1DU2A

Solution structure of the theta subunit of dna polymerase iii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA POLYMERASE III
publication title NMR solution structure of the theta subunit of DNA polymerase III from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
total genus 7
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 1du2A00
1DU2A 2IDOB 2AE9A 2AXDS 1SE7A 2XY8B
chains in the Genus database with same CATH superfamily
4TWDA 4NIQA 1EZ3A 2N1GA 4C90A 5LNKA 1BR0A 5LGUB 3ZMVB 2X51A 3ZCIA 3JADA 3ABVA 3F57A 3ZMZB 3IEEA 3KV9A 1KEYA 4YHJA 4HWFA 4LF9T 5IHYA 2HHHT 4NUUA 3CKDA 3AAAB 4I55E 4DBQA 3QB5K 5KDMC 1XDOA 4IIJE 3VR9A 1G8XA 2V5DA 3TLUA 3ZN0B 1I6ZA 3E22E 3LK42 1X9BA 4UF0A 4EEDA 5C3JA 4JI2T 3FZFB 4IT4A 2YKSA 3QB5A 2RPAA 5AQVB 4LF4T 4ADZA 5HEUA 3ZJ2A 2WP9A 4QHOA 4LF6T 4XZCA 3SFEA 3PE0A 3N2KE 5J2TE 2YEVC 4TNVA 1WR0A 3ZYLA 2VKOA 3N5LA 4PNIA 3SFDA 2LSYA 2P9BA 2V8SV 1KK7A 1ZP0A 2YU2A 4LFBT 3AEDA 2GK9A 5ABEA 4H9PC 3J7Yq 4TWHA 5FVLA 3E0ZA 3AA7B 4H9NC 3KINB 2X0YA 2D2SA 2JJ9A 4IL9A 4FI5A 5ABFB 5LG4A 4GK0E 4I50E 4QH4A 1UK5A 4MLKA 5JDFA 5L2LA 2W67A 2X9YA 5LOVE 5JDHA 3A7MA 5AQHB 3AE1A 5AQPB 4ILBA 1HS7A 1YQ3A 4QX7B 3N9PA 3AAIA 3ZCJA 2VKDA 4C91A 2XTLA 2BKPA 4ILUA 2LSJA 2NTXA 2I0MA 5FXXA 4AKHA 1CHUA 3G06A 5FXZA 5J2UE 1E2AA 2A2FX 4UVCB 3PUGA 3CK6A 4B3MT 3O9XA 1D0YA 2D5UA 3U3IA 1JNZA 2KINB 2R6GF 2X67A 2I59A 4QWNB 3LBXB 1LKXA 2UXDT 4DNDA 4DV0T 2IHR1 3UFGA 3C51A 4DV5T 3FB2A 1HNZT 4EEBA 2Q9QB 1YKEB 4JI6T 5FP3A 2CMRA 5HAXA 3UTKA 3PURA 2WDRA 2F4VT 4LFCT 1XNQT 1BR1A 5HCJA 3I1AA 4B3RT 5ABHA 2D0UA 5AQUB 3OTOT 5L4HA 2XAGB 2VURA 5FXVA 3RIUC 4DUZT 3PU8A 2BVMA 1MIWA 3PUVF 3ZC1A 3UQ7A 4TX5A 3M65A 4KHPT 4A5XA 3PUAA 5KX5E 2V6XA 4U7YA 4UV9B 1YQ4A 2L8KA 2KXPB 2EHOB 3Q2MA 2J1DG 2RA1A 3H3AA 4YJ2E 5LGNB 3LDQB 1XNRT 2V5CA 3MK7C 4BJMA 1IBLT 2BG9A 3OYXA 3ZT5A 1N32T 2JQ9A 2CWOA 3ZN1B 4DBRA 3UU4A 4HEAA 1QUUA 3ZMTB 2BKOA 4NUVA 5AQGB 3S4UA 4HFCA 4I0UA 2PFVA 3NZQA 3Q5DA 1UX5A 2IC9A 2PJQA 4Z91A 3EVYA 4JI3T 1E7PA 3T1HT 3TLVA 2KMFA 5LCYA 4UELA 2LLYA 1J5ET 5ABFA 2Y48B 4F8HA 2H7OA 1WLXA 3L09A 4DV7T 2BG9E 4ZS3A 3BQKA 3VHLA 4H9QC 3X1DA 2XHEB 3P50A 5L3BB 5L3EB 4HFHA 2DWKA 4ANJA 5A1LA 4DR2T 5HXHA 4YY3T 3C4ZA 2WAUA 4ZXLA 3UU6A 4YT0A 5LBMA 3I9WA 3AEAA 3RLFF 4DVDA 5FY7A 1BR2A 3RQWA 3O1JA 3ESLA 3TLWA 2E9XA 4IE7A 4WBOA 1MIVA 2X66A 3FZHB 3VKHA 4YJ3E 5LYJE 3SS1A 2XQ9A 4DMVA 3AE8A 4P09A 2KWHA 1I94T 1MNDA 4ASKA 2WS3A 4WBNE 2XPKA 3I0OA 2XQ8A 4L0RA 1OXZA 1IJ6A 2AE9A 4JV5T 3Q5XA 1W0BA 2XQ4A 2QGSA 1U5PA 2E9XD 5J1GA 2HN1A 3R6NA 2YDQA 3C4WA 5IUXA 1XMOT 4YSXA 2N9DA 3A5XA 4TNWA 2UXNB 4U74A 2LM2A 1L0VA 2KWIB 3BQLA 3FBZA 3RC8A 5HEOA 4K0KT 2EHOA 2SPCA 2VASA 1SHZC 1D0ZA 5AQOB 1KF6A 4IHJE 2H88A 1YKHB 4B3ST 3CQCB 2H7VC 3PUZF 2J62A 2UUBT 4B3TT 3RGLA 4A56A 5LA6E 2Q9QC 3H3MA 2BVLA 2WDQA 5DJQC 2LSKA 3I9YA 1ZV4X 2ZM8A 4X65T 1HG2A 2HN2A 1OEDC 2X9XA 2LEHA 2NR4A 1AJ3A 2JRKA 5BMVE 1QLBA 4YTMA 4OK0A 2XQ6A 1FMWA 4ZZBA 4EAHA 4X5TA 3HR0A 3BQIA 4IDNA 3RH3A 3RIFA 2XM1A 2CXLA 4ZI7E 2VQFT 3GWHA 3KV6A 3ZSSA 5HYAA 2XM2A 3IHRA 4AQYT 2EHOC 1H7CA 1HF8A 1ZOYA 4JI5T 4H63V 5CGMA 1VOMA 3OJAA 4WNKA 4HFIA 5AQNB 5AQQB 1T7SA 3KBUA 2C0SA 4I4TE 5EK2A 3AE6A 2YOEA 4I43B 3QC9A 3UUNA 1US7B 2QYWA 4AKRB 2DI4A 4DR7T 5FKYA 3OPCA 1HFAA 3K8PC 5LGTB 4YTPA 2XY8B 5H6RB 3P4QA 4GK5E 4JI7T 5JDGA 4X1KE 3K1SA 1WRDA 4KHZF 2W2UA 4EYUA 4EB6E 5LJMA 5LMNT 3UULA 3Q9DA 2JMKA 5HXEA 4L9IA 2ZMAA 2CLYC 3J9X1 2Y6XA 2HH7A 2BKNA 3CWZB 1U4QA 3U78A 5LP6E 1J1JA 2JQKA 3N2GE 1YXRA 2WU2A 3HI2A 2FUPA 4CI3B 1WCRA 2CE7A 3IA3A 3AXJB 3A8YC 2W63A 2VK9A 2BG9B 3GN5A 2UUCT 2WY2A 5JQGE 5HEGA 4IE6A 3ONJA 2ODVA 3D0TA 5JVDE 3NRYA 2BZBA 3L3PA 4YHHT 4AKLA 3ZC0A 2WWUA 3FZKB 3ANWB 3B5MA 4UR9A 3VRAA 1D1CA 1X79A 5ADXL 2BS2A 3TLSA 4HFBA 2CWYA 2N2NA 1WR6A 4KX6A 4X62T 3JC6D 1MMGA 4XAXB 2FJDA 4QXBB 4V1Av 3RYFE 2CXFA 1HG5A 4HN9A 2FBWA 1UURA 4F6RC 2PBIA 1HNWT 2LSGA 4ZI3C 2DWGA 4CN1A 3ONLC 3P8CD 2K48A 1HR0T 4JI8T 4JI4T 3CVRA 3TLTA 4MFRA 1HX8A 2W0GA 3RKOA 1IBMT 1IJ5A 3O1IA 3CIRA 3VKGA 4U2YA 2W66A 3E08A 4HTEA 3UUXB 3EDUA 4IGUA 1N33T 5AQSB 2XJ7A 5IWAT 4AQGA 4AKIA 1Z8UA 2E9XB 2XQ3A 3DTOA 4CXYA 4ZS2A 3R84B 5LJNA 5AQJB 2X9HA 2LJLA 4IE0A 2M67A 3PJAA 1LRZA 4TWFA 2WBLA 3VR8A 4ZEYA 5FY0A 2XQ7A 2XSBA 2JMHA 3NBXX 4LF5T 5L3GB 4AKGA 3B13A 3C98B 4UIGA 1IZNB 1KNRA 3AE2A 3HKEE 4CZZB 3BK9A 5KMGP 1GQEA 4L5GA 3SWHA 3AE3A 4LF7T 2LRKA 2CRBA 5KXJA 4X66T 3EI0A 2DLRA 1D0XA 2E2AA 4KI0F 4O4HE 5AQMB 1MMAA 2DCFA 4YTNA 4JUYA 4PJJA 5HXCA 3QK6A 4U33A 4YSZA 2UXXB 1FJGT 3ZT7A 3AXJA 4CI1B 3C4XA 4P1NA 2B1EA 2E5VA 2VKHA 2IW5B 1W09A 4U2ZA 4GKJT 4OHFA 4PK6A 5LHGB 5AQLB 2Z6EA 4E7SA 2V6YA 5FL1A 3B57A 4EOZB 3I0QA 4H9OC 3MJXA 2BS3A 2QVAA 2HPJA 3AE5A 1NWMX 3ANWA 2A3DA 2X0LB 2MBGA 4CXXA 3EAMA 2MOZA 3HKCE 4AIUA 2Y8DA 3OBVE 1V9DA 4YXDA 4U31A 5JR9A 3VRBA 4DR6T 5CJ5A 2K24A 2K5BB 4DV3T 5HEHA 4A97A 4UV8B 2ZM0A 2BBJA 3ZT6A 4O8SA 5AQTB 1BR4A 5CFBA 4K0UA 1YD8G 2IAKA 4O4IE 4O2AE 3SRZA 3GA8A 3N9OA 3RX6A 1FIOA 3PTRB 5LBQB 2BG9C 5DQWA 5JTGA 1D1AA 4OYJA 3NZPA 3ZYKA 4P0AA 3UU5A 3HL6A 4IE5A 2MYSA 3AEEA 3M3ZB 4CQIA 2UU9T 2OV9A 5L3FB 3KV4A 2XQAA 2ZM6T 4DR1T 2JQQA 2XAFB 2X0HA 4QX8B 4U7IA 5JREA 5CA0E 4ISTA 3RF1A 3FBLA 3NKZA 3RRCA 2PTFA 1XWMA 4JLEA 4MHCA 4QXCB 1D1BA 3ZYMA 5FNVE 2LHNA 2LSIA 3VU7H 5HEJA 2VL8A 3AVRA 3V5SA 5L47A 2OLTA 4JEUB 1ZKEA 5HWXA 1XMQT 5FMNA 2WMNA 3Q5WA 3LSVA 2VWAA 3FXEB 2LM9A 5CB4E 3RQUA 3DJBA 1FEWA 4EGWA 4DV1T 3Q5EA 1T72A 3RPUA 3P4RA 3ZPOA 1YW0A 4H9RC 5LHHB 2M6BA 3FXDB 1E1HB 3MZKB 2A9UA 1ZHCA 4DUYT 1QSDA 3GN5B 2E9XC 2YK0A 3AVSA 4OX9T 4EYYR 3AA0B 2JIWA 4PFPA 1T98A 3K3QC 4KP3C 3KVBA 2AXDS 4HE8A 2IIUA 5FYMA 3ETUA 3CX8B 2VL0A 3ZMUB 5HXSA 4YSYA 4J2CA 5F3JA 4BA9A 3UUBA 3K3NA 4ZI2C 4DR3T 4KMCA 1HNXT 2X9WA 3K3OA 2C5IT 3QUJA 2L9QA 5FXWA 3EDVA 2JPFA 3PUYF 1XZYA 4GIWA 5AFUL 2V7LA 3UU3A 2FJAA 2WU5A 2LT3A 1Z0PA 4JI1T 2H3RA 3FHNA 4YFSA 3MA9A 5LXTE 2ACXA 1MIYA 4WZXA 5AQKB 2PG8A 3ZEFB 1HX1B 1NEKA 3T1YT 1XDPA 3CX6B 4GYRA 4PFOA 4U3CA 5JDQA 2XAHB 2OA5A 2YU1A 2E8IA 2CPTA 4LF8T 4X20E 3EHZA 2FJBA 4HGAA 2QA7A 1N36T 4A98A 4QH5A 2LKGA 5LMUT 2NP9A 4JEHB 3JAFA 1NENA 4UVAB 3SOLA 2XZEA 4GOUA 4UVBB 2CA5A 1DU2A 1WYCA 3RC3A 1WYBA 5F8PA 3KFWX 5F5WA 3FZLB 2ZLYA 3P7IA 4HWHA 3LJCA 3UQ4A 5JDNA 4IDZA 4AI6A 4DIDB 4PK4A 3UT5E 1VCSA 3GMIA 3KVAA 3PUWF 3KV5A 2CBJA 2V1DB 5JDMA 4QXHB 3W15B 5TAOA 2NOXA 5JH7E 2XQ5A 2CCQA 4P0BA 1UGOA 3NWIA 4DV2T 4G2AA 1T8BA 3F2EA 1LVKA 2V7JA 4ISSA 4ILCA 2L3LA 1SUMB 4M1PA 2D9DA 3O1HA 3PUSA 2V6YB 5JRCB 2WDVA 2IDOB 2KSRA 1R8IA 2BBHA 1KNPA 2J47A 2LRLA 3AE4A 2A72A 4TZ4C 4EV6A 1KNZA 2G0UA 3FZMB 2C5JA 1G73A 3CQGB 3MACA 5LHIB 2NTYA 2NW7A 3O4XE 4H63H 1VCTA 4WW0A 5JR9B 4CXWA 2CEAA 4EXTA 5LB7B 3LG7A 4ZI3D 4Q25A 4OFZA 4NXNT 2HPLA 2ZM2A 1W0AA 4EZHA 3RYCE 2CXDA 2WB5A 4NPPA 2RP4A 2YDRA 3N9QA 2C5KT 4XBFB 3JC6C 5FY1A 3RIUA 2D0TA 1UX4A 4TUYE 1UCUA 2YINA 4AQFA 1SA0E 3NRXA 3T8OA 2V7IA 3HKBE 5DQVA 1S35A 3RI5A 3MKDA 4IDPA 4PK5A 3ETVA 3OKQA 2VKJA 3RKGA 2KLQA 1Y01A 2BS4A 2J4GA 3QOFA 2MTQA 4O2BE 1KFYA 4JBWF 3TKLB 3CMLA 1WFDA 3RRWA 3ZMSB 2CM0A 2LOSA 4DR5T 5FVKA 4PW8A 2WM9A 2CHOA 3PDYA 5HCMA 3P4WA 2E5LT 3RIAA 3C50A 4TV8E 5DABA 3JCFA 4IE4A 3NVOA 3PV0F 1OWAA 1ZEEA 1OEDB 3PU3A 1FMVA 4DO0A 2VVSA 4QH1A 5AQIB 5C8YE 1IAPA 3RYIE 1CUNA 4CI2B 1B7TA 3L39A 4COFA 2NW8A 4X1IE 1UUSA 2W4XA 5L4EA 2VB6A 3N9NA 4AQFC 2QRXA 3PUQA 2I6HA 2XAQB 2LE8A 3UFEA 2W00A 5AQFB 2W61A 2UXCT 4EZ4A 1Y64B 3AEBA 4U72A 3AA1B 2UUAT 5EK4A 4TN7B 2V7KA 5M4YA 5JRCA 4DV6T 4FJOA 4AISA 4HFEA 3CQXC 2IMLA 2ES0A 4H9SE 3WI3A 2ODUA 4LFAT 1M62A 3IBPA 2YN6A 3WAKA 1W9RA 3MXZA 3OYZA 1HCIA 3L8RA 2VQET 5IYZE 5CA1E 2JQHA 2XQYA 4MBQA 4KUMB 4ZHQE 4DR4T 4ERRA 3ZJ1A 3UUMA 5J0ZA 4PJNA 4NXMT 2VVNA 4IL4A 4YLHA 4HFVA 1VRBA 5EK3A 1LVFA 4QKNA 2B76A 2DNXA 5FL0A 2LHRA 2WMOA 2K3WA 4PAGA 3AAEB 1MMNA 2W62A 3AA6B 2H89A 2CLYB 1MMDA 2BDEA 3CX7B 2LOPA 3N9LA 2LKHA 3N9MA 4CN4A 1HTJF 5L3DB 2DL1A 3CPZA 1MNEA 2KT9A 4GYSA 4IDQA 3AB3B 5H6QB 5ETWA 2XASB 2CBIA 4UEMA 4B6XA 4N78D 3AE9A 4BAYB 4JYAT 3KDSE 2KNDA 4GKKT 2V26A 3LBXA 5JR9C 4HFDA 1M7KA 2CHNA 2MAWA 4UXNB 2Q9QA 2ACZA 1O3XA 3ONXA 2V7MA 4X64T 3DP7A 2WZHA 2YDSA 5E0OA 5L3CB 5GONE 1OEDA 4CN6A 4IREA 4AXPA 4EIWA 4LMKA 2WWVA 3PUXF 3H37A 4UF0B 2MPKA 4KBMB 3RYHE 2NW9A 3UU8A 1S94A 3F31A 4HWCA 5BR8T 4BJNA 2Q9QD 1N34T 5LG3A 4X1YE 4O4JE 2UXBT 3P4PA 3IF8B 3LK3B 3EABA 4HKAA 2FJEA 4JI0T 4TV9E 3RHWA 4Z8XA 3P4SA 1J5WA 3WAJA 4PJMA 4ZI2D 1OEDE 1SE7A 4HWIB 4LMJA 5EZYE 3EUHA 3QNUA 2WCAA 5AQRB 3OVUA 5JDLA 1NAFA 3ZSTA 2KZ7B 4E7ZA 3V5UA 3AE7A 5HXRA 5HWYA 4O4LE 2XAJB 3JAEA 4Z90A 1JNRA 3LFMA 2XSAA 2EHOD 4PJLA 3AEGA 3HKDE 3AECA 3KBTA 2XUEA 2X68A 1IBKT 4MALA 5ABGA 4ZZCA 2M6IA 3PJAJ 4DMWA 2K9AA 2IUBA 3AEFA 3C64A 4G63A 4IDOA 5C2TA 4ZOLE 2WQYA 4WYVA 4HWDA 2WZIA 3HA4A 4DV4T 3ZKRA 2NWBA 3LK2B 4OYKA 2IC6A 3ZLIA 3N2OA 2WSSV 4LMLA 4ILAA 2DHRA
chains in the Genus database with same CATH topology
1DU2A 2IDOB 2AE9A 2AXDS 1SE7A 2XY8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DU2 A;  2IDO B;  2AE9 A;  2AXD S;  1SE7 A;  2XY8 B; 
#chains in the Genus database with same CATH topology
 4TWD A;  4NIQ A;  1EZ3 A;  2N1G A;  4C90 A;  5LNK A;  1BR0 A;  5LGU B;  3ZMV B;  2X51 A;  3ZCI A;  3JAD A;  3ABV A;  3F57 A;  3ZMZ B;  3IEE A;  3KV9 A;  1KEY A;  4YHJ A;  4HWF A;  4LF9 T;  5IHY A;  2HHH T;  4NUU A;  3CKD A;  3AAA B;  4I55 E;  4DBQ A;  3QB5 K;  5KDM C;  1XDO A;  4IIJ E;  3VR9 A;  1G8X A;  2V5D A;  3TLU A;  3ZN0 B;  1I6Z A;  3E22 E;  3LK4 2;  1X9B A;  4UF0 A;  4EED A;  5C3J A;  4JI2 T;  3FZF B;  4IT4 A;  2YKS A;  3QB5 A;  2RPA A;  5AQV B;  4LF4 T;  4ADZ A;  5HEU A;  3ZJ2 A;  2WP9 A;  4QHO A;  4LF6 T;  4XZC A;  3SFE A;  3PE0 A;  3N2K E;  5J2T E;  2YEV C;  4TNV A;  1WR0 A;  3ZYL A;  2VKO A;  3N5L A;  4PNI A;  3SFD A;  2LSY A;  2P9B A;  2V8S V;  1KK7 A;  1ZP0 A;  2YU2 A;  4LFB T;  3AED A;  2GK9 A;  5ABE A;  4H9P C;  3J7Y q;  4TWH A;  5FVL A;  3E0Z A;  3AA7 B;  4H9N C;  3KIN B;  2X0Y A;  2D2S A;  2JJ9 A;  4IL9 A;  4FI5 A;  5ABF B;  5LG4 A;  4GK0 E;  4I50 E;  4QH4 A;  1UK5 A;  4MLK A;  5JDF A;  5L2L A;  2W67 A;  2X9Y A;  5LOV E;  5JDH A;  3A7M A;  5AQH B;  3AE1 A;  5AQP B;  4ILB A;  1HS7 A;  1YQ3 A;  4QX7 B;  3N9P A;  3AAI A;  3ZCJ A;  2VKD A;  4C91 A;  2XTL A;  2BKP A;  4ILU A;  2LSJ A;  2NTX A;  2I0M A;  5FXX A;  4AKH A;  1CHU A;  3G06 A;  5FXZ A;  5J2U E;  1E2A A;  2A2F X;  4UVC B;  3PUG A;  3CK6 A;  4B3M T;  3O9X A;  1D0Y A;  2D5U A;  3U3I A;  1JNZ A;  2KIN B;  2R6G F;  2X67 A;  2I59 A;  4QWN B;  3LBX B;  1LKX A;  2UXD T;  4DND A;  4DV0 T;  2IHR 1;  3UFG A;  3C51 A;  4DV5 T;  3FB2 A;  1HNZ T;  4EEB A;  2Q9Q B;  1YKE B;  4JI6 T;  5FP3 A;  2CMR A;  5HAX A;  3UTK A;  3PUR A;  2WDR A;  2F4V T;  4LFC T;  1XNQ T;  1BR1 A;  5HCJ A;  3I1A A;  4B3R T;  5ABH A;  2D0U A;  5AQU B;  3OTO T;  5L4H A;  2XAG B;  2VUR A;  5FXV A;  3RIU C;  4DUZ T;  3PU8 A;  2BVM A;  1MIW A;  3PUV F;  3ZC1 A;  3UQ7 A;  4TX5 A;  3M65 A;  4KHP T;  4A5X A;  3PUA A;  5KX5 E;  2V6X A;  4U7Y A;  4UV9 B;  1YQ4 A;  2L8K A;  2KXP B;  2EHO B;  3Q2M A;  2J1D G;  2RA1 A;  3H3A A;  4YJ2 E;  5LGN B;  3LDQ B;  1XNR T;  2V5C A;  3MK7 C;  4BJM A;  1IBL T;  2BG9 A;  3OYX A;  3ZT5 A;  1N32 T;  2JQ9 A;  2CWO A;  3ZN1 B;  4DBR A;  3UU4 A;  4HEA A;  1QUU A;  3ZMT B;  2BKO A;  4NUV A;  5AQG B;  3S4U A;  4HFC A;  4I0U A;  2PFV A;  3NZQ A;  3Q5D A;  1UX5 A;  2IC9 A;  2PJQ A;  4Z91 A;  3EVY A;  4JI3 T;  1E7P A;  3T1H T;  3TLV A;  2KMF A;  5LCY A;  4UEL A;  2LLY A;  1J5E T;  5ABF A;  2Y48 B;  4F8H A;  2H7O A;  1WLX A;  3L09 A;  4DV7 T;  2BG9 E;  4ZS3 A;  3BQK A;  3VHL A;  4H9Q C;  3X1D A;  2XHE B;  3P50 A;  5L3B B;  5L3E B;  4HFH A;  2DWK A;  4ANJ A;  5A1L A;  4DR2 T;  5HXH A;  4YY3 T;  3C4Z A;  2WAU A;  4ZXL A;  3UU6 A;  4YT0 A;  5LBM A;  3I9W A;  3AEA A;  3RLF F;  4DVD A;  5FY7 A;  1BR2 A;  3RQW A;  3O1J A;  3ESL A;  3TLW A;  2E9X A;  4IE7 A;  4WBO A;  1MIV A;  2X66 A;  3FZH B;  3VKH A;  4YJ3 E;  5LYJ E;  3SS1 A;  2XQ9 A;  4DMV A;  3AE8 A;  4P09 A;  2KWH A;  1I94 T;  1MND A;  4ASK A;  2WS3 A;  4WBN E;  2XPK A;  3I0O A;  2XQ8 A;  4L0R A;  1OXZ A;  1IJ6 A;  2AE9 A;  4JV5 T;  3Q5X A;  1W0B A;  2XQ4 A;  2QGS A;  1U5P A;  2E9X D;  5J1G A;  2HN1 A;  3R6N A;  2YDQ A;  3C4W A;  5IUX A;  1XMO T;  4YSX A;  2N9D A;  3A5X A;  4TNW A;  2UXN B;  4U74 A;  2LM2 A;  1L0V A;  2KWI B;  3BQL A;  3FBZ A;  3RC8 A;  5HEO A;  4K0K T;  2EHO A;  2SPC A;  2VAS A;  1SHZ C;  1D0Z A;  5AQO B;  1KF6 A;  4IHJ E;  2H88 A;  1YKH B;  4B3S T;  3CQC B;  2H7V C;  3PUZ F;  2J62 A;  2UUB T;  4B3T T;  3RGL A;  4A56 A;  5LA6 E;  2Q9Q C;  3H3M A;  2BVL A;  2WDQ A;  5DJQ C;  2LSK A;  3I9Y A;  1ZV4 X;  2ZM8 A;  4X65 T;  1HG2 A;  2HN2 A;  1OED C;  2X9X A;  2LEH A;  2NR4 A;  1AJ3 A;  2JRK A;  5BMV E;  1QLB A;  4YTM A;  4OK0 A;  2XQ6 A;  1FMW A;  4ZZB A;  4EAH A;  4X5T A;  3HR0 A;  3BQI A;  4IDN A;  3RH3 A;  3RIF A;  2XM1 A;  2CXL A;  4ZI7 E;  2VQF T;  3GWH A;  3KV6 A;  3ZSS A;  5HYA A;  2XM2 A;  3IHR A;  4AQY T;  2EHO C;  1H7C A;  1HF8 A;  1ZOY A;  4JI5 T;  4H63 V;  5CGM A;  1VOM A;  3OJA A;  4WNK A;  4HFI A;  5AQN B;  5AQQ B;  1T7S A;  3KBU A;  2C0S A;  4I4T E;  5EK2 A;  3AE6 A;  2YOE A;  4I43 B;  3QC9 A;  3UUN A;  1US7 B;  2QYW A;  4AKR B;  2DI4 A;  4DR7 T;  5FKY A;  3OPC A;  1HFA A;  3K8P C;  5LGT B;  4YTP A;  2XY8 B;  5H6R B;  3P4Q A;  4GK5 E;  4JI7 T;  5JDG A;  4X1K E;  3K1S A;  1WRD A;  4KHZ F;  2W2U A;  4EYU A;  4EB6 E;  5LJM A;  5LMN T;  3UUL A;  3Q9D A;  2JMK A;  5HXE A;  4L9I A;  2ZMA A;  2CLY C;  3J9X 1;  2Y6X A;  2HH7 A;  2BKN A;  3CWZ B;  1U4Q A;  3U78 A;  5LP6 E;  1J1J A;  2JQK A;  3N2G E;  1YXR A;  2WU2 A;  3HI2 A;  2FUP A;  4CI3 B;  1WCR A;  2CE7 A;  3IA3 A;  3AXJ B;  3A8Y C;  2W63 A;  2VK9 A;  2BG9 B;  3GN5 A;  2UUC T;  2WY2 A;  5JQG E;  5HEG A;  4IE6 A;  3ONJ A;  2ODV A;  3D0T A;  5JVD E;  3NRY A;  2BZB A;  3L3P A;  4YHH T;  4AKL A;  3ZC0 A;  2WWU A;  3FZK B;  3ANW B;  3B5M A;  4UR9 A;  3VRA A;  1D1C A;  1X79 A;  5ADX L;  2BS2 A;  3TLS A;  4HFB A;  2CWY A;  2N2N A;  1WR6 A;  4KX6 A;  4X62 T;  3JC6 D;  1MMG A;  4XAX B;  2FJD A;  4QXB B;  4V1A v;  3RYF E;  2CXF A;  1HG5 A;  4HN9 A;  2FBW A;  1UUR A;  4F6R C;  2PBI A;  1HNW T;  2LSG A;  4ZI3 C;  2DWG A;  4CN1 A;  3ONL C;  3P8C D;  2K48 A;  1HR0 T;  4JI8 T;  4JI4 T;  3CVR A;  3TLT A;  4MFR A;  1HX8 A;  2W0G A;  3RKO A;  1IBM T;  1IJ5 A;  3O1I A;  3CIR A;  3VKG A;  4U2Y A;  2W66 A;  3E08 A;  4HTE A;  3UUX B;  3EDU A;  4IGU A;  1N33 T;  5AQS B;  2XJ7 A;  5IWA T;  4AQG A;  4AKI A;  1Z8U A;  2E9X B;  2XQ3 A;  3DTO A;  4CXY A;  4ZS2 A;  3R84 B;  5LJN A;  5AQJ B;  2X9H A;  2LJL A;  4IE0 A;  2M67 A;  3PJA A;  1LRZ A;  4TWF A;  2WBL A;  3VR8 A;  4ZEY A;  5FY0 A;  2XQ7 A;  2XSB A;  2JMH A;  3NBX X;  4LF5 T;  5L3G B;  4AKG A;  3B13 A;  3C98 B;  4UIG A;  1IZN B;  1KNR A;  3AE2 A;  3HKE E;  4CZZ B;  3BK9 A;  5KMG P;  1GQE A;  4L5G A;  3SWH A;  3AE3 A;  4LF7 T;  2LRK A;  2CRB A;  5KXJ A;  4X66 T;  3EI0 A;  2DLR A;  1D0X A;  2E2A A;  4KI0 F;  4O4H E;  5AQM B;  1MMA A;  2DCF A;  4YTN A;  4JUY A;  4PJJ A;  5HXC A;  3QK6 A;  4U33 A;  4YSZ A;  2UXX B;  1FJG T;  3ZT7 A;  3AXJ A;  4CI1 B;  3C4X A;  4P1N A;  2B1E A;  2E5V A;  2VKH A;  2IW5 B;  1W09 A;  4U2Z A;  4GKJ T;  4OHF A;  4PK6 A;  5LHG B;  5AQL B;  2Z6E A;  4E7S A;  2V6Y A;  5FL1 A;  3B57 A;  4EOZ B;  3I0Q A;  4H9O C;  3MJX A;  2BS3 A;  2QVA A;  2HPJ A;  3AE5 A;  1NWM X;  3ANW A;  2A3D A;  2X0L B;  2MBG A;  4CXX A;  3EAM A;  2MOZ A;  3HKC E;  4AIU A;  2Y8D A;  3OBV E;  1V9D A;  4YXD A;  4U31 A;  5JR9 A;  3VRB A;  4DR6 T;  5CJ5 A;  2K24 A;  2K5B B;  4DV3 T;  5HEH A;  4A97 A;  4UV8 B;  2ZM0 A;  2BBJ A;  3ZT6 A;  4O8S A;  5AQT B;  1BR4 A;  5CFB A;  4K0U A;  1YD8 G;  2IAK A;  4O4I E;  4O2A E;  3SRZ A;  3GA8 A;  3N9O A;  3RX6 A;  1FIO A;  3PTR B;  5LBQ B;  2BG9 C;  5DQW A;  5JTG A;  1D1A A;  4OYJ A;  3NZP A;  3ZYK A;  4P0A A;  3UU5 A;  3HL6 A;  4IE5 A;  2MYS A;  3AEE A;  3M3Z B;  4CQI A;  2UU9 T;  2OV9 A;  5L3F B;  3KV4 A;  2XQA A;  2ZM6 T;  4DR1 T;  2JQQ A;  2XAF B;  2X0H A;  4QX8 B;  4U7I A;  5JRE A;  5CA0 E;  4IST A;  3RF1 A;  3FBL A;  3NKZ A;  3RRC A;  2PTF A;  1XWM A;  4JLE A;  4MHC A;  4QXC B;  1D1B A;  3ZYM A;  5FNV E;  2LHN A;  2LSI A;  3VU7 H;  5HEJ A;  2VL8 A;  3AVR A;  3V5S A;  5L47 A;  2OLT A;  4JEU B;  1ZKE A;  5HWX A;  1XMQ T;  5FMN A;  2WMN A;  3Q5W A;  3LSV A;  2VWA A;  3FXE B;  2LM9 A;  5CB4 E;  3RQU A;  3DJB A;  1FEW A;  4EGW A;  4DV1 T;  3Q5E A;  1T72 A;  3RPU A;  3P4R A;  3ZPO A;  1YW0 A;  4H9R C;  5LHH B;  2M6B A;  3FXD B;  1E1H B;  3MZK B;  2A9U A;  1ZHC A;  4DUY T;  1QSD A;  3GN5 B;  2E9X C;  2YK0 A;  3AVS A;  4OX9 T;  4EYY R;  3AA0 B;  2JIW A;  4PFP A;  1T98 A;  3K3Q C;  4KP3 C;  3KVB A;  2AXD S;  4HE8 A;  2IIU A;  5FYM A;  3ETU A;  3CX8 B;  2VL0 A;  3ZMU B;  5HXS A;  4YSY A;  4J2C A;  5F3J A;  4BA9 A;  3UUB A;  3K3N A;  4ZI2 C;  4DR3 T;  4KMC A;  1HNX T;  2X9W A;  3K3O A;  2C5I T;  3QUJ A;  2L9Q A;  5FXW A;  3EDV A;  2JPF A;  3PUY F;  1XZY A;  4GIW A;  5AFU L;  2V7L A;  3UU3 A;  2FJA A;  2WU5 A;  2LT3 A;  1Z0P A;  4JI1 T;  2H3R A;  3FHN A;  4YFS A;  3MA9 A;  5LXT E;  2ACX A;  1MIY A;  4WZX A;  5AQK B;  2PG8 A;  3ZEF B;  1HX1 B;  1NEK A;  3T1Y T;  1XDP A;  3CX6 B;  4GYR A;  4PFO A;  4U3C A;  5JDQ A;  2XAH B;  2OA5 A;  2YU1 A;  2E8I A;  2CPT A;  4LF8 T;  4X20 E;  3EHZ A;  2FJB A;  4HGA A;  2QA7 A;  1N36 T;  4A98 A;  4QH5 A;  2LKG A;  5LMU T;  2NP9 A;  4JEH B;  3JAF A;  1NEN A;  4UVA B;  3SOL A;  2XZE A;  4GOU A;  4UVB B;  2CA5 A;  1DU2 A;  1WYC A;  3RC3 A;  1WYB A;  5F8P A;  3KFW X;  5F5W A;  3FZL B;  2ZLY A;  3P7I A;  4HWH A;  3LJC A;  3UQ4 A;  5JDN A;  4IDZ A;  4AI6 A;  4DID B;  4PK4 A;  3UT5 E;  1VCS A;  3GMI A;  3KVA A;  3PUW F;  3KV5 A;  2CBJ A;  2V1D B;  5JDM A;  4QXH B;  3W15 B;  5TAO A;  2NOX A;  5JH7 E;  2XQ5 A;  2CCQ A;  4P0B A;  1UGO A;  3NWI A;  4DV2 T;  4G2A A;  1T8B A;  3F2E A;  1LVK A;  2V7J A;  4ISS A;  4ILC A;  2L3L A;  1SUM B;  4M1P A;  2D9D A;  3O1H A;  3PUS A;  2V6Y B;  5JRC B;  2WDV A;  2IDO B;  2KSR A;  1R8I A;  2BBH A;  1KNP A;  2J47 A;  2LRL A;  3AE4 A;  2A72 A;  4TZ4 C;  4EV6 A;  1KNZ A;  2G0U A;  3FZM B;  2C5J A;  1G73 A;  3CQG B;  3MAC A;  5LHI B;  2NTY A;  2NW7 A;  3O4X E;  4H63 H;  1VCT A;  4WW0 A;  5JR9 B;  4CXW A;  2CEA A;  4EXT A;  5LB7 B;  3LG7 A;  4ZI3 D;  4Q25 A;  4OFZ A;  4NXN T;  2HPL A;  2ZM2 A;  1W0A A;  4EZH A;  3RYC E;  2CXD A;  2WB5 A;  4NPP A;  2RP4 A;  2YDR A;  3N9Q A;  2C5K T;  4XBF B;  3JC6 C;  5FY1 A;  3RIU A;  2D0T A;  1UX4 A;  4TUY E;  1UCU A;  2YIN A;  4AQF A;  1SA0 E;  3NRX A;  3T8O A;  2V7I A;  3HKB E;  5DQV A;  1S35 A;  3RI5 A;  3MKD A;  4IDP A;  4PK5 A;  3ETV A;  3OKQ A;  2VKJ A;  3RKG A;  2KLQ A;  1Y01 A;  2BS4 A;  2J4G A;  3QOF A;  2MTQ A;  4O2B E;  1KFY A;  4JBW F;  3TKL B;  3CML A;  1WFD A;  3RRW A;  3ZMS B;  2CM0 A;  2LOS A;  4DR5 T;  5FVK A;  4PW8 A;  2WM9 A;  2CHO A;  3PDY A;  5HCM A;  3P4W A;  2E5L T;  3RIA A;  3C50 A;  4TV8 E;  5DAB A;  3JCF A;  4IE4 A;  3NVO A;  3PV0 F;  1OWA A;  1ZEE A;  1OED B;  3PU3 A;  1FMV A;  4DO0 A;  2VVS A;  4QH1 A;  5AQI B;  5C8Y E;  1IAP A;  3RYI E;  1CUN A;  4CI2 B;  1B7T A;  3L39 A;  4COF A;  2NW8 A;  4X1I E;  1UUS A;  2W4X A;  5L4E A;  2VB6 A;  3N9N A;  4AQF C;  2QRX A;  3PUQ A;  2I6H A;  2XAQ B;  2LE8 A;  3UFE A;  2W00 A;  5AQF B;  2W61 A;  2UXC T;  4EZ4 A;  1Y64 B;  3AEB A;  4U72 A;  3AA1 B;  2UUA T;  5EK4 A;  4TN7 B;  2V7K A;  5M4Y A;  5JRC A;  4DV6 T;  4FJO A;  4AIS A;  4HFE A;  3CQX C;  2IML A;  2ES0 A;  4H9S E;  3WI3 A;  2ODU A;  4LFA T;  1M62 A;  3IBP A;  2YN6 A;  3WAK A;  1W9R A;  3MXZ A;  3OYZ A;  1HCI A;  3L8R A;  2VQE T;  5IYZ E;  5CA1 E;  2JQH A;  2XQY A;  4MBQ A;  4KUM B;  4ZHQ E;  4DR4 T;  4ERR A;  3ZJ1 A;  3UUM A;  5J0Z A;  4PJN A;  4NXM T;  2VVN A;  4IL4 A;  4YLH A;  4HFV A;  1VRB A;  5EK3 A;  1LVF A;  4QKN A;  2B76 A;  2DNX A;  5FL0 A;  2LHR A;  2WMO A;  2K3W A;  4PAG A;  3AAE B;  1MMN A;  2W62 A;  3AA6 B;  2H89 A;  2CLY B;  1MMD A;  2BDE A;  3CX7 B;  2LOP A;  3N9L A;  2LKH A;  3N9M A;  4CN4 A;  1HTJ F;  5L3D B;  2DL1 A;  3CPZ A;  1MNE A;  2KT9 A;  4GYS A;  4IDQ A;  3AB3 B;  5H6Q B;  5ETW A;  2XAS B;  2CBI A;  4UEM A;  4B6X A;  4N78 D;  3AE9 A;  4BAY B;  4JYA T;  3KDS E;  2KND A;  4GKK T;  2V26 A;  3LBX A;  5JR9 C;  4HFD A;  1M7K A;  2CHN A;  2MAW A;  4UXN B;  2Q9Q A;  2ACZ A;  1O3X A;  3ONX A;  2V7M A;  4X64 T;  3DP7 A;  2WZH A;  2YDS A;  5E0O A;  5L3C B;  5GON E;  1OED A;  4CN6 A;  4IRE A;  4AXP A;  4EIW A;  4LMK A;  2WWV A;  3PUX F;  3H37 A;  4UF0 B;  2MPK A;  4KBM B;  3RYH E;  2NW9 A;  3UU8 A;  1S94 A;  3F31 A;  4HWC A;  5BR8 T;  4BJN A;  2Q9Q D;  1N34 T;  5LG3 A;  4X1Y E;  4O4J E;  2UXB T;  3P4P A;  3IF8 B;  3LK3 B;  3EAB A;  4HKA A;  2FJE A;  4JI0 T;  4TV9 E;  3RHW A;  4Z8X A;  3P4S A;  1J5W A;  3WAJ A;  4PJM A;  4ZI2 D;  1OED E;  1SE7 A;  4HWI B;  4LMJ A;  5EZY E;  3EUH A;  3QNU A;  2WCA A;  5AQR B;  3OVU A;  5JDL A;  1NAF A;  3ZST A;  2KZ7 B;  4E7Z A;  3V5U A;  3AE7 A;  5HXR A;  5HWY A;  4O4L E;  2XAJ B;  3JAE A;  4Z90 A;  1JNR A;  3LFM A;  2XSA A;  2EHO D;  4PJL A;  3AEG A;  3HKD E;  3AEC A;  3KBT A;  2XUE A;  2X68 A;  1IBK T;  4MAL A;  5ABG A;  4ZZC A;  2M6I A;  3PJA J;  4DMW A;  2K9A A;  2IUB A;  3AEF A;  3C64 A;  4G63 A;  4IDO A;  5C2T A;  4ZOL E;  2WQY A;  4WYV A;  4HWD A;  2WZI A;  3HA4 A;  4DV4 T;  3ZKR A;  2NWB A;  3LK2 B;  4OYK A;  2IC6 A;  3ZLI A;  3N2O A;  2WSS V;  4LML A;  4ILA A;  2DHR A; 
#chains in the Genus database with same CATH homology
 1DU2 A;  2IDO B;  2AE9 A;  2AXD S;  1SE7 A;  2XY8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...