2W63A

Saccharomyces cerevisiae gas2p in complex with laminaritriose and laminaritetraose
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
455
structure length
432
Chain Sequence
SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
total genus 161
structure length 432
sequence length 455
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w63A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w63A01
2JALA 4YN5A 1NWUA 1WKYA 4AZCA 5E0FA 1HL8A 2CCRA 2VNCA 2VQUA 3ALFA 1OWQA 4TVDA 3GH5A 2DT0A 1UKTA 2YBUA 2QMKA 4BQ4A 1PPIA 2BY0A 3OLIA 3QHNA 1R7AA 4IPNB 2VI0A 2WSPA 1E1EA 3PZQA 2WMIA 3MO4A 2XYLA 2X09A 2DDXA 1TUXA 3AHZA 3N9KA 3VD4A 1DEDA 2WHLA 1ZL1A 3W27A 3N18A 1CNVA 1V0NA 1E6PA 1ESWA 1H0GA 1AQMA 4EE9A 2A3BA 2D24A 2QPUA 2W92A 5M17A 1OINA 1NM9A 2CITA 5ABGA 2E40A 5D9OA 3TP4A 3W26A 3SUVA 4J28A 1JI2A 1ITCA 4S3JA 5HPOA 5ABFA 1LLOA 4KH2A 2FH6A 1UOKA 2PWHA 5A8MA 5I24A 4JL2A 1JYWA 1UD5A 2XSAA 1J10A 3O2LA 3W81A 5DF0A 1K6AA 1NWRA 3AHYA 1HJSA 2G4FA 3ECQA 1HT6A 2GJXA 3AZTA 5IFPA 3CUJA 4M82A 4MJ4A 3MV01 3WDPP 3BCDA 1QI4A 3RM4A 3W4RA 2BFGA 1UD6A 1XSJA 2Y8VA 2YA2A 2D0FA 4H7VA 2XWDA 4M56A 2W4XA 1FHDA 4S3KA 4RE4A 5E09A 4DUXA 5EMYA 4AMCA 2RGLA 4GI9A 3BMWA 3WD1A 2BXZA 3F5JA 1NP2A 5E0CA 3AI0A 1BYAA 2WZHA 3WNMA 2WBGA 3POHA 4AW7A 2B31A 3AIWA 2VRQA 2XVLA 4JFUA 3N12A 1CZ1A 1E4LA 4OBRA 1J12A 2PC8A 2WM0A 5ABFB 4MB3A 3A4WA 1CXKA 2XVPA 1B1YA 2YOCA 3ARWA 4GQQA 3UCQA 1VBUA 3K8KA 3MU7A 2V5CA 2VZVA 4AD1A 4H8VA 3PZIA 1KXQA 1SR0A 1UKPA 3W29A 1ISVA 3WDQA 1VRXA 4XZBA 1QW9A 1G9HA 2OLHA 1HKIA 3MKKA 1BHGA 2Y8KA 1PX4A 1OB0A 4U5IA 4X9YA 3WMSA 4OJYA 1HJVA 4UOZA 3T0BA 5BWFA 3D5HA 2DIEA 3OLGA 2HVMA 1E4MM 2D2OA 5I77A 4J3SA 1XYZA 1E71M 1UWTA 4V27A 3SUSA 2WMGA 4PBGA 1JYVA 3ARRA 3VGGA 3WQ5A 1OIMA 4IM4A 2W91A 1UR9A 2E4TA 3QOKA 4IISA 4PMQA 2CKRA 1WZLA 2YBTA 2VQTA 3VOCA 3WNPA 4PTVA 1ODZA 5I6SA 1V02E 1M03A 1WAWA 5CSUA 1VENA 3DYMA 4PTXA 8CGTA 6A3HA 4UCFA 1WP6A 1C7TA 1EDTA 1EHNA 2PF0A 5JUVA 1GOKA 1FP8A 1CXEA 3CUFA 3RCNA 3T2QA 4ACZA 3B8SA 4LYRA 2PBOA 3CZKA 2VR4A 3W24A 1V3LA 3U5YA 2MANA 3O9NA 4HA3A 3VO0A 2WW5A 2W62A 1J0YA 2PB1A 3GDBA 2DSKA 3GNRA 3WELA 1PIFA 2AAAA 2EPMX 2OWCA 1MW0A 2GK1A 2QHAA 3VKKA 2CBJA 3CO4A 5FKYA 5GNZA 3EMZA 3SCTA 1PX3A 3AZRA 4W5ZA 4GO9A 4OKDA 5LA1A 2CBUA 1E1FA 4HA1A 2J4GA 1VEMA 4D1JA 2F61A 3SCNA 2BY2A 4HU8A 2WC4A 3FXYA 3M7SA 4MB5A 1GVIA 1W9XA 1E72M 2BXYA 1GQLA 3ZJ7A 4NF7A 3KL3A 5CQ1A 3OZOA 1ZB5A 2JEPA 4L4PA 1XRVA 3W82A 3GH4A 1M01A 1B2YA 1VFUA 4EK7A 4JCLA 4GXPA 3D3AA 4XZWA 5BXPA 1NWTA 2GUYA 5ECUA 3ZT7A 1KXHA 2W66A 4MB4A 2WAGA 1FH9A 1BGGA 4J3XA 1TG7A 4TTUA 1LG2A 4A3HA 4PCSA 2WNWA 3A4AA 1HJWA 4MB1A 4R5EA 1J18A 3RILA 1CECA 1MYRA 3ALGA 5CGTA 4UZUA 3WNNA 2FGZA 3ZIZA 1QI0A 3CIVA 3VIMA 3ARUA 3G6LA 4AIUA 3VVGA 5I3DA 2XSBA 3VDHA 1VFOA 3AHTA 1V3MA 3WF0A 4HZ7A 1V3KA 3EDJA 2WVUA 1SFSA 3BAXA 3WUFA 4J7RA 1JYNA 3I3DA 1E5NA 1G94A 3OBAA 4NI3A 4AD5A 3TONA 5A69A 1A47A 3GXFA 3I3BA 1Q6EA 4W8AA 1B31A 4J3UA 2YIHA 1HIZA 1G0CA 2WMJA 2D1ZA 1DWGM 2ZE0A 2GJXB 4CVWA 4CCEA 2ZUTA 4XUYA 3BAYA 1BQCA 1HXJA 4YHEA 2YA1A 1CGTA 1JL8A 4HZ8A 5AY7A 2YL6A 4UR9A 1QBBA 1R87A 1GOOA 1K9EA 1KFWA 4F9JA 3WEOA 2J77A 4U2YA 9CGTA 1WDPA 4EANA 3GNPA 3SUWA 3VIJA 2XWEA 4Z2GA 3SCPA 1VBRA 1E6XM 3WD4A 1LL6A 2VCBA 2FHFA 1EO5A 2ZICA 4TVUA 3IJ9A 2WLYA 1NOUA 3TA9A 4P7LA 2WC3A 5HOSA 3ZJ8A 1HNYA 1W2PA 4AIOA 1B30A 4P8VA 2J79A 4CN4A 1UD3A 3EBVA 4U3CA 4CD8A 3SCOA 2VX5A 1KXVA 1L0PA 4B9YA 3DYOA 5A6KA 4UFIA 3ARXA 1MFUA 5E6ZA 1JZ3A 4RE2A 1IT0A 4AY1A 4CUCA 1W1YA 4H8UA 1OT1A 2OYMA 4W5UA 2DQXA 1C8YA 1MQPA 1JD9A 3VD5A 1UHVA 1UZ4A 1QNPA 3MUY1 2F2HA 4MADA 1ISXA 4MJ2A 1CTNA 3SCVA 1P6WA 3AS1A 1C3FA 1PZ2A 4AWEA 1R86A 4PMZA 1G5AA 3SEPA 3RJYA 1C93A 1QNSA 2W63A 1PAMA 2XGBA 1US3A 1DP0A 1W9BM 4UFJA 1UQZA 2CERA 3VDAA 3S6TA 3QOMA 2CBIA 7CGTA 1CWYA 1OM0A 1MQRA 2XFRA 3KEHA 1UWUA 2EPKX 1VF8A 4U5KA 2G3JA 1DWFM 2V3DA 4BQ2A 4AZIA 4F8XA 2YA0A 1QVBA 3FN9A 1BG9A 2GDVA 3BMVA 5IXEA 4OUEA 1J01A 3MV11 1JZ8A 3VIGA 4UFLA 1QHZA 1HX0A 1VFFA 3PZ9A 3AS2A 5CSYA 2JFEX 3VDBA 2WKGA 1XD0A 3L4VA 3NSNA 3F5KA 3ZR5A 1UZ1A 4HMCA 1XGZA 4PN2A 1CENA 1KB3A 4YPJA 4GPNA 5GNYA 4PSRA 3ARVA 2VJXA 2WYSA 3HMCA 5A2CA 1NARA 4W89A 1XHGA 2VX7A 3N17A 1V3HA 4W8BA 3ZJKA 4AIEA 2WVTA 1PZ3A 3CHDA 2J7EA 3BAJA 3WD0A 2X05A 2ZX6A 1PEZA 4CN1A 1EO7A 2Y2WA 1EOKA 4GZIA 1F4AA 3AXHA 4J3WA 1OD8A 4BQ5A 1JFXA 1TZ7A 1E6SM 3W28A 5DFAA 3PHAA 1HVXA 1NOWA 1CXFA 3AHXA 4AD0A 2X8RA 2X0HA 3LPPA 1BAGA 3SCWA 3UG5A 1RH9A 1W3KA 1RP9A 2VCCA 3WDIA 3ZT6A 2DT1A 2WANA 1BF2A 1TA3B 2ZXQA 1JXJA 5I79A 1QBAA 4ZFMA 4CU8A 4IUGA 3EMQA 1V6XA 2OYLA 2W5FA 4ATDA 1E3XA 4FK9A 3WF3A 3VGFA 4Z2JA 3IAPA 3WEZA 1CLXA 5AYBA 4JZ5A 2D3LA 4ACYA 3ARYA 5M03A 5FOOA 4Q7NA 2CETA 4W7WA 1XCXA 2UY4A 2UY2A 3SURA 1CGUA 2D23A 1H09A 3GTNA 1DTUA 3B9AA 2OSXA 3L4TA 3MMUA 4WIWA 1MW1A 2D3NA 1EHAA 2XM1A 1XV8A 3AIUA 4W8LA 1UD8A 1HP4A 4UQCA 3TTQA 3VD7A 4JFSA 4M81A 4GZJA 3UEQA 2XIIA 3S2CA 2WC7A 3FAWA 2DSUA 5A6BA 3FNDA 3T08A 3W0KA 1FP9A 2JEQA 1UWIA 6CGTA 3DHUA 1BLIA 3ARQA 3W6MA 2BHYA 3U5UA 3QR3A 3NSXA 5DEZA 2WWDA 3N1AA 3ARSA 4L4OA 2RGMA 1FH8A 3MSGA 2PWGA 1E0WA 1U30A 4B3KA 4GIAA 1MW2A 3CTTA 4UQ9A 3SCSA 4ATLA 2WXDM 3ARZA 1MQQA 3MUIA 4RE3A 1JZ7A 1CLVA 2PWFA 1KWGA 1K9FA 3L2MA 1LL7A 2UY3A 3VILA 1EXPA 1HL9A 4CGTA 2VT0A 4GI8A 1XH1A 2NSXA 1E6ZA 1CPUA 1V0MA 3T0AA 1TVPA 4QLJA 1G1YA 4OBSA 4UFKA 3VDCA 1XCWA 3VX1A 5EFFA 1UR4A 3WY1A 4AEEA 2TAAA 1WDRA 5FIPA 4LXFA 1EGZA 3ZSTA 3WBEA 2DT2A 2GSJA 3I3EA 3N04A 3CHCA 3A47A 4MNMA 1VJSA 4DWSD 2UY5A 3ZQ9A 3J7HA 4Y7EA 3WBAA 1J0IA 1EQCA 1WZKA 5A8QA 4N42A 2XM2A 3CH9A 3BH4A 3W25A 3T0DA 4J3VA 4UQDA 4LQ1A 2EBNA 4PRWA 1ISWA 4F79A 7TAAA 2FDMA 3PZNA 1GOWA 1QNRA 4CCDA 1JAKA 4HU0A 4PMYA 4Z2KA 4MDPA 2VR5A 4JHZA 2C8NA 1LG1A 3QHMA 1Z32X 5D8ZA 3AZSA 4J27A 3VM5A 1D7FA 3VIHA 3BC9A 1ZBCA 3O6AA 3WUGA 4DUWA 2E9MA 1RD6A 2O9RA 1ODUA 2GK1B 3M6DA 2WHKA 4MTVA 3F5LA 1KWKA 3GYCA 1V6YA 4MNKA 3OLDA 4W93A 4W88A 1GQIA 1J0ZA 3AMKA 4EAMA 1V6UA 3B9EA 5IFTA 1L8NA 4AYSA 1KQYA 4RL3A 3AMLA 2CHNA 2VC9A 4D6CA 1U2YA 1J0JA 2DT3A 1E70M 1AQHA 4DWSC 1E5JA 1V08A 3EDEA 1TCMA 2ZXBA 3MS8A 4WKAA 4C7GA 3U57A 2DGAA 5A6LA 4A4AA 3KL5A 3EDKA 2FH8A 2IUZA 1TR1A 5E9AA 5HBFA 2GVYA 1Q6GA 3CUGA 4ZE4A 2VOTA 3CBWA 1OIFA 3WNOA 5A95A 5IDIA 2J47A 1EDGA 5BCAA 4PEEA 3W53A 4E2OA 5A8NA 4QAWA 2XG9A 4E4PA 5BXRA 1E73M 1UD4A 1MWOA 3NJ3A 2WVVB 3ZSSA 5I0DA 4QCFA 1J0HA 3VU2A 5IHSA 4PMDA 4AZHA 4PMNA 2Z1SA 2QPSA 1KQZA 2DEPA 1DWHM 4DWSA 4P8WA 3WQ6A 4JKKA 5CZKA 3M46A 3LPGA 4ZE5A 3AXIA 5HXMA 4ML4A 2Q8XA 3AS3A 4K68A 4PYSA 1DWAM 1QW8A 1W3LA 1CIUA 2NT1A 5E6YA 2G41A 3BAKA 1QHPA 3MMDA 3UR8A 7A3HA 1G01A 4WSKA 1UD2A 1QNQA 3K4DA 2EXOA 2GJRA 2V3GA 2WCGA 1RP8A 5I2UA 1VJZA 5A3HA 4QFUA 4W7VA 1H41A 3GBEA 4URIA 5CLWA 1OD0A 3T2PA 1OGBA 3PZTA 5JIPA 3W6LA 4WF7A 2GJPA 2C7FA 3K4AA 3OGVA 2EPNA 1W2VA 2D20A 2J7BA 4M80A 4CD7A 4JHOA 1YHTA 1UR0A 1AMYA 1W1TA 3CZJA 3IJ7A 1C8XA 3HJEA 3QGVA 2O92A 1B3YA 5D9MA 2CEQA 1W3JA 1B3ZA 1UA7A 1ZBKA 3WQVA 3OLEA 1WB0A 3B9DA 3N13A 4PSPA 1E4IA 1R7OA 3A3HA 2WSKA 2ZX9A 3EYPA 4P8UA 2ZUWA 2WWCA 1JGIA 1TVNA 3LPOA 1H1NA 3RM8A 4CD4A 1GUVA 2XTKA 3CLWA 3DYPA 2E9BA 2Y4SA 2DPEA 4F9DA 3VNZA 3DHPA 2A3CA 1XYFA 1CGXA 4HMEA 3WH8A 1ISYA 1GHSA 4GI6A 4PTMA 2Y24A 2WMIB 3TTOA 4X0NA 1JZ6A 3ZT5A 5A6MA 1R8LA 4D71A 2DSZA 1EQPA 4LYPA 3BLPX 4UFMA 1NP0A 1JZ5A 1E3ZA 1E6RA 4DM1A 1V3JA 2D0GA 3MSDA 5EB8A 1H49A 3DC0A 1WNOA 1B3VA 1KR1A 3VMNA 1QI2A 5JBFA 4AEFA 1CDGA 2BY1A 4D6EA 4HPGA 3MMWA 3ARTA 3GM8A 4QLLA 5DO8A 4HPHA 4OOUA 4HP5A 5E70A 2BVYA 2VTFA 2EPLX 1C92A 2J78A 1CGYA 5CGMA 5CPTA 1JF6A 1ZBVA 5BXTA 5DT5A 2BY3A 5LA0A 2NW0A 5F7UA 1UWQA 1MXGA 1HKKA 2BVTA 3AS0A 2IXVA 4W86A 4P7RA 2Y5EA 1W1VA 4D72A 1W1PA 2OYKA 1OSEA 3CMGA 1LQ0A 3FHQA 3U7BA 2E8YA 5KEZA 2XVNA 4R27A 2EEXA 4WKHA 2JF7A 3WL1A 5C71A 1JFHA 1DWIM 1V6WA 3WL0A 4V28A 2WCAA 2DIJA 1U33A 2W61A 4HOWA 4ZENA 4MAZA 2BS9A 4PMXA 4UOQA 3II1A 4B9ZA 5CPQA 3L4XA 4H8HA 5HPCA 1GHRA 2XVGA 4A3YA 4AZGA 2ZX8A 2BHUA 5C8BB 1E9LA 5AC4A 1D2KA 2VL4A 4ZEPA 3RM9A 3UESA 2WBKA 4FMVA 4BS0A 2WKLA 4U3AA 2ZUVA 3VGEA 4B15A 4IPLA 1H3GA 1KCLA 1BG4A 1X1NA 3MUZ1 1GORA 1JIBA 3WIJA 2X1IA 3MUAA 3WH5A 1UWSA 1W9PA 4KWUA 2V3FA 3KL0A 4HTYA 3WKZA 3VGHA 1MFVA 2J7DA 1CXHA 3GXDA 3EMCA 2J8FA 1JI1A 3BXWA 4HOZA 3AMGA 2ZUUA 3WF2A 1CXIA 1W91A 5IHRA 2XFFA 4C7FA 1UG6A 3VIPA 3FHAA 1D3CA 2D22A 1WDQA 4DWSB 5LYRA 2PBGA 3AISA 1K9DA 2VCAA 4GO8A 5EBAA 4M8UA 4U2ZA 3GXIA 2WVVA 1V03A 1DWJM 1C7SA 4JKMA 3NDZA 4PUDA 1E15A 4UQBA 3RDKA 1XH2A 3WDHA 3TTSA 1K9TA 3UERA 3TTYA 1B90A 1LJYA 4JFTA 4ATWA 2CESA 1ZBWA 1QI3A 1UH2A 5CPSA 2DH3A 1E55A 1HJQA 4AZ6A 1M04A 1QNOA 2J74A 2WMKA 2OSWA 3IANA 1GCYA 1UUQA 1GJWA 1E0XA 1CGVA 4GKLA 3SCUA 4PUEA 4TOQA 4QP0A 3WF4A 1C90A 4ZXLA 3AIQA 4HZ6A 4UQAA 3N15A 3WENA 4TTGA 1VEOA 2ZXAA 4PMOA 1HN1A 5A6AA 3VINA 1I1WA 2CIPA 1OBAA 4FLSA 1MW3A 4NRRA 3CGTA 4KRTA 1IZJA 1H11A 1NWSA 1VEPA 1KGWA 2ZX7A 4CU7A 2WMFA 1PJ9A 4EKJA 3K1DA 1V0LA 4JFWA 1BGAA 3BCFA 2XVKA 4LPCA 1UR1A 4KGJA 1OCQA 4AZ7A 4D6FA 3BGAA 1EOMA 2WPGA 1PIGA 4BCEA 4CVUA 1TMQA 3CUIA 4HMDA 5BRQA 3T09A 2ZIDA 3VTRA 1ZJAA 1OGGA 3AYRA 1HP5A 4W87A 1XC6A 1E6QM 3WN6A 1V3IA 2OSYA 1XH0A 4E8DA 5A6JA 1IZKA 1H2JA 1QPKA 3T2OA 3WD3A 3UG4A 4WK9A 1UKQA 3E1F1 3CZLA 4BA0A 4LGXA 1KGXA 3VNYA 4P7QA 1WZAA 2C0HA 1BPLB 1NOFA 2NT0A 4PMRA 3SUUA 2WB5A 1AVAA 5D4YA 3OZPA 6TAAA 2E8ZA 3AJ7A 1Y7VA 3KZSA 8A3HA 3ZOAA 2J62A 1UKSA 3TOPA 2X0YA 1EA9C 1FFQA 3CPUA 3SUTA 5A94A 1UKOA 1GPFA 1MXDA 2ZUSA 2CXGA 2OWXA 1JXKA 2YL8A 1E6NA 1JZ4A 1CEOA 1WZMA 4PTWA 1VFMA 4TX8A 2ZXDA 5A6SA 1CYGA 3K46A 4AC1X 2VZSA 3AOFA 3GNOA 1W9UA 1R85A 4GZEA 4Z2HA 3K8MA 3VMOA 1B3XA 4PCTA 4D6IA 4CD6A 5A8OA 1S46A 1B0IA 4D6JA 2WLZA 3AXXA 1EIBA 3N11A 3WUEA 3OGRA 1JDDA 2DH2A 1SMDA 2BNJA 2EQDA 2FHBA 2CBVA 2J75A 1KBBA 1GJUA 1IV8A 3BAIA 3POCA 2O9TA 2PWEA 2V3EA 1KR0A 3PZOA 4MPKA 2D0HA 2VO5A 3IAQA 1ZJBA 5JIWA 3THCA 1HJUA 2DSVA 3BSHA 4UTFA 2WZEA 4Z2LA 4JIEA 3WMCA 3AQUA 3EDDA 3PZGA 5FD0A 3CZEA 4H2CA 3WH7A 1BTCA 2CYGA 3IJ8A 2VX4A 4XV0A 4DM2A 4J3TA 3WEMA 4HOXA 4AISA 3OIHA 2PWDA 5A2AA 1BYBA 1BVNP 2ZWYA 2ZWZA 4HA4A 2E9LA 3WNKA 4LYQA 3DECA 5KZ6A 3THDA 1GQKA 1B3WA 1TE1A 2A3EA 4JFVA 1FH7A 3PTMA 4P7OA 2Z1KA 4U31A 3WH6A 2WHMA 3W38A 5C70A 3VUPA 1ZS2A 3CMJA 2OWWA 5TD4A 4CCCA 2F8QA 3AROA 4CN6A 2BV9A 1RPKA 4QCEA 4MNJA 3VD9A 2EJ1A 1WDSA 3GH7A 2XIBA 5A2BA 2HISA 4F66A 2FGLA 3FAXA 2WCSA 2ZUNA 4TXEA 2UWFA 4OIFA 4NRSA 5I78A 1J11A 5DT7A 1O7AA 5BXSA 4AZ5A 1XSKA 2YDQA 1Q4NX 3AIBA 2CNCA 3JUGA 1FA2A 3ZR6A 2V5DA 1H0IA 1MVYA 4BF7A 1UA3A 5CLTA 3L4ZA 4AZCB 2VMFA 1PBGA 3VMPA 1E4NA 5EFDA 1GOIA 4LX4A 1BFNA 3HN3A 2EPOA 1OGSA 2W67A 4Q22A 3SCQA 1E0VA 4UQEA 1E40A 4N0RA 3SIMA 3OG2A 4GQRA 3PZUA 4V2XA 4OOZA 1Q6DA 3NSMA 1OT2A 2JF6A 2VVNA 3G6MA 3PTKA 2ZX5A 1Q6CA 4FLOA 2O9PA 5M5DA 2CHOA 3NCOA 2XFYA 3WFZA 1UH3A 1LL4A 2G3MA 2E3ZA 1JDCA 1EH9A 2G3IA 3ARPA 4NZCA 1I1XA 4WJXA 3OB8A 5A8PA 1JZ2A 1WE5A 2BVDA 4E8CA 1GVYA 5I5RA 3ZM8A 1ITXA 3A6OA 1M53A 2O9OA 2JIWA 2QV4A 5FL0A 1HJXA 4UZSA 5JBEA 2VZOA 4P7NA 3AHVA 5AC5A 1NQ6A 2YL9A 3UETA 4AD3A 4P8XA 1US2A 3VIKA 4W85A 2YL5A 2GFTA 4FLRA 2AOSA 3VPLA 1C91A 1GOMA 5BRPA 1PX8A 1BSIA 3AIVA 3AYSA 3OGSA 2WMHA 5D9NA 2J7FA 3GXMA 4PMVA 3CHFA 1O6IA 3NIYA 4AD2A 1EDQA 1B9ZA 3M07A 1H4PA 3L4YA 2CKSA 1CBGA 3APGA 4BZYA 4Z2IA 1FFRA 1ZU8A 1GZJA 3L4WA 3L4UA 1LF1A 5CXPA 3RMEA 3WUBA 4UOJA 1UR2A 3ZO9A 1X6NA 1XD1A 3AIEA 4CD5A 5ABEA 4TVCA 1HKMA 4H04A 2DSWA 2VRJA 5LA2A 3WDRA 4U33A 1BVZA 2V38A 1JAEA 5CG0A 1VIWA 5ABHA 3ZMRA 4ZXOA 5BROA 1AQ0A 3PTQA 1ISZA 2WZIA 1CGWA 1Q6FA 1GONA 5D8WA 4JKLA 2A3HA 2VURA 2EO7A 1VAHA 3WDJA 4D6DA 1KCKA 3F4VA 3U7VA 5M3WA 3VGDA 1F4HA 2WK2A 2J8GA 4YHGA 3KWXA 1I75A 1QOXA 1ECEA 5A6BD 3UG3A 3RJXA 2XGIA 2QMJA 3NUKA 5A1AA 4WLCA 1TFVA 4AD4A 1V02A 2VRKA 1JDAA 3AMCA 3VIIA 1KXTA 1UR8A 3BLKA 4MDOA 1X6LA 4UFHA 3CHEA 4KGLA 1HKJA 1QHOA 3CZ8A 3K8LA 4CU6A 3L2LA 4D6GA 1JNDA 1KGUA 5JBDA 1M7XA 3FY1A 3OA5A 2QLYA 4M29A 3VIOA 4JCMA 2YJQA 2YKKA 4W7UA 4FLQA 3FW6A 5GNXA 1WCGA 1GQJA 1LWHA 3ZJ6A 3GBDA 3BAWA 3NYDA 1YQ2A 3LMYA 3RIKA 1W9VA 3UR7A 1H5VA 3RPMA 4NSBA 3VGBA 2QF8A 1QI5A 3AMDA 4TX6A 4AZBA 3WH9A 2YDSA 2GDUA 1SMAA 3AIRA 3PZMA 3A4XA 4UNIA 1JF5A 3W37A 1GW1A 3EDFA 4JL1A 1CXLA 2VX6A 2ZOXA 3VX0A 2WVSA 4XX6A 1KBKA 4KMQA 2XJ7A 2XUCA 1UQYA 4M24A 5HNNA 1V0KA 1J9YA 1TA3A 1XSIA 2ESCA 2VZUA 5BYWA 1C8QA 2J7HA 3IK2A 1BYDA 2JIEA 2XPKA 1GNXA 3WF1A 4M1RA 4WKFA 1N82A 3PZVA 4KRUA 4OZOA 4CKQA 1GOQA 1VB9A 4JAWA 1JNEA 2YLAA 3LPFA 1LWJA 1UYQA 2J7GA 4B3LA 2J25A 4MNLA 4C7DA 2JE8A 5GPRA 4PMUA 1JYXA 1A3HA 3WQWA 5HDRA 1BYCA 1W32A 4QLKA 1WO2A 2J7CA 5I23A 5DMYA 1WPCA 1FHLA 3WFLA 2VUYA 2X2YA 3WSUA 2AMGA 4GINA 4D6HA 1W3HA 2G3NA 4FF5A 1DHKA 3WD2A 1JG9A 2YLLA 2FHCA 4X0VA 3BSGA 2XHYA 1E56A 4H41A 4DUVA 4W84A 1UH4A 3QHOA 4XB3A 5GQBA 3GZAA 4ACZB 3MANA 2WHJA 1UWRA 5D9PA 1J0KA 2G8ZA 3VIFA 4AXNA 3WNLA 3VD3A 4B16A 3AICA 3AFBA 5CJ5A 2ZUMA 5FL1A 3SCRA 2PI6A 5FCZA 1HVQA 1NH6A 2E0PA 1JD7A 1FOBA 3KE0A 4TUFA 1W9DM 3PN8A 2BHZA 3HU7A 4QDMA 3CUHA 1SYTA 3CZGA 3NDYA 2VVSA 4MAVA 3RO8A 3WMBA 1HF6A 2YDRA 3VM7A 3WQ4A 4D1IA 2A3AA 2IXUA 4WSJA 2VZTA 1E43A 3PBGA 3WQ8A 5AYIA 2CPUA 4BQ3A 1V6VA
chains in the Genus database with same CATH superfamily
4ZGYA 5K9XA 1WKYA 4ADTA 5MKGB 3C2RA 3X1DA 2RDXA 4DO6A 3AB3B 2G0UA 3RLFF 4AHOA 3MKCA 2QMKA 4IPNB 1HO4A 3VR8A 4E4UA 2WSPA 1XDJA 3PZQA 1O94A 3N4AA 4XD5A 3WBXA 3RF9A 1TUXA 3N9KA 3DN5A 2WHLA 1G4TA 2GJLA 4Q4MA 4FPSA 2QUVA 2HRWA 4KBMB 5LGUB 2A3BA 2D24A 2W92A 3RU8X 5ABGA 3MY9A 3SECA 4UVAB 1QXLA 1KTNA 1FWCC 2UUAT 1RCXB 4TWDA 2Y6ZA 4KH2A 3H23A 3R43A 1UOKA 1XDMA 3NGFA 3DDMA 4JL2A 3HO8A 4O8AA 1NQKA 4YL2A 6XIAA 1GPWA 2V5JA 4KBXA 4IFOA 4LWWA 4O28A 1SSGA 1G7VA 2CEAA 2L9QA 2EHOD 5BOFA 3TH6A 3CUJA 1RSCA 3EEGA 1QI4A 5DMMA 4KPLA 4H7VA 2W4XA 3TMQA 4AMCA 4ICNA 2RGLA 4NJJA 4GI9A 1A0CA 3F5JA 4YFSA 2PDIA 1M65A 3EX4A 4QRNA 4OBRA 2PC8A 1J2BA 4M0XA 1CXKA 3MZ2A 1B1YA 4Q8MA 1ZJHA 1TRDA 1PXGA 2BMBA 3G22A 3UCQA 5GJMA 3IIXA 4JTLA 2AQWA 2VZVA 3GE7A 4YT0A 8XIAA 2WWUA 4H6QA 2XQ7A 3G1HA 3GD6A 4UMCA 3SR7A 3U8GA 4XZBA 1EUAA 4XZNX 1HKIA 1E0UA 1BHGA 4O18A 3NVOA 5LOVE 3OQEA 4NYYA 2O55A 2DCFA 4PFMA 2IUBA 1HJVA 3TYDA 2HN1A 4PUMA 1OEPA 1OEDB 3C8NA 1E4MM 3SSZA 3DFTA 3QYSA 2JQHA 4S3GA 2WMGA 5JTGA 4DUOA 3RC8A 1KLYA 2R6OA 2W91A 1HR0T 1UR9A 2E4TA 3NL3A 3QOKA 5CPMA 4GNKB 2C5KT 1KNRA 3ONBA 4C6FA 2PRHA 3VOCA 1CB2A 1L6YA 2LSIA 1D0ZA 4TZ4C 3LENA 3JAFA 1V02E 1WBHA 5BU6A 3TC6A 2B4GA 8CGTA 2E77A 4A8NA 1WP6A 2CZFA 4ZSUA 5DELA 5H8PA 1R5YA 3M0VA 1EHNA 2PF0A 2IHR1 1GOKA 3GAYA 3LUTA 1CXEA 1VD6A 4DYEA 2V7IA 3C86A 4QS5A 4QSFA 4UTMA 1Y01A 3SOLA 4F40A 4PC8A 1LLZA 3EA1A 5FJTA 2WW5A 1TPWA 2W62A 3C2OA 3W02A 2PB1A 1S3TC 3P7YA 3TC7A 3B5MA 2DSKA 5FXVA 1F05A 2W6RA 5RUBA 4HHMA 1FWAC 2QHAA 3VKKA 3DAQA 5I3HA 3CQHA 4AKRB 1PX3A 5LKYA 4W5ZA 1GYNA 4HA1A 2J4GA 3EZ4A 4PTNA 1QSDA 4AG0A 4ZS2A 3U48A 1IXNA 4DNHA 4PJNA 1PTDA 4HU8A 3TUUA 3FXYA 3LTYA 3BO9A 1XUZA 4NZ3A 2E5VA 3KV4A 3OZOA 3SRHA 1XC4A 3N2TA 3UZYA 3RYIE 3HQPA 3W82A 4ERGA 4AWSA 1M01A 1B7TA 1VFUA 2INZA 3IV3A 2X51A 2O0TA 4LU0A 2NQHA 1LRNA 4Y9MA 5LG3A 3WK2A 5BXPA 2DWGA 1MXSA 2QCDA 2QVHA 2W66A 5JDNA 4IH3A 1FH9A 3SFEA 1N34T 1TG7A 3H12A 2N2NA 4TTUA 1YDYA 1U5VA 4CI3B 3RILA 2REQA 3W2NA 4LEQA 2R1PA 1LBMA 4CXYA 5EZYE 2GVJA 1TPH1 2YR1A 4LVAA 6ALDA 5D2WA 3P61A 1XKYA 5EMKA 3GK0A 3N9LA 4YHJA 4IQLA 1KM6A 1F7BA 2QCHA 4EIWA 1XLBA 4AKLA 3BTNA 2WVUA 3EWBX 4UR7A 4ERRA 2PDBA 4R53A 4Q8OA 4RZ6A 4QG6A 4ADUA 4J7RA 1WKFA 4M6VA 1E5NA 1G94A 1HFAA 3B9OA 2X9XA 4NI3A 3USBA 1KM4A 3VNKA 3GXFA 3INPA 1WA3A 5LXXA 4FNTA 3BV7A 2ZM0A 4J3UA 3WLJA 3FZLB 1HIZA 1G0CA 1W9RA 1Q8JA 3GTXA 2WMJA 1UP2A 1Z89A 5AQGB 3A3XA 3GN5B 4RNIA 3WFAA 3L5MA 1HXJA 4YVXA 4UR9A 1K9EA 1NF0A 2UV8G 4F9JA 4JNMA 3EX3A 2J77A 1A5MC 5IOBA 4UVBB 4US5D 1O1HA 3GNPA 4HYVA 2XWEA 3SCPA 4S3CA 1LL6A 3AA0B 1S5TA 1HS7A 4FALA 1AH4A 2NXHA 3PJWA 2ZICA 2PDKA 5AQQB 1AZ1A 2BLEA 2WZMA 3UG8A 4U74A 4FNPA 2HSAA 4AIOA 2JPFA 3N2XA 3FYYA 2GOKA 4CN4A 4CD8A 4U3CA 2Y70A 3SCOA 1OX5A 1XW8A 4F2BA 3DYOA 4A6GA 4GGBA 1IGSA 2GWNA 1QWGA 4CUCA 2X7WA 4H8UA 4Q8NA 3QZAA 5FXWA 3N2GE 1MQPA 4FSAA 3RGLA 1QU4A 5I02A 3KOWA 1X1ZA 3L67A 1OYCA 2OX1A 4GKTA 1EUNA 3WJWA 4MADA 5CPLA 4NHVA 1ISXA 3OVPA 4X2PA 1JJKA 4IL0A 3STPA 4AWEA 2VC7A 3SEPA 4LMKA 3RJYA 3PPCA 1TX2A 2PCQA 1W9BM 2GSHA 3QOMA 4QDWA 5XIMA 3A5VA 2XN0A 5HXEA 4JTIA 2XFRA 1UWUA 3ITVA 2EPKX 1VF8A 4U5KA 3BSMA 4AZIA 3R1ZA 3BMVA 4OUEA 1J01A 3ZYMA 2VFEA 1JZ8A 2IC9A 3VIGA 1VPYA 1K1DA 3AS2A 4IG2B 5CSYA 1REQB 3KHJA 1XD0A 4GLEA 3NSNA 5B7ZA 4U7YA 4ZI3C 3ZR5A 3PNUA 1XGZA 1W3IA 4MBQA 1KTBA 1CENA 4PULA 1X97A 3ARVA 4TX9A 1SW7A 5A2CA 4W89A 1XHGA 3S6OA 4WR3A 3DG7A 3SGUA 4AIEA 2Y89A 2WVTA 3NRXA 2GVEA 2J7EA 4ZQCA 4NKCA 1ZPTA 2RHGA 2OX4A 1UB3A 3SRDA 3ZXWA 2V7KA 4J2CA 1PEZA 4EPKA 2Y2WA 2AQVA 1UMLA 5E0KA 1F4AA 5EMUA 4J3WA 3LK2B 1WRDA 3THAA 4QJ5B 1XRSA 4HE8A 4RNJA 1TZ7A 1H1YA 1GVQA 3FV9A 4I5XA 5DQPA 5DFAA 1SZRA 2PP3A 3PHAA 3M5XA 5LSMA 1HVXA 2FPYA 4LEFA 2FZNA 2KWIB 2XAHB 1U1JA 2YK0A 3MW7A 3T9PA 1XBVA 4IIBA 5C7VA 3NFUA 3RQUA 4DV3T 4FAMA 1KV5A 3UG5A 1NENA 3VE7A 1YEYA 2DT1A 3L0KA 2V5BA 3B0YA 4LUIA 4O0KA 1QBAA 1I6ZA 3U2EA 4JX4A 4IL9A 5GONE 4MM1A 4IREA 3NEHA 2V6YB 4HK5A 2ZQ0A 3VGFA 1YW0A 3WEZA 1CLXA 4JZ5A 3ARYA 3DI1A 1U4QA 5FOOA 2ZA2A 2CMRA 2CETA 2QVNA 5BOOA 4M5PA 4LUSB 3GTNA 2QCCA 4WIWA 1HUVA 3EPOA 4M6QA 1MW1A 4IPPA 4MZ8A 3H21A 4W8LA 2WJFA 3LG7A 1IGWA 5FYMA 3UWYA 3L7RA 3EX6A 5CG7A 1Z44A 2XIIA 1UIOA 1R38A 3FAWA 3IV8A 3EI0A 1T7SA 1I2RA 1D1BA 2DSUA 3DZ1A 3W0KA 2OR2A 3ZKRA 3G1AA 3GHSA 4LF6T 3EKGA 2BHYA 3U5UA 1ZUAX 1QK2A 2A5HA 5DEZA 3AVSA 4X65T 4Q7IA 1EC7A 2PWGA 1RBOB 3GTIA 5T9CE 3C4UA 4GIAA 1MW2A 1VR6A 4KQNA 1KRCC 4QJ4B 3I10A 1GVFA 3CWHA 3SCSA 1R3QA 7TIMA 2PWFA 4EPBC 3L2MA 1BR2A 3PK7A 1HL9A 2P0IA 4LUTA 1XH1A 3AUJA 5KZDA 3PU8A 4GE8A 3UZZA 3LLDA 5A5WA 3T0AA 3CC1A 4QLJA 1G1YA 1NEYA 5EFFA 4ZQOA 4B90A 3VNJA 4DJFA 3Q5WA 4O16A 4K38A 1WDRA 4LXFA 5I7GA 1EGZA 3GHUA 3ZSTA 1DJQA 3TWAA 4JLEA 1FDZA 3I3EA 5K9CA 1LKXA 3A47A 3DFSA 2KINB 3T8LA 2XTLA 3H24A 1VJSA 8RUCA 4DWSD 3S5YA 3ZQ9A 2ZLYA 5L3DB 4B3MT 4QROA 1WZKA 3LS9A 2FVLA 3UJRA 4AU0A 3T0DA 3I1AA 1XLCA 4LQ1A 4NG3A 4JTAA 1VFHA 2EBNA 2ZZ1A 3O8AA 1V7AA 4F79A 4XKYB 4JI8T 1YXRA 5K2ZA 3MCOA 4F0RA 1WX0A 3GFZA 1XR2A 1D9EA 4MDPA 1YD8G 2OEMA 4S23A 4EXTA 5D8ZA 4HBKA 1BR4A 1SFLA 4J27A 1QFEA 3TJLA 3WLIA 4GUHA 1KK7A 1L6GA 2WHKA 4W9TA 1VCFA 2PDCA 3EWXA 3F5LA 2LSGA 1TPUA 1ICPA 4H9YA 4MNKA 2C79A 4H6EA 4H9QC 1GQIA 3M0ZA 1J0ZA 3AMKA 4JIRA 1XG3A 1CLKA 2ZA1A 1L0VA 3AEFA 4GVFA 3B9EA 4DPPA 1L8NA 2A9UA 1RPXA 4CQ8A 2D5UA 4YTNA 4WXZA 1ZAHA 2ISVA 3HKCE 2XIOA 4Y96A 3AYVA 2P8CA 3G77A 1U2YA 1MDRA 3RIUC 4DWSC 1E5JA 4DO7A 1TCMA 3V1PA 5A6LA 3E3HA 3CU2A 5D02A 4F0LA 2IUZA 1TR1A 5E9AA 1Q6GA 3GW0A 2W0GA 3UQ4A 2LKGA 4FNQA 1N8IA 1TQJA 3WNOA 4B5UA 5A95A 2QGSA 5IDIA 5BCAA 3W53A 4K37A 3L9CA 4RNFA 3TC3A 5BXRA 1E73M 1UD4A 2EGZA 3BLLA 3ZSSA 4IE4A 4L80A 5CC5A 2DZAA 3VU2A 3BG3A 3PUGA 4PMDA 4DNDA 4AZHA 4PMNA 5I00A 4IGNA 3ANVA 2FB3A 4ZI2C 4P8WA 3QYQA 4JKKA 4UMBA 3O6YX 3NVTA 1R46A 2FUPA 1RJPA 1XINA 2A7PA 2Q8XA 3AS3A 1H7XA 1LDCA 4HKPA 5AZ0A 1DWAM 1RJRA 2G41A 4JI1T 4CXXA 3W72A 2ODVA 5F4SA 3N3TA 2DIKA 1UD2A 4DYJA 4U10A 3K4DA 3AE9A 2EXOA 2KAUC 2GJRA 5I2UA 4JI4T 3B0VC 4LC8A 4XD4A 4QIUA 3UGVA 3W7EA 3LG3A 2H7OA 1GW9A 3PZTA 3OOQA 3M0JA 2GJPA 3KBMA 4DR1T 2HZGA 4LVGA 1W2VA 3IGHX 2X67A 4GBUA 3GUGA 1VIZA 4S2CA 4CD7A 4IDQA 4AIBA 3OU8A 1A4MA 3QGVA 1SZGA 4FI5A 5KX5E 1KCXA 3GR7A 3S3GA 2NTYA 1ELSA 1W3JA 1UA7A 3WQVA 3QY8A 2EG6A 2VWAA 2OLAA 3GDTA 1DU2A 2XN2A 3DFNA 3P81A 4J3ZA 2J9ZA 2WWCA 4LF7T 1IHIA 1TVNA 3HQNA 1JPMA 1RCOB 3CUXA 4FX6M 5HK4A 2QNEA 2Y4SA 4O1CA 2QXWA 5HWMA 2A3CA 1XYFA 4Q8UA 2XFWA 4PTMA 3FZKB 2Y24A 4PBFA 3BE7A 3P4PA 1TWSA 1QUMA 3EAUA 1R8LA 1EZWA 2IMLA 1EQPA 1Q5MA 3OODA 2LSJA 4LYPA 5FEPA 2Z0IA 2VDIA 3RYCE 3M0XA 1V3JA 5EB8A 1WYIA 1Z69A 1OFBA 1NF7A 1RQBA 1I2NA 4D6EA 4HPGA 3MMWA 1WOBA 3M3ZB 4O54A 5AQJB 1YPXA 1H7CA 3KXQA 3RHGA 4A97A 3T6CA 4ORMA 4GIEA 4HCHA 5AQMB 2GUUA 1X96A 3CL6A 3SQMA 1Z9AA 1A5NC 1W5PA 5J5RA 5CGMA 1ITQA 5CCZA 5BR8T 4M3PA 5EGRA 5BXTA 2Z6JA 4OECA 1BD0A 3K5XA 2MOZA 4ZQRA 4P7RA 4D72A 1W1VA 1OSEA 4XQ6A 3ZC0A 3FHQA 4TX5A 1FWDC 4D2JA 2PGFA 5KEZA 3LX9A 1HO1A 4R27A 3W2LA 2GVGA 1XLFA 2PU0A 2FKPA 2JF7A 1RV8A 5C71A 1A3WA 1J79A 1WAUA 1DWIM 4F2UA 3RI5A 2F38A 1XWMA 5F1UA 1Y5VA 3RYHE 4O1AA 1NDZA 1VFLA 4HOWA 3MJYA 4PMXA 3QKZA 5LIUX 5BMVE 4B9ZA 5CPQA 2LSKA 4TV5A 2LOPA 1C29A 1IAPA 4QXIA 3RM9A 3UESA 1F74A 2VFDA 3L5LA 3OIXA 4DR3T 4NVTA 2TODA 3B97A 4FR1A 4U3AA 5L3EB 1IEIA 1G73A 2Y6XA 2XAQB 4X64T 3H54A 4RUBA 1X1NA 3I0QA 2K9AA 1VLWA 3WIJA 2X1IA 3NAVA 5PTDA 2DHRA 3WH5A 5D04C 3A4JA 2V3FA 2XQ6A 4IGSA 3VGHA 2ACZA 4PMJA 3TSDA 3GNNA 1TPDA 3WF2A 5K7JA 4HWFA 1PDYA 4GD0A 4BI6A 1D3CA 4ILCA 1ECQA 1HGWA 1CUNA 1D0YA 4RJEA 3AISA 1K9DA 2VCAA 3MWCA 5EBAA 3OVUA 3GXIA 1C7SA 2P53A 3QLDA 4PUDA 4LS2A 1XH2A 4CLMA 1XNQT 2BDQA 3QV9A 5DN1A 3W1UA 1P0NA 3TTYA 3WG6A 5IYZE 2CESA 3IGXA 2DQWA 1N36T 1XXXA 4S3DA 2V81A 4NXKA 1E55A 4R7WA 3XIMA 5HMDA 3A23A 4CEUC 1OVDA 3SCUA 2DZVA 3PS7A 3FXEB 2E9XD 1BQGA 2FYMA 3WF4A 3FA5A 4ZXLA 7ODCA 5HWJA 3E08A 1XJBA 3WENA 1KCZA 4C1NB 2MNRA 5LHFA 4H9SE 1W37A 2YX0A 3RXZA 4O4HE 3VINA 2CIPA 4F4RA 1OBAA 4FLSA 3WJYA 2VD9A 3CGTA 3D46A 2NTXA 4C6BA 1KGWA 2Q6ZA 2ZX7A 1Y64B 1UJPA 1K7XA 2J9YA 3P7IA 2WQPA 3MHGA 4F0MA 4JFWA 4DR6T 3BCFA 2ZADA 3KW3A 5TAOA 3MCMA 4WNKA 1LQAA 1EJTC 2WPGA 1Q7QA 3DHFA 3R2GA 3NM3A 3T09A 1L6SA 3VTRA 4H9ZA 3WLQA 2PS2A 2OQHA 3AYRA 4ZQMA 1ZCOA 1NDWA 4O4IE 1B54A 1TSIA 3M41A 5H91A 4DVOA 3VI2A 1XH0A 2ZVIA 4WDUA 1H2JA 2A1YA 3SO7A 5L3FB 3TLWA 1UKQA 2ZBTA 3E1F1 4BA0A 3M0LA 1ZGDA 1NELA 4I9MA 2B7QA 2FFCA 1W1B1 3QW4B 4GNVA 1TV4A 3LSCA 5CH9A 2AE9A 1OEDA 1F2JA 2WB5A 5L3GB 4Z1BA 6TAAA 2PTXA 1R3SA 8A3HA 1UKSA 4WBOA 3TVAA 4KIRA 4EPEC 2D2JA 1R47A 1T0OA 2ZRYA 3MHUA 2CXGA 4AXPA 4G7EA 1JXKA 1E6NA 4WBNE 2J6VA 1R85A 1ONRA 1P43A 4Z2HA 2XDFA 1PYFA 4JQAA 3KRBA 2ZTJA 4EWND 1O1ZA 4D6IA 5A8OA 4REQB 4P0AA 1B0IA 4JQ4A 3MZKB 1DTNA 4OYKA 5HNRA 1TWZA 5AQNB 3AXXA 3ABRA 4NXSA 4QM1A 3N11A 4EZ4A 2EQDA 2HXUA 3KDSE 2BNJA 2CBVA 3BAIA 5DCBA 3POCA 2BTMA 3CUZA 2WOQA 4ZOLE 1KR0A 4IE0A 1TVLA 4I3GA 5FESA 3N2OA 4PNIA 3THCA 3PU3A 2DSVA 3LCFA 5T26A 4ILUA 1FWRA 2PWUA 2WZEA 4Z2LA 3NL5A 5A6TC 3WMCA 3EDDA 2HROA 4HQVA 4IX2A 4L7ZA 3CZEA 2RPAA 4H2CA 1FWEC 4COFA 1B57A 4XV0A 5D09A 3WEMA 3O7UA 3OIHA 1EEPA 3RPUA 2PWDA 1M7PA 3THDA 1TE1A 4JFVA 1W17A 4FIQA 3VRAA 2OG9A 3WH6A 4DVDA 1I60A 5C70A 3I6EA 3L09A 4YMZA 3VUPA 4C6LA 1AJ0A 3S2MA 2CZDA 3V16A 3PAJA 2OWWA 3NZQA 3EXSA 1YYAA 2LHRA 4CN6A 4RDVA 1RPKA 1EJSC 4MNJA 2I1OA 2LM9A 3W1PA 1EA0A 5A2BA 2JKPA 1M3UA 3FAXA 2YEVC 3LRKA 3G1FA 4OIFA 2YU2A 4NRSA 5LNSA 5DT7A 1P7TB 5BXSA 1FKXA 4X5TA 3B40A 3JUGA 3V5SA 3T8QA 1QK0A 1H0IA 4JX5A 4BF7A 3TQ0A 3MWAA 3GMIA 1UA3A 5CJNA 2ZVRA 2DLRA 3DENA 4KWWA 2BBJA 1XLDA 4YTMA 1E4NA 2CCQA 5L3CB 3DH7A 2EPOA 5REQB 1OGSA 1YE4A 2YCJA 3O05A 2A79A 5JVLA 4EACA 4UTWC 4F6RC 3H7UA 3BGGA 1R8IA 3KVBA 1E40A 3CJPA 3TZFA 4L6OA 4OOZA 5FY1A 2R24A 4YJ5A 1Q6QA 3JR2A 1RLDA 2HMCA 3P3BA 2JF6A 1H7WA 4A05A 3DTOA 3G6MA 1Q6CA 1TO3A 2O9PA 5M5DA 5CSRA 1Y5WA 1E9ZB 2XFYA 1DXFA 4GVGA 1R3TA 2Z25A 3D0TA 1EH9A 4PJMA 2NZLA 1K77A 1QWKA 1XFCA 2BVDA 4IGMA 5I5RA 3ZM8A 3E2RA 1M53A 2O9OA 3QEZA 1OZMA 2Z29A 5JBEA 1PV8A 3TOYA 2Z6IA 3AHVA 3ITTA 2YL9A 4JI0T 3E0ZA 3IIPA 3W1QA 3VIKA 1W8GA 1S2AA 4W85A 3U2CA 5CBIA 1QOQA 5I3KA 3LGEA 1C91A 5B80A 1EX5A 1GOMA 1FTXA 1XIDA 2MTQA 1J96A 3GXMA 2M6BA 2IPFA 2WQDA 4QHOA 4AD2A 1EDQA 1KNWA 1B9ZA 3EPMA 3ESLA 3BOXA 1H4PA 3CPRA 3O16A 3A5FA 2F2KA 4G9PA 3QF0A 1YDNA 4Z2IA 1ZU8A 2VKDA 4DO4A 1JCJA 4H63H 1Q13A 1LF1A 4E3TA 1ZAIA 4KCUA 1YXDA 5AHMA 1D0XA 1EXBA 4AKGA 1WDWA 3C4ZA 1GTHA 1Q7MA 4HJWA 2BGNE 3UR5A 4H04A 1AD1A 2VRJA 5LA2A 3RK8A 4AWUA 2YINA 3RKOA 2WSRA 1BWKA 4GJIA 3LXBA 4TNVA 4TIMA 2O56A 1ITUA 5BROA 4D8LA 1W5NA 3R5EA 4DR4T 1SUXA 1CGWA 2ZZ3A 4ZS3A 1GONA 3JCFA 3UY8A 2Z7GA 5EK2A 3S4TA 1Z3NA 4D6DA 3DP7A 3OHMB 3GXTA 4LUTB 2KT9A 3NM1A 3H3AA 4O53A 3WQOA 3K13A 5M3WA 3N6JA 4LAKA 4YNGA 4U28A 4Y2WA 3WLLA 4RE0A 3E0FA 1R30A 2LE8A 3OEXA 2X9YA 4JI5T 1X9BA 2J8GA 3F4NA 4FX8A 3UYCA 3M44A 1QPRA 4S3EA 1QOXA 4JIHA 1ECEA 1I9CB 4IIJE 3UG3A 2IPJA 2XGIA 2XSXA 3C0SA 3WQPA 2QMJA 4IPJA 4GNJA 1TFVA 4HIBA 2DUXA 3TCSA 2CHRA 2OA5A 3T05A 2FGBA 1XL9A 7REQB 1K8YA 5C3JA 3BLKA 4GK8A 4MDOA 4B4HA 3CHEA 3C2FA 4KGLA 3VFCA 3IJDA 4XD6A 3QY6A 3T42A 1XIFA 3FB2A 4CU6A 1FWGC 3BICA 3RX3A 2PODA 1H63A 1ZENA 3FY1A 1UJQA 2QLYA 4M29A 3CASA 1VOMA 1M62A 3VIOA 5D2VA 3O3RA 2GLKA 3FW6A 1GQJA 4NL1A 4O4JE 3NR0A 1ZZMA 2C1IA 3HKBE 2Z6EA 1R2RA 4ZI2D 2LT3A 3GBDA 3WQFA 4GYPC 3ZLGA 1W9VA 1H5VA 4WGXA 3LMZA 3BVJA 2QF8A 3AMDA 3QMSA 3WH9A 4PL2A 3PZMA 3A5XA 4UNIA 4IJRA 4DO0A 1JRBA 4TR9A 1G4SA 1TPVA 1GW1A 4B3ST 4WOQA 1CXLA 4PBEA 4QISA 1BKSA 1UMYA 5U4NA 3UFYA 3FLUA 2CZ5A 3S1WA 4ZHQE 1TELA 5HR6A 1V0KA 1TA3A 1AH0A 3BOLA 4J2PA 2ESCA 2VZUA 3R0DA 3NPUA 4IZGA 3GO2A 3P4SA 3PANA 3EVYA 1BEUA 1JDEA 3BWWA 5FF2A 4MJMA 4JN7A 5JH2A 1BYDA 1O5QA 1JEZA 1QO5A 2W00A 2X2GA 3WF1A 1DXEA 4AAJA 4LCSA 2K5BB 4NJIA 1OEDC 3VKAA 1VB9A 1TPB1 1W3NA 2IC6A 2A6NA 3VNDA 1C8VA 3DUGA 1JNEA 3G0SA 5DANA 2AKMA 4JYAT 3LPFA 3SIZA 2NR4A 4C90A 1UYQA 2ES0A 3SFKA 4KCTA 2HS8A 1K02A 4Z1YA 1PYMA 4GH1A 1I6NA 2FPVA 1JYXA 3V5CA 3QMTA 2XQ9A 3KHDA 1MIYA 5I23A 2ALDA 1WPCA 3PVFA 5DBUA 2WAUA 1E2AA 3M4HA 1AJZA 3PC0A 2X2YA 3WSUA 4N2YA 1JPIA 3WLHA 1W3HA 4LAUA 4WGHA 5CZSA 2XHYA 1AZ2A 3IRDA 4W84A 1EX1A 4O0ZA 4L64A 3STGA 2QKFA 3KCLA 4XB3A 3GZAA 5TBOA 2WHJA 2HBXA 2XAFB 1J0KA 3ORWA 1VS1A 5HXRA 5L3BB 1YIXA 2UZ9A 5LHIB 4B16A 3GR8A 2ZUMA 2DV0A 2PI6A 4KWSA 4K8EA 1NH6A 3BQLA 4C5ZA 3STEA 5F4XA 3CB8A 3UCDA 3CUHA 3ZMVB 4DJFD 3NDYA 1PKNA 5LBQB 2VVSA 3C0QA 4MAVA 3RO8A 5FF3A 3VM7A 4XZLX 4IX0A 4XG1A 2IXUA 3B03A 2BB0A 3WJXA 3VDGA 3HV9A 4EZHA 1D7KA 2JALA 2OEKA 4HU3A 3FXGA 2E5CA 1A5KC 4P2VA 5E0FA 1HL8A 2CCRA 3MVIA 2VQUA 1OWQA 4TVDA 3GH5A 1R9ZA 2DT0A 3IACA 2OQYA 4AYGA 2YBUA 3CK6A 1R7AA 5KMGP 1E1EA 2B0MA 3LHVA 3MO4A 3WI3A 2X09A 1H51A 3O6CA 1YX1A 5LGTB 3W2JA 2GGGA 3SY1A 3NO3A 4Q4OA 3VD4A 2QGHA 4D9PA 3PUDA 3TLSA 1ZL1A 1EPXA 1FDYA 1V0NA 4GVIA 1AQMA 3D6NA 4QS6A 5M17A 1MNSA 3UQNA 1U83A 1ITCA 3ZLFA 5HPOA 5ABFA 4QQUA 3MJXA 5LMUT 1FWIC 1LLOA 2O7SA 1JCTA 3QZ6A 2E67A 3ZJ1A 2BKNA 2VGBA 5I24A 3C98B 1UZDA 1V6TA 1BR0A 5H8MA 3O2LA 3W81A 2G5WA 1NWRA 3RLUA 4GYRA 5TF0A 2CZEA 4WZHA 4C6EA 5IFPA 3NURA 1EPVA 1WCRA 2LLEA 3E0WA 1MO0A 3R8HA 1TWIA 3JW7A 2D0FA 2NV9A 3SSJA 5DMLA 1FHDA 1UX4A 2NWBA 3OO2A 1F07A 3WQDA 1NP2A 3WNMA 2CLYB 3POHA 4QE1A 4AW7A 1JQVA 3VUSA 4LW7A 1GQEA 2E6YA 3BQ5A 2X40A 1E4LA 4HK7A 4KFPA 1J12A 5ABFB 4MB3A 3HGRA 4J9JA 5CA1E 3R94A 3A4WA 4X22A 2XVPA 3JADA 1EIXA 3NL6A 4JV5T 1ADDA 2QUNA 1F3EA 2PDPA 2I14A 2BKPA 3MU7A 2CC0A 3B05A 2P10A 3CYJA 1ZKEA 2J8TA 1KXQA 1UKPA 3HIJA 2PC4A 2X1TA 4H9UA 3W29A 1ISVA 3LCGA 5I3IA 2Z26A 1VRXA 2OV9A 4YU1A 3TZNA 1QW9A 2GGJA 2TRSA 2C6QA 3EWCA 5EMJA 3W7NA 3I65A 2BG9C 4ISTA 2Y8KA 2YXOA 4O0QA 4U5IA 4G5DA 3H55A 3WMSA 4WDXA 1RXOB 1FWHC 3BW4A 3H8AA 3T0BA 3M9YA 3D5HA 1FXQA 3S9ZA 1MIVA 1A4LA 1NFPA 5I77A 4J3SA 5AQRB 4V27A 1QPOA 1JYVA 3ZYZA 3VKHA 2E6FA 2BBHA 5FXZA 3VGGA 2V67A 4IM4A 4L65A 3F2EA 2PZ0A 3LHTA 3O07A 1LUCA 3EOEA 1ZAJA 2YBTA 5CAKA 1DJIA 2VQTA 2CXLA 1VCSA 1K7EA 1ONXA 4PTVA 1ODZA 5HEJA 1NY1A 2EJAA 1EB3A 4Q4QA 1PVNA 3FSUA 3OG3A 1QPNA 2R14A 5CBJA 4UCFA 2B81A 4QH1A 2BKOA 2I17A 2WSSV 3IVUA 5K4XA 1X1OA 3RCNA 4ACZA 4Q3MA 5AHLA 2IQDA 5HATA 2PBOA 1TYGA 2VR4A 4JTQA 2QDGA 2R82A 1F76A 5T91A 3NEVA 3VO0A 1UASA 3GDBA 1MNEA 4GYJA 3GNRA 4DBDA 4LF1A 4DR2T 1LOSA 3B4YA 3UULA 4B3RT 4FB7A 3W7PA 2WMNA 3K1SA 1SU5A 4G8TA 3EMZA 2DZTA 1QW7A 3LU2A 3KLLA 1VFSA 4NP7A 4D1JA 4JIQA 2WDRA 4IUOA 2F61A 3SCNA 4AC7C 3LZ5A 3M7SA 4MB5A 1GVIA 1E72M 2BXYA 1GQLA 1P0BA 3HBLA 3LHZA 3ZJ7A 4JTDA 5CQ1A 4YSZA 4WUIA 5KZEA 5HQMA 2JEPA 1TIWA 5F2LA 3ANWA 5CC3A 3E9AA 1BR1A 2OEJA 3EB3A 1Q65A 3D3AA 1N2VA 3AYTA 1GT8A 2GUYA 5JH1A 2YOEA 4PEKA 3T40A 2X68A 3R58A 2WAGA 4JQ1A 4IPIA 1TWWA 3A4AA 2HHHT 4XBJA 1HJWA 1BXNA 4YXGA 2QIIA 5C2XA 1EJUC 4JQ3A 2FGZA 3OW1A 5JR9B 1RY8A 2ISDA 3VIMA 3ARUA 3AEBA 4YWIA 3M5ZA 2XQYA 1YQ3A 5FAJA 4ZZ9A 3LSBA 2XSBA 2V5KA 2OZ8A 1V3KA 2HQAA 3SJNA 3AE8A 1SFSA 3BAXA 4JTGA 3WUFA 3ABZA 3FS2A 1JYNA 3I3DA 4AD5A 3GXPA 4G2DA 1KKOA 3TONA 1EBGA 4N4PA 3W23A 3PWGA 4XBFB 1XM3A 1B31A 4ZZBA 4YVPA 3J9X1 2Y85A 2VWTA 4DUYT 3EPNA 5FF4A 5J2TE 1IIGA 3ANYA 5EBUA 3GXNA 2ZE0A 3W00A 5AHFA 4CVWA 3QPZA 4XSMA 2OB3A 3VZZA 1TB3A 3RCYA 3BG9A 4H01A 4XUYA 2ZUTA 2GPTA 3BAYA 2UXCT 4QE4A 2PDXA 4HFDA 4MHBA 4RPPA 4A56A 2YL6A 1CT5A 2A0NA 3AU6A 3WEOA 2VEFA 4I9JA 9CGTA 4EANA 3VIJA 2IKJA 3LI0A 5AQLB 3GAKA 4CNPA 2FHFA 2G50A 4QHRA 4PFOA 3TA9A 1HNYA 1AL7A 1DV7A 1NIUA 4ZB0A 4P8VA 2J79A 4O52A 1M9HA 3UWQA 1J2WA 1KXVA 1L0PA 4B9YA 1HKVA 3QPYA 1JR1A 1IT0A 1AW5A 5BMXA 4AY1A 3IJ6A 1W1YA 1OT1A 4QGCA 3PUOA 3WBYA 5JDHA 4NJHA 4JYDA 2NUXA 1QNPA 1W31A 3M64A 3MUY1 4GJ1A 1YKEB 1FWBC 1XLHA 4MJ2A 1VHNA 3KM8A 4PMZA 1QNSA 3Q2DA 3W73A 1VBJA 2XGBA 2CERA 3S6TA 2XIMA 4AQYT 7CGTA 4N9DA 1QNVA 3B0UX 4WRHA 1MQRA 3RX6A 4KETA 1AG1O 3KBSA 3LDVA 3FSTA 4BQ2A 4G63A 1Z7AA 4F8XA 4U72A 1TREA 3TAKA 5IXEA 4MHCA 1WKDA 4WDTA 3WLSA 5I3GA 2HH7A 4GC4A 3P4QA 2VQFT 3PBWA 1OFRA 4MGGA 2WKGA 3F5KA 3LCIA 3B0PA 2VKHA 4NX0A 4GPNA 2WO5A 3HMCA 5HXCA 4HK6A 1TJPA 2BGSA 2VX7A 3U4AA 2QUUA 1V3HA 1E1HB 4DZAA 4W8BA 4L4LA 4ZO7A 1SQ7A 4K8HA 3H70A 1ZNNA 1C9WA 3TNOA 3BAJA 3H4GA 2X05A 4JOMA 5AKQA 4GXWA 5LZLA 3UUMA 2Q3OA 1EOKA 4GZIA 2HE5A 2DW7A 4HFBA 1OD8A 2D69A 1JFXA 5JRCA 4UTWA 1QR7A 1S39A 3FBZA 1HKWA 3QOFA 1E6SM 2ISFA 1GYLA 4H63V 4HWIB 1NOWA 2W0UA 5HINA 1CXFA 1XKJA 2X8RA 2FIQA 2ZM6T 1KFBA 1BAGA 4XUGA 3UT0A 3GC2A 2H9AA 3HI2A 1EJVC 5EPDA 4XVDA 1W3KA 2CXDA 5JDMA 1SSDA 3DFPA 3VABA 2OXNA 1LVKA 4O2AE 2WANA 4E6MA 3BLEA 2ZXQA 3R25A 4AXKA 4ZFMA 3R89A 2OYLA 2W5FA 4J2MA 4IP7A 3WF3A 2WU5A 4Z2JA 3IAPA 4NAEB 4ACYA 5M03A 2PLKA 4Q7NA 5A8GA 1D8WA 1IXOA 3SURA 4NJGA 1CGUA 3B9AA 4UCGA 2ZFAA 2OT1A 3FDKA 3FCPA 3CMLA 3AIUA 1J5TA 4NJKA 1UD8A 4UQCA 3S47A 4WDWA 3VD7A 4KHPT 3S46A 4LAZA 1O95A 5AQIB 1D1AA 2IW5B 3FNDA 3T08A 4DQWA 3W2UA 2C16A 2JEQA 1AODA 2OOGA 4AY8A 3G5EA 3SN4A 3GN5A 5ADXL 3C61A 5DRIA 2YKSA 1G6CA 2F9RA 1IE7C 3DBNA 1MRQA 1K6WA 4Q4PA 2NVDA 4Y8FA 2Q8ZA 3N1AA 3P60A 3ARSA 2DZXA 2D0UA 3ZZ1A 1DJYA 3VXGA 3WAKA 3G1SA 2JKEA 4B3KA 1L2UA 4K1WA 5KITA 5CPNA 2WXDM 4E2DA 1MQQA 3AEEA 1KWGA 3RYFE 1K9FA 1XYCA 5C9XA 2OT0A 1P6CA 1SPQA 2VEPA 1AMKA 2BVMA 3S1VA 3VILA 2C0SA 2OLTA 3LGDA 2WJDA 4CGTA 1LORA 2PDJA 3GFXA 4GI8A 3BQ6A 3AAMA 4LVBA 3CX7B 3LBXB 5I3FA 1NDVA 4H9PC 4L4MA 3RHWA 2TAAA 2Y7FA 2DORA 4UTUA 5IWAT 3LM7A 1IWAA 3T81A 4WHBA 3WBEA 3W1NA 4O1FA 3KAOA 4AHPA 1CX9A 4UTTC 4N6FA 3G18A 2QCDB 4BI7A 4TU1A 3SRKA 1ZP3A 1P0EA 3SDOA 2Q9QD 3J7HA 3NYZA 1XISA 1GYMA 3QGKC 4JY8A 5A8QA 4N42A 1X79A 3Q45A 4K39A 3W71A 4PRWA 3IGSA 4DJED 3MP5A 3ITLA 4FO4A 3M0YA 1QNRA 1OQFA 2A7RA 4PR4A 4EF9A 4JHZA 1LG1A 3QHMA 2Y8UA 2EF9A 4Z0SA 1XI3A 4H8NA 1XICA 5AQHB 2LEHA 2VEKA 3UXKA 1ZBCA 5LP6E 4L61A 3S6DA 1KF6A 2GK1B 2PP1A 2Q02A 3M6DA 4EEDA 5DX7A 2ZM8A 2OKTA 3L0NA 3GYCA 1V6YA 4PE8A 2PDNA 3S0CA 3NQVA 3SS1A 4EAMA 2KMFA 5EK4A 3QTGA 5AQTB 4TUYE 5AC8A 4Z1CA 3WLPA 4UTHA 1D8CA 1KQYA 3AMLA 1EWDA 3SI9A 5KSWA 3CAQA 2X9HA 1XMQT 4D6CA 3GNXA 3M5YA 2DT3A 1AQHA 5HEOA 3EDEA 2CPTA 3TLUA 4HTEA 3W1TA 4DB7A 1RVKA 4WKAA 2P50A 3E12A 2DGAA 1LUCB 3EDKA 2FH8A 5HBFA 3CUGA 4ZE4A 5D2XA 3TA6A 4DEFA 2ACSA 1TCDA 3TYCA 5LNUA 2J47A 4IDPA 1UK5A 2ZRWA 4Q7BA 4ICMA 3VOIA 3WLKX 5DY3A 3KUMA 2X41A 4E4PA 1L6FA 2X0LB 3WLMA 2WVVB 1N7KA 1ML1A 4DJEC 4MMWA 4QCFA 2O4QA 3B9NA 1IEWA 3OP2A 2Z1SA 2P88A 2QPSA 1HW6A 2DEPA 4OE7A 3RIUA 1DWHM 3TYBA 4DWSA 3QV6A 1FWSA 3WQ6A 1HNXT 5CZKA 4ZE5A 3NQ7A 3H2MA 2OJPA 3OYZA 1W3LA 2G95A 3G1YA 4G1NA 3ZMTB 3MMDA 3BJTA 4AVOA 7A3HA 3JZUA 2FJDA 4WSKA 4GYSA 3HKEE 2Z2UA 2WCGA 2E8IA 2V8SV 3P2VA 5EU9A 3AEDA 1KBLA 4URIA 5I07A 3PPHA 4OU1A 4DAFA 4HU4A 1F6PA 1OD0A 1ICSA 1MIWA 1BKHA 2C5JA 4DNMA 3W2MA 5FEXA 3V0UA 4L56A 3LK3B 1M5WA 3URBA 4X9SA 3PJAJ 3OGVA 1W09A 4FR6A 2CWOA 2D20A 2J7BA 4C65A 2XH4A 5D03A 1YHTA 1UR0A 1W1TA 3CZJA 1U5PA 3IJ7A 3HJEA 3UF9A 2O92A 1A53A 5FJJA 2F7FA 1B3YA 5JH7E 2JKAA 4H2HA 5D9MA 2CEQA 2EG8A 3UU5A 1ZBKA 2FFIA 2EPHA 4XD3A 4GYKA 3B9DA 4PSPA 1E4IA 5T8GA 1R7OA 1W5MA 3A3HA 4HNUA 1NAFA 4KEZA 2ZX9A 3EYPA 4MSSA 2F6UA 3LPOA 3R10A 3CH0A 3PB2A 3CK5A 2M6IA 3RM8A 4CD4A 3KTSA 1OK6A 1RALA 3H2CA 4PUJA 2Y62A 2DPEA 4F9DA 3DHPA 1XIMA 3MQTA 4EB6E 4BAYB 1CGXA 4DBWA 1PE1A 4HMEA 3VNMA 4GI6A 4EXBA 2PPGA 3Q4DA 3VKJA 3TNBA 4DBSA 1CI1A 1EGMA 2GOUA 4D71A 4BWLC 3K3QC 3C0LA 2W9MA 1E6RA 1R3VA 4DM1A 2D0GA 2G0WA 4OGZA 1ZLPA 1U5HA 4ECLA 1A5BA 1B3VA 3VMNA 2A85A 4JEQA 4KEVA 5JBFA 3KV9A 4AEFA 1JPHA 3A9IA 3R12A 3RAOA 4DV1T 1VCVA 2FMOA 3ARTA 4H3DA 5C9WA 1VQTA 4YTQA 5DO8A 1WLXA 5HAXA 4OOUA 1BSLA 3SRZA 2IKHA 2VTFA 3QJAA 3UWUA 4XSLA 3U3IA 1CGYA 3CPZA 2XASB 5CPTA 4JUYA 1JF6A 3LFMA 2E2AA 1ZBVA 2PEVA 3AWOA 5EMLA 4FNRA 3CNYA 5LJNA 3CWOX 1RHCA 1R3RA 1MXGA 3LCHA 1YBQB 4W86A 2Y5EA 3AO0A 3W07A 2POTA 2C71A 3U7BA 2LM2A 2KX9A 2EEXA 2CW6A 3P4RA 3HF3A 2H88A 3WL1A 1MSSA 2H3RA 1JFHA 3CX6B 4RW3A 3PSVA 4E7ZA 4V28A 2W61A 2VC5A 4ZENA 4EAYA 2PGRA 4LSBA 3II1A 4GKJT 3UTKA 1HGYA 4LFYA 4LMLA 2QJMA 4C6DA 4A3YA 4XZHA 4AZGA 5C8BB 1S5MA 1SJCA 2VL4A 4ZEPA 2CM0A 4ROPA 2C19A 2WSQA 3IJLA 5HQEA 5K9DA 3J7Yq 1DIEA 2OLSA 2ZUVA 4B15A 3UU4A 1H3GA 3O06A 4KRZA 1BG4A 4JI3T 1K4GA 3P8CD 3SB0A 3MUZ1 5I09A 3N14A 1KBIA 4WEVX 2PTWA 1OF8A 3UNTA 2Q09A 3PFMA 4LT9A 3W7LA 3VR9A 2QPXA 5FJIA 3KL0A 3P4WA 3WKZA 2J7DA 3BXWA 3O6DA 1GTEA 2ZUUA 3LBOA 3P84A 1W91A 3VKDA 4YHHT 1GGOA 4CNOA 1UG6A 3VIPA 3FHAA 4J40A 3V3WA 2VKJA 1G69A 3F7JA 4IHCA 4UIOA 3TXZA 1W0BA 4JI7T 3RITA 5HJXA 1DWJM 3NKZA 4I7VA 5JDLA 3S5OA 4F8HA 4TNWA 5H1WA 2XISA 3GG1A 3UERA 2R91A 1UR3M 1P1XA 3T78A 3LYEA 2UXDT 2XAJB 4JFTA 1OFPA 1IF2A 5HNUA 3D47A 2DH3A 4F0SA 4DPQA 3DIPA 4LRSA 1QNOA 2J74A 2OSWA 1AW1A 3HV8A 3GVVA 4GKLA 4PUEA 3LQGA 4IQJA 4CQIA 3ATZA 5I3JA 1VYRA 3AIQA 3QR1A 3OBVE 3XINA 4UQAA 3MPGA 4B3ZA 3C64A 4K3ZA 2ZXAA 4A3UA 3H2FA 3C3UA 3SM0A 1QO2A 2SFPA 4AQFC 3PM6A 2Y7EA 2WM9A 1J5WA 1AJ2A 2GWGA 5IDZA 1MW3A 4KRTA 1ADSA 2PLJA 4ASKA 4X66T 1QMLA 3P14A 3P6LA 4DI9A 3M6YA 2WNZA 1XDPA 3DC8A 3CAVA 4JXCA 3IEEA 1PJ9A 3MUCA 3K1DA 3LD5A 1S3HA 1GWJA 2VFIA 2XVKA 3W7CA 4JYFA 3FBLA 1UR1A 4KGJA 1EF2A 4PODA 2HNEA 4FNUA 2V9DA 2LHNA 3A12A 3TN4A 3GB6A 1PIGA 4NASA 4CVUA 2BXVA 2FJAA 1Q6OA 3CUIA 4IE6A 3P74A 2ZIDA 2R9RA 1HP5A 4W87A 1XC6A 1E6QM 3IUHA 4IF2A 1FWNA 3IVTA 2J1DG 3ABVA 3ITCA 5L47A 1B4KA 1U1UA 4FF7A 4TMBA 5A6JA 3TROA 2FZBA 4MY9A 4UXDA 2QYWA 4AF0A 3R84B 1IZKA 1QPKA 3T2OA 2A2FX 4YJ2E 1A49A 3T8OA 2HPMA 4LGXA 1KGXA 4QNEA 3IJQA 3VNYA 3CQIA 2YW4A 1W5OA 2NLIA 2JQ9A 1H62A 5BW6A 4KIEA 2QUTA 1OADA 1BPLB 1NOFA 1IT7A 3W1MA 4PMRA 3P5YA 1RA0A 3SUUA 3NA8A 1WUFA 3OZPA 4RZ4A 2E8ZA 3ZYKA 1Y7VA 3QRHA 2Y61A 4RXGA 1ICQA 3KZSA 1XQKA 2WM1A 2UUBT 3ZOAA 3TOPA 4P09A 1SO6A 4LS0A 1P5BA 1UKOA 5E5CA 1XDOA 5G4EA 2QW5A 2Q9QC 4FJOA 2YCEA 1JZ4A 3NQDA 4QX8B 1MUWA 4LBSA 5LIXX 4PTWA 4S2BA 4H9NC 3IJIA 1M7OA 2ZXDA 4DXKA 5A6SA 1CYGA 4AC1X 1W9UA 1XIGA 5TQLA 4GZEA 4EIVA 3AAEB 2ASHA 4PB5A 2CWYA 3F4WA 4PCTA 3ZJ2A 3WMLA 2BDEA 4DV2T 3MMTA 2FZMA 4B6XA 2HEJA 4GQGA 4D6JA 1DPMA 3SBFA 3HG4A 1ZY9A 1EIBA 3WUEA 1JDDA 1SMDA 4LF8T 3AXJA 1GJUA 5DXYA 1HTIA 3GDRA 3BOFA 3NNTA 4MWAC 3PZOA 4MPKA 2VO5A 1TX0A 4BHYA 1M6JA 4R9OA 3HFTA 1HJUA 3LTSA 4P5UA 4UTFA 1JUEA 5JU6A 3AQUA 4KESA 3K30A 5FD0A 3S1XA 2JRKA 3AEAA 1BTCA 3WH7A 3IJ8A 4OVXA 2HWGA 2QYGA 3FJNA 3FKKA 1BYBA 2ZWZA 4GGHA 2P0OA 4JTRA 4HA4A 1EFZA 2E9LA 4LYQA 4ZFCA 4O17A 1GQKA 1MNDA 1B3WA 3GY1A 2A3EA 4ML9A 4DZHA 1UURA 1EKOA 5HNTA 2DP3A 2Z1KA 2OVLA 2GQ8A 4A2SA 5CZ0A 2GGIA 1T72A 1ZS2A 3G1RA 2I5IA 3GU2A 3TLQA 5TD4A 3WX7A 2QCMA 4QCEA 3VD9A 4BR1A 1W5QA 3NQFA 2HISA 1VLIA 2FGLA 2WCSA 2WJZA 4TXEA 1EF3A 4MG4A 2X16A 3CV7A 4DXVA 4NAEA 3KBWA 2YDQA 2WKJA 2CNCA 1IIHA 2PAJA 4KCWA 4GWEA 3GDKA 4FA3A 3FVMA 3QN3A 4H6RA 5MKGA 4XKMA 3NOEA 2LJLA 5CLTA 3TLVA 1GOXA 2QZRA 5EFDA 3THQA 3QC0A 3NQGA 1E0VA 2NW8A 3MYOA 3OG2A 4GQRA 3S83A 5IBXC 4JTUA 2ZMAA 1L6WA 4WW0A 3IHRA 3PTKA 4YSXA 3VC6A 5JRCB 4C6JA 3ONCA 4MLJA 1YTDA 1OCNA 3WFZA 1E9IA 1LL4A 2G3MA 1JDCA 3GVRA 2JQKA 4QH4A 2DUAA 1P1MA 2YU1A 3SN0A 1GVYA 1DJGA 3GU1A 1SZFA 3OA3A 1ITXA 2Q01A 2R1KA 3A6OA 5CA0E 2QJGA 5FL0A 2C3ZA 3CAKA 4RK8A 2QJIA 4UWMA 3KV6A 4NUUA 2YFOA 4AMAA 1ZHCA 4AD3A 3N9MA 3PAOA 4KP3C 1US2A 2V8ZA 3THUA 3GZ3A 2GFTA 4FLRA 2AOSA 3M0HA 2RKXA 2CLFA 2ZRVA 3AIVA 3AYSA 3TJXA 4JIPA 5D9NA 1Q2RA 4GY1A 3KWSA 3HA4A 2FMNA 2J7FA 3CHFA 2QA7A 3ONJA 2Y7GA 4V1Av 3L4YA 1V79A 2CLMA 3PULA 3LV5A 5F4WA 3SY8A 3W7OA 4HA0A 4BZYA 3CV2A 2Z2AA 3RC3A 2NX3A 2P3ZA 3L4UA 3L4WA 5CXPA 2G3FA 4Q8QA 2SPCA 1Z42A 3WUBA 5LGZA 4UOJA 4DLFA 3EDVA 3ZO9A 3V18A 1X6NA 1XD1A 5BWAA 4CD5A 4DBRA 4TVCA 3WDRA 4DN1A 3PP7A 2A21A 5CG0A 1TV8A 2QF7A 2X1SA 2CLHA 4PJLA 3FFSA 1I0BA 1QRQA 3BARA 3PTQA 1AQ0A 2LLYA 1D3HA 2WZIA 2Y0FA 3QLLA 2WDVA 1YMYA 1PDZA 1I8JA 1DOSA 2XZ7A 3WDJA 1KCKA 1YTKA 3APYA 2PBIA 3F4VA 3U7VA 2WK2A 4NXMT 5HA7A 1KM2A 4YHGA 1KM3A 1I75A 3KWXA 1ZP0A 5H6RB 1SFTA 2ISSA 4AX6A 1TPFA 1EJXC 2FB2A 2P1FA 4FIRA 1I2OA 1Y5XA 5L6UA 3ZWTA 3UA3A 4EV6A 2OZ3A 3KCJA 2DJLA 1NFBA 4O11A 1N55A 4KX6A 3NQ6A 3W7MA 3QV8A 4AD4A 1V02A 4UIGA 1YDOA 5CEWA 3GVQA 1Q4WA 5HWNA 2X66A 4EYUA 1LOQA 1QHOA 3PUQA 4JDYA 3CZ8A 3CM4A 2GL5A 3K8LA 1CCWB 1P48A 3N3MA 4D6GA 1JNDA 3MVTA 3M0IA 4Q4SA 1KGUA 1WV2A 3OA5A 1UUSA 3UPWA 2YJQA 3QSTA 2YKKA 4W7UA 1KV8A 5GNXA 3KBJA 3CQXC 2PZNA 2K3WA 2EHOC 1J6PA 1LWHA 4ZOAA 4JI6T 2NV2A 4B5NA 4A3QA 3BAWA 4Z0JA 2G4JA 3NYDA 4IFKA 3EXRA 4LH8A 3L2IA 4NSBA 3VGBA 2PDLA 1OCJA 1R2TA 1EGVA 4AZBA 2YDSA 1SMAA 2YB4A 4GKKT 3T0CA 1TTQA 1O60A 4HMNA 4NAFA 1JNRA 1XYLA 2VX6A 3A13A 2WVSA 5AN7A 4IGHA 4AH7A 4XX6A 2XJ7A 1UQYA 1HG5A 4M24A 3R6IA 5HNNA 1Z41A 1KA9F 2HPJA 4CCZA 1KFKA 5BYWA 1JPKA 1WXYA 1C8QA 4XK2A 3IK2A 4NNAA 2OTDA 1XX1A 2M67A 4DY1A 1DJWA 3URNA 3PZVA 4DRSA 2ATMA 4OZOA 3OBEA 4CKQA 3PG9A 4ZSTA 1S5WA 3AECA 1FWWA 2FZDA 4H9RC 4B5TA 3C2EA 2RJHA 3UYIA 5L4HA 4JPGA 1XUUA 2OODA 4ZB5A 2J7GA 4B3LA 5H2ZA 2RFGA 1F6KA 4DJDA 5GPRA 3C2YA 1DYSA 2N9DA 1BYCA 4QLKA 1SUMB 1F8MA 1I0DA 2J7CA 3G1VA 3OJGA 2B1EA 2YCKX 4WY0A 3B8VA 3SGZA 3OJAA 3KBNA 4Z1DA 1LRQA 5J0ZA 4D6HA 1S2WA 2W27A 3ZYLA 3P62A 1A5AA 3WD2A 4HB7A 1R0MA 2YLLA 4X0VA 1REQA 5LYJE 2OU4A 5HMEA 4DJDD 1UH4A 4Z17A 4MYAA 3ZCIA 4ACZB 3G8RA 3MA9A 1Q3NA 1Q45A 2G8ZA 4ZOEA 4AXNA 5LIYX 3VD3A 1YRRA 5CJ5A 3AFBA 5FL1A 2INFA 4HNNA 3GFYA 4R88A 2E0PA 4ZO6A 4GY7A 4QG8A 1W9DM 3PN8A 2HE8A 2BHZA 4QDMA 3QC3A 1E51A 1L2QA 2HBVA 3WMBA 1HF6A 3N2MA 5DRCA 2VK9A 1V9DA 4WSJA 1W6TA 1LWIA 3EX1A 3MP3A 1V6VA 3PY2A 4FZIA 3LOTA 3H7RA 4YN5A 4AZCA 2NVAA 1J1JA 3UD6A 2ON3A 3HURA 2BG9E 3MBDA 2E68A 1PPIA 2BY0A 1DHPA 2OPJA 3PR2A 1SGJA 1WYCA 1QATA 1P7TA 2XYLA 3WQCA 4G7FA 2DDXA 2AL1A 3LHYA 3R11A 1DEDA 3ZMSB 4LCRA 4YIWA 4DO5A 2E5DA 3N18A 3FJLA 1E6PA 1ESWA 4DUZT 1OX6A 5DABA 4DI8A 2HTMA 2Z2BA 3EDUA 3GSMA 4PJJA 4A8LA 5LGNB 4FXRA 2HK0A 2CITA 1O3XA 1PS9A 2OGJA 3W26A 4MWAB 3SUVA 1JI2A 2DI4A 2UUCT 4O1BA 4S3JA 5LNVA 4WQ6A 2A3LA 2FH6A 1P0DA 5XINA 4NUVA 2PWHA 4ORIA 3QW3A 5A8MA 5BU9A 4UF0B 1JYWA 3S9YA 1UD5A 2XSAA 3KFWX 1J10A 2F84A 5G5IA 3LHUA 5FY0A 5DF0A 1EP3A 1K6AA 3KVAA 3TWBA 3AHYA 1HJSA 1WUEA 2GJXA 3UUXB 4M82A 3WDPP 1PTAA 1YQ4A 3KOFA 3SZ8A 3RM4A 4XBKA 2QULA 1UD6A 1BRLA 2Y8VA 4ASTA 3QB5K 2QV5A 3G0UA 1A0EA 2H6RA 3TN6A 1KD0A 4CEXC 4RE4A 1IWBA 5AQUB 2I16A 4PW8A 2W79A 3BMWA 3WD1A 1E0TA 2BXZA 4C6MA 5E0CA 4JEUB 2POZA 3AI0A 3AXJB 3F4DA 2WZHA 2WBGA 5CSSA 3AA6B 1AL8A 2B31A 3AIWA 3AE1A 4NY2A 2XVLA 4JFUA 3N12A 5BNKA 3VOHA 4I0UA 3E2VA 2F6KA 4BEQA 4JQ2A 2YOCA 3ARWA 4RZBA 1QCWA 3UW6A 2Z1WA 2CWNA 1NVMA 1VBUA 3DI0A 3K8KA 2V5CA 3U6WA 3JC6D 2V68A 1S1PA 3PZIA 3LEPA 1SR0A 4C6OA 4X60A 1W54A 5MHBA 5EMMA 3WDQA 4I90A 4Q8TA 4LVFA 4XAXB 5J8LA 3AXMA 3RH3A 4YLHA 1JRCA 4Y8EA 4OJYA 3GNDA 4GI4A 1MRAA 3UU8A 3L66A 5EK3A 4YSYA 2DIEA 4QX4A 1QTWA 4G6CA 3RX2A 2BASA 1E71M 2Y5JA 5T9BG 2OFJA 1Z48A 3ARRA 2VENA 2WZTA 3WQ5A 1OIMA 1SA0E 4IISA 4PMQA 2BOGX 3VCRA 1QDSA 2CKRA 3FKRA 2J13A 4ISSA 2UXNB 4AF0B 1TMHA 1LM1A 5HUOA 5I6SA 3MSYA 3BK0A 1M03A 2YPIA 1WAWA 1F3XA 1UP0A 5CSUA 1VENA 3DYMA 4PTXA 4NILA 4BY3A 2C1GA 4OBTA 3OVGA 4FOJA 3MI3A 1J5ET 4IL4A 1C7TA 3HL6A 3V7PA 1FDJA 3H53A 1DQXA 1BXCA 2V30A 4HD5A 2DFAA 2DNXA 1ZQ5A 3MP4A 1FP8A 3T2QA 3CUFA 1YKHB 3B8SA 1GK8A 4YTPA 1WYBA 1V3LA 2C5IT 3IIZA 4ZEYA 3ZN1B 3AE6A 4POCA 1N33T 5G2HA 2HDJA 1JPDX 1K7FA 1T8XA 2AAAA 2OWCA 1MW0A 3VZYA 4Q8WA 2NW9A 4ILAA 3U78A 2GK1A 4EVZA 2CBJA 3CO4A 4WY0B 3GDLA 5GNZA 3N4FA 4NZ1A 3SCTA 2X7VA 3T55A 4XWUA 4LY8A 4GO9A 4OKDA 4AVNA 1E1FA 1VP5A 4H19A 1JCLA 1MUCA 5K3VA 1VEMA 4N9CA 5G1MA 1RR2A 3S1GA 2BZBA 2BY2A 4IMGA 3VC5A 1IR1A 2WC4A 4N02A 4NZJA 1W9XA 3MUXA 1A3XA 2VR2A 3IEBA 3TDFA 1ZB5A 4N9EA 4GOAA 1XRVA 1QPQA 4O15A 3GH4A 1W3TA 3SWHA 2VM8A 4HT3A 2BVLA 4IGUA 3NPXA 3RRCA 4R9XA 4EK7A 3CIRA 3USZA 3BQIA 1WXJA 1NWTA 2DL1A 5C9UA 3TE9A 3ZT7A 2Z1VA 4MB4A 2WNNA 2PD5A 4J3XA 3RR4A 4A3HA 4NXNT 4FI4A 4O1DA 1UP3A 4HWDA 2VKOA 4HN9A 4R5EA 3VCNA 3FGCA 1MYRA 2XIQA 2R1NA 4H00A 5CGTA 4UZUA 3E96A 1TUFA 3LCWA 4QAIA 1QI0A 3N5LA 4R7JA 1PO9A 3EA2A 3G6LA 4AIUA 1XLAA 5AOUA