4H9QC

Complex structure 4 of daxx(e225a)/h3.3(sub5)/h4
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQAARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 76
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9qC00
4H9QC 4H9RC 4HGAA 4H9NC 5KDMC 4H9OC 4H9SE 4H9PC
chains in the Genus database with same CATH superfamily
3F31A 1KEYA 2ACXA 2QYWA 2W4XA 4EZHA 5LGTB 4X1KE 1T98A 2VL8A 2XQYA 3TLWA 4BAYB 1D0ZA 4JI7T 2K24A 4I55E 3GN5A 3FZKB 3HA4A 5ABFB 2CBJA 3BK9A 1XNRT 1SA0E 2NTYA 4O4IE 3ZC0A 2CE7A 3AA6B 3LSVA 4PJLA 3OJAA 3AAAB 4BA9A 3CVRA 1EZ3A 3PJAA 3M3ZB 3R84B 2VVNA 4X1IE 3E08A 1WCRA 5F5WA 1U5PA 1NENA 4DV6T 3NWIA 5ETWA 4OX9T 2LSIA 1D1CA 5FXVA 3RI5A 2FJEA 3E0ZA 2Q9QC 2WMOA 2E9XD 3ZC1A 3J7Yq 3AXJB 4HE8A 3ANWA 2BS2A 2V7LA 4GOUA 4ZZCA 3AEAA 3C4ZA 2LLYA 4U7YA 3PUSA 1HCIA 2XAQB 4MHCA 3MJXA 3Q5DA 4DV5T 3EDUA 5JR9A 4CXXA 5LCYA 4P0BA 2X67A 3LBXB 2LM9A 5FXZA 3FZFB 1HX8A 2IAKA 4B3RT 1W0BA 4U2YA 4AKHA 3EHZA 2UXCT 2PJQA 2M67A 4DV4T 3AE4A 2HHHT 1MIYA 4O2BE 2V1DB 2X0HA 2D5UA 1E7PA 2XM2A 3RH3A 4E7ZA 2ODUA 2WAUA 4UXNB 5CGMA 4O2AE 4QH5A 5HAXA 1UGOA 4O8SA 4U33A 3J9X1 3JC6D 3TLUA 4EXTA 1E1HB 3ONJA 5H6RB 4K0KT 4PFOA 4UVAB 5JDHA 2HN1A 2X66A 1BR0A 2FUPA 2LSYA 4HFEA 5EK3A 5AQJB 5HXSA 2EHOC 1VRBA 5JVDE 3PV0F 2J62A 3SRZA 4DBRA 1UUSA 4HEAA 1LRZA 2LOSA 1CUNA 1W9RA 5HXCA 3DP7A 4DR5T 1OXZA 4UEMA 4UELA 3GN5B 4ADZA 2V7MA 3AB3B 3KBTA 5FVLA 2J1DG 5L4EA 3BQIA 1XDOA 4LFBT 3H37A 5LGUB 4HWDA 4A5XA 4H9QC 2K9AA 2QGSA 4IE7A 5LG4A 3JADA 4PW8A 4TWFA 2BDEA 3LJCA 3ZN0B 3RYFE 5JR9B 2PTFA 5JDNA 4UV8B 1IBMT 4WBNE 3P7IA 5JRCB 3FBZA 3I9WA 1VCTA 2WZHA 1BR4A 3NKZA 4YJ3E 4CI2B 1FEWA 4HWFA 1NEKA 3MZKB 4C90A 3QOFA 2B1EA 3RYHE 4Z91A 3UUMA 1W09A 3ANWB 1SUMB 1HG2A 2K5BB 2CBIA 2XAFB 3OVUA 3RQWA 3T1HT 4LF9T 5J2TE 2LKGA 2ACZA 4PJNA 4DR7T 2W61A 1O3XA 4OYKA 4MBQA 3DTOA 3PUAA 3L39A 1OEDE 4NIQA 4IDPA 4AIUA 3QNUA 1XMQT 4MALA 1SE7A 3RHWA 2LEHA 3AEGA 4WW0A 2EHOA 1SHZC 4DIDB 3V5UA 2RPAA 2HH7A 2XSBA 4PK6A 4UF0A 5ABHA 2IIUA 2R6GF 4IE4A 2WSSV 2W66A 4TN7B 5IHYA 3UFGA 5L3FB 3EAMA 4L0RA 3CX7B 4O4HE 4YHHT 3HKEE 4JV5T 4U3CA 4F6RC 1N36T 1KNRA 2LKHA 3PURA 2CLYB 3I9YA 1QSDA 3GWHA 3KV9A 4GK0E 4EIWA 4EV6A 4QX8B 3ZMUB 4AKLA 3BQKA 2PG8A 4PK5A 2WY2A 2YINA 4YLHA 5J1GA 5FL0A 5HEUA 4JBWF 3RLFF 2H7VC 4OK0A 2IUBA 2KWIB 2M6BA 1X79A 3CMLA 2BG9B 3KBUA 1FMWA 2JJ9A 2V6XA 2V7IA 3NZPA 4GK5E 1XMOT 4GKJT 4DR6T 3LBXA 3QUJA 4GYRA 4OYJA 5L4HA 3B13A 5HEOA 4LFAT 1WR0A 3PTRB 4UVCB 3HKCE 5LBQB 3RX6A 3W15B 3NBXX 3A7MA 3JCFA 3K8PC 4ANJA 2WMNA 4HGAA 3ZSSA 4EGWA 5L47A 3ZJ1A 5C8YE 3UU6A 2ZM6T 4XBFB 3R6NA 4AQFA 1IAPA 1YKHB 3N9PA 5JDQA 2VQET 2Y48B 2XQ5A 4A97A 4AKRB 4HFCA 3FBLA 5BR8T 4HTEA 3AE2A 3EI0A 5LMNT 2JQKA 2CEAA 5LJNA 3P4QA 1R8IA 3KVAA 1UK5A 5JDGA 2UU9T 2XQ3A 2WU5A 2H3RA 4PK4A 2DWGA 5AQLB 3KV6A 3RIAA 4JLEA 2OA5A 4OFZA 5FYMA 3ZMVB 1MNEA 5IWAT 4QKNA 2OLTA 2PFVA 3TLTA 4DR2T 2W00A 2XQ4A 2VVSA 1XWMA 4DNDA 4YSZA 5ABFA 1I94T 4HFDA 4TWDA 4U74A 5FP3A 4YY3T 4X62T 4BJMA 3AE9A 2KZ7B 3CQXC 2JMHA 2VL0A 5FY0A 1N33T 1IJ6A 4DR4T 3AXJA 5LGNB 4I0UA 2IC6A 2CM0A 3AE8A 2MBGA 4KHZF 4I4TE 3B57A 3T1YT 2WM9A 2V6YA 2LM2A 2JQ9A 2Q9QB 3PU3A 4HWHA 3AAEB 2K3WA 3QK6A 4IE5A 3KINB 2NOXA 3LDQB 2N1GA 2X9HA 3KDSE 1G73A 3UULA 1D1BA 4DV0T 2VK9A 5L3DB 1CHUA 4HWIB 4ZEYA 4PJMA 3PUYF 5LXTE 2YEVC 1B7TA 3KV4A 3LK2B 4J2CA 3PUZF 3HKDE 2YKSA 3O1JA 4QXBB 2E5VA 2MYSA 4ZI3D 4Z8XA 2DL1A 4WZXA 5DQWA 5LMUT 1KFYA 4EYYR 4L9IA 4IDZA 5CA1E 5J2UE 4DUZT 2C5KT 3Q9DA 2ZM2A 3QC9A 5AQNB 3LK42 4DV7T 4U72A 4EB6E 3C98B 4AKIA 2CLYC 2D2SA 2J47A 4H63V 2NW8A 2H7OA 4NUVA 1Z0PA 2BKNA 3CX8B 3RKOA 1L0VA 4IREA 4UV9B 1FMVA 4KX6A 2VWAA 3Q5EA 1KNZA 5HEGA 3FXDB 2XZEA 3CK6A 1BR2A 3IA3A 2A3DA 4NXNT 4DUYT 2XUEA 2LRLA 3CPZA 2KNDA 2XJ7A 1G8XA 4HFBA 1UX5A 4DR1T 1T7SA 3OPCA 3PUWF 4QH4A 3ZT5A 1UX4A 4E7SA 4JYAT 1I6ZA 2EHOB 5EZYE 4LF8T 3MACA 4YXDA 2V6YB 3RYIE 4AQFC 5M4YA 3C4XA 5ADXL 2YDSA 4TZ4C 5JH7E 1FIOA 2XTLA 4ZOLE 5AQKB 3FZLB 2VKHA 3N5LA 4DV3T 2XAJB 1MIVA 2WDRA 2X0YA 4IL9A 3H3MA 2XAGB 2XPKA 3N9QA 5JDFA 3UU5A 3ZCIA 5KX5E 3RIFA 3ZN1B 3ETUA 3RIUC 2KXPB 4COFA 5IUXA 1N32T 1MIWA 4KMCA 4QXHB 1IZNB 1X9BA 2MAWA 2WQYA 3A5XA 2CA5A 3PU8A 4TV8E 4ZI2D 3Q5WA 4X1YE 3AAIA 3AA0B 3VRBA 1HTJF 3AA1B 3ETVA 4HWCA 4A98A 4QX7B 3OYZA 4ZI2C 1S35A 4X65T 1YKEB 1NWMX 3NRXA 3RRWA 2FJBA 2NP9A 3P50A 5DJQC 4ZXLA 3ZYMA 3KVBA 5HWXA 3ZT6A 2BG9C 3UQ4A 3F57A 3RC3A 3MK7C 5AQMB 2YU2A 5FKYA 4KUMB 4M1PA 4HFHA 5AQGB 2LT3A 4X5TA 3ZMTB 4XAXB 3JC6C 2XQAA 2XQ9A 3KFWX 3VHLA 2DWKA 5L3EB 2JIWA 3RKGA 2W2UA 1YW0A 3VR8A 3WI3A 1Y01A 3NRYA 3AE7A 4U2ZA 5EK4A 2NTXA 5FVKA 3SS1A 2E2AA 2VASA 1YQ3A 2LHRA 2WDVA 2BVMA 4MFRA 2XAHB 4F8HA 4DV2T 3N9NA 3U78A 3VKHA 2JQHA 2YDRA 3PUXF 4WYVA 1ZEEA 2N9DA 5FMNA 2LOPA 1OEDB 3P4RA 2BBJA 1MNDA 2QVAA 3NVOA 4IIJE 2NW9A 3RRCA 4EOZB 5JDMA 2BKOA 2DLRA 1U4QA 2AXDS 4CQIA 4LF6T 4LFCT 4H9OC 2VQFT 5AQQB 5AQRB 1HG5A 5A1LA 4CXYA 5DQVA 4H9PC 3C4WA 5CFBA 4ERRA 3PUQA 2D9DA 3RC8A 2UUBT 3AEBA 2YK0A 2LSJA 2YU1A 4V1Av 3CQGB 1HNWT 5C2TA 1BR1A 5LOVE 3K3OA 5LHGB 3UUXB 3SFDA 3I0QA 3JAFA 5L2LA 3N9LA 3OKQA 4JI2T 2ES0A 3N2OA 3TLVA 4AI6A 1M7KA 1J5WA 2V7KA 2DNXA 2CXFA 1XZYA 4EEBA 4DV1T 4ILUA 4U31A 5JQGE 1T72A 1US7B 2KT9A 3PUVF 3UUNA 3UU8A 2RP4A 2YDQA 2MPKA 2J4GA 4ISTA 3RF1A 2CHOA 3K3NA 1E2AA 4G2AA 1T8BA 2WU2A 4ILBA 1JNRA 4PNIA 2CPTA 4AKGA 3P4SA 3VRAA 3ONLC 2FJAA 3IHRA 3O9XA 4JI0T 4IGUA 3C50A 1J1JA 4CI1B 2LSKA 4B6XA 1XNQT 1MMGA 2WP9A 3AE3A 5HXRA 1WLXA 2XM1A 2Y6XA 3ZPOA 2AE9A 1H7CA 3E22E 5LBMA 3V5SA 1OEDA 3ESLA 4TUYE 2WWVA 4JEHB 5AQHB 2UXBT 2HN2A 3F2EA 1HNZT 1YD8G 5AFUL 1IJ5A 1OWAA 1YQ4A 2WS3A 2XASB 4HN9A 1QLBA 2W67A 4EAHA 2JQQA 2XQ8A 1VOMA 3N2GE 1NAFA 4H9RC 3I0OA 3X1DA 3CQCB 2YOEA 2V8SV 5AQSB 2LE8A 5HCMA 5FXWA 2KINB 1UURA 2Q9QA 5AQOB 2E9XC 5IYZE 3WAKA 4JI6T 3DJBA 1LVKA 4YSXA 4IE6A 1MMAA 2A72A 4CN6A 3GA8A 3AE1A 1ZP0A 1ZOYA 3UFEA 2K48A 5JREA 4K0UA 4ILAA 3HI2A 5FNVE 2XQ7A 4DO0A 3ZEFB 1JNZA 2P9BA 2ZM8A 2X9XA 3TKLB 5C3JA 2KLQA 3LK3B 4HKAA 3M65A 5EK2A 3K1SA 2IDOB 2ZM0A 4LF4T 3I1AA 3ZKRA 1HNXT 3VU7H 3RQUA 4TX5A 4B3ST 2QA7A 2L3LA 2BZBA 2UXNB 2CHNA 3CX6B 5AQTB 2RA1A 4CXWA 4JI5T 5FL1A 4P0AA 4B3MT 2FJDA 3CIRA 1KF6A 3IEEA 5CB4E 5L3BB 1ZHCA 4QWNB 4ZS2A 2WCAA 5CJ5A 3H3AA 5HEHA 4EZ4A 2V7JA 1YXRA 4NUUA 2WBLA 3HKBE 4IL4A 5CA0E 2ODVA 1WYCA 2H88A 1MMDA 2A9UA 4KI0F 4O4LE 4ZI7E 5HYAA 4YT0A 4AQYT 4NXMT 5ABGA 5HCJA 5H6QB 4X66T 1W0AA 2I0MA 2KSRA 2X9YA 2DHRA 2VKDA 3IF8B 4ILCA 3UUBA 4AISA 3L8RA 4YTNA 2JRKA 4GKKT 2YN6A 1WFDA 3HL6A 3L3PA 4WNKA 3RPUA 3UTKA 5F3JA 1DU2A 3FHNA 2CXDA 3AVSA 4UR9A 4H9NC 3AEDA 3N9MA 2VB6A 3A8YC 3UU3A 3UT5E 5JRCA 2FBWA 2EHOD 2CCQA 3NZQA 4P09A 5J0ZA 2A2FX 3O1HA 3ABVA 1HFAA 3K3QC 4AQGA 2L9QA 3OYXA 4ZHQE 2UUAT 5LB7B 5LJMA 3P4WA 2C5JA 2E8IA 4EEDA 4IDQA 3UU4A 5JR9C 5LHHB 4IDOA 4KP3C 3L09A 3EUHA 3MA9A 3PDYA 4DVDA 4GYSA 5GONE 4ISSA 4LMKA 3SFEA 2BS3A 5LHIB 1J5ET 2Q9QD 4O4JE 5ABEA 1IBLT 3RYCE 2W63A 2NR4A 3ZMSB 5AQIB 2X0LB 3OTOT 2CWOA 2E9XA 3ZJ2A 3IBPA 1IBKT 2IC9A 2D0UA 2KMFA 4H9SE 4IDNA 2L8KA 4P1NA 3VKGA 4TNWA 3AE5A 3CWZB 5AQFB 3QB5A 5LP6E 2WB5A 4C91A 3FZHB 3EABA 4WBOA 1N34T 4DBQA 2KWHA 4KBMB 1V9DA 2BVLA 3OBVE 4I50E 4UIGA 3SWHA 2DCFA 3ZT7A 4GIWA 1D1AA 4FI5A 4QH1A 4CZZB 2XY8B 4Z90A 2I6HA 2Z6EA 5KXJA 1OEDC 3P8CD 2CRBA 2M6IA 4LF7T 5LG3A 1FJGT 3G06A 2BG9A 4H63H 5JDLA 1S94A 2Y8DA 3FB2A 5AQPB 2V5CA 5HWYA 4JI4T 1WR6A 2XHEB 3ONXA 4JEUB 3EDVA 2DI4A 5F8PA 3ZCJA 4X64T 2BG9E 2UXDT 2X9WA 2W0GA 5HXEA 4YHJA 2X68A 2I59A 2XSAA 3FZMB 1Z8UA 3LFMA 3PE0A 4PAGA 4PJJA 5FXXA 4DR3T 4Q25A 4NPPA 3AEFA 5E0OA 2G0UA 3VR9A 4EYUA 5JTGA 3RIUA 4LMLA 2V5DA 3WAJA 3U3IA 1KNPA 3PUGA 4YJ2E 3N2KE 4A56A 2CXLA 2IMLA 5AQUB 5HEJA 1D0YA 4YTPA 1HX1B 2V26A 5TAOA 3P4PA 5LA6E 2LSGA 4PFPA 4TWHA 5AQVB 3LG7A 2ZLYA 2IHR1 4X20E 4DMVA 2CMRA 4IHJE 2E9XB 4HFVA 2CWYA 2QRXA 2BBHA 4TV9E 4U7IA 4B3TT 3N9OA 2H89A 5KMGP 4TNVA 1UCUA 1LVFA 1D0XA 2HPLA 4MLKA 3B5MA 3FXEB 4YFSA 3AE6A 4DMWA 1QUUA 2UUCT 1HS7A 1M62A 3JAEA 3ZMZB 2VKOA 4L5GA 3AA7B 5FY7A 2JPFA 4XZCA 4YSYA 3EVYA 3O1IA 4HFIA 2PBIA 2SPCA 3D0TA 3ZLIA 2W62A 3ZSTA 4ASKA 3BQLA 3SOLA 3C64A 5L3GB 4IE0A 3C51A 4G63A 5HXHA 3O4XE 5L3CB 4CN1A 4JI1T 2N2NA 2GK9A 5KDMC 1GQEA 2MTQA 4OHFA 3PJAJ 4I43B 1XDPA 2IW5B 4BJNA 2C0SA 2NW7A 2E5LT 2MOZA 2ZMAA 3Q5XA 4UF0B 3HR0A 3QB5K 3ZYLA 4AXPA 1AJ3A 4CI3B 4JI3T 2HPJA 2LRKA 4QHOA 4JI8T 2UXXB 4YTMA 4JUYA 1MMNA 2LJLA 4N78D 3CKDA 3RGLA 3S4UA 3AEEA 3AECA 1ZV4X 2WDQA 3TLSA 5FY1A 3MXZA 1HR0T 3AVRA 1WRDA 2X51A 4FJOA 2C5IT 3UQ7A 1ZKEA 1Y64B 2JMKA 4QXCB 2NWBA 3MKDA 5BMVE 2BS4A 4IT4A 3ZYKA 4ZS3A 1LKXA 3T8OA 1HF8A 2WZIA 2BKPA 2OV9A 4UVBB 4ZI3C 1KK7A 2WWUA 2F4VT 5LNKA 2LHNA 2VURA 4CN4A 2D0TA 4KHPT 2B76A 4LMJA 1VCSA 1WYBA 2XQ6A 3KV5A 3Q2MA 5LYJE 4ZZBA 2VKJA 5DABA 4LF5T 3GMIA
chains in the Genus database with same CATH topology
3F31A 2ACXA 4EZHA 4X1KE 1T98A 2VL8A 2XQYA 4BAYB 1D0ZA 2K24A 4I55E 3GN5A 3HA4A 3BK9A 1SA0E 2NTYA 4O4IE 3ZC0A 2CE7A 3AA6B 4PJLA 3OJAA 3AAAB 4BA9A 3CVRA 1EZ3A 3R84B 4X1IE 3E08A 1U5PA 5ETWA 2LSIA 1D1CA 5FXVA 3E0ZA 2Q9QC 2WMOA 2E9XD 3ZC1A 3J7Yq 4HE8A 3ANWA 2V7LA 4GOUA 3C4ZA 3PUSA 1HCIA 2XAQB 4MHCA 3MJXA 3EDUA 5JR9A 4CXXA 5LCYA 4P0BA 2X67A 3LBXB 2LM9A 5FXZA 1HX8A 2IAKA 4AKHA 2PJQA 2M67A 1MIYA 4O2BE 2V1DB 3RH3A 2D5UA 4E7ZA 2ODUA 2WAUA 4UXNB 4O2AE 5HAXA 4O8SA 3J9X1 3JC6D 4EXTA 1E1HB 5H6RB 4PFOA 4UVAB 5JDHA 2X66A 1BR0A 2LSYA 5EK3A 5HXSA 2EHOC 1VRBA 5JVDE 4DBRA 3SRZA 4HEAA 1LRZA 2LOSA 1CUNA 5HXCA 3DP7A 1OXZA 4UEMA 4UELA 3GN5B 4ADZA 2V7MA 3AB3B 3KBTA 2J1DG 3BQIA 3H37A 5LGUB 4H9QC 2K9AA 2QGSA 4IE7A 5LG4A 4PW8A 5JR9B 2BDEA 3LJCA 3ZN0B 3RYFE 5JDNA 4UV8B 4WBNE 3P7IA 5JRCB 3FBZA 3I9WA 1BR4A 4YJ3E 4CI2B 1FEWA 3MZKB 4C90A 2B1EA 3RYHE 3UUMA 3ANWB 1HG2A 2K5BB 2XAFB 5J2TE 4PJNA 2W61A 1O3XA 4OYKA 4MBQA 3DTOA 3PUAA 4MALA 2LEHA 4WW0A 2EHOA 1SHZC 3V5UA 2HH7A 4PK6A 4UF0A 4IE4A 5IHYA 2WSSV 4TN7B 5L3FB 4L0RA 3CX7B 4O4HE 3HKEE 4F6RC 3PURA 2CLYB 3I9YA 1QSDA 3GWHA 3KV9A 4GK0E 4EIWA 4QX8B 3ZMUB 4AKLA 3BQKA 2PG8A 4PK5A 2YINA 4YLHA 5J1GA 2H7VC 4OK0A 2KWIB 3CMLA 1X79A 3KBUA 3NZPA 1FMWA 2JJ9A 2V7IA 4GK5E 3LBXA 3QUJA 4GYRA 4OYJA 3B13A 3PTRB 4UVCB 5LBQB 3HKCE 3RX6A 3W15B 4ANJA 3NBXX 3K8PC 2WMNA 4HGAA 3ZJ1A 5C8YE 4XBFB 3R6NA 4AQFA 1IAPA 1YKHB 3N9PA 5JDQA 2Y48B 4AKRB 3FBLA 4HTEA 2CEAA 5LJNA 3KVAA 5JDGA 2H3RA 4PK4A 2DWGA 3KV6A 4JLEA 2OA5A 4OFZA 5FYMA 3ZMVB 1MNEA 4QKNA 2PFVA 2W00A 4DNDA 2VKJA 4U74A 5FP3A 4BJMA 2KZ7B 3CQXC 2JMHA 5FY0A 1IJ6A 5LGNB 2IC6A 2CM0A 2MBGA 4I4TE 3B57A 2WM9A 2Q9QB 3PU3A 3AAEB 3QK6A 4IE5A 3KINB 2NOXA 2N1GA 2X9HA 3KDSE 1G73A 3UULA 1D1BA 2VK9A 5L3DB 4PJMA 5LXTE 2YEVC 1B7TA 3KV4A 3LK2B 4J2CA 4QXBB 3HKDE 3O1JA 2MYSA 4ZI3D 4Z8XA 5DQWA 4EYYR 4L9IA 4IDZA 5CA1E 5J2UE 2C5KT 3Q9DA 2ZM2A 3QC9A 3LK42 4U72A 4EB6E 3C98B 4AKIA 2CLYC 2D2SA 4H63V 2NW8A 2H7OA 4NUVA 1Z0PA 3CX8B 3RKOA 4UV9B 1FMVA 2VWAA 1KNZA 3FXDB 1BR2A 2A3DA 2XUEA 2KNDA 1G8XA 1UX5A 4E7SA 1UX4A 2EHOB 5EZYE 3MACA 3RYIE 4AQFC 5M4YA 3C4XA 5ADXL 4TZ4C 5JH7E 1FIOA 2XTLA 4ZOLE 2VKHA 3N5LA 2XAJB 1MIVA 5KX5E 2XAGB 3N9QA 5JDFA 3ZCIA 3ZN1B 3ETUA 2KXPB 1MIWA 4KMCA 4QXHB 1IZNB 3A5XA 4ZI2D 4TV8E 2CA5A 3PU8A 5HYAA 3Q5WA 4X1YE 3AAIA 3AA0B 1HTJF 3AA1B 3ETVA 4QX7B 3OYZA 4ZI2C 1S35A 1YKEB 1NWMX 3NRXA 3RRWA 5DJQC 2NP9A 5HWXA 3ZYMA 3KVBA 3F57A 3RC3A 3MK7C 2YU2A 4KUMB 4M1PA 3ZMTB 2LT3A 4XAXB 3JC6C 3KFWX 3VHLA 2DWKA 5L3EB 1YW0A 3WI3A 3NRYA 5EK4A 2NTXA 3SS1A 2VASA 2LHRA 2BVMA 4MFRA 2XAHB 3N9NA 3U78A 3VKHA 1ZEEA 2N9DA 5FMNA 2LOPA 3RRCA 1MNDA 2NW9A 4EOZB 4IIJE 5JDMA 2DLRA 1U4QA 4CQIA 4H9OC 5A1LA 1HG5A 4CXYA 5DQVA 4H9PC 3C4WA 4ERRA 3PUQA 3RC8A 2YK0A 2LSJA 2YU1A 4V1Av 3CQGB 1BR1A 5LOVE 3K3OA 5LHGB 3UUXB 5L2LA 3I0QA 3N9LA 3OKQA 2ES0A 3N2OA 4AI6A 2V7KA 2DNXA 2CXFA 4ILUA 5JQGE 1US7B 2KT9A 3UUNA 2RP4A 4ISTA 3K3NA 4G2AA 4PNIA 3IHRA 3O9XA 4IGUA 3C50A 4CI1B 2LSKA 4B6XA 1MMGA 5HXRA 1WLXA 2Y6XA 3ZPOA 1H7CA 3E22E 5LBMA 3V5SA 3ESLA 4TUYE 4JEHB 3F2EA 1YD8G 5AFUL 1IJ5A 1OWAA 5LGTB 2XASB 4HN9A 4EAHA 2JQQA 1VOMA 3N2GE 1NAFA 4H9RC 3I0OA 3CQCB 2LE8A 5FXWA 2KINB 2Q9QA 5IYZE 3WAKA 2E9XC 3DJBA 1LVKA 4IE6A 1MMAA 2A72A 3GA8A 3UFEA 2K48A 5JREA 4K0UA 3ZEFB 3HI2A 5FNVE 4DO0A 2P9BA 2ZM8A 2X9XA 3TKLB 2KLQA 3LK3B 4HKAA 3M65A 5EK2A 2ZM0A 3I1AA 3VU7H 4TX5A 2QA7A 2L3LA 2BZBA 2UXNB 3CX6B 4CXWA 2RA1A 4P0AA 3IEEA 5L3BB 5CB4E 1ZHCA 4QWNB 4ZS2A 3H3AA 4EZ4A 2V7JA 4NUUA 2WBLA 3HKBE 5CA0E 2ODVA 1WYCA 4O4LE 1MMDA 4ZI7E 5H6QB 2X9YA 3IF8B 2DHRA 2VKDA 2JRKA 3L3PA 3HL6A 4WNKA 3UTKA 3RPUA 5F3JA 3FHNA 2CXDA 3AVSA 4H9NC 3N9MA 2VB6A 3UT5E 5JRCA 3NZQA 2EHOD 2CCQA 4P09A 2A2FX 3O1HA 1HFAA 3K3QC 4AQGA 2L9QA 3OYXA 4ZHQE 5LJMA 2C5JA 2E8IA 5LHHB 5JR9C 4KP3C 3L09A 3EUHA 3MA9A 3PDYA 4DVDA 4GYSA 5GONE 4ISSA 5LHIB 2Q9QD 4O4JE 3RYCE 2W63A 3ZMSB 2X0LB 2CWOA 2E9XA 3ZJ2A 3IBPA 2IC9A 2D0UA 2KMFA 4H9SE 2L8KA 3VKGA 3CWZB 5LP6E 4C91A 4WBOA 4DBQA 2KWHA 4KBMB 1V9DA 2BVLA 3OBVE 4I50E 4UIGA 3SWHA 2DCFA 4GIWA 1D1AA 4FI5A 4CZZB 2Z6EA 3P8CD 4AKGA 4H63H 5JDLA 1S94A 2Y8DA 3FB2A 5HWYA 1WR6A 2XHEB 3ONXA 4JEUB 3EDVA 2DI4A 5F8PA 3ZCJA 2X9WA 2W0GA 5HXEA 4YHJA 2X68A 2I59A 3PE0A 4PAGA 3LFMA 4PJJA 5FXXA 5E0OA 2G0UA 4EYUA 3WAJA 3U3IA 3PUGA 4YJ2E 3N2KE 4A56A 2CXLA 1D0YA 2V26A 5TAOA 5LA6E 2LSGA 4PFPA 3LG7A 2ZLYA 4X20E 4DMVA 2CMRA 4IHJE 2E9XB 4HFVA 2CWYA 4TV9E 3N9OA 5KMGP 1UCUA 1LVFA 1D0XA 2HPLA 4MLKA 4DMWA 3FXEB 4YFSA 1HS7A 1QUUA 3ZMZB 2VKOA 4L5GA 3AA7B 5FY7A 2JPFA 4XZCA 3EVYA 3O1IA 2PBIA 2SPCA 3D0TA 3ZLIA 2W62A 4ASKA 3BQLA 3SOLA 3C64A 5L3GB 4IE0A 3C51A 4G63A 5HXHA 3O4XE 5L3CB 2N2NA 2GK9A 5KDMC 2MTQA 4I43B 4OHFA 4BJNA 2IW5B 2C0SA 2NW7A 2MOZA 2ZMAA 3Q5XA 4UF0B 3HR0A 3ZYLA 4AXPA 1AJ3A 4CI3B 2HPJA 4QHOA 2UXXB 4JUYA 1MMNA 2LJLA 4N78D 3CKDA 3S4UA 1ZV4X 5FY1A 3MXZA 3AVRA 1WRDA 2X51A 4FJOA 2C5IT 1ZKEA 1Y64B 2JMKA 4QXCB 2NWBA 3MKDA 5BMVE 3ZYKA 4ZS3A 1LKXA 3T8OA 1HF8A 4UVBB 4ZI3C 1KK7A 2WWUA 5LNKA 2LHNA 2D0TA 1WYBA 3Q2MA 3KV5A 5LYJE 3CPZA 5DABA 3GMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9Q C;  4H9R C;  4HGA A;  4H9N C;  5KDM C;  4H9O C;  4H9S E;  4H9P C; 
#chains in the Genus database with same CATH topology
 3F31 A;  1KEY A;  2ACX A;  2QYW A;  2W4X A;  4EZH A;  5LGT B;  4X1K E;  1T98 A;  2VL8 A;  2XQY A;  3TLW A;  4BAY B;  1D0Z A;  4JI7 T;  2K24 A;  4I55 E;  3GN5 A;  3FZK B;  3HA4 A;  5ABF B;  2CBJ A;  3BK9 A;  1XNR T;  1SA0 E;  2NTY A;  4O4I E;  3ZC0 A;  2CE7 A;  3AA6 B;  3LSV A;  4PJL A;  3OJA A;  3AAA B;  4BA9 A;  3CVR A;  1EZ3 A;  3PJA A;  3M3Z B;  3R84 B;  2VVN A;  4X1I E;  3E08 A;  1WCR A;  5F5W A;  1U5P A;  1NEN A;  4DV6 T;  3NWI A;  5ETW A;  4OX9 T;  2LSI A;  1D1C A;  5FXV A;  3RI5 A;  2FJE A;  3E0Z A;  2Q9Q C;  2WMO A;  2E9X D;  3ZC1 A;  3J7Y q;  3AXJ B;  4HE8 A;  3ANW A;  2BS2 A;  2V7L A;  4GOU A;  4ZZC A;  3AEA A;  3C4Z A;  2LLY A;  4U7Y A;  3PUS A;  1HCI A;  2XAQ B;  4MHC A;  3MJX A;  3Q5D A;  4DV5 T;  3EDU A;  5JR9 A;  4CXX A;  5LCY A;  4P0B A;  2X67 A;  3LBX B;  2LM9 A;  5FXZ A;  3FZF B;  1HX8 A;  2IAK A;  4B3R T;  1W0B A;  4U2Y A;  4AKH A;  3EHZ A;  2UXC T;  2PJQ A;  2M67 A;  4DV4 T;  3AE4 A;  2HHH T;  1MIY A;  4O2B E;  2V1D B;  2X0H A;  2D5U A;  1E7P A;  2XM2 A;  3RH3 A;  4E7Z A;  2ODU A;  2WAU A;  4UXN B;  5CGM A;  4O2A E;  4QH5 A;  5HAX A;  1UGO A;  4O8S A;  4U33 A;  3J9X 1;  3JC6 D;  3TLU A;  4EXT A;  1E1H B;  3ONJ A;  5H6R B;  4K0K T;  4PFO A;  4UVA B;  5JDH A;  2HN1 A;  2X66 A;  1BR0 A;  2FUP A;  2LSY A;  4HFE A;  5EK3 A;  5AQJ B;  5HXS A;  2EHO C;  1VRB A;  5JVD E;  3PV0 F;  2J62 A;  3SRZ A;  4DBR A;  1UUS A;  4HEA A;  1LRZ A;  2LOS A;  1CUN A;  1W9R A;  5HXC A;  3DP7 A;  4DR5 T;  1OXZ A;  4UEM A;  4UEL A;  3GN5 B;  4ADZ A;  2V7M A;  3AB3 B;  3KBT A;  5FVL A;  2J1D G;  5L4E A;  3BQI A;  1XDO A;  4LFB T;  3H37 A;  5LGU B;  4HWD A;  4A5X A;  4H9Q C;  2K9A A;  2QGS A;  4IE7 A;  5LG4 A;  3JAD A;  4PW8 A;  4TWF A;  2BDE A;  3LJC A;  3ZN0 B;  3RYF E;  5JR9 B;  2PTF A;  5JDN A;  4UV8 B;  1IBM T;  4WBN E;  3P7I A;  5JRC B;  3FBZ A;  3I9W A;  1VCT A;  2WZH A;  1BR4 A;  3NKZ A;  4YJ3 E;  4CI2 B;  1FEW A;  4HWF A;  1NEK A;  3MZK B;  4C90 A;  3QOF A;  2B1E A;  3RYH E;  4Z91 A;  3UUM A;  1W09 A;  3ANW B;  1SUM B;  1HG2 A;  2K5B B;  2CBI A;  2XAF B;  3OVU A;  3RQW A;  3T1H T;  4LF9 T;  5J2T E;  2LKG A;  2ACZ A;  4PJN A;  4DR7 T;  2W61 A;  1O3X A;  4OYK A;  4MBQ A;  3DTO A;  3PUA A;  3L39 A;  1OED E;  4NIQ A;  4IDP A;  4AIU A;  3QNU A;  1XMQ T;  4MAL A;  1SE7 A;  3RHW A;  2LEH A;  3AEG A;  4WW0 A;  2EHO A;  1SHZ C;  4DID B;  3V5U A;  2RPA A;  2HH7 A;  2XSB A;  4PK6 A;  4UF0 A;  5ABH A;  2IIU A;  2R6G F;  4IE4 A;  2WSS V;  2W66 A;  4TN7 B;  5IHY A;  3UFG A;  5L3F B;  3EAM A;  4L0R A;  3CX7 B;  4O4H E;  4YHH T;  3HKE E;  4JV5 T;  4U3C A;  4F6R C;  1N36 T;  1KNR A;  2LKH A;  3PUR A;  2CLY B;  3I9Y A;  1QSD A;  3GWH A;  3KV9 A;  4GK0 E;  4EIW A;  4EV6 A;  4QX8 B;  3ZMU B;  4AKL A;  3BQK A;  2PG8 A;  4PK5 A;  2WY2 A;  2YIN A;  4YLH A;  5J1G A;  5FL0 A;  5HEU A;  4JBW F;  3RLF F;  2H7V C;  4OK0 A;  2IUB A;  2KWI B;  2M6B A;  1X79 A;  3CML A;  2BG9 B;  3KBU A;  1FMW A;  2JJ9 A;  2V6X A;  2V7I A;  3NZP A;  4GK5 E;  1XMO T;  4GKJ T;  4DR6 T;  3LBX A;  3QUJ A;  4GYR A;  4OYJ A;  5L4H A;  3B13 A;  5HEO A;  4LFA T;  1WR0 A;  3PTR B;  4UVC B;  3HKC E;  5LBQ B;  3RX6 A;  3W15 B;  3NBX X;  3A7M A;  3JCF A;  3K8P C;  4ANJ A;  2WMN A;  4HGA A;  3ZSS A;  4EGW A;  5L47 A;  3ZJ1 A;  5C8Y E;  3UU6 A;  2ZM6 T;  4XBF B;  3R6N A;  4AQF A;  1IAP A;  1YKH B;  3N9P A;  5JDQ A;  2VQE T;  2Y48 B;  2XQ5 A;  4A97 A;  4AKR B;  4HFC A;  3FBL A;  5BR8 T;  4HTE A;  3AE2 A;  3EI0 A;  5LMN T;  2JQK A;  2CEA A;  5LJN A;  3P4Q A;  1R8I A;  3KVA A;  1UK5 A;  5JDG A;  2UU9 T;  2XQ3 A;  2WU5 A;  2H3R A;  4PK4 A;  2DWG A;  5AQL B;  3KV6 A;  3RIA A;  4JLE A;  2OA5 A;  4OFZ A;  5FYM A;  3ZMV B;  1MNE A;  5IWA T;  4QKN A;  2OLT A;  2PFV A;  3TLT A;  4DR2 T;  2W00 A;  2XQ4 A;  2VVS A;  1XWM A;  4DND A;  4YSZ A;  5ABF A;  1I94 T;  4HFD A;  4TWD A;  4U74 A;  5FP3 A;  4YY3 T;  4X62 T;  4BJM A;  3AE9 A;  2KZ7 B;  3CQX C;  2JMH A;  2VL0 A;  5FY0 A;  1N33 T;  1IJ6 A;  4DR4 T;  3AXJ A;  5LGN B;  4I0U A;  2IC6 A;  2CM0 A;  3AE8 A;  2MBG A;  4KHZ F;  4I4T E;  3B57 A;  3T1Y T;  2WM9 A;  2V6Y A;  2LM2 A;  2JQ9 A;  2Q9Q B;  3PU3 A;  4HWH A;  3AAE B;  2K3W A;  3QK6 A;  4IE5 A;  3KIN B;  2NOX A;  3LDQ B;  2N1G A;  2X9H A;  3KDS E;  1G73 A;  3UUL A;  1D1B A;  4DV0 T;  2VK9 A;  5L3D B;  1CHU A;  4HWI B;  4ZEY A;  4PJM A;  3PUY F;  5LXT E;  2YEV C;  1B7T A;  3KV4 A;  3LK2 B;  4J2C A;  3PUZ F;  3HKD E;  2YKS A;  3O1J A;  4QXB B;  2E5V A;  2MYS A;  4ZI3 D;  4Z8X A;  2DL1 A;  4WZX A;  5DQW A;  5LMU T;  1KFY A;  4EYY R;  4L9I A;  4IDZ A;  5CA1 E;  5J2U E;  4DUZ T;  2C5K T;  3Q9D A;  2ZM2 A;  3QC9 A;  5AQN B;  3LK4 2;  4DV7 T;  4U72 A;  4EB6 E;  3C98 B;  4AKI A;  2CLY C;  2D2S A;  2J47 A;  4H63 V;  2NW8 A;  2H7O A;  4NUV A;  1Z0P A;  2BKN A;  3CX8 B;  3RKO A;  1L0V A;  4IRE A;  4UV9 B;  1FMV A;  4KX6 A;  2VWA A;  3Q5E A;  1KNZ A;  5HEG A;  3FXD B;  2XZE A;  3CK6 A;  1BR2 A;  3IA3 A;  2A3D A;  4NXN T;  4DUY T;  2XUE A;  2LRL A;  3CPZ A;  2KND A;  2XJ7 A;  1G8X A;  4HFB A;  1UX5 A;  4DR1 T;  1T7S A;  3OPC A;  3PUW F;  4QH4 A;  3ZT5 A;  1UX4 A;  4E7S A;  4JYA T;  1I6Z A;  2EHO B;  5EZY E;  4LF8 T;  3MAC A;  4YXD A;  2V6Y B;  3RYI E;  4AQF C;  5M4Y A;  3C4X A;  5ADX L;  2YDS A;  4TZ4 C;  5JH7 E;  1FIO A;  2XTL A;  4ZOL E;  5AQK B;  3FZL B;  2VKH A;  3N5L A;  4DV3 T;  2XAJ B;  1MIV A;  2WDR A;  2X0Y A;  4IL9 A;  3H3M A;  2XAG B;  2XPK A;  3N9Q A;  5JDF A;  3UU5 A;  3ZCI A;  5KX5 E;  3RIF A;  3ZN1 B;  3ETU A;  3RIU C;  2KXP B;  4COF A;  5IUX A;  1N32 T;  1MIW A;  4KMC A;  4QXH B;  1IZN B;  1X9B A;  2MAW A;  2WQY A;  3A5X A;  2CA5 A;  3PU8 A;  4TV8 E;  4ZI2 D;  3Q5W A;  4X1Y E;  3AAI A;  3AA0 B;  3VRB A;  1HTJ F;  3AA1 B;  3ETV A;  4HWC A;  4A98 A;  4QX7 B;  3OYZ A;  4ZI2 C;  1S35 A;  4X65 T;  1YKE B;  1NWM X;  3NRX A;  3RRW A;  2FJB A;  2NP9 A;  3P50 A;  5DJQ C;  4ZXL A;  3ZYM A;  3KVB A;  5HWX A;  3ZT6 A;  2BG9 C;  3UQ4 A;  3F57 A;  3RC3 A;  3MK7 C;  5AQM B;  2YU2 A;  5FKY A;  4KUM B;  4M1P A;  4HFH A;  5AQG B;  2LT3 A;  4X5T A;  3ZMT B;  4XAX B;  3JC6 C;  2XQA A;  2XQ9 A;  3KFW X;  3VHL A;  2DWK A;  5L3E B;  2JIW A;  3RKG A;  2W2U A;  1YW0 A;  3VR8 A;  3WI3 A;  1Y01 A;  3NRY A;  3AE7 A;  4U2Z A;  5EK4 A;  2NTX A;  5FVK A;  3SS1 A;  2E2A A;  2VAS A;  1YQ3 A;  2LHR A;  2WDV A;  2BVM A;  4MFR A;  2XAH B;  4F8H A;  4DV2 T;  3N9N A;  3U78 A;  3VKH A;  2JQH A;  2YDR A;  3PUX F;  4WYV A;  1ZEE A;  2N9D A;  5FMN A;  2LOP A;  1OED B;  3P4R A;  2BBJ A;  1MND A;  2QVA A;  3NVO A;  4IIJ E;  2NW9 A;  3RRC A;  4EOZ B;  5JDM A;  2BKO A;  2DLR A;  1U4Q A;  2AXD S;  4CQI A;  4LF6 T;  4LFC T;  4H9O C;  2VQF T;  5AQQ B;  5AQR B;  1HG5 A;  5A1L A;  4CXY A;  5DQV A;  4H9P C;  3C4W A;  5CFB A;  4ERR A;  3PUQ A;  2D9D A;  3RC8 A;  2UUB T;  3AEB A;  2YK0 A;  2LSJ A;  2YU1 A;  4V1A v;  3CQG B;  1HNW T;  5C2T A;  1BR1 A;  5LOV E;  3K3O A;  5LHG B;  3UUX B;  3SFD A;  3I0Q A;  3JAF A;  5L2L A;  3N9L A;  3OKQ A;  4JI2 T;  2ES0 A;  3N2O A;  3TLV A;  4AI6 A;  1M7K A;  1J5W A;  2V7K A;  2DNX A;  2CXF A;  1XZY A;  4EEB A;  4DV1 T;  4ILU A;  4U31 A;  5JQG E;  1T72 A;  1US7 B;  2KT9 A;  3PUV F;  3UUN A;  3UU8 A;  2RP4 A;  2YDQ A;  2MPK A;  2J4G A;  4IST A;  3RF1 A;  2CHO A;  3K3N A;  1E2A A;  4G2A A;  1T8B A;  2WU2 A;  4ILB A;  1JNR A;  4PNI A;  2CPT A;  4AKG A;  3P4S A;  3VRA A;  3ONL C;  2FJA A;  3IHR A;  3O9X A;  4JI0 T;  4IGU A;  3C50 A;  1J1J A;  4CI1 B;  2LSK A;  4B6X A;  1XNQ T;  1MMG A;  2WP9 A;  3AE3 A;  5HXR A;  1WLX A;  2XM1 A;  2Y6X A;  3ZPO A;  2AE9 A;  1H7C A;  3E22 E;  5LBM A;  3V5S A;  1OED A;  3ESL A;  4TUY E;  2WWV A;  4JEH B;  5AQH B;  2UXB T;  2HN2 A;  3F2E A;  1HNZ T;  1YD8 G;  5AFU L;  1IJ5 A;  1OWA A;  1YQ4 A;  2WS3 A;  2XAS B;  4HN9 A;  1QLB A;  2W67 A;  4EAH A;  2JQQ A;  2XQ8 A;  1VOM A;  3N2G E;  1NAF A;  4H9R C;  3I0O A;  3X1D A;  3CQC B;  2YOE A;  2V8S V;  5AQS B;  2LE8 A;  5HCM A;  5FXW A;  2KIN B;  1UUR A;  2Q9Q A;  5AQO B;  2E9X C;  5IYZ E;  3WAK A;  4JI6 T;  3DJB A;  1LVK A;  4YSX A;  4IE6 A;  1MMA A;  2A72 A;  4CN6 A;  3GA8 A;  3AE1 A;  1ZP0 A;  1ZOY A;  3UFE A;  2K48 A;  5JRE A;  4K0U A;  4ILA A;  3HI2 A;  5FNV E;  2XQ7 A;  4DO0 A;  3ZEF B;  1JNZ A;  2P9B A;  2ZM8 A;  2X9X A;  3TKL B;  5C3J A;  2KLQ A;  3LK3 B;  4HKA A;  3M65 A;  5EK2 A;  3K1S A;  2IDO B;  2ZM0 A;  4LF4 T;  3I1A A;  3ZKR A;  1HNX T;  3VU7 H;  3RQU A;  4TX5 A;  4B3S T;  2QA7 A;  2L3L A;  2BZB A;  2UXN B;  2CHN A;  3CX6 B;  5AQT B;  2RA1 A;  4CXW A;  4JI5 T;  5FL1 A;  4P0A A;  4B3M T;  2FJD A;  3CIR A;  1KF6 A;  3IEE A;  5CB4 E;  5L3B B;  1ZHC A;  4QWN B;  4ZS2 A;  2WCA A;  5CJ5 A;  3H3A A;  5HEH A;  4EZ4 A;  2V7J A;  1YXR A;  4NUU A;  2WBL A;  3HKB E;  4IL4 A;  5CA0 E;  2ODV A;  1WYC A;  2H88 A;  1MMD A;  2A9U A;  4KI0 F;  4O4L E;  4ZI7 E;  5HYA A;  4YT0 A;  4AQY T;  4NXM T;  5ABG A;  5HCJ A;  5H6Q B;  4X66 T;  1W0A A;  2I0M A;  2KSR A;  2X9Y A;  2DHR A;  2VKD A;  3IF8 B;  4ILC A;  3UUB A;  4AIS A;  3L8R A;  4YTN A;  2JRK A;  4GKK T;  2YN6 A;  1WFD A;  3HL6 A;  3L3P A;  4WNK A;  3RPU A;  3UTK A;  5F3J A;  1DU2 A;  3FHN A;  2CXD A;  3AVS A;  4UR9 A;  4H9N C;  3AED A;  3N9M A;  2VB6 A;  3A8Y C;  3UU3 A;  3UT5 E;  5JRC A;  2FBW A;  2EHO D;  2CCQ A;  3NZQ A;  4P09 A;  5J0Z A;  2A2F X;  3O1H A;  3ABV A;  1HFA A;  3K3Q C;  4AQG A;  2L9Q A;  3OYX A;  4ZHQ E;  2UUA T;  5LB7 B;  5LJM A;  3P4W A;  2C5J A;  2E8I A;  4EED A;  4IDQ A;  3UU4 A;  5JR9 C;  5LHH B;  4IDO A;  4KP3 C;  3L09 A;  3EUH A;  3MA9 A;  3PDY A;  4DVD A;  4GYS A;  5GON E;  4ISS A;  4LMK A;  3SFE A;  2BS3 A;  5LHI B;  1J5E T;  2Q9Q D;  4O4J E;  5ABE A;  1IBL T;  3RYC E;  2W63 A;  2NR4 A;  3ZMS B;  5AQI B;  2X0L B;  3OTO T;  2CWO A;  2E9X A;  3ZJ2 A;  3IBP A;  1IBK T;  2IC9 A;  2D0U A;  2KMF A;  4H9S E;  4IDN A;  2L8K A;  4P1N A;  3VKG A;  4TNW A;  3AE5 A;  3CWZ B;  5AQF B;  3QB5 A;  5LP6 E;  2WB5 A;  4C91 A;  3FZH B;  3EAB A;  4WBO A;  1N34 T;  4DBQ A;  2KWH A;  4KBM B;  1V9D A;  2BVL A;  3OBV E;  4I50 E;  4UIG A;  3SWH A;  2DCF A;  3ZT7 A;  4GIW A;  1D1A A;  4FI5 A;  4QH1 A;  4CZZ B;  2XY8 B;  4Z90 A;  2I6H A;  2Z6E A;  5KXJ A;  1OED C;  3P8C D;  2CRB A;  2M6I A;  4LF7 T;  5LG3 A;  1FJG T;  3G06 A;  2BG9 A;  4H63 H;  5JDL A;  1S94 A;  2Y8D A;  3FB2 A;  5AQP B;  2V5C A;  5HWY A;  4JI4 T;  1WR6 A;  2XHE B;  3ONX A;  4JEU B;  3EDV A;  2DI4 A;  5F8P A;  3ZCJ A;  4X64 T;  2BG9 E;  2UXD T;  2X9W A;  2W0G A;  5HXE A;  4YHJ A;  2X68 A;  2I59 A;  2XSA A;  3FZM B;  1Z8U A;  3LFM A;  3PE0 A;  4PAG A;  4PJJ A;  5FXX A;  4DR3 T;  4Q25 A;  4NPP A;  3AEF A;  5E0O A;  2G0U A;  3VR9 A;  4EYU A;  5JTG A;  3RIU A;  4LML A;  2V5D A;  3WAJ A;  3U3I A;  1KNP A;  3PUG A;  4YJ2 E;  3N2K E;  4A56 A;  2CXL A;  2IML A;  5AQU B;  5HEJ A;  1D0Y A;  4YTP A;  1HX1 B;  2V26 A;  5TAO A;  3P4P A;  5LA6 E;  2LSG A;  4PFP A;  4TWH A;  5AQV B;  3LG7 A;  2ZLY A;  2IHR 1;  4X20 E;  4DMV A;  2CMR A;  4IHJ E;  2E9X B;  4HFV A;  2CWY A;  2QRX A;  2BBH A;  4TV9 E;  4U7I A;  4B3T T;  3N9O A;  2H89 A;  5KMG P;  4TNV A;  1UCU A;  1LVF A;  1D0X A;  2HPL A;  4MLK A;  3B5M A;  3FXE B;  4YFS A;  3AE6 A;  4DMW A;  1QUU A;  2UUC T;  1HS7 A;  1M62 A;  3JAE A;  3ZMZ B;  2VKO A;  4L5G A;  3AA7 B;  5FY7 A;  2JPF A;  4XZC A;  4YSY A;  3EVY A;  3O1I A;  4HFI A;  2PBI A;  2SPC A;  3D0T A;  3ZLI A;  2W62 A;  3ZST A;  4ASK A;  3BQL A;  3SOL A;  3C64 A;  5L3G B;  4IE0 A;  3C51 A;  4G63 A;  5HXH A;  3O4X E;  5L3C B;  4CN1 A;  4JI1 T;  2N2N A;  2GK9 A;  5KDM C;  1GQE A;  2MTQ A;  4OHF A;  3PJA J;  4I43 B;  1XDP A;  2IW5 B;  4BJN A;  2C0S A;  2NW7 A;  2E5L T;  2MOZ A;  2ZMA A;  3Q5X A;  4UF0 B;  3HR0 A;  3QB5 K;  3ZYL A;  4AXP A;  1AJ3 A;  4CI3 B;  4JI3 T;  2HPJ A;  2LRK A;  4QHO A;  4JI8 T;  2UXX B;  4YTM A;  4JUY A;  1MMN A;  2LJL A;  4N78 D;  3CKD A;  3RGL A;  3S4U A;  3AEE A;  3AEC A;  1ZV4 X;  2WDQ A;  3TLS A;  5FY1 A;  3MXZ A;  1HR0 T;  3AVR A;  1WRD A;  2X51 A;  4FJO A;  2C5I T;  3UQ7 A;  1ZKE A;  1Y64 B;  2JMK A;  4QXC B;  2NWB A;  3MKD A;  5BMV E;  2BS4 A;  4IT4 A;  3ZYK A;  4ZS3 A;  1LKX A;  3T8O A;  1HF8 A;  2WZI A;  2BKP A;  2OV9 A;  4UVB B;  4ZI3 C;  1KK7 A;  2WWU A;  2F4V T;  5LNK A;  2LHN A;  2VUR A;  4CN4 A;  2D0T A;  4KHP T;  2B76 A;  4LMJ A;  1VCS A;  1WYB A;  2XQ6 A;  3KV5 A;  3Q2M A;  5LYJ E;  4ZZB A;  2VKJ A;  5DAB A;  4LF5 T;  3GMI A; 
#chains in the Genus database with same CATH homology
 3F31 A;  2ACX A;  4EZH A;  4X1K E;  1T98 A;  2VL8 A;  2XQY A;  4BAY B;  1D0Z A;  2K24 A;  4I55 E;  3GN5 A;  3HA4 A;  3BK9 A;  1SA0 E;  2NTY A;  4O4I E;  3ZC0 A;  2CE7 A;  3AA6 B;  4PJL A;  3OJA A;  3AAA B;  4BA9 A;  3CVR A;  1EZ3 A;  3R84 B;  4X1I E;  3E08 A;  1U5P A;  5ETW A;  2LSI A;  1D1C A;  5FXV A;  3E0Z A;  2Q9Q C;  2WMO A;  2E9X D;  3ZC1 A;  3J7Y q;  4HE8 A;  3ANW A;  2V7L A;  4GOU A;  3C4Z A;  3PUS A;  1HCI A;  2XAQ B;  4MHC A;  3MJX A;  3EDU A;  5JR9 A;  4CXX A;  5LCY A;  4P0B A;  2X67 A;  3LBX B;  2LM9 A;  5FXZ A;  1HX8 A;  2IAK A;  4AKH A;  2PJQ A;  2M67 A;  1MIY A;  4O2B E;  2V1D B;  3RH3 A;  2D5U A;  4E7Z A;  2ODU A;  2WAU A;  4UXN B;  4O2A E;  5HAX A;  4O8S A;  3J9X 1;  3JC6 D;  4EXT A;  1E1H B;  5H6R B;  4PFO A;  4UVA B;  5JDH A;  2X66 A;  1BR0 A;  2LSY A;  5EK3 A;  5HXS A;  2EHO C;  1VRB A;  5JVD E;  4DBR A;  3SRZ A;  4HEA A;  1LRZ A;  2LOS A;  1CUN A;  5HXC A;  3DP7 A;  1OXZ A;  4UEM A;  4UEL A;  3GN5 B;  4ADZ A;  2V7M A;  3AB3 B;  3KBT A;  2J1D G;  3BQI A;  3H37 A;  5LGU B;  4H9Q C;  2K9A A;  2QGS A;  4IE7 A;  5LG4 A;  4PW8 A;  5JR9 B;  2BDE A;  3LJC A;  3ZN0 B;  3RYF E;  5JDN A;  4UV8 B;  4WBN E;  3P7I A;  5JRC B;  3FBZ A;  3I9W A;  1BR4 A;  4YJ3 E;  4CI2 B;  1FEW A;  3MZK B;  4C90 A;  2B1E A;  3RYH E;  3UUM A;  3ANW B;  1HG2 A;  2K5B B;  2XAF B;  5J2T E;  4PJN A;  2W61 A;  1O3X A;  4OYK A;  4MBQ A;  3DTO A;  3PUA A;  4MAL A;  2LEH A;  4WW0 A;  2EHO A;  1SHZ C;  3V5U A;  2HH7 A;  4PK6 A;  4UF0 A;  4IE4 A;  5IHY A;  2WSS V;  4TN7 B;  5L3F B;  4L0R A;  3CX7 B;  4O4H E;  3HKE E;  4F6R C;  3PUR A;  2CLY B;  3I9Y A;  1QSD A;  3GWH A;  3KV9 A;  4GK0 E;  4EIW A;  4QX8 B;  3ZMU B;  4AKL A;  3BQK A;  2PG8 A;  4PK5 A;  2YIN A;  4YLH A;  5J1G A;  2H7V C;  4OK0 A;  2KWI B;  3CML A;  1X79 A;  3KBU A;  3NZP A;  1FMW A;  2JJ9 A;  2V7I A;  4GK5 E;  3LBX A;  3QUJ A;  4GYR A;  4OYJ A;  3B13 A;  3PTR B;  4UVC B;  5LBQ B;  3HKC E;  3RX6 A;  3W15 B;  4ANJ A;  3NBX X;  3K8P C;  2WMN A;  4HGA A;  3ZJ1 A;  5C8Y E;  4XBF B;  3R6N A;  4AQF A;  1IAP A;  1YKH B;  3N9P A;  5JDQ A;  2Y48 B;  4AKR B;  3FBL A;  4HTE A;  2CEA A;  5LJN A;  3KVA A;  5JDG A;  2H3R A;  4PK4 A;  2DWG A;  3KV6 A;  4JLE A;  2OA5 A;  4OFZ A;  5FYM A;  3ZMV B;  1MNE A;  4QKN A;  2PFV A;  2W00 A;  4DND A;  2VKJ A;  4U74 A;  5FP3 A;  4BJM A;  2KZ7 B;  3CQX C;  2JMH A;  5FY0 A;  1IJ6 A;  5LGN B;  2IC6 A;  2CM0 A;  2MBG A;  4I4T E;  3B57 A;  2WM9 A;  2Q9Q B;  3PU3 A;  3AAE B;  3QK6 A;  4IE5 A;  3KIN B;  2NOX A;  2N1G A;  2X9H A;  3KDS E;  1G73 A;  3UUL A;  1D1B A;  2VK9 A;  5L3D B;  4PJM A;  5LXT E;  2YEV C;  1B7T A;  3KV4 A;  3LK2 B;  4J2C A;  4QXB B;  3HKD E;  3O1J A;  2MYS A;  4ZI3 D;  4Z8X A;  5DQW A;  4EYY R;  4L9I A;  4IDZ A;  5CA1 E;  5J2U E;  2C5K T;  3Q9D A;  2ZM2 A;  3QC9 A;  3LK4 2;  4U72 A;  4EB6 E;  3C98 B;  4AKI A;  2CLY C;  2D2S A;  4H63 V;  2NW8 A;  2H7O A;  4NUV A;  1Z0P A;  3CX8 B;  3RKO A;  4UV9 B;  1FMV A;  2VWA A;  1KNZ A;  3FXD B;  1BR2 A;  2A3D A;  2XUE A;  2KND A;  1G8X A;  1UX5 A;  4E7S A;  1UX4 A;  2EHO B;  5EZY E;  3MAC A;  3RYI E;  4AQF C;  5M4Y A;  3C4X A;  5ADX L;  4TZ4 C;  5JH7 E;  1FIO A;  2XTL A;  4ZOL E;  2VKH A;  3N5L A;  2XAJ B;  1MIV A;  5KX5 E;  2XAG B;  3N9Q A;  5JDF A;  3ZCI A;  3ZN1 B;  3ETU A;  2KXP B;  1MIW A;  4KMC A;  4QXH B;  1IZN B;  3A5X A;  4ZI2 D;  4TV8 E;  2CA5 A;  3PU8 A;  5HYA A;  3Q5W A;  4X1Y E;  3AAI A;  3AA0 B;  1HTJ F;  3AA1 B;  3ETV A;  4QX7 B;  3OYZ A;  4ZI2 C;  1S35 A;  1YKE B;  1NWM X;  3NRX A;  3RRW A;  5DJQ C;  2NP9 A;  5HWX A;  3ZYM A;  3KVB A;  3F57 A;  3RC3 A;  3MK7 C;  2YU2 A;  4KUM B;  4M1P A;  3ZMT B;  2LT3 A;  4XAX B;  3JC6 C;  3KFW X;  3VHL A;  2DWK A;  5L3E B;  1YW0 A;  3WI3 A;  3NRY A;  5EK4 A;  2NTX A;  3SS1 A;  2VAS A;  2LHR A;  2BVM A;  4MFR A;  2XAH B;  3N9N A;  3U78 A;  3VKH A;  1ZEE A;  2N9D A;  5FMN A;  2LOP A;  3RRC A;  1MND A;  2NW9 A;  4EOZ B;  4IIJ E;  5JDM A;  2DLR A;  1U4Q A;  4CQI A;  4H9O C;  5A1L A;  1HG5 A;  4CXY A;  5DQV A;  4H9P C;  3C4W A;  4ERR A;  3PUQ A;  3RC8 A;  2YK0 A;  2LSJ A;  2YU1 A;  4V1A v;  3CQG B;  1BR1 A;  5LOV E;  3K3O A;  5LHG B;  3UUX B;  5L2L A;  3I0Q A;  3N9L A;  3OKQ A;  2ES0 A;  3N2O A;  4AI6 A;  2V7K A;  2DNX A;  2CXF A;  4ILU A;  5JQG E;  1US7 B;  2KT9 A;  3UUN A;  2RP4 A;  4IST A;  3K3N A;  4G2A A;  4PNI A;  3IHR A;  3O9X A;  4IGU A;  3C50 A;  4CI1 B;  2LSK A;  4B6X A;  1MMG A;  5HXR A;  1WLX A;  2Y6X A;  3ZPO A;  1H7C A;  3E22 E;  5LBM A;  3V5S A;  3ESL A;  4TUY E;  4JEH B;  3F2E A;  1YD8 G;  5AFU L;  1IJ5 A;  1OWA A;  5LGT B;  2XAS B;  4HN9 A;  4EAH A;  2JQQ A;  1VOM A;  3N2G E;  1NAF A;  4H9R C;  3I0O A;  3CQC B;  2LE8 A;  5FXW A;  2KIN B;  2Q9Q A;  5IYZ E;  3WAK A;  2E9X C;  3DJB A;  1LVK A;  4IE6 A;  1MMA A;  2A72 A;  3GA8 A;  3UFE A;  2K48 A;  5JRE A;  4K0U A;  3ZEF B;  3HI2 A;  5FNV E;  4DO0 A;  2P9B A;  2ZM8 A;  2X9X A;  3TKL B;  2KLQ A;  3LK3 B;  4HKA A;  3M65 A;  5EK2 A;  2ZM0 A;  3I1A A;  3VU7 H;  4TX5 A;  2QA7 A;  2L3L A;  2BZB A;  2UXN B;  3CX6 B;  4CXW A;  2RA1 A;  4P0A A;  3IEE A;  5L3B B;  5CB4 E;  1ZHC A;  4QWN B;  4ZS2 A;  3H3A A;  4EZ4 A;  2V7J A;  4NUU A;  2WBL A;  3HKB E;  5CA0 E;  2ODV A;  1WYC A;  4O4L E;  1MMD A;  4ZI7 E;  5H6Q B;  2X9Y A;  3IF8 B;  2DHR A;  2VKD A;  2JRK A;  3L3P A;  3HL6 A;  4WNK A;  3UTK A;  3RPU A;  5F3J A;  3FHN A;  2CXD A;  3AVS A;  4H9N C;  3N9M A;  2VB6 A;  3UT5 E;  5JRC A;  3NZQ A;  2EHO D;  2CCQ A;  4P09 A;  2A2F X;  3O1H A;  1HFA A;  3K3Q C;  4AQG A;  2L9Q A;  3OYX A;  4ZHQ E;  5LJM A;  2C5J A;  2E8I A;  5LHH B;  5JR9 C;  4KP3 C;  3L09 A;  3EUH A;  3MA9 A;  3PDY A;  4DVD A;  4GYS A;  5GON E;  4ISS A;  5LHI B;  2Q9Q D;  4O4J E;  3RYC E;  2W63 A;  3ZMS B;  2X0L B;  2CWO A;  2E9X A;  3ZJ2 A;  3IBP A;  2IC9 A;  2D0U A;  2KMF A;  4H9S E;  2L8K A;  3VKG A;  3CWZ B;  5LP6 E;  4C91 A;  4WBO A;  4DBQ A;  2KWH A;  4KBM B;  1V9D A;  2BVL A;  3OBV E;  4I50 E;  4UIG A;  3SWH A;  2DCF A;  4GIW A;  1D1A A;  4FI5 A;  4CZZ B;  2Z6E A;  3P8C D;  4AKG A;  4H63 H;  5JDL A;  1S94 A;  2Y8D A;  3FB2 A;  5HWY A;  1WR6 A;  2XHE B;  3ONX A;  4JEU B;  3EDV A;  2DI4 A;  5F8P A;  3ZCJ A;  2X9W A;  2W0G A;  5HXE A;  4YHJ A;  2X68 A;  2I59 A;  3PE0 A;  4PAG A;  3LFM A;  4PJJ A;  5FXX A;  5E0O A;  2G0U A;  4EYU A;  3WAJ A;  3U3I A;  3PUG A;  4YJ2 E;  3N2K E;  4A56 A;  2CXL A;  1D0Y A;  2V26 A;  5TAO A;  5LA6 E;  2LSG A;  4PFP A;  3LG7 A;  2ZLY A;  4X20 E;  4DMV A;  2CMR A;  4IHJ E;  2E9X B;  4HFV A;  2CWY A;  4TV9 E;  3N9O A;  5KMG P;  1UCU A;  1LVF A;  1D0X A;  2HPL A;  4MLK A;  4DMW A;  3FXE B;  4YFS A;  1HS7 A;  1QUU A;  3ZMZ B;  2VKO A;  4L5G A;  3AA7 B;  5FY7 A;  2JPF A;  4XZC A;  3EVY A;  3O1I A;  2PBI A;  2SPC A;  3D0T A;  3ZLI A;  2W62 A;  4ASK A;  3BQL A;  3SOL A;  3C64 A;  5L3G B;  4IE0 A;  3C51 A;  4G63 A;  5HXH A;  3O4X E;  5L3C B;  2N2N A;  2GK9 A;  5KDM C;  2MTQ A;  4I43 B;  4OHF A;  4BJN A;  2IW5 B;  2C0S A;  2NW7 A;  2MOZ A;  2ZMA A;  3Q5X A;  4UF0 B;  3HR0 A;  3ZYL A;  4AXP A;  1AJ3 A;  4CI3 B;  2HPJ A;  4QHO A;  2UXX B;  4JUY A;  1MMN A;  2LJL A;  4N78 D;  3CKD A;  3S4U A;  1ZV4 X;  5FY1 A;  3MXZ A;  3AVR A;  1WRD A;  2X51 A;  4FJO A;  2C5I T;  1ZKE A;  1Y64 B;  2JMK A;  4QXC B;  2NWB A;  3MKD A;  5BMV E;  3ZYK A;  4ZS3 A;  1LKX A;  3T8O A;  1HF8 A;  4UVB B;  4ZI3 C;  1KK7 A;  2WWU A;  5LNK A;  2LHN A;  2D0T A;  1WYB A;  3Q2M A;  3KV5 A;  5LYJ E;  3CPZ A;  5DAB A;  3GMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...