3MXZ A;  1YW0 A;  3AAI A;  5JH7 E;  4X1K E;  2K48 A;  2DWK A;  3AE8 A;  2QVA A;  4ZXL A;  2VL8 A;  5LMU T;  5LCY A;  2JQ9 A;  2PTF A;  1XMQ T;  3L09 A;  2EHO A;  1OWA A;  2CLY C;  2X9W A;  2DWG A;  2IIU A;  3RLF F;  4CXY A;  5FKY A;  5JDN A;  5AQI B;  4PFP A;  5L3E B;  3CWZ B;  5LA6 E;  4DO0 A;  4IST A;  4HN9 A;  3JAF A;  4WZX A;  4ZI2 D;  3O1I A;  4JI8 T;  5TAO A;  2UXD T;  2W2U A;  3N9L A;  4DR1 T;  1MND A;  2KSR A;  3ZMZ B;  4CN1 A;  1LVK A;  1NEK A;  1S35 A;  3E0Z A;  3R84 B;  4AKH A;  3L3P A;  4DBR A;  3U3I A;  4YTM A;  4ZZB A;  5AQK B;  5AQP B;  3JC6 C;  3P4R A;  3LJC A;  4HKA A;  4TV9 E;  2YU2 A;  4H9S E;  5HEJ A;  2WDQ A;  1Z8U A;  2LSJ A;  4IIJ E;  2OV9 A;  1UUS A;  2WP9 A;  1FMV A;  3C4W A;  1IAP A;  2Q9Q B;  3MKD A;  2XQA A;  2XAJ B;  2UXB T;  5JRC A;  2NW8 A;  4MFR A;  3UU4 A;  3CK6 A;  2XM1 A;  3HI2 A;  3AAA B;  4CI1 B;  2UXC T;  3AAE B;  1XMO T;  1UX5 A;  5F8P A;  4ILC A;  2C0S A;  3UTK A;  4DV0 T;  1T72 A;  4OK0 A;  5AQT B;  4EGW A;  3CQX C;  3LDQ B;  4GK5 E;  4JLE A;  3LBX A;  1WYC A;  1E7P A;  3KIN B;  4AI6 A;  2BBJ A;  4TWD A;  5HYA A;  4B3M T;  3FZK B;  4I50 E;  5ADX L;  2ZMA A;  2QA7 A;  4NXM T;  4QX8 B;  2E8I A;  4UIG A;  4IE6 A;  3UU3 A;  2VQE T;  5KXJ A;  1H7C A;  3F57 A;  2XZE A;  5HXC A;  4O2B E;  4DUY T;  2CBJ A;  4HEA A;  2WU2 A;  1IBK T;  2J1D G;  2UXN B;  3UUL A;  4KP3 C;  3F2E A;  4UEL A;  4GYS A;  2WY2 A;  4K0U A;  2X9X A;  5AQH B;  4DMW A;  3OPC A;  4LF8 T;  1EZ3 A;  3ZC1 A;  3JAE A;  5LGT B;  2FBW A;  4B3S T;  4DR6 T;  3VRB A;  3ZN0 B;  4EIW A;  3PE0 A;  2CMR A;  3K3O A;  5JR9 A;  3UUN A;  1J1J A;  2MYS A;  1ZKE A;  4I55 E;  3QB5 A;  4P1N A;  4JUY A;  2E9X B;  4HFC A;  4EOZ B;  4QHO A;  4JI1 T;  1HX8 A;  1S94 A;  1KF6 A;  3DP7 A;  2C5J A;  4IDP A;  2X51 A;  3IA3 A;  2MAW A;  1VCT A;  2ZM2 A;  4LML A;  2YN6 A;  2H3R A;  3D0T A;  3RIA A;  2X66 A;  1XNR T;  3HKC E;  5ABF A;  4DID B;  4JYA T;  2RA1 A;  2CXF A;  3GA8 A;  5J0Z A;  3AEE A;  4ZOL E;  3UUM A;  4AKR B;  1YKE B;  4X66 T;  3LK3 B;  4U3C A;  2D9D A;  1W9R A;  4UVC B;  2ZLY A;  5LHH B;  3S4U A;  2XSA A;  4QWN B;  2ODV A;  4DV1 T;  3CX8 B;  4HWF A;  4IE0 A;  1D0Y A;  5F3J A;  5LMN T;  4J2C A;  3O1J A;  3UUB A;  3PUW F;  2ACZ A;  3UU5 A;  5JQG E;  4ILA A;  4JI3 T;  4C91 A;  4IDN A;  5CA0 E;  2NR4 A;  4TNW A;  1HNX T;  4EYU A;  2X68 A;  4O4I E;  4CI2 B;  3B13 A;  2XSB A;  3UQ4 A;  5AQM B;  4ILB A;  2YDS A;  5JDF A;  4CXX A;  2IHR 1;  4KI0 F;  3NRX A;  3CQC B;  5LHG B;  2DCF A;  3P7I A;  4IHJ E;  4QX7 B;  4JEH B;  5BR8 T;  4X62 T;  1J5W A;  3HKE E;  4JBW F;  2EHO B;  2N9D A;  1HCI A;  3C4Z A;  2K9A A;  3N2G E;  3SS1 A;  1HS7 A;  4O8S A;  4PJN A;  3SWH A;  4A56 A;  4LF9 T;  3AE5 A;  4AQF A;  2WB5 A;  1N36 T;  1GQE A;  1N33 T;  4UR9 A;  2VKD A;  1MMN A;  3PU3 A;  1I94 T;  1V9D A;  2IC6 A;  1VCS A;  3RHW A;  1XDP A;  1WFD A;  4OYK A;  1N32 T;  1G73 A;  4GK0 E;  3ZPO A;  3EAM A;  2H89 A;  2DHR A;  3ONX A;  2VWA A;  4MBQ A;  3T1Y T;  3T8O A;  5EK3 A;  5AQU B;  2BS2 A;  4E7S A;  4F8H A;  1MIY A;  2PFV A;  3K8P C;  4JI2 T;  2M6B A;  2I6H A;  2LHR A;  3R6N A;  3AA7 B;  3IF8 B;  4X1Y E;  3ZT7 A;  2W66 A;  4IL9 A;  4YT0 A;  2VVS A;  3FZL B;  2X9H A;  2ACX A;  2LSG A;  1WRD A;  3AEG A;  3NKZ A;  2NP9 A;  5JDQ A;  4OFZ A;  4JV5 T;  1BR0 A;  2PG8 A;  3LBX B;  4LFB T;  4I43 B;  2XUE A;  2F4V T;  2LOS A;  2JIW A;  1R8I A;  1KNR A;  1OED E;  1HNZ T;  5KX5 E;  4OX9 T;  1HFA A;  3ZMV B;  4A5X A;  1YXR A;  3T1H T;  3TKL B;  4HWH A;  4IT4 A;  2UXX B;  4YSZ A;  1DU2 A;  4HE8 A;  4ZI2 C;  1MMA A;  3QOF A;  4ANJ A;  3I1A A;  3PDY A;  4LF4 T;  4CZZ B;  2J4G A;  3GMI A;  3HKD E;  2WQY A;  1E2A A;  2CXD A;  4ADZ A;  4LF5 T;  3NZP A;  2M67 A;  4PK5 A;  5LJM A;  2LOP A;  4AKI A;  4B3T T;  3CX6 B;  3N2O A;  2X0Y A;  2V7L A;  4DMV A;  5EK4 A;  3IBP A;  3AEF A;  4YHH T;  3RI5 A;  4DR7 T;  5JR9 B;  1D1B A;  5C2T A;  4PK4 A;  5LBM A;  1ZEE A;  3KV4 A;  4TV8 E;  4O4H E;  3RKO A;  4YSX A;  2VL0 A;  2E5V A;  5H6R B;  1WYB A;  5HWY A;  3FBZ A;  2FJD A;  4CQI A;  3GN5 B;  4TZ4 C;  4QXB B;  3VHL A;  4QH5 A;  3PUG A;  3G06 A;  2HN1 A;  5L4E A;  2JQQ A;  2CE7 A;  3MK7 C;  1HG5 A;  3Q2M A;  2JQH A;  4OHF A;  3GWH A;  3CML A;  5LG3 A;  5IUX A;  2UUA T;  1UK5 A;  3ZSS A;  5ABF B;  3L8R A;  5CB4 E;  5DQW A;  3ZT6 A;  2IC9 A;  5J2T E;  4MLK A;  2CHO A;  4FI5 A;  2JRK A;  5FXX A;  3BQI A;  3H37 A;  2V7J A;  2V6X A;  1Y01 A;  4I4T E;  3ZJ1 A;  4TNV A;  3Q5W A;  2UU9 T;  2MPK A;  4QKN A;  4DV6 T;  4HFI A;  5LP6 E;  4UF0 A;  3RIF A;  4XBF B;  4DUZ T;  4U2Y A;  2KT9 A;  2XPK A;  1MIW A;  4EED A;  3P50 A;  2R6G F;  1XZY A;  1XNQ T;  3N9P A;  3QK6 A;  2XQ4 A;  4JI6 T;  3RRW A;  3RYI E;  3B57 A;  2LRL A;  1HTJ F;  2MBG A;  2BKP A;  2KLQ A;  3RC8 A;  3TLS A;  3P4W A;  2UUB T;  2LM2 A;  2HPJ A;  5FL1 A;  1JNZ A;  2AXD S;  1BR2 A;  3UQ7 A;  2XY8 B;  4KX6 A;  2YU1 A;  1X9B A;  2E2A A;  4EZ4 A;  2BG9 C;  3P8C D;  2V7M A;  5J2U E;  4UV8 B;  3CPZ A;  5H6Q B;  5ABH A;  1CHU A;  2WWV A;  4G2A A;  3NBX X;  2LKG A;  4FJO A;  4HTE A;  3AVS A;  3ZLI A;  1BR4 A;  2CWO A;  3Q5X A;  1OED C;  3ANW A;  4ZI3 D;  3FZF B;  2D2S A;  5ETW A;  4X5T A;  4Q25 A;  3ZMT B;  2YIN A;  2Y8D A;  5A1L A;  3EHZ A;  2HN2 A;  5L3G B;  2LKH A;  4MHC A;  2CXL A;  1XWM A;  3KV9 A;  4ISS A;  2XQ8 A;  2C5K T;  4P0B A;  1MMG A;  2KMF A;  2N1G A;  2L8K A;  2A2F X;  2XTL A;  3ZKR A;  3KVB A;  1KK7 A;  2E9X D;  5JDH A;  2WU5 A;  2LHN A;  3CQG B;  4EZH A;  5JRE A;  3HL6 A;  4DV4 T;  3RKG A;  4HWC A;  4O2A E;  3ONJ A;  3N9N A;  5AQJ B;  5FY7 A;  3EAB A;  5HXS A;  3TLT A;  3M3Z B;  3NVO A;  1LVF A;  3ZYK A;  3KBU A;  2W63 A;  4XZC A;  2XAQ B;  1T98 A;  2W0G A;  4HWI B;  3M65 A;  1WCR A;  2YOE A;  2CLY B;  5LNK A;  1QUU A;  5JDL A;  1D0X A;  5AQN B;  3P4P A;  1FEW A;  3UFE A;  3QNU A;  3AVR A;  1UGO A;  3BQK A;  4C90 A;  2XQ9 A;  4E7Z A;  3AE3 A;  4YFS A;  1I6Z A;  3VU7 H;  5HEO A;  3I9W A;  4U74 A;  3QC9 A;  2HH7 A;  2CHN A;  4TUY E;  3AXJ A;  3Q5D A;  5FVL A;  4XAX B;  4H63 H;  4KHZ F;  4X20 E;  2LT3 A;  4GYR A;  5C8Y E;  2NW7 A;  5J1G A;  4QH1 A;  3QB5 K;  3OJA A;  4ASK A;  4U7I A;  3W15 B;  4DR2 T;  2JMH A;  3SOL A;  1KNZ A;  5JTG A;  4EYY R;  2GK9 A;  3DJB A;  3UFG A;  1ZOY A;  5CA1 E;  5AFU L;  5JVD E;  2CRB A;  4YTN A;  1M62 A;  4NPP A;  4PNI A;  3Q5E A;  2XM2 A;  4AIU A;  4BJN A;  3K3Q C;  5HXH A;  3RIU C;  1FMW A;  3FZM B;  2D0U A;  2G0U A;  2XAH B;  2WMO A;  3LK2 B;  1FJG T;  3IHR A;  3QUJ A;  4JI5 T;  3RC3 A;  2C5I T;  5EZY E;  4NIQ A;  3I0Q A;  2B76 A;  3K1S A;  3OTO T;  1QSD A;  5HEG A;  3UU6 A;  3HKB E;  2DNX A;  4KBM B;  4F6R C;  5E0O A;  2CA5 A;  5HWX A;  3EDU A;  4I0U A;  4JI7 T;  3F31 A;  1B7T A;  4L5G A;  1YQ4 A;  2D5U A;  4UF0 B;  4DBQ A;  1IBM T;  5AQS B;  3RH3 A;  3RGL A;  4HWD A;  4DR5 T;  4B3R T;  5IWA T;  2IAK A;  2H7V C;  2ZM8 A;  4H9Q C;  2IDO B;  2KWH A;  2W4X A;  3KBT A;  1X79 A;  4V1A v;  4AIS A;  4IE5 A;  5HAX A;  2VK9 A;  2J47 A;  2V5D A;  1WR6 A;  3OKQ A;  2JJ9 A;  3PTR B;  2CM0 A;  4YHJ A;  2Y6X A;  3N2K E;  3JCF A;  5JRC B;  2VAS A;  4UVA B;  3AA1 B;  2HHH T;  2BS3 A;  3O4X E;  3FXE B;  2XAS B;  3ZYL A;  1IZN B;  2V7K A;  2NOX A;  2VKH A;  4YLH A;  4YY3 T;  2BG9 E;  4DND A;  2OA5 A;  3RPU A;  4QXC B;  1ZHC A;  3ANW B;  4O4J E;  3AEC A;  4A98 A;  5CJ5 A;  2VQF T;  5DAB A;  5L3B B;  3ETU A;  3VR9 A;  2WAU A;  1VRB A;  2KWI B;  4U31 A;  5KMG P;  3J7Y q;  5AQL B;  4X64 T;  5FXW A;  4LF7 T;  3C4X A;  4HGA A;  2Q9Q C;  5LXT E;  3AE7 A;  3WAJ A;  4PJM A;  2WS3 A;  5LG4 A;  2D0T A;  2MOZ A;  2PBI A;  2OLT A;  3KDS E;  5FNV E;  3JAD A;  5BMV E;  3TLV A;  5AQR B;  5HCJ A;  2QYW A;  5JDM A;  2VB6 A;  3OYX A;  1U5P A;  3PUR A;  4QH4 A;  3C50 A;  2WM9 A;  4H9P C;  4P09 A;  4X65 T;  1BR1 A;  4NXN T;  2BG9 A;  2LSK A;  4TWH A;  3KV5 A;  4YSY A;  4HFE A;  2VKO A;  4YXD A;  3PUZ F;  2QGS A;  4PK6 A;  2WWU A;  4YTP A;  3PV0 F;  2NW9 A;  2DL1 A;  2I59 A;  3OVU A;  5L3D B;  1OED A;  4IGU A;  3PUY F;  5FP3 A;  4DV3 T;  4EAH A;  3ZEF B;  3SRZ A;  5L3F B;  5AQO B;  2LSY A;  4DVD A;  1CUN A;  3U78 A;  3OBV E;  4KHP T;  1D1A A;  4H9R C;  4GIW A;  2H7O A;  3AXJ B;  2V6Y A;  4ZI3 C;  5LGU B;  2WZI A;  1U4Q A;  4ERR A;  4M1P A;  5FY1 A;  3PUQ A;  3VKG A;  5M4Y A;  2Q9Q D;  4IDQ A;  3N5L A;  1NAF A;  4UXN B;  5AQQ B;  1WLX A;  2XHE B;  3VR8 A;  5LB7 B;  1W0A A;  3J9X 1;  3RF1 A;  5FMN A;  5EK2 A;  3MAC A;  2E9X C;  3PJA J;  2P9B A;  1IBL T;  2WDR A;  4ZS2 A;  4GKK T;  2FJE A;  3N9Q A;  5L47 A;  2FJA A;  3CKD A;  1HR0 T;  3C98 B;  4H9O C;  3NWI A;  4ILU A;  2BKN A;  3RX6 A;  2Z6E A;  5CGM A;  3VKH A;  3RRC A;  2X0L B;  3WI3 A;  3RQW A;  3CVR A;  4CI3 B;  4DR4 T;  4L9I A;  4TX5 A;  4NUU A;  4HFH A;  2NWB A;  1IJ6 A;  4ZS3 A;  1UX4 A;  4BAY B;  1LRZ A;  1M7K A;  2BKO A;  1D1C A;  4G63 A;  2FUP A;  2ODU A;  2YDQ A;  2BS4 A;  3B5M A;  3C64 A;  1T7S A;  3EUH A;  3ZST A;  3NRY A;  3N9M A;  4HFD A;  3KV6 A;  1D0Z A;  4EV6 A;  1WR0 A;  3ZCI A;  2WSS V;  2Y48 B;  4DV7 T;  2A9U A;  2XQ3 A;  2XAG B;  2JMK A;  2CEA A;  2H88 A;  2LRK A;  1YKH B;  2CPT A;  1VOM A;  1Z0P A;  3A7M A;  3TLW A;  4NUV A;  1NWM X;  1SE7 A;  1KEY A;  3AA0 B;  4DV2 T;  3NZQ A;  3N9O A;  1KNP A;  5CFB A;  5L3C B;  4HFV A;  4IDO A;  4MAL A;  4AQG A;  1O3X A;  4Z8X A;  5L4H A;  4GKJ T;  2B1E A;  2BBH A;  3CX7 B;  3UUX B;  4COF A;  2KXP B;  4UEM A;  3RIU A;  3FZH B;  3LFM A;  2V26 A;  2EHO C;  3A5X A;  2L9Q A;  4U72 A;  5ABG A;  3RYF E;  2X9Y A;  3C51 A;  4H63 V;  4IE7 A;  3A8Y C;  4U7Y A;  3UT5 E;  2V1D B;  1HX1 B;  1YD8 G;  4KUM B;  5DJQ C;  2I0M A;  3O9X A;  4QXH B;  3JC6 D;  3DTO A;  2QRX A;  2A72 A;  1G8X A;  3I9Y A;  3VRA A;  2ES0 A;  2XQ7 A;  1HNW T;  4LMJ A;  2E5L T;  2V8S V;  2XQY A;  4PJL A;  2VKJ A;  3BQL A;  4N78 D;  4WYV A;  4WNK A;  4WBN E;  3P4S A;  1E1H B;  2XQ6 A;  5AQV B;  1J5E T;  3MZK B;  3GN5 A;  3MA9 A;  3AE9 A;  2IML A;  5HCM A;  5HXR A;  4DV5 T;  1HF8 A;  3AE2 A;  2CBI A;  4BJM A;  2K5B B;  4LF6 T;  3RYC E;  5HXE A;  3AED A;  3RQU A;  5KDM C;  1SA0 E;  4A97 A;  2W61 A;  1OXZ A;  2FJB A;  2LLY A;  1LKX A;  5HEU A;  3ETV A;  3K3N A;  5IHY A;  2XQ5 A;  3TLU A;  5FXZ A;  3CIR A;  2EHO D;  3MJX A;  2N2N A;  4U33 A;  1N34 T;  4CN6 A;  4WW0 A;  2XAF B;  2BG9 B;  1US7 B;  2RPA A;  4EB6 E;  2CWY A;  5C3J A;  4WBO A;  3FHN A;  4ZEY A;  4JI0 T;  3E22 E;  2BDE A;  3AB3 B;  5IYZ E;  3PU8 A;  4P0A A;  1OED B;  1MMD A;  2JPF A;  2LEH A;  4U2Z A;  4KMC A;  5LJN A;  3ZN1 B;  3AA6 B;  5F5W A;  2IW5 B;  3WAK A;  2KIN B;  4LFC T;  2WMN A;  3HA4 A;  1W09 A;  1ZV4 X;  1FIO A;  1KFY A;  5FL0 A;  2JQK A;  3AE6 A;  2YDR A;  2YKS A;  2V6Y B;  3FB2 A;  2PJQ A;  2Q9Q A;  5GON E;  1XDO A;  2IUB A;  2AE9 A;  2YEV C;  3ESL A;  5AQG B;  4AXP A;  1SHZ C;  5JR9 C;  4ZHQ E;  3H3M A;  5L2L A;  4ZI7 E;  4X1I E;  2BZB A;  2J62 A;  2NTX A;  3PUS A;  3PJA A;  3OYZ A;  5FY0 A;  3RYH E;  5DQV A;  4PW8 A;  2BVM A;  4CN4 A;  4YJ2 E;  3P4Q A;  2V5C A;  2W67 A;  4B6X A;  3ZT5 A;  2BVL A;  3IEE A;  4EXT A;  3EDV A;  1MNE A;  3Q9D A;  3ZYM A;  3O1H A;  3ZMU B;  1T8B A;  4TN7 B;  2NTY A;  5AQF B;  2W00 A;  1AJ3 A;  4BA9 A;  3V5S A;  1YQ3 A;  3HR0 A;  5LHI B;  4Z90 A;  2WBL A;  2WCA A;  1IJ5 A;  4HFB A;  3FXD B;  3AE1 A;  3UU8 A;  1ZP0 A;  3PUV F;  2DI4 A;  4YJ3 E;  3PUX F;  5LOV E;  4UVB B;  3AEB A;  1Y64 B;  3ZJ2 A;  3AE4 A;  2WZH A;  2VUR A;  3KFW X;  2CCQ A;  4Z91 A;  3LSV A;  3SFE A;  2A3D A;  4H9N C;  4K0K T;  2ZM6 T;  4LMK A;  3SFD A;  5LYJ E;  4JI4 T;  1W0B A;  2X0H A;  3EI0 A;  3BK9 A;  3H3A A;  2WDV A;  4CXW A;  2VVN A;  3LG7 A;  1L0V A;  1HG2 A;  4IRE A;  2E9X A;  4IE4 A;  3EVY A;  3I0O A;  4EEB A;  3V5U A;  2K24 A;  5FXV A;  1QLB A;  2RP4 A;  3X1D A;  4L0R A;  3FBL A;  2LJL A;  5LGN B;  4JEU B;  1MIV A;  2XJ7 A;  3L39 A;  4IDZ A;  3ZC0 A;  5FYM A;  2SPC A;  5FVK A;  4AKL A;  2V7I A;  2MTQ A;  4PFO A;  4PAG A;  4ZZC A;  1JNR A;  2KND A;  2ZM0 A;  2K3W A;  4TWF A;  4LFA T;  1UUR A;  1SUM B;  4AQF C;  3AEA A;  3ZCJ A;  3E08 A;  5LBQ B;  4O4L E;  3ABV A;  4GOU A;  2X67 A;  5JDG A;  1NEN A;  5ABE A;  2DLR A;  2LE8 A;  4AQY T;  2LSI A;  5HEH A;  2L3L A;  1UCU A;  3ZMS B;  4PJJ A;  2HPL A;  3KVA A;  4OYJ A;  2LM9 A;  2YK0 A;  3ONL C;  4IL4 A;  2W62 A;  2KZ7 B;  2UUC T; 
#chains in the Genus database with same CATH homology
 2AE9 A;  1DU2 A;  2AXD S;  2XY8 B;  1SE7 A;  2IDO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...