2E5LT

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2e5lT00
4B3RT 5LMNT 1HNWT 3T1HT 1IBKT 2VQET 4B3ST 4DR6T 1XNQT 4JI4T 1HNZT 4DR4T 1HNXT 4LFAT 4JV5T 2UU9T 2UUAT 5BR8T 1N32T 4DR2T 2UXCT 4GKKT 4JI2T 4OX9T 5IWAT 4X66T 1N33T 2UUCT 4DV5T 4KHPT 4GKJT 4JI6T 4X65T 2VQFT 4YY3T 4JI5T 4LFBT 4LF9T 4DV7T 4JI0T 4DR1T 5LMUT 4AQYT 1HR0T 4DR5T 4JI8T 4DV4T 1XMOT 1N34T 4LF4T 4DV3T 2E5LT 4B3MT 4LF8T 2HHHT 4DR7T 4X64T 1J5ET 4NXNT 4DV2T 1XNRT 1N36T 4NXMT 4JI1T 1I94T 3T1YT 4JI7T 4DV6T 2ZM6T 1FJGT 4JYAT 4DR3T 4DUZT 4LFCT 2UUBT 4LF6T 2F4VT 4DUYT 1IBMT 3OTOT 2UXBT 1IBLT 4X62T 4LF5T 4YHHT 4DV1T 4DV0T 4LF7T 2UXDT 1XMQT 4B3TT 4JI3T 4K0KT
chains in the Genus database with same CATH superfamily
2XSAA 3ESLA 2VL0A 3AE9A 3J9X1 2K9AA 5L3FB 4DBRA 2WDVA 5HXSA 5HEUA 5LHHB 1M62A 4PK6A 2WZIA 5TAOA 1SUMB 2K24A 3BK9A 3O1IA 1B7TA 2XQ8A 2C5IT 3O4XE 4YY3T 2VURA 4TNWA 5AQTB 2A3DA 1HR0T 3SWHA 2G0UA 1T8BA 5L3EB 2CXDA 3PU3A 4I0UA 2V5CA 3CMLA 1W0BA 4B3MT 5L3DB 2IMLA 4JBWF 3FXDB 3L39A 4ZS3A 4UIGA 1H7CA 4NXMT 3GN5A 4CI1B 3KFWX 2LJLA 3ZSSA 3DTOA 4ZOLE 3RX6A 3RYCE 3ETUA 2NOXA 3AVRA 4EIWA 2YDRA 2PBIA 3ETVA 2X9HA 3VKHA 1U4QA 4F6RC 4DBQA 4TZ4C 3CK6A 5FL1A 2X0YA 2XTLA 3TLWA 5CFBA 4LMLA 2JQKA 5LHIB 2L8KA 1D0YA 2Y48B 1YD8G 4X1IE 2WMOA 4ZI3C 2P9BA 2UUAT 2XQAA 3V5SA 1KF6A 1HS7A 2D0TA 3UU8A 4H9OC 4TN7B 2D0UA 3UU6A 5AQKB 3MA9A 4U3CA 4AQFC 2Y8DA 4H63H 3UUMA 4JEUB 3IA3A 4QH1A 1DU2A 4CXWA 3SFEA 3UFGA 2BG9E 3KBUA 3QC9A 2LRLA 4CXYA 4UV9B 2QA7A 1XNRT 2L9QA 1MMAA 2PG8A 3EDVA 5AQJB 2CEAA 2NW9A 2V6XA 2VKDA 2EHOC 4DR3T 3LSVA 1FIOA 4MHCA 4WW0A 1FMVA 3PDYA 3NBXX 4DUYT 3A5XA 3RPUA 4EOZB 2XUEA 3P50A 4FI5A 5KDMC 1E2AA 2RP4A 3N9MA 3AE4A 4TWDA 3RLFF 3AB3B 2KLQA 2ZM8A 4YJ2E 4K0KT 2W0GA 2Q9QB 3Q2MA 3CWZB 2C0SA 3ZJ1A 1E1HB 4CXXA 1E7PA 3P4WA 4COFA 1YQ4A 1SA0E 3NRYA 4KP3C 3KV6A 1KNZA 3JCFA 2CRBA 3AEAA 4X1YE 5IWAT 2UUCT 3AA1B 5LOVE 3RIUC 2V7IA 5LBMA 3RIAA 2CBIA 1Y64B 2HN2A 5CGMA 2BG9B 5LJNA 3RF1A 3QK6A 2WDRA 4P0BA 1YXRA 3F2EA 1U5PA 3L3PA 3PURA 5HXHA 5HEJA 2W4XA 4UF0A 4IDPA 4U33A 2FBWA 3M3ZB 3EABA 3CX8B 3N9QA 4L0RA 1OXZA 3P4SA 3JAFA 1XZYA 2V8SV 2UXBT 4DV1T 3CIRA 5AQVB 1D1CA 1VOMA 4LF7T 4UEMA 3C64A 3FZLB 5ABGA 3MK7C 2VB6A 3FZHB 5LMNT 5L47A 3NVOA 1KNRA 4EYUA 3AEBA 3B57A 2UXNB 2WZHA 2A72A 2J1DG 2PFVA 5FL0A 4IDOA 2LEHA 2K3WA 3CX6B 4QWNB 2B76A 4ZZBA 4OX9T 2XASB 2V26A 3ZYKA 3CQGB 5KX5E 2V5DA 2OLTA 3E08A 2OV9A 4LF9T 4JI0T 4DR1T 3AE1A 1V9DA 3RKGA 4ZXLA 1NEKA 3L8RA 2VVSA 1XMOT 4H63V 5L4HA 1G73A 2XPKA 4ADZA 2JMHA 2M6IA 4K0UA 2YEVC 5AQSB 2WWVA 1X79A 3CKDA 4WBNE 2YU1A 2XQ7A 4IT4A 2B1EA 2XM2A 3X1DA 5EZYE 3QB5K 4HWHA 2VVNA 1GQEA 2QVAA 1LRZA 3RGLA 2F4VT 3QB5A 5AQOB 1IBLT 1HCIA 4EB6E 3FXEB 3PUZF 3A8YC 3OBVE 4KI0F 4UELA 3P7IA 3C4XA 4U2YA 3W15B 3UULA 2D5UA 2IHR1 2V7JA 3LK42 3GA8A 1OWAA 3RRCA 3AE2A 3T8OA 2ZM0A 4HEAA 2C5JA 2CXFA 3KVAA 3CQCB 4O8SA 3OVUA 5JR9B 5FY1A 3AAEB 4HFCA 1VRBA 4H9PC 4MALA 1Y01A 2VQFT 4TX5A 4QX7B 2JMKA 2WQYA 3RH3A 4C91A 2BBJA 3WI3A 4HKAA 4EZ4A 5HWXA 4LF4T 1UK5A 1MMGA 3ONXA 2KWHA 3LBXA 1J5ET 2V6YB 3N2OA 1BR2A 4AKHA 3PUWF 4P0AA 5LXTE 5EK2A 5C8YE 3BQLA 3Q5EA 2Z6EA 4V1Av 1KFYA 4WYVA 3ZYMA 4LMJA 3VRBA 2E2AA 3OPCA 1WYCA 5DABA 5IUXA 2UXDT 4AKGA 1ZEEA 2LKHA 4CN1A 2MPKA 1D1BA 2E5VA 2YN6A 5J2TE 4GK5E 5F5WA 4ZI3D 2E9XB 3LG7A 5JDNA 5EK4A 2JQHA 1X9BA 3L09A 4AQFA 2YDQA 5CA0E 5LJMA 2W00A 4DR2T 2UXCT 3KV4A 4GK0E 3K1SA 1NWMX 1IAPA 4ZZCA 4UVAB 4NUVA 2QRXA 4X65T 5JDQA 3ZMUB 4JI5T 2IAKA 3DP7A 3Q5WA 5L3BB 3WAJA 2WS3A 5AQGB 3LDQB 2EHOA 1HX8A 2IIUA 2W62A 3KINB 2VL8A 3P4PA 3P4RA 2LSYA 2BKNA 3AEDA 2WM9A 4O2AE 2EHOD 5FXWA 2PJQA 5GONE 1LVKA 2ZM6T 4N78D 3JADA 2X9WA 3AEEA 5J2UE 1KNPA 2UUBT 3UFEA 4IE5A 3JAEA 1WR6A 4CZZB 3I9YA 3BQKA 3OTOT 3I0OA 1S35A 4ZEYA 4CI3B 4IGUA 3U78A 4OYKA 2YK0A 3VHLA 4IIJE 3ABVA 2JQ9A 2CA5A 5HEGA 1XDPA 4A97A 1UUSA 2XQYA 3RYIE 1MIYA 5L2LA 3O9XA 3FBZA 3AA6B 3NZQA 5FP3A 4JI4T 1HG2A 4AIUA 3AVSA 1R8IA 4U7YA 4YHJA 2BBHA 2RPAA 3RIUA 5HXEA 4JLEA 1UX5A 5FXXA 1N33T 2XAJB 3UT5E 4JUYA 2X66A 1HG5A 2D9DA 3D0TA 4PK4A 4EYYR 3ZN0B 4NIQA 3AE6A 4O4HE 4DV7T 4HFVA 2ODVA 3LFMA 3AE8A 3VR8A 3GN5B 2JIWA 4BA9A 4JI8T 4UVBB 1W09A 3UU4A 3SFDA 5FVKA 4CQIA 1YQ3A 2E5LT 2HHHT 4QXBB 2A9UA 4I43B 2IC6A 4DV2T 2YDSA 2JJ9A 1FMWA 3OJAA 2VKHA 3H37A 2GK9A 3E22E 3NZPA 3HL6A 2HPJA 3B13A 5HXRA 2BS2A 1SHZC 4EV6A 5CJ5A 4DVDA 4H9QC 4PJMA 2WMNA 4X1KE 4YHHT 3HKEE 3RYFE 2RA1A 1MMDA 4GYSA 3PTRB 4HE8A 3ZT7A 2FJEA 2V7LA 2C5KT 2FJBA 3WAKA 2HH7A 3IF8B 1HNZT 2XSBA 4X20E 3C51A 2ACZA 4IDQA 4DMVA 3OYXA 2YU2A 5LG4A 5HCMA 3C4WA 2KWIB 5HEHA 3ZC1A 2W63A 4JI6T 2LOSA 2CXLA 4G2AA 3AAIA 2KINB 5AQFB 5LMUT 5FKYA 3CQXC 4DMWA 5JQGE 3NKZA 2MBGA 2IW5B 4U74A 5JRCA 4XZCA 2CHNA 2W67A 3ZCJA 3ONLC 3UU3A 3UUXB 3K8PC 4HWIB 4ZI2C 1JNRA 2W66A 5J1GA 2V7MA 2WSSV 1LKXA 2ES0A 3C98B 1ZP0A 4WBOA 4EAHA 3GWHA 4ILUA 4U7IA 1OEDC 1W0AA 3ZT6A 2ODUA 2H89A 3ONJA 5J0ZA 1XMQT 1US7B 1UCUA 4ASKA 3N5LA 2LSJA 4BAYB 2I6HA 2ZLYA 1IBKT 4B3ST 4I55E 1HNXT 4JV5T 2UU9T 1MNEA 4IE4A 3FB2A 1WLXA 3P8CD 4OYJA 3S4UA 1CUNA 4O2BE 5LCYA 2Y6XA 4TV9E 1WCRA 4E7SA 1D0XA 2CLYC 2Q9QC 2LKGA 3ZSTA 4QX8B 3CPZA 4I4TE 5LHGB 3PUVF 2ZM2A 4UF0B 4HGAA 4IDNA 4LF8T 4MLKA 3TLTA 5ETWA 1N36T 3AEGA 5JREA 1J1JA 2XY8B 4U2ZA 3N2GE 3AEFA 3RC3A 1G8XA 3N9LA 2LHNA 1L0VA 1FEWA 5JVDE 2XQ9A 2LSGA 4PW8A 4HWFA 2BG9C 4MFRA 3TLSA 2MOZA 2KXPB 2YOEA 3EAMA 4IHJE 4MBQA 3IBPA 3FZFB 2N2NA 3UUBA 1AJ3A 4HFHA 4ZI7E 4IE6A 4WZXA 4IL9A 4Q25A 2BZBA 4EEBA 4B3RT 2LT3A 4HFIA 2VQET 4QXCB 4GIWA 2J47A 5FVLA 2IDOB 2NWBA 4J2CA 3AE5A 2XQ6A 5LBQB 1QSDA 3GMIA 4F8HA 3ZYLA 1N32T 2WDQA 2KMFA 4AQGA 4X66T 2BVMA 5LB7B 2YINA 2XAFB 2W2UA 3KBTA 4Z91A 2BS3A 2NP9A 3OYZA 5ADXL 1UURA 4PK5A 3U3IA 4IDZA 2LE8A 5AQUB 2XM1A 5IHYA 3ZJ2A 4BJMA 2LLYA 2WU2A 2DI4A 4UV8B 5AQMB 2CM0A 3MKDA 3QUJA 2ACXA 3ZMZB 4JI1T 3HKBE 3N9NA 3ZCIA 4IE7A 4JYAT 5EK3A 2HPLA 4O4JE 4LF6T 5ABHA 2W61A 3FZMB 1XDOA 1WRDA 1SE7A 2I0MA 1NENA 5HAXA 2NR4A 3O1HA 4HFEA 5HEOA 5DJQC 5DQVA 5C3JA 2X9YA 2N9DA 3PJAJ 4HWDA 4XAXB 4HN9A 2LSKA 4KX6A 4PFPA 4LMKA 3I0QA 2VKJA 4DR6T 3PUSA 1HFAA 3RRWA 3PUGA 2BS4A 4PNIA 4Z8XA 5BR8T 4AKRB 1ZHCA 2JPFA 1MIWA 3QOFA 2MTQA 3R84B 3N9OA 3CVRA 3H3AA 1YKEB 5CB4E 3KVBA 3HKDE 3NRXA 3PV0F 3LBXB 1HF8A 3RQUA 5A1LA 5LGTB 5BMVE 4TUYE 4YT0A 4O4IE 2XAHB 3M65A 3QNUA 3ANWA 2XAGB 3MJXA 1YKHB 3PUAA 4JEHB 4X64T 3RC8A 1JNZA 5JR9C 2BDEA 2K48A 3N2KE 3T1YT 2AE9A 1UX4A 2V7KA 4HWCA 3G06A 4P1NA 4H9RC 2N1GA 4DV0T 5L4EA 1VCTA 2H7VC 3ZMTB 5H6RB 3F31A 2J62A 3ZN1B 3I1AA 5JDMA 3PUXF 2CWOA 4H9NC 5AQHB 1BR0A 5AQQB 4ERRA 4EGWA 3T1HT 3ANWB 1T72A 3LK2B 3HR0A 4LFAT 2DWKA 4YTNA 2WCAA 1ZKEA 4PJLA 3A7MA 2A2FX 2DCFA 2CPTA 2WWUA 4JI2T 4ISTA 2LM2A 1OEDE 2KZ7B 2VASA 3K3OA 5FMNA 3O1JA 5AQPB 1KK7A 2EHOB 2E8IA 4UVCB 3K3QC 3JC6C 3AXJA 2E9XC 4DR5T 2V1DB 5FY0A 3CX7B 1NAFA 3I9WA 4ZI2D 4NXNT 5DQWA 5FY7A 2XAQB 4DV6T 3AAAB 2DNXA 1OEDA 3SS1A 3RIFA 4ZS2A 4OK0A 5ABEA 2LSIA 3PUQA 5L3CB 3Q5XA 1WYBA 4QKNA 4YLHA 4U31A 3RKOA 2LRKA 3EVYA 5AQIB 5LGNB 3K3NA 4YTMA 4LF5T 2HN1A 4YSYA 5C2TA 1HX1B 2VKOA 2R6GF 4KMCA 4B3TT 1WFDA 2LHRA 2FUPA 4AI6A 3Q5DA 3AXJB 3VR9A 4QH4A 4XBFB 2MAWA 3H3MA 4DR4T 5LA6E 1ZOYA 2XZEA 2X9XA 5JTGA 2L3LA 1MNDA 4YTPA 2WB5A 5AFUL 4L9IA 2X67A 2Q9QA 3MZKB 1M7KA 1OEDB 2XQ4A 4Z90A 5LGUB 4KHPT 2JQQA 2Q9QD 5JDHA 4GKJT 3RYHE 1I6ZA 2NTYA 2DWGA 1YW0A 2D2SA 4DIDB 3IEEA 4M1PA 4TNVA 4AXPA 5AQLB 4H9SE 1MIVA 1N34T 4FJOA 1UGOA 1S94A 2X68A 4QHOA 3ZPOA 3EUHA 2BG9A 1KEYA 4HTEA 4DNDA 5L3GB 2AXDS 2XQ3A 1LVFA 3VRAA 2CLYB 2X0LB 1HTJF 4KHZF 1Z0PA 5FYMA 4PJNA 1W9RA 3J7Yq 3ZMSB 4A5XA 2KT9A 3ZT5A 5M4YA 1T98A 4HFBA 2CHOA 4GYRA 3AE7A 5LNKA 4U72A 4BJNA 2FJAA 4ANJA 3UU5A 3NWIA 2LM9A 4PAGA 1XNQT 3UQ7A 2DHRA 3FZKB 5F8PA 1ZV4X 2CE7A 3V5UA 2IC9A 3MACA 2QGSA 1BR4A 3HA4A 3EDUA 2IUBA 2DL1A 4A98A 2JRKA 4ILCA 4DV5T 3PE0A 2XJ7A 5AQRB 4C90A 5E0OA 2NW8A 3OKQA 5JDLA 3N9PA 4QXHB 5JRCB 1BR1A 4AQYT 5HXCA 3VKGA 4UR9A 2VK9A 1O3XA 1QLBA 3KV9A 3PJAA 4YFSA 2BKPA 1EZ3A 3AECA 3F57A 1QUUA 2UXXB 4X5TA 3TLVA 1FJGT 3ZKRA 3TLUA 4LFCT 4I50E 3RQWA 2K5BB 5H6QB 4KBMB 3RI5A 2CCQA 4AKLA 2WP9A 2X0HA 4JI3T 4NPPA 1IZNB 1HNWT 2LOPA 3ZMVB 2WAUA 1J5WA 2M6BA 4UXNB 2YKSA 2ZMAA 2XQ5A 5KXJA 3PUYF 4QH5A 4EZHA 4TV8E 3LJCA 2CMRA 4OFZA 2WY2A 3R6NA 2NW7A 4CN4A 3P4QA 2VWAA 1XWMA 4OHFA 4YJ3E 1D0ZA 4CI2B 4LFBT 4PFOA 3PU8A 5JR9A 4PJJA 4GOUA 5HYAA 3TKLB 5JH7E 1T7SA 3MXZA 4DV3T 2WBLA 4DR7T 5ABFA 5LYJE 2OA5A 3UQ4A 2CWYA 3KDSE 1I94T 2WU5A 3SRZA 3FBLA 2CBJA 3VU7H 2V6YA 3C50A 4E7ZA 3ZC0A 4AKIA 1Z8UA 4KUMB 1IBMT 4X62T 3BQIA 5F3JA 2SPCA 4AISA 3IHRA 5JDGA 1WR0A 2KNDA 3AA7B 2QYWA 2I59A 4YXDA 2NTXA 1IJ6A 5FNVE 3AA0B 4TWHA 1MMNA 4DO0A 1VCSA 2H88A 3UUNA 5ABFB 4EXTA 3SOLA 3KV5A 3HKCE 5LP6E 3LK3B 5CA1E 4ZHQE 3HI2A 4GKKT 5HCJA 2BKOA 4CN6A 2FJDA 2E9XA 4IL4A 5KMGP 1IJ5A 5JDFA 3EHZA 4L5GA 2X51A 3JC6D 2E9XD 3ZLIA 2PTFA 5HWYA 4IREA 5IYZE 3UTKA 3E0ZA 3Q9DA 1D1AA 3ZEFB 4ISSA 1CHUA 4DV4T 2MYSA 4B6XA 5FXVA 3DJBA 4A56A 2DLRA 4YSXA 3B5MA 4IE0A 4JI7T 2KSRA 3AE3A 5AQNB 4O4LE 4DUZT 3RHWA 4TWFA 3EI0A 4EEDA 2M67A 5FXZA 5LG3A 4G63A 3FHNA 4P09A 2XHEB 4WNKA 2H7OA 4ILAA 4NUUA 2J4GA 4ILBA 2BVLA 2H3RA 4YSZA 4HFDA 3C4ZA
chains in the Genus database with same CATH topology
4B3RT 5LMNT 1HNWT 3T1HT 1IBKT 2VQET 4B3ST 4DR6T 1XNQT 4JI4T 1HNZT 4DR4T 1HNXT 4LFAT 4JV5T 2UU9T 2UUAT 5BR8T 1N32T 4DR2T 2UXCT 4GKKT 4JI2T 4OX9T 5IWAT 4X66T 1N33T 2UUCT 4DV5T 4KHPT 4GKJT 4JI6T 4X65T 2VQFT 4YY3T 4JI5T 4LFBT 4LF9T 4DV7T 4JI0T 4DR1T 5LMUT 4AQYT 1HR0T 4DR5T 4JI8T 4DV4T 1XMOT 1N34T 4LF4T 4DV3T 2E5LT 4B3MT 4LF8T 2HHHT 4DR7T 4X64T 1J5ET 4NXNT 4DV2T 1XNRT 1N36T 4NXMT 4JI1T 1I94T 3T1YT 4JI7T 4DV6T 2ZM6T 1FJGT 4JYAT 4DR3T 4DUZT 4LFCT 2UUBT 4LF6T 2F4VT 4DUYT 1IBMT 3OTOT 2UXBT 1IBLT 4X62T 4LF5T 4YHHT 4DV1T 4DV0T 4LF7T 2UXDT 1XMQT 4B3TT 4JI3T 4K0KT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R T;  5LMN T;  1HNW T;  3T1H T;  1IBK T;  2VQE T;  4B3S T;  4DR6 T;  1XNQ T;  4JI4 T;  1HNZ T;  4DR4 T;  1HNX T;  4LFA T;  4JV5 T;  2UU9 T;  2UUA T;  5BR8 T;  1N32 T;  4DR2 T;  2UXC T;  4GKK T;  4JI2 T;  4OX9 T;  5IWA T;  4X66 T;  1N33 T;  2UUC T;  4DV5 T;  4KHP T;  4GKJ T;  4JI6 T;  4X65 T;  2VQF T;  4YY3 T;  4JI5 T;  4LFB T;  4LF9 T;  4DV7 T;  4JI0 T;  4DR1 T;  5LMU T;  4AQY T;  1HR0 T;  4DR5 T;  4JI8 T;  4DV4 T;  1XMO T;  1N34 T;  4LF4 T;  4DV3 T;  2E5L T;  4B3M T;  4LF8 T;  2HHH T;  4DR7 T;  4X64 T;  1J5E T;  4NXN T;  4DV2 T;  1XNR T;  1N36 T;  4NXM T;  4JI1 T;  1I94 T;  3T1Y T;  4JI7 T;  4DV6 T;  2ZM6 T;  1FJG T;  4JYA T;  4DR3 T;  4DUZ T;  4LFC T;  2UUB T;  4LF6 T;  2F4V T;  4DUY T;  1IBM T;  3OTO T;  2UXB T;  1IBL T;  4X62 T;  4LF5 T;  4YHH T;  4DV1 T;  4DV0 T;  4LF7 T;  2UXD T;  1XMQ T;  4B3T T;  4JI3 T;  4K0K T; 
#chains in the Genus database with same CATH topology
 2XSA A;  3ESL A;  2VL0 A;  3AE9 A;  3J9X 1;  2K9A A;  5L3F B;  4DBR A;  2WDV A;  5HXS A;  5HEU A;  5LHH B;  1M62 A;  4PK6 A;  2WZI A;  5TAO A;  1SUM B;  2K24 A;  3BK9 A;  3O1I A;  1B7T A;  2XQ8 A;  2C5I T;  3O4X E;  4YY3 T;  2VUR A;  4TNW A;  5AQT B;  2A3D A;  1HR0 T;  3SWH A;  2G0U A;  1T8B A;  5L3E B;  2CXD A;  3PU3 A;  4I0U A;  2V5C A;  3CML A;  1W0B A;  4B3M T;  5L3D B;  2IML A;  4JBW F;  3FXD B;  3L39 A;  4ZS3 A;  4UIG A;  1H7C A;  4NXM T;  3GN5 A;  4CI1 B;  3KFW X;  2LJL A;  3ZSS A;  3DTO A;  4ZOL E;  3RX6 A;  3RYC E;  3ETU A;  2NOX A;  3AVR A;  4EIW A;  2YDR A;  2PBI A;  3ETV A;  2X9H A;  3VKH A;  1U4Q A;  4F6R C;  4DBQ A;  4TZ4 C;  3CK6 A;  5FL1 A;  2X0Y A;  2XTL A;  3TLW A;  5CFB A;  4LML A;  2JQK A;  5LHI B;  2L8K A;  1D0Y A;  2Y48 B;  1YD8 G;  4X1I E;  2WMO A;  4ZI3 C;  2P9B A;  2UUA T;  2XQA A;  3V5S A;  1KF6 A;  1HS7 A;  2D0T A;  3UU8 A;  4H9O C;  4TN7 B;  2D0U A;  3UU6 A;  5AQK B;  3MA9 A;  4U3C A;  4AQF C;  2Y8D A;  4H63 H;  3UUM A;  4JEU B;  3IA3 A;  4QH1 A;  1DU2 A;  4CXW A;  3SFE A;  3UFG A;  2BG9 E;  3KBU A;  3QC9 A;  2LRL A;  4CXY A;  4UV9 B;  2QA7 A;  1XNR T;  2L9Q A;  1MMA A;  2PG8 A;  3EDV A;  5AQJ B;  2CEA A;  2NW9 A;  2V6X A;  2VKD A;  2EHO C;  4DR3 T;  3LSV A;  1FIO A;  4MHC A;  4WW0 A;  1FMV A;  3PDY A;  3NBX X;  4DUY T;  3A5X A;  3RPU A;  4EOZ B;  2XUE A;  3P50 A;  4FI5 A;  5KDM C;  1E2A A;  2RP4 A;  3N9M A;  3AE4 A;  4TWD A;  3RLF F;  3AB3 B;  2KLQ A;  2ZM8 A;  4YJ2 E;  4K0K T;  2W0G A;  2Q9Q B;  3Q2M A;  3CWZ B;  2C0S A;  3ZJ1 A;  1E1H B;  4CXX A;  1E7P A;  3P4W A;  4COF A;  1YQ4 A;  1SA0 E;  3NRY A;  4KP3 C;  3KV6 A;  1KNZ A;  3JCF A;  2CRB A;  3AEA A;  4X1Y E;  5IWA T;  2UUC T;  3AA1 B;  5LOV E;  3RIU C;  2V7I A;  5LBM A;  3RIA A;  2CBI A;  1Y64 B;  2HN2 A;  5CGM A;  2BG9 B;  5LJN A;  3RF1 A;  3QK6 A;  2WDR A;  4P0B A;  1YXR A;  3F2E A;  1U5P A;  3L3P A;  3PUR A;  5HXH A;  5HEJ A;  2W4X A;  4UF0 A;  4IDP A;  4U33 A;  2FBW A;  3M3Z B;  3EAB A;  3CX8 B;  3N9Q A;  4L0R A;  1OXZ A;  3P4S A;  3JAF A;  1XZY A;  2V8S V;  2UXB T;  4DV1 T;  3CIR A;  5AQV B;  1D1C A;  1VOM A;  4LF7 T;  4UEM A;  3C64 A;  3FZL B;  5ABG A;  3MK7 C;  2VB6 A;  3FZH B;  5LMN T;  5L47 A;  3NVO A;  1KNR A;  4EYU A;  3AEB A;  3B57 A;  2UXN B;  2WZH A;  2A72 A;  2J1D G;  2PFV A;  5FL0 A;  4IDO A;  2LEH A;  2K3W A;  3CX6 B;  4QWN B;  2B76 A;  4ZZB A;  4OX9 T;  2XAS B;  2V26 A;  3ZYK A;  3CQG B;  5KX5 E;  2V5D A;  2OLT A;  3E08 A;  2OV9 A;  4LF9 T;  4JI0 T;  4DR1 T;  3AE1 A;  1V9D A;  3RKG A;  4ZXL A;  1NEK A;  3L8R A;  2VVS A;  1XMO T;  4H63 V;  5L4H A;  1G73 A;  2XPK A;  4ADZ A;  2JMH A;  2M6I A;  4K0U A;  2YEV C;  5AQS B;  2WWV A;  1X79 A;  3CKD A;  4WBN E;  2YU1 A;  2XQ7 A;  4IT4 A;  2B1E A;  2XM2 A;  3X1D A;  5EZY E;  3QB5 K;  4HWH A;  2VVN A;  1GQE A;  2QVA A;  1LRZ A;  3RGL A;  2F4V T;  3QB5 A;  5AQO B;  1IBL T;  1HCI A;  4EB6 E;  3FXE B;  3PUZ F;  3A8Y C;  3OBV E;  4KI0 F;  4UEL A;  3P7I A;  3C4X A;  4U2Y A;  3W15 B;  3UUL A;  2D5U A;  2IHR 1;  2V7J A;  3LK4 2;  3GA8 A;  1OWA A;  3RRC A;  3AE2 A;  3T8O A;  2ZM0 A;  4HEA A;  2C5J A;  2CXF A;  3KVA A;  3CQC B;  4O8S A;  3OVU A;  5JR9 B;  5FY1 A;  3AAE B;  4HFC A;  1VRB A;  4H9P C;  4MAL A;  1Y01 A;  2VQF T;  4TX5 A;  4QX7 B;  2JMK A;  2WQY A;  3RH3 A;  4C91 A;  2BBJ A;  3WI3 A;  4HKA A;  4EZ4 A;  5HWX A;  4LF4 T;  1UK5 A;  1MMG A;  3ONX A;  2KWH A;  3LBX A;  1J5E T;  2V6Y B;  3N2O A;  1BR2 A;  4AKH A;  3PUW F;  4P0A A;  5LXT E;  5EK2 A;  5C8Y E;  3BQL A;  3Q5E A;  2Z6E A;  4V1A v;  1KFY A;  4WYV A;  3ZYM A;  4LMJ A;  3VRB A;  2E2A A;  3OPC A;  1WYC A;  5DAB A;  5IUX A;  2UXD T;  4AKG A;  1ZEE A;  2LKH A;  4CN1 A;  2MPK A;  1D1B A;  2E5V A;  2YN6 A;  5J2T E;  4GK5 E;  5F5W A;  4ZI3 D;  2E9X B;  3LG7 A;  5JDN A;  5EK4 A;  2JQH A;  1X9B A;  3L09 A;  4AQF A;  2YDQ A;  5CA0 E;  5LJM A;  2W00 A;  4DR2 T;  2UXC T;  3KV4 A;  4GK0 E;  3K1S A;  1NWM X;  1IAP A;  4ZZC A;  4UVA B;  4NUV A;  2QRX A;  4X65 T;  5JDQ A;  3ZMU B;  4JI5 T;  2IAK A;  3DP7 A;  3Q5W A;  5L3B B;  3WAJ A;  2WS3 A;  5AQG B;  3LDQ B;  2EHO A;  1HX8 A;  2IIU A;  2W62 A;  3KIN B;  2VL8 A;  3P4P A;  3P4R A;  2LSY A;  2BKN A;  3AED A;  2WM9 A;  4O2A E;  2EHO D;  5FXW A;  2PJQ A;  5GON E;  1LVK A;  2ZM6 T;  4N78 D;  3JAD A;  2X9W A;  3AEE A;  5J2U E;  1KNP A;  2UUB T;  3UFE A;  4IE5 A;  3JAE A;  1WR6 A;  4CZZ B;  3I9Y A;  3BQK A;  3OTO T;  3I0O A;  1S35 A;  4ZEY A;  4CI3 B;  4IGU A;  3U78 A;  4OYK A;  2YK0 A;  3VHL A;  4IIJ E;  3ABV A;  2JQ9 A;  2CA5 A;  5HEG A;  1XDP A;  4A97 A;  1UUS A;  2XQY A;  3RYI E;  1MIY A;  5L2L A;  3O9X A;  3FBZ A;  3AA6 B;  3NZQ A;  5FP3 A;  4JI4 T;  1HG2 A;  4AIU A;  3AVS A;  1R8I A;  4U7Y A;  4YHJ A;  2BBH A;  2RPA A;  3RIU A;  5HXE A;  4JLE A;  1UX5 A;  5FXX A;  1N33 T;  2XAJ B;  3UT5 E;  4JUY A;  2X66 A;  1HG5 A;  2D9D A;  3D0T A;  4PK4 A;  4EYY R;  3ZN0 B;  4NIQ A;  3AE6 A;  4O4H E;  4DV7 T;  4HFV A;  2ODV A;  3LFM A;  3AE8 A;  3VR8 A;  3GN5 B;  2JIW A;  4BA9 A;  4JI8 T;  4UVB B;  1W09 A;  3UU4 A;  3SFD A;  5FVK A;  4CQI A;  1YQ3 A;  2E5L T;  2HHH T;  4QXB B;  2A9U A;  4I43 B;  2IC6 A;  4DV2 T;  2YDS A;  2JJ9 A;  1FMW A;  3OJA A;  2VKH A;  3H37 A;  2GK9 A;  3E22 E;  3NZP A;  3HL6 A;  2HPJ A;  3B13 A;  5HXR A;  2BS2 A;  1SHZ C;  4EV6 A;  5CJ5 A;  4DVD A;  4H9Q C;  4PJM A;  2WMN A;  4X1K E;  4YHH T;  3HKE E;  3RYF E;  2RA1 A;  1MMD A;  4GYS A;  3PTR B;  4HE8 A;  3ZT7 A;  2FJE A;  2V7L A;  2C5K T;  2FJB A;  3WAK A;  2HH7 A;  3IF8 B;  1HNZ T;  2XSB A;  4X20 E;  3C51 A;  2ACZ A;  4IDQ A;  4DMV A;  3OYX A;  2YU2 A;  5LG4 A;  5HCM A;  3C4W A;  2KWI B;  5HEH A;  3ZC1 A;  2W63 A;  4JI6 T;  2LOS A;  2CXL A;  4G2A A;  3AAI A;  2KIN B;  5AQF B;  5LMU T;  5FKY A;  3CQX C;  4DMW A;  5JQG E;  3NKZ A;  2MBG A;  2IW5 B;  4U74 A;  5JRC A;  4XZC A;  2CHN A;  2W67 A;  3ZCJ A;  3ONL C;  3UU3 A;  3UUX B;  3K8P C;  4HWI B;  4ZI2 C;  1JNR A;  2W66 A;  5J1G A;  2V7M A;  2WSS V;  1LKX A;  2ES0 A;  3C98 B;  1ZP0 A;  4WBO A;  4EAH A;  3GWH A;  4ILU A;  4U7I A;  1OED C;  1W0A A;  3ZT6 A;  2ODU A;  2H89 A;  3ONJ A;  5J0Z A;  1XMQ T;  1US7 B;  1UCU A;  4ASK A;  3N5L A;  2LSJ A;  4BAY B;  2I6H A;  2ZLY A;  1IBK T;  4B3S T;  4I55 E;  1HNX T;  4JV5 T;  2UU9 T;  1MNE A;  4IE4 A;  3FB2 A;  1WLX A;  3P8C D;  4OYJ A;  3S4U A;  1CUN A;  4O2B E;  5LCY A;  2Y6X A;  4TV9 E;  1WCR A;  4E7S A;  1D0X A;  2CLY C;  2Q9Q C;  2LKG A;  3ZST A;  4QX8 B;  3CPZ A;  4I4T E;  5LHG B;  3PUV F;  2ZM2 A;  4UF0 B;  4HGA A;  4IDN A;  4LF8 T;  4MLK A;  3TLT A;  5ETW A;  1N36 T;  3AEG A;  5JRE A;  1J1J A;  2XY8 B;  4U2Z A;  3N2G E;  3AEF A;  3RC3 A;  1G8X A;  3N9L A;  2LHN A;  1L0V A;  1FEW A;  5JVD E;  2XQ9 A;  2LSG A;  4PW8 A;  4HWF A;  2BG9 C;  4MFR A;  3TLS A;  2MOZ A;  2KXP B;  2YOE A;  3EAM A;  4IHJ E;  4MBQ A;  3IBP A;  3FZF B;  2N2N A;  3UUB A;  1AJ3 A;  4HFH A;  4ZI7 E;  4IE6 A;  4WZX A;  4IL9 A;  4Q25 A;  2BZB A;  4EEB A;  4B3R T;  2LT3 A;  4HFI A;  2VQE T;  4QXC B;  4GIW A;  2J47 A;  5FVL A;  2IDO B;  2NWB A;  4J2C A;  3AE5 A;  2XQ6 A;  5LBQ B;  1QSD A;  3GMI A;  4F8H A;  3ZYL A;  1N32 T;  2WDQ A;  2KMF A;  4AQG A;  4X66 T;  2BVM A;  5LB7 B;  2YIN A;  2XAF B;  2W2U A;  3KBT A;  4Z91 A;  2BS3 A;  2NP9 A;  3OYZ A;  5ADX L;  1UUR A;  4PK5 A;  3U3I A;  4IDZ A;  2LE8 A;  5AQU B;  2XM1 A;  5IHY A;  3ZJ2 A;  4BJM A;  2LLY A;  2WU2 A;  2DI4 A;  4UV8 B;  5AQM B;  2CM0 A;  3MKD A;  3QUJ A;  2ACX A;  3ZMZ B;  4JI1 T;  3HKB E;  3N9N A;  3ZCI A;  4IE7 A;  4JYA T;  5EK3 A;  2HPL A;  4O4J E;  4LF6 T;  5ABH A;  2W61 A;  3FZM B;  1XDO A;  1WRD A;  1SE7 A;  2I0M A;  1NEN A;  5HAX A;  2NR4 A;  3O1H A;  4HFE A;  5HEO A;  5DJQ C;  5DQV A;  5C3J A;  2X9Y A;  2N9D A;  3PJA J;  4HWD A;  4XAX B;  4HN9 A;  2LSK A;  4KX6 A;  4PFP A;  4LMK A;  3I0Q A;  2VKJ A;  4DR6 T;  3PUS A;  1HFA A;  3RRW A;  3PUG A;  2BS4 A;  4PNI A;  4Z8X A;  5BR8 T;  4AKR B;  1ZHC A;  2JPF A;  1MIW A;  3QOF A;  2MTQ A;  3R84 B;  3N9O A;  3CVR A;  3H3A A;  1YKE B;  5CB4 E;  3KVB A;  3HKD E;  3NRX A;  3PV0 F;  3LBX B;  1HF8 A;  3RQU A;  5A1L A;  5LGT B;  5BMV E;  4TUY E;  4YT0 A;  4O4I E;  2XAH B;  3M65 A;  3QNU A;  3ANW A;  2XAG B;  3MJX A;  1YKH B;  3PUA A;  4JEH B;  4X64 T;  3RC8 A;  1JNZ A;  5JR9 C;  2BDE A;  2K48 A;  3N2K E;  3T1Y T;  2AE9 A;  1UX4 A;  2V7K A;  4HWC A;  3G06 A;  4P1N A;  4H9R C;  2N1G A;  4DV0 T;  5L4E A;  1VCT A;  2H7V C;  3ZMT B;  5H6R B;  3F31 A;  2J62 A;  3ZN1 B;  3I1A A;  5JDM A;  3PUX F;  2CWO A;  4H9N C;  5AQH B;  1BR0 A;  5AQQ B;  4ERR A;  4EGW A;  3T1H T;  3ANW B;  1T72 A;  3LK2 B;  3HR0 A;  4LFA T;  2DWK A;  4YTN A;  2WCA A;  1ZKE A;  4PJL A;  3A7M A;  2A2F X;  2DCF A;  2CPT A;  2WWU A;  4JI2 T;  4IST A;  2LM2 A;  1OED E;  2KZ7 B;  2VAS A;  3K3O A;  5FMN A;  3O1J A;  5AQP B;  1KK7 A;  2EHO B;  2E8I A;  4UVC B;  3K3Q C;  3JC6 C;  3AXJ A;  2E9X C;  4DR5 T;  2V1D B;  5FY0 A;  3CX7 B;  1NAF A;  3I9W A;  4ZI2 D;  4NXN T;  5DQW A;  5FY7 A;  2XAQ B;  4DV6 T;  3AAA B;  2DNX A;  1OED A;  3SS1 A;  3RIF A;  4ZS2 A;  4OK0 A;  5ABE A;  2LSI A;  3PUQ A;  5L3C B;  3Q5X A;  1WYB A;  4QKN A;  4YLH A;  4U31 A;  3RKO A;  2LRK A;  3EVY A;  5AQI B;  5LGN B;  3K3N A;  4YTM A;  4LF5 T;  2HN1 A;  4YSY A;  5C2T A;  1HX1 B;  2VKO A;  2R6G F;  4KMC A;  4B3T T;  1WFD A;  2LHR A;  2FUP A;  4AI6 A;  3Q5D A;  3AXJ B;  3VR9 A;  4QH4 A;  4XBF B;  2MAW A;  3H3M A;  4DR4 T;  5LA6 E;  1ZOY A;  2XZE A;  2X9X A;  5JTG A;  2L3L A;  1MND A;  4YTP A;  2WB5 A;  5AFU L;  4L9I A;  2X67 A;  2Q9Q A;  3MZK B;  1M7K A;  1OED B;  2XQ4 A;  4Z90 A;  5LGU B;  4KHP T;  2JQQ A;  2Q9Q D;  5JDH A;  4GKJ T;  3RYH E;  1I6Z A;  2NTY A;  2DWG A;  1YW0 A;  2D2S A;  4DID B;  3IEE A;  4M1P A;  4TNV A;  4AXP A;  5AQL B;  4H9S E;  1MIV A;  1N34 T;  4FJO A;  1UGO A;  1S94 A;  2X68 A;  4QHO A;  3ZPO A;  3EUH A;  2BG9 A;  1KEY A;  4HTE A;  4DND A;  5L3G B;  2AXD S;  2XQ3 A;  1LVF A;  3VRA A;  2CLY B;  2X0L B;  1HTJ F;  4KHZ F;  1Z0P A;  5FYM A;  4PJN A;  1W9R A;  3J7Y q;  3ZMS B;  4A5X A;  2KT9 A;  3ZT5 A;  5M4Y A;  1T98 A;  4HFB A;  2CHO A;  4GYR A;  3AE7 A;  5LNK A;  4U72 A;  4BJN A;  2FJA A;  4ANJ A;  3UU5 A;  3NWI A;  2LM9 A;  4PAG A;  1XNQ T;  3UQ7 A;  2DHR A;  3FZK B;  5F8P A;  1ZV4 X;  2CE7 A;  3V5U A;  2IC9 A;  3MAC A;  2QGS A;  1BR4 A;  3HA4 A;  3EDU A;  2IUB A;  2DL1 A;  4A98 A;  2JRK A;  4ILC A;  4DV5 T;  3PE0 A;  2XJ7 A;  5AQR B;  4C90 A;  5E0O A;  2NW8 A;  3OKQ A;  5JDL A;  3N9P A;  4QXH B;  5JRC B;  1BR1 A;  4AQY T;  5HXC A;  3VKG A;  4UR9 A;  2VK9 A;  1O3X A;  1QLB A;  3KV9 A;  3PJA A;  4YFS A;  2BKP A;  1EZ3 A;  3AEC A;  3F57 A;  1QUU A;  2UXX B;  4X5T A;  3TLV A;  1FJG T;  3ZKR A;  3TLU A;  4LFC T;  4I50 E;  3RQW A;  2K5B B;  5H6Q B;  4KBM B;  3RI5 A;  2CCQ A;  4AKL A;  2WP9 A;  2X0H A;  4JI3 T;  4NPP A;  1IZN B;  1HNW T;  2LOP A;  3ZMV B;  2WAU A;  1J5W A;  2M6B A;  4UXN B;  2YKS A;  2ZMA A;  2XQ5 A;  5KXJ A;  3PUY F;  4QH5 A;  4EZH A;  4TV8 E;  3LJC A;  2CMR A;  4OFZ A;  2WY2 A;  3R6N A;  2NW7 A;  4CN4 A;  3P4Q A;  2VWA A;  1XWM A;  4OHF A;  4YJ3 E;  1D0Z A;  4CI2 B;  4LFB T;  4PFO A;  3PU8 A;  5JR9 A;  4PJJ A;  4GOU A;  5HYA A;  3TKL B;  5JH7 E;  1T7S A;  3MXZ A;  4DV3 T;  2WBL A;  4DR7 T;  5ABF A;  5LYJ E;  2OA5 A;  3UQ4 A;  2CWY A;  3KDS E;  1I94 T;  2WU5 A;  3SRZ A;  3FBL A;  2CBJ A;  3VU7 H;  2V6Y A;  3C50 A;  4E7Z A;  3ZC0 A;  4AKI A;  1Z8U A;  4KUM B;  1IBM T;  4X62 T;  3BQI A;  5F3J A;  2SPC A;  4AIS A;  3IHR A;  5JDG A;  1WR0 A;  2KND A;  3AA7 B;  2QYW A;  2I59 A;  4YXD A;  2NTX A;  1IJ6 A;  5FNV E;  3AA0 B;  4TWH A;  1MMN A;  4DO0 A;  1VCS A;  2H88 A;  3UUN A;  5ABF B;  4EXT A;  3SOL A;  3KV5 A;  3HKC E;  5LP6 E;  3LK3 B;  5CA1 E;  4ZHQ E;  3HI2 A;  4GKK T;  5HCJ A;  2BKO A;  4CN6 A;  2FJD A;  2E9X A;  4IL4 A;  5KMG P;  1IJ5 A;  5JDF A;  3EHZ A;  4L5G A;  2X51 A;  3JC6 D;  2E9X D;  3ZLI A;  2PTF A;  5HWY A;  4IRE A;  5IYZ E;  3UTK A;  3E0Z A;  3Q9D A;  1D1A A;  3ZEF B;  4ISS A;  1CHU A;  4DV4 T;  2MYS A;  4B6X A;  5FXV A;  3DJB A;  4A56 A;  2DLR A;  4YSX A;  3B5M A;  4IE0 A;  4JI7 T;  2KSR A;  3AE3 A;  5AQN B;  4O4L E;  4DUZ T;  3RHW A;  4TWF A;  3EI0 A;  4EED A;  2M67 A;  5FXZ A;  5LG3 A;  4G63 A;  3FHN A;  4P09 A;  2XHE B;  4WNK A;  2H7O A;  4ILA A;  4NUU A;  2J4G A;  4ILB A;  2BVL A;  2H3R A;  4YSZ A;  4HFD A;  3C4Z A; 
#chains in the Genus database with same CATH homology
 4B3R T;  5LMN T;  1HNW T;  3T1H T;  1IBK T;  2VQE T;  4B3S T;  4DR6 T;  1XNQ T;  4JI4 T;  1HNZ T;  4DR4 T;  1HNX T;  4LFA T;  4JV5 T;  2UU9 T;  2UUA T;  5BR8 T;  1N32 T;  4DR2 T;  2UXC T;  4GKK T;  4JI2 T;  4OX9 T;  5IWA T;  4X66 T;  1N33 T;  2UUC T;  4DV5 T;  4KHP T;  4GKJ T;  4JI6 T;  4X65 T;  2VQF T;  4YY3 T;  4JI5 T;  4LFB T;  4LF9 T;  4DV7 T;  4JI0 T;  4DR1 T;  5LMU T;  4AQY T;  1HR0 T;  4DR5 T;  4JI8 T;  4DV4 T;  1XMO T;  1N34 T;  4LF4 T;  4DV3 T;  2E5L T;  4B3M T;  4LF8 T;  2HHH T;  4DR7 T;  4X64 T;  1J5E T;  4NXN T;  4DV2 T;  1XNR T;  1N36 T;  4NXM T;  4JI1 T;  1I94 T;  3T1Y T;  4JI7 T;  4DV6 T;  2ZM6 T;  1FJG T;  4JYA T;  4DR3 T;  4DUZ T;  4LFC T;  2UUB T;  4LF6 T;  2F4V T;  4DUY T;  1IBM T;  3OTO T;  2UXB T;  1IBL T;  4X62 T;  4LF5 T;  4YHH T;  4DV1 T;  4DV0 T;  4LF7 T;  2UXD T;  1XMQ T;  4B3T T;  4JI3 T;  4K0K T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...