2W63A

Saccharomyces cerevisiae gas2p in complex with laminaritriose and laminaritetraose
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
455
structure length
432
Chain Sequence
SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 161
structure length 432
sequence length 455
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w63A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w63A01
4W93A 3S2CA 3UG4A 1BG4A 3W4RA 3WF1A 3L4ZA 4GO8A 2XSAA 4BS0A 1BVNP 1BVZA 4X9YA 3WNOA 2DGAA 2ZXAA 4WSKA 2X1IA 3WELA 4QP0A 3OLGA 1UD4A 3GXIA 2F2HA 1WZAA 4P7RA 1JG9A 2WHMA 5HPOA 4QDMA 4CU7A 4CD4A 3NDYA 2W63A 5HDRA 1KBKA 1IT0A 1VB9A 2QPSA 1ZU8A 1JDAA 5D9OA 3HU7A 4J3SA 2G4FA 1BHGA 1OD0A 1SMAA 5CLWA 1PZ3A 3ARQA 3QOKA 6TAAA 1LL6A 3LPOA 2QLYA 4JHOA 3HJEA 5HXMA 1B0IA 3WNPA 1ECEA 5EMYA 3W38A 1QBAA 4CD7A 1GJWA 4ZENA 1OM0A 3AHYA 3PTQA 1E4NA 4ZEPA 3AOFA 2YA0A 5LYRA 5AY7A 4KMQA 1GOMA 5C70A 1PZ2A 2BHUA 3A6OA 3FW6A 3VNYA 5BYWA 4KGLA 2CEQA 1CYGA 4P7NA 3TTYA 3W82A 4W8AA 2Y8VA 5BRPA 3SUVA 2ZUWA 1BPLB 2J78A 3OIHA 3ZSSA 1WB0A 1BYCA 3TONA 1VFFA 4UR9A 2CERA 3CZLA 2NW0A 5DT7A 1UOKA 4DWSA 3WD1A 2J7GA 1L0PA 2V3FA 2A3HA 1TE1A 3CHCA 3K1DA 1WDSA 1JZ7A 3LMYA 2C7FA 1MXGA 4W7VA 4UOQA 5E70A 3A4XA 1HF6A 2WCSA 1JZ3A 3VTRA 2J7CA 3VO0A 3DHPA 3MV01 5I3DA 2CBVA 4HOWA 3N15A 3PBGA 1EO5A 4Z2JA 1Q4NX 1W9XA 1XHGA 3IANA 1K9TA 3ALGA 2EO7A 4A3YA 2ZUVA 4M29A 2OSYA 3NIYA 5BXSA 1E40A 3UERA 5I5RA 2CNCA 1ISVA 1PJ9A 5M3WA 1JZ2A 1PX3A 1CGWA 2YL8A 1JGIA 2PBOA 3ECQA 3VUPA 2IXUA 4FLRA 3WQ6A 1V3LA 1MQQA 2BHYA 1ZJAA 3HMCA 3SCNA 5A94A 2VC9A 2DPEA 2OSWA 3PZUA 2BY2A 2D3LA 1Q6EA 4DWSB 2EQDA 5LA0A 4D6IA 3DYOA 3SURA 4C7GA 3QGVA 1VRXA 3WQ5A 3EDEA 1WZMA 2FGLA 2O9PA 2GDVA 2DT0A 7A3HA 1VIWA 4C7DA 1BTCA 4JIEA 1D3CA 4W89A 2GUYA 3BH4A 5EB8A 1UKQA 1DP0A 2OYKA 4PTWA 1JFXA 1LG2A 1E0WA 2WC4A 2YDQA 3NYDA 2VZTA 1UD2A 2IXVA 2UY5A 1J0JA 2J77A 3ARUA 4AZHA 1F4AA 5LA1A 4PCSA 1RP8A 1QNSA 3GH7A 1HVQA 4KRTA 2G3MA 5KEZA 4CGTA 5TD4A 1VFOA 4AEFA 1OIFA 4F8XA 1E0VA 2E8ZA 1JXJA 2JFEX 4UZSA 1MFUA 1QOXA 3IAQA 2O9OA 2DIEA 3WF3A 4MAVA 7TAAA 3EMZA 2ZX8A 4C7FA 1GOWA 1W9VA 4CU6A 2V5DA 4MB5A 1QI2A 4JKMA 1WPCA 4EAMA 4LGXA 4QLKA 1NOWA 3F5KA 4JZ5A 4QLLA 4QCFA 2Z1KA 4TX8A 3CUHA 2EXOA 2E9BA 4FLOA 3TTSA 2VMFA 2D3NA 5A2CA 3UG5A 1VEPA 2XVGA 4H8VA 3IAPA 1QI5A 3PZGA 3CMGA 2ZX6A 3OGSA 1XSJA 2XHYA 1QVBA 1UYQA 3MSDA 1GVIA 2O9RA 5I79A 4WKHA 1V3MA 1FFQA 3VIJA 1E6NA 4ATDA 3MUAA 4CN1A 4RE2A 1R85A 1NP0A 4JKLA 3PTMA 4E4PA 3PZQA 1KCKA 4PMDA 1V6YA 3W37A 1KWGA 1C8XA 1WKYA 4KGJA 4PTVA 1B3ZA 2D20A 1G01A 3L4VA 3WUGA 1NWTA 2PWDA 1M7XA 1MQRA 1SYTA 5E6YA 4H04A 3ZR5A 4AYSA 4PMVA 1PX4A 4FK9A 2XG9A 1J0YA 5A2BA 2W62A 4V28A 2OWCA 4MPKA 4AD3A 4CUCA 3RJXA 4NF7A 2XIIA 2XGBA 1BSIA 4PMNA 3FHAA 2DT1A 5A6LA 1BYDA 2FGZA 3WDHA 3WL1A 5I77A 1U2YA 2V38A 1LLOA 2CITA 4WKAA 3W25A 4TVCA 4F79A 1HX0A 2ZUMA 3TTOA 2BXYA 1O7AA 2CHNA 4DWSC 2WMIA 3VGDA 1JYWA 2RGMA 4AWEA 1GW1A 1KBBA 3AICA 5I23A 2D0GA 3GNOA 3WF2A 1QNOA 3U7BA 1WZKA 3AIUA 1R8LA 3KL0A 2VQTA 1PBGA 8A3HA 3ZT6A 1TMQA 1ITCA 2VRJA 4MJ2A 3L4UA 3CUFA 2DDXA 3NDZA 3F5JA 1D7FA 3GNRA 4YHEA 1QI4A 1Q6CA 1JZ4A 3EBVA 5A6BD 4ACZA 1R7AA 2G41A 3L2MA 4OBSA 1CXKA 2YDRA 3EDDA 2XVPA 4UZUA 1UR9A 3VIGA 1W32A 2XGIA 1EDGA 2G3IA 1EIBA 1OT2A 3O2LA 3GH4A 1XC6A 4P8XA 5BXTA 5HNNA 3WDIA 5ECUA 3FAXA 3ZJ7A 2ZICA 4MB1A 3SCQA 1V0NA 3ZM8A 1H11A 2WMIB 4XB3A 1U33A 3UCQA 3FY1A 1ISWA 4GI8A 1V6WA 1V02E 1VJSA 4IM4A 3WNLA 1C7TA 2VX5A 1EOKA 5A6JA 5CPQA 2PWEA 2ZUSA 4AC1X 5JBFA 1UKPA 4WLCA 1G94A 4Z2HA 5A6KA 3ARYA 3AXXA 4MJ4A 2ZXDA 1H0GA 3ARRA 4W8BA 1CGXA 4JFTA 3RM9A 2ZUNA 2DSUA 1UH3A 1CGUA 1J9YA 3T2OA 2XPKA 4LYRA 3VIOA 1DEDA 1EXPA 1YHTA 4W7WA 3BXWA 4WK9A 3TA9A 1V0MA 4CVUA 1KXQA 4GQQA 3BAJA 3HN3A 4GIAA 2VNCA 2BXZA 3KL3A 3W26A 4LPCA 2EPKX 3MKKA 4HA1A 3CTTA 4OKDA 1G9HA 1EQPA 2XM2A 5A69A 2F61A 1GONA 1UQYA 1MW2A 1UZ4A 3ZT5A 3PN8A 3I3DA 4DM1A 2CXGA 1XCXA 9CGTA 1E6PA 4PUEA 4P8VA 3AYRA 1DWFM 3WD4A 1JDDA 1R86A 3VX1A 2WMGA 5FCZA 4NSBA 3IJ7A 2J7DA 1JI2A 1WZLA 3UR7A 3EDJA 5JIPA 4QLJA 2WHKA 1UWSA 4HOZA 3CUIA 4JFWA 4CCDA 2WLYA 3CZKA 2XFYA 2NT0A 5BRQA 4WIWA 4R5EA 1CLVA 4JCMA 5JIWA 3L2LA 5IFTA 5F7UA 2AAAA 4TX6A 3VINA 3QHMA 4AW7A 2FHBA 2Y24A 4U3AA 1E5NA 2E9MA 3NCOA 2PF0A 3VILA 2FHCA 4A3HA 3WH9A 2EPMX 5ABEA 5I0DA 2ZE0A 3EDFA 4P7LA 2C8NA 1V02A 2D0FA 3VIMA 1XSKA 1HN1A 2YLLA 4E8DA 4W85A 2WWCA 2YKKA 5FD0A 4HMEA 5A6AA 3T2QA 4CVWA 4J3TA 3WBEA 4AZCA 1W1VA 2W4XA 3EMQA 3OGRA 3WD3A 1G5AA 2O92A 2VR4A 1FH7A 1H3GA 2OSXA 1W3HA 2ZWYA 2VVSA 3DECA 2VX7A 2XUCA 4EKJA 1KGUA 1DWIM 2NT1A 1ZBWA 4IUGA 4MDPA 4E2OA 3OB8A 3WQ8A 1QHZA 1NWRA 1JYNA 1U30A 1WAWA 2V3GA 4CN6A 3CMJA 4EK7A 3MMDA 3WUBA 4V2XA 2BS9A 2WNWA 2YJQA 1J10A 1QHPA 1W2PA 3M6DA 1UWUA 3SCTA 4ZFMA 2WC3A 1HJUA 1HKMA 1V6UA 4GI6A 4TUFA 1MQPA 3VDBA 1I75A 3ZQ9A 1QNQA 1V03A 4PMXA 1HL8A 1OSEA 4W8LA 2CBUA 3AMKA 1JAEA 1XGZA 4M56A 5BXPA 3VGFA 4Z2KA 2ZOXA 4DWSD 1EDTA 1ISYA 3WL0A 2J7HA 4AZCB 1E0XA 4GKLA 2XVLA 1FH8A 3I3EA 2VURA 2G8ZA 1M04A 3AZTA 1JNEA 2WCAA 1H09A 4ZE4A 3LPFA 3ALFA 4IPLA 1YQ2A 1DHKA 3O6AA 1UWIA 3EMCA 1KGWA 2JF6A 4LQ1A 1EQCA 2QHAA 1ZJBA 1AQ0A 3CZ8A 1HJWA 1PIFA 3G6LA 5DF0A 3SUWA 3MMWA 1JI1A 4F9JA 4GI9A 5I24A 4GQRA 4PTXA 5A8OA 2E0PA 2PWHA 2XIBA 3TOPA 2CBIA 3VPLA 4N42A 3K4DA 2WVSA 1EH9A 2VRKA 4UQBA 1GUVA 3BAIA 3OLDA 3T09A 1AQMA 5BXRA 1TUXA 2D1ZA 2J7FA 5CPSA 2UWFA 5CLTA 3SUTA 4UFHA 4DUXA 1BYBA 1RD6A 5EFDA 1E15A 3BMVA 5E6ZA 4PTMA 4AXNA 3VIHA 2VRQA 1JD7A 3FXYA 1UR2A 2Y8KA 4PN2A 4HPGA 3K8LA 4MNLA 1E73M 2EPLX 4Y7EA 1NARA 5EFFA 3AMLA 4BQ5A 1VJZA 4IPNB 3VMOA 4PRWA 4LYPA 1E4MM 1TR1A 2WHJA 4TVUA 3VGBA 1EGZA 1LG1A 2WMHA 1ZL1A 1WCGA 4UFKA 2YLAA 3GBDA 3B9EA 4S3JA 4WF7A 4AD1A 2YOCA 3MMUA 4OJYA 2YL5A 3K46A 2JIEA 1GORA 5DEZA 1KR1A 2CYGA 2VVNA 4M82A 4URIA 4M24A 3CPUA 4M80A 1QBBA 1UKTA 1OGGA 5A8MA 3VD9A 1KR0A 4D6HA 1NP2A 2BHZA 1EDQA 1C8YA 3JUGA 1C93A 4UOJA 3VKKA 1E4IA 2O9TA 3RILA 5CGMA 1J0HA 3POCA 1W1PA 1BF2A 4CD5A 3BAXA 3N12A 3U5YA 4HP5A 3U7VA 3K8KA 1MYRA 3WDPP 2GFTA 3BC9A 1J0KA 4FF5A 3VNZA 1B1YA 2J8GA 1HP5A 4AZGA 3WIJA 3N04A 1JXKA 4QAWA 1LF1A 1ZB5A 1WP6A 1QW8A 2NSXA 1B3YA 3AFBA 3DYPA 5I78A 3UESA 3PHAA 2W5FA 5JBEA 1V3IA 1FOBA 1A3HA 2YL6A 3BAYA 4UQEA 4AZBA 4HA4A 3BSHA 4J7RA 2X2YA 2XWDA 3QHOA 2Y5EA 3BSGA 2WMKA 2XFRA 3L4YA 4HU8A 4H2CA 1GVYA 4UFMA 1K9DA 4D1IA 3OA5A 4PSPA 3D3AA 1CEOA 2PI6A 2CBJA 2DSKA 2EPNA 2FH8A 2BV9A 2W92A 3ARXA 2VZVA 1VFUA 2J25A 2WYSA 3VD4A 4AMCA 1BGGA 3AQUA 1VAHA 1Q6FA 1TG7A 2VL4A 4GZEA 4P8UA 1DTUA 2DSZA 4UQAA 4MNMA 1WDQA 4AD0A 1ODZA 2E8YA 4LX4A 3BCFA 1LL7A 1CXEA 3AZRA 3AZSA 4HMDA 4AZ7A 3VVGA 4TOQA 3AMCA 2A3CA 4U2ZA 2WAGA 3W6MA 2YDSA 1BQCA 3VMNA 2XTKA 3E1F1 2YBTA 1FP8A 4DM2A 5IHSA 1X6NA 1B3WA 3SCVA 2J7BA 4AD2A 1W9UA 2XYLA 1I1XA 4RE3A 1B2YA 1E43A 2EPOA 2ZX9A 1LJYA 2OLHA 2XFFA 1KQZA 2WLZA 5DMYA 2ESCA 1V3JA 2VR5A 4Q7NA 4L4OA 3AXHA 1AMYA 1J0ZA 4W84A 2F8QA 1GQLA 1UZ1A 5C71A 2QMJA 1LL4A 3LPPA 2WMJA 1CDGA 1UD6A 5C8BB 1J18A 2YA2A 3N18A 5D9PA 3W28A 3IJ9A 1VEOA 1E5JA 1RP9A 3DYMA 3U57A 3L4WA 2JEPA 1K9FA 1OINA 4B9YA 1ITXA 4GZIA 2A3BA 1ZBKA 5M17A 4UFJA 5GNYA 3WDJA 2VCBA 1B30A 1H41A 3CHFA 3CGTA 1XYZA 1A47A 4W87A 4EANA 2XVKA 2E3ZA 2CKRA 3A47A 3OZPA 4EE9A 2B31A 1JF5A 4PMRA 4D6JA 5D8WA 3RM4A 4NRRA 2WM0A 2Z1SA 3AMDA 1ZBCA 2VQUA 1MFVA 2UY4A 1EOMA 1XV8A 3PTKA 3VIPA 2XWEA 4JKKA 3VX0A 2D23A 2ZXQA 1W9PA 2EBNA 2ZXBA 3SCUA 4PMOA 3SCPA 3AHTA 1VEMA 2GSJA 1E9LA 3F4VA 4Z2IA 3CO4A 1MVYA 3MO4A 1UUQA 5E0FA 3WEOA 4OOZA 1UA3A 3RM8A 1JIBA 3NSNA 2DIJA 4TTGA 2J8FA 3BLPX 3MUY1 2J74A 3VOCA 1HP4A 1W3LA 4AIUA 4H41A 3TTQA 4D71A 4W5ZA 1IZKA 4GXPA 3WMBA 1HKKA 4HU0A 4BQ4A 3ARTA 4FMVA 4RE4A 5EBAA 5CQ1A 1B3VA 1JFHA 2WMFA 2WWDA 4HOXA 5GQBA 1MWOA 2RGLA 2X0HA 4U5IA 3AROA 3OG2A 1UD3A 3BLKA 1LWHA 1NQ6A 1TA3A 4GPNA 1QI0A 4HA3A 4DUVA 5HBFA 2WK2A 3RCNA 4J3UA 3FAWA 5A6SA 3VIIA 4PMYA 4OUEA 3CZGA 5GPRA 2PC8A 3WMSA 2CCRA 1PAMA 2VCCA 1WDPA 3CUGA 4PEEA 2J79A 3W53A 2YA1A 3VGEA 1WNOA 2Y4SA 3AHZA 3WF4A 1OB0A 1OCQA 1CECA 2FDMA 3N17A 1XYFA 1CTNA 4XZBA 3ZMRA 4AZ6A 1V6VA 4MNJA 3WNKA 1E6QM 3WH7A 5IXEA 2QMKA 4AZIA 2DH3A 3AISA 3T0AA 3GNPA 2DT2A 1E55A 2GVYA 1DWAM 3WSUA 3CLWA 2YIHA 3AIEA 4N0RA 4ZXOA 2J4GA 3K4AA 1UR4A 3IK2A 2CESA 2G3JA 4L4PA 2WVVA 5KZ6A 4TXEA 1V6XA 4D6DA 4P7OA 1OIMA 3CIVA 3SCOA 4X0NA 3A4AA 4BQ3A 3U5UA 3GBEA 1TA3B 3W29A 1OT1A 1KXTA 3N9KA 2VZSA 2ZWZA 2GK1B 1VBUA 1DWJM 2WSKA 1UHVA 5BCAA 1GHRA 2VTFA 4GINA 1ZBVA 4W5UA 2EEXA 4AD4A 4ZXLA 2GJXA 3WDQA 1EO7A 2QF8A 4CD8A 4D6GA 2WVTA 1R87A 5BROA 1KWKA 3J7HA 3SCRA 2EJ1A 2W61A 1KCLA 1HXJA 1MW1A 2J7EA 3GXDA 3VIKA 1CWYA 4HPHA 4HTYA 3QOMA 4UNIA 3PZIA 4CD6A 1FH9A 3AS2A 3WKZA 2J62A 2V3EA 1Q6GA 2YBUA 4FLQA 3AHXA 1GHSA 2DSVA 4MTVA 3GYCA 3EDKA 2JEQA 1UKSA 2VCAA 5LA2A 4XV0A 1WO2A 1W2VA 2PBGA 5AC5A 3MSGA 3VIFA 2J75A 1ESWA 1HJQA 1US3A 2WHLA 3AIWA 2WVVB 4MNKA 4UQCA 4ATWA 2JIWA 3T0DA 4FLSA 4PUDA 1Y7VA 1KGXA 1UA7A 5ABFA 5A8NA 1C92A 3MUIA 3N1AA 3ARWA 2WKGA 1OGBA 1EHNA 4B3KA 2WBGA 3AMGA 2QPUA 2IUZA 3PZMA 1KB3A 1UR1A 2VI0A 2WZEA 2DQXA 2GJXB 1E6RA 5CJ5A 1V08A 1UG6A 3B9AA 4AZ5A 3ZJKA 1CGVA 1N82A 4JHZA 4U31A 5FOOA 3CZEA 1V0KA 3O9NA 3SEPA 4M81A 5A3HA 3MS8A 3THCA 5CPTA 1SFSA 3SCSA 1J01A 1B90A 2BY0A 4ZE5A 1NH6A 3AIQA 1E70M 3SUUA 1M01A 4X0VA 4HZ6A 3AIVA 3RPMA 3A3HA 1E6SM 3GZAA 4AISA 1XCWA 1DWHM 2E40A 1J11A 1H5VA 4D6EA 4CCCA 1BYAA 2GDUA 1CXIA 2OWXA 2J47A 2X09A 3WNMA 1V0LA 5A8PA 3S6TA 3VDAA 1FFRA 1CNVA 5AC4A 3BAWA 5CSUA 5A95A 3RDKA 1B9ZA 5ABFB 2W67A 4QCEA 1L8NA 1US2A 1H1NA 1UWRA 3VMPA 4D1JA 4B3LA 4CN4A 1FHDA 3WNNA 2JF7A 4J3VA 3POHA 5CG0A 1UR8A 3G6MA 3WDRA 2WZIA 3MANA 2XM1A 1SR0A 4KH2A 3AS3A 1MXDA 2BVTA 4W7UA 4ACYA 1JF6A 4BZYA 1QNRA 4XX6A 2BY1A 4MAZA 1KXHA 1UH4A 1F4HA 4JAWA 4F9DA 2CKSA 5IFPA 2V5CA 4YPJA 5FKYA 1UD8A 8CGTA 1VF8A 1W9DM 3L4TA 1FP9A 1BLIA 1Q6DA 4K68A 5ABGA 5GNZA 2VX4A 3LPGA 4OBRA 1ISXA 4GO9A 1E4LA 4UTFA 3FHQA 2ZUUA 2XJ7A 4B15A 3M7SA 4H7VA 4S3KA 3ZR6A 3WBAA 3SUSA 1HVXA 4UCFA 3K8MA 2E4TA 2W91A 3SCWA 3WFLA 1JZ8A 4DUWA 1B31A 1EA9C 3WQWA 3KL5A 3GXMA 2X8RA 2DH2A 1GOQA 3PZTA 5AYBA 2VZUA 3T0BA 4RL3A 2XSBA 3VD5A 1CZ1A 2WBKA 3CHEA 1NM9A 1X1NA 4PMZA 3VDHA 4OZOA 1GCYA 3MU7A 5CGTA 4D6FA 3M46A 3I3BA 1UR0A 1GZJA 1C3FA 3ZIZA 4YHGA 3WQ4A 4R27A 2PB1A 4LXFA 1LQ0A 3AIRA 1W3KA 3AJ7A 2VX6A 1JL8A 2X05A 5M03A 2ZX7A 3WD0A 4MB3A 1QPKA 5HOSA 2BNJA 2WKLA 4A4AA 1HKJA 3KWXA 5E09A 2HVMA 2DEPA 1VENA 2WSPA 4D6CA 3GXFA 1R7OA 4U2YA 4XUYA 3ARPA 1TZ7A 3APGA 4PMQA 4H8UA 3WMCA 1GOIA 5DT5A 2BVDA 2ZX5A 1BAGA 1JDCA 4WKFA 3B9DA 3EYPA 3RIKA 2AMGA 2FH6A 3W0KA 4XZWA 2CETA 5E9AA 4JFSA 5CZKA 1WDRA 3W81A 3AI0A 4B9ZA 4U5KA 1VBRA 1PEZA 4BF7A 3WFZA 1W91A 5A8QA 1OGSA 3KE0A 3WH5A 4Z2GA 4PBGA 2D24A 4IISA 1ISZA 1C8QA 1PIGA 3GDBA 4TVDA 3KEHA 1E72M 1E1EA 5FIPA 4HMCA 3ZOAA 3AIBA 1E56A 1C91A 3B8SA 1E6XM 5FL1A 3CUJA 5DFAA 4PYSA 1OD8A 3A4WA 1X6LA 3PZNA 4UQDA 4UFIA 1HJVA 3F5LA 1DWGM 1UD5A 1I1WA 4CCEA 3DHUA 3WENA 1GPFA 2W66A 2C0HA 4P7QA 3T08A 4AIEA 1NOFA 1KXVA 1AQHA 2ZIDA 1C7SA 1GQKA 4M8UA 3FN9A 1GOKA 3VGHA 4E8CA 2PWFA 3MUZ1 3UEQA 1HIZA 2JE8A 1CGTA 4UQ9A 1XH1A 1OBAA 2WCGA 5BWFA 4WJXA 1H0IA 4F66A 2G3NA 4J3XA 3M07A 3ZO9A 3FNDA 3CHDA 4NZCA 3WUFA 5JUVA 3WEZA 1JZ5A 3UG3A 2CHOA 5D8ZA 2GJPA 3NJ3A 4OIFA 2A3EA 1CBGA 3WH8A 2UY3A 3QR3A 4J28A 1E1FA 1W3JA 3THDA 4D72A 5ABHA 2FHFA 4JFVA 3DC0A 4P8WA 2AOSA 3VD7A 4M1RA 2WVUA 3ZT7A 4BA0A 3PZVA 2MANA 3WEMA 1GOOA 1G1YA 5CXPA 4HZ8A 2ZUTA 5A6MA 3CH9A 1CGYA 4NRSA 2WC7A 2JALA 3VD3A 4JFUA 2GJRA 2QV4A 3ARZA 3ZSTA 3BGAA 5DO8A 4TTUA 1H2JA 2UY2A 5D9MA 1MW3A 4YN5A 1C90A 3WD2A 1HT6A 4MADA 1S46A 1JAKA 3OLEA 3RJYA 3ZJ8A 1KQYA 4LYQA 1JZ6A 1W1TA 3WUEA 4CKQA 2D22A 3QHNA 1M03A 1JNDA 5A1AA 3L4XA 2A3AA 1E3XA 1LWJA 1UQZA 3OBAA 4V27A 5I6SA 5IHRA 1IZJA 3AS0A 1VFMA 5CSYA 3GTNA 1K9EA 4KRUA 3AYSA 3PZ9A 1UKOA 2YL9A 2CPUA 1CXFA 1M53A 3W27A 1CIUA 3BAKA 2VJXA 3TP4A 4OOUA 3W6LA 1FA2A 4Z2LA 3NUKA 2D2OA 4J3WA 2DT3A 3D5HA 1QHOA 1XH2A 4ML4A 1ZS2A 3VGGA 5D4YA 3RMEA 1WE5A 2WANA 1GNXA 1XRVA 3UR8A 2X0YA 1HJSA 1PPIA 3VM5A 1IV8A 1V3HA 1CLXA 1CPUA 2V3DA 4AD5A 5A6BA 1K6AA 5IDIA 2OYMA 4AIOA 2PWGA 3GM8A 3IJ8A 1TVNA 1XSIA 4H8HA 1NWUA 5FL0A 3W24A 4BCEA 1Z32X 5AYIA 3UETA 3WY1A 2BVYA 6A3HA 1HKIA 2GK1A 2BFGA 1JYVA 4JL2A 1QNPA 2HISA 1BFNA 4PCTA 4Q22A 2D0HA 2Q8XA 3GH5A 1TCMA 4MDOA 1G0CA 4HZ7A 2VUYA 3NSMA 1V3KA 1CXHA 4GZJA 5JBDA 3WH6A 1H49A 4ATLA 2VT0A 1UWTA 2OWWA 3ARVA 5HPCA 3SIMA 4ACZB 3PZOA 2E9LA 1P6WA 2XVNA 3VM7A 3CBWA 2WZHA 1E71M 4JL1A 1UWQA 2BY3A 1AVAA 1D2KA 1HNYA 5M5DA 2WW5A 1QI3A 1GJUA 1XD1A 1GQIA 1RH9A 1HJXA 1W9BM 3OZOA 4W88A 3AS1A 3BCDA 5E0CA 1ODUA 1TFVA 6CGTA 4B16A 1KFWA 1E3ZA 1FHLA 4JCLA 4WSJA 3WN6A 1BG9A 3II1A 4QFUA 3VDCA 1HL9A 4BQ2A 1BGAA 3N11A 3AXIA 5I2UA 3OGVA 2WB5A 2TAAA 1PX8A 4PMUA 3CZJA 2WXDM 4W86A 1TVPA 1W1YA 3WQVA 4CU8A 2CIPA 1J12A 1XD0A 1CENA 3AHVA 4MB4A 2VOTA 3RO8A 1UH2A 7CGTA 1QW9A 1O6IA 3OLIA 3T2PA 4KWUA 4U3CA 2DSWA 5A2AA 2WPGA 3ARSA 1H4PA 4AEEA 1OWQA 1XH0A 1B3XA 3MV11 1EHAA 3ZJ6A 1NOUA 4PSRA 1RPKA 1CXLA 1MW0A 4U33A 1NWSA 1SMDA 2VZOA 5D9NA 3WF0A 4AY1A 4UFLA 1E6ZA 1GQJA 4UOZA 2VO5A 4J27A 2OYLA 4NI3A 1JD9A 1JYXA 3KZSA 2Y2WA 3N13A 1J0IA 3VU2A 3BMWA 5GNXA 3NSXA
chains in the Genus database with same CATH superfamily
2R9RA 4W93A 4Y6GA 4C90A 3IEBA 1BG4A 2ABBA 1MUCA 4PC8A 3N2OA 2PE4A 3PV0F 2A1YA 1OEDC 4O0KA 4DYEA 3W88A 5L9FA 2XSAA 4BS0A 4IX0A 1BVNP 5CEWA 5C7VA 3PB2A 4H7ZA 2X1IA 1QRQA 3WELA 2PDGA 2I9UA 1O5KA 2J66A 1XX1A 4CQ8A 3OLGA 3TC7A 4YL2A 2ZVRA 3SECA 2WSRA 2OT0A 2MBGA 1L6SA 2WHMA 4O2BE 2JKAA 3I65A 4J3SA 5BWAA 1GYNA 3WQEA 2OFJA 4PK4A 4NAEB 5DBTA 1FCVA 4CNTA 3VHLA 5JXQA 2J9YA 1FDZA 3O05A 1NELA 1N8IA 1A5MC 3W38A 3T42A 1GJWA 4C1NB 1NSJA 3AHYA 3EXTA 1E4NA 1PKMA 2FZ9A 5BMVE 3P61A 1J8VA 3OKQA 3BANA 4KMQA 1YRRA 3NGJA 4AWUA 3KBTA 1PZ2A 3X1DA 3AEBA 2PU1A 3A6OA 3ZVHB 3ABOA 1CYGA 3TTYA 4C6IA 4PBEA 3UU5A 5EMUA 2V69A 2Y8VA 2CW6A 5BRPA 3SUVA 1Q65A 3RQWA 1H7NA 2J78A 5MKGA 2D2JA 4O1CA 3DFYA 1KK7A 1W6TA 5AC7A 4IE7A 2I5IA 3A3XA 3TONA 3H53A 1R0MA 3CZLA 3A5VA 3LN3A 3WQDA 1OFBA 4FR6A 4G56A 1UUSA 2UXCT 3C2EA 1XIGA 4DV6T 2QCLA 4L9XA 4FIRA 4XISA 4I9JA 1JZ7A 5EMMA 3LMYA 4UOQA 1V9DA 3KM8A 3T8OA 3A4XA 4YTSA 1U5VA 2E9XA 4O8SA 4XSMA 3VTRA 2J7CA 4DZIA 3LSCA 1RJPA 3BQIA 3W15B 2IPFA 1GTHA 1Q4NX 4GFIA 5AKQA 4ZOAA 1XHGA 4ZI3D 1K9TA 2HN2A 2WSSV 3STFA 3HMJG 1YXCA 3NIYA 4XTDA 3QKZA 4MF4A 1XR2A 3E2SA 3ZJ2A 2R1LA 4PCPA 4X63A 4CZZB 3SS1A 5AQPB 1JZ2A 2O7QA 2YL8A 3AVRA 2V82A 2YB4A 2B81A 2PBOA 1VRDA 4ZOCA 2XASB 5JVDE 1K8YA 1SVDA 3ECQA 2ZMAA 1ZP4A 4FLRA 3E0VA 1MEHA 1UBPC 1SZNA 2HE8A 5E5CA 1FQ0A 1ZJAA 3W7QA 2D0UA 5A94A 4V1Av 3TLQA 3V1PA 2OSWA 3MHUA 2BY2A 1P1MA 2K48A 2VC7A 2OQLA 4GXWA 3S2JA 4DWSB 2YZRA 1A5LC 4D6IA 1DV7A 1ME7A 2C5KT 3WQ5A 2YINA 4US6A 4IDPA 4JI8T 2GDVA 1WAUA 1PE1A 3NZRA 4IIJE 3Q5WA 4HB7A 2A6NA 4JIEA 3S83A 5HXCA 4JTKA 1DP0A 3FDKA 1M9HA 3MYPA 2OYKA 2YEVC 1UX4A 4AMAA 2DI4A 2Z7GA 4F0MA 4A05A 2VZTA 1UD2A 3TE9A 3H7VA 2LSGA 1Q6RA 1UASA 1J0JA 3ARUA 4J2MA 5K2ZA 1RP8A 1EJSC 1HVQA 2W27A 4NJKA 3NXFA 2O4MA 3QYSA 3NVOA 5TD4A 1VFOA 3JZEA 5I7GA 3C2VA 2OA5A 2OU4A 2QIWA 4EXAA 3LJCA 4R3UA 1JUKA 2MAWA 3ZCIA 3O0FA 3H4WA 3AXJB 3WF3A 4CEXC 2ASHA 3WLJA 2DUZA 2HN1A 3FJ4A 2ZX8A 2QV5A 1M7OA 2BS4A 2OJPA 2V5DA 4MB5A 3LQLA 1QI2A 3N2KE 1PTGA 5LOVE 5LSMA 4JI7T 3U2CA 1NOWA 3GKAA 1EPVA 2NP9A 4YLWA 3P6LA 1FIOA 4DLFA 2OGJA 4TX8A 1ENUA 1YEYA 3QN3A 4XZCA 4PUMA 4TO8A 1ONEA 2PGEA 2XVGA 3UJEA 2YB1A 3H24A 4HFVA 1O60A 1QI5A 4S39A 3OGSA 1J2WA 4IL9A 4GUJA 1DJXA 3S5OA 2GWNA 3LK2B 3A4JA 1V3MA 1EB3A 2CEAA 1TV5A 1VCTA 4ATDA 2PDLA 3KTCA 4RE2A 2Y5JA 3H2CA 3P4SA 3IIPA 4FXSA 3IEEA 4O14A 2CWOA 4C6QA 3VC6A 4MSSA 4PTVA 3SJ3A 1FKWA 4CQAA 3RIUC 1J79A 3SZ8A 3HURA 1G01A 3MCOA 4BFAA 5J1GA 1M7XA 1SYTA 4DJEA 3QW3A 4PMVA 4JTRA 4FK9A 4U7YA 3ZZ1A 1J0YA 5FJOA 4F2TA 5A2BA 2ZZ1A 1XRSA 5H6RB 5L47A 4HPNA 4LBUA 5A6LA 3DFHA 3ZMUB 1BYDA 4U4MA 3OPCA 3WL1A 1W5OA 2AKZA 4YXDA 4HKPA 3EDUA 3NNTA 3E2VA 2V38A 5BNKA 2E77A 4Z0JA 3O1JA 1RY0A 4PJMA 2UXNB 1M7JA 5T8GA 3K4WA 2XQ8A 4Y8EA 4XTIA 1JGMA 2ZUMA 3NL5A 1S38A 4FHAA 4RXGA 2D0GA 1OFEA 3GNOA 3WF2A 1QNOA 5K7JA 4K37A 3AIUA 4E8GA 5JH1A 1I9CB 2VGFA 1J6PA 2VQTA 3KL0A 4KWOA 4HFEA 1A0EA 3W2UA 5DN1A 4GGBA 1TMQA 4LUSA 1ITCA 1AUSL 3D0CA 3L4UA 1N2VA 2DDXA 3F5JA 3V5FA 3EA1A 3CYVA 4X5TA 1NFGA 4HFIA 4YHEA 2WAUA 1Q6CA 5KETA 4GMEA 3BLIA 4ONVA 1R7AA 3TC6A 1TJ1A 1CXKA 3RC3A 5TAOA 3SOLA 4KRZA 3VIGA 2XGIA 2C5JA 3O3RA 5LP6E 2HBXA 3NGFA 4NNCA 3EWUA 2M67A 3TLTA 1LRQA 3WLRA 3ABVA 2PPGA 2ZLYA 3LBXA 4GJJA 4HN8A 3E0WA 4TV6A 3P0WA 1S2WA 2VENA 2YN6A 5FACA 1V0NA 1LRNA 1BQGA 2WMIB 4HSHA 1NVMA 4M6UA 1ITUA 1V02E 1VJSA 3IUHA 2PG8A 4UV9B 4I0UA 4JI5T 2WMNA 4M19A 4W9TA 4DHGA 2VX5A 3FB2A 1V5XA 4LC8A 4NPPA 5CPQA 2PWEA 3AEDA 4RX0A 5F2GA 1ZOYA 4B3MT 1O66A 1UKPA 3HG2A 3PR2A 3FXGA 2Y8DA 5GVJA 1OCJA 1S1PA 3ARYA 1O1HA 3NWRA 4ZTYA 3WO8A 3W1LA 4AU0A 2DSUA 4O18A 1GG0A 3STGA 3PBWA 4PK5A 3KRBA 4GX9A 4LB4A 3BTNA 1FCQA 2DZUA 4LYRA 3VIOA 1H7RA 2NW7A 3CWNA 4W7WA 3BXWA 5CZ0A 1V0MA 3M3ZB 3VKGA 3T40A 1X1ZA 1EL3A 4GQQA 4FR1A 1J4EA 2AE9A 3GA8A 1VJIA 3KL3A 1FCBA 4KIEA 2EPKX 1GVEA 2QCHA 1QUMA 2DZAA 4OKDA 2XM2A 2GQAA 2F61A 3O4XE 1O5RA 1UQYA 4MMWA 4DM1A 2QUUA 3VZYA 2CXGA 1RHCA 3FZFB 4UUIA 4FNTA 1ZUAX 4P8VA 4ZS2A 3AYRA 1DWFM 3RLGA 4Q8WA 3ZYKA 1JDDA 1F3XA 2FB2A 2EJAA 1J6OA 3PSVA 1UIPA 4WHBA 5FCZA 3EPOA 3TMQA 2DZXA 5C3JA 1PDYA 2CLOA 1LBMA 3EDJA 5JIPA 3OO2A 1UWSA 3CL7A 1HTIA 2RHGA 1PIIA 5AQUB 1KM0A 2LOSA 1Q66A 4GUFA 4WIWA 4GHRA 4LEQA 3L2LA 1RVKA 2V8ZA 5IFTA 5HK4A 2FHBA 2OTDA 2BOEX 5CA0E 7ENLA 2E9MA 2LEHA 2PF0A 3CO8A 4Y9MA 1BXNA 1V02A 5D2XA 2ZDSA 3VIMA 4AWSA 4TZ4C 1GEHA 2YLLA 1OG0A 4DJEC 4E8DA 4W85A 4OX9T 2CE7A 2WWCA 5FD0A 4K1WA 4NYUA 2NQZA 3I0QA 2EHOA 5FVLA 1G4TA 3TWAA 3WBEA 4UXNB 4BI6A 3EMQA 5LHEA 1XW8A 3PSWA 4IICA 2GJLA 4DEFA 2WDQA 1G5AA 2O92A 1QXLA 1DE5A 3G24A 1QWGA 1FH7A 3WBWA 3BLLA 5HQMA 3HKBE 5AYXA 3DFTA 4YTPA 1SZEA 2XUCA 2PCQA 5FF7A 1UUMA 4QJ4B 3VKCA 1KGUA 4E2OA 3HPFA 4WNKA 3WG6A 1VHCA 2RFGA 4O1DA 3ENLA 4CN6A 4S3GA 4JTFA 3CMJA 1LP6A 4GKTA 2WM9A 4H63H 3HBLA 5CCZA 2WNWA 4Q4RA 2NXGA 3SR7A 1W2PA 4EWJA 5C54A 1US0A 1UWUA 4LOCA 4H9MA 3N25A 2KXPB 4LMJA 3L5LA 3VDBA 1I75A 1TWDA 3TMLA 3V75A 1I2NA 4RDVA 3IS4A 1PKLA 1X98A 3U0HA 5C6MA 3VGFA 4O12A 1P48A 3NQ8A 2ZOXA 2RH9A 1EDTA 4GH3A 4MKVA 3KLLA 4K3ZA 1WDWA 5HR6A 2I17A 3I3EA 3PFRA 3R84B 4AIBA 1A0CA 4ZE4A 3FX4A 1YQ2A 1Q45A 1XIDA 1KM3A 1DHKA 4L1WA 4N78D 3GN5A 3LDVA 3P80A 2QHAA 4QXHB 1T99A 3IACA 1X96A 3CZ8A 2YW3A 1DJQA 2C18A 1MMAA 4F9JA 4HU4A 4GQRA 4QGCA 2E0PA 2PWHA 2XIBA 4IQLA 1Z8UA 5G1MA 2NUYA 3LZ3A 2XN2A 3OLDA 3J9X1 1DVJA 3AEFA 3ONLC 4HU3A 2UWFA 4DUXA 1YNYA 3DDMA 4PUJA 3MCNA 4YVPA 5EFDA 4XAYA 3GTHA 1S2CA 8XIMA 3VIHA 4WBNE 1FWDC 1JD7A 2Y8KA 2GPTA 3Q94A 3ZPOA 3E0FA 1HNXT 4HPGA 1VYPX 3K8LA 1YXRA 4YT0A 3DI1A 3E12A 3C0SA 1NF0A 1T72A 5DRIA 4ALDA 3AMLA 1VJZA 2DNXA 4JTAA 3I7RA 3GDMA 4PRWA 4NQ1A 4O2AE 3MHFA 2HK0A 4IFOA 2OELA 1ZAJA 1BWLA 4UFKA 2FDSA 3GBDA 2Z0IA 4JI0T 4S3JA 3LRKA 5TIMA 4Q4MA 4ILSA 3UWVA 3W84A 3MMUA 4OJYA 1AL8A 4MWAA 3FHNA 1LKXA 4L6DA 1W5QA 1XIHA 3TQKA 5KITA 2JIEA 4O19A 1S3TC 1KR1A 1X9BA 1LUCB 2Z25A 4LRSA 1QBBA 4FS9A 2Z29A 1XDOA 1C8YA 1C93A 3EA2A 4HT3A 4UOJA 3VKKA 9XIMA 2NV9A 2INZA 2WJZA 3DBNA 3LCLA 1W1PA 4GA8A 4AKGA 3ANYA 3ZC0A 1CX9A 1WFDA 1HCIA 1QK0A 1MYRA 4L0RA 2EF9A 2IW0A 5HWNA 2GFTA 4RDYA 1AQFA 3AC0A 3W1QA 4Y8FA 4IJRA 5AZ0A 1XI3A 3VNZA 1XLKA 3W00A 1LF1A 3MQTA 1FWIC 4RXFA 4M6PA 4ZOLE 4HWCA 1ZSXA 3UGRA 4L65A 2Z00A 1FOBA 4Y96A 3USZA 4E7SA 4QS6A 2E1DA 5D30A 4X61A 3CX6B 3L68A 1TWWA 4AZBA 3G3MA 2EHOC 1B57A 2HZGA 2X2YA 3BGGA 4J7RA 4NY2A 3GAYA 5LHHB 4E3VA 2YK0A 4DO5A 1RA5A 2Y5EA 3W1MA 3BSGA 4O1EA 3H7RA 4QE4A 4H2CA 4JV5T 4JYDA 4UFMA 2INFA 1LT8A 3D3AA 2XUEA 3EX2A 4NZFA 4MGGA 4REQA 3FKRA 2EPNA 3ARXA 1UP2A 2DZPA 1EBHA 1VS1A 1MI3A 3AAIA 4AMCA 1BGGA 3C0LA 4OFZA 4TUYE 4DJED 4GZEA 2NQHA 2CHRA 5LBMA 3ZYLA 1A5BA 5J8LA 4GY7A 4UQAA 4MFDA 1WDQA 3E9AA 1KBLA 3NAVA 5JMUA 4AVOA 1EWEA 2E8YA 3MA8A 1LL7A 4FX8A 4IMFA 4DI9A 2AMXA 2B7QA 3UXLA 1QASA 3AMCA 4JTHA 3VOFA 3W6MA 4YJ2E 3E1F1 1X39A 4OBTA 2J7BA 1W9UA 4NUVA 2GGJA 3G0SA 4C6JA 3Q4DA 1I1XA 2QZRA 5HYAA 4QJ3B 1B2YA 1OQFA 4RE3A 2WQDA 2XFFA 3BGJA 2WLZA 3N4FA 1RLCL 2E5BA 4H6KA 2ESCA 3B8VA 5HAOA 4Q7NA 2QCFA 3GXNA 1AMYA 4MLKA 5C71A 2QMJA 4P2VA 1LL4A 3E2RA 3N6QA 2QQ6A 2WMJA 3N18A 4OYKA 4LEFA 2GGEA 2A21A 3L4WA 2JEPA 4C6KA 5JRCB 1XLDA 4DNMA 5MF5A 2I5QA 2ACZA 1OINA 1EX1A 4GZIA 1TQJA 4MZ1A 3FFSA 2DVTA 2RAGA 3OHMB 4GVIA 1H41A 2SFPA 3CGTA 2IIUA 5DQWA 4XG1A 1IZCA 4EE9A 2E5DA 4D6JA 3RM4A 3PPHA 4PZVA 1XZYA 3R0DA 3JADA 3KWSA 4KFNA 1EOMA 3UR5A 2Y6XA 3KVLA 2D23A 5ENLA 2Q8ZA 4KUMB 2GDQA 2ZXBA 4PMOA 3N9MA 4K2SA 1T41A 5F2MA 1A5UA 1MVYA 3ZWSA 3SFEA 2EKGA 3N14A 4LV9A 2X67A 1WKEA 3WEOA 2FPVA 2DIJA 4TTGA 3TAOA 1D0ZA 2J8FA 3BLPX 3MUY1 3ABRA 4MWAC 1BRLB 1HP4A 1W3LA 4H41A 1Q2SA 3RG6A 4W5ZA 3WMBA 1HKKA 3ARTA 4FMVA 1ME8A 1JFHA 3B8TA 5LNVA 4Z1DA 4O11A 1MWOA 1XF0A 3LTSA 4U5IA 5LYJE 4WQ6A 2VKOA 1LWHA 1NQ6A 3F2EA 1UK5A 3VNJA 3UFGA 5AQFB 2DCFA 3VIIA 1E1HB 4PMYA 3BQKA 4M5PA 4RLIA 5GPRA 4Q8QA 3ZFHA 3WMSA 4Q8MA 3FZMB 1PAMA 2VCCA 3CUGA 2I1OA 2CLHA 3UZXA 2BVLA 1WNOA 2Y4SA 1IHIA 1RJQA 3LHVA 2FDMA 3N17A 1XYFA 1OG6A 3VKBA 4TWFA 2CXLA 4IHJE 1EGMA 3LGEA 3WH7A 1UPMB 2DZWA 2QMKA 4AZIA 3AISA 3VI2A 2NTYA 3BO9A 1WX0A 3WSUA 3RYIE 3CLWA 3LRMA 1SE7A 1A80A 2WJDA 2IKIA 2QJGA 5D03A 3RPUA 4X1KE 1EUAA 2NXIA 4TNWA 4H83A 4PTNA 4TXEA 3JAFA 3ETVA 1H51A 1GEQA 2LM2A 1R3WA 4FX6M 5D38A 3SCOA 3A4AA 3H22A 2CWYA 3OPSA 1FCUA 3K1SA 1KXTA 4YSZA 4IG2B 1D3GA 3GG8A 1DWJM 2WSKA 1VQTA 5BCAA 1KNRA 8RUCA 5DLCA 1ELSA 6XIAA 2EEXA 1HX8A 3M0ZA 1EJRC 2GJXA 1EO7A 2QF8A 4CD8A 5EYWA 2EPHA 3PTDA 1R87A 4WCJA 4NP7A 3SCRA 2EJ1A 3R0UA 1UR3M 3KOZA 1KCLA 4XBSA 4HPHA 3PZIA 5E0OA 4FLQA 2DSVA 2G5WA 2Q6ZA 4MTVA 3W7JA 4Q4OA 5G2IA 2YXGA 2UUBT 4XV0A 1D0XA 3M0VA 5AC5A 4LT9A 4PGLA 1US3A 1Q8JA 3T0DA 1RR2A 3GMIA 4DUYT 1Y7VA 1UIOA 2PA6A 1KGXA 2E8IA 1C92A 3H23A 3VYLA 1XJBA 1OGBA 4B3KA 4D8ZA 3I7QA 2OO0A 3B9NA 2C6QA 1FDYA 1Z69A 3HKEE 4JTDA 2GUBA 1HG5A 3CK5A 5EK4A 1PL9A 3B9OA 3PG8A 1V08A 4AZ5A 1L6YA 1N34T 4MALA 1I60A 1ZAHA 3CZEA 1LORA 3OZYA 4LMKA 5A3HA 4PUNA 5DCDA 3VA8A 1MUMA 3B3DA 3R7MA 2DY3A 3F4CA 3CWOX 1B90A 2BY0A 4XKMA 4RZ4A 3SUUA 2BVMA 3C6CA 5DBUA 4I6KA 4AISA 1E1CB 1XCWA 1UZDA 3BQ6A 4JX4A 5AQQB 1XIEA 2OWXA 2J47A 3S6TA 3VDAA 1CLKA 3PULA 4KF1A 3E0ZA 1CNVA 3BAWA 2ZYFA 2NUXA 2YOEA 4LUYA 5FMNA 3RDKA 2VFGA 4NX5A 5IM51 5HXEA 1H7OA 4QCEA 4H6RA 3ITLA 5CH9A 4GE8A 4P61A 4PFMA 1UWRA 4D1JA 4CN4A 1GGOA 1TVLA 2JF7A 4J3VA 3POHA 4YLHA 2WZIA 4GACA 1NDVA 5CKSA 1S39A 3MSRA 1SR0A 4IIGA 4KH2A 4OHQA 1MXDA 4W7UA 3N29A 2H9AA 1JF6A 3A22A 3MHGA 4BZYA 4HYVA 3ZLIA 3ZMZB 3QFEA 1IZNB 2ZM8A 1KXHA 1F4HA 3A21A 3OJAA 3RGTA 4F9DA 2D69A 2CKSA 3LDQB 1Z41A 1LROA 4DBRA 1QK2A 2CZEA 4KPLA 2JQXA 3QSTA 4IP4A 1VFLA 1GZGA 3HGJA 3IF8B 4X66T 3L09A 3SGUA 3MXZA 4Y9NA 4BI5A 2CLYC 4IT1A 2CLPA 4UCFA 4FB7A 3WFLA 4DAIA 2Y8UA 1EA9C 3SAZA 1TX0A 5HCJA 3GHTA 4MWAD 1EEPA 2X8RA 3S3GA 2DH2A 3AE1A 2A7NA 1M62A 1UGOA 1YX1A 3P7IA 2WNQA 3S42A 1C9DA 4AHOA 1NM9A 1QR7A 3QPZA 2ZZ7A 3UXDA 3IV3A 4G7EB 4LJ3A 1GCYA 5GJPA 5CGTA 5G2WA 1KV8A 1IEXA 4HYRA 5FNVE 1C3FA 2F38A 3FKKA 5DY3A 5LIXX 4KCVA 3SN4A 5C5YA 3DESA 4DMVA 1R3YA 4MFRA 3HG4A 1W3KA 3KBJA 1JL8A 5DMMA 1JR1A 2G95A 4IP5A 5D04C 4MB3A 1MNSA 2BWGA 3S1VA 1QPKA 3EXSA 2OQYA 2BNJA 1V8EA 4BWLA 2WKLA 3E6EA 4X20E 3GIQA 2AGKA 3CV2A 2WSQA 1HX1B 5XINA 1MNDA 3GXFA 1AL7A 1YDYA 3C98B 4JN6A 3ARPA 4XKYA 4M7TA 5H8PA 1BAGA 1TCDA 2AGTA 4NL1A 3EWZA 3UW6A 4XZWA 2CETA 3IHRA 4FSAA 5CZKA 4A6GA 5TF0A 3MACA 4H6EA 1KRCC 4BF7A 4Q8VA 3RH3A 3WFZA 4DV1T 1OGSA 2X40A 4H2HA 3BOLA 4PB3A 4Z2GA 3M0YA 4CQCA 1TREA 4ES4A 1WBJA 5FIPA 4HMCA 2BG9B 1XRTA 9XIAA 1C91A 2VP8A 5IWAT 1E6XM 4MPQA 3KVAA 4PYSA 3T44A 3RR4A 3C2YA 2PDCA 3A4WA 5C9WA 5BMXA 2MYSA 4UFIA 4XAGA 1HJVA 4AKLA 3RRWA 4PMJA 1UD5A 3UT0A 1I1WA 3T6CA 1GPFA 4WW0A 4MKNA 2W66A 3OBEA 2FVMA 2IW5B 3LM3A 4IOTA 1AH4A 1AQHA 2ZIDA 3QB5A 2R91A 4Z90A 1GOKA 2QJIA 1IR1A 3FBZA 1HIZA 4UQ9A 2DW6A 1GTEA 3UWWA 5BWFA 4WJXA 1KC7A 2E7FA 3RPDA 1R8IA 2OEJA 2CXFA 3ZO9A 3CHDA 3WUFA 4DBSA 3WEZA 4WVXA 3GHUA 3U4FA 5D8ZA 2A3EA 1CBGA 3WH8A 3STEA 3IVTA 2YXXA 4DNDA 1E1FA 2V8SV 3THDA 2FHFA 3DENA 3BQLA 2JQHA 3KINB 3HA4A 4JFVA 1HG3A 3UQNA 4P8WA 3GU1A 5AB3A 1VZWA 3PUOA 2WVUA 4AQYT 2XIQA 4JX5A 4JIHA 4JD4A 3S0CA 3PC0A 3HL6A 1CGYA 4ISTA 3HG3A 3VD3A 5LIYX 2ZRWA 2CZDA 1FMWA 4I8DA 4N4PA 1FWRA 1H2JA 4JBRA 3VABA 1MW3A 3UVAA 1HT6A 4JI2T 3OLEA 1R2TA 5C0QA 4JTCA 2BDEA 3WUEA 5CFBA 4MOZA 4IFKA 4J2CA 1ZGDA 3IJLA 2H8ZA 4IJBA 3CIWA 2VKHA 2PLCA 1TWIA 2QUTA 3DEQA 2QGSA 1VFMA 3N9NA 2A7PA 4XBKA 4ZO7A 1NWMX 3N4AA 2C1IA 1ZQ5A 3KBMA 1BXCA 1UURA 1M53A 4LNCA 4N9BA 2POTA 3WK2A 3W27A 3S46A 4O50A 3W6LA 1RVGA 4Z2LA 2ZKMX 5CBJA 3HGSA 1O94A 3UF9A 1LLZA 4ADZA 2VHLA 3I6EA 2AL2B 3UA3A 1WE5A 3B4UA 1GNXA 1XRVA 3UJRA 1K02A 2X0YA 4KHZF 3PU3A 3W7NA 1P0NA 2EAWA 3MO7A 5EPDA 5KZDA 2R8WA 1LOQA 2V3DA 2Y89A 4WY0A 5KXJA 4UTJA 1K6AA 3FDGA 3I10A 2K24A 5F4XA 4AIOA 1JQXA 2PWGA 2PJQA 3BL3A 1Z32X 4I9MA 3S4TA 5AYIA 2QR6A 3VR8A 1F07A 2BVYA 3USBA 2OZ8A 3APTA 4JQAA 4GNKB 3C3UA 2BFGA 4BWLC 2BGQA 1QNPA 2O55A 3KOYA 1PSCA 3W72A 4D8AA 1GOXA 3PWIA 3W2KA 1YNPA 2IS7A 3EX6A 4JEQA 3VFCA 4DO7A 3INPA 4HZ7A 1CXHA 2XH2A 5JBDA 2JPFA 2A7RA 4LWWA 4ATLA 5IHYA 3K30A 2ANUA 4QAIA 3ARVA 2V7KA 3M41A 2E9LA 3APYA 4S3BA 2QJJA 5D2WA 2WZHA 1FWWA 4NKCA 1XYAA 4JL1A 2R14A 5H1WA 1UWQA 3EB3A 3C0QA 2QDGA 1D2KA 4O1FA 3IUIA 1A5SA 1VH7A 1QI3A 1GJUA 1T6MA 5E0KA 4LTSA 1RH9A 3H54A 1HJXA 1FWJC 3S2MA 1Y0EA 3BCDA 4EPBC 3QF0A 2V6YA 4CI2B 1KFWA 1LTDA 8XIAA 3L39A 3SGZA 3GWHA 5LIUX 1PYFA 1BG9A 3FA3A 4HGXA 2A5HA 4LC6A 3N73A 1TYGA 2JQKA 1SW7A 3LG7A 3OGVA 1J5TA 2TYSA 2TAAA 4BR1A 3OIXA 2ZDRA 1R3QA 4H9VA 4LVDA 4PMUA 2XIJA 3VE9A 4L56A 4HTBA 1DIEA 3TCSA 4AYGA 4E0CA 3P3BA 3ZN0B 1UB3A 3VFLA 2VOTA 4ZMGA 4J1OA 2Y1HA 2E5LT 3HQPA 2H3BA 3W7OA 2PAJA 1P1XA 3ORWA 5CC7A 2HNHA 3BW4A 3LHYA 4KHPT 2WDVA 3MV11 3ATYA 2F6XA 5AC6A 2JK2A 2LLYA 3M5YA 1SMDA 4Q3MA 1N8FA 1E6ZA 5AZ1A 4UOZA 1RQBA 2J27A 2Z27A 3N3MA 4YTUA 2MOZA 1JYXA 3UG8A 3N13A 1HUVA 1J0IA 3RF9A 1XPYA 3NOEA 3S2CA 3UG4A 2UUAT 3PP7A 3W4RA 1QATA 3WF1A 3L4ZA 2OLAA 4RNIA 4X64T 3IJQA 1ECQA 1BVZA 3PJWA 4X9YA 2DGAA 4WGXA 3PJAA 1S5WA 2WOQA 4CQ9A 5LGXA 4HK7A 4L1XA 4K0UA 4QP0A 5FEXA 3WK3A 1ADOA 2V7LA 3GXIA 4HTEA 4DV4T 1W54A 4RUBA 4NIQA 4HFBA 3RCMA 2DIKA 5BR8T 5HDRA 4DO6A 1SZRA 4TX5A 1JDAA 2XGZA 5D9OA 4BJMA 1OD0A 5CLWA 3C52A 3E49A 4B5NA 1DIDA 3QFWA 1HG2A 1TELA 4ZZBA 3MJXA 4KERA 3FYOA 3AEAA 5F2IA 2FB3A 5EMYA 1QBAA 4PRTA 1OM0A 3PTQA 2P88A 3AOFA 4Z1BA 1L6GA 3CLMA 1TJPA 1GOMA 5C70A 2R6OA 4WDXA 4ZODA 5EBUA 3AE2A 3VNYA 5F3JA 4KGLA 4GY0A 4P7NA 1EC8A 3ITGA 5FF2A 3CASA 4W8AA 1BPLB 1TSIA 4GG9A 3JVAA 2F2KA 1AZ1A 4S3DA 3ZSSA 3SIZA 2YU1A 3P4PA 4AQLA 4IH3A 3CQXC 3GHSA 4ZQPA 3O6DA 5EZYE 4ILAA 3RNDA 2X9HA 4UB9A 2GL5A 1JNZA 2P1FA 1XIBA 2V3FA 3NQMA 3CHCA 7REQB 3QRHA 4JTQA 4L9YA 4PUKA 1MXGA 2HHHT 3NO3A 1S2TA 3EOUA 1M68A 4F2UA 2X51A 2HS8A 5I3DA 4QJ1A 4HOWA 2E5VA 3N15A 3PBGA 2HVNA 4I55E 3MP5A 1W9XA 3NA8A 4Q7BA 1EJ7L 1RBLA 4Q4KA 2HQAA 2EO7A 5HJXA 2C1HA 5BXSA 5I5RA 1E40A 2XHEB 3P74A 4YSXA 5CGQA 3P5ZA 4OFCA 1A3XA 2ABAA 3MB9A 5DABA 2JMHA 4NU7A 4Y90A 3S5ZA 4XIMA 2IXUA 4XWUA 2FJBA 2QA7A 1MQQA 2BHYA 3HMCA 3SCNA 1THFD 1XUZA 2VC9A 2X9WA 2DPEA 2PDQA 2EG8A 5IOBA 2D3LA 1YTDA 3ANVA 5LA0A 2PWVA 3RX2A 3G2GA 3QGVA 2GJNA 1PCWA 4FNPA 3EDEA 5G5IA 3RRXA 2O9PA 1R46A 1TRIA 4C7DA 1BTCA 2MUCA 2VELA 3W7MA 3BH4A 1NJJA 5EB8A 5LXXA 4F0SA 2LSJA 1RSCA 1XKJA 1JFXA 4Q8UA 2DVUA 1HW6A 1E0WA 2NX3A 5LB7B 4YU1A 3NYDA 4HKAA 2GGGA 2UY5A 3KDOA 4OK0A 5C55A 4PCSA 1PHQA 1EF2A 2NUWA 4KRTA 2G3MA 1ZJIA 4DJDD 4CGTA 3VNLA 1WKDA 1YLVA 1OIFA 5AVHA 2CCQA 1TPUA 1VPXA 4S3CA 4UZSA 1QOXA 1SO4A 1ZP3A 3IAQA 3NURA 2O9OA 4WOZA 4L4LA 2DIEA 1JPKA 3TR2A 4MAVA 3R79A 1UBSA 3VUSA 4CU6A 3IIZA 2P5NA 4JTSA 1OFOA 3VKAA 1MO0A 2KLQA 4EAMA 3N2TA 5EGRA 3IIOA 5CPOA 1AK5A 4GYRA 2IQTA 1XP3A 3I6RA 1TIWA 3VAVA 3OQEA 2D3NA 4H8VA 5KDMC 3IAPA 3GTXA 4EAHA 4WX2A 4QQ3A 4EIVA 5K3VA 4DR1T 1QVBA 3MP4A 5HMDA 1UYQA 3MSDA 3H2NA 1GVIA 1WCRA 5I79A 1K8ZA 4WKHA 5FEWA 3KCLA 1XRFA 3BK9A 1A5CA 5H6QB 3ID7A 2W6RA 3PPCA 2IKGA 2V63A 1VFTA 4LVBA 4MJMA 2ISDA 2YYTA 3PTMA 1YKHB 5AQLB 1KCKA 4PMDA 4EPKA 3TN5A 1N32T 1C8XA 1WKYA 3P62A 5FJTA 4IE0A 3EVYA 2PTXA 1BWVA 2PDKA 4A8IA 3ABQA 1SQ7A 3KBSA 1NWTA 2PWDA 4FNRA 3HPSA 1REQA 2V26A 1IEWA 2W62A 3W85A 5U7SA 2OWCA 5EU9A 1QFEA 3RJXA 1Q85A 3TJLA 1XL9A 4TWHA 4PMNA 3FHAA 5HQEA 3AVSA 3PBUA 3LBMA 5FSEC 4MJZA 4UTIA 2DUAA 3I7SA 2D2SA 2CITA 1SFTA 1XLHA 1IWAA 3CB8A 3W25A 3IK4A 1XBZA 2Z6EA 3AE9A 4TVCA 4F79A 5J2UE 3UJ2A 3EAUA 1JYWA 2RGMA 5FAGA 3AICA 3JR2A 4AWEA 5J04A 3AE7A 3U7BA 1XNRT 1WZKA 1R8LA 4MJ2A 2ZC8A 4M1PA 2OLTA 3GNRA 1KF6A 3F2BA 3SWHA 3MZNA 1QI4A 3H26A 5J0ZA 1AW1A 4OBSA 5G2HA 5E93A 2L9QA 3M0IA 2XVPA 1FBAA 1TPB1 1UR9A 2FIQA 3LZ5A 3ANUA 4O57A 1W32A 4ROQA 1EFZA 1WA3A 1DXIA 3HTWA 2GOUA 5CA1E 2QW5A 2YCIX 1XC6A 3S2LA 4P8XA 2VFFA 3WDIA 2AQOA 3SFKA 3EB2A 4PBFA 2ON3A 3ZJ7A 4XAPA 4MB1A 1YE6A 5JR9C 4KFPA 5LHIB 4XB3A 2X1UA 3UCQA 1LQ2A 3QQ0A 3FY1A 4GI8A 4IM4A 1C7TA 3PWGA 4BAYB 1X8FA 2EKCA 3FVDA 1B9BA 4IUOA 2ZUSA 4AC1X 1A3WA 2YCLA 4UR8A 3PJUA 1Q7ZA 1SZGA 1LCOA 3GSMA 2I57A 1XBXA 4JFTA 3RM9A 1LVKA 2ZUNA 1RJRA 1CGUA 4GX8A 1J9YA 4FI5A 1KKOA 4LB3A 3QBUA 2XPKA 1EXPA 5LXTE 2DZVA 4A3QA 2X9YA 4OGZA 1X7IA 4OQVA 5FAJA 3HN3A 4GIAA 2M6IA 2VNCA 4F4RA 3MDWA 4H9ZA 2GYIA 1QWKA 2GLKA 4HA1A 1W5PA 3W07A 1G9HA 1EQPA 3E0IA 5FI8A 1WKFA 1UZ4A 3PN8A 4ZBCA 3I3DA 2TRSA 1XCXA 4PUEA 1D9EA 5GJNA 2F9RA 1DU2A 1ICSA 4XQ6A 5KZEA 4HMNA 4JYAT 3WK0A 4LCSA 2J8TA 2P0IA 2NR4A 2WMGA 1T40A 3IJ7A 1QSDA 2M6BA 4IL4A 1J96A 3LQGA 4UVCB 3DP7A 1E9YB 2VEMA 2CXEA 3TDFA 4NNAA 4HOZA 3CUIA 3BG3A 4CCDA 1XS2A 3UNTA 2NT0A 5BRQA 1CLVA 3WFAA 4JCMA 2IC9A 3URNA 4O54A 5LGNB 3WQGA 2GVLA 4CNNA 4TX6A 4Z08A 1YTEA 3QHMA 4XUGA 4WR3A 3MW7A 3L9CA 1POKA 1E5NA 3Q9DA 3WH9A 2EPMX 2L8KA 3EDFA 3TTEA 2C8NA 1FWCC 2NQ5A 4C6EA 3RU6A 3TIMA 3WI3A 5HCMA 2XQ4A 1Q2RA 4DZHA 2DQWA 2ZRYA 4L61A 3T2QA 4AZCA 1W1VA 3MKVA 2VASA 3EABA 1ICQA 3MWCA 3OGRA 4C6DA 4L5ZA 2KZHA 3P4WA 1SJAA 2CLIA 3BW2A 2C3ZA 3KP0A 2G3FA 1XYCA 3LXBA 2B76A 1W3HA 1KCZA 2VVSA 3W01A 3CB3A 2GQ9A 1VPYA 2VX7A 3G1YA 4ASKA 1YDOA 4H9RC 4O0ZA 3P8JA 1S5TA 4GQ0A 3IBPA 4HCDA 3DOPA 1ZV4X 3EX1A 4LUTB 1QHZA 1NWRA 2PURA 1T7LA 4I9AA 4O4HE 4IIDA 4EK7A 3GS6A 3W2NA 3BVJA 2BS9A 4JNYA 3GY1A 1Q4WA 2VDIA 4AI6A 1QHPA 3CV1A 1W8GA 2WC3A 1A5KC 4ASTA 1V6UA 1IBKT 5D2YA 3C4UA 1WYIA 1O68A 4JYFA 3NZ1A 4TUFA 1MQPA 2FTYA 1VGAA 3ZQ9A 1QNQA 3ZXWA 1V03A 4C65A 1H61A 5T26A 1O12A 4W8LA 3AMKA 1JAEA 4M56A 5BXPA 4U28A 3MZKB 2HBVA 1HQTA 3LA4A 1FWAC 3MMTA 4XIAA 1ISYA 1TMLA 3WL0A 4NG3A 1H63A 4GKLA 4ZL1A 3IUDA 4MZ8A 4HSNA 4EF8A 5CJMA 3B0XA 1SSGA 2QCNA 2QGHA 1ZEEA 2ZZ5A 1FRBA 3AZTA 4PFOA 3NEVA 3AA6B 4F0LA 1YKEB 2GK9A 1N33T 1JJKA 4DB7A 3O6AA 1UWIA 1T96A 3BK0A 3GZ3A 4Q6JA 2QCCA 1KGWA 1AD1A 2JF6A 3L21A 3TYEA 3L0GA 1KBJA 1XG3A 4GI4A 3ONBA 5SWUA 4WUIA 1ZJBA 2V67A 3QGAC 4A29A 3CV6A 1DYSA 3C4WA 1HJWA 1PIFA 1X8CA 1XLCA 3UJSA 5C2CA 4TV9E 3B0YA 3G6LA 3PM6A 2VL0A 5AQSB 3DN5A 2ZADA 3MMWA 4ZOBA 2D5UA 1KNZA 1RUSA 2NZLA 3TOPA 3VPLA 4N42A 3LY0A 4UQBA 1GUVA 3T09A 4CI1B 4L64A 3F2DA 1J93A 3PBMA 2D1ZA 1JRBA 5CLTA 2OOGA 2Z28A 1RD6A 3PJTA 3IPWA 4DXXA 1F76A 4MY9A 4PTMA 2HVOA 3FXYA 2R6GF 3IV8A 4X60A 4PN2A 3KLKA 5K9XA 1S5NA 2NQLA 1NARA 4IQDA 4BQ5A 4DUZT 1MUWA 4QXIA 3ZVIA 3A12A 4F8HA 4LY4A 2NWRA 1EGZA 2WMHA 2Y63A 3S1XA 1X97A 3G06A 3P50A 1IIHA 1WCGA 5BOOA 2YLAA 2Y88A 3F4WA 4GYFA 4WF7A 3DFQA 3R4IA 3W9ZA 3ANWB 3N9RA 3VNMA 1TPH1 1GORA 3RQUA 3LRLA 2ZM2A 4P0BA 4M80A 2QUVA 3N2CA 4QISA 1ITQA 1TV2A 4UF0B 3JUGA 5C9ZA 2VQET 2FGBA 1D3HA 1KRAC 3OA3A 4MHBA 1J0HA 3I9WA 1HFAA 1M5WA 4CD5A 2RDTA 2PC4A 4HP5A 1FHVA 3HKDE 2IUBA 4GIWA 3CK6A 1KLZA 4S23A 3NQVA 5F1VA 3N04A 1JXKA 4X2RA 1WP6A 3R8RA 2NSXA 5DQVA 5I78A 3UESA 4ICNA 3T8QA 1SJDA 5JR9B 2LE8A 3QY6A 5D32A 4LANA 2YL6A 4WRHA 3BAYA 2QVAA 2CFFA 1XXXA 5EK3A 2QAPA 3S8HA 3NQ6A 2ONEA 1I8JA 3LM7A 3QHOA 3PUQA 3SN1A 4L80A 4FA3A 2FZ8A 4PFHA 1NU5A 4GXMA 1LBLA 2CLFA 1K9DA 3PUZF 3E0LA 1XLFA 4PSPA 5T9BG 3V36A 3O0KA 2CLMA 3EWYA 1AG1O 2DSKA 4K8HA 2W92A 4Q25A 3TSDA 2CZFA 2VZVA 4DR7T 1VFUA 3UFEA 3ZCJA 2BG5A 1VAHA 4WDWA 1P0KA 1FVPA 4J40A 4K38A 3OVQA 2DW7A 3GNNA 2DSZA 2L3LA 5DRCA 4E3TA 4UMBA 4AD0A 5HA7A 1ODZA 3H55A 3YPIA 3AZSA 4HMDA 4AZ7A 3GIYA 2ODOA 3W3OA 1MSSA 5AHFA 2A3CA 2LSYA 3HGRA 1BQCA 1D8WA 3VMNA 2UXXB 2YBTA 3XISA 1FP8A 5IHSA 4NZ5A 4QDPA 4J35A 1JRCA 1Z0PA 1I45A 1VBGA 3ITCA 4WDUA 2ZX9A 2OLHA 1XYMA 1KQZA 4IPIA 3FSUA 2HROA 4Q8PA 3NM1A 1M6JA 2XN0A 1X6UA 1V3JA 2NWBA 2A9UA 4ZQCA 3AXHA 5H2ZA 2F8QA 1F8MA 1R30A 4A35A 1WUEA 4MBQA 3HO8A 3UY8A 1I0DA 1S2UA 4KCUA 1NY1A 3ZN1B 1VEOA 2PTZA 3NQ7A 4R33A 2VWAA 3DYMA 3U57A 1Z8AA 3IVUA 1LM1A 2IC6A 1ZPTA 4C1KA 1JVNA 3CQCB 1W9RA 2YU2A 4IFRA 1HO4A 2VEPA 5GNYA 5CSSA 1CT5A 2QYWA 4ERIA 3HJZA 1NIUA 1XYZA 1A47A 5A6TC 3V5CA 1GVRA 1KM5A 3M0XA 1GKPA 4IF2A 3AU6A 3UWQA 5D8WA 4KW2A 4NRRA 3TH6A 1W5MA 2Z1SA 3AMDA 4GRSA 1ZBCA 3BMXA 1G7VA 1F6YA 1NEKA 3PTKA 2NOXA 1R47A 3VCNA 1FWTA 1AODA 3AUOA 3SCPA 3AHTA 1VEMA 2QDDA 3D3FA 1E9LA 4UCGA 5I3KA 3URQA 3CO4A 3B8WA 4E6MA 1P43A 2JKPA 3SQMA 1OCNA 1LDCA 2PCEA 1JIBA 3W7RA 1TZZA 2UZ9A 1R9ZA 4AIUA 4YSYA 4A3UA 3NZQA 3CHVA 1TPEA 4H9TA 4BQ4A 4HU0A 1HNZT 2Q71A 4RJEA 1PUDA 2WMFA 5GQBA 1P7TB 3MUCA 2X0HA 3AROA 5LHGB 4IT4A 3OG2A 1UD3A 1YBQB 4I50E 2AKMA 6XIMA 4R7WA 3UWUA 2E6AA 4HA3A 4DUVA 3MA9A 5DJQC 2WK2A 3QXBA 3FAWA 2QCGA 1IGWA 1XIMA 2RJGA 4OUEA 1X79A 3CZGA 3GB6A 1XBYA 4EV6A 2CCRA 2O7SA 1JCNA 2YA1A 4LS0A 3WF4A 1KNPA 3KDNA 1OB0A 1K6WA 1XUUA 3SGGA 3PUGA 4H8NA 4GFSA 5B80A 4N2YA 4B3ZA 1Y5WA 3ITYA 4QRNA 4AUBA 5T9CE 4F48A 4JTUA 1E6QM 3GDRA 4M6VA 5DX7A 5IXEA 1IGSA 1XC4A 3T0AA 3GW0A 3TOYA 3LBCA 2A85A 2GSHA 1WXYA 2DT2A 3AU2A 2ADAA 4CQDA 5AOUA 4MM1A 4ZXOA 5LGUB 1U22A 5L3BB 5CBIA 2V68A 2CESA 2G3JA 3FYPA 5KZ6A 2ICSA 1XQKA 3QY7A 1OIMA 3NQCA 2KWHA 4QS5A 4FOUA 3EHZA 2GSEA 4I9TA 5EL1A 5AQOB 4J2PA 2XQ7A 1TA3B 3KRUA 3W29A 1GYMA 3ITXA 4HWIB 3T0TA 1ZBVA 4U7IA 3UJFA 4DYKA 3PUVF 2ISSA 4LUTA 1W1B1 3WDQA 4BEQA 5L4EA 2WVTA 3N34A 1KWKA 3PG9A 4TNVA 5CPLA 3T55A 4HN9A 1PS9A 4RW3A 3C2RA 4R9OA 2J7EA 1A49A 3QOMA 2Q9QB 1V7AA 3AS2A 3WKZA 3P8CD 2Z1BA 1Q6GA 2FVKA 4QR6A 1GT8A 3N2GE 3DAQA 4COFA 4ZO8A 1U5HA 3B4YA 3MSGA 3VIFA 1DQUA 3EKGA 4L6HA 1HJQA 4ZSUA 7TIMA 2WHLA 3HF3A 2WVVB 2B7NA 4NZ4A 4BF9A 4DXKA 2P8BA 5AYYA 4MIMA 2JIWA 2EGZA 3RMJA 3SSZA 4LNYA 4LRTA 1UA7A 5ABFA 3SQSA 5A8NA 1A5OC 3NQFA 3LK6A 4XBJA 1KB3A 1UR1A 2FUPA 3OBKA 2PDUA 2CRBA 3LG3A 1KTNA 3AE6A 1ZNNA 1YMYA 1EYEA 1E6RA 2JRKA 3QV9A 5L3FB 1UG6A 1QPOA 1TQXA 2FFIA 1CGVA 3CJPA 1V0KA 3WLLA 3SEPA 1G4PA 3MS8A 1SFSA 2HNEA 1P0EA 4EYYR 5HEHA 1OFPA 3DFOA 4DJFA 1FDJA 1J01A 4S3AA 3AIQA 2CZVA 1E70M 3P0XA 3AIVA 3G1HA 3A3HA 1ZTVA 2QF7A 1K7XA 3GZAA 1DWHM 2E40A 3FJLA 4CCCA 1CXIA 4TIMA 2X09A 4IJCA 1V0LA 3MJMA 1FWFC 5AC4A 3RO6A 5CSUA 3PPGA 3N2XA 1B9ZA 1XISA 2FTPA 2W67A 5JDGA 1P0DA 3WJYA 3C2FA 3MZ2A 3STPA 1VOMA 5AHNA 4ANJA 1E9ZB 4FF7A 2NQJA 1KM1A 3VMPA 2REQB 2E68A 5HJYA 3QTPA 1FHUA 4FIQA 4IMEA 1UR8A 3WDRA 3Q5XA 3O8AA 2XM1A 1YDVA 3T4CA 3AS3A 2ZZ3A 4ACYA 4ZO9A 1WYCA 1GVFA 2OO6A 3UZJA 3KV9A 2ZRXA 1UH4A 3LGGA 1JPDX 3UBPC 2Q02A 4GJIA 3V5SA 3R5EA 4YPJA 2POZA 1TX2A 1UD8A 4R34A 1VF8A 2YCKX 1BLIA 4K68A 5ABGA 3IVSA 4UF0A 5GNZA 1NAFA 4HA0A 1TTIA 4MY1A 4NXKA 3HGOA 4OBRA 1ISXA 4UTFA 3FHQA 4P1NA 4B15A 4EEDA 4IGHA 2HSAA 3MVIA 3T4WA 3WBAA 3SW6A 2FZBA 4IQEA 2XIMA 5IDZA 2W91A 4JNZA 4DUWA 1JCTA 2VEIA 2ZRVA 3EWBX 1K77A 4ZTXA 1GOQA 1GPWA 3PZTA 4KI0F 2NLIA 4HHPA 1F3WA 2XSBA 4H63V 1KW1A 4B3ST 1HTJF 2HRWA 3I3BA 3AXKA 3RX4A 2UU9T 4KX6A 4YHGA 1SFLA 3VRAA 1S5VA 3C56A 4R27A 1LRTA 4FNQA 3W1UA 4EXTA 4LXFA 3AIRA 3EWCA 1MZHA 1PTDA 3AJ7A 2X05A 4Z0SA 1VHNA 2BDQA 4UTLA 2NVCA 3WD0A 3A13A 3TCEA 4Z1CA 3KOFA 4MKSA 1ONWA 3KWXA 1HKJA 1GKRA 5E09A 1MXSA 2DEPA 3P67A 1G73A 3F31A 1VENA 3AEGA 3G1FA 3APGA 3G1XA 3A9BA 4DBQA 3E5BA 1W0AA 2WQPA 1JDCA 3UYIA 3V3WA 3B9DA 4RR4A 1OWAA 3EYPA 3OP2A 4L9ZA 4A3RA 1GYLA 3RIKA 2J1DG 2AMGA 3EX3A 1KFKA 4JFSA 4YIWA 3W1PA 1WDRA 3HG5A 4GY1A 3WLPA 2R82A 1CB2A 4NHVA 4U5KA 2OPJA 3B0PA 3PDYA 3TN4A 4HHHA 1YPFA 3R6IA 3KE0A 3TLUA 2XDFA 1ZZMA 4QHRA 4IISA 4JICA 1ISZA 4X22A 3ATZA 1RBAA 2D73A 1E1EA 3LCHA 5AHIA 2V2HA 3LNPA 3SB0A 5G4WA 5FL1A 1DL3A 1RLDA 1TPFA 4DRSA 1OD8A 2VFEA 5CAHA 4NAFB 2FYMA 1X6LA 3PZNA 4UQDA 1Y5VA 3F5LA 2ZA3A 3DHUA 4GQBA 2NSOA 3WENA 3TSMA 1ONXA 6REQB 1KFBA 3GK0A 3T08A 5DXXA 3GFYA 1KXVA 4QNEA 2YSWA 1GQKA 2V5LA 3B04A 3FN9A 3U2EA 2FQIA 2KX9A 3VGHA 4H9UA 3UEQA 2NW9A 1QLBA 2OOFA 3W1AA 1TWSA 4XZLX 2G3NA 1KM2A 2OEMA 4AXKA 3DFPA 4J3XA 3M07A 4JQ1A 4NZCA 3BV7A 3N5LA 3WAJA 3UG3A 2CHOA 4Z1YA 2UY3A 1SA0E 4D72A 5ABHA 2I14A 4QDWA 1FXQA 2BTMA 4A56A 2AOSA 4KIRA 3VD7A 1H7XA 3VK5A 1QJWA 1VC4A 2DHRA 4ZI2C 2PFHA 2Z6JA 3ES7A 3PY2A 2WZMA 3F1QA 5DMLA 4HZ8A 2ZUTA 5A6MA 3C51A 4NRSA 3VCCA 4CNSA 2QV4A 4LSBA 3NM3A 3BGAA 2VEGA 2PRMA 3AAEB 5DO8A 3LLDA 3RF1A 2VFHA 5D9MA 1G7UA 4XD4A 3WD2A 3AB3B 4AC7C 3STCA 1Q3NA 2BP1A 1S46A 3KBWA 3ZJ8A 3N4EA 3RJYA 1KQYA 1RV8A 2QCDA 4CXYA 3LTYA 4UIGA 4FOKA 7PTDA 5K4ZA 2A6LA 5A5WA 2D22A 3QHNA 1M03A 1H62A 3RU8X 1MIYA 4UWMA 3ES8A 3L4XA 3PUEA 3VOJA 3TZFA 2UXDT 4PH6A 3D0TA 1E3XA 1LWJA 3OBAA 3Q37A 3PNZA 4Q4PA 3WLTA 2E9XC 4JHMA 4KEVA 1IZJA 3AS0A 1VCSA 2WY2A 5JDQA 3KRSA 3AYSA 1UKOA 2YL9A 4HZMA 1SSDA 2CPUA 5FJRA 1CXFA 3CQJA 2OT1A 2VJXA 2LT3A 1U1HA 4OOUA 5B7ZA 2GQ3A 4N9CA 2P76A 2V7IA 1KKRA 4H9PC 2PDPA 2QIIA 3SJNA 3OJGA 2DT3A 1XH2A 4RPPA 3EPMA 5REQB 5KX5E 4ZR8A 1YXYA 4FXJA 4N4QA 1OEDB 1UPPA 1ZS2A 4NJHA 5D4YA 1R2RA 4C5YA 5CZJA 2X42A 1G8XA 4DAFA 3UR8A 3P84A 1R38A 1PPIA 4ZEYA 1IV8A 4OTKA 1V3HA 1CPUA 3V4BA 1IEVA 3A24A 3W7LA 3M5VA 1PV8A 1N55A 2JJ9A 3GM8A 3TAKA 5BMWA 3IJ8A 1DKWA 1XSIA 4BCEA 3UETA 3AE3A 6A3HA 1XLJA 2D9DA 4BKNA 4JL2A 3N9SA 3DTOA 1XLIA 1MRAA 4PCTA 2Y5SA 3M65A 2Y61A 2PTYA 4UBPC 4Z17A 2Q8XA 4LF8T 4Q7IA 4MDOA 1R3TA 4GGHA 2VGGA 3IJDA 1MDLA 1H49A 1KO0A 4IWWA 4ZQRA 2OGYA 4JXCA 3SIMA 3BLDA 3PZOA 4L4MA 2XVNA 3CBWA 1E71M 2CMRA 5FF0A 2BY3A 3WX7A 3GU2A 1HNYA 2VQFT 4GIRA 5M5DA 1YNQA 4LF4T 1Q6OA 2WW5A 1I2OA 3ZYMA 3AECA 4JDBA 1W9BM 1OF6A 4AFYA 4OHFA 4K8GA 1TFVA 1LBFA 1WDDA 1FHLA 5KZMA 1UROA 4O52A 1SO6A 5L6UA 2C91A 4QQUA 4YTMA 2QJHA 4QFUA 1RY8A 4BQ2A 3UY7A 3OEXA 3B5MA 3N11A 5HJLA 3AXIA 5CAKA 1F6KA 5I2UA 3Q2MA 1AW5A 4YYCA 2A79A 3REQB 4HFDA 4KS0A 5FP3A 3EDVA 2INEA 2ES0A 3RITA 2WXDM 3R10A 4W86A 5HNTA 5CC3A 2KZ7B 1J12A 3AHVA 1C29A 4MB4A 3RO8A 3OBVE 1KM4A 3EUHA 3ARSA 2OX1A 3SRDA 3H3MA 2Y70A 4AEEA 1OWQA 1VYSX 5KINA 1O3XA 1JPMA 4LVAA 5CBBA 3OODA 3U9IA 1EHAA 3ZJ6A 3AE4A 4YMZA 1RPKA 4NAEA 3PAOA 5D9NA 3TNBA 3WF0A 1FX6A 3BG9A 4M7SA 3SY1A 3WLNA 2V0TA 3N9PA 4EEBA 1HNWT 1ALDA 3KZSA 3NZPA 2Y2WA 4MZYA 2QVNA 4C1NA 3PBYA 5I07A 4CNUA 1G4SA 2XY8B 4W4QA 2W0GA 3MVTA 1TJRA 5ETWA 1US7B 4DZ5A 5DQPA 3ZVHA 4GO8A 1YIXA 3C86A 3K3NA 2ZXAA 3GO2A 5BOFA 1W56A 1F3EA 3G22A 4GLEA 1MZRA 2F2HA 4ORIA 4GUGA 1DJWA 4P7RA 3BLEA 3FS2A 2ZZ4A 1JG9A 3O9XA 3H4XA 3S5YA 4CU7A 2W63A 4UV8B 1IT0A 1VB9A 2WPBA 3QMSA 3HU7A 4ZI2D 2G4FA 3R8HA 1SMAA 4ERGA 3OYXA 2LOPA 1PZ3A 5J5DA 3ARQA 2ZM6T 3QOKA 3MTWA 3N9QA 1R5YA 1I0BA 2J9ZA 2DVXA 4MWAE 1LL6A 3SFWA 3W02A 3H37A 3M4HA 1OVDA 1BEUA 5HXMA 3MC5A 1ECEA 2RDXA 4CD7A 4AEOA 4O17A 4ZEPA 3WMLA 1R9XA 4LF7T 3S5SA 2RJHA 1PXGA 2DV0A 2BHUA 3FW6A 5BYWA 4K7VA 3U4AA 3CNYA 2P0OA 3E96A 3OIHA 1EC9A 2E9XD 1JEZA 3CS2A 1GVQA 5KTLA 1WB0A 2JGYA 1BYCA 4HJWA 3WLIA 5DY2A 3BDKA 3HI2A 2Z7KA 1UOKA 5L2LA 4DWSA 2C5IT 4DWDA 2DLRA 5DXYA 1L0PA 3UZYA 3K1DA 4TMCA 1WDSA 3W87A 3G5EA 3R12A 4W7VA 3PUYF 4OT7A 1WXJA 1YKWA 5E70A 4U10A 3P4RA 5K9CA 1HF6A 3JC6C 1JCJA 3OVGA 1ZAIA 4G1KA 3C4XA 4ZQMA 3LI1A 3M44A 4YXGA 1EO5A 1IWPA 1S2VA 3RXZA 1OYBA 2FKPA 3WCZA 2V6XA 3IANA 3JRKA 3QZ6A 3B8DA 3ALGA 4A3YA 4PR4A 2ZUVA 2OSYA 2A2IA 3UERA 4IGNA 1ISVA 3TXZA 5M3WA 3ABZA 1PX3A 5BU9A 2ZM0A 4MUZA 1MMNA 2XAHB 1FMVA 1F9CA 1U83A 3RLVA 3VUPA 5MKGB 3NVTA 3QM3A 1D1CA 3RKOA 3DFNA 3AXJA 2YCEA 1V3LA 2FZDA 1Q8AA 3F03K 5D37A 3U6WA 4HNVA 2ATSA 3QZAA 3N6HA 7ODCA 1Q6EA 1SW3A 2EQDA 4WBOA 4O4JE 3SURA 4C7GA 1VRXA 3TYAA 1WZMA 2FGLA 4B6XA 4C5ZA 4A2SA 5LZLA 2BKOA 2DT0A 7A3HA 1VIWA 4G63A 4I5RA 5HEUA 3QTGA 1EZ3A 2E9XB 5EMLA 1D3CA 4GVGA 1QPRA 2GUYA 1EF3A 2YDAA 3EEGA 6REQA 5AQKB 2ZFAA 3E38A 4N6EA 4NILA 3JCFA 3FZHB 4IGSA 4ZQNA 4AZHA 2J77A 5LA1A 3OQ8A 1QNSA 3A5XA 4DBUA 3GH7A 4HBKA 2UBPC 4ZCWA 1JQVA 5KEZA 4F0KA 3HPZA 2FTWA 4F8XA 1TPC1 3ITTA 4XO6A 3M0MA 1VFSA 1RQEA 2CWXA 3T0CA 3CX7B 1TB3A 3FEMA 3CQ0A 3RR1A 4QXCB 1L0VA 3DH7A 4ERRA 7TAAA 1OFQA 3EMZA 4F6RC 3FGCB 3GAKA 4C7FA 2R1PA 1T8BA 1ZRQA 4DPQA 1DJNA 3JW7A 5EMJA 5FEZA 4FOJA 1WPCA 1Q7QA 3UUXB 4LGXA 3F7JA 4QLKA 3MT1A 5IBXA 4QLLA 4QCFA 2Z1KA 3VKJA 3BOXA 3SRFA 2EXOA 2E9BA 1JCYA 2VMFA 3NL2A 3A64A 5A2CA 3UG5A 1VEPA 3QZEA 1S1RA 5MHBA 3AE5A 4AH7A 2J13A 2X66A 1A5NC 3PZGA 2ZX6A 4E2VA 2XHYA 1XFBA 3NDOA 3SFDA 5LGTB 1FFQA 3GLCA 1UP0A 4R53A 3GW3A 4EF9A 4CN1A 2X0SA 4AHPA 1R85A 5HNRA 1WYBA 4IREA 3U3IA 3FXEB 3CL6A 1F61A 2Y7DA 2RP4A 4MHCA 3C50A 1KWGA 3QVQA 3CAWA 1QW7A 4KGJA 2X7VA 4EYUA 2ZTJA 3MP3A 4JPGA 4NASA 4YJ3E 3L4VA 5F1UA 4G7FA 5FY1A 3WUGA