2W63A

Saccharomyces cerevisiae gas2p in complex with laminaritriose and laminaritetraose
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
455
structure length
432
Chain Sequence
b'SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 161
structure length 432
sequence length 455
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w63A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w63A01
1W9UA 2CIPA 3HU7A 1EA9C 1OD8A 2G4FA 5I24A 4C7DA 2CHOA 4P7RA 4CU7A 4GZEA 2PC8A 3ZM8A 5IXEA 1NH6A 3VUPA 5D8WA 3T09A 3UCQA 1DWIM 3SCWA 4D6DA 1CGVA 1OGGA 3EDEA 4D1IA 4GINA 2WBKA 4MNKA 5M03A 3T2QA 4PTVA 3WDHA 3S6TA 4CCCA 1V6WA 2BXYA 2GVYA 1VFUA 2WMGA 3U5YA 4Z2KA 1JG9A 3N18A 1B2YA 3WFZA 4BCEA 1Y7VA 5CG0A 1UR0A 2WCSA 1VFFA 3E1F1 3T0AA 5A3HA 1CIUA 4TTUA 1MQRA 2ZUUA 3AXHA 3WNKA 2ZX7A 1C7SA 5EFFA 4PUDA 3W29A 2X09A 3SCOA 2X0HA 2Z1SA 1KWKA 3AROA 4M29A 1JD9A 1JD7A 1KXVA 3BAYA 4GXPA 2NT0A 3W25A 1K9EA 1HP4A 4WIWA 3DC0A 2Y8KA 2BVTA 2WHKA 1GOWA 2XG9A 3DECA 1L8NA 3ARXA 3G6LA 1UR4A 3AHVA 3VINA 3WUEA 2JEQA 2FH8A 1Q6CA 3AIUA 3OZOA 4QLLA 4IM4A 3ZR5A 3TTQA 3GBEA 5M3WA 1H0IA 2DEPA 1HKIA 3VMPA 3D3AA 1B1YA 1E73M 4PMDA 5D9PA 5HPCA 2XIBA 3WNOA 1XYZA 1NWSA 1WCGA 1J0ZA 3VPLA 4AWEA 2XFRA 2XHYA 5IHSA 3CLWA 3ZMRA 2WPGA 4TTGA 3W53A 4MTVA 1UKTA 2E3ZA 2VO5A 1FP9A 2D24A 3WDQA 1QW9A 2W66A 1E6SM 1ZBVA 4NRRA 1HKJA 2YDQA 3W82A 1UWSA 8CGTA 5BXPA 3IJ8A 3CUHA 4LPCA 1KB3A 3M6DA 3MUY1 1HJSA 3LPFA 1H49A 1E3XA 1NM9A 2BXZA 3UERA 1EO7A 3W6MA 7TAAA 2YA0A 3A4AA 1GJWA 5HPOA 1B3XA 1W91A 5ECUA 4RE3A 1SFSA 3L4ZA 3QHNA 2VZUA 2ZUNA 2D0FA 4ATLA 1JAEA 2XJ7A 1JNEA 4EAMA 1R7OA 4LYRA 1FH7A 1V0MA 1J12A 2XVGA 3OGSA 1FHLA 3IJ9A 1UD5A 1CXLA 1KCKA 2CBIA 1QBAA 3ZT7A 3AIVA 3SUVA 1BYAA 5DF0A 3W81A 1KBBA 4JCMA 3VDAA 1CGTA 1HJXA 1CDGA 1HX0A 2DT1A 1TA3B 3QHMA 1HJWA 1A47A 5JBDA 4MNLA 1MWOA 4GZIA 3ZSTA 2E9MA 4MDOA 4WJXA 1AVAA 1KGXA 2JFEX 3VD7A 2XUCA 1E0WA 1GZJA 3VIGA 2WC3A 3B9EA 4EK7A 3DHUA 3LPGA 3SIMA 1WDSA 5IDIA 4UR9A 3DHPA 1R8LA 2ZWZA 1B3WA 1E9LA 4XB3A 3WH7A 5BXTA 1PIGA 1PEZA 2XPKA 1W1VA 4M80A 4TVUA 5GNZA 4DWSB 1MQPA 3CZGA 2YBUA 1NP0A 2NSXA 1GUVA 5CPTA 2YL9A 1GHRA 4CD4A 1I75A 3WDJA 3WQ8A 1UR2A 3CPUA 2WMFA 3AHYA 3AIQA 3EDKA 1MXGA 4ZFMA 1XC6A 3VMNA 2WSKA 3AMDA 1WPCA 1IT0A 1MW1A 3VGEA 2EO7A 2WVSA 4DWSC 3FHQA 1H09A 3PTMA 4UCFA 5A8OA 1EH9A 1B0IA 1UA3A 3BAKA 4AY1A 2WNWA 4W86A 4P8VA 1JYWA 4PMQA 1TZ7A 3EDFA 3VDHA 4CD7A 1BQCA 1CXHA 3GNRA 3CMJA 1W9PA 1LF1A 3VGFA 1OIMA 2YL8A 4UFKA 2VURA 2QPSA 1YQ2A 3PZQA 1CYGA 1K9FA 2EPNA 1MVYA 2Z1KA 2J7DA 4CN4A 3VIKA 3BGAA 2W91A 1OINA 2V38A 2VNCA 2DSKA 5I79A 2PWDA 5BRQA 1OWQA 4AIOA 2WMJA 2VOTA 5BYWA 1JDAA 3GZAA 3MUZ1 4P7LA 2D22A 4D71A 3U7BA 5BROA 1E6NA 1JI1A 4BA0A 3ARZA 1HXJA 4MB1A 4H8UA 2PF0A 2W4XA 4PBGA 1EO5A 4PSPA 4IPNB 1V3MA 4LYPA 1UD3A 2VR5A 2YA2A 3FAXA 4YHEA 1WB0A 1BGAA 4MJ2A 4W8BA 1HL8A 2YDSA 2DPEA 2W62A 4U3CA 4E8DA 1KR1A 4FLSA 3F5JA 2WBGA 1BVNP 1GQIA 1UD2A 4LGXA 3DYMA 3WQVA 1UKOA 4B16A 3MV11 3ZJ6A 1KGUA 3WL0A 5GNXA 4UOZA 2VTFA 3AIBA 1CGWA 1QI5A 3ARYA 1WE5A 4GQQA 2DT0A 1PX8A 4H8VA 4JFSA 3B9DA 3OA5A 1MYRA 4HA4A 3WD4A 4FLQA 2VX4A 1HIZA 1QI4A 1BYBA 4TVDA 3NYDA 2PI6A 5DFAA 2D2OA 1WZKA 3IANA 1M01A 1D2KA 1JZ3A 1DHKA 1U33A 1W32A 5I5RA 3VD9A 3J7HA 5AC5A 1V3JA 4H41A 3ARRA 4B9ZA 2W5FA 2WANA 4E8CA 3QGVA 3OGRA 3WQ4A 2V5DA 3ZT5A 2GK1A 5A6KA 2ZOXA 1E1FA 4HMDA 1HL9A 1CLXA 5E09A 2X05A 1UR1A 3N04A 5AYIA 2ZXQA 4XUYA 2WVVA 4W84A 4V27A 2UY5A 3VIIA 2VJXA 4JIEA 1R85A 2X0YA 3AS2A 4X0VA 4J3TA 1H11A 1ITCA 1W2PA 4AZHA 4F9JA 2C7FA 1QHPA 4ATDA 1PJ9A 3OG2A 1J9YA 4W7UA 3W26A 6CGTA 3BMVA 4HZ7A 3UG4A 3W28A 4AZ6A 2PBGA 3IJ7A 3NJ3A 1JZ6A 2X2YA 5JIWA 2ZX5A 4CU8A 3PTQA 3VM7A 3AIRA 1PPIA 4WKHA 4MADA 1WNOA 3ZJKA 2MANA 3PZGA 3KZSA 1GOKA 2JIWA 1UWIA 1H41A 1NOWA 2ZX6A 1ZL1A 2E9BA 5LA0A 3KEHA 2WWDA 1Z32X 2WCAA 4UQEA 3UESA 5JBFA 2BS9A 3VVGA 3A6OA 3N9KA 1E3ZA 4J3UA 1QNSA 2W67A 4PSRA 4PMRA 1G94A 4D72A 5HXMA 1EDGA 3PZTA 4M1RA 1SMDA 4UNIA 1VIWA 1CTNA 2J4GA 3T08A 2GJRA 4BZYA 1RH9A 4Z2LA 2J7FA 2XWEA 3OIHA 1TCMA 3WF4A 3UR7A 2VZVA 1VBUA 3N13A 3AMGA 2A3BA 4FF5A 2O9OA 6A3HA 1MW2A 2ZXBA 1WO2A 4AISA 3L4VA 1F4HA 4JFUA 1E4NA 2CXGA 4JHZA 4JKKA 3THCA 3MSGA 3U57A 1NOUA 4CUCA 1M03A 1H0GA 4D6GA 1PX4A 2E8ZA 2EPLX 4X0NA 1XCWA 5ABGA 1IZJA 1UD8A 1QBBA 3PZUA 3KL5A 3FY1A 4D6FA 1N82A 1XH2A 4A3HA 1C93A 1LL7A 1M04A 3WH8A 4DUVA 2AAAA 1UWTA 2IXUA 3AIWA 4JKLA 3WEMA 4GI6A 1HKKA 2WMIA 2D3LA 2ZXAA 2G3IA 3ZT6A 1MFVA 4PMVA 3W27A 3BH4A 3S2CA 4HPGA 5E0CA 4NI3A 2V3DA 2WLYA 2CNCA 3BLKA 4QLKA 2WMKA 1OIFA 5E70A 3EDDA 3G6MA 2J75A 1BFNA 3MANA 4NRSA 1E56A 3L4XA 5M17A 4W5UA 2PB1A 3WNMA 1W3LA 1OB0A 2ZICA 1PZ2A 2QMKA 1C91A 1LG2A 2D0HA 3I3DA 4M8UA 1W3KA 1GPFA 1JGIA 4CCEA 1JYVA 3GM8A 3TONA 1UOKA 4UFIA 4KRUA 3MS8A 3NIYA 3WNPA 1JAKA 3WMCA 1Q4NX 4AEEA 1HJVA 5D9NA 5A6JA 1GOOA 1VRXA 4URIA 4DM1A 2HISA 3RO8A 1LJYA 2WC4A 3WH5A 4B9YA 3NCOA 3VD5A 5C8BB 4PMOA 1OM0A 3KL0A 1EQPA 3MMWA 4RE4A 3W6LA 3GXIA 4CVUA 3WD1A 3CUGA 4PMUA 5HDRA 4ACYA 1E4IA 3WEZA 4M56A 1G01A 1X1NA 5A1AA 1DWGM 3BCDA 1GNXA 3F5LA 2XWDA 3DYOA 2FGZA 3TTOA 5A94A 5EFDA 4GO8A 2YDRA 2WHMA 1Q6EA 3UETA 5KZ6A 4UOJA 1HF6A 3VGDA 4HA3A 1Q6GA 1TG7A 2WXDM 1F4AA 2GDVA 1UUQA 5FCZA 4J3WA 2DIEA 3EMQA 2JIEA 1R87A 3CUFA 4MJ4A 3AICA 2QHAA 3IK2A 4M81A 3WDPP 2WZHA 2OSWA 4W7VA 2VX7A 3PZIA 4B15A 4PMXA 5EMYA 1W3HA 4W8AA 3VIJA 2PWHA 2WYSA 1WDPA 2DSVA 4DUXA 1XSKA 4YN5A 1E6ZA 3BSGA 3PBGA 3CTTA 4Z2IA 5A8PA 3WUFA 3LPPA 2VRQA 4W87A 1C8QA 3U5UA 1TVNA 3SURA 2VT0A 3AHTA 3GH4A 5A8MA 4B3LA 1LG1A 3N15A 4UQBA 4JFTA 3GYCA 2D23A 4ZE4A 5A8NA 1EDTA 5BXRA 2DIJA 1AQ0A 3ARTA 5I0DA 1ODZA 1QI0A 2D20A 2ZXDA 3AHZA 3TTSA 2W61A 3BAWA 5I23A 1KCLA 5A69A 5IFPA 2CCRA 3CUJA 3ARQA 1NWRA 1VENA 4XV0A 1ISYA 1K9TA 3POCA 5CLTA 4Q22A 3W37A 1KXHA 4PTMA 5D9MA 4CVWA 3POHA 2DT2A 2PBOA 4P7NA 1X6NA 1AQMA 3ZIZA 2EPMX 1JXKA 2E8YA 1BVZA 1UZ1A 3FXYA 2Y8VA 2YA1A 1ZJAA 4GZJA 5D8ZA 2CBJA 4J27A 4LQ1A 4MDPA 4KGJA 1UD6A 1LWJA 1QOXA 3WQ5A 2DH2A 4HA1A 4MAVA 3K8LA 1SMAA 1OT1A 1BYDA 2B31A 4U2ZA 1RP9A 2FHFA 4U2YA 3WMBA 4N0RA 4OKDA 2RGLA 3I3BA 3ZO9A 3CHFA 1A3HA 3EDJA 2GDUA 1B3ZA 3WNLA 2D1ZA 2FDMA 1UYQA 3FW6A 2Y24A 3MV01 1UQZA 1TFVA 1NP2A 4AMCA 2EBNA 2IUZA 1VEPA 4CKQA 2DGAA 1HJQA 1JZ2A 1AMYA 4U5IA 2PWEA 1PZ3A 1O7AA 2O92A 4DUWA 1DWJM 4E4PA 1E4MM 4CD5A 5DO8A 1X6LA 3AYRA 3I3EA 1I1XA 4KH2A 3PZOA 3CHCA 1CWYA 1CPUA 4PRWA 3W38A 2VVSA 1E72M 5E0FA 3CUIA 3VOCA 5DT5A 2RGMA 1E55A 2O9RA 5TD4A 4HOWA 4CCDA 3WENA 2CEQA 4H7VA 1Q6DA 4JCLA 3WY1A 4JL1A 1XV8A 2ZUMA 5LA2A 3VIFA 5JIPA 4PYSA 2WMHA 1B30A 1UA7A 1BHGA 1PX3A 4UQCA 3UR8A 4U33A 3NDYA 5JBEA 4Z2HA 2J7HA 1MQQA 2CBUA 1J0IA 1EXPA 5C70A 4E2OA 2D0GA 3AXIA 1R7AA 2ZUVA 3K46A 3GBDA 1JIBA 3WDIA 1V03A 2G3NA 1HVQA 3WUGA 3WF1A 3WNNA 4BS0A 3UEQA 3VD3A 3AHXA 1V02A 2DSZA 3N12A 4LX4A 2WZEA 3BMWA 3AS3A 3GXFA 4AIEA 3GNOA 2HVMA 2W63A 4AD1A 5CSYA 3ZQ9A 3FNDA 3CHDA 2CKRA 4HU0A 2XFYA 3N17A 2YLLA 1E15A 4ZEPA 1KQYA 1G9HA 5E6YA 1WZLA 1MW3A 2XGIA 4PUEA 3NSXA 3SCTA 1OBAA 3QOMA 4AEFA 3CZKA 4PTWA 3ARVA 3W4RA 2EJ1A 2DH3A 1EHAA 1EQCA 4YHGA 2X8RA 1JFHA 4XZBA 1J0JA 3MMUA 2BHZA 1VB9A 3RDKA 1E40A 3ECQA 3BSHA 1KQZA 2OYKA 2G41A 3ALGA 2WKLA 1J0KA 4D6EA 3HMCA 2A3AA 3EBVA 1HNYA 1W1TA 5BXSA 3AYSA 2VL4A 2WVUA 5AYBA 2GFTA 3L2MA 1J0YA 2NT1A 3L4TA 4P8XA 2XVLA 4W7WA 4Y7EA 2QV4A 3RM4A 1GQJA 1V0LA 4F66A 4GO9A 2O9TA 3CZEA 3WN6A 2J8GA 3VIMA 2Q8XA 1AQHA 4UZUA 3B8SA 2WSPA 2BVDA 5D9OA 3II1A 1VF8A 1B31A 1TE1A 1TUXA 3T0BA 2E4TA 4JFWA 1CXFA 3WL1A 1JZ8A 3B9AA 1W9BM 2OWCA 4L4PA 5CPQA 1P6WA 2GK1B 2XYLA 1BTCA 1BAGA 3AISA 1VEOA 3OZPA 4DWSD 2A3CA 1QHZA 1W2VA 1UHVA 3GH7A 2WVVB 3QR3A 2W92A 3GH5A 4MNJA 2CITA 4UZSA 4D6JA 1LL4A 4HZ6A 2FH6A 1BG9A 3W24A 3CGTA 2J8FA 1CNVA 3VIPA 4CGTA 1HKMA 1IV8A 3MKKA 1OT2A 2OLHA 3AXXA 4P7QA 3ARPA 4N42A 4QFUA 2J7BA 1NWTA 1L0PA 2J7CA 2Y5EA 2ZE0A 4FK9A 3CZ8A 5GQBA 4OUEA 2E0PA 4NF7A 4OOZA 4UTFA 2XSAA 3HJEA 4WKAA 3A47A 4WK9A 3SCSA 3NUKA 2VX5A 1PAMA 2BVYA 2OWXA 4WSKA 1S46A 4BQ3A 4BQ2A 1QI2A 4S3KA 3N11A 5DMYA 4FLOA 5KEZA 7A3HA 1J11A 4C7GA 4KRTA 4U3AA 1MXDA 3PHAA 4KMQA 4U5KA 2YBTA 4ZXOA 1XHGA 3RMEA 1CBGA 1KXQA 1GOMA 4UQAA 4MB5A 1GONA 4OJYA 1J18A 3TOPA 5A2AA 1GVYA 2QMJA 4W85A 3U7VA 3VIHA 1K6AA 2WK2A 5FOOA 3M07A 3VDBA 1G5AA 3WF0A 1BYCA 3CZJA 1DWHM 1B3VA 2VI0A 1ITXA 2CKSA 1JNDA 3GXMA 3LPOA 1DTUA 1W9DM 3WBEA 3THDA 3PZMA 2UY4A 1ZBWA 1JF5A 1FH8A 4ATWA 1JI2A 9CGTA 4IISA 4AZ5A 2E9LA 3SCRA 3K1DA 3WUBA 3RILA 4JL2A 4D6CA 3VGGA 1MW0A 2VX6A 1QNPA 1UR8A 5FIPA 3K8KA 5EBAA 1E6XM 2TAAA 3APGA 3O2LA 3EMZA 1KXTA 1JDDA 1US2A 1H5VA 5ABFA 4W88A 2GJPA 2WZIA 2WMIB 2CPUA 3SCQA 4WF7A 2BY3A 3WMSA 4AZBA 2DSWA 1J10A 2BY0A 2YL5A 1CXKA 4F79A 1W9VA 4AYSA 1FFQA 1UWRA 2VCAA 1XRVA 2J7GA 2OYMA 3BAXA 1UR9A 1ODUA 1V3HA 4HZ8A 1RP8A 2V3FA 2QLYA 2OSYA 3MSDA 4TOQA 2BFGA 4AD3A 4F8XA 8A3HA 4LYQA 4AW7A 1JF6A 4AD0A 1QNOA 5IHRA 3ALFA 4CD8A 1Q6FA 3O6AA 1FH9A 3WD3A 1ISXA 1EOMA 1NARA 2CBVA 2VZSA 2EPOA 2Y2WA 1NOFA 1QW8A 1NWUA 4Z2JA 1GQKA 4QP0A 5BRPA 5I78A 3QOKA 1XH0A 3FHAA 3AI0A 1CECA 2CHNA 2XFFA 3ZOAA 2EEXA 4RE2A 4ACZB 4ACZA 3SUTA 3KE0A 4X9YA 1FA2A 3MO4A 2V5CA 1W3JA 3HN3A 1WAWA 3AS0A 3PZNA 5I2UA 1K9DA 3OLEA 1KBKA 4PEEA 3ZSSA 3A3HA 2A3HA 3JUGA 2XVNA 4S3JA 2IXVA 2XTKA 1J01A 5FD0A 1ZJBA 4HPHA 1CENA 1OGBA 2GJXB 2GJXA 4FLRA 4XX6A 3WQ6A 2G3MA 2J79A 4NZCA 5LYRA 5A6BD 5E9AA 5BWFA 1LWHA 1XCXA 3SCVA 3A4WA 1GVIA 2V3GA 4Q7NA 3WBAA 1V6XA 4B3KA 1VAHA 1EHNA 3NDZA 4YPJA 3VMOA 4ZXLA 3RM9A 4EKJA 4J28A 3ZJ8A 3SUSA 1QNQA 5FL0A 3T2OA 3FAWA 1CZ1A 2ZIDA 4MAZA 4L4OA 3EYPA 4RL3A 2V3EA 1HJUA 1QNRA 5AY7A 1KR0A 4TX8A 3FN9A 4PCSA 2JF6A 3NSNA 1GQLA 2ZUTA 2F61A 2UY3A 1XD0A 2PWFA 1OD0A 1H1NA 2J7EA 1HN1A 1JXJA 3TP4A 7CGTA 4HOXA 3WF3A 2YOCA 1UWQA 1XGZA 2OSXA 3AS1A 3WH6A 4W8LA 2VQUA 3AMKA 4EANA 1V3KA 3BCFA 1EDQA 2FHCA 4DM2A 2C0HA 4CN6A 5FL1A 1CGUA 1VBRA 1E5NA 2VRKA 4OZOA 5ABEA 5FKYA 3GXDA 4OOUA 1JYXA 3MUAA 4W5ZA 5CJ5A 3OBAA 3WEOA 2WCGA 1TMQA 4BF7A 3CMGA 4JHOA 1D3CA 3ARWA 1VJZA 2F8QA 2NW0A 3SEPA 4JAWA 1SR0A 1GW1A 2BHUA 1NQ6A 3A4XA 5CXPA 2VMFA 2O9PA 2EPKX 5I77A 4AZIA 4Z2GA 2JEPA 3VTRA 4A4AA 1WDQA 2AMGA 2CYGA 4ZE5A 3CO4A 1UH3A 2CERA 1ISVA 1US3A 1XSIA 4GI9A 3BAJA 3L2LA 2VR4A 4M82A 4R5EA 1IZKA 4F9DA 1DWFM 1DEDA 2X1IA 3VX1A 3L4YA 3D5HA 5E6ZA 3WELA 1SYTA 2G3JA 1JYNA 2EQDA 4QAWA 4GKLA 3F4VA 4W89A 4PCTA 3AMCA 1CXIA 1XH1A 5AC4A 5I3DA 3AZSA 5BCAA 3PN8A 1J0HA 3VGBA 3SCUA 1TA3A 4QDMA 3SUUA 1UH4A 1E70M 1E71M 2XM1A 1GORA 3OLGA 4TUFA 1E6RA 4P8UA 4AC1X 3VIOA 2DDXA 4HTYA 3KWXA 2BY2A 2ESCA 1HT6A 2XSBA 3WFLA 4HOZA 1JL8A 5HNNA 1GOQA 5A95A 5CGTA 4J3VA 1E1EA 3VD4A 5IFTA 2YL6A 2DQXA 1EOKA 2PWGA 4OBSA 3L4WA 1R86A 3AFBA 3GDBA 4GQRA 5GPRA 5A6LA 4DWSA 1MFUA 1DWAM 4GIAA 3RJYA 1ZBCA 1ZS2A 3O9NA 1LQ0A 4XZWA 4CN1A 3DYPA 3TTYA 3N1AA 3VU2A 4IPLA 1V3IA 2VCCA 1PBGA 1V6VA 2J78A 2ZX9A 4AIUA 1OSEA 3MMDA 1QVBA 2QPUA 2WAGA 2YLAA 2VC9A 1H4PA 1XYFA 3RIKA 3LMYA 4H2CA 1GHSA 3RCNA 1FP8A 3WKZA 5CLWA 1EIBA 2J77A 5DT7A 2AOSA 1JDCA 2DT3A 4U31A 4TX6A 3ZJ7A 2XVPA 4GI8A 3K4DA 1ESWA 1TR1A 1UH2A 1V02E 1WZMA 3ZR6A 3WF2A 3RPMA 3UG5A 2VUYA 4WLCA 1WZAA 2C8NA 3VKKA 3VILA 1HP5A 3MU7A 4PMZA 3CIVA 1W1YA 3WD2A 2E40A 4UFJA 3F5KA 2JALA 1BPLB 2WW5A 2Y4SA 2XM2A 4P7OA 1BLIA 2VRJA 3VGHA 3NSMA 2OWWA 1E6QM 1RPKA 4MB4A 4W93A 2BNJA 3BAIA 2ZUWA 2WB5A 4J3SA 1JFXA 3OLDA 1B9ZA 2WHJA 3WDRA 2J47A 4LXFA 4C7FA 3OLIA 3BXWA 1C7TA 4KGLA 2YJQA 2XGBA 1CXEA 2BHYA 4OBRA 4BQ5A 1GJUA 2J25A 1WP6A 3PZVA 3VNZA 5EB8A 5GNYA 1VFMA 4J7RA 1B90A 1BSIA 2CESA 1KWGA 2VVNA 2VZOA 3AJ7A 5CQ1A 1VFOA 1KFWA 1ISWA 2WM0A 3WQWA 1VEMA 1WKYA 1XSJA 4AZ7A 1CGXA 4PMYA 3EMCA 3CBWA 1QPKA 3IAQA 5ABHA 4UQ9A 3AMLA 2ZX8A 4QCEA 1U2YA 2BV9A 1V6YA 4MB3A 1JZ4A 3WSUA 4CU6A 2FGLA 2JF7A 1B3YA 3K4AA 2JE8A 5CSUA 1CGYA 5CPSA 2FHBA 1RD6A 3WIJA 1FOBA 3AOFA 5A2CA 4ML4A 1LL6A 4P8WA 5M5DA 2OYLA 3SUWA 1O6IA 4ZENA 5A8QA 4D6IA 1M7XA 1E0XA 2J74A 2WVTA 5CZKA 1UKPA 1E5JA 1CLVA 1V08A 4UFLA 3T2PA 3VM5A 5D4YA 1C92A 3CHEA 4CD6A 5JUVA 6TAAA 1UKQA 1XD1A 2YIHA 5HOSA 4JZ5A 3QHOA 4PN2A 1EGZA 4D6HA 1V0KA 4FMVA 4A3YA 3VX0A 1I1WA 2WWCA 1V3LA 1E6PA 3OB8A 3UG3A 2WC7A 3AZRA 4H8HA 4TXEA 4AD5A 5A2BA 4D1JA 1KGWA 1QI3A 4UQDA 4NSBA 1LLOA 1C8YA 1GOIA 4AD2A 2XVKA 2GSJA 4H04A 4UOQA 4UFMA 2BY1A 3TA9A 4AZCB 4AZCA 1W9XA 1OCQA 3AIEA 1HVXA 1ISZA 3AQUA 1E4LA 4R27A 5CGMA 2UWFA 1E43A 4EE9A 5LA1A 4UFHA 4V28A 1E0VA 2CETA 2ZWYA 2GUYA 5A6MA 4WSJA 4AXNA 1BG4A 4V2XA 1PIFA 3IAPA 5A6AA 4MPKA 1G1YA 3ARSA 1G0CA 3MUIA 2UY2A 2VCBA 1UWUA 3GNPA 2G8ZA 5A6BA 1TVPA 4BQ4A 2QF8A 1BGGA 4PMNA 1D7FA 4AD4A 2YKKA 3PZ9A 4M24A 1H2JA 1UD4A 4TVCA 2VQTA 2F2HA 2EXOA 4K68A 5A6SA 1JZ7A 2D3NA 1WDRA 4KWUA 4HU8A 3BC9A 5C71A 5I6SA 1ZU8A 2WLZA 1VJSA 1FHDA 1QHOA 4GPNA 1U30A 5ABFB 1V6UA 3L4UA 3RJXA 3WH9A 3KL3A 3WD0A 3M46A 1YHTA 4HP5A 3RM8A 2XIIA 2VZTA 4AZGA 1CEOA 3VDCA 4QCFA 5F7UA 1UG6A 3K8MA 3PTKA 4WKFA 3SCNA 2DSUA 3SCPA 4MNMA 1ZB5A 1BF2A 3T0DA 1DP0A 3M7SA 3BLPX 3GTNA 1W1PA 1UKSA 4JFVA 4JKMA 5DEZA 2WKGA 5HBFA 2A3EA 1OGSA 4IUGA 1ECEA 4OIFA 3CH9A 3VO0A 3ARUA 4HMEA 2ZUSA 1C3FA 3OGVA 3AZTA 2WHLA 1M53A 1UZ4A 1V0NA 1ZBKA 4QLJA 3W0KA 1JZ5A 1GCYA 2J62A 1UQYA 4PTXA 1FFRA 4J3XA 3VNYA 3CZLA 1C8XA 1C90A 4HMCA 1H3GA
chains in the Genus database with same CATH superfamily
4JI8T 3N2OA 2XDFA 3S47A 1V79A 4KIRA 5CSRA 4AYGA 2Q3OA 4L61A 3VCCA 4CU7A 3H21A 4DZIA 4EOZB 1FUYA 3ZM8A 2ZTKA 3T09A 4XIMA 3SCWA 4JY8A 3IWPA 3R25A 5J2UE 2HS8A 3BLFA 3EDEA 4IXXA 4EZ4A 4M3PA 4GINA 3QKZA 2NR4A 3DZ1A 1Q3NA 3S42A 5TAOA 1V6WA 5G2WA 3PFRA 4FXRA 1KBJA 1VFUA 4HTBA 2WMGA 1W3TA 4LMJA 4ZO8A 1Y7VA 2L5HA 4CNSA 5A3HA 3WI3A 2QNEA 1CIUA 4TTUA 1MQRA 2ZUUA 4PUDA 1EP3A 3T42A 4DJDD 1KLZA 2YGYA 3TLVA 3HMJG 4YWIA 2Z1SA 3OA3A 5C2CA 3LN3A 4TV5A 3AROA 4M29A 1D3HA 1JD7A 7PTDA 3ABOA 1KXVA 3BAYA 4GXPA 4ILUA 3WCZA 2K48A 3DCPA 4IQJA 2G50A 5F8PA 2DUAA 2TRSA 1HP4A 4L5GA 1GOWA 2WPBA 4DNMA 3ARXA 4K38A 1W0BA 3ZMZB 5F2IA 1TPVA 3VINA 3CXOA 3UW6A 3P67A 3WUEA 3WLLA 1XLJA 3DDMA 2PTXA 1ZJIA 4NG3A 3VMPA 4PULA 3D3AA 1B1YA 5HPCA 1W8SA 4HSOA 2PDMA 3KVJA 2XHYA 3S83A 2HXUA 3ZMRA 4TV6A 4TTGA 4AF0A 1GGOA 2E3ZA 4WNKA 1I9CB 3H2AA 4IXHA 2IKGA 2D24A 3WDQA 3F4NA 1Q4WA 1E6SM 5HXCA 1ZBVA 4RPQA 3G0UA 1K8XA 3GR8A 1OFQA 2VGGA 2X42A 4ZODA 4HNNA 5BXPA 1BQGA 3LK3B 2QCGA 2RUSA 3EVYA 4AY8A 1FWIC 4KX6A 1HJSA 1H49A 4OUIA 1ZTVA 2BXZA 3UERA 1EO7A 1FCVA 1WKFA 4PTNA 2YA0A 3LRMA 1H7RA 1GJWA 1WUFA 3QR0A 5HPOA 2FJAA 4TNVA 2I17A 5E9XA 2GVJA 1SFSA 2PA6A 3L4ZA 3QHNA 4JTGA 2ZUNA 3N3MA 4E2BA 3T8OA 4ATLA 3AEEA 1JAEA 2ES0A 5H6RB 2PCQA 4PNIA 4GH3A 4FNPA 4HPXA 3URAA 1L2QA 3OGSA 1R3QA 3G18A 5C7HA 2PAJA 2XH2A 1S5VA 5F3JA 5GJNA 2X67A 5DF0A 1GZ1A 1HX0A 2H8XA 5HMFA 4ZTXA 3H4XA 2DT1A 1M6JA 1TA3B 3ZWSA 5B80A 2E9XB 3ABZA 5J5DA 1MWOA 4GZIA 3S5ZA 3DIPA 1PVNA 3AYVA 3ZLGA 1B57A 2JFEX 4GI4A 4DQWA 3SQLA 1E0WA 5LHFA 1GZJA 1O1ZA 3VIGA 4ZI7E 3FLUA 3JZEA 3B9EA 4ZQPA 1FXPA 2NVDA 2RKXA 4IP4A 4X1YE 2G0UA 1RK6A 3DHUA 5IDIA 4Y9OA 2HCVA 3BK0A 1EP2A 2PDXA 3ONBA 3W7IA 3P62A 1Z42A 3APYA 2XQ6A 2ZBTA 1J5TA 1PEZA 1IEWA 5ECVA 1W1VA 4M80A 3UWQA 3PM6A 3SSJA 3GMIA 4FJOA 4YSYA 3VKHA 4LEQA 3B05A 2H7VC 2EAWA 2YBUA 2NSXA 1V4YA 2C1GA 3PJAJ 1GUVA 3ZEFB 2YL9A 4NUUA 2F38A 2Z4GA 3UPWA 3AHYA 1MXGA 4ZFMA 1XC6A 2UXBT 1W5MA 3W85A 2WSKA 3FJNA 2Y48B 1H50A 3C2RA 1MW1A 3VGEA 2P3ZA 2WVSA 4DWSC 5C6MA 1H09A 3CIRA 1FQ0A 3CO8A 5LA6E 3WBWA 2WNWA 3M5ZA 4P8VA 3W3OA 8XIAA 2XQAA 4BA9A 3Q2DA 1SW7A 2OKOA 3AA6B 5EMLA 2XY8B 3FZFB 4CD7A 2QCNA 3GNRA 4R7WA 4HFVA 3QBUA 2PDLA 3KBMA 1VFSA 4UFKA 1BEUA 3KLKA 1DJZA 3QGKC 5HULA 4E5TA 4KEVA 2QJJA 1K9FA 2QCDB 1EIXA 1M5WA 3BW4A 2EPNA 4FOUA 4MWAB 3KBNA 3I10A 3VIKA 4AVNA 2W91A 1LBFA 2V38A 1QLBA 2DSKA 6XIAA 4WDUA 3L8RA 3UU6A 2WMJA 2VOTA 4CNNA 2NQJA 3QLDA 4V1XA 3H54A 1TZZA 3U7BA 4NU7A 4HFDA 4Q4MA 1BRLA 2WM1A 4Y9AA 1HXJA 1FDJA 4PA8A 2PJQA 4QXIA 3DFOA 1DJHA 3RI5A 4BY3A 2Q9QC 3RPTA 4G2DA 4OU1A 4YHEA 2EPHA 1WB0A 2P0OA 4JIPA 4IJBA 4MJ2A 1U1JA 3R0KA 4MFEA 1V51A 3GVGA 2NQ5A 3CMLA 4FLSA 2V8ZA 3F5JA 4KETA 2FTYA 3IBPA 1GQIA 3UU4A 2OMAA 1ONRA 1SZGA 3E08A 2NVAA 4C6OA 4I55E 2C16A 3UJFA 1CGWA 4A8IA 1XG4A 4KWOA 4IF2A 4H8VA 1DVJA 3EWCA 5F2GA 4DO0A 1MYRA 3WJYA 5LSMA 3O6CA 4FNQA 4TVDA 5FAJA 5U4NA 4K2SA 1TJ1A 1LROA 3F7JA 1WZKA 3WQCA 4MHCA 4BKNA 4QBXA 1JZ3A 2V0TA 3UJRA 3RQUA 1VH7A 3CQ0A 4ZB5A 4DNDA 5I5RA 1EXBA 3PUSA 1D8CA 4OTKA 1V3JA 1BR4A 4H9ZA 2ON3A 4B9ZA 2W5FA 5C5YA 1UCUA 3QGVA 3WQ4A 2BODX 3FYOA 3U48A 4B5NA 4HWDA 2ANUA 2NW7A 5AYZA 4HMDA 1HL9A 4D2JA 1E9ZB 1XIGA 3NNTA 1T99A 1G8XA 2ZXQA 2WVVA 3C5QA 2OX4A 1EZ3A 1IYXA 2VJXA 1SZNA 4WY0F 1R85A 2X0YA 1XI3A 4G1KA 3M41A 1O68A 3PJXA 2GQ8A 1F3TA 1TSIA 2AGKA 2WJDA 3T1GA 2BKOA 1UIOA 4F9JA 2OT1A 1UOZA 2FZBA 1PJ9A 5D05A 3UZXA 3QPEA 5JDGA 1J9YA 5DXYA 3TYUA 3BMVA 1XZYA 2WQDA 1Q7QA 4P0BA 4Y9NA 1L6GA 1CUNA 2X2YA 3FXGA 5JIWA 4PUNA 1UB3A 1XYBA 1TTPA 3S3GA 3VM7A 3K13A 1NU5A 4R33A 1PPIA 4GWEA 4WKHA 1Y65A 3RN6A 5LHIB 3R84B 1HFAA 1UWIA 2K9AA 2E9BA 3INPA 1HX1B 1MDLA 3GNXA 3UESA 1WA3A 3TXVA 3VVGA 4CZZB 3N9KA 4N4QA 1EGMA 2OVLA 4ZGYA 1IGSA 1E3ZA 2QIIA 4Q32A 1RR2A 3W87A 1H5YA 4JN7A 4HFCA 3HJZA 1G94A 4D72A 5B7YA 5LNUA 4DJDA 1RVKA 4JYEA 2FVMA 3A9BA 1EDGA 4GNJA 5H6QB 5KMGP 2O4MA 2J7FA 3OIHA 3AE7A 2G5WA 1TCMA 1VBUA 3UPBA 2ATSA 2V7LA 3MI2A 1WO2A 2PZNA 2VC5A 4NAFB 4CQBA 2Y5SA 3QB5K 5JMUA 5FJUA 5EYWA 3MSGA 3U57A 4BEUA 1NOUA 4ZA0A 1M03A 1JGMA 4IDZA 2CLHA 4NJKA 2EPLX 5EBUA 5EK4A 4L9IA 1SJBA 2XH7A 4HNTA 1QBBA 3PZUA 2VGFA 3FY1A 3FYPA 3VKAA 4A3HA 1MNZA 2D2JA 3WH8A 2LSIA 3MVTA 4DUOA 3T0CA 2IXUA 4XZCA 4CLMA 2GSHA 2ZXAA 3RR4A 4NJIA 3H2MA 2VDIA 1Q66A 3L5MA 1HG5A 4DO7A 1R38A 5HK4A 3BH4A 4IP7A 2V3DA 4U74A 4HK7A 3UWEA 2WMKA 3G6MA 3PDYA 1QPOA 3MANA 1A5KC 2D2HA 3H2CA 2PB1A 4ERGA 2PLKA 4KS0A 3NYZA 2ZZ3A 3EAUA 1GTHA 1PZ2A 3NQ7A 4M1PA 4K3ZA 4AKGA 1EUNA 3TJXA 2MPKA 4IQDA 1W3KA 4DLMA 5FVLA 4Z91A 1JGIA 1K8YA 1RCOB 4CCEA 3D46A 3CIXA 5GJMA 4UFIA 4B92A 4KRUA 3TYDA 2V2CA 3MS8A 4MG4A 3EKLA 5FP3A 2FQIA 4NAEA 1WR0A 2ZVRA 1R9ZA 1GOOA 4O4VA 5D9NA 2QUVA 4LWWA 2PRHA 2HISA 5LHEA 3TKLB 4B9YA 3VD5A 4ADSA 1OM0A 2W3ZA 2GUUA 3A23A 3KL0A 3LTPA 3Q5WA 2QXWA 3O05A 5HDRA 3WEZA 4UTTA 2B7OA 3GTHA 1DWGM 2W0GA 3QKEA 1GNXA 3PJAA 4HFEA 1Q8AA 1M68A 1I0BA 4E38A 1KV8A 3IJQA 4YTMA 2YDRA 3USZA 2OXNA 2WHMA 5KZ6A 4E2VA 4L1XA 1PWLA 3G0SA 4L80A 2WXDM 4LBRA 2YB1A 2C3ZA 5G4EA 3FK4A 4Q8QA 1RA0A 4J3WA 3RLFF 4LUSA 2DIEA 1J79A 1R87A 3CUFA 1JPDX 4GJIA 3AICA 4KFPA 3W7QA 4ALDA 3NQAA 3C6CA 2OSWA 3TYAA 1GVSA 6ALDA 2VX7A 5EMYA 4O4HE 1TTJA 1R0MA 4Y9PA 3F03K 3P5YA 4EXAA 7XIMA 2PWHA 2NWRA 2WYSA 3JVAA 1WDPA 2DSVA 3UGVA 3QPYA 4I7VA 5JDFA 3AE6A 2VRQA 3LPPA 4J1OA 4W87A 3M7WA 3F4DA 4B3LA 4UQBA 3MY9A 2PP1A 4KHZF 4JFTA 3GYCA 1NENA 3B0PA 5LGUB 1SM9A 4PUJA 4IE5A 4AG0A 2AKZA 1Q8JA 2DIJA 2PWUA 5AHMA 2EG7A 2F84A 2F9RA 4O8RA 2ZXDA 3NL5A 2KINB 4ZS2A 1OFBA 3HPSA 1H51A 2W61A 5I23A 4QXBB 4GBUA 3FB2A 4N9CA 1DXEA 2GGEA 3D0CA 3ARQA 3EKZA 4XV0A 3PTRB 5H6HA 4KCWA 4S1FA 4EWJA 3W37A 4FF7A 2KLQA 3GG1A 5D9MA 4EF8A 1UWAA 3R89A 1RJRA 4B5UA 3O0FA 1XG3A 2PBOA 3W7GA 1X6NA 3ZIZA 1JXKA 1I2QA 1SFJA 1RY0A 3FXYA 3CQIA 3MXZA 4QH1A 2HVOA 4KCVA 3F2CA 2G37A 4GVIA 3IV3A 4KGJA 4MY8A 3WQ5A 4HA1A 1EA0A 4BJMA 1OT1A 1BF6A 2FHFA 3GHUA 2PP0A 5EA9A 3MUCA 4KESA 2RGLA 3I3BA 3TQVA 3X1DA 1DJGA 4MOZA 4YMZA 2X0LB 2JQXA 2JGYA 5H8PA 4X63A 2Z2UA 3GR7A 2CZEA 3HV9A 3UNDA 1TFVA 2W27A 4HPNA 2Y61A 1VKFA 1XLMA 4U5IA 2PWEA 3OYZA 1PZ3A 3K2GA 5LNRA 1DWJM 3RX2A 1VBHA 1AG1O 1Z7AA 4C6IA 2Z27A 2QGYA 4DAFA 1XC4A 4CD5A 3WQOA 4FXJA 3ESLA 3TC3A 3M9YA 3GTIA 4Q4OA 3P82A 3RLUA 3I1AA 4YTPA 3MZ2A 3WO8A 3TZNA 1Q6LA 1DJWA 3GWQA 4H7CA 4PRWA 2WSRA 1PZ0A 5DT5A 3WJSA 2O9RA 3KOWA 5LBMA 3ZPOA 4ZQOA 1ZGDA 1TV5A 4HHLA 2UXNB 1S5TA 4QX7B 2YXXA 4CCDA 5LGNB 4K8GA 2CHRA 2Q01A 2ZUMA 4HWCA 1TR9A 1BHGA 1TQXA 4O8AA 5HANA 1EX1A 3PWGA 1T0OA 4H9MA 1RAKA 1P1XA 1XLFA 2OLTA 1ZKEA 1Q85A 1FDYA 3KP0A 1J0IA 4Q6JA 2QVNA 5FJIA 1R7AA 2ZUVA 3W1LA 2JRKA 2Y8UA 3GBDA 4NX0A 1JIBA 4QTGA 4BS0A 1DHPA 1WKDA 4B2DD 4IJCA 1M7JA 3JW7A 3CQXC 3GNOA 5CSYA 3HGJA 3CAKA 2IKHA 5D2WA 2G0WA 1W37A 3SS1A 3R6NA 1H62A 5E6YA 3SCTA 4IP5A 4YYCA 4PTWA 3W4RA 1Z8UA 2VWTA 4BJNA 2H3RA 1EHAA 1EQCA 4S3DA 4FXFA 1UP2A 4EP8C 3MMUA 4RZ6A 3FXEB 1E40A 3ECQA 3GQYA 4YS1A 1AL8A 3KCJA 1KQZA 2OYKA 5JREA 3ALGA 1J0KA 3O6DA 2ODOA 3KOFA 4D6EA 1V8EA 4AKLA 2KT9A 1HNYA 4PJLA 2PD5A 5AC7A 5BXSA 3A13A 1YMYA 1EBGA 2NLIA 1TYGA 1T41A 4XAGA 2GQ3A 3L4TA 4P8XA 4W7WA 2QV4A 3RM4A 5HCMA 3GXNA 3EXRA 3H37A 3VNIA 3PJUA 2JBMA 3VIMA 4DZ5A 4UZUA 5HR7A 2VEKA 2BVDA 3H3AA 2KMFA 3VZXA 1B31A 3U2OA 1VLIA 3A12A 1WCRA 7ENLA 5JQ9A 4LAKA 4LUYA 4XQ6A 1EEPA 2QUNA 3WLJA 4N9BA 1HTJF 1JZ8A 3ZMSB 2PDGA 1UMYA 1LWIA 4AB4A 3B4UA 1J5ET 3OBEA 4WJ8A 3WBYA 6ENLA 3MCOA 4ZQMA 2MOZA 1OWAA 2PTDA 2Z25A 3DX5A 2XGZA 3QMRA 3OZPA 1QHZA 4QSHA 3GR4A 1XKYA 3DG6A 2YK0A 3NM1A 4H9TA 4P61A 2D0UA 3RHGA 3AE1A 2CITA 2CXEA 4HZ6A 2FH6A 3M65A 4UXDA 5DJQC 3UZWA 4CGTA 4Q8MA 5FXWA 3VNJA 1RQBA 1IV8A 1VPYA 5EPDA 1N8WA 2OLHA 1XMQT 3AXXA 3MKKA 3AWOA 4Y90A 1W5QA 1RBLA 4FX6M 3V5SA 1EC9A 2QRXA 1E0TA 2ZE0A 1PZ1A 4FK9A 1BR2A 3RH3A 3TK7A 1S2AA 4UTFA 1JCJA 3S1UA 4WKAA 1S94A 2CXLA 2ZKMX 4KBMB 3C86A 3SCSA 2VX5A 3NUKA 1VP5A 4BQ2A 1C29A 1T7LA 1VLWA 2JMKA 3N11A 2Y7DA 2VD8A 4O4WA 1XFCA 1I2OA 3IK4A 2CWOA 4EYYR 2MAWA 2XTLA 3FA5A 3PHAA 3TIMA 1OQFA 3LHUA 3LTYA 4NL1A 4O16A 1H61A 4AXPA 4H1ZA 1F7BA 1Q7MA 2EHOD 1BXBA 5A2AA 5I3KA 3SZ8A 4DF1A 1WKEA 2QIWA 1KNWA 3PF3A 3UNTA 4PK6A 1NAFA 1OX6A 3VIHA 3PANA 3TN5A 3M07A 1UROA 1W1B1 4Y8EA 3F2EA 4Z0JA 3IF8B 3RX4A 3WBEA 2E8IA 3D6NA 4DIAA 1JF5A 5HQLA 4DBRA 2EF9A 3SW6A 3ITVA 4YL2A 3K3NA 1MMFA 1RUSA 3ENLA 1J96A 4MLKA 3LBCA 4JEJA 1MEWA 1XLLA 4MJMA 3VCRA 2BKNA 2NTXA 1RA5A 3Q37A 1J1JA 3APGA 1MZHA 3EMZA 1US2A 5ABFA 2GJPA 3M4HA 4CNPA 4X22A 4WF7A 4XBKA 1HGWA 1US0A 2BY0A 1NAL1 4AYSA 3KTXA 4JUYA 2QUTA 2C1IA 4FNTA 6REQB 6REQA 1OG6A 1P5BA 1RCQA 1UR9A 3UPMA 4HZ8A 1RP8A 4IX0A 3MSDA 2P8BA 4ERAA 3UU5A 3Q9DA 4NHVA 3VOHA 1OF6A 1EOMA 1NARA 2P0IA 2VZSA 2EPOA 1FWNA 4LUTB 2NX9A 3L39A 3MYPA 2V9DA 1RVGA 4JEQA 2FMOA 4ERIA 1DL3A 2LEHA 5I78A 1JEZA 4MVAA 2ALDA 2YN6A 3QYQA 3FHAA 5JRCA 3UJEA 3AI0A 2XFFA 3W7MA 4IL9A 2PGWA 3V3WA 4RE2A 2VWSA 4LBUA 4JTEA 3SUTA 3KE0A 1RBAA 3O1HA 1S39A 3BQKA 2V5CA 3HN3A 4AFYA 1OEDE 2VGBA 1K9DA 1OEDB 4LF7T 3JRKA 1SUMB 1DV7A 3ZFHA 3NQCA 3NGJA 1EBHA 3E2VA 3IVSA 2XAQB 2FZDA 5LG3A 3A3HA 4UV8B 3NA8A 4DI9A 2XIMA 4N78D 3PAOA 3PVFA 4LAZA 1OCBA 4Q4SA 3AUOA 4NZCA 3UYCA 2QW5A 4H9UA 3LDQB 2V2HA 2JKEA 1I94T 1LWHA 2XSXA 2ICSA 3SCVA 2DHRA 1TMHA 1X97A 3O6YX 1VAHA 4YPJA 3STEA 2D73A 4ZXLA 3RM9A 3J9X1 4J28A 1BWLA 3T78A 4IE4A 3FAWA 2ZIDA 4MAZA 1GTEA 3HTWA 2R14A 2V3EA 2ZZ2A 3KBTA 4GKKT 5T26A 1KR0A 3BE7A 3OZYA 2YW3A 4XD3A 4Q8TA 3EB3A 1GVFA 2IQ0A 3R11A 2IPWA 3VDGA 4B5WA 1KK7A 4ZI2C 2F61A 4HA0A 2J7EA 7CGTA 3QEZA 1AJ3A 2YCKX 3MP5A 1YPFA 2YOCA 1XGZA 5JDHA 4W8LA 2BTMA 1IIGA 3PJTA 4EANA 1V3KA 1NEYA 2FHCA 4DM2A 2DZTA 4XZHA 1CGUA 1ITQA 2Y62A 3AU2A 2IMLA 1VBRA 4CQDA 3OTRA 5ABEA 3ITCA 4OZOA 3GXDA 3GHTA 1E2AA 4OOUA 4B2DA 4DJEC 1SGJA 1VD6A 3IACA 5CJ5A 3LXCA 4OK0A 1XNRT 2WCGA 1D3CA 3ARWA 1VJZA 3GVRA 2V5KA 3GVQA 2ZE3A 5E93A 4AQGA 1ME8A 3F4WA 2BHUA 3QGAC 1NQ6A 5EK3A 3G2GA 3NXLA 1D9EA 2VMFA 4O8SA 1NDZA 4NQ1A 1KFEA 3GIQA 1P0BA 4MY9A 2CYGA 1GWJA 5AQVB 1W1IE 3CO4A 1UH3A 3GDTA 5C0QA 2OGYA 4O0QA 1MIVA 3PP7A 4G6CA 3KV4A 1IZKA 2DZWA 1DEDA 3N6JA 4C60A 4H9NC 5E6ZA 3JU2A 3WELA 1SYTA 3ZCIA 4QAWA 2HJPA 4PCTA 1CXIA 2GVLA 3AZSA 3L2IA 4HCLA 3PU3A 2CW6A 2Z1XA 3DTOA 5J5RA 4ENLA 2XZ9A 3GY1A 1TZ9A 1UH4A 3B8TA 3SUUA 1V77A 5LXTE 2DU2A 4QSFA 3VIOA 2DDXA 1XIJA 3NPXA 4HTYA 1EJWC 3OPSA 1TPH1 4KBXA 4DV5T 3UUBA 5BRBA 4EF9A 2Y1HA 4ORMA 3KOYA 1JL8A 5HNNA 3C0QA 3BZJA 5A95A 3UGRA 4B4HA 1PSCA 1TX2A 5JDMA 2PRLA 3R79A 2H9AA 1EOKA 3LBOA 2KX9A 3ABQA 2BOFX 2WSYA 3CL7A 5EMUA 4GQRA 3GFYA 2NX3A 3CASA 1UC4A 5A6LA 2ACUA 3RIAA 2YZ5A 1DWAM 3EX2A 2OOFA 2P53A 1VR6A 2A2IA 1XL9A 1PBGA 1V6VA 1OSEA 3MMDA 1QVBA 2QPUA 2OR2A 2C5IT 2VFGA 3ZWTA 4NX5A 1Y0EA 2W2UA 2B1EA 5IBXC 1XRTA 4NXNT 1JNZA 3S0CA 3OBKA 5HWMA 3PY2A 1JCXA 2VELA 4DR3T 1ESWA 1UH2A 1V02E 1SFTA 2Y88A 5HQMA 3WF2A 3RPMA 4QS6A 3SRZA 2X9WA 4HYWA 2Z24A 3STFA 4P5UA 5EMKA 2QULA 3L5LA 3MU7A 3QSTA 1W1YA 3FV9A 4UFJA 1D0YA 5PTDA 3CIWA 3VKCA 3KTCA 3NWIA 3KFTA 5DY2A 4O54A 3G8RA 3BAIA 4HN9A 3AA7B 4EAYA 2WB5A 3RIFA 1JFXA 3C3NA 2RAGA 1WYBA 4D8LA 2EHOA 1B9ZA 4JNYA 2CXDA 4MWAC 2J47A 4KGLA 4R34A 2QGSA 1P4CA 3C4WA 2BHYA 1I6NA 3P7YA 5C2XA 2J25A 5IOBA 2Q71A 4I90A 1VFMA 3B5MA 3HKEE 2PP3A 3W1XA 3AJ7A 4INFA 3KOXA 1XDJA 4HHHA 4IPPA 3WQWA 4X1IE 1XSJA 3LJCA 3DFYA 3IAQA 5FJTA 4F48A 3GG8A 3DFPA 4QCEA 2CEAA 1V6YA 2BV9A 2GLKA 2I56A 1JZ4A 3WSUA 1PKNA 3MDUA 3LCIA 2PODA 2JF7A 3AXJB 4CXYA 1LZOA 1O3XA 1PTDA 2Q3RA 4X2RA 5CPSA 1R5YA 4X61A 2FHBA 1T7SA 3I0QA 3NG3A 3HFTA 1FOBA 5A2CA 3GHRA 5M5DA 3CL8A 1WBHA 5E5CA 5K4ZA 1O6IA 1XIBA 4PEKA 5AQMB 4D6IA 2Y0FA 3M5VA 3WMLA 2J74A 2UUCT 2XAHB 3NQ2A 1DXIA 4C6PA 1V08A 3VM5A 1F73A 4DVOA 3H3MA 4CD6A 2CXFA 3BSMA 2DVXA 2DWKA 1AH4A 1YPIA 6TAAA 2W0UA 3TR2A 4LVGA 5I07A 2RDXA 3VFLA 5AHEA 3VX0A 1I1WA 1QNVA 3AEAA 3S4UA 2WWCA 3EWBX 2PDBA 1E6PA 3D0TA 4AD5A 5A2BA 3N2KE 1KGWA 3PUDA 1RK5A 4UQDA 3DG7A 3CK6A 4AD2A 2XVKA 3R0UA 2FMNA 3M0IA 3RMJA 2DJLA 1MEHA 1A5LC 1VCFA 4DBSA 3TU9A 1W9XA 3HR0A 1OCQA 1QTWA 3AE3A 1IT8A 4V28A 2LJLA 2XISA 3OO2A 3FCPA 4WSJA 5G4HC 4O2AE 1POKA 2IHR1 1PKYA 3DC8A 1YD8G 3TDFA 2QS8A 4K36A 2PDWA 3KVAA 1CW2A 2HWGA 4ILAA 5A6AA 2Q9QD 4MPKA 1R3VA 4JR5A 1G1YA 3CX8B 1QK2A 4A8RA 5TIMA 2LM2A 3OVUA 3MUIA 3BO9A 2WSQA 1K3UA 3SFEA 1EWDA 1TVPA 3TQ0A 3BZGA 4CQ9A 4Q7BA 3N6QA 3G1YA 4KERA 5HJYA 4GY0A 3AE9A 4RZ5A 1XR2A 2QYGA 5HWJA 2M6IA 1HKVA 1YIXA 4M24A 1H2JA 1FWAC 4OWGA 2VQTA 3NO3A 4E6MA 1QRQA 3L68A 3HF3A 1IWPA 4IFKB 3FEMA 4B3MT 2EXOA 2VD9A 1X6UA 1WX0A 3TMQA 2WBLA 1W3NA 2P8CA 4KWUA 4HNOA 4N9DA 7TIMA 4R9OA 3BC9A 3EEZA 3BJFA 4IDQA 1THFD 5I6SA 1XIIA 4IIBA 4Z08A 3M0HA 3LA4A 4XBSA 2IPJA 1FHDA 4MYAA 3HB9A 4EZHA 4FNUA 3RJXA 1GZGA 3WH9A 3KL3A 3C61A 3RYSA 4HP5A 1SZFA 3PPFA 2ZC8A 4GMEA 4AZGA 4QEEA 5AFDA 4QCFA 3UULA 2Z28A 4WXYA 2V69A 4I6KA 3TV8A 1BF2A 3QW4B 4OE7A 4LJ3A 4MFRA 3W70A 2FGBA 3VRAA 5FY1A 3M7SA 3TFCA 3RGTA 4M6VA 1UKSA 3NQMA 3N25A 4JKMA 5FI8A 5HBFA 1J6PA 3BWWA 3PUXF 1OGSA 1PWMA 4IUGA 4OIFA 3ARUA 2ZUSA 3OGVA 1REQA 3AZTA 1D0ZA 4HTEA 3RPUA 1IBKT 4QDWA 1V0NA 5JQGE 3WLPA 4QLJA 4JX4A 1SO4A 2Y89A 1FY6A 4J3XA 4A8LA 3TZFA 1US7B 4HBKA 1F3EA 1FWEC 4UVBB 1XX1A 5AN7A 1W9UA 4CQIA 2CIPA 1EA9C 1OD8A 2G4FA 3LCLA 1Y01A 4MSSA 1E0UA 1U22A 4C7DA 3T07A 4P7RA 1BR1A 4C90A 1YPXA 3TCEA 2PC8A 4O1EA 1NH6A 1AW2A 3RC3A 4ZOBA 3NQVA 1CGVA 3TQKA 1G4EA 4QJ5B 4N7QA 1V93A 2WBKA 2I6HA 3IGSA 3WDHA 3S6TA 4CCCA 1F8IA 1Q65A 3LNMA 2BXYA 2GVYA 3U5YA 4CNOA 4Z2KA 1K7XA 1JG9A 5AYYA 3SM0A 4F0RA 1IF2A 5I3GA 3AVSA 4IGNA 5H8UA 2NUYA 5CG0A 3WK3A 4PJNA 1NSJA 2WCSA 5CJMA 1VFFA 2ZZ7A 1HGYA 3E1F1 3T0AA 2WQYA 4M6UA 3TYBA 4O12A 3E22E 2DWGA 1D0XA 2V2DA 4DBDA 3MYOA 4AWUA 1S35A 3HURA 3AAAB 3W25A 4C6BA 2FPVA 4WIWA 3DECA 1UR4A 2LLYA 1VYSX 3LZ5A 4EV6A 3N2MA 4J9JA 3T40A 3TAOA 2LM9A 2FH8A 1Q6CA 3EKGA 3OZOA 5JR9A 3D47A 4IM4A 3TTQA 3REQB 3GBEA 3UR2A 1H0IA 1HKIA 1GKQA 3PUEA 2E6FA 5D9PA 3UZZA 4MHBA 1NWSA 1J0ZA 2Z6EA 3VPLA 3V4BA 2FZMA 5IHSA 1VJIA 4MTVA 4ZQNA 5LBQB 2VO5A 4DN1A 1OJXA 1K7EA 1OC7A 3P3BA 2QYWA 3LCFA 3WLHA 1QW9A 3TYZA 3ZN0B 2BZBA 3O1IA 3M0XA 1F2JA 3FDKA 4JTLA 3W02A 1QAPA 3IJ8A 1W6TA 4GUIA 3AA1B 4NZ5A 2NQHA 2FJKA 2QJNA 5K9DA 2PDFA 4IMAA 1KB3A 4S3GA 4M6QA 1NM9A 3M5YA 4GZ7A 3F2BA 3RC8A 2NV2A 4N6EA 1P0DA 7TAAA 3A4AA 4BWLC 2DLRA 2OODA 1B3XA 2HPLA 4RE3A 3PULA 4NVTA 5BOEA 1JDEA 2AL1A 1LRQA 1YX1A 4EAMA 1V0MA 4QJ1A 4ZTYA 3QOFA 1VCGA 2XVGA 5F2MA 1GW9A 2Z29A 3RF9A 3QC9A 3IJ9A 1YDOA 3I4EA 1JVNA 2BOGX 4C6KA 4DXKA 2CBIA 1QBAA 3VZZA 3U0HA 3W81A 5I00A 2PG8A 3VDAA 1CGTA 3UU8A 4H83A 3VZYA 4FALA 1HJWA 1L6WA 1A47A 3H23A 3LG7A 5C2GA 1N32T 4KWWA 1EJUC 2XUCA 3WAJA 4MZ1A 3P93A 3E12A 2PDQA 2WC3A 2PDJA 4B4FA 4EK7A 3LPGA 3SIMA 1VPQA 1WDSA 3B8WA 1T8XA 3CLMA 1E9LA 4G7EB 4XB3A 2UUBT 4TV9E 2JKAA 5BW6A 5MKGB 1B4EA 2XPKA 2E5BA 5MKGA 1LLWA 4S3BA 4TVUA 4DWSB 3TUUA 3EWWA 1CLKA 5LZLA 3CZGA 1NP0A 4IPIA 1XRFA 4NJJA 2QCLA 4CD4A 3IEEA 3WDJA 1WOAA 3AIQA 4QH4A 3GXPA 4FOKA 2R91A 4JTRA 3GS6A 1WPCA 3MCMA 4C5YA 3C8NA 4YTSA 1HO4A 4KFOA 3N34A 3PTMA 4UCFA 1LRZA 3G1SA 1EH9A 2FVLA 4IE7A 5LIWX 4PMQA 3EDFA 2BBFA 1BQCA 4FIRA 5G1TA 1T72A 3CMJA 1Y8BA 4GX9A 3R43A 2IDOB 1OIMA 2VURA 3PZQA 4JI5T 1PHQA 5C7VA 4H4IA 1CYGA 1OC6A 3H7VA 4H3DA 3VU7H 4UELA 1XBYA 3BGAA 4DI8A 3A21A 3W9ZA 1T8QA 1Y5XA 2VNCA 3P4SA 3U4FA 2PWDA 5BRQA 3UUXB 5BYWA 2Q9QA 1JDAA 3CPZA 1P0NA 1VQTA 2I7GA 3GZAA 2JQKA 4O28A 3SRDA 4RDZA 4REQB 4REQA 4YWSA 5BROA 1JI1A 3ARZA 3UWZA 1G67A 3LMZA 2P9BA 3N9LA 2PF0A 4DYEA 3P4PA 4LY4A 4Q8NA 5FF0A 4PSPA 4JD4A 3EZ4A 2CZVA 4IPNB 5ABTA 4E7SA 4AKRB 1UD3A 2XQYA 3K3QC 5D38A 3PUZF 1JDFA 2YA2A 2UXDT 2UXCT 2QUUA 1SVDA 3W23A 5M2FX 4QG6A 4Q8UA 1QO2A 2W62A 1N36T 2WZMA 3BDKA 3KLLA 1H7WA 3ELFA 4N02A 3GW0A 4MLJA 3SIZA 1YDVA 1BVNP 3NVOA 1UD2A 4LGXA 5DX7A 1A0DA 4B16A 1F6PA 3C4ZA 5AHFA 1TRDA 2EKGA 2ZA1A 1YDYA 3CT7A 5KZMA 1A5MC 1XW8A 3ARYA 1EJTC 1WE5A 2OZTA 3GUWA 3IARA 1GG0A 1GT8A 1QU4A 2DT0A 4AKIA 5C54A 4JFSA 4ZZBA 3B9DA 2HN2A 4FLQA 2DW7A 2INEA 4GCXA 4IX2A 2VC7A 2W9MA 1TMLA 2PI6A 4FZIA 3RIUC 5CB4E 1L0VA 4EX4A 4LB3A 3CB8A 3EDUA 1D2KA 2GK9A 2DQWA 3IEBA 5AQIB 4PUMA 1DHKA 5M4YA 1FWDC 3UA3A 5F5WA 2R24A 2R8WA 3S5SA 4TWHA 3BJTA 2A1YA 3ARRA 3VC6A 3QRHA 1EFZA 5IWAT 1YADA 3E0WA 5XIAA 4ZBCA 1G4TA 1QPNA 3NVDA 3HQOA 4JEUB 4YJ3E 3V5FA 5C9WA 2V5DA 3NQEA 2GK1A 5A6KA 2E25A 2BKPA 1CLXA 5E09A 3P0XA 4KCUA 4W84A 3I6TA 3SAZA 2BVLA 1AA1B 4B3ST 4X0VA 3CQJA 5L6UA 3ICJA 1W2PA 1KNPA 1KCZA 4AZHA 2VEPA 3SJ3A 4CI3B 2HE5A 1VCSA 2HN1A 3VFCA 2DZAA 1GYLA 3UG4A 2PBGA 3CV1A 4FEZA 4X62T 3IJ7A 3NJ3A 1C8VA 1W1ZA 3RKGA 5FJJA 1X1ZA 1MNSA 1E7PA 4UBPC 3DI0A 4CU8A 4NNBA 3GX9A 2DL1A 3P61A 2PTYA 3WLOA 4UTMA 2XINA 3W1AA 4LC8A 1GOKA 1NOWA 1IT7A 3NFUA 5AYXA 2PZ0A 3DP7A 3H7RA 5LA0A 2WWDA 2X40A 1XICA 1DJIA 2RP4A 4HT3A 1S1RA 4ILSA 3FVDA 1H7XA 1PTGA 4QITA 2VFHA 4PSRA 4U28A 2ZLYA 3C98B 5HXMA 3N3TA 3RO6A 2Y85A 5G1YA 2Z6IA 2QDEA 5REQB 2QDGA 3FHNA 1KKRA 1ME7A 4FP1A 3W7OA 5EMJA 1E51A 2C0SA 2GJRA 4B3TT 4L9ZA 1F3WA 2QJMA 3DFHA 2XWEA 1J2BA 1XMOT 4AAJA 3UR7A 2C79A 4YJ2E 3AMGA 3LY0A 4WOQA 1YYAA 3MP3A 1TV7A 5FEPA 4Q4KA 2X68A 1V7AA 6XIMA 1CCWB 3L9CA 1F4HA 5DMMA 4JFUA 1E4NA 3GB6A 2RFGA 4JKKA 1K8ZA 3THCA 1HL2A 2R1MA 2C15A 4CUCA 4J2CA 1YW0A 2CRBA 2PRMA 2VFFA 4ONVA 1M62A 2LOPA 1IZJA 1YQ4A 1U5PA 1TELA 4PRRA 1N82A 1C93A 3A64A 4DUVA 3AAIA 5HEOA 3AIWA 1HKKA 2WMIA 1Q6OA 1OG0A 3HPXA 1XGDA 3VKBA 3H2OA 3ZT6A 3DHDA 4PMVA 1MMGA 3S2CA 5E0CA 3KM8A 1KRCC 3W7HA 1W54A 4FA3A 2GQ9A 3BLKA 1TWIA 1FEWA 3HG2A 1OIFA 1QCWA 3M47A 4NRSA 3UT5E 1E56A 1WDWA 5C8YE 4W5UA 5RUBA 1ZJHA 1K70A 1W3LA 1VFHA 3ANVA 4H00A 3W74A 2UU9T 4HN8A 3PAJA 5CFBA 1FDZA 4M8UA 4C6FA 4YXDA 1P6BA 3GD6A 3TONA 2OZ3A 5JU6A 1WXYA 1BR0A 2ZQ0A 5LIKX 3S6OA 4HYVA 3E3HA 2ZM6T 3SGGA 3NIYA 2PCEA 3PBUA 4QRNA 2FZNA 4UV9B 1O5RA 2XU2A 4JXCA 4URIA 4DM1A 1EF3A 1R2TA 3RO8A 1LJYA 1GKRA 1RBOB 5J1GA 3NCOA 2XAFB 1GVEA 2PLJA 3JAEA 3KDOA 1RXOB 3ITTA 4CVUA 3CUGA 4PMUA 3EI0A 2JQ9A 4RLIA 3EX1A 2RH9A 4M56A 1G01A 5A1AA 3L21A 5D2YA 3BCDA 3MKCA 3R6IA 3FKRA 3F5LA 4IUOA 2XWDA 3DYOA 4DZAA 4WHBA 5EFDA 4GO8A 5AQGB 3CT2A 3LCXA 3N2XA 1ENUA 3DENA 2OO6A 4NNCA 1W8GA 3SN4A 1HF6A 3U4AA 2HBVA 4RNIA 4GFIA 2ZFAA 4JLEA 3OG3A 1VYPX 1FTXA 5FCZA 4JTDA 2E09A 3GN5B 4Y96A 3P8CD 3LHYA 3UWUA 2C5KT 4O14A 4M81A 2WZHA 3MJMA 3PZIA 3Q4DA 1W3HA 2VP8A 3S1XA 2Y7FA 4W8AA 1RZMA 2Q09A 1XSKA 4YN5A 3U2CA 1E6ZA 3ANUA 3CTTA 5A8PA 1SFLA 3WUFA 1TPUA 2X1TA 5EY5A 1KM4A 1TVNA 3ZLHA 1YDNA 4B5VA 5HNRA 3LNPA 3CEPA 4TX5A 1YEYA 2D23A 5G5IA 1E1CA 2YB4A 4LS2A 3PR2A 2YBVA 4BI7A 1R47A 3ARTA 3B4YA 3M0KA 2D20A 3KCLA 2QCFA 5DMNA 5LNVA 1VFTA 4MY1A 5SWUA 3ANWA 3QW3A 1KCLA 3KBJA 1SJCA 2Z00A 1HNXT 4JYDA 3CUJA 3V35A 2I0MA 5CLTA 3LK2B 5ETWA 4ILBA 4GVHA 3S1VA 2Z1VA 4CVWA 3M16A 3LG3A 3EA2A 4XIAA 1FHUA 4P7NA 1H7CA 2QVHA 1VIZA 4OYJA 1LRTA 1XLGA 3W7EA 2Y8VA 4J27A 4UNKA 3AVRA 3RKOA 4E3VA 3PV0F 3H53A 4AVFA 1UD6A 3UCCA 1L9WA 3K8LA 3AO0A 3QV6A 4DF2A 1RP9A 4UEMA 4U2YA 2VL8A 4K39A 4JDBA 4DIDB 4N0RA 4OV9A 1PHWA 4QG8A 2G97A 2JKPA 1IZCA 3ZO9A 1A3HA 3EDJA 2ZRYA 3MUXA 2FTWA 4EACA 4UVAB 3Q5XA 1J5SA 4QIUA 2FDMA 3ZLFA 1UPPA 4I5RA 1D8WA 4O19A 3Q5DA 4PB5A 3MV01 4LVFA 2YFNA 3O7UA 4AMCA 2IUZA 4CKQA 1HJQA 2NOXA 3WQEA 2O92A 2X66A 4NASA 3DU0A 2HEJA 5HNTA 4DUWA 4EXBA 1P7TA 5LIXX 4GKTA 3QNUA 2HS6A 2R1NA 1E4MM 3BTNA 4JBWF 2UXXB 4BAYB 1IEVA 3ONXA 4CQ8A 3T55A 1CWYA 1CPUA 3H7UA 4TWFA 1U1UA 2YCEA 3GFZA 1RJQA 1WUEA 3FKKA 5E0FA 1KNZA 4Q4PA 4B91A 4IQEA 4O1DA 2VEIA 1Q2SA 2ZC1A 1E55A 4ZI2D 1TPDA 1Q6DA 4CI1B 3NQ6A 4PYSA 1UA7A 2ATMA 4LNYA 3Q94A 3ZYZA 4XD4A 1R2SA 2GUBA 2SFPA 3UR8A 4U33A 3LTSA 3WLQA 1KFJA 3R10A 4DJED 4ISTA 3ITOA 3U6WA 4Z2HA 3CUXA 4FNRA 1MQQA 1XPYA 5CPNA 1EXPA 3BLDA 5JVLA 5C70A 4S3AA 4J2MA 2WS3A 1SR9A 3QK6A 2G3NA 3WUGA 4LS0A 3IS4A 3CU2A 3VD3A 1YBQB 2ZRUA 4LCSA 3GU2A 1PV8A 3BMWA 3B8UA 4QR6A 3GXFA 3ZVHA 3HGOA 4AIEA 2Q8ZA 4S2CA 2J66A 2J13A 2MUCA 3P5ZA 4Z1DA 2HVMA 1GEHA 1XXXA 3BPWA 2W63A 3KP1A 1O5QA 3IJDA 4WEVX 4AD1A 3ZQ9A 4BFAA 3FNDA 3MDWA 3CHDA 3W88A 2CKRA 1UUOA 4HU0A 3LSVA 1KQYA 1G9HA 1VPXA 2VDGA 5C9ZA 4WYVA 4JYFA 1OBAA 4JN6A 5CC6A 1DU2A 3CZKA 3ARVA 3LERA 3QV8A 4GCAA 5D04C 4H8NA 2EJ1A 3S2JA 4P1NA 2WJZA 1AW1A 4YHGA 2X8RA 2PDHA 1I60A 2BHZA 1VB9A 5EGRA 3RDKA 1ALDA 1R3WA 3C51A 3UF9A 4Z90A 4LRTA 3THQA 1XINA 4ORIA 5D09A 3I7RA 5FXXA 4PL1A 2WKLA 2NQ9A 3RG6A 3HMCA 2A3AA 2HPMA 1LUCA 4B90A 4L64A 1XIDA 4NXKA 3NQ8A 2VL4A 5AYBA 4TV8E 3L2MA 1J0YA 3RAOA 3NZRA 1I0DA 3S6DA 1IEIA 4G63A 1D1BA 2ACZA 3TN4A 1HF8A 4KI0F 4CEUC 2E9XD 3NO5A 1V0LA 5IHYA 4GO9A 1LCOA 2ABBA 1JCMP 3WN6A 4F0SA 1J4EA 4K7VA 4H6QA 5D9OA 2BB0A 3S1GA 4JQ3A 1TE1A 1TUXA 2E4TA 4JFWA 5F4XA 1ZP0A 3B9AA 2HH7A 3ZYKA 1W9BM 4L4PA 3MHFA 3MVIA 3BQ6A 5CPQA 1P6WA 3CPGA 5CBIA 4YSXA 3NM3A 1BTCA 4WGHA 1W2VA 3EUHA 3PUVF 1IXNA 5L3EB 1UHVA 2RDTA 3GH7A 4ZCWA 4P09A 3CS2A 3B9NA 3HPAA 3GH5A 3PTDA 2J6VA 4XG1A 3LYEA 4QQUA 4AVOA 5KZEA 2ZRXA 1SZRA 2LLEA 2J8FA 3CGTA 5T91A 4K37A 4JQ1A 4ZOEA 2J1DG 1HKMA 2NSOA 1OT2A 4QFUA 4O10A 4G56A 3KRSA 3GVVA 2ABAA 3PUGA 2Y5EA 1RV8A 4NF7A 4WY0A 3QQWA 4OOZA 2FFIA 2XSAA 3D3FA 3HJEA 1NDWA 1S2CA 1KO0A 4WK9A 3VI2A 4QDPA 4WSKA 2BVYA 2OWXA 4BQ3A 3WJXA 3KWSA 3W7KA 5IUXA 5KEZA 3AB3B 7A3HA 1J11A 3LSCA 3GWHA 4MWAD 4KRTA 4IL4A 1KFKA 1MXDA 3EXSA 3NZPA 4IIFA 4HE8A 2WJFA 2FBWA 2QZRA 2V82A 4GUGA 3HA4A 1N34T 4CEXC 4XO6A 1GONA 1EKOA 1TJ0A 1ML1A 5AQUB 2X9HA 3ONCA 1Q45A 1XBZA 2DFAA 2QMJA 4MKVA 2PSNA 3U7VA 2ZZ6A 2WK2A 4JI0T 3FX4A 1EJ7L 3WG6A 2N9DA 1PUDA 5XINA 3U9IA 2WNZA 1A50A 4CCZA 2I1OA 1KFCA 4UTIA 1JNDA 3GXMA 3CTLA 1DTUA 5AQOB 3L0GA 3GDMA 3PZMA 4MKSA 4FO4A 5A5WA 1FH8A 2QCMA 2YYUA 1EPXA 5FACA 3DUGA 1OX4B 4DLFA 4U7YA 3IJLA 3SCRA 3NBXX 4JL2A 4LUJA 2VWAA 4GYPA 3EOSA 4D6CA 4PR4A 5CJNA 4AU0A 2JK2A 5FIPA 5XIMA 4ANJA 1E6XM 1G69A 2TAAA 1KTBA 3O2LA 5F4SA 1KXTA 1FCUA 4LU0A 1H5VA 1LTDA 4GHRA 1NFBA 3SCQA 1T40A 4ZS3A 2YL5A 2E7FA 1CXKA 1AD1A 1UWRA 4XSMA 2CPTA 2HSAA 1XRVA 3PNZA 4JI4T 1KM0A 2QLYA 2KZ7B 4TOQA 4ASTA 3KUMA 4LYQA 4E4UA 5I09A 2PGRA 3V5CA 3ALFA 1Q6FA 4L6DA 1ISXA 3QB5A 4IHJE 1LBMA 2Y2WA 3GK0A 1Y64B 1SPQA 5D33A 2V7MA 4Z2JA 1GJPA 3IGXA 2GSEA 5BRPA 2MYSA 5KX5E 2A9UA 2CHNA 3ZOAA 1UASA 2ISSA 4S2BA 1G7VA 3TYCA 2Z1BA 2H88A 4X9YA 1FA2A 1W3JA 4XSLA 2HROA 4H9RC 5I2UA 4X60A 3S9YA 5U7SA 3EEGA 3H2FA 3M0VA 3I9YA 5AHLA 2BG9E 3JUGA 2NZLA 4S3JA 2BG9B 1UR3M 4AH7A 2G3MA 1FVPA 4QWNB 2X9XA 1IBMT 4PH6A 1EP1A 3LBXB 2X7VA 4Q7NA 3MPGA 4B3KA 2B81A 3WQDA 2CCQA 3EB2A 4EKJA 4NI8A 1GG1A 2Y63A 1QNQA 3TTEA 2QJGA 5FL0A 3R2GA 4U4MA 2BG5A 4X3ZA 1HJUA 4R7OA 3ITGA 2O55A 2GOKA 3H2EA 5FNVE 1K03A 3FN9A 3ES8A 4PCSA 4ML9A 1RALA 4LUIA 3N2BA 3NSNA 1GQLA 1YNQA 2UY3A 1H60A 2Q8LA 1H1NA 1JXJA 4DV4T 1JQXA 3FJ4A 4DJEA 2BDQA 5D2TA 5A8GA 1FWRA 3WH6A 2C71A 4ZO9A 5HWYA 3U3HA 5HEJA 1N7KA 4AQFC 1SU5A 3C4XA 2C0HA 4QH5A 1FWBC 5FL1A 3LHZA 5G2HA 1DJQA 2VRKA 5FKYA 1XWMA 2M6BA 4W5ZA 1XLKA 1M1BA 3N4FA 3ORWA 4DXXA 3CMGA 3ITLA 2ZDSA 5CBBA 3E0VA 1QR7A 9RUBA 3A4XA 4V1YA 5CXPA 2BWGA 2O9PA 5I77A 4HU4A 1HS7A 3KAOA 2JEPA 1WDQA 3UT0A 3NZQA 2BMBA 4G7FA 4ZE5A 4AUBA 2A0NA 3TJ4A 3W7CA 1DJXA 2CERA 4A22A 3QF0A 1Q6RA 5HXEA 3HM7A 1UJQA 4GI9A 4RNFA 2VC6A 3EWXA 4F9DA 2X1IA 3VX1A 5C9UA 3A4JA 3L4YA 2EQDA 1R9XA 3VE7A 4H9QC 3ERPA 1YNPA 3MJYA 5FY7A 3O9XA 4ISSA 4JTKA 4AC7C 3NAVA 1KRAC 4Z1YA 3HPZA 1OZQA 2X1UA 3PK7A 2A7NA 3HKDE 4UF0B 1TA3A 2E9XA 4DR6T 5T9BG 5HAOA 3W7DA 1E70M 4DV1T 2FFCA 1E6RA 4G8TA 3C2FA 4AC1X 3SADA 3BICA 3M0ZA 4FIQA 1HT6A 1HX8A 4JGDA 3DFSA 1KM1A 4O4LE 3KRBA 1N55A 1FWTA 4J3VA 1ZHAA 5EL1A 5IFTA 3LK6A 2DQXA 3B8IA 4EGWA 1HNZT 3L4WA 1R86A 3VOJA 3S8HA 1I2NA 3W71A 1UMLA 2DZBA 2PUZA 2PDKA 1ZBCA 5L3GB 1LQ0A 4XZWA 4WDXA 5IBXA 2ASHA 2HRWA 4DYJA 1YXRA 4DV0T 4IPLA 1X9BA 4X65T 5I3IA 2DORA 2WAGA 4RR4A 2VC9A 3H12A 1XYFA 1FP8A 4LSBA 5CLWA 1FKXA 1EIBA 2CC0A 2J77A 3K5XA 5DT7A 2P5NA 3IIZA 2XVPA 4GI8A 4I43B 1EJSC 3KFWX 4QNWA 2VENA 3KDNA 3KVKA 3S2NA 3QM3A 4E0CA 4OHFA 3RYIE 1WZAA 4OYKA 4MWAE 1HP5A 2QCDA 5FYMA 1W5PA 4MWAA 2HNHA 4PE8A 2E40A 2JALA 1KFBA 1A5NC 2VRJA 2OWWA 3MWCA 4MB4A 2QT3A 1T98A 2WHJA 1BWKA 3IRSA 5FAGA 3WDRA 4LXFA 3UA4A 4C7FA 3MZKB 1TPFA 2YJQA 2XGBA 4GUJA 3S1WA 2PS2A 1CXEA 4JI1T 4PZVA 4XKYB 4XKYA 4YU1A 1ZQ5A 3RYCE 2IS7A 3VNZA 2REQB 3N9SA 4JTJA 4JYAT 1B90A 2CESA 2GGIA 5CQ1A 3T8LA 2ZCGA 4F4RA 4FI5A 2RDWA 3P8IA 2VEGA 4KFNA 4YVXA 4E2DA 1PYFA 3QFEA 2WM0A 1W0AA 4QE4A 3N9OA 4PCFA 4PMYA 3EMCA 3O63A 4GOAA 4UQ9A 3ZMVB 1ZENA 2YSWA 3T81A 4C6QA 3W1PA 2ZX8A 5CAKA 1YTEA 1U2YA 3NPUA 4I5UA 4CU6A 3LOTA 3VR9A 3M0JA 3KOZA 1NWMX 2BS3A 4GJ1A 1VHNA 3K4AA 3MMTA 1KNRA 2LHRA 1R9YA 1XWYA 1RD6A 2ONEA 2Z2BA 4P8WA 4GX8A 2NXIA 2G4JA 3HOJA 5DANA 4L5ZA 3M1ZA 3C2YA 3PUWF 2A72A 4I8YA 4UTUA 1XDLA 4NJHA 3C64A 3W2KA 3QN3A 3BQ5A 4D8ZA 3T2PA 2E1WA 4OFCA 5HWXA 4N6FA 3PBWA 4PAGA 1XD1A 5I3HA 2YIHA 4JZ5A 5IYZE 3QHOA 3RITA 1V0KA 2VASA 4A3YA 2VFDA 5B7ZA 3WQPA 5KZDA 4CQCA 4HEAA 4K0KT 2WC7A 5EMMA 3AZRA 2CWXA 4H8HA 4LNCA 2IPFA 2AL2B 2OQYA 3R5EA 1C8YA 2GSJA 4KQNA 4H04A 1AUSL 2PDCA 3IGUA 4I8DA 4KT2A 3VYLA 3O06A 3B97A 3OTOT 2MNRA 3LGEA 3CQGB 4ICMA 2ODUA 3QY8A 1ZY9A 2ISVA 1ISZA 4J35A 5LA1A 1A80A 4UFHA 2YW4A 3UR5A 1F61A 2DUXA 1E0VA 1ICSA 2CETA 2ZWYA 4IE0A 2GUYA 3CWOX 1XLEA 1DQXA 2HPJA 4HN4A 1TV2A 3DEQA 1VOMA 4WZXA 3CYVA 4NJGA 3LI0A 4HQVA 1FWWA 1PIFA 3DFNA 3DN5A 4LFCT 1S5WA 1P0EA 3I6EA 1G0CA 4YLHA 4GFSA 2NXHA 1HW6A 1F6YA 1F74A 3GNPA 3I7SA 2G8ZA 3B3DA 3DOPA 1M7KA 3MSYA 3PSVA 3JC6C 4BI5A 4Z17A 2ISWA 2QF8A 1BGGA 1F05A 3EA3A 2XQ9A 4JQ2A 2DNXA 3KVBA 1KLYA 2WSSV 3DFQA 4OGZA 5HEHA 1DJNA 4C65A 5CSSA 4WUIA 2VKDA 5LYJE 4IMCA 3CAQA 4X9SA 1BSLA 1WDRA 1DIKA 4DB7A 2QA7A 3G1DA 3RU8X 1AL7A 5C71A 1MMDA 5D03A 3RLHA 1IXOA 4YTUA 3AE8A 1VJSA 2YXOA 1QHOA 4GPNA 4NAFA 2D5UA 1UIPA 3EAMA 2YX0A 4WCJA 3AU6A 1X8FA 4BF5A 2NUXA 3UJSA 3MBFA 4LALA 1OCJA 1WXJA 4WKFA 3SCNA 4MNMA 4QS5A 1GVRA 3KX6A 3E9AA 3KHDA 2I9EA 2INFA 1HNWT 3GTNA 3QTPA 1J2WA 1W1PA 5DEZA 1Z89A 3H55A 2WKGA 3C4UA 4F0HA 1PKLA 3GSMA 3CH9A 3E2QA 1KEYA 3GHSA 3VO0A 4DR7T 4L7ZA 4HCHA 3SFDA 4ZO7A 5AQQB 3MCNA 3N2TA 3UY8A 5CKSA 2J62A 3OHIA 1GQEA 5J0ZA 1UQYA 2J24A 4MF4A 4GYRA 1C90A 4HMCA 5HYAA 2TPSA 1H3GA 3HU7A 3T4CA 1OFPA 3UXDA 5I24A 4EIVA 4MM1A 2LKGA 1HUVA 1U1HA 1XFBA 4XTIA 4C6CA 3URNA 3U78A 3B8DA 2G95A 2ZADA 4PUUA 2JQHA 4K0UA 4H6EA 3UCQA 1LQ2A 1DWIM 2GVGA 4O1AA 2YFOA 4D6DA 1OGGA 4D1IA 3N29A 4U10A 4MNKA 4A8NA 4PTVA 5KMYA 1QWGA 3PJWA 2XHEB 3ZLIA 1ZZMA 5L47A 3EPOA 1B2YA 1N2VA 3BG3A 3IUHA 4DO5A 1EJVC 1UR0A 2KNDA 3UU0A 4S3FA 2ZX7A 3NL3A 5EFFA 4WD0A 4PFOA 3W84A 3SCOA 5T8GA 5KINA 3B40A 1LBLA 1KWKA 1JUBA 1JD9A 2QPXA 3W7LA 4DMVA 1EPVA 3C50A 2EG8A 1M7PA 4PTDA 3KV9A 4XBFB 6PTDA 1K9EA 4JV5T 5LOVE 2WHKA 3DC0A 5EU9A 2E2AA 1J5WA 4AI6A 1L8NA 2NLYA 3AHVA 1XISA 3A3WA 3PFMA 1Y5VA 5DXXA 1SO6A 2EJAA 3AIUA 4JI6T 4DRSA 4ZMGA 4QLLA 4CNUA 4KPLA 4LYKA 2L3LA 3LK42 2BZNA 2DEPA 3N5LA 5I03A 1E73M 1FXQA 4PMDA 1FX6A 2XIBA 1XYZA 2I59A 4KWVA 3NQGA 4XO7A 3ANYA 2WPGA 4Z8XA 2XH4A 3GAYA 4HSNA 1FP9A 5BOFA 2H3DA 1AMKA 3H2NA 1BXNA 3FEQA 1HKJA 4NRRA 1U5VA 3OW1A 2YDQA 2AQOA 4FPSA 3PURA 3VOIA 2ZM8A 8CGTA 4LPCA 3M43A 3M6DA 3TQPA 2XN1A 3MUY1 3B04A 5C3JA 1N8FA 3CQKA 3R8RA 5J04A 4FX8A 3BL3A 4S3EA 2O56A 3T4WA 1D1AA 2F2KA 5T9CE 2TYSA 5AC6A 5K2ZA 1IR2A 5CEWA 2VZUA 1P0KA 2D0FA 3V0SA 4ZOCA 1J8VA 2WM9A 2OKTA 3FBZA 3OYXA 3PB0A 2VK9A 1WYIA 1FRBA 1R7OA 1FH7A 1PKMA 1Z0PA 1HCIA 5AQKB 5AQLB 1UD5A 1CXLA 1K7FA 4FI4A 1KCKA 1XYAA 1LVKA 2WDRA 3ZT7A 4COFA 3AIVA 1BYAA 2G96A 4JTAA 4AQLA 1ADSA 1KBBA 4JCMA 4J5NA 5FVKA 2QGHA 4HHMA 1NELA 3PG8A 1CDGA 2HHHT 2K5BB 1M41A 5JBDA 4H63H 3BOFA 4H01A 1UX4A 3ZSTA 2E9MA 1AVAA 1KGXA 2ACQA 1K1DA 3SB0A 3VD7A 5L3CB 5E0OA 2V5JA 3MB9A 3WLIA 4JHMA 1ZCCA 3PSWA 1PE1A 4GGHA 4K1WA 1KRBC 3DHPA 1R8LA 1B3WA 4MALA 1FJGT 4V15A 3GRIA 5DBTA 5BXTA 5GNZA 1QW7A 4YVPA 4YHJA 3RFAA 1RCXB 2PDYA 3P8JA 5DRIA 2V81A 2C13A 3CHVA 5CPTA 3HGSA 4TX9A 1I75A 3NOYA 3CPUA 2WMFA 2FJUB 2YOEA 3EDKA 3UJ2A 4IREA 3VMNA 2ZMAA 1DXFA 3QTGA 3BQLA 3VRBA 1IT0A 4K8HA 4O50A 2EO7A 3FIGA 3FHQA 3W7PA 4WR3A 1L6YA 1B0IA 3BAKA 4ES4A 4AY1A 2KWIB 4W86A 5D37A 2YCLB 1NFPA 3NL2A 1TZ7A 5FXZA 2V30A 4EWND