2E5LT

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2e5lT00
4LFCT 1FJGT 4KHPT 3T1HT 2UUAT 4B3RT 3OTOT 1HR0T 4JI4T 1XMQT 2UXDT 4X64T 5LMNT 4DV2T 4JI0T 1IBKT 4LF4T 4YHHT 4JI7T 4DR2T 4LF8T 4DV7T 4JYAT 4JI5T 1HNZT 4DR4T 4DUYT 4DV3T 2UUCT 1IBLT 4B3MT 4GKJT 4DR1T 3T1YT 4B3TT 1J5ET 1N33T 2E5LT 1XNRT 1N32T 4AQYT 4DV1T 2F4VT 4K0KT 4DV6T 4JI1T 4DR7T 1XNQT 4GKKT 2UUBT 2VQFT 4DV5T 4LF5T 4JV5T 2HHHT 5IWAT 4X65T 4JI8T 1HNXT 2VQET 4LFAT 4JI3T 4DR5T 2ZM6T 4DUZT 4DV4T 4LF6T 4LF7T 4DR3T 4NXMT 1XMOT 4B3ST 5LMUT 4LFBT 1I94T 2UXCT 1HNWT 4X62T 2UU9T 4LF9T 4X66T 1N36T 4DR6T 4YY3T 2UXBT 4JI6T 4NXNT 4JI2T 5BR8T 4OX9T 1N34T 1IBMT 4DV0T
chains in the Genus database with same CATH superfamily
4IHJE 1J5WA 2LM9A 2M67A 5J1GA 2XAJB 3MKDA 2UUAT 1NAFA 3AE4A 4JI4T 3U78A 1WFDA 2J1DG 2XTLA 4YHJA 1D1CA 4JI7T 4IL4A 2X9XA 4HEAA 2L8KA 3ONJA 3U3IA 3VR9A 3F57A 3RLFF 4MALA 4WNKA 2UUCT 1QUUA 2K3WA 2N9DA 4Z8XA 3AA0B 3AEEA 3AE5A 4F6RC 2K24A 2KWIB 3P7IA 2E9XB 2H88A 4DV1T 2X9WA 4DBQA 5L4EA 4JEUB 5FXVA 4DIDB 4GKKT 1MMDA 2ZMAA 4OYKA 1T72A 1SA0E 4IL9A 3TLSA 4TV9E 2BKPA 4UF0A 2ZM6T 3ETUA 4PW8A 3N2OA 1QLBA 2X9YA 2LLYA 1YQ4A 2CLYC 1X9BA 4JUYA 4Z90A 4A5XA 5FVLA 2A2FX 3CQXC 4JI6T 5LA6E 4YLHA 3FZFB 3ONLC 5L2LA 2CWOA 1NENA 1M7KA 3KV5A 5LGNB 5LGTB 3H37A 2Q9QC 3C50A 2XQYA 4AKIA 4YTNA 4X64T 2B1EA 3Q5EA 3X1DA 3FBZA 4LF8T 4I4TE 4CXYA 1WR0A 4EIWA 2LOSA 5AFUL 5HEJA 2XAQB 5DQWA 1IJ6A 2J4GA 5L3BB 3KFWX 3WAKA 3NZQA 3PUWF 4TWHA 3AE7A 4I43B 4DR7T 4U74A 3RC8A 4IE4A 2V7MA 3RKOA 2YU1A 4IE0A 2VQET 3HR0A 2W2UA 5HWXA 2I6HA 2VL8A 5AQPB 3SWHA 3UU5A 3PUVF 1ZEEA 1ZOYA 2CEAA 3ZMTB 3GA8A 2X68A 3VR8A 2BBJA 3W15B 5CA1E 3B57A 3JAEA 3PV0F 5F5WA 1Z8UA 2H7VC 5AQRB 3JCFA 3PU8A 3UU3A 4U2ZA 5DABA 5HXEA 1Y01A 2VKJA 4H9PC 4JEHB 2BG9A 2LRLA 4ZZCA 5H6RB 4AISA 2W67A 1HR0T 5AQMB 3MXZA 4TNWA 4XAXB 3GWHA 5LOVE 2JQKA 5IYZE 5LHGB 3FZKB 3KV9A 1W9RA 5KMGP 3F31A 4EV6A 1DU2A 3RYIE 4DV7T 3PUZF 3UUMA 4H63H 4QXCB 2WCAA 2NW9A 2A9UA 1IBLT 5FL1A 3EDUA 4OFZA 4P1NA 2LJLA 4EGWA 2W4XA 4KI0F 5AQLB 4AQYT 3N9OA 2V1DB 4MLKA 1HS7A 3K3OA 3L3PA 4U7IA 1VRBA 3B5MA 3SFDA 5KX5E 5F3JA 3Q5DA 2VKOA 4AIUA 3RIFA 4X65T 4YXDA 1HNXT 2NW8A 5J2TE 3AEBA 4ZI2C 4DUZT 2V26A 5AQHB 5HWYA 2XQ3A 3H3MA 3FHNA 4KP3C 4CI1B 2OV9A 5L3EB 3KINB 5EK4A 4IDNA 5GONE 4PJMA 2X67A 3CWZB 4DR6T 3PDYA 4JI2T 3K1SA 5LNKA 3UULA 4AQFA 1CUNA 5EZYE 5ABFB 4OHFA 3MZKB 3A8YC 2XQ7A 2XUEA 4C90A 3ZCJA 3OTOT 3CQGB 5FY1A 2JPFA 3RH3A 2KLQA 5AQJB 3SS1A 2WSSV 5C8YE 2XAGB 3CX8B 4CZZB 4DBRA 2M6BA 2DWGA 3NBXX 3JC6D 4TZ4C 4DUYT 1WLXA 5LYJE 2MPKA 3LG7A 4CI2B 4CI3B 4MHCA 1N33T 3GN5A 4G63A 3N9PA 4QX7B 3O9XA 4ILUA 5AQFB 3CIRA 4DV6T 4I55E 4HWFA 3N9NA 2P9BA 2QA7A 5L4HA 2E9XD 1CHUA 5EK2A 2V5CA 5HEHA 3Q5WA 2CBJA 4HKAA 2BS3A 4WW0A 3P8CD 4DR5T 3NKZA 1HG2A 4UF0B 3R84B 4B3ST 3TKLB 3C4ZA 2WP9A 1W09A 4DMVA 2RPAA 4QX8B 2FJBA 5JDQA 4J2CA 2ACXA 2VK9A 4IIJE 5LXTE 1YD8G 2BVLA 5FMNA 2BS2A 1T98A 4OYJA 4HWHA 1UX5A 2IIUA 2C5KT 3VU7H 1WR6A 4PK5A 3P4WA 2UXDT 2BDEA 1KK7A 3Q9DA 4YSYA 2BS4A 2PBIA 3HL6A 2XAFB 2V8SV 4DNDA 2J62A 1HNZT 5LB7B 4IGUA 2V7KA 1H7CA 3PU3A 3OVUA 3IBPA 5JVDE 2YEVC 2XQ5A 4GK5E 1EZ3A 1XZYA 3UQ7A 2K9AA 3P4QA 5LG3A 2YK0A 1FEWA 1N32T 2D9DA 5JDFA 1SUMB 3UU4A 4WZXA 2E5VA 2XPKA 4YTMA 2X66A 4TNVA 2WWVA 2IAKA 4LF6T 4ZHQE 2FJEA 2DI4A 5FXZA 3ETVA 1S35A 5LMUT 2WZHA 3A7MA 3O1IA 1HNWT 2X51A 2QRXA 5F8PA 3R6NA 1J1JA 2ACZA 2FJAA 4QH4A 4HFDA 4NXNT 4UIGA 4U72A 1I6ZA 1IBMT 2NW7A 3E22E 2CHNA 5LHIB 2X0LB 3JADA 3AA1B 2BG9B 2RA1A 5AQNB 1HCIA 4LF4T 3ZSTA 4YHHT 2NR4A 5ABFA 2MBGA 5ETWA 4U7YA 5J0ZA 5FXWA 2E9XC 3P4RA 1YW0A 2YU2A 2DL1A 2GK9A 4TX5A 4EYYR 2UXNB 2V7JA 5IUXA 3PUYF 2CHOA 1MNDA 4U3CA 1UX4A 4KX6A 1X79A 4EZ4A 2IDOB 1FMVA 2SPCA 1E7PA 2HHHT 3N9MA 3LK2B 2LKHA 4ZS2A 4YJ2E 3C4WA 5JDNA 4H9QC 3I0OA 1XDPA 4LMLA 2JQHA 4HFEA 2OA5A 4LMKA 4EZHA 4PFOA 4A97A 3WAJA 4QXBB 2A3DA 4UXNB 5E0OA 5AQOB 2Y48B 4KBMB 2XZEA 1HX8A 5AQKB 3FZLB 4X66T 3DP7A 3L09A 3AE8A 3WI3A 1D1AA 5AQSB 4YSXA 2PJQA 2KINB 4UEMA 3CPZA 3P4PA 1MMAA 4ANJA 2VURA 5HXCA 2JRKA 2X9HA 4U2YA 5ABEA 2CA5A 2CXDA 4NIQA 2BBHA 2D0UA 2MYSA 3RQUA 4B6XA 3PUGA 1KEYA 4A98A 4I50E 3LK3B 4DVDA 4ZI2D 1FIOA 5DQVA 3CK6A 2VVNA 1XDOA 3AXJA 3ESLA 4X1KE 3ZC0A 3QOFA 2E5LT 2ES0A 2QVAA 4A56A 3KV6A 3GN5B 5HXRA 4ISTA 2X0YA 2X0HA 2VASA 4H9OC 5KXJA 3UUNA 5EK3A 2XSBA 4AQGA 3PTRB 2XQAA 4DV4T 3TLUA 1VCTA 2XASB 2IHR1 1MIVA 3LBXB 2XQ6A 5C3JA 2Y8DA 5JH7E 1FMWA 4ILBA 1N36T 4HFBA 2EHOB 3AEAA 5J2UE 1UK5A 4HGAA 3VKGA 4BA9A 5LCYA 3PE0A 2QGSA 5JR9B 1LVFA 4MBQA 4GOUA 1FJGT 2LE8A 3PURA 1MMNA 2L3LA 2J47A 3BQKA 5A1LA 3AE6A 1ZP0A 4IDQA 3UU8A 4ZOLE 4DMWA 2NOXA 4FJOA 4CN1A 1W0BA 2KWHA 3F2EA 3J7Yq 4HTEA 2FJDA 2H89A 3LK42 2XJ7A 5HCJA 4DV3T 3CMLA 2W62A 4QWNB 2WWUA 3B13A 4K0UA 4KMCA 2YN6A 3AEDA 4K0KT 3N9QA 4COFA 5FKYA 3ANWA 5AQVB 2UUBT 2VQFT 2IMLA 1WRDA 4EYUA 2DWKA 2YDRA 3UU6A 3MA9A 2H3RA 4HWDA 3ZMSB 3GMIA 3RX6A 5L3GB 2XHEB 2G0UA 2D5UA 1I94T 5LBQB 4X62T 3CX6B 4ZI7E 2QYWA 3ZCIA 5HYAA 2W0GA 2IC9A 1T7SA 4JBWF 5LP6E 3TLVA 4DV0T 3NWIA 3AEFA 4M1PA 2WDQA 3RRCA 3RIUA 3ZYMA 4HFIA 4ZI3C 4HWIB 2N1GA 1ZHCA 1IBKT 4O2BE 2WU2A 3NVOA 5FY0A 4TUYE 4XBFB 1Y64B 3IA3A 5FY7A 2JMKA 2WB5A 2CBIA 2UXXB 4PJNA 1SHZC 4L0RA 2LSKA 3NZPA 3HKDE 2W63A 4B3TT 1OXZA 1WYCA 3AEGA 2NP9A 2BG9E 2F4VT 1YKHB 3N2GE 2LHNA 1E1HB 2RP4A 3C98B 3O1JA 4O8SA 1UURA 3L39A 4JV5T 1KF6A 2CMRA 3AAIA 3O1HA 4L9IA 2ODUA 4JI8T 2LEHA 2KXPB 3E0ZA 3AA7B 4IDPA 3AECA 3OYXA 4QXHB 3RI5A 3T8OA 2YINA 3QUJA 4KUMB 1NWMX 2UXBT 4G2AA 3SRZA 4U31A 4AKHA 2LM2A 3LBXA 2WAUA 4KHPT 3OJAA 1BR0A 3RGLA 2EHOA 1AJ3A 1UCUA 5DJQC 3AAEB 3QB5K 2DLRA 4O4HE 4ERRA 1L0VA 4DR2T 2Q9QA 2K5BB 4O2AE 2D0TA 5JR9A 2JQ9A 2KSRA 3TLWA 2D2SA 4Z91A 4JYAT 2IC6A 1HG5A 3AE2A 4GKJT 3CX7B 4OK0A 4QH1A 2Y6XA 3AXJB 1OEDB 1HFAA 5LGUB 5HCMA 3VRBA 4HFCA 2N2NA 3N5LA 3QB5A 3IHRA 2W61A 1MIYA 2NTXA 3AVRA 4UV8B 5CFBA 2A72A 4IREA 3KVAA 1IZNB 4PAGA 4LF7T 1JNZA 1XMOT 3FZHB 2IW5B 3LSVA 3RYFE 4N78D 4PK4A 4LFBT 5FVKA 4LF9T 2LHRA 2NWBA 1E2AA 2JMHA 2V7LA 5HXSA 3PJAA 2KT9A 3FXDB 2BG9C 3UUBA 2LSYA 5H6QB 3FZMB 5JQGE 4ZEYA 2CWYA 3FBLA 3TLTA 3PJAJ 2WDRA 3RHWA 2W66A 4KHZF 5TAOA 4YTPA 5L47A 2LT3A 2WY2A 3LDQB 4NUVA 3ZT5A 3BQLA 4NUUA 1YXRA 3S4UA 3EAMA 4L5GA 3NRXA 2HH7A 3Q5XA 3VRAA 4ILAA 3G06A 3C4XA 2VWAA 4JI1T 3EHZA 2HPLA 2XSAA 3ZYKA 4BAYB 4LF5T 1D0YA 2MOZA 3ANWB 5FL0A 5JREA 3KV4A 4EEDA 2YDQA 4JI3T 3HKCE 4ADZA 2JIWA 2XQ4A 3RIUC 3ZMVB 3UUXB 2W00A 1G8XA 2UXCT 1S94A 2XQ9A 3K3NA 4IE5A 4IDZA 5IHYA 3EDVA 3HI2A 3N9LA 4AQFC 4P0BA 4PK6A 4P0AA 1VOMA 3RKGA 4O4LE 1KFYA 3C51A 1D0XA 2H7OA 3AAAB 4GYRA 4YSZA 2WS3A 4EB6E 4UVCB 2PFVA 2CXLA 3EI0A 3ZKRA 3EVYA 4YFSA 5LJMA 1KNRA 2WQYA 4YT0A 1HF8A 4DV2T 3VKHA 1MMGA 3AE9A 5CA0E 4HFVA 5C2TA 2YKSA 2WM9A 1JNRA 2LSGA 1BR1A 3MACA 2V5DA 1QSDA 3HKBE 5HXHA 2VVSA 1XWMA 3UFEA 1D0ZA 1R8IA 2V6XA 4PNIA 4MFRA 1V9DA 4B3MT 5FNVE 4V1Av 3T1YT 4PJLA 3O4XE 3BK9A 4ILCA 3CKDA 2LRKA 2WDVA 3M3ZB 3ZC1A 2CCQA 2CPTA 1XNQT 4C91A 1LKXA 2WU5A 2WMOA 5LJNA 3P50A 1HX1B 2M6IA 5L3CB 4ZI3D 1D1BA 2VKHA 5L3FB 3OPCA 3QK6A 1OEDA 3I0QA 4DR3T 2XAHB 5JDMA 2EHOC 4NXMT 3ZT7A 3QC9A 1O3XA 4UVBB 3KBUA 3PUQA 4UVAB 2L9QA 4CXXA 3PUSA 2UU9T 2HN1A 2LKGA 3M65A 5JR9C 2VL0A 4H9SE 2Z6EA 3RRWA 2PTFA 4AKGA 5CGMA 1Z0PA 2CLYB 5JRCA 3RF1A 4X1IE 2ZM0A 2KNDA 2I59A 4XZCA 2ZLYA 3UQ4A 3HA4A 3AB3B 4JI0T 1KNZA 4TWFA 2Q9QB 4UR9A 2AXDS 3OYZA 2LSJA 5JDGA 3MJXA 4DR1T 1VCSA 5HEUA 2WMNA 2XM1A 2C5JA 5AQIB 3VHLA 1IAPA 4EOZB 5IWAT 4FI5A 5JTGA 3RYCE 1W0AA 3KDSE 2FBWA 2KMFA 1KNPA 4BJNA 4DO0A 2V6YB 2PG8A 4AKRB 2BZBA 2CXFA 1OEDE 2E8IA 4E7ZA 3OBVE 1G73A 3NRYA 4O4JE 4TV8E 1N34T 5AQUB 3IF8B 3PUAA 3DJBA 2HN2A 4LFCT 1YQ3A 5HEOA 3KVBA 3ZJ2A 2I0MA 2VB6A 2DNXA 2KZ7B 5ABGA 1XMQT 4X1YE 4O4IE 3ZYLA 5HAXA 5LMNT 3CVRA 2ZM8A 3C64A 3I1AA 4ZS3A 5AQGB 2ODVA 4WBNE 4DR4T 3IEEA 4HWCA 3FXEB 4YJ3E 4WBOA 1ZKEA 2E2AA 2E9XA 3I9YA 3RIAA 2DCFA 1J5ET 2OLTA 3I9WA 4AI6A 5JDHA 1XNRT 3RQWA 5BMVE 1YKEB 4UV9B 1GQEA 1LVKA 1M62A 3RYHE 1U5PA 2CM0A 4HFHA 1MIWA 4QHOA 4HE8A 1OWAA 4EAHA 2JJ9A 3BQIA 3UTKA 4WYVA 4AXPA 5JDLA 4IE7A 4PFPA 4IT4A 2BKOA 3PUXF 3J9X1 4NPPA 3ZLIA 4JLEA 3MK7C 1NEKA 3ZSSA 4EXTA 1BR2A 3ZEFB 3EABA 3ZMZB 5ABHA 5KDMC 3T1HT 3DTOA 2MTQA 4GK0E 1WCRA 4ZZBA 4ISSA 5AQTB 3H3AA 3ZPOA 3ZJ1A 1OEDC 4E7SA 1US7B 3ZN0B 1MNEA 4CQIA 1B7TA 1WYBA 4BJMA 2CRBA 1LRZA 5L3DB 4CN4A 2CE7A 4H9RC 3AE3A 3EUHA 3ZMUB 4CXWA 3L8RA 2YOEA 2K48A 4DV5T 2V7IA 4IDOA 5LBMA 2XY8B 3SFEA 3V5UA 5M4YA 4H63V 3K8PC 4GIWA 2B76A 2C5IT 4F8HA 4UELA 3P4SA 4IE6A 4YY3T 3D0TA 3Q2MA 3KBTA 1HTJF 3K3QC 3N2KE 4OX9T 3UT5E 2V6YA 5LHHB 4I0UA 4ZXLA 4LMJA 5FP3A 5LG4A 1UGOA 3UFGA 3AVSA 4X5TA 4B3RT 5JRCB 3A5XA 4Q25A 3OKQA 5HEGA 5CJ5A 4U33A 2BVMA 2MAWA 3QNUA 3AA6B 2EHOD 3AE1A 4JI5T 3JAFA 3SOLA 3E08A 2WBLA 2VKDA 4X20E 3ZT6A 3FB2A 2AE9A 2Q9QD 1ZV4X 2BKNA 2XM2A 3RC3A 1BR4A 2LSIA 5FYMA 1UUSA 4CN6A 3CQCB 3ZN1B 2IUBA 4EEBA 2WZIA 2NTYA 1T8BA 5FXXA 4QKNA 2R6GF 4TN7B 4GYSA 5CB4E 4PJJA 3LFMA 3ONXA 4AKLA 4LFAT 2JQQA 2DHRA 3HKEE 3RPUA 4ASKA 3ABVA 2C0SA 4QH5A 3JC6C 3LJCA 4H9NC 1IJ5A 4HN9A 2XQ8A 5ADXL 3V5SA 2YDSA 2ZM2A 5AQQB 5BR8T 1SE7A 4P09A 2HPJA 2FUPA 4TWDA 2LOPA 1U4QA
chains in the Genus database with same CATH topology
4LFCT 1FJGT 4KHPT 3T1HT 2UUAT 4B3RT 3OTOT 1HR0T 4JI4T 1XMQT 2UXDT 4X64T 5LMNT 4DV2T 4JI0T 1IBKT 4LF4T 4YHHT 4JI7T 4DR2T 4LF8T 4DV7T 4JYAT 4JI5T 1HNZT 4DR4T 4DUYT 4DV3T 2UUCT 1IBLT 4B3MT 4GKJT 4DR1T 3T1YT 4B3TT 1J5ET 1N33T 2E5LT 1XNRT 1N32T 4AQYT 4DV1T 2F4VT 4K0KT 4DV6T 4JI1T 4DR7T 1XNQT 4GKKT 2UUBT 2VQFT 4DV5T 4LF5T 4JV5T 2HHHT 5IWAT 4X65T 4JI8T 1HNXT 2VQET 4LFAT 4JI3T 4DR5T 2ZM6T 4DUZT 4DV4T 4LF6T 4LF7T 4DR3T 4NXMT 1XMOT 4B3ST 5LMUT 4LFBT 1I94T 2UXCT 1HNWT 4X62T 2UU9T 4LF9T 4X66T 1N36T 4DR6T 4YY3T 2UXBT 4JI6T 4NXNT 4JI2T 5BR8T 4OX9T 1N34T 1IBMT 4DV0T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC T;  1FJG T;  4KHP T;  3T1H T;  2UUA T;  4B3R T;  3OTO T;  1HR0 T;  4JI4 T;  1XMQ T;  2UXD T;  4X64 T;  5LMN T;  4DV2 T;  4JI0 T;  1IBK T;  4LF4 T;  4YHH T;  4JI7 T;  4DR2 T;  4LF8 T;  4DV7 T;  4JYA T;  4JI5 T;  1HNZ T;  4DR4 T;  4DUY T;  4DV3 T;  2UUC T;  1IBL T;  4B3M T;  4GKJ T;  4DR1 T;  3T1Y T;  4B3T T;  1J5E T;  1N33 T;  2E5L T;  1XNR T;  1N32 T;  4AQY T;  4DV1 T;  2F4V T;  4K0K T;  4DV6 T;  4JI1 T;  4DR7 T;  1XNQ T;  4GKK T;  2UUB T;  2VQF T;  4DV5 T;  4LF5 T;  4JV5 T;  2HHH T;  5IWA T;  4X65 T;  4JI8 T;  1HNX T;  2VQE T;  4LFA T;  4JI3 T;  4DR5 T;  2ZM6 T;  4DUZ T;  4DV4 T;  4LF6 T;  4LF7 T;  4DR3 T;  4NXM T;  1XMO T;  4B3S T;  5LMU T;  4LFB T;  1I94 T;  2UXC T;  1HNW T;  4X62 T;  2UU9 T;  4LF9 T;  4X66 T;  1N36 T;  4DR6 T;  4YY3 T;  2UXB T;  4JI6 T;  4NXN T;  4JI2 T;  5BR8 T;  4OX9 T;  1N34 T;  1IBM T;  4DV0 T; 
#chains in the Genus database with same CATH topology
 4IHJ E;  1J5W A;  2LM9 A;  2M67 A;  5J1G A;  2XAJ B;  3MKD A;  2UUA T;  1NAF A;  3AE4 A;  4JI4 T;  3U78 A;  1WFD A;  2J1D G;  2XTL A;  4YHJ A;  1D1C A;  4JI7 T;  4IL4 A;  2X9X A;  4HEA A;  2L8K A;  3ONJ A;  3U3I A;  3VR9 A;  3F57 A;  3RLF F;  4MAL A;  4WNK A;  2UUC T;  1QUU A;  2K3W A;  2N9D A;  4Z8X A;  3AA0 B;  3AEE A;  3AE5 A;  4F6R C;  2K24 A;  2KWI B;  3P7I A;  2E9X B;  2H88 A;  4DV1 T;  2X9W A;  4DBQ A;  5L4E A;  4JEU B;  5FXV A;  4DID B;  4GKK T;  1MMD A;  2ZMA A;  4OYK A;  1T72 A;  1SA0 E;  4IL9 A;  3TLS A;  4TV9 E;  2BKP A;  4UF0 A;  2ZM6 T;  3ETU A;  4PW8 A;  3N2O A;  1QLB A;  2X9Y A;  2LLY A;  1YQ4 A;  2CLY C;  1X9B A;  4JUY A;  4Z90 A;  4A5X A;  5FVL A;  2A2F X;  3CQX C;  4JI6 T;  5LA6 E;  4YLH A;  3FZF B;  3ONL C;  5L2L A;  2CWO A;  1NEN A;  1M7K A;  3KV5 A;  5LGN B;  5LGT B;  3H37 A;  2Q9Q C;  3C50 A;  2XQY A;  4AKI A;  4YTN A;  4X64 T;  2B1E A;  3Q5E A;  3X1D A;  3FBZ A;  4LF8 T;  4I4T E;  4CXY A;  1WR0 A;  4EIW A;  2LOS A;  5AFU L;  5HEJ A;  2XAQ B;  5DQW A;  1IJ6 A;  2J4G A;  5L3B B;  3KFW X;  3WAK A;  3NZQ A;  3PUW F;  4TWH A;  3AE7 A;  4I43 B;  4DR7 T;  4U74 A;  3RC8 A;  4IE4 A;  2V7M A;  3RKO A;  2YU1 A;  4IE0 A;  2VQE T;  3HR0 A;  2W2U A;  5HWX A;  2I6H A;  2VL8 A;  5AQP B;  3SWH A;  3UU5 A;  3PUV F;  1ZEE A;  1ZOY A;  2CEA A;  3ZMT B;  3GA8 A;  2X68 A;  3VR8 A;  2BBJ A;  3W15 B;  5CA1 E;  3B57 A;  3JAE A;  3PV0 F;  5F5W A;  1Z8U A;  2H7V C;  5AQR B;  3JCF A;  3PU8 A;  3UU3 A;  4U2Z A;  5DAB A;  5HXE A;  1Y01 A;  2VKJ A;  4H9P C;  4JEH B;  2BG9 A;  2LRL A;  4ZZC A;  5H6R B;  4AIS A;  2W67 A;  1HR0 T;  5AQM B;  3MXZ A;  4TNW A;  4XAX B;  3GWH A;  5LOV E;  2JQK A;  5IYZ E;  5LHG B;  3FZK B;  3KV9 A;  1W9R A;  5KMG P;  3F31 A;  4EV6 A;  1DU2 A;  3RYI E;  4DV7 T;  3PUZ F;  3UUM A;  4H63 H;  4QXC B;  2WCA A;  2NW9 A;  2A9U A;  1IBL T;  5FL1 A;  3EDU A;  4OFZ A;  4P1N A;  2LJL A;  4EGW A;  2W4X A;  4KI0 F;  5AQL B;  4AQY T;  3N9O A;  2V1D B;  4MLK A;  1HS7 A;  3K3O A;  3L3P A;  4U7I A;  1VRB A;  3B5M A;  3SFD A;  5KX5 E;  5F3J A;  3Q5D A;  2VKO A;  4AIU A;  3RIF A;  4X65 T;  4YXD A;  1HNX T;  2NW8 A;  5J2T E;  3AEB A;  4ZI2 C;  4DUZ T;  2V26 A;  5AQH B;  5HWY A;  2XQ3 A;  3H3M A;  3FHN A;  4KP3 C;  4CI1 B;  2OV9 A;  5L3E B;  3KIN B;  5EK4 A;  4IDN A;  5GON E;  4PJM A;  2X67 A;  3CWZ B;  4DR6 T;  3PDY A;  4JI2 T;  3K1S A;  5LNK A;  3UUL A;  4AQF A;  1CUN A;  5EZY E;  5ABF B;  4OHF A;  3MZK B;  3A8Y C;  2XQ7 A;  2XUE A;  4C90 A;  3ZCJ A;  3OTO T;  3CQG B;  5FY1 A;  2JPF A;  3RH3 A;  2KLQ A;  5AQJ B;  3SS1 A;  2WSS V;  5C8Y E;  2XAG B;  3CX8 B;  4CZZ B;  4DBR A;  2M6B A;  2DWG A;  3NBX X;  3JC6 D;  4TZ4 C;  4DUY T;  1WLX A;  5LYJ E;  2MPK A;  3LG7 A;  4CI2 B;  4CI3 B;  4MHC A;  1N33 T;  3GN5 A;  4G63 A;  3N9P A;  4QX7 B;  3O9X A;  4ILU A;  5AQF B;  3CIR A;  4DV6 T;  4I55 E;  4HWF A;  3N9N A;  2P9B A;  2QA7 A;  5L4H A;  2E9X D;  1CHU A;  5EK2 A;  2V5C A;  5HEH A;  3Q5W A;  2CBJ A;  4HKA A;  2BS3 A;  4WW0 A;  3P8C D;  4DR5 T;  3NKZ A;  1HG2 A;  4UF0 B;  3R84 B;  4B3S T;  3TKL B;  3C4Z A;  2WP9 A;  1W09 A;  4DMV A;  2RPA A;  4QX8 B;  2FJB A;  5JDQ A;  4J2C A;  2ACX A;  2VK9 A;  4IIJ E;  5LXT E;  1YD8 G;  2BVL A;  5FMN A;  2BS2 A;  1T98 A;  4OYJ A;  4HWH A;  1UX5 A;  2IIU A;  2C5K T;  3VU7 H;  1WR6 A;  4PK5 A;  3P4W A;  2UXD T;  2BDE A;  1KK7 A;  3Q9D A;  4YSY A;  2BS4 A;  2PBI A;  3HL6 A;  2XAF B;  2V8S V;  4DND A;  2J62 A;  1HNZ T;  5LB7 B;  4IGU A;  2V7K A;  1H7C A;  3PU3 A;  3OVU A;  3IBP A;  5JVD E;  2YEV C;  2XQ5 A;  4GK5 E;  1EZ3 A;  1XZY A;  3UQ7 A;  2K9A A;  3P4Q A;  5LG3 A;  2YK0 A;  1FEW A;  1N32 T;  2D9D A;  5JDF A;  1SUM B;  3UU4 A;  4WZX A;  2E5V A;  2XPK A;  4YTM A;  2X66 A;  4TNV A;  2WWV A;  2IAK A;  4LF6 T;  4ZHQ E;  2FJE A;  2DI4 A;  5FXZ A;  3ETV A;  1S35 A;  5LMU T;  2WZH A;  3A7M A;  3O1I A;  1HNW T;  2X51 A;  2QRX A;  5F8P A;  3R6N A;  1J1J A;  2ACZ A;  2FJA A;  4QH4 A;  4HFD A;  4NXN T;  4UIG A;  4U72 A;  1I6Z A;  1IBM T;  2NW7 A;  3E22 E;  2CHN A;  5LHI B;  2X0L B;  3JAD A;  3AA1 B;  2BG9 B;  2RA1 A;  5AQN B;  1HCI A;  4LF4 T;  3ZST A;  4YHH T;  2NR4 A;  5ABF A;  2MBG A;  5ETW A;  4U7Y A;  5J0Z A;  5FXW A;  2E9X C;  3P4R A;  1YW0 A;  2YU2 A;  2DL1 A;  2GK9 A;  4TX5 A;  4EYY R;  2UXN B;  2V7J A;  5IUX A;  3PUY F;  2CHO A;  1MND A;  4U3C A;  1UX4 A;  4KX6 A;  1X79 A;  4EZ4 A;  2IDO B;  1FMV A;  2SPC A;  1E7P A;  2HHH T;  3N9M A;  3LK2 B;  2LKH A;  4ZS2 A;  4YJ2 E;  3C4W A;  5JDN A;  4H9Q C;  3I0O A;  1XDP A;  4LML A;  2JQH A;  4HFE A;  2OA5 A;  4LMK A;  4EZH A;  4PFO A;  4A97 A;  3WAJ A;  4QXB B;  2A3D A;  4UXN B;  5E0O A;  5AQO B;  2Y48 B;  4KBM B;  2XZE A;  1HX8 A;  5AQK B;  3FZL B;  4X66 T;  3DP7 A;  3L09 A;  3AE8 A;  3WI3 A;  1D1A A;  5AQS B;  4YSX A;  2PJQ A;  2KIN B;  4UEM A;  3CPZ A;  3P4P A;  1MMA A;  4ANJ A;  2VUR A;  5HXC A;  2JRK A;  2X9H A;  4U2Y A;  5ABE A;  2CA5 A;  2CXD A;  4NIQ A;  2BBH A;  2D0U A;  2MYS A;  3RQU A;  4B6X A;  3PUG A;  1KEY A;  4A98 A;  4I50 E;  3LK3 B;  4DVD A;  4ZI2 D;  1FIO A;  5DQV A;  3CK6 A;  2VVN A;  1XDO A;  3AXJ A;  3ESL A;  4X1K E;  3ZC0 A;  3QOF A;  2E5L T;  2ES0 A;  2QVA A;  4A56 A;  3KV6 A;  3GN5 B;  5HXR A;  4IST A;  2X0Y A;  2X0H A;  2VAS A;  4H9O C;  5KXJ A;  3UUN A;  5EK3 A;  2XSB A;  4AQG A;  3PTR B;  2XQA A;  4DV4 T;  3TLU A;  1VCT A;  2XAS B;  2IHR 1;  1MIV A;  3LBX B;  2XQ6 A;  5C3J A;  2Y8D A;  5JH7 E;  1FMW A;  4ILB A;  1N36 T;  4HFB A;  2EHO B;  3AEA A;  5J2U E;  1UK5 A;  4HGA A;  3VKG A;  4BA9 A;  5LCY A;  3PE0 A;  2QGS A;  5JR9 B;  1LVF A;  4MBQ A;  4GOU A;  1FJG T;  2LE8 A;  3PUR A;  1MMN A;  2L3L A;  2J47 A;  3BQK A;  5A1L A;  3AE6 A;  1ZP0 A;  4IDQ A;  3UU8 A;  4ZOL E;  4DMW A;  2NOX A;  4FJO A;  4CN1 A;  1W0B A;  2KWH A;  3F2E A;  3J7Y q;  4HTE A;  2FJD A;  2H89 A;  3LK4 2;  2XJ7 A;  5HCJ A;  4DV3 T;  3CML A;  2W62 A;  4QWN B;  2WWU A;  3B13 A;  4K0U A;  4KMC A;  2YN6 A;  3AED A;  4K0K T;  3N9Q A;  4COF A;  5FKY A;  3ANW A;  5AQV B;  2UUB T;  2VQF T;  2IML A;  1WRD A;  4EYU A;  2DWK A;  2YDR A;  3UU6 A;  3MA9 A;  2H3R A;  4HWD A;  3ZMS B;  3GMI A;  3RX6 A;  5L3G B;  2XHE B;  2G0U A;  2D5U A;  1I94 T;  5LBQ B;  4X62 T;  3CX6 B;  4ZI7 E;  2QYW A;  3ZCI A;  5HYA A;  2W0G A;  2IC9 A;  1T7S A;  4JBW F;  5LP6 E;  3TLV A;  4DV0 T;  3NWI A;  3AEF A;  4M1P A;  2WDQ A;  3RRC A;  3RIU A;  3ZYM A;  4HFI A;  4ZI3 C;  4HWI B;  2N1G A;  1ZHC A;  1IBK T;  4O2B E;  2WU2 A;  3NVO A;  5FY0 A;  4TUY E;  4XBF B;  1Y64 B;  3IA3 A;  5FY7 A;  2JMK A;  2WB5 A;  2CBI A;  2UXX B;  4PJN A;  1SHZ C;  4L0R A;  2LSK A;  3NZP A;  3HKD E;  2W63 A;  4B3T T;  1OXZ A;  1WYC A;  3AEG A;  2NP9 A;  2BG9 E;  2F4V T;  1YKH B;  3N2G E;  2LHN A;  1E1H B;  2RP4 A;  3C98 B;  3O1J A;  4O8S A;  1UUR A;  3L39 A;  4JV5 T;  1KF6 A;  2CMR A;  3AAI A;  3O1H A;  4L9I A;  2ODU A;  4JI8 T;  2LEH A;  2KXP B;  3E0Z A;  3AA7 B;  4IDP A;  3AEC A;  3OYX A;  4QXH B;  3RI5 A;  3T8O A;  2YIN A;  3QUJ A;  4KUM B;  1NWM X;  2UXB T;  4G2A A;  3SRZ A;  4U31 A;  4AKH A;  2LM2 A;  3LBX A;  2WAU A;  4KHP T;  3OJA A;  1BR0 A;  3RGL A;  2EHO A;  1AJ3 A;  1UCU A;  5DJQ C;  3AAE B;  3QB5 K;  2DLR A;  4O4H E;  4ERR A;  1L0V A;  4DR2 T;  2Q9Q A;  2K5B B;  4O2A E;  2D0T A;  5JR9 A;  2JQ9 A;  2KSR A;  3TLW A;  2D2S A;  4Z91 A;  4JYA T;  2IC6 A;  1HG5 A;  3AE2 A;  4GKJ T;  3CX7 B;  4OK0 A;  4QH1 A;  2Y6X A;  3AXJ B;  1OED B;  1HFA A;  5LGU B;  5HCM A;  3VRB A;  4HFC A;  2N2N A;  3N5L A;  3QB5 A;  3IHR A;  2W61 A;  1MIY A;  2NTX A;  3AVR A;  4UV8 B;  5CFB A;  2A72 A;  4IRE A;  3KVA A;  1IZN B;  4PAG A;  4LF7 T;  1JNZ A;  1XMO T;  3FZH B;  2IW5 B;  3LSV A;  3RYF E;  4N78 D;  4PK4 A;  4LFB T;  5FVK A;  4LF9 T;  2LHR A;  2NWB A;  1E2A A;  2JMH A;  2V7L A;  5HXS A;  3PJA A;  2KT9 A;  3FXD B;  2BG9 C;  3UUB A;  2LSY A;  5H6Q B;  3FZM B;  5JQG E;  4ZEY A;  2CWY A;  3FBL A;  3TLT A;  3PJA J;  2WDR A;  3RHW A;  2W66 A;  4KHZ F;  5TAO A;  4YTP A;  5L47 A;  2LT3 A;  2WY2 A;  3LDQ B;  4NUV A;  3ZT5 A;  3BQL A;  4NUU A;  1YXR A;  3S4U A;  3EAM A;  4L5G A;  3NRX A;  2HH7 A;  3Q5X A;  3VRA A;  4ILA A;  3G06 A;  3C4X A;  2VWA A;  4JI1 T;  3EHZ A;  2HPL A;  2XSA A;  3ZYK A;  4BAY B;  4LF5 T;  1D0Y A;  2MOZ A;  3ANW B;  5FL0 A;  5JRE A;  3KV4 A;  4EED A;  2YDQ A;  4JI3 T;  3HKC E;  4ADZ A;  2JIW A;  2XQ4 A;  3RIU C;  3ZMV B;  3UUX B;  2W00 A;  1G8X A;  2UXC T;  1S94 A;  2XQ9 A;  3K3N A;  4IE5 A;  4IDZ A;  5IHY A;  3EDV A;  3HI2 A;  3N9L A;  4AQF C;  4P0B A;  4PK6 A;  4P0A A;  1VOM A;  3RKG A;  4O4L E;  1KFY A;  3C51 A;  1D0X A;  2H7O A;  3AAA B;  4GYR A;  4YSZ A;  2WS3 A;  4EB6 E;  4UVC B;  2PFV A;  2CXL A;  3EI0 A;  3ZKR A;  3EVY A;  4YFS A;  5LJM A;  1KNR A;  2WQY A;  4YT0 A;  1HF8 A;  4DV2 T;  3VKH A;  1MMG A;  3AE9 A;  5CA0 E;  4HFV A;  5C2T A;  2YKS A;  2WM9 A;  1JNR A;  2LSG A;  1BR1 A;  3MAC A;  2V5D A;  1QSD A;  3HKB E;  5HXH A;  2VVS A;  1XWM A;  3UFE A;  1D0Z A;  1R8I A;  2V6X A;  4PNI A;  4MFR A;  1V9D A;  4B3M T;  5FNV E;  4V1A v;  3T1Y T;  4PJL A;  3O4X E;  3BK9 A;  4ILC A;  3CKD A;  2LRK A;  2WDV A;  3M3Z B;  3ZC1 A;  2CCQ A;  2CPT A;  1XNQ T;  4C91 A;  1LKX A;  2WU5 A;  2WMO A;  5LJN A;  3P50 A;  1HX1 B;  2M6I A;  5L3C B;  4ZI3 D;  1D1B A;  2VKH A;  5L3F B;  3OPC A;  3QK6 A;  1OED A;  3I0Q A;  4DR3 T;  2XAH B;  5JDM A;  2EHO C;  4NXM T;  3ZT7 A;  3QC9 A;  1O3X A;  4UVB B;  3KBU A;  3PUQ A;  4UVA B;  2L9Q A;  4CXX A;  3PUS A;  2UU9 T;  2HN1 A;  2LKG A;  3M65 A;  5JR9 C;  2VL0 A;  4H9S E;  2Z6E A;  3RRW A;  2PTF A;  4AKG A;  5CGM A;  1Z0P A;  2CLY B;  5JRC A;  3RF1 A;  4X1I E;  2ZM0 A;  2KND A;  2I59 A;  4XZC A;  2ZLY A;  3UQ4 A;  3HA4 A;  3AB3 B;  4JI0 T;  1KNZ A;  4TWF A;  2Q9Q B;  4UR9 A;  2AXD S;  3OYZ A;  2LSJ A;  5JDG A;  3MJX A;  4DR1 T;  1VCS A;  5HEU A;  2WMN A;  2XM1 A;  2C5J A;  5AQI B;  3VHL A;  1IAP A;  4EOZ B;  5IWA T;  4FI5 A;  5JTG A;  3RYC E;  1W0A A;  3KDS E;  2FBW A;  2KMF A;  1KNP A;  4BJN A;  4DO0 A;  2V6Y B;  2PG8 A;  4AKR B;  2BZB A;  2CXF A;  1OED E;  2E8I A;  4E7Z A;  3OBV E;  1G73 A;  3NRY A;  4O4J E;  4TV8 E;  1N34 T;  5AQU B;  3IF8 B;  3PUA A;  3DJB A;  2HN2 A;  4LFC T;  1YQ3 A;  5HEO A;  3KVB A;  3ZJ2 A;  2I0M A;  2VB6 A;  2DNX A;  2KZ7 B;  5ABG A;  1XMQ T;  4X1Y E;  4O4I E;  3ZYL A;  5HAX A;  5LMN T;  3CVR A;  2ZM8 A;  3C64 A;  3I1A A;  4ZS3 A;  5AQG B;  2ODV A;  4WBN E;  4DR4 T;  3IEE A;  4HWC A;  3FXE B;  4YJ3 E;  4WBO A;  1ZKE A;  2E2A A;  2E9X A;  3I9Y A;  3RIA A;  2DCF A;  1J5E T;  2OLT A;  3I9W A;  4AI6 A;  5JDH A;  1XNR T;  3RQW A;  5BMV E;  1YKE B;  4UV9 B;  1GQE A;  1LVK A;  1M62 A;  3RYH E;  1U5P A;  2CM0 A;  4HFH A;  1MIW A;  4QHO A;  4HE8 A;  1OWA A;  4EAH A;  2JJ9 A;  3BQI A;  3UTK A;  4WYV A;  4AXP A;  5JDL A;  4IE7 A;  4PFP A;  4IT4 A;  2BKO A;  3PUX F;  3J9X 1;  4NPP A;  3ZLI A;  4JLE A;  3MK7 C;  1NEK A;  3ZSS A;  4EXT A;  1BR2 A;  3ZEF B;  3EAB A;  3ZMZ B;  5ABH A;  5KDM C;  3T1H T;  3DTO A;  2MTQ A;  4GK0 E;  1WCR A;  4ZZB A;  4ISS A;  5AQT B;  3H3A A;  3ZPO A;  3ZJ1 A;  1OED C;  4E7S A;  1US7 B;  3ZN0 B;  1MNE A;  4CQI A;  1B7T A;  1WYB A;  4BJM A;  2CRB A;  1LRZ A;  5L3D B;  4CN4 A;  2CE7 A;  4H9R C;  3AE3 A;  3EUH A;  3ZMU B;  4CXW A;  3L8R A;  2YOE A;  2K48 A;  4DV5 T;  2V7I A;  4IDO A;  5LBM A;  2XY8 B;  3SFE A;  3V5U A;  5M4Y A;  4H63 V;  3K8P C;  4GIW A;  2B76 A;  2C5I T;  4F8H A;  4UEL A;  3P4S A;  4IE6 A;  4YY3 T;  3D0T A;  3Q2M A;  3KBT A;  1HTJ F;  3K3Q C;  3N2K E;  4OX9 T;  3UT5 E;  2V6Y A;  5LHH B;  4I0U A;  4ZXL A;  4LMJ A;  5FP3 A;  5LG4 A;  1UGO A;  3UFG A;  3AVS A;  4X5T A;  4B3R T;  5JRC B;  3A5X A;  4Q25 A;  3OKQ A;  5HEG A;  5CJ5 A;  4U33 A;  2BVM A;  2MAW A;  3QNU A;  3AA6 B;  2EHO D;  3AE1 A;  4JI5 T;  3JAF A;  3SOL A;  3E08 A;  2WBL A;  2VKD A;  4X20 E;  3ZT6 A;  3FB2 A;  2AE9 A;  2Q9Q D;  1ZV4 X;  2BKN A;  2XM2 A;  3RC3 A;  1BR4 A;  2LSI A;  5FYM A;  1UUS A;  4CN6 A;  3CQC B;  3ZN1 B;  2IUB A;  4EEB A;  2WZI A;  2NTY A;  1T8B A;  5FXX A;  4QKN A;  2R6G F;  4TN7 B;  4GYS A;  5CB4 E;  4PJJ A;  3LFM A;  3ONX A;  4AKL A;  4LFA T;  2JQQ A;  2DHR A;  3HKE E;  3RPU A;  4ASK A;  3ABV A;  2C0S A;  4QH5 A;  3JC6 C;  3LJC A;  4H9N C;  1IJ5 A;  4HN9 A;  2XQ8 A;  5ADX L;  3V5S A;  2YDS A;  2ZM2 A;  5AQQ B;  5BR8 T;  1SE7 A;  4P09 A;  2HPJ A;  2FUP A;  4TWD A;  2LOP A;  1U4Q A; 
#chains in the Genus database with same CATH homology
 4LFC T;  1FJG T;  4KHP T;  3T1H T;  2UUA T;  4B3R T;  3OTO T;  1HR0 T;  4JI4 T;  1XMQ T;  2UXD T;  4X64 T;  5LMN T;  4DV2 T;  4JI0 T;  1IBK T;  4LF4 T;  4YHH T;  4JI7 T;  4DR2 T;  4LF8 T;  4DV7 T;  4JYA T;  4JI5 T;  1HNZ T;  4DR4 T;  4DUY T;  4DV3 T;  2UUC T;  1IBL T;  4B3M T;  4GKJ T;  4DR1 T;  3T1Y T;  4B3T T;  1J5E T;  1N33 T;  2E5L T;  1XNR T;  1N32 T;  4AQY T;  4DV1 T;  2F4V T;  4K0K T;  4DV6 T;  4JI1 T;  4DR7 T;  1XNQ T;  4GKK T;  2UUB T;  2VQF T;  4DV5 T;  4LF5 T;  4JV5 T;  2HHH T;  5IWA T;  4X65 T;  4JI8 T;  1HNX T;  2VQE T;  4LFA T;  4JI3 T;  4DR5 T;  2ZM6 T;  4DUZ T;  4DV4 T;  4LF6 T;  4LF7 T;  4DR3 T;  4NXM T;  1XMO T;  4B3S T;  5LMU T;  4LFB T;  1I94 T;  2UXC T;  1HNW T;  4X62 T;  2UU9 T;  4LF9 T;  4X66 T;  1N36 T;  4DR6 T;  4YY3 T;  2UXB T;  4JI6 T;  4NXN T;  4JI2 T;  5BR8 T;  4OX9 T;  1N34 T;  1IBM T;  4DV0 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...