2W63A

Saccharomyces cerevisiae gas2p in complex with laminaritriose and laminaritetraose
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
455
structure length
432
Chain Sequence
SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 161
structure length 432
sequence length 455
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w63A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w63A01
4D72A 3EYPA 4TVUA 2CKSA 5EMYA 1HXJA 2PWDA 4KRTA 1U30A 2V3GA 3BAYA 4D6JA 2DT0A 2WKGA 4TOQA 1UD2A 3RM4A 1UD5A 4X9YA 4Q22A 1SMDA 2J7CA 3WUFA 2WMJA 2WLYA 2FH8A 2IXVA 3EDKA 1UKSA 1R7AA 3K8MA 4XUYA 1DWHM 1B3ZA 1PX4A 7TAAA 1XCXA 3BC9A 2C0HA 5BXRA 4UZSA 3VTRA 3K4AA 4QDMA 4UOZA 5DO8A 1UH4A 3WKZA 5FL1A 1A47A 5JUVA 3VX0A 2EBNA 3KE0A 1AMYA 4JFVA 3LPOA 3QGVA 3WD1A 1JAKA 2ZX8A 3NSNA 4ATLA 1XSIA 3OGVA 1UWTA 1NWSA 1V08A 1CXEA 4PUEA 3N18A 2DH2A 3ZT7A 2UY2A 3AFBA 3BXWA 5E6ZA 2VQUA 4GO8A 5A6JA 3DYMA 2W4XA 4C7DA 4D6EA 1Y7VA 3RO8A 1ZBVA 2QMKA 1OGGA 1W9UA 2VI0A 2GSJA 3TOPA 1E6QM 1H11A 3G6MA 2E9MA 1VEPA 5E0CA 2V3EA 1E6XM 4UR9A 5BRPA 2FH6A 1QHPA 3TA9A 3CZEA 2G3JA 3IJ9A 3RJXA 4HZ6A 3HU7A 3GXIA 2E0PA 3FY1A 1EXPA 3RILA 4PBGA 3ZSSA 4JHOA 3NSMA 3F5KA 2ZUMA 2BV9A 6A3HA 1J0JA 1H0IA 1TA3A 4WF7A 1LWJA 2BY1A 4AD3A 4W87A 1QNOA 4CD4A 2NT1A 2VX7A 4CCEA 4H41A 3EDEA 1WZMA 5IHSA 4PRWA 3ZMRA 3U5UA 3OLEA 2BY0A 3VNZA 2XVLA 4BF7A 4JKMA 4MADA 4EK7A 1UHVA 1FFQA 2WC4A 2ZUNA 3WEMA 3CUHA 2XSBA 2VL4A 5LA1A 4AZ5A 2AOSA 2E9BA 1JD7A 4F8XA 2CITA 2WXDM 3CUJA 2EJ1A 2GJXA 4AZ7A 1JF6A 3WD2A 5BRQA 2GK1B 3WH6A 5I23A 3CPUA 2G3IA 2X05A 1MW0A 2RGMA 4M81A 1EDTA 5D9MA 1GQLA 1K9DA 1E9LA 1PIGA 2J4GA 1V0NA 2V38A 2OWXA 3PZ9A 1CWYA 2D0HA 1TVPA 2JIWA 2UY3A 2WSPA 4AZCA 8A3HA 1PBGA 2ZXAA 5HPOA 1U2YA 3UERA 3BAIA 1TZ7A 2YL8A 2XJ7A 3EDDA 2JIEA 1UQZA 4QLLA 4UQDA 2EPOA 3RMEA 5FCZA 4AZHA 4GKLA 2D0GA 1W9BM 2E8ZA 5C70A 4E8CA 2UWFA 5I2UA 1CENA 1IT0A 4UQCA 1JZ6A 3K8KA 1GNXA 3PZQA 4AD5A 2WMIB 3MUY1 3M46A 1UH3A 1EO5A 3W4RA 3ARXA 4PMNA 2PI6A 4Z2GA 1W1VA 3VIPA 3OLDA 1CXFA 5ECUA 2VC9A 4A3YA 1CGYA 2EO7A 2GUYA 4LX4A 4P8VA 1HJWA 3AIWA 3TTYA 5A69A 1H5VA 3ARWA 4IM4A 4P7OA 1SR0A 1UKPA 3AMKA 1B30A 4PMQA 2QLYA 1OIMA 1E6ZA 1WCGA 3AYSA 4KWUA 4UOJA 1UYQA 3RJYA 1WO2A 3SCNA 3WNOA 4WKFA 2YBUA 3BAWA 3LMYA 2XWEA 1BAGA 3GXMA 5DFAA 4M56A 5E70A 5KZ6A 2VRQA 2BY3A 4UZUA 4HP5A 1K9TA 1QBAA 4CKQA 5A8PA 1JD9A 1C92A 3MMWA 4HZ8A 5ABEA 2CKRA 4UCFA 3VM5A 1BG9A 5A6LA 1EQCA 3ZO9A 5A94A 4CU7A 4AD2A 1XSKA 3IJ7A 3BCDA 1UR2A 4Z2JA 4HOZA 2IXUA 3ARRA 1JNEA 4Z2HA 1RH9A 2DSZA 5I24A 1UR1A 2W66A 5LYRA 2QF8A 3ALGA 3SCWA 4IPLA 3FNDA 3VDHA 5GNYA 1KWGA 2WWCA 1XRVA 1KXVA 2WMHA 1EHNA 4PEEA 4AYSA 7A3HA 1V3HA 4GQRA 1VJSA 3WF2A 3L4XA 3ZM8A 1ZL1A 4DM2A 3WL1A 1VFFA 4Z2LA 3TTSA 3VD3A 2PB1A 4XB3A 3WDPP 1AQ0A 4PCTA 4AZCB 2D24A 1J0YA 5GNZA 4W89A 5CG0A 1JZ5A 1LG2A 5BWFA 2WZHA 5JBEA 5D9OA 4GIAA 2AMGA 3CHEA 3T2PA 1HKIA 4U2YA 1WAWA 2VVSA 5CLWA 2GDVA 2O9PA 1LLOA 2QPSA 3U5YA 5D4YA 5IXEA 1JYVA 1JYNA 4PTXA 3UG5A 4PMYA 4UFLA 5ABFB 1IZJA 2EPKX 3N9KA 4QLKA 5A2BA 2XVKA 2WANA 1KGWA 3VUPA 4E4PA 1GOWA 3S6TA 1V6XA 1J9YA 3LPGA 1JZ7A 1QNQA 2WNWA 2J62A 1WZLA 1FP8A 2DSUA 1FOBA 4E2OA 3AMGA 1L0PA 1PX8A 2YLLA 3ARSA 2J7FA 5A6BD 3CZGA 1XYFA 1KBKA 1E4LA 3AS0A 5HXMA 1VFOA 3WNNA 4UFKA 4HOXA 3T0DA 2XSAA 3HMCA 4CN6A 4Q7NA 4XV0A 1JYXA 3AQUA 3AZRA 4MJ4A 4NSBA 2A3EA 3AIVA 4BQ4A 4UQAA 4URIA 3GXDA 1E0VA 1E1FA 1NWUA 9CGTA 1HVXA 4EKJA 1HX0A 4J3WA 2VR4A 3WNKA 1M53A 2BVTA 1KBBA 1V3MA 1NOFA 1TFVA 1V0KA 1GOOA 2NW0A 3WEZA 2ZIDA 1VB9A 4J3VA 4B3KA 5M3WA 1G5AA 3A3HA 3ZQ9A 2WK2A 4PMOA 5D8ZA 1E3XA 4CGTA 4D6DA 4M29A 4PUDA 1V0LA 3OIHA 4CD5A 2WMGA 4GI6A 1BPLB 4Z2IA 4TTGA 5E09A 4WK9A 3QOMA 4JAWA 1WDPA 4MB4A 4KH2A 1LWHA 1QI0A 3AROA 1TR1A 4PTMA 4AW7A 3IAPA 3VGHA 5CGMA 1BQCA 1G01A 3BCFA 3SCUA 3CHCA 2J25A 1JDAA 1GONA 1WPCA 3F4VA 3NDYA 2ZWYA 5JBFA 4UNIA 1JL8A 3MKKA 1GCYA 2VCAA 1V0MA 2D23A 3W82A 2XM1A 3BLKA 1HJUA 3I3DA 1MW1A 3T2OA 3WQ8A 1QHZA 1PZ3A 3WD3A 2VJXA 2V3DA 3SCPA 1EHAA 1FHDA 1OB0A 5CXPA 1BHGA 1Q6CA 1R87A 2Y4SA 6CGTA 4S3JA 4EE9A 3CHDA 3ARZA 1KR0A 2C7FA 2WBGA 1EQPA 1C8QA 4KGJA 4PYSA 2J7DA 1CTNA 3GZAA 3W26A 1J0ZA 1B3VA 3ZT5A 1HN1A 2D1ZA 4GQQA 1HKJA 2D3NA 5BYWA 1J11A 1KQYA 2VCBA 1VENA 5E0FA 1KQZA 3RPMA 1VAHA 3AIEA 2F8QA 2VT0A 2VZUA 3EMQA 2JEPA 4AEFA 4JFWA 2YJQA 3GH7A 1NWRA 4IUGA 4AISA 4MNJA 4XX6A 4QAWA 1MQPA 2WLZA 3M07A 5CLTA 2W5FA 4JFTA 2NT0A 2ZX9A 3WH8A 4P7RA 1V3LA 3UG4A 3UETA 5EFDA 4BQ2A 3IJ8A 2VZSA 2WHJA 4UQBA 1J10A 3AXHA 4J3SA 1EOMA 1X6NA 3AXXA 1M03A 3NUKA 1MYRA 2BHYA 3WF1A 3OBAA 2DSWA 1E56A 4AIUA 3ARYA 2PC8A 4MPKA 5M17A 2VTFA 3AZSA 4HA1A 1YHTA 5A6KA 1W91A 4GPNA 4ZE4A 2VMFA 4UFJA 1GJWA 1KXQA 1VFUA 2WCGA 4J3XA 4P8XA 3AMCA 3FXYA 3WDHA 1UWRA 1W1YA 3KL3A 3N04A 1JFHA 2YL5A 1W3KA 3VIKA 3MANA 1OGBA 1ITCA 3IK2A 3POCA 3BLPX 3POHA 4NI3A 4LGXA 2ZUWA 5A1AA 5F7UA 3N11A 1WZKA 4LYPA 5I77A 1LL6A 4GXPA 3O9NA 1MW3A 1E6SM 5FKYA 4QCFA 3SUVA 3UG3A 3AZTA 4QLJA 2BVYA 3LPFA 1H4PA 1VIWA 4YN5A 3WIJA 2EQDA 1G9HA 1HJXA 1VEMA 1W2VA 3W53A 2WZEA 1U33A 4JFUA 3S2CA 4JHZA 3VD9A 3VKKA 5AYIA 2HVMA 1DP0A 2UY5A 1UWSA 4BZYA 4MDPA 2A3HA 3RDKA 2IUZA 3U57A 1I1XA 1H09A 1C90A 1H2JA 4EANA 3BGAA 4CD6A 1NARA 1NM9A 1WDQA 1JZ4A 1YQ2A 4CCDA 1CNVA 5CSUA 5HNNA 3AYRA 4PN2A 5IFPA 1W32A 4W85A 1QNSA 1D2KA 1NWTA 4N42A 4FK9A 5GQBA 4HZ7A 1E70M 1GQKA 4ATWA 1QBBA 3T0AA 2BXYA 4WKAA 2XM2A 3PZNA 4UFMA 4W5UA 2WSKA 5CZKA 4EAMA 1OINA 1BGAA 2VR5A 1NP2A 4W88A 3SUTA 1ZJAA 3WH7A 3VINA 1I1WA 4V28A 3CLWA 4W7WA 3VX1A 3WBEA 4HA3A 1WB0A 1N82A 3J7HA 2JEQA 2O9OA 2XVNA 2Y8VA 3FW6A 3ZIZA 3K46A 1UQYA 2QV4A 2YIHA 4L4PA 3CGTA 5HPCA 3VD4A 1FP9A 4MB1A 4TVDA 1UKOA 2FGZA 1JFXA 1JDDA 1CXHA 1TG7A 3ZR6A 1HL9A 2UY4A 3VD7A 5IHRA 4WSJA 3WQVA 4CCCA 3GDBA 1K9FA 1PEZA 3B8SA 1WKYA 3BMVA 1OCQA 5JIWA 3PTQA 4BA0A 1XH1A 5C8BB 4AC1X 3A4XA 1NOUA 3MUAA 1VBUA 5D8WA 2VCCA 2VZTA 5JIPA 2YA2A 5D9NA 2VX4A 4R5EA 2A3AA 2OYLA 2WC7A 2EPLX 1E15A 3L4ZA 3L4UA 1E4MM 2BHUA 3WQ6A 2GVYA 4AWEA 1C93A 3VMNA 1UR0A 2X1IA 1BVZA 3D3AA 1M01A 1Q6EA 1QNRA 1JI2A 4P7NA 2W62A 2PWFA 3VIGA 1BF2A 1E72M 1DHKA 3DYPA 3FHAA 3WQ4A 5I3DA 2V5DA 1RP9A 3WDRA 2OSYA 4W5ZA 3WH9A 2CERA 2D22A 1C7TA 2YBTA 2CEQA 1J18A 1MXGA 3MSDA 2YOCA 4RE4A 4XZWA 6TAAA 5AYBA 1RP8A 2QHAA 3CHFA 3VMOA 2G41A 4AZGA 3MS8A 5CJ5A 2Y2WA 3CZ8A 4ACZA 3VDAA 1XGZA 3SCRA 1R8LA 3OZOA 2JF7A 4WKHA 4W93A 1SMAA 1ODZA 2XGIA 4H8HA 1UOKA 4A3HA 3CMJA 3W6MA 2J8GA 2VQTA 4JIEA 2CBUA 1W2PA 1B3XA 1ZS2A 2E9LA 3CUFA 2PWGA 2WAGA 1QNPA 1JNDA 3ARUA 1KWKA 2A3BA 1Z32X 1I75A 3NYDA 1TA3B 2WC3A 3W25A 4D71A 3AHYA 4V27A 4MNKA 1XD0A 5D9PA 4ZXOA 1B90A 1C8XA 2OSWA 3MUZ1 1EA9C 1VFMA 4HPGA 3VU2A 2ZUVA 3OLGA 1NH6A 1EO7A 4R27A 4CU6A 1OSEA 4P8UA 1G0CA 2ZICA 3G6LA 4Y7EA 1Q6DA 2AAAA 5M03A 1EDGA 3EDFA 4OOUA 1C3FA 1UR8A 2GJXB 4DWSA 3EBVA 2V3FA 2VX6A 1CGXA 2YL9A 1EDQA 2XVGA 5IDIA 1UG6A 1JIBA 4HA4A 4JKLA 3WBAA 4M24A 3E1F1 3HN3A 1UKTA 5AY7A 4DWSC 1MFVA 3JUGA 3AISA 1E55A 3QOKA 4W8AA 5BCAA 2XFFA 1ISWA 2DIEA 3TTQA 1BTCA 3SCSA 3VDBA 2Z1KA 5FOOA 4CU8A 4AY1A 2VO5A 1BYBA 1WDRA 4NF7A 4MJ2A 5EFFA 2WVVA 4PTWA 5AC4A 4AIEA 4HMEA 1W1PA 1XHGA 2XVPA 2ZX6A 1E5JA 1E43A 1L8NA 4PMVA 1W1TA 4TTUA 1QW8A 3MMUA 4H7VA 1GW1A 5C71A 1DWIM 2VVNA 3UCQA 2CYGA 3VO0A 3DHPA 1B3YA 1JZ3A 1W3LA 3WFLA 3B9EA 3VIIA 1CIUA 3WF4A 2W61A 4HOWA 3B9DA 5I78A 1ZJBA 4TX6A 2J7HA 5A8MA 3WSUA 4TXEA 1O7AA 3PZVA 4PMRA 1WNOA 1ITXA 1OT2A 4UQEA 2BHZA 2HISA 5FL0A 2XGBA 1HKMA 3CBWA 1E1EA 1PX3A 4YHGA 2Y8KA 1TE1A 4U31A 4NRRA 1AVAA 1QI4A 4W8BA 2WPGA 4TVCA 4E8DA 2CBVA 4GZEA 2XHYA 3VGEA 2VOTA 4GINA 3VGGA 2XUCA 1S46A 1BYAA 2O9TA 2DT3A 1OD0A 2BXZA 3A4AA 1LQ0A 5A6SA 1DWAM 1UWQA 2CBIA 2FHBA 4PCSA 3DC0A 2CXGA 3QHOA 3NIYA 3N13A 1RD6A 4YHEA 2ZXQA 4H8UA 3THCA 4H2CA 4DUWA 1FH8A 3M6DA 3I3BA 3AHZA 3ZJ6A 1E40A 2ZX7A 4HMCA 4D6HA 2Z1SA 5M5DA 1ZU8A 3W81A 3AS1A 3GH4A 2YA1A 3WL0A 4W7VA 3U7BA 1VBRA 5IFTA 4OZOA 2J79A 2W63A 4JCMA 5E9AA 1E6NA 2JALA 1R86A 3KEHA 3AI0A 4OIFA 4WSKA 1H1NA 5KEZA 4CUCA 5I79A 2W92A 4KGLA 4PMUA 1JAEA 1W9XA 3CZKA 1KGUA 2YDRA 1H49A 1HIZA 3HJEA 4LQ1A 4L4OA 3WUGA 2X0HA 2WBKA 3LPPA 1KCKA 4QFUA 1FH9A 1FFRA 1DWFM 4MAZA 1GHRA 5DF0A 2A3CA 2CESA 1K6AA 3KL0A 3QHMA 3SUWA 5A6MA 4GI8A 3WDJA 2XWDA 4PSRA 1W9VA 4AEEA 2VRKA 3AHTA 4CVWA 3CTTA 2OWWA 4FLOA 3VM7A 1KGXA 1VJZA 1F4AA 2ZWZA 4ZEPA 2FGLA 1CXLA 4MB3A 5LA2A 2J74A 1GHSA 3OZPA 1W3JA 2WZIA 4UQ9A 1HT6A 2VUYA 3BAJA 3OG2A 4UFHA 2OLHA 4OJYA 3ZSTA 1BVNP 1GUVA 2CHOA 4WJXA 1BYCA 2JE8A 2TAAA 3SCTA 3SURA 3TP4A 4XZBA 3W37A 1HJSA 2ZE0A 3NCOA 4MTVA 1E71M 1ECEA 2VURA 3I3EA 1O6IA 3ZR5A 2WCSA 5I0DA 3PZGA 3AIRA 1JZ2A 2O92A 1HVQA 1J01A 1E6RA 3OB8A 4C7FA 4F66A 3RCNA 4P8WA 2XIIA 1WZAA 1W9DM 4CD8A 4ZFMA 2DH3A 2YDQA 4AD4A 1TMQA 2PBOA 1OIFA 3PZTA 3MMDA 4W8LA 5TD4A 3THDA 3WF0A 5DT5A 1EOKA 4N0RA 3WEOA 4M1RA 4UFIA 3ARVA 2WVUA 1WE5A 3AHXA 3KL5A 1J0IA 1P6WA 3SCOA 2Q8XA 1QOXA 5A8NA 2WKLA 4B9ZA 3W24A 2JF6A 3EMZA 2DEPA 4AZ6A 1CXIA 2D20A 1MQRA 1JXJA 4X0NA 1KXTA 4FMVA 1ISZA 3MU7A 1QPKA 3RM8A 2X0YA 3VDCA 3KWXA 4B9YA 1CECA 1E4IA 2BS9A 5A8QA 4CVUA 2CCRA 1EIBA 5BXTA 3N15A 1X6LA 5DT7A 1BYDA 5I5RA 1E0XA 2G8ZA 1DWJM 4FLQA 1R7OA 4U3CA 5CPQA 5I6SA 3L4VA 1UR4A 1TVNA 3WQ5A 2BVDA 1KFWA 3CMGA 3ZOAA 4MNMA 1ISVA 2GK1A 3VGDA 1SYTA 3T08A 3GBEA 3VPLA 1XV8A 2FHCA 3L4WA 4MB5A 3ECQA 1BLIA 2WWDA 3VIJA 5ABHA 4JZ5A 2J7BA 2J7EA 3WNMA 3MUIA 1PIFA 4MAVA 1DTUA 3AIBA 4U2ZA 4B16A 3GTNA 4AZBA 3WD0A 4K68A 2G3NA 3OLIA 3GNRA 5A8OA 1KR1A 3N17A 3ALFA 4U3AA 5CSYA 3GXFA 1XC6A 5DMYA 1V03A 1QW9A 4AD1A 1V3KA 3APGA 4P7QA 2NSXA 3SIMA 4ZXLA 1AQMA 1K9EA 3L4TA 1GOIA 4F79A 2WMIA 1DWGM 2DPEA 3SUSA 3CUGA 3NSXA 1EH9A 3AXIA 1CDGA 1QI3A 4CN1A 3BSGA 5HDRA 2XTKA 4OKDA 1UWUA 1C91A 1UA7A 1KB3A 3BAXA 3WY1A 1FHLA 1CLXA 1D7FA 1B3WA 3WF3A 4GZJA 1JXKA 3AICA 1HJQA 5A2AA 1UUQA 1CZ1A 1MW2A 4QCEA 1LF1A 1UZ1A 1GVIA 4GI9A 5EB8A 2E8YA 5FIPA 4TUFA 1LG1A 1B1YA 2ZUUA 1HKKA 3EDJA 2XPKA 1JI1A 3SEPA 4UTFA 4Z2KA 4U5IA 3WD4A 1G94A 1IZKA 3L2LA 4RL3A 2J75A 3ZJKA 1TCMA 4JL1A 1HL8A 3PZUA 3VVGA 1GJUA 2GJRA 1SFSA 2BNJA 2BY2A 1NQ6A 3VD5A 2F2HA 1VEOA 5A6AA 3DECA 3WH5A 3K4DA 2CHNA 1TUXA 4UOQA 1B0IA 3II1A 4RE2A 4QP0A 2WMKA 4FLSA 4F9DA 2F61A 1UD8A 1XSJA 1ISYA 1HNYA 2VNCA 3ARPA 4JL2A 5CPTA 2ZXDA 3RIKA 1GZJA 3KZSA 3K1DA 3QHNA 1FH7A 1AQHA 3WNPA 4ATDA 3T2QA 2VZOA 2VRJA 3IANA 4J27A 1QI2A 1Q6FA 1UH2A 1MFUA 3AMLA 4LPCA 3FAWA 3CO4A 4J28A 1PZ2A 2J47A 1OBAA 4JFSA 4LXFA 3AOFA 4TX8A 3VIMA 1QI5A 3ZJ7A 4AMCA 1H3GA 3GYCA 5BXPA 5BXSA 2XFRA 3T0BA 2WHKA 1MQQA 2WM0A 4HU8A 2XYLA 4OBSA 4PMZA 5AC5A 5ABFA 1JZ8A 3CZLA 4WLCA 3PTMA 1US3A 2PBGA 4A4AA 3D5HA 3BH4A 3PN8A 4D6GA 4U5KA 2XIBA 4AD0A 2FHFA 5CQ1A 1BG4A 2E3ZA 1XH0A 3W29A 2WCAA 4MDOA 3MV11 1A3HA 5CGTA 1CEOA 3W28A 3L4YA 3EMCA 5GPRA 3ZJ8A 1OT1A 3B9AA 2W67A 3WMCA 4D1JA 3PBGA 1KXHA 1UD3A 1US2A 4H8VA 5A6BA 1MVYA 1GQJA 3W6LA 1XH2A 1CGTA 4ACYA 3ARQA 1HJVA 3FHQA 2DT1A 2PF0A 4W84A 3WQWA 2PWEA 4ZE5A 5ABGA 3PZIA 3WN6A 1V3JA 1EGZA 5JBDA 4HPHA 1J0KA 1GOKA 2G4FA 2DDXA 2C8NA 2XG9A 5FD0A 3OA5A 2OYKA 3PHAA 2GDUA 1KCLA 1JYWA 4AXNA 3UR8A 1J0HA 1MXDA 1LL4A 3WFZA 2ZUSA 1UA3A 1DEDA 1RPKA 1ZBWA 4D6IA 1E3ZA 1CGWA 2Y5EA 2GJPA 1V6YA 1QHOA 1ISXA 1GVYA 2YDSA 4X0VA 4B15A 3DYOA 1D3CA 3BAKA 4ACZB 4ZENA 3VOCA 4PSPA 2YKKA 3AS3A 1V6VA 1B2YA 1V02A 2J77A 3PZOA 3AMDA 4IISA 3GBDA 1R85A 4NRSA 4S3KA 4NZCA 2B31A 3VNYA 1XD1A 1ZBKA 2X2YA 8CGTA 1IV8A 1OGSA 1XYZA 5HBFA 3NDZA 2EPMX 3SCQA 1M7XA 3F5LA 2OYMA 3CZJA 1CGUA 1C7SA 2DSKA 2X09A 3AHVA 4KRUA 3L2MA 1ZBCA 1CYGA 5CPSA 4IPNB 3VGFA 1HP4A 2E4TA 3FN9A 1E0WA 1ZB5A 4V2XA 1UR9A 3GNPA 1OD8A 3MV01 3W38A 4M8UA 4HU0A 1E4NA 3AJ7A 1WDSA 4HTYA 4BS0A 2QMJA 4DUVA 5BROA 1HF6A 3TTOA 4D1IA 2CETA 4AZIA 3ZT6A 1MWOA 3UESA 3CH9A 4DM1A 1JDCA 4KMQA 3WNLA 3A4WA 4DWSD 4W86A 2Y24A 3GM8A 1UWIA 2YLAA 3N12A 3CUIA 4RE3A 2WW5A 4PMXA 1GQIA 3WUBA 3SCVA 1UZ4A 4DWSB 2WVTA 3AIUA 4J3TA 4DUXA 2J7GA 3TONA 3F5JA 3T09A 1CLVA 4CD7A 5GNXA 3WMBA 3GH5A 3VIOA 1ESWA 3WELA 1PAMA 2BFGA 2CNCA 3OGRA 1H0GA 1E5NA 4FLRA 1JG9A 1J12A 4W7UA 3VILA 4F9JA 3VIHA 4GZIA 2WVVB 2EXOA 1B31A 1JF5A 1GOMA 1VF8A 2WYSA 2RGLA 1WP6A 2YA0A 1UKQA 2DSVA 3NJ3A 2FDMA 1V6UA 4D6CA 3MSGA 3O2LA 5HOSA 3W0KA 2ZOXA 2E40A 4BQ3A 3WUEA 4LYQA 7CGTA 1BSIA 1HP5A 1Q4NX 3WDQA 1V3IA 2ZXBA 2DT2A 2EPNA 2VZVA 2ESCA 3FAXA 5EBAA 2WHMA 2ZX5A 4JCLA 3N1AA 1LL7A 2OWCA 1QVBA 4H04A 1GPFA 1LJYA 3M7SA 1B9ZA 3QR3A 1H41A 1W3HA 3BSHA 1C8YA 5A2CA 1V02E 3VIFA 4OOZA 3PTKA 5A95A 4C7GA 2DIJA 3A47A 4PTVA 3VMPA 1GORA 1NP0A 5DEZA 1UD4A 2EEXA 4YPJA 4B3LA 1UD6A 3K8LA 4GO9A 1X1NA 2GFTA 1PJ9A 2D2OA 4OBRA 2VX5A 3W27A 1F4HA 2CIPA 3OGSA 4JKKA 1G1YA 4AIOA 2DQXA 1GOQA 5LA0A 1FA2A 3AIQA 3DHUA 4LYRA 2XFYA 2OSXA 1ODUA 4M82A 4P7LA 3ARTA 4M80A 2J8FA 4MNLA 1M04A 2J78A 2V5CA 2ZUTA 4WIWA 1XCWA 3WMSA 4ML4A 1VRXA 1CGVA 3IAQA 2MANA 1V6WA 2QPUA 3GNOA 2D0FA 4HMDA 2PWHA 5E6YA 2O9RA 1CPUA 2WB5A 3PZMA 3WENA 3A6OA 1OM0A 4J7RA 3UEQA 4CN4A 1JGIA 1E6PA 3U7VA 2CPUA 2DGAA 4OUEA 3RM9A 4J3UA 3AS2A 4U33A 1OWQA 3UR7A 2X8RA 1BGGA 3CIVA 2WHLA 1BFNA 1CBGA 3WDIA 2JFEX 3MO4A 2YL6A 2CBJA 4BQ5A 3VGBA 1CXKA 1NOWA 2G3MA 3O6AA 1Q6GA 2WVSA 4D6FA 3SUUA 2W91A 1W9PA 2WMFA 3BMWA 2D3LA 5A3HA 4BCEA 1E73M 1PPIA 4PMDA 4FF5A
chains in the Genus database with same CATH superfamily
7ODCA 4UC5A 4I8DA 4Z1CA 5LIUX 2KLQA 4M6VA 5J2TE 4G9PA 3H2MA 1W8GA 4GFSA 1U30A 3LG3A 3QEZA 4NNBA 4PRTA 2NVDA 4TOQA 1UD2A 4WDUA 4X9YA 4K0UA 1QOQA 1TPH1 1YBQA 2PDUA 3EDKA 3K8MA 5AVHA 1DWHM 3QPEA 2PDPA 2V6YA 1B3ZA 3M0ZA 1DQUA 1FRBA 3IGUA 3NQVA 4Y6GA 7TAAA 2O55A 1CX9A 4IMDA 3VTRA 3QSRA 4FALA 3KWSA 1HGYA 3LLDA 4Q4SA 1F61A 3BE7A 5DO8A 4YTSA 3UWQA 4IDQA 2EBNA 4JFVA 1AMYA 4HWFA 3P3BA 3NVTA 1VFLA 4RW3A 2Y88A 3OGVA 4IP7A 3JR2A 1V08A 5FJRA 4PUEA 2I9UA 3L65A 3ZT7A 2R6GF 3MJYA 2UY2A 1IBLT 3BXWA 5E6ZA 2CZDA 2VQUA 3OBEA 5A6JA 3PAJA 4GABA 4D6EA 1Y7VA 2C1HA 1EA0A 3IGXA 1ZBVA 2JQ9A 1GTHA 1FIOA 1TWWA 2WKJA 2BASA 1QMLA 2VFEA 4DI9A 4UELA 1JVNA 4UIGA 3PV0F 1E6QM 1HL2A 2VD8A 3ES7A 2POTA 4X1KE 4BJHA 4PW8A 1Z6KA 4UR8A 4L6HA 3B0UX 1A4MA 4PL1A 5E0CA 1QCWA 1G4TA 2V3EA 1E6XM 3BLFA 3CQJA 2DLRA 1MZHA 1J5ET 2VKOA 2Z00A 3RJXA 1RY8A 2DZSA 1WX0A 3GXIA 1RHCA 4YTRA 1TPB1 2TYSA 4BJNA 1EC8A 4BI6A 4PJJA 1DTNA 2BV9A 1J0JA 4RCXA 1LWJA 3WK2A 3TYEA 2BY1A 3C8FA 3EOLA 4QDWA 4D8AA 4DXVA 2ZKMX 1KTCA 4W87A 1QNOA 3NQ2A 4H41A 5IHSA 4GBDA 3IVSA 2QUUA 1ZLPA 3VNZA 4BF7A 4OECA 1F05A 4HYRA 4REQA 1KW1A 4QROA 1XGEA 3BZGA 4A29A 5BU9A 3UYIA 4JY8A 3LLFA 2XSBA 4ZHQE 1TCDA 2OV9A 2VL4A 5LA1A 2E9BA 1FXQA 5LHFA 2CITA 2WXDM 2GJXA 4AZ7A 1JF6A 2ZYFA 1CLKA 1YBQB 2HNEA 5LGNB 2GK1B 5I3JA 2NXIA 4Y9OA 4C6JA 6TIMA 5EL1A 4LAZA 3LDVA 3EGJA 5D9MA 4LUIA 2ZZ7A 1REQA 2EHOD 5I3HA 1E9LA 3DG7A 1Y5XA 3VKBA 3KDNA 4YYFA 4EPDC 4NJHA 3P4PA 1OFOA 1RAKA 4JLEA 4UTJA 1GQNA 1VRBA 4IMGA 3U2ZA 2JIWA 4AX7A 5HYAA 5L3BB 4AZCA 3QLDA 2HS6A 2ZXAA 4X65T 3OVGA 1TZ7A 2INZA 1UQZA 2EPOA 3UFGA 1S2TA 5DRIA 2N2NA 3RMEA 4QH4A 2XQ7A 2QUVA 1SUXA 2ZMAA 4WX2A 4KCTA 1FWHC 2XINA 4EZ4A 4GKLA 2LSYA 1W9BM 5C70A 3VHLA 3RPTA 4UQCA 2YFNA 1F3XA 1RY0A 3EXRA 3PZQA 4AD5A 4LF1A 3M46A 2CLYC 3T81A 1N33T 4JD4A 4Z2GA 4RW5A 3SIZA 3FSUA 3JZUA 5I3IA 4A98A 3IUIA 5E0OA 2FBWA 4RDZA 2QCNA 3U8GA 5ETWA 1R9ZA 3AIWA 3TTYA 4P7OA 1XGDA 2OU4A 2QVAA 1OG6A 1Q8JA 4L6OA 4Q4KA 4RLIA 3SFKA 4RXGA 3TJ4A 5FVLA 2W0UA 1OIMA 3DG6A 1E6ZA 1ZTVA 1Q3NA 1UYQA 3RJYA 3AVSA 2YXOA 4Q4OA 3BAWA 3LMYA 3SQLA 2F2KA 3GXMA 5DFAA 4M56A 3P6LA 4WDWA 2R6OA 2VRQA 3AXJA 3B06A 2R82A 2HBVA 4I4TE 5EMMA 1K9TA 3LCFA 5BMWA 4Q4PA 4CKQA 5A8PA 2XFWA 4NT0A 4OV9A 4KFOA 4UCFA 3W84A 3VM5A 3C4ZA 2E77A 1XLFA 1E9ZB 3H4WA 3GDMA 3V18A 4CU7A 5FESA 2E8IA 1SJAA 2R9RA 5FNVE 4HQVA 3H2FA 3ANWA 1ME7A 3UP8A 4Z2JA 4UXDA 3CWZB 1YW1A 1JNEA 6ALDA 3ITOA 5LYRA 1IE7C 4M7SA 3NL2A 4BA9A 2NP9A 3SCWA 3COTA 4KQNA 5E5CA 2OX4A 2OMAA 5GNYA 1FWWA 2J13A 3SECA 1XRVA 4DUZT 2WMHA 1EHNA 1VCGA 3CM4A 3ABVA 3RYCE 4CCZA 1UZDA 1I2PA 5PTDA 1VJSA 2W27A 4Z2LA 3N9MA 4N9CA 4AZCB 1ONXA 5GNZA 5CG0A 4DPPA 3QY7A 2VELA 2WZHA 5JBEA 2AMGA 4IIHA 3T2PA 1TPVA 4GYKA 1D0XA 2K9AA 5IXEA 4NJIA 5ABFB 4PMYA 2FYMA 4UFLA 2EPKX 2Y85A 5C55A 3N9KA 3K8PC 1FWJC 1FWEC 2WWVA 3DHFA 2XVKA 2WANA 1AK5A 3DFOA 3SN1A 3BQIA 3PJUA 2VC7A 3S6TA 3SY8A 4WY0A 2WNWA 1EGVA 2X0SA 3STEA 2D9DA 1FP8A 3CQIA 3VKCA 1L0PA 3ARSA 3P2VA 1KBKA 1E4LA 5HXMA 1VFOA 3MWAA 3KM8A 5H8PA 3WNNA 4UFKA 1PWMA 1OXZA 3B13A 2GL5A 3DIPA 2HEJA 4WGXA 3I7QA 2Y63A 3HMCA 4CN6A 3N4EA 1JYXA 2AL1A 3NM1A 4MJ4A 4NSBA 4M5PA 4BQ4A 5HQLA 3B8DA 4O53A 3TSMA 2ZM6T 3UA3A 1Q2SA 1EZ2A 3PC0A 1E0VA 1E1FA 1Y01A 4PBEA 1WXJA 3HFYA 4C6IA 5B7ZA 3U48A 1W56A 1PKMA 4H1ZA 1NOFA 4IQDA 3NPUA 4R34A 4CNPA 1A5LC 1VB9A 5HEUA 2ODUA 3RLUA 3ANWB 2VL8A 3GUGA 4PMOA 4M29A 3AE6A 4K0KT 5HQEA 5DX7A 4TN7B 1SGJA 4DJFC 4U7IA 1TTIA 4ZB0A 9RUBA 5LJNA 4GI6A 1BPLB 3N6HA 2QJMA 5E09A 3ZMVB 3UA4A 1PV8A 4DV0T 1OYCA 1WR0A 4MB4A 1LWHA 2XSXA 4TMBA 4PTMA 5BZAA 2G95A 5CGMA 4AQLA 5AFDA 1G01A 4JQ2A 3E74A 3T1HT 1GONA 1U1UA 3NDYA 2ZWYA 4JTLA 5G1MA 5AQPB 4F0RA 4UTMA 1XLKA 1NAFA 3RYHE 3SFWA 2FB2A 2PRMA 5DJQC 2YXGA 4C60A 3N9PA 1S2CA 2BLEA 1M62A 3L0KA 4QS5A 1R87A 3CX7B 1TR9A 4MKNA 1XI3A 3L8RA 1KR0A 2C7FA 2WBGA 4CI3B 4WY0B 3TR9A 1CTNA 1E7PA 1UCWA 3CQKA 4LJ3A 1HKJA 1IYXA 4DV7T 2GJNA 2PDQA 1KFYA 4MJMA 1DJXA 4IGMA 1VAHA 2P53A 3JU2A 2VZUA 2QDGA 4LF5T 5FJIA 3IEEA 3ZCJA 2YCEA 3P82A 1YD8G 1NWRA 3SGGA 3DN5A 3I0QA 4LVFA 3M07A 3CEPA 1G7UA 1FWGC 3ANVA 4JFTA 2KT9A 4HD5A 3U4FA 2YW4A 1Z8UA 2WHJA 4AY7A 3LK2B 2XIQA 2GQAA 2ZQ0A 4J3SA 1OCJA 3Q5DA 1LLZA 1EOMA 1MYRA 4FA3A 2FZBA 3B05A 5HAXA 1FJGT 1W0MA 3OBAA 1HCIA 4XD3A 1YTEA 4BFAA 2VTFA 1YW0A 5A1LA 1JCYA 3NOEA 4AVFA 5A6KA 1W91A 5L3GB 3PUGA 2VMFA 3M43A 1GJWA 4XZLX 4DIAA 3W7KA 1VFUA 4P8XA 5JQGE 1BWVA 1KBLA 2YL5A 3W1MA 2HRWA 2E6AA 3CK5A 1ITCA 4NP7A 4PK4A 5ECVA 4ZVJA 2ZUWA 1A5MC 3BQLA 1WUFA 5LNSA 1LL6A 1OCNA 3O9NA 2Y61A 4IIDA 4Q8WA 2RHGA 3LPFA 1H4PA 1VIWA 4HYWA 4YN5A 3WIJA 2EQDA 1VEMA 3W53A 3UF9A 2PZ0A 1VZWA 3TV8A 3VKKA 3LBXA 1XZYA 2ONEA 4EPEC 4PGLA 4IDNA 1UWSA 1SW3A 3V5SA 1FVPA 5LNVA 3RDKA 1H09A 3OPCA 3ES8A 5FSEC 2Z2UA 4CD6A 4J2CA 1NM9A 5D30A 3NO1A 4CCDA 3TFXA 2V82A 3AYRA 3E02A 3BICA 2QGSA 1W32A 2X7VA 1S5VA 3OO2A 4KEMA 1D2KA 1QBBA 3M5VA 3AU6A 4ZBCA 4LUYA 2QZRA 3GNNA 4KI0F 1XLAA 2OTDA 1QOPA 3G3DA 4EAMA 1OINA 5IYZE 1AMKA 1NP2A 4W88A 1W5MA 1LKXA 1YXRA 2Y6XA 4E6MA 1ZJAA 1PKYA 2IS7A 3VINA 9XIMA 1I1WA 3VZZA 4UTTC 3HGSA 3PS7A 4WY0F 4HA3A 2VFDA 3VABA 3OYZA 3MMTA 3TNBA 2Y8VA 3FW6A 4HK7A 5AQJB 3ZEFB 1UQYA 2NX1A 2QV4A 3CGTA 3T0TA 1FP9A 4TVDA 3SSZA 1E9YB 1XISA 4B2DA 3RF9A 1TG7A 3ZR6A 1HL9A 3BJTA 1XBVA 4LNYA 3VXGA 4WSJA 4GUGA 2C15A 1OCQA 3AWNA 1D3GA 4GK0E 2ACXA 3QGAC 4BA0A 2D2SA 3A5VA 1L2UA 5CFBA 3GZ3A 4WZHA 3AXKA 5FF4A 1NOUA 2OODA 3I6RA 1VBUA 2VCCA 5D9NA 2JK2A 4R5EA 3ZVHB 4UV8B 1P4CA 4LEQA 2DNXA 3L4UA 2BHUA 2GVYA 4AWEA 2ZCGA 3GDTA 1QNRA 2VEGA 2IHR1 2BS2A 2BS3A 4PFMA 5CJMA 3L68A 4DO4A 2D5UA 2DP3A 3WQ4A 5I3DA 1U22A 3VFLA 4H7CA 4ZZCA 3G1SA 5M1TA 2VOMA 3AE4A 3AE3A 1OEDA 4QHRA 5IWAT 1MXGA 4U7YA 2YOCA 4RE4A 6TAAA 1RP8A 2IAKA 2I56A 3ZLHA 4E2VA 2G41A 4XVDA 5H1WA 1SO4A 2OZ0A 2GGHA 3VDAA 3W7PA 1XIIA 4LMJA 5I07A 4WKHA 1YDNA 1WRDA 3EX1A 1EJXC 4H8HA 1UOKA 3TR2A 3HKEE 4H6KA 2FZMA 4H9VA 4C6BA 5C9ZA 1VYSX 1GZ1A 2ZLYA 1H62A 5DMMA 3FIGA 3SRKA 1B3XA 4ADTA 4DF0A 3EXSA 1QNPA 1TJ0A 2ISFA 3HO8A 1JNDA 3I9WA 4GBUA 3QJAA 4NPPA 3UZYA 2A3BA 3LTPA 3EWBX 5DY3A 3KFWX 3NYDA 4D71A 4GACA 5HAOA 1B90A 5JDLA 2FZ8A 3BG3A 2O56A 3GA8A 1R0MA 3VU2A 2OQLA 4GIEA 1NH6A 3TC6A 1QDSA 1OX5A 2QUMA 5BOFA 4C6FA 1EO7A 4R27A 3RR1A 2ZICA 4XSMA 4Y7EA 4LMKA 1H7NA 2AAAA 4B3ZA 4OOUA 3FYPA 5H6HA 2DZXA 3EBVA 5HEGA 1GEHA 1RLCL 2B7NA 2XVGA 1UG6A 3UJ2A 3MCNA 3Q9DA 5BWAA 2NUWA 1DOSA 3LZ5A 3QOKA 2PRLA 3CAKA 2ZA2A 2DIEA 1SJBA 3TTQA 4CU8A 3U78A 4UUIA 4NF7A 5H6QB 3K13A 4MJ2A 3PPGA 4PTWA 5AC4A 6REQA 3EABA 5HMSA 4GX8A 1T8QA 1W1PA 3HFTA 5EBUA 1E43A 5EK2A 4H19A 5L3FB 3LD5A 3TH6A 3IUDA 4LWWA 2QAPA 3ZZ1A 4F8HA 3UCQA 3C2EA 1B3YA 1BTMA 3E9AA 4JN8A 1W3LA 2QIIA 1W3IA 2PRHA 3B9EA 4XO7A 3VIIA 5C7VA 1CIUA 3W70A 3B9DA 3SRDA 3WK1A 5I78A 1ZJBA 4YCPA 4TX6A 5EU9A 3QPYA 4IDPA 3AUOA 1CB7B 4IL0A 3PUXF 2YN6A 1GW9A 4JDBA 2QJJA 2WDQA 2BHZA 1WAUA 1QW7A 4FO4A 2PDGA 2DI4A 3W7JA 2H8ZA 1DORA 4HWHA 1A80A 4CI1B 1GTEA 3NL5A 1KBIA 3FXGA 2QJHA 4ZB5A 4GUHA 1SUMB 3QQ0A 4MF4A 4NRRA 1HO1A 4TVCA 2TODA 4E8DA 1NJJA 4PJLA 4KW2A 2XHYA 2XUCA 1VPYA 2DT3A 4Q4QA 3TJLA 1OD0A 4JTEA 4LNCA 4X9SA 4Y8FA 1BD0A 4EXTA 2QDDA 1KC7A 4PCSA 3B8TA 3CL8A 2CXGA 4MM1A 5JR9C 1RD6A 4YHEA 1M41A 4OYKA 4H8UA 3THCA 4TNVA 5C9RA 1T5AA 2E9XB 5B80A 3ZJ6A 4O16A 1QWGA 5M5DA 1NENA 1OFAA 4GXMA 4ZOEA 3SQSA 3RHWA 2GGJA 2BVLA 3G8EA 3U7BA 4NUWA 1V93A 1EGMA 3NQAA 4ZOLE 1EB3A 2J79A 3LRKA 2ZFAA 3KBWA 5G2IA 3STCA 3AI0A 5BNKA 2RKXA 4KGLA 4RDYA 3ATZA 1SO3A 3Q58A 4R9XA 3HJEA 6REQB 5LXEA 4X61A 4PEKA 4L4OA 4DV2T 3OJGA 2I57A 3H53A 3I7RA 4GC3A 1FFRA 1DWFM 4MAZA 1KFLA 1H61A 1E0UA 3W1PA 4M1BA 1ENUA 2WMNA 2F7FA 3UY8A 3W2MA 4MWAA 2V0TA 1AH3A 4JBWF 2VRKA 3VOFA 3B8IA 3IIOA 3DOPA 3EAMA 3LGEA 4LUTA 5G4WA 1F4AA 5HWMA 2ZWZA 1TMLA 2FGLA 1CXLA 4MB3A 2J74A 3LHYA 2XGZA 1GHSA 5K3VA 2HPJA 1PWLA 5AKQA 5KMGP 1IIHA 1RBLA 1O12A 3THUA 4UQ9A 2VUYA 2CLEA 3KV9A 4UFHA 3ZSTA 1GUVA 5CZJA 1S3TC 3EX6A 1IXQA 4ERIA 4QG8A 3FSTA 4H4IA 4XO6A 3W37A 2A9UA 2CZ5A 3P8IA 3PNZA 5LBMA 2D2GA 3G1VA 3P8JA 4NVTA 5I0DA 4DJFD 3LDQB 4F6RC 2LHNA 2PDLA 3PZGA 3CXOA 2O92A 3BV4A 4C5YA 2BDEA 4AQGA 4P8WA 2PD9A 3PUAA 4CD8A 3G0UA 2DH3A 3RIUC 3W22A 5JDHA 2PPGA 2XZ7A 1JPKA 3ITXA 3ARVA 3PF3A 4S3DA 1IR1A 3I65A 3UTKA 4OT7A 3PUZF 4LUSA 3CMLA 3SCOA 1UP3A 4DYJA 2WKLA 2I16A 1SFJA 2JF6A 4AZ6A 1CXIA 5CG7A 4B5XA 4X0NA 3GLCA 1BXCA 1HGWA 4EB6E 3HQPA 4O17A 2XN1A 4DAIA 3RM8A 3G1FA 1IF2A 2BS9A 4QG6A 1EIBA 1GVQA 3N15A 1ELSA 5CGQA 1BYDA 1HUVA 3B0PA 3R13A 5I5RA 4YHHT 3HPSA 5LMUT 5D32A 1XWMA 1W1ZA 1TYGA 2H90A 2L5HA 5CBJA 4NX0A 4U3CA 2V6AA 1N32T 2DZUA 2QCGA 3HTWA 4JTTA 3IA3A 2PDKA 4LUTB 5I3KA 4WJ8A 4MNMA 4AKRB 5J04A 3W1QA 3XINA 4MY1A 3V4BA 1T8BA 2XAHB 2ZRXA 3ECQA 2BDQA 3NL6A 2OGYA 2WWDA 5EZYE 4HNTA 2VASA 1F74A 2LM2A 4Y8EA 2NLIA 3VKDA 3TE9A 4GVGA 1S2UA 5B7YA 5AQQB 3GIYA 1SPQA 1OK4A 2EHOA 2X2GA 4QJ5B 4ZQPA 3OLIA 3C86A 3K3NA 1F76A 3TN5A 3CV6A 4U72A 3RAOA 5ENLA 4WBOA 4CQAA 1AZ2A 1K4HA 4QSFA 1XC6A 1WCRA 4TV6A 3VK5A 3ONJA 3CEUA 4H63V 3LJCA 4DZIA 1YPXA 1MZRA 2RP4A 2NSXA 3W7CA 1AQMA 1K9EA 4S3CA 2GPTA 2WMIA 4GVIA 2P3EA 1B54A 3KTSA 4LF9T 4DWDA 3GDKA 5EKYA 3G0SA 1FWDC 4G2DA 2Z24A 1OX6A 1EYEA 1XRTA 3V0TA 3GDRA 3UWVA 3LQGA 4HFVA 2FLIA 1QPOA 3P0WA 1B3WA 1IGSA 1D1AA 5A2AA 5C2XA 1KCZA 3SFDA 2ZDRA 1UZ1A 2QDEA 1IZNB 4KKXA 4PUJA 4GI9A 1I2RA 5EB8A 1GT8A 5JREA 1GVRA 5J5DA 1ZENA 5FJJA 1LG1A 1ZV4X 3EDJA 2BOGX 1RQEA 4Z2KA 3QMTA 2C1GA 4QQUA 1PIIA 3WD4A 1IZKA 1M6JA 3L2LA 4Z1AA 5EPDA 3S4TA 1TCMA 1SFSA 2CWYA 3ZJ2A 3VD5A 2ALDA 1VEOA 5CPLA 3PBMA 2ICSA 4UTLA 3L2IA 3H6OA 3LRLA 1P5BA 4I6KA 2DJXA 5F4WA 2Y8UA 1UD8A 4XBFB 3EWXA 2FQIA 4LVAA 3N3MA 7XIMA 1OJXA 3D46A 4LAMA 4JL2A 4QR6A 4DO6A 3J7Yq 2ZXDA 5FACA 3R8RA 3K1DA 3PU8A 3A5FA 3R94A 1FH7A 1XPYA 3WNPA 3HMJG 3T4CA 3ABQA 4ATDA 1NEKA 4O4IE 3IANA 1BVWA 3NFUA 4HYVA 1Q6FA 1DJIA 5BOOA 1P48A 3C2RA 4LRTA 4J28A 2J47A 1PZ2A 1OBAA 4LXFA 3AOFA 1AW2A 1QI5A 5XIMA 3GYCA 4KMCA 1DJGA 4PZVA 2WHKA 2OO6A 4QH5A 2XYLA 4DRSA 2IIUA 4OBSA 4B5WA 2X51A 2LOSA 4AQFA 8RUCA 1Q6OA 4YNGA 4QIUA 1FCUA 3D5HA 4UVAB 3PN8A 1NFBA 4D6GA 3OJAA 2XIBA 3M1ZA 4AD0A 1A5OC 4B4FA 2FHFA 3NYZA 3QY6A 1BG4A 1XH0A 3KLLA 2V5JA 3F2EA 3W29A 3CX6B 3KRBA 4C90A 3PSVA 2V7JA 2R91A 3AAIA 3MV11 3TWBA 1JCMP 2C0AA 3L4YA 5DELA 3EVYA 1VR6A 3R43A 3RYIE 2W67A 4HU3A 3WMCA 1KXHA 1UD3A 4C6NA 1GQJA 3W6LA 4S1FA 4LFBT 2ZVIA 2D2JA 1CGTA 1P0NA 3I6EA 2CLMA 3B9OA 2PF0A 4UR7A 1O4UA 2C1IA 3SR7A 4OK0A 2Y7FA 3QZEA 3GX9A 3PZIA 1PO9A 5HNUA 1LM1A 3TROA 5FJTA 3SW6A 4HPHA 1J0KA 4ANJA 1GOKA 3BL3A 2YKSA 3ESLA 3JAEA 4UF0A 4ERRA 2HCVA 4KBMB 2C8NA 3NTYA 1EJVC 2OYKA 3PHAA 4MG4A 3KV5A 2A2FX 4AXNA 4OVXA 1S38A 4X3ZA 4L6DA 2R24A 1DVJA 1MO0A 4RK8A 1KNZA 2F84A 3VKAA 1UA3A 1RPKA 1ZBWA 5LGTB 3SGZA 2BX7A 1ISXA 4B15A 3G8RA 3CL6A 4ACZB 4ZENA 2NUYA 1V6TA 3VOCA 2YKKA 4PJMA 1XL9A 3KVMA 1WDWA 1V6VA 4BI5A 4IISA 3HJZA 4Q6XA 1AA1B 4NRSA 4NZCA 3ITVA 2OLAA 8CGTA 2BTMA 5HBFA 3SQMA 3UQNA 3O1JA 3EWDA 1K02A 1VC4A 1IWAA 1HKWA 3HR0A 4NNAA 2IW0A 4JNMA 5CPMA 1S1PA 1TIMA 4CQDA 3UFEA 3VCCA 1NDWA 1ZB5A 4V2XA 3C3NA 1W09A 3L3PA 3MV01 3INPA 3F57A 2GJLA 2HH7A 5CBIA 4MKVA 1W3NA 1E4NA 2O4MA 3JS3A 5D09A 4JX4A 1ZHCA 4JYEA 1Q2RA 1XUZA 1HF6A 3N14A 3URQA 4NXNT 1JQXA 2CETA 3RX6A 1HKVA 1WKEA 4Q4MA 2VFGA 1X7IA 5HK4A 1A4LA 4IE6A 3WNLA 3FJNA 2ISDA 3CK6A 1CB2A 3JCFA 1LBLA 1OG0A 2Y7DA 1DJQA 3QUJA 2Z6JA 3QXBA 1H7OA 1Q85A 1VHCA 4JI7T 3O07A 5TF0A 1UZ4A 5D05A 2ZTKA 3AIUA 4IG2B 4CQBA 4LY8A 5G2HA 3UU6A 2FVKA 3BMXA 3UFYA 2OKOA 2MBGA 4UEMA 1IXOA 4YTUA 3WMBA 4GWEA 1DBTA 4JXCA 3HI2A 1ESWA 1PAMA 5FJPA 5K4ZA 3C51A 2M6IA 2CNCA 3N9OA 5LG4A 1S35A 3OGRA 3LHZA 4FLRA 4W7UA 1UX4A 3QQ1A 2VD9A 4GZIA 2WVVB 3NGJA 1SHZC 3ZMZB 1B31A 3UNTA 2RGLA 5FP3A 3EB2A 4D6CA 3MSGA 1Z48A 2E40A 4FEZA 1FUYA 1A5UA 4JN6A 1Q4NX 1V3IA 2ZXBA 2DT2A 2EPNA 1E1CA 4K36A 3LM3A 2XQ8A 2OWCA 4HSOA 1GPFA 2AQOA 4EPBC 1T40A 1LJYA 3PFRA 5J2UE 3M7SA 4LCQA 3P61A 3TSBA 3VRAA 1C8YA 4HEAA 1F07A 3PTKA 4OHFA 1TPEA 1RCQA 1Y5WA 1GORA 2EAWA 3N2GE 3ERPA 5CPNA 4Z17A 1T41A 5KX5E 3K30A 1X1NA 2LKGA 3BTNA 5AECA 3C4UA 2O7QA 1W9RA 2P0OA 3GHRA 1NEYA 2NQJA 3FA4A 2DQXA 4UWMA 5LA0A 1FA2A 4LYRA 4GNKB 1NELA 4M80A 2J24A 2J8FA 3RGTA 5KZDA 3S1GA 4L56A 4FNTA 4GXWA 3W1UA 1AJ0A 3KHDA 4YTMA 3UUBA 3D47A 4C6OA 3IAQA 4C6EA 1GVSA 2GQ9A 2Z2BA 3ITGA 1V6WA 4Z42C 1D1BA 3SN0A 4A3RA 3ZWTA 1O66A 2DWKA 2OKTA 1O5XA 1PYMA 3WENA 1VCSA 5CBBA 2YK0A 4WGHA 4HWDA 3RM9A 3IS4A 1TPUA 3PE0A 2ACSA 2SPCA 1BWLA 2JFEX 2Y70A 2PS2A 4LSBA 2A3LA 5CH9A 4DJEC 4O2AE 5BRBA 1NOWA 2G3MA 3HKDE 3MDWA 1XMOT 3Q2DA 3WK0A 1Q6RA 1W9PA 1BRLA 3BMWA 5A3HA 2H9AB 4B5TA 4ZI2C 4HJFA 1Y5VA 4PMDA 1XBXA 3DBNA 3PWAA 5GVJA 1RCXB 3M0KA 2PTXA 5C2CA 4QNWA 1X6UA 3TQ0A 4A22A 4NUVA 5CPOA 3RCMA 3NA8A 3GHTA 4EWJA 3U0HA 4KRTA 2NX9A 2X41A 3M64A 1V79A 3GE7A 4XG1A 1AFSA 1EJSC 4D6JA 2DT0A 1ZPTA 2WKGA 1W6TA 3B4UA 3NURA 4IE4A 4GYPA 1SMDA 3GNDA 1DIDA 3NZ1A 1OY0A 1FHVA 1UKSA 1R7AA 1X96A 4X64T 3DG3A 1XCXA 3BC9A 3IIZA 3URBA 4WNKA 4GIRA 1ZCOA 4UOZA 3NQDA 1UH4A 5FL1A 1B9BA 4JI5T 2EKCA 4E3TA 3LPOA 3QGVA 3WD1A 4DYKA 2ZX8A 4ATLA 1LUCA 2FUPA 4G8TA 3TX9A 1CXEA 2QJGA 2INFA 4LS1A 4PRRA 3N4AA 2W4XA 3RO8A 4QE4A 2QMKA 1OABA 1W9UA 3TW7A 3AE1A 3QN3A 2LLYA 1D9EA 2GSJA 3IRDA 4NJGA 3DDMA 3AEBA 1UIPA 4R7JA 1EXBA 1JPDX 1F3TA 4R88A 2QVNA 4EEBA 3JC6C 3RKOA 1XKYA 4DZHA 5BRPA 2FH6A 4IMAA 4GKTA 5HJXA 4NZ3A 3DAQA 3IJ9A 3W2JA 4JI2T 2TSYA 5F2LA 5I03A 5HJYA 1EXPA 3CQCB 4INFA 4JHOA 3GKFA 3VOHA 3K3QC 6A3HA 3W2NA 1TA3A 4QG9A 4ZSUA 3MA9A 4X2PA 4CD4A 3RNDA 2VKDA 1WZMA 4PRWA 2Q01A 4P61A 2YZ5A 2XUEA 2BY0A 2F6KA 4AYGA 3R84B 5AHEA 2XZ9A 4IE7A 3S4UA 3NL3A 2PU0A 3KS5A 4GX9A 1ZAHA 4AZ5A 4ILSA 2X1UA 4F8XA 3QRHA 2C13A 3FLUA 4WHBA 3CWOX 4Z0JA 2CWOA 2CLFA 4LC8A 3W7NA 2CLIA 4CI2B 4DNMA 2FZNA 3F2CA 4RE0A 5I23A 4FJOA 2G3IA 3HG4A 3KBNA 3OHMB 3R0UA 2X05A 5EMUA 2RGMA 5HR7A 3C0SA 2WY2A 3TLWA 1FWAC 1EDTA 2E28A 2AAMA 1YEYA 2P88A 1JEZA 5DCBA 1V0NA 2V38A 3SRFA 2OWXA 2XH7A 1CWYA 4EV6A 2D0HA 2OOFA 2UY3A 2WSPA 4P2VA 3P80A 1FDJA 1PBGA 1A50A 3C61A 1EJWC 1YXDA 5HPOA 1HQTA 2DUZA 1XPGA 2C6QA 3EDDA 3SB0A 4OX9T 5DQWA 3O4XE 4ILCA 1SFTA 1OADA 4B3MT 5IOBA 3W7MA 2UWFA 4E8CA 1IT0A 1JZ6A 4HCHA 4NI8A 4HFBA 2QUTA 1UH3A 1ICPA 3CASA 3ARXA 4PMNA 2PI6A 5AC6A 2NQ5A 1W1VA 3VIPA 3OLDA 5ECUA 3U4AA 1A3WA 4H9TA 1Y65A 5F2GA 1CGYA 2Q9QD 3B0XA 3MBDA 4I7UA 1Z41A 1OX4A 3WK3A 2H6RA 1KM2A 4YLHA 4IM4A 2FVLA 1SR0A 3DFYA 3V1PA 3CMFA 3T55A 3RI5A 6PTDA 1B30A 4PMQA 3NDOA 1R3RA 3AYSA 4G6CA 2AL2B 1WO2A 3SCNA 5HNRA 4H9ZA 2JKEA 3PBUA 4HCDA 1XKJA 1ZJIA 1H7PA 3CV2A 2GUUA 4IIGA 5A6TC 2BY3A 4UZUA 2OGJA 1RJRA 2WSQA 1QBAA 1U5HA 3VKJA 5JVLA 5ABEA 4HZ8A 1Q7MA 3J9X1 4JI1T 3W88A 3NQ8A 1BG9A 1UUSA 3ZO9A 4TX9A 3W00A 4AD2A 4RNFA 1IEQA 2QA7A 1XSKA 4LRSA 3MDUA 1A53A 3ARRA 1T98A 2X40A 1G6CA 4YJ3E 3FJ4A 4HNOA 5IM51 3EUHA 2E9XC 4YY3T 2DSZA 2P8CA 2VDGA 2VM8A 4HN4A 2FJAA 1UR1A 4ADUA 5DXYA 3EKGA 2I7GA 2W00A 1CI1A 1VP5A 3CWHA 3OQ8A 3FNDA 4N6FA 4ROQA 3ZWSA 3F1QA 3WBXA 3R25A 4R85A 4JYDA 3OVRA 1UPPA 3QH2A 3WF2A 4I0UA 3ZM8A 1DU2A 2XAJB 5JH1A 4XB3A 2D24A 4G7EB 1RXOB 2XZEA 3PBVA 5E9XA 5D9OA 1ZZMA 1JUBA 4GIAA 3P74A 1XRSA 4A3QA 2VVSA 5CLWA 1QU4A 5LP6E 1T99A 3U2EA 4DX3A 2OFJA 2I59A 4QLKA 1NSJA 3VUPA 1J9YA 3LPGA 1V5XA 1WOBA 4JICA 2DSUA 1ZNNA 3N2MA 5LGUB 1TE6A 3AMGA 5AHLA 2BGNE 3NZGA 2J7FA 1OX4B 4HK5A 2Z1WA 1DE5A 3AS0A 4K1GA 1J1JA 1ALDA 1FTXA 4HOXA 3FYYA 2XSAA 4GI4A 2D69A 4GJ1A 2HBXA 1Y64B 3GD6A 1T0OA 1AG1O 1RK5A 1AL8A 3AIVA 4QE5A 1OWAA 4Q6JA 1NWUA 9CGTA 1HVXA 4EKJA 2QGHA 3RXZA 1E0TA 4J3WA 1A0EA 1EJTC 1M5WA 3FX4A 2Y5SA 3EX3A 1V3MA 3SSJA 4DJFA 3IVUA 4J3VA 4B3KA 2BWGA 4LCSA 3U3HA 4IL2A 4O52A 1TWIA 3ZQ9A 3AJXA 4PUDA 2P8BA 4V15A 5SWUA 2YSWA 3OU8A 3UGRA 5HCMA 1EX1A 4UNLA 4XKYA 2P10A 4TTGA 1X8FA 1WBJA 2Y7EA 3CQGB 4WK9A 4JAWA 3NQ7A 2AQWA 4KH2A 4PB3A 3AROA 1TR1A 3IAPA 3VGHA 4YTPA 3MT1A 3MW7A 2Z27A 5AN7A 4B4HA 1HNWT 2J25A 1TTQA 4YWIA 1FCQA 1IGWA 1MXSA 1LRTA 3MKKA 1GCYA 4HNUA 4HKAA 3PVFA 3UY7A 1V0MA 3P7YA 3W82A 2XM1A 3WI3A 1HJUA 3I3DA 3MKVA 3TFCA 1MW1A 3T2OA 2JJ9A 1PZ3A 1ZOYA 2VJXA 2V3DA 4XSLA 1FHDA 1OB0A 1BHGA 2Y4SA 2C19A 4S3JA 4DBRA 1XICA 1XS2A 4GIWA 1QFEA 1ZFJA 4O18A 4EIWA 3GDLA 1EQPA 1C8QA 4PYSA 1I9CB 2J7DA 4MLJA 4YL2A 4I5UA 4O1EA 3L23A 4R9OA 2E6DA 1H63A 4O4JE 4DUOA 4ZI3D 1HNXT 3M7WA 5AVNA 4PE8A 4MWAC 4GQQA 5EK4A 1LOQA 2D3NA 1J11A 1QXLA 4XAXB 3UU5A 1OFRA 1M9HA 1RBOB 1VENA 1XBZA 3W1LA 4JTQA 3JW7A 3IJDA 3RX2A 2XQ9A 4JFWA 3GH7A 4AHPA 4AISA 4MNJA 4XX6A 3RX4A 3W07A 1YDYA 2WLZA 4UMCA 3RITA 3CT2A 2YCIX 4LF8T 1X98A 2NT0A 4FXSA 5LNUA 1SZRA 1V3LA 3M0VA 3YPIA 3IJ8A 5DMLA 4UQBA 3VOJA 3KS6A 1SO6A 3V36A 3AXHA 1DPMA 3NUKA 1M03A 4ISSA 1XP3A 2BHYA 5DXXA 4O1DA 3VC6A 4TNWA 4AIUA 5AQUB 1KM4A 1W8SA 1UIOA 4WRHA 3ARYA 2Y8DA 3AZSA 4HA1A 1YHTA 4Z08A 4F4RA 3EB3A 1EZ3A 1THFD 4FXJA 2E5CA 2IKGA 3AMCA 4LBSA 3WDHA 1UWRA 2R94A 3BJFA 2ISWA 1P0EA 3OA3A 3W2KA 5JRCA 3IK2A 4O1AA 5LJMA 3POCA 4GGHA 5IUXA 4DO0A 3POHA 4V33A 3TMLA 4NI3A 2DVTA 4K8HA 5A1AA 2QDHA 5F7UA 2H7VC 3N11A 5I77A 4GXPA 2FVMA 2A6LA 5FXVA 4QCFA 3SUVA 3ONLC 2A3DA 2R1MA 2WSRA 1OYBA 2GSHA 3S3GA 3UVIA 2BBHA 4JFUA 3S2CA 3JZEA 4JHZA 3QLLA 3I4KA 3LQLA 3UJSA 4BK9A 3R8GA 1VFTA 2WS3A 1MIWA 3F4CA 1XIGA 3RPUA 4L5GA 4MDPA 3MJMA 3KAOA 3PAOA 3T6CA 1VLIA 4D9PA 4X22A 1IEXA 1UMLA 1XC4A 5DY2A 5LHEA 4EANA 3IVTA 1XIJA 1NARA 1JZ4A 3WLHA 2BKNA 1YQ2A 5CSUA 4ZQRA 3M16A 1I2QA 3WLNA 3LY0A 4AIBA 2V63A 4O14A 2LE8A 5LHGB 1E70M 2X1TA 1MRQA 8TIMA 1G4SA 4Y90A 4PH6A 4F0LA 5DBTA 4C1NA 4DJED 2GQ8A 1WBHA 3PZNA 4UFMA 4W5UA 4WXYA 3UPMA 2WSKA 3QF0A 5CZKA 3F4WA 2TRSA 1U83A 3WQOA 4ZI2D 1OVDA 5EMJA 4JI4T 3CLWA 4W7WA 5FXWA 3RO6A 4CNOA 3WBEA 4LBRA 3J7HA 2V7IA 4DUYT 4MHCA 5AQHB 2Z1XA 2Q3OA 1Q45A 4WD0A 1YQ4A 2Q6ZA 2YIHA 3E08A 4IQEA 4NQ1A 2FJKA 4MB1A 2RUSA 3LHUA 2QCCA 1UKOA 3AEEA 3GXPA 1R9YA 2UY4A 2J27A 3HGJA 1MMNA 3P0XA 4JHMA 1F3EA 4N02A 3GDBA 1PEZA 3B8SA 4XBSA 3QPZA 1IT7A 3NZPA 3KP0A 2CXLA 3BSMA 1YXCA 2DY3A 3H2EA 5D8WA 2OQYA 4LVGA 4ZZBA 2QCDB 2OYLA 1K6WA 2WC7A 1SE7A 1XYBA 3L4ZA 4ILUA 2XAFB 2OO0A 4JGDA 3VMNA 1BVZA 3D3AA 4FIQA 1QAPA 3EWCA 2W62A 1WQ5A 4PMJA 2J9ZA 3MB9A 4US6A 1TJ1A 4TMCA 4E8GA 1Z9AA 5FY1A 2QT3A 3N25A 3W7GA 4IL9A 1P0KA 2HN2A 4QS6A 3DCPA 2OSYA 4PUUA 2PSNA 2HWGA 5I7GA 4W5ZA 4CQCA 3UG8A 2OVLA 4IFKB 4MIMA 3VNMA 1UURA 2CEQA 3TVAA 4I9MA 3B3DA 4Z91A 5TQLA 4V1YA 1D0YA 3WLRA 2QHAA 5EYWA 2A1YA 4DBDA 2L9QA 1AD1A 4A8IA 4IJRA 1QSDA 2DWGA 1QWKA 1V51A 5FEZA 1KM1A 5CJ5A 2Y2WA 3PPFA 2X9HA 2ZVRA 3AA0B 3OZOA 4GCXA 2JF7A 2OZ3A 4W93A 2MTQA 5FVKA 2BOEX 4FF7A 4A3HA 3CMJA 2E1DA 1ICSA 2GSEA 1IR2A 3GY1A 2DZPA 2CW6A 4QH1A 2VQTA 2TPSA 4JIEA 1TJ2A 2E9LA 3PANA 1OYAA 1IXPA 4S3AA 1KWKA 4M6PA 3PJAA 1YNQA 5JU6A 3LCWA 2ABBA 5KZEA 4AQFC 3VR9A 3DZ1A 2WC3A 3MHGA 1XLMA 3W25A 4V27A 4MNKA 3KX6A 3S5NA 2OSWA 3E2VA 4UV9B 1WR6A 4B6XA 4AB4A 3W86A 3C0LA 3EX2A 4ZOCA 1DJYA 3S2JA 1OSEA 1LRNA 4MHBA 4NX5A 1Q6DA 3V0UA 2C14A 1EDGA 3B57A 3QKZA 4DY1A 2LLEA 3M0LA 2V3FA 2B0MA 2VX6A 4R3UA 2YL9A 1EDQA 1JIBA 5KDMC 4EVZA 5HUPA 2VFIA 3T42A 4JKLA 2QJIA 3W71A 3WBAA 1FDZA 4IP4A 1UCUA 2XQ6A 4M24A 4ALDA 2XISA 4GHRA 1YPIA 4LAUA 2W3ZA 3JUGA 3AISA 1E55A 3PB0A 1YKEB 2WPBA 1PE1A 3MYPA 3VDBA 4NIQA 1WDRA 4AF0A 3F03K 3MPGA 3M9YA 3UQ7A 1XHGA 2ZX6A 4LH8A 4TTUA 3REQB 4X60A 1LZOA 1OFEA 1DWIM 3C0JA 2YCLB 3AA7B 2CYGA 3VO0A 2Q8ZA 2PCQA 2KZHA 3VC5A 4XIMA 3S1WA 3FA3A 3M41A 4JNYA 4X66T 3WF4A 3T9PA 3WQEA 2Z29A 3M5ZA 2Q71A 3SRHA 1XDLA 3WSUA 5U7SA 4IZGA 5FAGA 3PZVA 4FZIA 2V6XA 2HISA 2XGBA 3ITYA 3CBWA 1PX3A 1XIEA 4YHGA 2K5BB 3TK7A 3KDSE 3CIRA 4U31A 4B90A 1EC7A 3B40A 1VOMA 1FBAA 1ZCCA 3MZ2A 5KSWA 4GZEA 4HFCA 4XQ6A 2VOTA 3AE2A 5D02A 4K6AA 1VFHA 4H6RA 3MZNA 1F6YA 5A6SA 3A4AA 1LQ0A 1WLXA 2E9XD 2CBIA 4LUJA 3VA8A 2H3DA 3ID7A 4KT2A 2ZXQA 2XQYA 4IIEA 1YMYA 2FKPA 3CQHA 3M6DA 3AHZA 1E40A 2ZX7A 4D6HA 3W1TA 1ZU8A 3RRWA 3W81A 4MFDA 1RLDA 1PKNA 1KM5A 4L65A 3UR2A 3H2CA 2YA1A 3GVQA 1W1B1 4W7VA 3BG9A 3G06A 1KNWA 1ITUA 4R33A 1ZY9A 2E5DA 1XFBA 3S0CA 4JCMA 5E9AA 1E6NA 3TWAA 1R86A 3KEHA 4WSKA 4OIFA 2ADAA 2QRXA 1ZJHA 2I9EA 1RA5A 4EIVA 2W92A 1SW0A 3ONBA 5FF0A 3WZ0E 3STGA 4EF8A 1JAEA 3CZKA 3O05A 4XD4A 1IJ6A 2BZNA 2W6RA 2MPKA 3PURA 1R46A 4DBQA 5J8LA 4LQ1A 2Y6ZA 2CPTA 3QTGA 3WLIA 1MMAA 4S39A 3KCJA 3C3UA 3MKDA 1KCKA 4ASTA 1ZGDA 3E12A 2C71A 3LM7A 4FIRA 5DF0A 1VBHA 4QKNA 1JDEA 1YLVA 5A6MA 4GI8A 2IW5B 2XWDA 4PSRA 2CXDA 1N2VA 3GB6A 3GU2A 1O95A 1R38A 5F5WA 2BG9B 2PDWA 4FLOA 3VM7A 4LB3A 1NY1A 3LN3A 4ZEPA 4WOQA 1YKHB 4IIJE 1XYCA 2L8KA 4BF5A 3OZPA 1O5QA 4TR9A 2XQ3A 2YXXA 2NVCA 1ZQ5A 1XNRT 4ZZ9A 2ASHA 2C3ZA 4WJXA 3H55A 2TAAA 3SURA 1EEXA 5AQTB 2ZE0A 1DJHA 4MTVA 1E71M 4CZZB 1ECEA 1PTDA 1J5WA 3QM3A 3ZR4A 4O4LE 1XYLA 2QYWA 3AWOA 5C9UA 3A64A 3WLOA 1KKOA 2NWRA 3RC3A 3RQUA 1E6RA 4F66A 3RCNA 4PCFA 2Q3RA 4DO5A 2I17A 1A5SA 2XIIA 1WZAA 2VGGA 4EZHA 4LU0A 2PEVA 3T78A 4ZFMA 4QRNA 1QASA 1XIDA 4JTCA 1TWSA 3TLLA 3TUUA 5TD4A 4UTKA 5M2FX 2VXNA 2YYUA 3THDA 3V75A 3WF0A 1EOKA 4U10A 4U74A 1P1XA 3KFTA 3WEOA 1TSIA 4DR1T 2X67A 3KL5A 1J0IA 1B5TA 1P6WA 1O1ZA 1UC5A 2Q8XA 4B9ZA 1EF2A 3LSCA 3AU2A 3DH7A 4K38A 3M5YA 2ZBTA 2DEPA 1KFKA 1MQRA 4I5RA 2WBLA 4HNCA 3CJPA 4XTIA 3NEVA 3MU7A 4GISA 4G1NA 2BGQA 3O6YX 4L61A 3KWXA 4PODA 1CECA 4CVUA 4O19A 1XLLA 2YCJA 1X6LA 4Y9PA 5DT7A 3PJAJ 1LDCA 1ITQA 2WWUA 1DWJM 2ATSA 1VJIA 1J4EA 1R7OA 5CPQA 3LGGA 5I6SA 1O3XA 2Y7GA 4GVFA 4J2MA 1MRAA 2PURA 4I90A 3R12A 1TKKA 1MDRA 2BVDA 1FKXA 3AA1B 3GU9A 1UPMB 1KFWA 3ZOAA 3NZQA 4FI5A 2GK1A 1LVFA 3E0WA 3LHVA 3C2FA 4GK5E 1XV8A 1EJUC 4Z90A 2VB6A 3L4WA 2FHCA 2B7PA 4DLMA 3H22A 4GYPC 2RJGA 2P3ZA 4EXBA 2J7EA 3WNMA 4XAFA 4L9IA 3KRUA 5I3FA 1GYMA 1PIFA 3LNPA 1DTUA 4MAVA 2GK9A 4A56A 3ZYZA 3NVOA 2G3NA 2DVUA 3N17A 3A3WA 5D33A 3ZXWA 4HKPA 4F0MA 2JQQA 3GXFA 4K7YA 5FEPA 2ODVA 1ECQA 2EGZA 1V03A 3KHJA 3APGA 4J4KA 3PPCA 3ZYKA 2JQHA 5F2IA 2BKPA 2VEPA 4I9AA 3L4TA 4O54A 4F79A 2QVHA 4Z1BA 1DWGM 1Q7QA 3O06A 4DMWA 3CUGA 2PFVA 3AEAA 1JCJA 3AXIA 1CDGA 3BSGA 4XZMX 5HDRA 3BAXA 3WY1A 3D0TA 1FHLA 4BR1A 1D7FA 4OTKA 2ZDSA 4QX4A 3FJLA 4TUYE 1Z89A 2YGYA 1I2OA 3WF3A 1IIGA 3IGSA 1NQKA 1P0BA 1JXKA 1S2WA 4JQ1A 4L9ZA 3M0IA 5I09A 1MW2A 4QCEA 4A6GA 3R11A 1B4KA 3F2BA 1TWDA 2E8YA 4UMAA 2V30A 1PKLA 4C6KA 2ZUUA 1JI1A 2VL0A 1MEIA 1FWSA 1G94A 3PJXA 1HL8A 3PZUA 1J93A 1GJUA 2GVLA 4AG0A 3HKBE 2C5IT 3CH0A 2PE4A 3DU0A 4N4QA 3WH5A 3K4DA 5HANA 4TU1A 1PZ0A 1UX5A 4UOQA 2ZRWA 4L1XA 4IGUA 2L3LA 1EP1A 2O0TA 3UW6A 5FY0A 3ZMTB 4H9SE 3Q45A 2F61A 1XSJA 3ARPA 3QK6A 3UU4A 2H89A 1VRDA 4KCVA 2Z4GA 4EXQA 3A12A 5KITA 2WDVA 1PHWA 3RLFF 5C3JA 4QXBB 2A4AA 2VZOA 2VRJA 2VEIA 5CA0E 2JBMA 1QI2A 4DYEA 1C9DA 1YDVA 3S2MA 1LRZA 1MFUA 1Z44A 1RV8A 3VIMA 3ZJ7A 3I4EA 3DERA 1H3GA 2XY8B 1DIKA 3KCOA 1Q13A 2XFRA 1MQQA 2WM0A 3CYJA 3AEGA 2LRKA 3EA2A 4HU8A 5AQNB 3OOQA 3QZ6A 3VE9A 5ABFA 3QBUA 1IWBA 1VGAA 1JZ8A 1NVMA 1QPQA 1Q6QA 4F2TA 3KLKA 3PTMA 1US3A 4JY9A 3C8NA 3BH4A 2IPFA 2WM9A 4U5KA 2AGKA 1ONEA 1ADOA 3MUCA 2Z6EA 2E5LT 5CQ1A 2AQVA 5AHIA 3EB4A 4F2BA 3SRZA 2Y62A 2WCAA 4C5ZA 2HN1A 3CAQA 3O9XA 1XXXA 3TLVA 2H88A 5CGTA 1D7KA 1VQTA 3LS9A 5C5YA 1O1HA 3ZJ8A 4GUFA 1OF6A 4EPKA 4EYYR 3ONXA 2Q9QB 3MJXA 5G5IA 5BU6A 1US2A 1MVYA 1K8ZA 2NQLA 3W2LA 1Q7ZA 1HJVA 2NV2A 1KEYA 5MKGB 4WYVA 3KBJA 3FHQA 1KBJA 3DP7A 3P60A 4LTSA 1BQGA 4ZE5A 4PFHA 3TEVA 4H63H 2VEFA 4RNHA 1EPVA 1EGZA 2R1LA 1XLCA 5BW6A 4DR7T 3KBSA 4JIHA 1PXGA 2GWGA 1XYMA 2G4FA 1LWIA 5D2YA 2DDXA 3CPZA 1VPXA 3UU3A 3VR8A 4HPNA 2X0LB 1LLWA 2J66A 1ZP4A 1KCLA 5H8MA 2CM0A 2LRLA 3UR8A 2N1GA 3WJYA 3WFZA 1NU5A 4WCJA 1EP2A 3GTHA 5L2LA 4N2YA 3Q5WA 1DEDA 1E3ZA 1CGWA 5AQVB 3PPHA 4O4VA 4J1OA 4OHQA 1GVYA 2YDSA 3DYOA 2CWNA 3H7UA 2CA5A 2OG9A 1FWCC 1WUEA 3I0OA 3AS3A 1B2YA 2J77A 3PZOA 2KX9A 2WV8A 4S3KA 3KOYA 3NWIA 1C29A 2B31A 3SDOA 2J88A 1XD1A 1ZBKA 1XDMA 1RJQA 4F48A 5AB3A 3MCOA 3HIJA 2EPMX 3KOFA 2OYMA 5AYXA 1C7SA 2DSKA 3UPWA 3L2MA 1ZBCA 3GC2A 4NZJA 4IPNB 1US0A 3VE7A 4KEZA 3NXLA 1JUKA 4NAEB 2E4TA 2BOFX 5REQA 1O94A 1POJA 1J8VA 3FGCB 1U5JA 3S1VA 4IJCA 3VKGA 4JNZA 1X1ZA 4M8UA 3AJ7A 1OF8A 1RUSA 4BS0A 3PG9A 2QMJA 4H9UA 4XZ9A 4DUVA 2NXHA 4D1IA 3K3OA 4AZIA 3KBUA 4ZO8A 3UESA 3CH9A 1BWKA 4DM1A 1VYPX 2E1WA 3A4WA 5CA1E 3RMJA 3W75A 1M68A 3DBPA 1KNPA 2YLAA 2G96A 2WW5A 4PMXA 4IL4A 2XAQB 3LOTA 4MJZA 3WLQA 4E38A 3SCVA 3QV7A 3QNUA 4DWSB 2WVTA 2NW8A 2OEMA 4DUXA 2OELA 3F5JA 3T09A 4ROPA 5FF7A 2PGWA 1FXPA 1DJZA 4TV5A 4FR6A 4O0QA 2ZRUA 1X9BA 4LANA 1K03A 2RAGA 4A35A 4ILBA 1TTPA 5C8YE 1I94T 4KIEA 2BFGA 3UXDA 2YINA 4FXFA 4IFOA 1J12A 3WLSA 3VILA 4F9JA 3VIHA 1W0BA 4B5NA 2NW9A 2YDAA 1TTJA 4DBUA 1JF5A 1GOMA 1VF8A 3VUSA 4L64A 2FFCA 4KIRA 1WP6A 4GYRA 2QCLA 1U1HA 1UKQA 2V26A 1W17A 2DSVA 4JTDA 4AY8A 2FDMA 2PD5A 5HOSA 2ZOXA 1KNRA 4BQ3A 3ZN0B 1XBYA 3WUEA 7CGTA 2PJQA 3U3IA 3WDQA 1QPNA 1PYFA 5IBXA 1S5NA 3H7RA 3S46A 3PWIA 3FAXA 2ESCA 2YU2A 4C91A 4JCLA 3RR4A 1QVBA 3Q94A 4MBQA 2CCQA 3O8AA 3QFWA 2FDSA 1H41A 1W3HA 5A2CA 1V02E 1EWDA 4DR4T 2GZXA 2WJEA 3A47A 2WZMA 3VMPA 1SZEA 3A9BA 4ZQOA 2XQAA 1GOXA 1GYLA 5DEZA 1RVGA 4B3LA 1UD6A 1GG0A 4I55E 3K8LA 5REQB 2DUAA 1DL3A 4JN7A 4HWCA 1PJ9A 3MTWA 1WKDA 3A21A 2ZADA 3CO8A 3UT5E 1F4HA 1XG3A 2WQPA 4JKKA 3OG3A 4WXZA 3RHGA 2KSRA 1M7KA 4AIOA 3GUWA 2PP0A 3DHUA 2HHHT 1ODUA 1P43A 1QUUA 2OEKA 4P7LA 1KFJA 3S47A 1X39A 3OBVE 1AH4A 2J78A 5G1TA 1CUNA 4H9NC 2QPXA 4J5NA 5L4HA 3WMSA 1XQLA 2G4JA 4H83A 4MUZA 4FAMA 2ACZA 3F4NA 4ZR8A 5BMVE 4N9EA 3SWHA 1L8PA 3PZMA 4POCA 1DIEA 3A6OA 4J7RA 4GA8A 3GNXA 3UEQA 4CN4A 1E6PA 3PG8A 2B7OA 4DJEA 4J3UA 3AS2A 2X8RA 1BGGA 2FPVA 4R7OA 1ADDA 1X1OA 1FWNA 4UTUA 1BFNA 3LCGA 3WDIA 1K8XA 3MO4A 1EX5A 3C4XA 1JCXA 4BQ5A 1XCFA 3Q4DA 4HMNA 3VGBA 2V2CA 3EWUA 1L6FA 4HNLA 1NAL1 3O6AA 1W0AA 4JEQA 4YTQA 1CW2A 3AVRA 3FKKA 3IF8B 3SUUA 3CIXA 4IPIA 1LP6A 2DUXA 3TAKA 4BCEA 3BANA 3HM7A 2RPAA 3CPRA 1E73M 2SFPA 2YYTA 5AQGB 3MWCA 3TLQA 2R14A 4HSNA 1R3SA 3T40A 3HV9A 3ZVHA 2JGYA 2V3GA 4ZB2A 3BAYA 3XIMA 1ADSA 4IGHA 3RM4A 2J7CA 3WUFA 2LSJA 2PTDA 1NDYA 4V1Av 2XIOA 2IXVA 2RFGA 5BMXA 2LKHA 4FS9A 1I8JA 4ONVA 2C0HA 1UJQA 5BXRA 4UZSA 3K4AA 4DF1A 3NAVA 5KINA 1G7VA 4QDMA 3TQVA 1A47A 5JUVA 3GFXA 1WOAA 3LCXA 3AYVA 1UUOA 1T72A 1RBAA 1JAKA 3NSNA 1UWTA 4PFOA 1NWSA 3TZNA 1MNSA 3IACA 3RG6A 3L5LA 3N18A 5J1GA 3AALA 2DZBA 3V35A 4UMBA 2DQWA 3S1UA 3S6DA 4AWTA 4GO8A 3FCPA 2BBJA 4J40A 1XLBA 2NQHA 1QATA 3W1AA 1QRQA 2V7KA 2WSSV 1T7SA 2A7NA 4O10A 2VI0A 2KAUC 1LQ2A 3LERA 5BR8T 3EAUA 3TOPA 2E68A 5LCYA 1NWMX 3R6IA 3F2DA 3O0KA 4IGSA 1VEPA 4KRZA 3UU8A 2NQ9A 1VCTA 4UR9A 4AEOA 2YU1A 3I6TA 3TA9A 3O16A 3CZEA 2G3JA 3WG6A 2CWXA 4HTEA 3RILA 4PBGA 4FXRA 4O4HE 1KD0A 3F5KA 1QK0A 2ZUMA 3FK4A 3E5BA 2YOEA 1H0IA 4WF7A 4JDYA 4AD3A 2XH0A 4ERGA 2HS8A 5EGRA 3OQEA 4TZ4C 2NT1A 2VX7A 1XMQT 3UVAA 3P7IA 3R10A 3PNUA 3BK0A 3WAKA 7ENLA 3EXTA 5HJLA 4DV6T 3VRBA 2XVLA 5GONE 5FMNA 3P5ZA 1UJPA 5CC7A 1UHVA 3RX3A 1FFQA 2WC4A 3DENA 3WEMA 1MSSA 3NRXA 4DV1T 2AOSA 3QKEA 1L6WA 3A23A 1JD7A 1XLDA 3G1YA 2EJ1A 5BRQA 5K7JA 3BZJA 3OPSA 1KV5A 4IE0A 1DJWA 1MW0A 3H3AA 3LSBA 3GTXA 3H2NA 4UNKA 2NUXA 2FTPA 2G5WA 1K9DA 2J4GA 1PIGA 4C1LA 3NQFA 3E0FA 3N2TA 3TYBA 3PZ9A 1N55A 4IREA 2HQAA 1TVPA 2MUCA 1UP2A 3T7VA 1SQ7A 8A3HA 2FJEA 3N2XA 1U2YA 3VZYA 3EKZA 3ITCA 2YL8A 2XJ7A 2JIEA 4O12A 4QLLA 4UQDA 1UP0A 1RK6A 3UWYA 1TV2A 4AZHA 1H1YA 4NXSA 3PTDA 2PWUA 4OFCA 3EPNA 4R53A 3H12A 1CENA 4JTUA 2VGIA 3E2SA 2HTMA 3EWYA 3MUY1 4TIMA 3W4RA 1YADA 2PODA 1WXYA 2NZLA 4A97A 1XWYA 2W0GA 3AXMA 3AC0A 1XM3A 4CNTA 1PSCA 1CXFA 4K1WA 4C65A 3QSTA 4IGNA 2UXXB 4K37A 4A3YA 2X30A 2EO7A 2GUYA 4LX4A 4YSXA 4P8VA 1HJWA 5A69A 3CV1A 1H5VA 2HXTA 1LT7A 4XZHA 2A21A 1UKPA 4AVOA 1A49A 2DCFA 2QLYA 1TUFA 2WM1A 1TV3A 1OZMA 1HFBA 4WKFA 2IC9A 2P1FA 2XWEA 1BAGA 3UJRA 4Z8XA 3T1GA 2DZWA 3L09A 2C18A 3U2OA 3D0CA 2QR6A 4HP5A 3VNLA 3NO3A 1JD9A 1POKA 1C92A 4XZIA 3MMWA 3WJWA 1WYBA 4GH1A 3B97A 3UCCA 4O11A 2E9XA 1BEUA 4LVBA 4MY8A 4H7ZA 1TWZA 4EGWA 3BCDA 1UR2A 1HR0T 1GPWA 1YX1A 4Z2HA 4M19A 1RH9A 5I24A 1S94A 2W66A 4LV4A 4NJKA 2BGSA 4RZ6A 3ALGA 2E67A 1BR0A 4IPLA 4Y9NA 3PWGA 4IX2A 3VDHA 2JMHA 3ZCIA 3A24A 2YPIA 3NR0A 2GLKA 4PEEA 2GDQA 4NYYA 4YYCA 4DM2A 3L4XA 1ZL1A