2E5LT

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2e5lT00
2UUAT 1N34T 1N36T 2UU9T 5BR8T 4DUYT 1J5ET 4JI7T 4GKJT 4YHHT 2UUBT 4LF5T 4LFCT 1I94T 2UXDT 1XMQT 4DV2T 4JI3T 4LF4T 5IWAT 4DV1T 1FJGT 2VQET 1XNQT 4DR3T 4B3MT 4JI1T 4JV5T 5LMNT 4YY3T 2UXCT 4B3TT 4JI2T 1N32T 4DR4T 4DR5T 3T1YT 4DUZT 4DV4T 4AQYT 4LF8T 1HNZT 4DV5T 2HHHT 4JI4T 2F4VT 4JYAT 4JI5T 4DV3T 4X64T 1XNRT 4K0KT 4DV7T 4X62T 4NXMT 1HNXT 2UUCT 2E5LT 4KHPT 4X65T 4OX9T 4B3ST 1IBLT 1XMOT 4DV6T 4DR6T 4DR1T 4DR7T 4LF7T 4LFAT 4B3RT 4LF6T 1IBMT 2VQFT 4LF9T 4LFBT 4DR2T 4NXNT 1IBKT 1HNWT 3T1HT 5LMUT 4DV0T 4JI8T 4JI0T 4GKKT 4X66T 2ZM6T 2UXBT 1N33T 1HR0T 4JI6T 3OTOT
chains in the Genus database with same CATH superfamily
3HA4A 3R6NA 4PNIA 3RGLA 2PG8A 1JNZA 4X1IE 4H9OC 2UUBT 3RIUC 3KINB 3ZMZB 1YKHB 2XPKA 4CN1A 2L8KA 2XHEB 2VQET 3MA9A 5L2LA 4B3TT 4IL9A 4WYVA 3NRYA 4UELA 5LB7B 3T1YT 1NEKA 1MMGA 2RP4A 5HCMA 2W62A 2IC6A 4QX8B 1SUMB 1Y64B 3NZPA 2E9XA 3RI5A 4AKIA 5HCJA 3MZKB 1T98A 4YFSA 5AQFB 2BG9A 1HX8A 3TLWA 3AE2A 5ABGA 5LG4A 2XAFB 5LHHB 3EDUA 5JRCB 3K3OA 4LF7T 4Z90A 2KWIB 2QVAA 3JCFA 5KDMC 5FL0A 3LJCA 2WP9A 4HGAA 4JI8T 2LM2A 3GA8A 4GKKT 2DWGA 4QX7B 4IL4A 4IE7A 5FMNA 3E0ZA 5HEHA 2IAKA 3AA6B 2N9DA 4PK5A 1DU2A 1KK7A 4AKLA 4EGWA 2KZ7B 5FVKA 4H9SE 2HPJA 2Q9QD 3AE5A 1I94T 2XQYA 3N9NA 2IUBA 4DIDB 1M62A 2E9XB 2ZMAA 4KBMB 5HEJA 2VKJA 1FMVA 2VKOA 5LGNB 2VWAA 2XQ4A 3UUBA 3HL6A 3LK3B 4K0UA 4AQYT 1UX5A 4QXHB 4IDQA 5TAOA 1US7B 4UR9A 1AJ3A 2K24A 4EYYR 2LHRA 2XSAA 2A2FX 4UVCB 4E7SA 2CWOA 3PJAJ 3SFDA 4CI2B 4L0RA 2GK9A 4A5XA 5AQLB 4LMKA 2IMLA 3TKLB 1ZOYA 2JJ9A 3DTOA 2VQFT 4QXBB 4YXDA 5EK3A 2H7OA 4IHJE 1UGOA 3ZMSB 4CN4A 5ADXL 4F8HA 5AQUB 4X66T 2XJ7A 4P1NA 1YQ3A 1LRZA 2CHNA 3RC3A 1KNPA 4L9IA 1N33T 4OFZA 3QUJA 3ZYMA 1D0YA 2XQ6A 1IJ6A 2YU2A 2JIWA 4JEHB 2LRKA 3KV5A 2EHOA 4AQFC 2X0HA 1M7KA 2PFVA 2XY8B 3RLFF 3AA1B 3OBVE 4ZI3D 3G06A 4UVBB 4EOZB 5AFUL 4JBWF 2BBJA 5ABFA 3P8CD 1D1CA 1Y01A 5M4YA 2X9WA 5AQNB 4QKNA 3ZSTA 3AB3B 2JRKA 5LP6E 3RC8A 3Q5WA 2SPCA 1ZEEA 3UTKA 4YT0A 1Z8UA 2YU1A 2X66A 2XQ8A 3C98B 2LSJA 2BKOA 3AEGA 3PUXF 1QLBA 4M1PA 1IBMT 2YDSA 4HE8A 5JDNA 5EK4A 2ZLYA 4O4IE 3OVUA 4PFPA 2C5IT 4O2AE 1D0XA 4AKHA 3PU3A 2EHOB 5JDMA 3K8PC 2VVNA 5LYJE 1G73A 1SE7A 3PTRB 4DUYT 5DJQC 1NWMX 4COFA 2DHRA 4UXNB 3RQWA 3RRWA 2DWKA 2KMFA 5J2UE 2KXPB 3PUYF 4UV9B 1BR4A 1OEDA 4ADZA 5IWAT 4U33A 5ABFB 2MAWA 4QH4A 1XNQT 3MJXA 3SWHA 3I9YA 5FXXA 1WR0A 3I9WA 3CIRA 4IE4A 3F57A 5H6RB 4DV4T 4HKAA 4ZI2D 5AQQB 3AE8A 3LK2B 4I50E 3L39A 4HEAA 3ZLIA 2V7IA 4DV3T 4X64T 3LBXA 5IUXA 2XM2A 2XAJB 3MXZA 1S94A 4CZZB 2KWHA 1WCRA 4O2BE 4OX9T 3K3NA 2Q9QA 2P9BA 2QRXA 3HKDE 5DABA 4GIWA 5CJ5A 3PURA 3HKBE 3PU8A 2ZM6T 1UURA 4ILUA 3AECA 2HPLA 5DQVA 3T8OA 4BAYB 1OEDB 2BVMA 4OYJA 3LDQB 4ZZBA 4I43B 3C64A 2CLYB 2ACXA 2CEAA 4PJNA 2V1DB 4LFCT 1XMQT 3BQKA 2X9HA 3O1JA 4LF4T 5ABEA 3AAEB 3K3QC 2CHOA 3ZC0A 3VR9A 3LBXB 5AQSB 3IA3A 4YY3T 4IE5A 1E2AA 4EIWA 4MALA 2BVLA 2CRBA 2JQQA 3FZKB 2PJQA 2BKPA 5LGTB 2NW9A 4HWDA 3RQUA 4QWNB 5JDQA 1XDOA 4DV7T 2E9XC 2IC9A 4KHPT 1EZ3A 3CQGB 3N2OA 3KVBA 1XMOT 2CWYA 2KLQA 4P0AA 3Q2MA 4DR6T 2H89A 2CPTA 2XZEA 3PUAA 5H6QB 4IIJE 3PUWF 4ZHQE 4JI0T 3EDVA 4PJLA 3AE6A 3CKDA 4TV9E 3O1HA 2LLYA 3BK9A 4C91A 4YJ2E 2VB6A 3NWIA 4JI7T 4EEBA 4F6RC 4AKGA 1I6ZA 1YQ4A 3ETUA 3H37A 4JI3T 3M65A 4QXCB 2LRLA 3V5SA 5L3BB 2MOZA 4O8SA 2LM9A 5IHYA 2L9QA 3UU8A 2WQYA 1WYCA 2A3DA 2V7JA 2D2SA 1N32T 3EABA 2W61A 5AQTB 5A1LA 4A97A 4TWDA 3N2KE 3ZYKA 4U2YA 2V7KA 2YN6A 2CMRA 4EAHA 2N1GA 3PUZF 5L3EB 1L0VA 4X65T 1MMAA 2NOXA 3ZCIA 2X51A 3OYZA 4ILBA 2L3LA 1KEYA 3I0QA 3Q9DA 4KHZF 3TLUA 4HFIA 3RYFE 2PTFA 2XSBA 3ZN0B 1HCIA 4BJNA 2WAUA 5DQWA 2LOSA 3JAEA 3ABVA 3R84B 1B7TA 4CN6A 3AEBA 2XQ5A 2W2UA 2D9DA 3L8RA 5BR8T 4HWIB 2J47A 5AQPB 3TLVA 5FKYA 2K9AA 1LKXA 4PJMA 1HX1B 4IDOA 2XAHB 4DV1T 4ISTA 3W15B 2JQHA 3C4XA 2E2AA 2I59A 3UQ7A 2YEVC 3KV4A 1WFDA 1YKEB 2ZM0A 5LMNT 2EHOC 2XQ3A 3C4ZA 4JI2T 4DMWA 2QGSA 3K1SA 4MHCA 5L3CB 5HXCA 3ZT6A 4HFEA 1XWMA 2VK9A 4ZOLE 2JPFA 3GN5A 2HHHT 3JC6C 3AAIA 4LMLA 4YSZA 2FJBA 4HWCA 5JDHA 3P4RA 3WAKA 4TV8E 4P09A 2QA7A 2CA5A 1ZKEA 2BG9B 2KINB 2DI4A 4V1Av 4C90A 3AA0B 3AE9A 2UXNB 2IDOB 3F31A 4LF6T 3V5UA 3RIUA 4LF9T 4NXNT 3ZSSA 1MNEA 1LVFA 2CE7A 2NTYA 3EUHA 3JAFA 3AAAB 3FZMB 4G63A 4PK6A 1W0AA 4DMVA 4U74A 2W4XA 2CXFA 3QB5K 3AE4A 4H9NC 2YDQA 2CBJA 3ESLA 2NW8A 4ANJA 5FXZA 4OHFA 3RPUA 4ZS2A 3VHLA 3N5LA 4BJMA 2V6XA 1D1BA 5HYAA 1CHUA 3AEEA 2WY2A 1OEDC 2N2NA 4U7IA 1YD8G 2CLYC 5AQHB 2WWVA 2ACZA 4DR4T 3N9OA 3ZMVB 3B57A 4JUYA 3VR8A 3HR0A 3L09A 2H3RA 4NUVA 4H63H 5CB4E 3DJBA 4B6XA 1IBLT 3FXDB 5JREA 4HFBA 3ONXA 5FY0A 2E5VA 4IGUA 3AVRA 3O4XE 3PUQA 1SA0E 3O1IA 4UVAB 4DR2T 5FP3A 3UU4A 3WAJA 3KVAA 2LHNA 1QUUA 3VKGA 3TLSA 1VCSA 5AQKB 5JR9A 3D0TA 4KI0F 3RYCE 4XAXB 2HN1A 4PW8A 2WWUA 5ABHA 1ZV4X 4KX6A 3FHNA 1N34T 4JEUB 2RPAA 4AIUA 1V9DA 2D0UA 2X0LB 1LVKA 4YJ3E 1JNRA 1U4QA 5KX5E 4GK5E 1OWAA 2WS3A 3AVSA 3PJAA 4O4LE 3AXJA 3PUGA 3VRAA 2J1DG 1FJGT 5JTGA 3PDYA 3I1AA 4PAGA 4U2ZA 3PUVF 2VKHA 4YLHA 4EXTA 3ZJ1A 4EZHA 3NKZA 4LF8T 3ZKRA 4WBNE 4JYAT 3CVRA 2NP9A 2D5UA 3LK42 1OXZA 5L3DB 4WBOA 2C5KT 1HTJF 2ODVA 3RX6A 5JR9B 3VRBA 1HG2A 4HWHA 3RF1A 3ZJ2A 4X5TA 4TWFA 3A5XA 3CPZA 3UT5E 4DV0T 3FXEB 3HKCE 1QSDA 5FY1A 3P4QA 2V7MA 4YTPA 4NUUA 4EEDA 5LJMA 3AXJB 3SOLA 3CQCB 3CWZB 3N9PA 2JMKA 1VRBA 4XZCA 2BDEA 3PUSA 3H3AA 4X20E 4JI6T 2UUAT 2NR4A 2M6IA 5C8YE 5JDLA 2VL8A 3UUNA 1CUNA 4TNWA 3S4UA 3TLTA 4HFHA 2W66A 3B5MA 2H88A 4N78D 2OLTA 5BMVE 2FJDA 3E08A 3ZMUB 3OYXA 3QC9A 3UULA 2LOPA 4UV8B 5LOVE 2W67A 4ILAA 1KNZA 3ZEFB 3L3PA 4ZXLA 5HEUA 5JDFA 3UUMA 4TN7B 4UF0A 4X62T 1E7PA 1MMDA 2X0YA 4NXMT 2V8SV 4GOUA 4GYRA 5JVDE 5F3JA 2PBIA 2DNXA 4OK0A 5LHIB 2W63A 2Q9QB 3RHWA 3RYHE 5EZYE 2IHR1 2LSGA 3ZN1B 3AEFA 1UCUA 2ES0A 4G2AA 4AI6A 2XQAA 2BS3A 4A56A 2AXDS 5FXWA 3MKDA 3RKOA 4YSYA 3ZT5A 2BG9C 4OYKA 1H7CA 2JQKA 3P50A 5L4HA 4I55E 3UUXB 4HN9A 2YDRA 4CI1B 1HFAA 1N36T 5L3FB 3Q5DA 4DVDA 1W0BA 4GKJT 3QOFA 4FJOA 4HFDA 3IF8B 3RYIE 4KUMB 1HG5A 4JLEA 3CX7B 1VCTA 1HS7A 4KMCA 4YHJA 3RKGA 2WBLA 2XTLA 2NW7A 3P4WA 3UFGA 2XM1A 3KBUA 4GK0E 1VOMA 3WI3A 1IZNB 5AQGB 3F2EA 2JMHA 4K0KT 4UIGA 5ETWA 3JC6D 5L4EA 1D1AA 1XDPA 2HH7A 3DP7A 5F5WA 1HF8A 1XZYA 2I6HA 4NIQA 5EK2A 2UXXB 2JQ9A 3VU7H 5HEOA 2WDQA 1S35A 3KV6A 4YSXA 3ZCJA 5HXHA 2LSYA 4MFRA 2KT9A 2WSSV 2X9YA 4HWFA 4QH5A 3FZHB 4ZI7E 1Z0PA 4O4JE 2XQ7A 4AQGA 1U5PA 3ANWA 4IDPA 3X1DA 4WNKA 3A7MA 3AEDA 4AISA 3RRCA 4ZS3A 4L5GA 3NVOA 2UXDT 2NTXA 2XAQB 3AE3A 2M6BA 1FMWA 2VVSA 5FNVE 3C51A 4I0UA 5C2TA 3NZQA 1G8XA 4X1YE 3UQ4A 3QB5A 4LMJA 4JV5T 4U72A 4EYUA 4IE0A 2VASA 1UK5A 2B76A 3LG7A 2X9XA 4HFVA 2YINA 5AQIB 2V7LA 3MACA 3AEAA 3VKHA 2WDRA 2LE8A 2LT3A 4JI4T 2F4VT 2DL1A 2LSKA 5LGUB 4IDZA 5HXSA 2WDVA 4TWHA 1XNRT 3AA7B 4CXWA 2LJLA 2OV9A 5LXTE 2LKGA 5L47A 2I0MA 3Q5EA 4TX5A 4DV6T 4U31A 5JH7E 5F8PA 4YTNA 4ILCA 3ANWB 2XQ9A 4NPPA 4TUYE 2C0SA 3P7IA 3A8YC 1BR0A 4EB6E 1YW0A 4QH1A 3HI2A 2R6GF 2H7VC 3E22E 4TNVA 2ODUA 3KDSE 5JR9C 3OTOT 4ERRA 4MBQA 4UEMA 2J62A 1BR1A 2UU9T 5AQRB 4XBFB 3EAMA 2CCQA 4TZ4C 4P0BA 5KMGP 2BBHA 4ASKA 3SFEA 1OEDE 1FIOA 3ZC1A 4DR3T 4B3MT 3QK6A 2WMNA 2V5CA 3C4WA 4IT4A 3AE1A 2MTQA 2KNDA 3FBLA 2WCAA 3J7Yq 3GN5B 4JI5T 4MLKA 1ZHCA 2MPKA 3EVYA 4ISSA 1HNXT 2UUCT 1MIWA 1YXRA 2IIUA 4PJJA 3PV0F 4H63V 3OKQA 4WZXA 4DR7T 4PK4A 1KFYA 3H3MA 4ZZCA 4LFBT 2CM0A 2V6YA 3N9LA 5LBMA 3C50A 5FY7A 2V5DA 2YOEA 3U78A 5FXVA 5GONE 1W9RA 3FB2A 5LBQB 2Q9QC 4EV6A 3P4PA 3N9MA 3P4SA 2Y6XA 4WW0A 3LFMA 5HEGA 3I0OA 4DBQA 4IE6A 5LHGB 1UUSA 2W0GA 4U3CA 2YKSA 3N2GE 4ZEYA 3NRXA 1UX4A 4QHOA 3RH3A 5IYZE 3RIFA 2X67A 4JI1T 5CFBA 1X79A 3OPCA 1SHZC 4O4HE 5KXJA 2WZHA 4DR5T 3B13A 2LKHA 2YK0A 2WZIA 4DV5T 2A9UA 5HWYA 4A98A 3ONJA 2V6YB 5HAXA 4B3ST 2WMOA 3SS1A 2NWBA 3KFWX 2D0TA 4H9QC 3OJAA 3GWHA 5J2TE 2Z6EA 4Q25A 5AQVB 3U3IA 1HNWT 3EHZA 2FJEA 5FVLA 2XASB 2UXBT 2E9XD 5HXEA 2X68A 5LG3A 1WYBA 2LEHA 2K5BB 1HR0T 2KSRA 3SRZA 5AQMB 5FYMA 4I4TE 4U7YA 5CA0E 2XUEA 1J5ET 3UU6A 5FL1A 4KP3C 2A72A 4J2CA 3EI0A 3CX8B 3RIAA 3CK6A 3AE7A 4CXXA 3JADA 3IHRA 2OA5A 4PFOA 4AQFA 3ETVA 3UFEA 5CA1E 3UU3A 2Y8DA 5C3JA 3MK7C 4ZI3C 2HN2A 2CXLA 2UXCT 2BS2A 4Z8XA 2WU5A 4DUZT 2C5JA 2ZM8A 3BQIA 3M3ZB 2CXDA 2WM9A 4CQIA 2K3WA 1X9BA 4HFCA 2FBWA 2ZM2A 5AQJB 4IDNA 2B1EA 5LA6E 1FEWA 5LCYA 1O3XA 5HWXA 3ZMTB 3IBPA 2V26A 2VKDA 3CQXC 4IREA 4LFAT 4AKRB 2E8IA 5L3GB 1WR6A 2RA1A 1KNRA 3T1HT 1KF6A 4EZ4A 2W00A 2BG9E 3J9X1 3O9XA 3UU5A 3QNUA 4DBRA 3NBXX 4E7ZA 1WLXA 3CX6B 2BZBA 4YTMA 5J0ZA 1WRDA 1BR2A 1T8BA 3LSVA 5AQOB 4YHHT 4LF5T 2XAGB 3IEEA 4CI3B 4DV2T 5LJNA 5JQGE 2Y48B 3ZT7A 2VURA 2AE9A 5HXRA 4BA9A 1NENA 1ZP0A 1R8IA 2BS4A 2IW5B 5LNKA 4DNDA 3FBZA 4ZI2C 4H9PC 4X1KE 1IAPA 1W09A 1GQEA 3BQLA 4Z91A 2DCFA 3KBTA 2G0UA 3N9QA 4CXYA 1HNZT 1MNDA 1IJ5A 1J1JA 4HTEA 5E0OA 1T7SA 1T72A 2WB5A 2VL0A 2K48A 1E1HB 2M67A 2WU2A 4UF0B 2CBIA 5JDGA 2LSIA 2E5LT 1J5WA 3ZPOA 3FZFB 2MBGA 1MIYA 4GYSA 3KV9A 2EHOD 4DR1T 4H9RC 4DO0A 2J4GA 2FJAA 4B3RT 2DLRA 3CMLA 1IBKT 2FUPA 1MMNA 5LMUT 1MIVA 1NAFA 3ZYLA 5CGMA 1D0ZA 2QYWA 3PE0A 2BKNA 4FI5A 3GMIA 3Q5XA 2MYSA 5JRCA 3FZLB 4AXPA 3ONLC 5J1GA 3HKEE
chains in the Genus database with same CATH topology
2UUAT 1N34T 1N36T 2UU9T 5BR8T 4DUYT 1J5ET 4JI7T 4GKJT 4YHHT 2UUBT 4LF5T 4LFCT 1I94T 2UXDT 1XMQT 4DV2T 4JI3T 4LF4T 5IWAT 4DV1T 1FJGT 2VQET 1XNQT 4DR3T 4B3MT 4JI1T 4JV5T 5LMNT 4YY3T 2UXCT 4B3TT 4JI2T 1N32T 4DR4T 4DR5T 3T1YT 4DUZT 4DV4T 4AQYT 4LF8T 1HNZT 4DV5T 2HHHT 4JI4T 2F4VT 4JYAT 4JI5T 4DV3T 4X64T 1XNRT 4K0KT 4DV7T 4X62T 4NXMT 1HNXT 2UUCT 2E5LT 4KHPT 4X65T 4OX9T 4B3ST 1IBLT 1XMOT 4DV6T 4DR6T 4DR1T 4DR7T 4LF7T 4LFAT 4B3RT 4LF6T 1IBMT 2VQFT 4LF9T 4LFBT 4DR2T 4NXNT 1IBKT 1HNWT 3T1HT 5LMUT 4DV0T 4JI8T 4JI0T 4GKKT 4X66T 2ZM6T 2UXBT 1N33T 1HR0T 4JI6T 3OTOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA T;  1N34 T;  1N36 T;  2UU9 T;  5BR8 T;  4DUY T;  1J5E T;  4JI7 T;  4GKJ T;  4YHH T;  2UUB T;  4LF5 T;  4LFC T;  1I94 T;  2UXD T;  1XMQ T;  4DV2 T;  4JI3 T;  4LF4 T;  5IWA T;  4DV1 T;  1FJG T;  2VQE T;  1XNQ T;  4DR3 T;  4B3M T;  4JI1 T;  4JV5 T;  5LMN T;  4YY3 T;  2UXC T;  4B3T T;  4JI2 T;  1N32 T;  4DR4 T;  4DR5 T;  3T1Y T;  4DUZ T;  4DV4 T;  4AQY T;  4LF8 T;  1HNZ T;  4DV5 T;  2HHH T;  4JI4 T;  2F4V T;  4JYA T;  4JI5 T;  4DV3 T;  4X64 T;  1XNR T;  4K0K T;  4DV7 T;  4X62 T;  4NXM T;  1HNX T;  2UUC T;  2E5L T;  4KHP T;  4X65 T;  4OX9 T;  4B3S T;  1IBL T;  1XMO T;  4DV6 T;  4DR6 T;  4DR1 T;  4DR7 T;  4LF7 T;  4LFA T;  4B3R T;  4LF6 T;  1IBM T;  2VQF T;  4LF9 T;  4LFB T;  4DR2 T;  4NXN T;  1IBK T;  1HNW T;  3T1H T;  5LMU T;  4DV0 T;  4JI8 T;  4JI0 T;  4GKK T;  4X66 T;  2ZM6 T;  2UXB T;  1N33 T;  1HR0 T;  4JI6 T;  3OTO T; 
#chains in the Genus database with same CATH topology
 3HA4 A;  3R6N A;  4PNI A;  3RGL A;  2PG8 A;  1JNZ A;  4X1I E;  4H9O C;  2UUB T;  3RIU C;  3KIN B;  3ZMZ B;  1YKH B;  2XPK A;  4CN1 A;  2L8K A;  2XHE B;  2VQE T;  3MA9 A;  5L2L A;  4B3T T;  4IL9 A;  4WYV A;  3NRY A;  4UEL A;  5LB7 B;  3T1Y T;  1NEK A;  1MMG A;  2RP4 A;  5HCM A;  2W62 A;  2IC6 A;  4QX8 B;  1SUM B;  1Y64 B;  3NZP A;  2E9X A;  3RI5 A;  4AKI A;  5HCJ A;  3MZK B;  1T98 A;  4YFS A;  5AQF B;  2BG9 A;  1HX8 A;  3TLW A;  3AE2 A;  5ABG A;  5LG4 A;  2XAF B;  5LHH B;  3EDU A;  5JRC B;  3K3O A;  4LF7 T;  4Z90 A;  2KWI B;  2QVA A;  3JCF A;  5KDM C;  5FL0 A;  3LJC A;  2WP9 A;  4HGA A;  4JI8 T;  2LM2 A;  3GA8 A;  4GKK T;  2DWG A;  4QX7 B;  4IL4 A;  4IE7 A;  5FMN A;  3E0Z A;  5HEH A;  2IAK A;  3AA6 B;  2N9D A;  4PK5 A;  1DU2 A;  1KK7 A;  4AKL A;  4EGW A;  2KZ7 B;  5FVK A;  4H9S E;  2HPJ A;  2Q9Q D;  3AE5 A;  1I94 T;  2XQY A;  3N9N A;  2IUB A;  4DID B;  1M62 A;  2E9X B;  2ZMA A;  4KBM B;  5HEJ A;  2VKJ A;  1FMV A;  2VKO A;  5LGN B;  2VWA A;  2XQ4 A;  3UUB A;  3HL6 A;  3LK3 B;  4K0U A;  4AQY T;  1UX5 A;  4QXH B;  4IDQ A;  5TAO A;  1US7 B;  4UR9 A;  1AJ3 A;  2K24 A;  4EYY R;  2LHR A;  2XSA A;  2A2F X;  4UVC B;  4E7S A;  2CWO A;  3PJA J;  3SFD A;  4CI2 B;  4L0R A;  2GK9 A;  4A5X A;  5AQL B;  4LMK A;  2IML A;  3TKL B;  1ZOY A;  2JJ9 A;  3DTO A;  2VQF T;  4QXB B;  4YXD A;  5EK3 A;  2H7O A;  4IHJ E;  1UGO A;  3ZMS B;  4CN4 A;  5ADX L;  4F8H A;  5AQU B;  4X66 T;  2XJ7 A;  4P1N A;  1YQ3 A;  1LRZ A;  2CHN A;  3RC3 A;  1KNP A;  4L9I A;  1N33 T;  4OFZ A;  3QUJ A;  3ZYM A;  1D0Y A;  2XQ6 A;  1IJ6 A;  2YU2 A;  2JIW A;  4JEH B;  2LRK A;  3KV5 A;  2EHO A;  4AQF C;  2X0H A;  1M7K A;  2PFV A;  2XY8 B;  3RLF F;  3AA1 B;  3OBV E;  4ZI3 D;  3G06 A;  4UVB B;  4EOZ B;  5AFU L;  4JBW F;  2BBJ A;  5ABF A;  3P8C D;  1D1C A;  1Y01 A;  5M4Y A;  2X9W A;  5AQN B;  4QKN A;  3ZST A;  3AB3 B;  2JRK A;  5LP6 E;  3RC8 A;  3Q5W A;  2SPC A;  1ZEE A;  3UTK A;  4YT0 A;  1Z8U A;  2YU1 A;  2X66 A;  2XQ8 A;  3C98 B;  2LSJ A;  2BKO A;  3AEG A;  3PUX F;  1QLB A;  4M1P A;  1IBM T;  2YDS A;  4HE8 A;  5JDN A;  5EK4 A;  2ZLY A;  4O4I E;  3OVU A;  4PFP A;  2C5I T;  4O2A E;  1D0X A;  4AKH A;  3PU3 A;  2EHO B;  5JDM A;  3K8P C;  2VVN A;  5LYJ E;  1G73 A;  1SE7 A;  3PTR B;  4DUY T;  5DJQ C;  1NWM X;  4COF A;  2DHR A;  4UXN B;  3RQW A;  3RRW A;  2DWK A;  2KMF A;  5J2U E;  2KXP B;  3PUY F;  4UV9 B;  1BR4 A;  1OED A;  4ADZ A;  5IWA T;  4U33 A;  5ABF B;  2MAW A;  4QH4 A;  1XNQ T;  3MJX A;  3SWH A;  3I9Y A;  5FXX A;  1WR0 A;  3I9W A;  3CIR A;  4IE4 A;  3F57 A;  5H6R B;  4DV4 T;  4HKA A;  4ZI2 D;  5AQQ B;  3AE8 A;  3LK2 B;  4I50 E;  3L39 A;  4HEA A;  3ZLI A;  2V7I A;  4DV3 T;  4X64 T;  3LBX A;  5IUX A;  2XM2 A;  2XAJ B;  3MXZ A;  1S94 A;  4CZZ B;  2KWH A;  1WCR A;  4O2B E;  4OX9 T;  3K3N A;  2Q9Q A;  2P9B A;  2QRX A;  3HKD E;  5DAB A;  4GIW A;  5CJ5 A;  3PUR A;  3HKB E;  3PU8 A;  2ZM6 T;  1UUR A;  4ILU A;  3AEC A;  2HPL A;  5DQV A;  3T8O A;  4BAY B;  1OED B;  2BVM A;  4OYJ A;  3LDQ B;  4ZZB A;  4I43 B;  3C64 A;  2CLY B;  2ACX A;  2CEA A;  4PJN A;  2V1D B;  4LFC T;  1XMQ T;  3BQK A;  2X9H A;  3O1J A;  4LF4 T;  5ABE A;  3AAE B;  3K3Q C;  2CHO A;  3ZC0 A;  3VR9 A;  3LBX B;  5AQS B;  3IA3 A;  4YY3 T;  4IE5 A;  1E2A A;  4EIW A;  4MAL A;  2BVL A;  2CRB A;  2JQQ A;  3FZK B;  2PJQ A;  2BKP A;  5LGT B;  2NW9 A;  4HWD A;  3RQU A;  4QWN B;  5JDQ A;  1XDO A;  4DV7 T;  2E9X C;  2IC9 A;  4KHP T;  1EZ3 A;  3CQG B;  3N2O A;  3KVB A;  1XMO T;  2CWY A;  2KLQ A;  4P0A A;  3Q2M A;  4DR6 T;  2H89 A;  2CPT A;  2XZE A;  3PUA A;  5H6Q B;  4IIJ E;  3PUW F;  4ZHQ E;  4JI0 T;  3EDV A;  4PJL A;  3AE6 A;  3CKD A;  4TV9 E;  3O1H A;  2LLY A;  3BK9 A;  4C91 A;  4YJ2 E;  2VB6 A;  3NWI A;  4JI7 T;  4EEB A;  4F6R C;  4AKG A;  1I6Z A;  1YQ4 A;  3ETU A;  3H37 A;  4JI3 T;  3M65 A;  4QXC B;  2LRL A;  3V5S A;  5L3B B;  2MOZ A;  4O8S A;  2LM9 A;  5IHY A;  2L9Q A;  3UU8 A;  2WQY A;  1WYC A;  2A3D A;  2V7J A;  2D2S A;  1N32 T;  3EAB A;  2W61 A;  5AQT B;  5A1L A;  4A97 A;  4TWD A;  3N2K E;  3ZYK A;  4U2Y A;  2V7K A;  2YN6 A;  2CMR A;  4EAH A;  2N1G A;  3PUZ F;  5L3E B;  1L0V A;  4X65 T;  1MMA A;  2NOX A;  3ZCI A;  2X51 A;  3OYZ A;  4ILB A;  2L3L A;  1KEY A;  3I0Q A;  3Q9D A;  4KHZ F;  3TLU A;  4HFI A;  3RYF E;  2PTF A;  2XSB A;  3ZN0 B;  1HCI A;  4BJN A;  2WAU A;  5DQW A;  2LOS A;  3JAE A;  3ABV A;  3R84 B;  1B7T A;  4CN6 A;  3AEB A;  2XQ5 A;  2W2U A;  2D9D A;  3L8R A;  5BR8 T;  4HWI B;  2J47 A;  5AQP B;  3TLV A;  5FKY A;  2K9A A;  1LKX A;  4PJM A;  1HX1 B;  4IDO A;  2XAH B;  4DV1 T;  4IST A;  3W15 B;  2JQH A;  3C4X A;  2E2A A;  2I59 A;  3UQ7 A;  2YEV C;  3KV4 A;  1WFD A;  1YKE B;  2ZM0 A;  5LMN T;  2EHO C;  2XQ3 A;  3C4Z A;  4JI2 T;  4DMW A;  2QGS A;  3K1S A;  4MHC A;  5L3C B;  5HXC A;  3ZT6 A;  4HFE A;  1XWM A;  2VK9 A;  4ZOL E;  2JPF A;  3GN5 A;  2HHH T;  3JC6 C;  3AAI A;  4LML A;  4YSZ A;  2FJB A;  4HWC A;  5JDH A;  3P4R A;  3WAK A;  4TV8 E;  4P09 A;  2QA7 A;  2CA5 A;  1ZKE A;  2BG9 B;  2KIN B;  2DI4 A;  4V1A v;  4C90 A;  3AA0 B;  3AE9 A;  2UXN B;  2IDO B;  3F31 A;  4LF6 T;  3V5U A;  3RIU A;  4LF9 T;  4NXN T;  3ZSS A;  1MNE A;  1LVF A;  2CE7 A;  2NTY A;  3EUH A;  3JAF A;  3AAA B;  3FZM B;  4G63 A;  4PK6 A;  1W0A A;  4DMV A;  4U74 A;  2W4X A;  2CXF A;  3QB5 K;  3AE4 A;  4H9N C;  2YDQ A;  2CBJ A;  3ESL A;  2NW8 A;  4ANJ A;  5FXZ A;  4OHF A;  3RPU A;  4ZS2 A;  3VHL A;  3N5L A;  4BJM A;  2V6X A;  1D1B A;  5HYA A;  1CHU A;  3AEE A;  2WY2 A;  1OED C;  2N2N A;  4U7I A;  1YD8 G;  2CLY C;  5AQH B;  2WWV A;  2ACZ A;  4DR4 T;  3N9O A;  3ZMV B;  3B57 A;  4JUY A;  3VR8 A;  3HR0 A;  3L09 A;  2H3R A;  4NUV A;  4H63 H;  5CB4 E;  3DJB A;  4B6X A;  1IBL T;  3FXD B;  5JRE A;  4HFB A;  3ONX A;  5FY0 A;  2E5V A;  4IGU A;  3AVR A;  3O4X E;  3PUQ A;  1SA0 E;  3O1I A;  4UVA B;  4DR2 T;  5FP3 A;  3UU4 A;  3WAJ A;  3KVA A;  2LHN A;  1QUU A;  3VKG A;  3TLS A;  1VCS A;  5AQK B;  5JR9 A;  3D0T A;  4KI0 F;  3RYC E;  4XAX B;  2HN1 A;  4PW8 A;  2WWU A;  5ABH A;  1ZV4 X;  4KX6 A;  3FHN A;  1N34 T;  4JEU B;  2RPA A;  4AIU A;  1V9D A;  2D0U A;  2X0L B;  1LVK A;  4YJ3 E;  1JNR A;  1U4Q A;  5KX5 E;  4GK5 E;  1OWA A;  2WS3 A;  3AVS A;  3PJA A;  4O4L E;  3AXJ A;  3PUG A;  3VRA A;  2J1D G;  1FJG T;  5JTG A;  3PDY A;  3I1A A;  4PAG A;  4U2Z A;  3PUV F;  2VKH A;  4YLH A;  4EXT A;  3ZJ1 A;  4EZH A;  3NKZ A;  4LF8 T;  3ZKR A;  4WBN E;  4JYA T;  3CVR A;  2NP9 A;  2D5U A;  3LK4 2;  1OXZ A;  5L3D B;  4WBO A;  2C5K T;  1HTJ F;  2ODV A;  3RX6 A;  5JR9 B;  3VRB A;  1HG2 A;  4HWH A;  3RF1 A;  3ZJ2 A;  4X5T A;  4TWF A;  3A5X A;  3CPZ A;  3UT5 E;  4DV0 T;  3FXE B;  3HKC E;  1QSD A;  5FY1 A;  3P4Q A;  2V7M A;  4YTP A;  4NUU A;  4EED A;  5LJM A;  3AXJ B;  3SOL A;  3CQC B;  3CWZ B;  3N9P A;  2JMK A;  1VRB A;  4XZC A;  2BDE A;  3PUS A;  3H3A A;  4X20 E;  4JI6 T;  2UUA T;  2NR4 A;  2M6I A;  5C8Y E;  5JDL A;  2VL8 A;  3UUN A;  1CUN A;  4TNW A;  3S4U A;  3TLT A;  4HFH A;  2W66 A;  3B5M A;  2H88 A;  4N78 D;  2OLT A;  5BMV E;  2FJD A;  3E08 A;  3ZMU B;  3OYX A;  3QC9 A;  3UUL A;  2LOP A;  4UV8 B;  5LOV E;  2W67 A;  4ILA A;  1KNZ A;  3ZEF B;  3L3P A;  4ZXL A;  5HEU A;  5JDF A;  3UUM A;  4TN7 B;  4UF0 A;  4X62 T;  1E7P A;  1MMD A;  2X0Y A;  4NXM T;  2V8S V;  4GOU A;  4GYR A;  5JVD E;  5F3J A;  2PBI A;  2DNX A;  4OK0 A;  5LHI B;  2W63 A;  2Q9Q B;  3RHW A;  3RYH E;  5EZY E;  2IHR 1;  2LSG A;  3ZN1 B;  3AEF A;  1UCU A;  2ES0 A;  4G2A A;  4AI6 A;  2XQA A;  2BS3 A;  4A56 A;  2AXD S;  5FXW A;  3MKD A;  3RKO A;  4YSY A;  3ZT5 A;  2BG9 C;  4OYK A;  1H7C A;  2JQK A;  3P50 A;  5L4H A;  4I55 E;  3UUX B;  4HN9 A;  2YDR A;  4CI1 B;  1HFA A;  1N36 T;  5L3F B;  3Q5D A;  4DVD A;  1W0B A;  4GKJ T;  3QOF A;  4FJO A;  4HFD A;  3IF8 B;  3RYI E;  4KUM B;  1HG5 A;  4JLE A;  3CX7 B;  1VCT A;  1HS7 A;  4KMC A;  4YHJ A;  3RKG A;  2WBL A;  2XTL A;  2NW7 A;  3P4W A;  3UFG A;  2XM1 A;  3KBU A;  4GK0 E;  1VOM A;  3WI3 A;  1IZN B;  5AQG B;  3F2E A;  2JMH A;  4K0K T;  4UIG A;  5ETW A;  3JC6 D;  5L4E A;  1D1A A;  1XDP A;  2HH7 A;  3DP7 A;  5F5W A;  1HF8 A;  1XZY A;  2I6H A;  4NIQ A;  5EK2 A;  2UXX B;  2JQ9 A;  3VU7 H;  5HEO A;  2WDQ A;  1S35 A;  3KV6 A;  4YSX A;  3ZCJ A;  5HXH A;  2LSY A;  4MFR A;  2KT9 A;  2WSS V;  2X9Y A;  4HWF A;  4QH5 A;  3FZH B;  4ZI7 E;  1Z0P A;  4O4J E;  2XQ7 A;  4AQG A;  1U5P A;  3ANW A;  4IDP A;  3X1D A;  4WNK A;  3A7M A;  3AED A;  4AIS A;  3RRC A;  4ZS3 A;  4L5G A;  3NVO A;  2UXD T;  2NTX A;  2XAQ B;  3AE3 A;  2M6B A;  1FMW A;  2VVS A;  5FNV E;  3C51 A;  4I0U A;  5C2T A;  3NZQ A;  1G8X A;  4X1Y E;  3UQ4 A;  3QB5 A;  4LMJ A;  4JV5 T;  4U72 A;  4EYU A;  4IE0 A;  2VAS A;  1UK5 A;  2B76 A;  3LG7 A;  2X9X A;  4HFV A;  2YIN A;  5AQI B;  2V7L A;  3MAC A;  3AEA A;  3VKH A;  2WDR A;  2LE8 A;  2LT3 A;  4JI4 T;  2F4V T;  2DL1 A;  2LSK A;  5LGU B;  4IDZ A;  5HXS A;  2WDV A;  4TWH A;  1XNR T;  3AA7 B;  4CXW A;  2LJL A;  2OV9 A;  5LXT E;  2LKG A;  5L47 A;  2I0M A;  3Q5E A;  4TX5 A;  4DV6 T;  4U31 A;  5JH7 E;  5F8P A;  4YTN A;  4ILC A;  3ANW B;  2XQ9 A;  4NPP A;  4TUY E;  2C0S A;  3P7I A;  3A8Y C;  1BR0 A;  4EB6 E;  1YW0 A;  4QH1 A;  3HI2 A;  2R6G F;  2H7V C;  3E22 E;  4TNV A;  2ODU A;  3KDS E;  5JR9 C;  3OTO T;  4ERR A;  4MBQ A;  4UEM A;  2J62 A;  1BR1 A;  2UU9 T;  5AQR B;  4XBF B;  3EAM A;  2CCQ A;  4TZ4 C;  4P0B A;  5KMG P;  2BBH A;  4ASK A;  3SFE A;  1OED E;  1FIO A;  3ZC1 A;  4DR3 T;  4B3M T;  3QK6 A;  2WMN A;  2V5C A;  3C4W A;  4IT4 A;  3AE1 A;  2MTQ A;  2KND A;  3FBL A;  2WCA A;  3J7Y q;  3GN5 B;  4JI5 T;  4MLK A;  1ZHC A;  2MPK A;  3EVY A;  4ISS A;  1HNX T;  2UUC T;  1MIW A;  1YXR A;  2IIU A;  4PJJ A;  3PV0 F;  4H63 V;  3OKQ A;  4WZX A;  4DR7 T;  4PK4 A;  1KFY A;  3H3M A;  4ZZC A;  4LFB T;  2CM0 A;  2V6Y A;  3N9L A;  5LBM A;  3C50 A;  5FY7 A;  2V5D A;  2YOE A;  3U78 A;  5FXV A;  5GON E;  1W9R A;  3FB2 A;  5LBQ B;  2Q9Q C;  4EV6 A;  3P4P A;  3N9M A;  3P4S A;  2Y6X A;  4WW0 A;  3LFM A;  5HEG A;  3I0O A;  4DBQ A;  4IE6 A;  5LHG B;  1UUS A;  2W0G A;  4U3C A;  2YKS A;  3N2G E;  4ZEY A;  3NRX A;  1UX4 A;  4QHO A;  3RH3 A;  5IYZ E;  3RIF A;  2X67 A;  4JI1 T;  5CFB A;  1X79 A;  3OPC A;  1SHZ C;  4O4H E;  5KXJ A;  2WZH A;  4DR5 T;  3B13 A;  2LKH A;  2YK0 A;  2WZI A;  4DV5 T;  2A9U A;  5HWY A;  4A98 A;  3ONJ A;  2V6Y B;  5HAX A;  4B3S T;  2WMO A;  3SS1 A;  2NWB A;  3KFW X;  2D0T A;  4H9Q C;  3OJA A;  3GWH A;  5J2T E;  2Z6E A;  4Q25 A;  5AQV B;  3U3I A;  1HNW T;  3EHZ A;  2FJE A;  5FVL A;  2XAS B;  2UXB T;  2E9X D;  5HXE A;  2X68 A;  5LG3 A;  1WYB A;  2LEH A;  2K5B B;  1HR0 T;  2KSR A;  3SRZ A;  5AQM B;  5FYM A;  4I4T E;  4U7Y A;  5CA0 E;  2XUE A;  1J5E T;  3UU6 A;  5FL1 A;  4KP3 C;  2A72 A;  4J2C A;  3EI0 A;  3CX8 B;  3RIA A;  3CK6 A;  3AE7 A;  4CXX A;  3JAD A;  3IHR A;  2OA5 A;  4PFO A;  4AQF A;  3ETV A;  3UFE A;  5CA1 E;  3UU3 A;  2Y8D A;  5C3J A;  3MK7 C;  4ZI3 C;  2HN2 A;  2CXL A;  2UXC T;  2BS2 A;  4Z8X A;  2WU5 A;  4DUZ T;  2C5J A;  2ZM8 A;  3BQI A;  3M3Z B;  2CXD A;  2WM9 A;  4CQI A;  2K3W A;  1X9B A;  4HFC A;  2FBW A;  2ZM2 A;  5AQJ B;  4IDN A;  2B1E A;  5LA6 E;  1FEW A;  5LCY A;  1O3X A;  5HWX A;  3ZMT B;  3IBP A;  2V26 A;  2VKD A;  3CQX C;  4IRE A;  4LFA T;  4AKR B;  2E8I A;  5L3G B;  1WR6 A;  2RA1 A;  1KNR A;  3T1H T;  1KF6 A;  4EZ4 A;  2W00 A;  2BG9 E;  3J9X 1;  3O9X A;  3UU5 A;  3QNU A;  4DBR A;  3NBX X;  4E7Z A;  1WLX A;  3CX6 B;  2BZB A;  4YTM A;  5J0Z A;  1WRD A;  1BR2 A;  1T8B A;  3LSV A;  5AQO B;  4YHH T;  4LF5 T;  2XAG B;  3IEE A;  4CI3 B;  4DV2 T;  5LJN A;  5JQG E;  2Y48 B;  3ZT7 A;  2VUR A;  2AE9 A;  5HXR A;  4BA9 A;  1NEN A;  1ZP0 A;  1R8I A;  2BS4 A;  2IW5 B;  5LNK A;  4DND A;  3FBZ A;  4ZI2 C;  4H9P C;  4X1K E;  1IAP A;  1W09 A;  1GQE A;  3BQL A;  4Z91 A;  2DCF A;  3KBT A;  2G0U A;  3N9Q A;  4CXY A;  1HNZ T;  1MND A;  1IJ5 A;  1J1J A;  4HTE A;  5E0O A;  1T7S A;  1T72 A;  2WB5 A;  2VL0 A;  2K48 A;  1E1H B;  2M67 A;  2WU2 A;  4UF0 B;  2CBI A;  5JDG A;  2LSI A;  2E5L T;  1J5W A;  3ZPO A;  3FZF B;  2MBG A;  1MIY A;  4GYS A;  3KV9 A;  2EHO D;  4DR1 T;  4H9R C;  4DO0 A;  2J4G A;  2FJA A;  4B3R T;  2DLR A;  3CML A;  1IBK T;  2FUP A;  1MMN A;  5LMU T;  1MIV A;  1NAF A;  3ZYL A;  5CGM A;  1D0Z A;  2QYW A;  3PE0 A;  2BKN A;  4FI5 A;  3GMI A;  3Q5X A;  2MYS A;  5JRC A;  3FZL B;  4AXP A;  3ONL C;  5J1G A;  3HKE E; 
#chains in the Genus database with same CATH homology
 2UUA T;  1N34 T;  1N36 T;  2UU9 T;  5BR8 T;  4DUY T;  1J5E T;  4JI7 T;  4GKJ T;  4YHH T;  2UUB T;  4LF5 T;  4LFC T;  1I94 T;  2UXD T;  1XMQ T;  4DV2 T;  4JI3 T;  4LF4 T;  5IWA T;  4DV1 T;  1FJG T;  2VQE T;  1XNQ T;  4DR3 T;  4B3M T;  4JI1 T;  4JV5 T;  5LMN T;  4YY3 T;  2UXC T;  4B3T T;  4JI2 T;  1N32 T;  4DR4 T;  4DR5 T;  3T1Y T;  4DUZ T;  4DV4 T;  4AQY T;  4LF8 T;  1HNZ T;  4DV5 T;  2HHH T;  4JI4 T;  2F4V T;  4JYA T;  4JI5 T;  4DV3 T;  4X64 T;  1XNR T;  4K0K T;  4DV7 T;  4X62 T;  4NXM T;  1HNX T;  2UUC T;  2E5L T;  4KHP T;  4X65 T;  4OX9 T;  4B3S T;  1IBL T;  1XMO T;  4DV6 T;  4DR6 T;  4DR1 T;  4DR7 T;  4LF7 T;  4LFA T;  4B3R T;  4LF6 T;  1IBM T;  2VQF T;  4LF9 T;  4LFB T;  4DR2 T;  4NXN T;  1IBK T;  1HNW T;  3T1H T;  5LMU T;  4DV0 T;  4JI8 T;  4JI0 T;  4GKK T;  4X66 T;  2ZM6 T;  2UXB T;  1N33 T;  1HR0 T;  4JI6 T;  3OTO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...