4H9QC

Complex structure 4 of daxx(e225a)/h3.3(sub5)/h4
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQAARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 76
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9qC00
5KDMC 4H9PC 4H9RC 4HGAA 4H9NC 4H9OC 4H9SE 4H9QC
chains in the Genus database with same CATH superfamily
1YXRA 5F3JA 3CIRA 2IC6A 3CQCB 3KVBA 5LBQB 5HXCA 5KDMC 2IUBA 3C51A 1E1HB 3CK6A 4PK6A 2ZM0A 1HNZT 1ZHCA 3UFEA 1G73A 3ZMTB 5LGTB 3RQUA 3VU7H 2Z6EA 1XZYA 2JRKA 4ZZCA 3OPCA 3PUSA 1IJ5A 1WR0A 2ES0A 4JI5T 3AEFA 5HXRA 4KI0F 4DV3T 4ZEYA 3WAJA 5LCYA 4AQYT 3SFDA 1MMNA 5JH7E 1BR1A 3VRBA 1NENA 1YD8G 4IE5A 4ILBA 4LFCT 3RIUA 4ANJA 2DI4A 3AXJA 1NWMX 4QH4A 4U7IA 4AKLA 3ESLA 4ASKA 3NZQA 2M6IA 3GA8A 2ODVA 2DWKA 1XMOT 5LHIB 4ZXLA 4CXXA 4YSZA 1KNRA 5H6RB 5HWXA 5AQPB 4ZZBA 4WNKA 1YQ4A 2I6HA 3ZT7A 2WDVA 3R6NA 3ZT5A 2V6YB 3G06A 1O3XA 3P7IA 1XWMA 4OFZA 2LRLA 4YJ2E 4HFCA 2Y8DA 4V1Av 1FEWA 4COFA 4TV8E 5FXWA 4TN7B 5F5WA 3N2GE 1HG2A 3ETUA 2DHRA 3RYFE 3WAKA 1W09A 4CI1B 5ABEA 2NW8A 2EHOB 4JBWF 2Q9QD 2P9BA 1WCRA 5DJQC 4IE6A 1HS7A 2L9QA 2NR4A 5LMNT 3OKQA 2IMLA 3BK9A 4U2ZA 3HKEE 4PW8A 3ZMVB 3QC9A 4X5TA 2QYWA 3AAEB 3LBXB 2LM9A 3RPUA 2LSKA 3P4SA 2VKJA 4O8SA 5EK3A 1T72A 4ZI3D 1E7PA 2BG9B 3OJAA 3ZMZB 2VASA 3L09A 5JREA 4Z8XA 2LLYA 5AQOB 2ACZA 5CB4E 2CRBA 2V7MA 3UUXB 5DQVA 2E5LT 3CX8B 2PJQA 2W0GA 4CN6A 5FL0A 1JNZA 1LVKA 4LMJA 4LF4T 2GK9A 5ABGA 4K0UA 2UXNB 3ZMUB 1J1JA 2FBWA 3KDSE 3ZSSA 1W0BA 3QUJA 4HWIB 2VL0A 4ZHQE 1OXZA 3JCFA 5DABA 2XAHB 5JRCB 4IE4A 4MHCA 1KK7A 5FVLA 2Y6XA 1D0YA 3UUMA 3ZLIA 2VVSA 2JQ9A 4O2AE 4YTNA 3QOFA 5AQTB 4LFAT 2VVNA 4HWCA 2CMRA 3X1DA 5FXZA 5FMNA 3NBXX 2LM2A 5F8PA 3ANWA 2W63A 2YN6A 4ZS3A 4OYKA 4MLKA 3TLSA 4P09A 2PTFA 3FBZA 5J2UE 3K3QC 4QWNB 1KF6A 2CWOA 2MTQA 3VKHA 2KMFA 4DV0T 3FB2A 3KFWX 5L3DB 2UXDT 4GYSA 2NTYA 1FIOA 5JDHA 1D0ZA 5L3FB 1ZP0A 3AE2A 2CLYC 3UU6A 2C0SA 2NOXA 3FZKB 2VQET 1HR0T 2CEAA 4AXPA 5JDLA 3RI5A 2N1GA 2IIUA 4AQGA 4IGUA 1LRZA 3RH3A 3C4XA 4JI7T 1S94A 4MALA 2E9XC 2FJEA 2J62A 4A5XA 3CPZA 1N32T 1QLBA 1WYBA 3A7MA 4IDQA 4FJOA 3LK3B 2V7KA 4P1NA 2X68A 1OEDC 4X1KE 4DR2T 3EABA 2W4XA 1XDOA 1JNRA 3DP7A 4X62T 3HKDE 1HFAA 2A2FX 4A56A 3I0OA 1KFYA 3N9NA 4PJNA 3ZJ2A 3RIFA 4AKGA 5HXHA 1UK5A 5HEUA 3KINB 3VHLA 5AQHB 4LMLA 4AQFA 2W66A 3A5XA 2JMHA 3NVOA 3GMIA 3OBVE 3CKDA 3RQWA 1GQEA 3EUHA 2WZHA 3NRXA 5AQVB 1BR2A 3BQIA 4YTPA 3ZC0A 5EK2A 5KXJA 4AKRB 2IAKA 1N36T 2D0UA 3HI2A 5HCMA 1BR0A 2I59A 4WZXA 4YHHT 3NKZA 4TNWA 2LE8A 3ZPOA 1HX1B 4CXWA 2DCFA 4HFVA 3UQ4A 5AQMB 4E7SA 3AEGA 3N9QA 2LOSA 2NW9A 5C2TA 2V7LA 2QA7A 2CHOA 2WY2A 1XNQT 4UR9A 2M6BA 4JEUB 2UUAT 3RYIE 3MXZA 3FHNA 2XPKA 4TV9E 3PTRB 3RF1A 2IDOB 3ZC1A 4H63V 5AQFB 4CQIA 3WI3A 3IA3A 2BKNA 5LOVE 3ZN0B 1R8IA 5GONE 4IE7A 2JQHA 1X9BA 4DV5T 4BA9A 2LSGA 2XQ8A 3PUZF 2EHOC 1UURA 1HNXT 2DL1A 2W61A 3ETVA 3RYHE 2CLYB 4LF8T 2YK0A 3PUQA 4M1PA 2A72A 4TUYE 2YINA 5HYAA 3E08A 3GN5A 4X20E 1HF8A 3PV0F 4DV4T 2CM0A 3RKOA 5H6QB 3GWHA 2LT3A 2BVLA 3VR8A 4NXNT 2XAQB 3I9WA 2J4GA 1OEDB 3P4QA 4QXBB 4HFIA 3EAMA 4B6XA 2WDQA 4DV6T 2LSJA 3FXEB 2X9HA 3N9LA 5J0ZA 3L8RA 2IHR1 2WU5A 2XQ7A 2CBJA 2CPTA 5BMVE 2H88A 2V7JA 1XMQT 5CJ5A 2IC9A 1ZV4X 4PAGA 4EV6A 4KP3C 4XAXB 2KLQA 4ILUA 3N5LA 4XZCA 5L47A 1WFDA 2XQ5A 1ZOYA 2UU9T 3M3ZB 2XQ6A 2WWVA 3AVSA 3MA9A 2BKPA 3ZEFB 4F8HA 3T1HT 2V1DB 2VK9A 3Q5WA 1W0AA 1FMWA 4DBQA 5E0OA 5ETWA 5AQRB 5LJNA 2WSSV 4AISA 5LG4A 1T8BA 4IDZA 4I43B 4MFRA 2YOEA 4O4JE 4ZOLE 3SWHA 5ABFA 5IWAT 3RX6A 3VRAA 5AQKB 1I94T 4AKHA 4EEBA 5EK4A 4ERRA 3AB3B 3AA6B 3HKCE 2D2SA 4HFDA 2E9XD 5FNVE 4U74A 2KNDA 3PUYF 2DWGA 1UX5A 1NAFA 4B3ST 4HWFA 4BJNA 3U3IA 2NTXA 3UU8A 1L0VA 3L3PA 4PJJA 3CWZB 4IIJE 2LKHA 3K8PC 5LYJE 4JEHB 5AQLB 5CA1E 2HPLA 4NUVA 1QUUA 2D9DA 2JQQA 5IUXA 3I1AA 2YDQA 3P4RA 2K24A 1OWAA 3F31A 4Z90A 4X1IE 5AQNB 3N9OA 5JTGA 1KNPA 4UV9B 4P0AA 4JLEA 3UU4A 4K0KT 3AEBA 3IF8B 1IAPA 1Y64B 1UGOA 2CHNA 4TNVA 2HN1A 2W67A 4O4HE 2FJDA 2XZEA 1HCIA 1KNZA 2MPKA 2XSAA 2NWBA 5KX5E 2RP4A 4HTEA 3AE3A 2KWHA 3AA7B 2XSBA 4DO0A 4CI3B 4ILCA 2WQYA 4QXHB 1MNEA 2WBLA 3I9YA 1M62A 2XQ4A 2ZM2A 3DJBA 5FVKA 1Z0PA 4LF7T 3UUNA 3UUBA 1HTJF 4H9OC 1U5PA 5JR9A 4YHJA 5LBMA 4IHJE 4UIGA 5HCJA 3JADA 4O4LE 4C91A 3RIUC 2YU2A 4EZHA 5L3EB 3RC3A 3SRZA 3AA0B 4GIWA 3FZFB 1MIVA 2MYSA 2CXFA 3O1JA 4JV5T 2Q9QA 1YW0A 1WR6A 3U78A 4PK5A 1X79A 3TLTA 4DBRA 4DUZT 3TLUA 3O9XA 4Z91A 4HWDA 3UFGA 1MNDA 3P4PA 4X1YE 4I4TE 1ZKEA 2EHOD 3I0QA 3R84B 2XQAA 3BQLA 2YEVC 3T1YT 5DQWA 1SA0E 2MAWA 4N78D 4J2CA 3AEDA 3O4XE 2VQFT 4TWFA 2H3RA 3VR9A 3FZMB 4PFPA 5JDGA 3L39A 3IBPA 4YFSA 3W15B 2JMKA 3Q5EA 5J2TE 3CX7B 2SPCA 4DR3T 3OYXA 2VKOA 2M67A 2YKSA 3H3MA 4DUYT 4YXDA 2XASB 3UQ7A 3QNUA 3EI0A 5C3JA 4DMWA 5AQSB 2HH7A 3J9X1 4UF0A 2XAJB 3ZN1B 4DMVA 1LKXA 2QVAA 3Q5XA 4OYJA 4ZI7E 1I6ZA 3KV9A 2JJ9A 3J7Yq 4HFHA 1J5WA 1MIWA 3D0TA 3P8CD 3QB5K 4H9QC 3K3NA 3LJCA 1D1CA 4HEAA 4F6RC 2X0YA 4AI6A 4GKJT 3ONXA 2BG9A 3N2OA 2LSYA 4QX8B 2MOZA 3PJAJ 2HPJA 2XJ7A 2IW5B 2V8SV 2F4VT 3JC6C 4X66T 4DNDA 4EYUA 3CVRA 3JAEA 4G63A 1IBLT 1HX8A 3RYCE 2XAFB 5HXEA 3P4WA 4UXNB 4LFBT 3AXJB 2X67A 3MACA 4IREA 3TKLB 1CUNA 1WYCA 3HA4A 3KBTA 2LEHA 3MZKB 2BVMA 1J5ET 4ILAA 2X66A 3P50A 4DR4T 5ABFB 1UCUA 3CMLA 2BBHA 1H7CA 4IDPA 4KUMB 2W2UA 5JDMA 4BJMA 1VOMA 3EHZA 3TLWA 3KV5A 2BG9E 1D1AA 3CX6B 4KX6A 3FZHB 2H7VC 2QGSA 4ISSA 4QXCB 2ZLYA 2MBGA 1V9DA 3AA1B 5M4YA 3FXDB 5AQUB 3UU3A 1AJ3A 1IBKT 5L3BB 4WW0A 3ZT6A 1EZ3A 3TLVA 3UTKA 2V6XA 2KSRA 1W9RA 2AXDS 3OVUA 3H3AA 3HKBE 2BS2A 4AIUA 3EDVA 3AVRA 4U31A 5HAXA 2J47A 3PURA 4GK0E 3N9PA 5AFUL 3OTOT 4U2YA 1WRDA 1Z8UA 2X51A 3PUWF 4YT0A 4IDOA 2WCAA 3B13A 3PUXF 4GOUA 4QHOA 1VCSA 2WMNA 2PG8A 4TWDA 1B7TA 3S4UA 4KBMB 4PNIA 4HWHA 5HXSA 2LOPA 4WYVA 4GKKT 4GYRA 3AAAB 3LFMA 4AQFC 3O1HA 3LDQB 4JI6T 2FJBA 4PFOA 1MIYA 5L4EA 1D1BA 5LB7B 3AE5A 5JR9B 3NZPA 2AE9A 1KEYA 2D5UA 5HWYA 2BZBA 4JUYA 1LVFA 5L3CB 4LF6T 3ABVA 4NXMT 2N2NA 3Q5DA 4WBOA 4CZZB 1XNRT 3AE4A 3ZYLA 3LK2B 2XQ9A 3N2KE 3HR0A 3RIAA 5A1LA 2ZM6T 5AQJB 2Q9QB 4YSXA 4QKNA 4H9PC 2BDEA 3MKDA 4PK4A 2ODUA 3BQKA 2JPFA 3C50A 4QH1A 3ZCJA 1T7SA 3ZSTA 1YQ3A 2B76A 4Q25A 5LGUB 2NW7A 3UU5A 4I50E 2NP9A 4H9NC 2D0TA 3ZJ1A 4C90A 4DV2T 3PDYA 5EZYE 2W62A 2KZ7B 3ANWB 4G2AA 5J1GA 1UUSA 5BR8T 4YTMA 4WBNE 3E22E 2CXLA 1CHUA 3PUGA 4H63H 2WWUA 2WDRA 4NUUA 3RRCA 3ZKRA 2LRKA 3FBLA 4L0RA 4HFBA 3ZYKA 3ZMSB 3AE8A 3ZYMA 4MBQA 1ZEEA 3UT5E 5JDFA 2K5BB 4YY3T 2ZM8A 4I0UA 1UX4A 2XHEB 2A3DA 2CBIA 3RKGA 5JQGE 3KBUA 3E0ZA 3PUAA 5JDQA 5FKYA 3VKGA 4PJMA 3AAIA 5FY1A 2BBJA 5ABHA 3QB5A 5LMUT 2CCQA 4X64T 4EYYR 5FXVA 5CA0E 3LK42 2UXCT 4UF0B 4TX5A 2WZIA 4JI2T 4YSYA 3AE9A 2X9YA 4KHPT 2I0MA 3LSVA 4EGWA 4KMCA 3JAFA 3JC6D 2CE7A 3C98B 2ZMAA 4U33A 5LG3A 2OLTA 4XBFB 5LGNB 2KWIB 5LJMA 4IDNA 3AE7A 2WAUA 4DR1T 2G0UA 2XTLA 3OYZA 4EEDA 1SUMB 1VCTA 1N34T 4KHZF 5HEOA 1US7B 2BS4A 2A9UA 2E9XA 2L3LA 4ZI2C 5HEGA 5LNKA 1IJ6A 5IYZE 4CN4A 2HHHT 1NEKA 3AE6A 1WLXA 3Q9DA 3UULA 1YKHB 4EZ4A 2L8KA 1MMAA 2BKOA 4FI5A 2E8IA 3B57A 2XM1A 3V5UA 4I55E 2V5CA 4EB6E 5KMGP 3ONLC 3PU8A 2YDSA 1OEDA 4P0BA 5FXXA 1YKEB 2XM2A 4UELA 2ACXA 4A98A 1HNWT 5LP6E 4TZ4C 4EAHA 2PBIA 5AQQB 3H37A 1MMDA 3KVAA 2UUCT 3RHWA 4CN1A 3Q2MA 3T8OA 2KT9A 3KV6A 2UUBT 2WB5A 4QX7B 3RC8A 5C8YE 5HEJA 4LMKA 5AQGB 4LF5T 4HGAA 3RGLA 2K9AA 2B1EA 3K3OA 3A8YC 3C4ZA 2CWYA 2DNXA 4O4IE 2RA1A 2HN2A 5CFBA 2E2AA 1OEDE 2LHNA 4TWHA 2K3WA 4ZS2A 5LA6E 4DR6T 1U4QA 3RLFF 5FP3A 4UVCB 2R6GF 4DVDA 3IEEA 4JI1T 2VURA 2W00A 2KXPB 5IHYA 3MK7C 4OK0A 3NWIA 5TAOA 4IL4A 4JI3T 4U72A 3GN5B 2V6YA 5HEHA 2LSIA 3IHRA 1G8XA 4AKIA 3O1IA 4OHFA 2RPAA 2XAGB 4JI8T 2X0HA 2VKHA 4HN9A 5JDNA 2C5IT 2WM9A 3K1SA 5FY7A 2XY8B 1MMGA 1DU2A 1BR4A 1VRBA 1QSDA 3SOLA 3DTOA 4L5GA 1IZNB 4IL9A 5LHGB 2WU2A 2EHOA 3CQXC 3V5SA 2X9WA 3AEEA 2UXXB 2PFVA 5JR9C 1SHZC 4JI0T 3C4WA 4ADZA 3B5MA 2YU1A 3RRWA 2J1DG 2BS3A 3LBXA 4HKAA 4IT4A 4DIDB 1T98A 3SS1A 1Y01A 2Q9QC 5AQIB 5LHHB 2WMOA 4B3RT 4YLHA 4LF9T 2XUEA 4B3MT 4EXTA 2XQYA 4OX9T 4UVAB 1IBMT 4B3TT 4O2BE 2K48A 2OA5A 2QRXA 4ZI3C 4DV1T 3CQGB 4H9RC 4UVBB 2VWAA 3F2EA 2H7OA 4U7YA 4NPPA 2UXBT 2LKGA 2JIWA 5JVDE 3NRYA 2FUPA 3C64A 2DLRA 3KV4A 3LG7A 3PJAA 4QH5A 5JRCA 4U3CA 2XQ3A 2VKDA 1D0XA 4YJ3E 1S35A 2WP9A 3N9MA 4IE0A 4JI4T 3SFEA 3ONJA 2YDRA 2V26A 3EDUA 5FY0A 4UV8B 1N33T 2JQKA 2N9DA 2VB6A 2X9XA 5L2LA 1HG5A 5CGMA 5L3GB 4EIWA 4E7ZA 3ZCIA 3HL6A 4HFEA 1XDPA 4BAYB 2V5DA 3EVYA 3PUVF 3AE1A 3QK6A 2KINB 2WS3A 2C5JA 4H9SE 4X65T 2CXDA 2H89A 4EOZB 1E2AA 4DV7T 4HE8A 3AECA 2Y48B 2OV9A 4ZI2D 4CI2B 2X0LB 4PJLA 4A97A 2LHRA 4GK5E 1FMVA 4ISTA 5FL1A 5LXTE 2V7IA 1FJGT 3FZLB 2VL8A 4JYAT 5ADXL 5FYMA 2CA5A 1SE7A 2FJAA 2BG9C 2E5VA 4NIQA 4DR5T 4DR7T 3MJXA 3PE0A 2C5KT 5L4HA 3AEAA 3M65A 3PU3A 4L9IA 2E9XB 2LJLA 1M7KA 3F57A 4UEMA 4CXYA
chains in the Genus database with same CATH topology
5F3JA 3NRXA 4N78D 2CCQA 4J2CA 2IC6A 3CQCB 3KVBA 1BR2A 3BQIA 5LBQB 5FXVA 4EYYR 5HXCA 5CA0E 5KDMC 3ZC0A 3C51A 5EK2A 3LK42 3O4XE 1E1HB 4UF0B 4PK6A 4TX5A 2H3RA 2X9YA 4AKRB 2ZM0A 2IAKA 4PFPA 5JDGA 2D0UA 3HI2A 1BR0A 4KMCA 1ZHCA 3UFEA 1G73A 2I59A 3JC6D 2CE7A 3ZMTB 3IBPA 3C98B 4YFSA 2ZMAA 2LE8A 3ZPOA 4CXWA 3W15B 2DCFA 2JMKA 4HFVA 5LGTB 3VU7H 2Z6EA 5J2TE 3CX7B 2SPCA 4E7SA 3N9QA 2LOSA 2NW9A 5LGNB 2KWIB 2V7LA 2JRKA 4XBFB 3OYXA 2VKOA 5LJMA 2QA7A 2WAUA 2M67A 3PUSA 2G0UA 2XTLA 1IJ5A 3OYZA 4JEUB 2ES0A 1US7B 3RYIE 2E9XA 3FHNA 3MXZA 2L3LA 4ZI2C 5HXRA 2XASB 5LNKA 1IJ6A 4TV9E 5IYZE 3WAJA 5LCYA 1WLXA 3PTRB 3Q9DA 1MMNA 3ZC1A 5JH7E 1BR1A 3UULA 4DMWA 1YKHB 4EZ4A 2L8KA 1MMAA 4FI5A 2E8IA 3B57A 4H63V 3V5UA 1YD8G 4I55E 4EB6E 4IE5A 4CQIA 5KMGP 3WI3A 2HH7A 3J9X1 3PU8A 5LOVE 4ANJA 3ZN0B 4UF0A 4P0BA 5FXXA 2DI4A 2XAJB 1NWMX 5GONE 4IE7A 3ZN1B 1YKEB 4AKLA 3ESLA 4DMVA 4ASKA 1LKXA 3NZQA 4UELA 2ACXA 2LSGA 4BA9A 3GA8A 2EHOC 3Q5XA 2ODVA 4OYJA 2DWKA 4ZI7E 5LP6E 5LHIB 4TZ4C 3KV9A 4EAHA 2PBIA 2JJ9A 4CXXA 3J7Yq 2W61A 1MIWA 3D0TA 3P8CD 5H6RB 3H37A 1MMDA 3ETVA 5HWXA 3RYHE 2CLYB 3KVAA 2YK0A 3PUQA 4H9QC 4M1PA 3K3NA 2A72A 3LJCA 1D1CA 3Q2MA 4TUYE 2YINA 4HEAA 5HYAA 3T8OA 2KT9A 3KV6A 4F6RC 3E08A 4AI6A 4QX7B 3GN5A 3ONXA 3N2OA 4WNKA 2LSYA 3RC8A 5C8YE 3EUHA 4X20E 1HF8A 4QX8B 2MOZA 3R6NA 4HGAA 2HPJA 2CM0A 1O3XA 3P7IA 2IW5B 4OFZA 3RKOA 4YJ2E 3JC6C 2K9AA 2B1EA 4E7ZA 4DNDA 4EYUA 3CVRA 3K3OA 2Y8DA 5H6QB 3GWHA 2LT3A 3C4ZA 2BVLA 4V1Av 4G63A 2CWYA 2DNXA 2XAQB 4O4IE 1FEWA 2RA1A 4TV8E 5FXWA 1HX8A 4TN7B 3I9WA 3N2GE 3RYCE 2LHNA 2XAFB 4ZS2A 5LA6E 5HXEA 1HG2A 3ETUA 1U4QA 2DHRA 5FP3A 4UVCB 3RYFE 3WAKA 4DVDA 3IEEA 4UXNB 4CI1B 2X67A 4QXBB 3MACA 2NW8A 2EHOB 2Q9QD 2P9BA 2W00A 3TKLB 1CUNA 4B6XA 5DJQC 1WYCA 2KXPB 3HA4A 3KBTA 2LSJA 4IE6A 2LEHA 2L9QA 3FXEB 1HS7A 2X9HA 3OKQA 3MZKB 3N9LA 2BVMA 5IHYA 3BK9A 3MK7C 4OK0A 2X66A 3HKEE 5BMVE 4PW8A 1UCUA 3ZMVB 3CMLA 3QC9A 1H7CA 5TAOA 4KUMB 2V7JA 3AAEB 5JDMA 3LBXB 4BJMA 2LM9A 1VOMA 3KV5A 1D1AA 2IC9A 2LSKA 3RPUA 1ZV4X 4U72A 2VKJA 4PAGA 4O8SA 5EK3A 3CX6B 4ZI3D 3GN5B 3OJAA 2LSIA 3IHRA 3ZMZB 2VASA 1G8XA 4KP3C 3L09A 4XAXB 4AKIA 2KLQA 5JREA 4ILUA 2H7VC 3N5LA 3O1IA 4OHFA 4XZCA 4Z8XA 2QGSA 2XAGB 4ISSA 5CB4E 2VKHA 2V7MA 4HN9A 3UUXB 5JDNA 2C5IT 4QXCB 2ZLYA 2WM9A 2MBGA 5DQVA 1V9DA 5FY7A 3AA1B 3AVSA 3FXDB 5M4YA 3MA9A 3CX8B 1MMGA 3ZEFB 2PJQA 1BR4A 2W0GA 2V1DB 1VRBA 2VK9A 1AJ3A 1QSDA 3SOLA 5L3BB 3DTOA 4WW0A 4L5GA 3Q5WA 1IZNB 1FMWA 4DBQA 1LVKA 5E0OA 5ETWA 5LHGB 1EZ3A 2EHOA 3UTKA 5LJNA 3CQXC 3V5SA 2WSSV 2X9WA 2GK9A 2UXXB 2PFVA 4K0UA 5LG4A 4IDZA 5JR9C 4I43B 1SHZC 3H3AA 2UXNB 3HKBE 4MFRA 3ZMUB 4O4JE 3EDVA 4ZOLE 3AVRA 3SWHA 3C4WA 3KDSE 4ADZA 2YU1A 3RX6A 3RRWA 2J1DG 4AKHA 5HAXA 3PURA 4GK0E 5EK4A 3QUJA 3LBXA 4HKAA 3N9PA 4ERRA 4ZHQE 5AFUL 3AB3B 1OXZA 5DABA 3AA6B 3HKCE 2D2SA 1WRDA 2XAHB 1T98A 2E9XD 4IE4A 5FNVE 3SS1A 2X51A 5JRCB 4U74A 2KNDA 4MHCA 2DWGA 2Q9QC 1KK7A 3B13A 2Y6XA 1UX5A 1D0YA 3UUMA 1NAFA 4GOUA 3ZLIA 4O2AE 4BJNA 5LHHB 2WMOA 4QHOA 3U3IA 4YLHA 2WMNA 2NTXA 2PG8A 1B7TA 2XUEA 3L3PA 3S4UA 2XQYA 4EXTA 2CMRA 4KBMB 4PNIA 4PJJA 3CWZB 5HXSA 4IIJE 2LOPA 4UVAB 5FXZA 5FMNA 3NBXX 3K8PC 4O2BE 5F8PA 3ANWA 5LYJE 4JEHB 2W63A 4GYRA 3AAAB 4ZS3A 2K48A 2HPLA 5CA1E 3LFMA 4AQFC 2OA5A 4NUVA 4ZI3C 1QUUA 4OYKA 4MLKA 2JQQA 3O1HA 3CQGB 4H9RC 4PFOA 3I1AA 1MIYA 4P09A 1D1BA 4UVBB 2VWAA 5JR9B 2K24A 3FBZA 3NZPA 3F2EA 1OWAA 2H7OA 3F31A 5J2UE 3K3QC 4QWNB 2D5UA 4X1IE 3N9OA 5HWYA 2BZBA 2CWOA 2MTQA 4JUYA 1LVFA 5L3CB 3VKHA 2KMFA 4UV9B 5JVDE 4P0AA 4JLEA 2N2NA 3NRYA 4CXYA 3IF8B 1IAPA 1Y64B 4WBOA 3C64A 2DLRA 3KV4A 3LG7A 4CZZB 3FB2A 3KFWX 3ZYLA 5JRCA 5L3DB 3LK2B 3N2KE 3HR0A 4GYSA 2NTYA 2VKDA 1FIOA 1D0XA 4O4HE 5A1LA 2Q9QB 1HCIA 4YJ3E 5JDHA 1S35A 1D0ZA 5L3FB 1KNZA 2CLYC 4QKNA 3N9MA 4H9PC 4IE0A 2BDEA 3MKDA 2C0SA 2NWBA 4PK4A 2ODUA 5KX5E 2NOXA 2V26A 3EDUA 2RP4A 4HTEA 3BQKA 2CEAA 4AXPA 5JDLA 2JPFA 2KWHA 3C50A 3ZCJA 2N1GA 3AA7B 5FY0A 4UV8B 4DO0A 2N9DA 2VB6A 4AQGA 2X9XA 5LGUB 2NW7A 4CI3B 4IGUA 5L2LA 4I50E 2NP9A 1LRZA 2D0TA 4H9NC 3ZJ1A 1HG5A 4C90A 5L3GB 4QXHB 1MNEA 3RH3A 3PDYA 3ZCIA 3HL6A 3C4XA 2WBLA 4EIWA 3I9YA 5EZYE 2W62A 2KZ7B 3ANWB 4BAYB 3EVYA 4G2AA 2ZM2A 3DJBA 5J1GA 1S94A 1Z0PA 4MALA 2E9XC 3UUNA 3QK6A 1HTJF 3CPZA 4H9OC 1U5PA 5JR9A 4WBNE 2KINB 4YHJA 5LBMA 4IHJE 3E22E 4UIGA 2CXLA 1WYBA 2C5JA 4H9SE 2CXDA 4O4LE 4FJOA 3LK3B 3PUGA 2V7KA 4C91A 4H63H 2X68A 4EOZB 2WWUA 4NUUA 4X1KE 3RRCA 2YU2A 4EZHA 5L3EB 3FBLA 4L0RA 3RC3A 4HE8A 3SRZA 3AA0B 4GIWA 3ZYKA 3ZMSB 1MIVA 2MYSA 2Y48B 2CXFA 3O1JA 3ZYMA 4ZI2D 4CI2B 4MBQA 2Q9QA 1YW0A 1ZEEA 2X0LB 1WR6A 3DP7A 3U78A 4PK5A 4PJLA 1X79A 3HKDE 3UT5E 1HFAA 5JDFA 2LHRA 4GK5E 2K5BB 4DBRA 2A2FX 3O9XA 4A56A 3I0OA 3N9NA 1FMVA 4ISTA 2ZM8A 5LXTE 2V7IA 1UX4A 2XHEB 4PJNA 3ZJ2A 1MNDA 2VL8A 4AKGA 2A3DA 5HXHA 5ADXL 5FYMA 2CA5A 3KINB 4X1YE 5JQGE 3VHLA 4I4TE 1ZKEA 3KBUA 3E0ZA 3PUAA 4AQFA 3MJXA 5JDQA 3PE0A 2C5KT 2EHOD 3A5XA 3I0QA 4PJMA 2JMHA 3AAIA 3R84B 3VKGA 5FY1A 3M65A 3PU3A 3BQLA 2YEVC 4L9IA 2E9XB 5DQWA 3GMIA 2LJLA 3OBVE 3F57A 4UEMA 3CKDA 1SA0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM C;  4H9P C;  4H9R C;  4HGA A;  4H9N C;  4H9O C;  4H9S E;  4H9Q C; 
#chains in the Genus database with same CATH topology
 1YXR A;  5F3J A;  3CIR A;  2IC6 A;  3CQC B;  3KVB A;  5LBQ B;  5HXC A;  5KDM C;  2IUB A;  3C51 A;  1E1H B;  3CK6 A;  4PK6 A;  2ZM0 A;  1HNZ T;  1ZHC A;  3UFE A;  1G73 A;  3ZMT B;  5LGT B;  3RQU A;  3VU7 H;  2Z6E A;  1XZY A;  2JRK A;  4ZZC A;  3OPC A;  3PUS A;  1IJ5 A;  1WR0 A;  2ES0 A;  4JI5 T;  3AEF A;  5HXR A;  4KI0 F;  4DV3 T;  4ZEY A;  3WAJ A;  5LCY A;  4AQY T;  3SFD A;  1MMN A;  5JH7 E;  1BR1 A;  3VRB A;  1NEN A;  1YD8 G;  4IE5 A;  4ILB A;  4LFC T;  3RIU A;  4ANJ A;  2DI4 A;  3AXJ A;  1NWM X;  4QH4 A;  4U7I A;  4AKL A;  3ESL A;  4ASK A;  3NZQ A;  2M6I A;  3GA8 A;  2ODV A;  2DWK A;  1XMO T;  5LHI B;  4ZXL A;  4CXX A;  4YSZ A;  1KNR A;  5H6R B;  5HWX A;  5AQP B;  4ZZB A;  4WNK A;  1YQ4 A;  2I6H A;  3ZT7 A;  2WDV A;  3R6N A;  3ZT5 A;  2V6Y B;  3G06 A;  1O3X A;  3P7I A;  1XWM A;  4OFZ A;  2LRL A;  4YJ2 E;  4HFC A;  2Y8D A;  4V1A v;  1FEW A;  4COF A;  4TV8 E;  5FXW A;  4TN7 B;  5F5W A;  3N2G E;  1HG2 A;  3ETU A;  2DHR A;  3RYF E;  3WAK A;  1W09 A;  4CI1 B;  5ABE A;  2NW8 A;  2EHO B;  4JBW F;  2Q9Q D;  2P9B A;  1WCR A;  5DJQ C;  4IE6 A;  1HS7 A;  2L9Q A;  2NR4 A;  5LMN T;  3OKQ A;  2IML A;  3BK9 A;  4U2Z A;  3HKE E;  4PW8 A;  3ZMV B;  3QC9 A;  4X5T A;  2QYW A;  3AAE B;  3LBX B;  2LM9 A;  3RPU A;  2LSK A;  3P4S A;  2VKJ A;  4O8S A;  5EK3 A;  1T72 A;  4ZI3 D;  1E7P A;  2BG9 B;  3OJA A;  3ZMZ B;  2VAS A;  3L09 A;  5JRE A;  4Z8X A;  2LLY A;  5AQO B;  2ACZ A;  5CB4 E;  2CRB A;  2V7M A;  3UUX B;  5DQV A;  2E5L T;  3CX8 B;  2PJQ A;  2W0G A;  4CN6 A;  5FL0 A;  1JNZ A;  1LVK A;  4LMJ A;  4LF4 T;  2GK9 A;  5ABG A;  4K0U A;  2UXN B;  3ZMU B;  1J1J A;  2FBW A;  3KDS E;  3ZSS A;  1W0B A;  3QUJ A;  4HWI B;  2VL0 A;  4ZHQ E;  1OXZ A;  3JCF A;  5DAB A;  2XAH B;  5JRC B;  4IE4 A;  4MHC A;  1KK7 A;  5FVL A;  2Y6X A;  1D0Y A;  3UUM A;  3ZLI A;  2VVS A;  2JQ9 A;  4O2A E;  4YTN A;  3QOF A;  5AQT B;  4LFA T;  2VVN A;  4HWC A;  2CMR A;  3X1D A;  5FXZ A;  5FMN A;  3NBX X;  2LM2 A;  5F8P A;  3ANW A;  2W63 A;  2YN6 A;  4ZS3 A;  4OYK A;  4MLK A;  3TLS A;  4P09 A;  2PTF A;  3FBZ A;  5J2U E;  3K3Q C;  4QWN B;  1KF6 A;  2CWO A;  2MTQ A;  3VKH A;  2KMF A;  4DV0 T;  3FB2 A;  3KFW X;  5L3D B;  2UXD T;  4GYS A;  2NTY A;  1FIO A;  5JDH A;  1D0Z A;  5L3F B;  1ZP0 A;  3AE2 A;  2CLY C;  3UU6 A;  2C0S A;  2NOX A;  3FZK B;  2VQE T;  1HR0 T;  2CEA A;  4AXP A;  5JDL A;  3RI5 A;  2N1G A;  2IIU A;  4AQG A;  4IGU A;  1LRZ A;  3RH3 A;  3C4X A;  4JI7 T;  1S94 A;  4MAL A;  2E9X C;  2FJE A;  2J62 A;  4A5X A;  3CPZ A;  1N32 T;  1QLB A;  1WYB A;  3A7M A;  4IDQ A;  4FJO A;  3LK3 B;  2V7K A;  4P1N A;  2X68 A;  1OED C;  4X1K E;  4DR2 T;  3EAB A;  2W4X A;  1XDO A;  1JNR A;  3DP7 A;  4X62 T;  3HKD E;  1HFA A;  2A2F X;  4A56 A;  3I0O A;  1KFY A;  3N9N A;  4PJN A;  3ZJ2 A;  3RIF A;  4AKG A;  5HXH A;  1UK5 A;  5HEU A;  3KIN B;  3VHL A;  5AQH B;  4LML A;  4AQF A;  2W66 A;  3A5X A;  2JMH A;  3NVO A;  3GMI A;  3OBV E;  3CKD A;  3RQW A;  1GQE A;  3EUH A;  2WZH A;  3NRX A;  5AQV B;  1BR2 A;  3BQI A;  4YTP A;  3ZC0 A;  5EK2 A;  5KXJ A;  4AKR B;  2IAK A;  1N36 T;  2D0U A;  3HI2 A;  5HCM A;  1BR0 A;  2I59 A;  4WZX A;  4YHH T;  3NKZ A;  4TNW A;  2LE8 A;  3ZPO A;  1HX1 B;  4CXW A;  2DCF A;  4HFV A;  3UQ4 A;  5AQM B;  4E7S A;  3AEG A;  3N9Q A;  2LOS A;  2NW9 A;  5C2T A;  2V7L A;  2QA7 A;  2CHO A;  2WY2 A;  1XNQ T;  4UR9 A;  2M6B A;  4JEU B;  2UUA T;  3RYI E;  3MXZ A;  3FHN A;  2XPK A;  4TV9 E;  3PTR B;  3RF1 A;  2IDO B;  3ZC1 A;  4H63 V;  5AQF B;  4CQI A;  3WI3 A;  3IA3 A;  2BKN A;  5LOV E;  3ZN0 B;  1R8I A;  5GON E;  4IE7 A;  2JQH A;  1X9B A;  4DV5 T;  4BA9 A;  2LSG A;  2XQ8 A;  3PUZ F;  2EHO C;  1UUR A;  1HNX T;  2DL1 A;  2W61 A;  3ETV A;  3RYH E;  2CLY B;  4LF8 T;  2YK0 A;  3PUQ A;  4M1P A;  2A72 A;  4TUY E;  2YIN A;  5HYA A;  3E08 A;  3GN5 A;  4X20 E;  1HF8 A;  3PV0 F;  4DV4 T;  2CM0 A;  3RKO A;  5H6Q B;  3GWH A;  2LT3 A;  2BVL A;  3VR8 A;  4NXN T;  2XAQ B;  3I9W A;  2J4G A;  1OED B;  3P4Q A;  4QXB B;  4HFI A;  3EAM A;  4B6X A;  2WDQ A;  4DV6 T;  2LSJ A;  3FXE B;  2X9H A;  3N9L A;  5J0Z A;  3L8R A;  2IHR 1;  2WU5 A;  2XQ7 A;  2CBJ A;  2CPT A;  5BMV E;  2H88 A;  2V7J A;  1XMQ T;  5CJ5 A;  2IC9 A;  1ZV4 X;  4PAG A;  4EV6 A;  4KP3 C;  4XAX B;  2KLQ A;  4ILU A;  3N5L A;  4XZC A;  5L47 A;  1WFD A;  2XQ5 A;  1ZOY A;  2UU9 T;  3M3Z B;  2XQ6 A;  2WWV A;  3AVS A;  3MA9 A;  2BKP A;  3ZEF B;  4F8H A;  3T1H T;  2V1D B;  2VK9 A;  3Q5W A;  1W0A A;  1FMW A;  4DBQ A;  5E0O A;  5ETW A;  5AQR B;  5LJN A;  2WSS V;  4AIS A;  5LG4 A;  1T8B A;  4IDZ A;  4I43 B;  4MFR A;  2YOE A;  4O4J E;  4ZOL E;  3SWH A;  5ABF A;  5IWA T;  3RX6 A;  3VRA A;  5AQK B;  1I94 T;  4AKH A;  4EEB A;  5EK4 A;  4ERR A;  3AB3 B;  3AA6 B;  3HKC E;  2D2S A;  4HFD A;  2E9X D;  5FNV E;  4U74 A;  2KND A;  3PUY F;  2DWG A;  1UX5 A;  1NAF A;  4B3S T;  4HWF A;  4BJN A;  3U3I A;  2NTX A;  3UU8 A;  1L0V A;  3L3P A;  4PJJ A;  3CWZ B;  4IIJ E;  2LKH A;  3K8P C;  5LYJ E;  4JEH B;  5AQL B;  5CA1 E;  2HPL A;  4NUV A;  1QUU A;  2D9D A;  2JQQ A;  5IUX A;  3I1A A;  2YDQ A;  3P4R A;  2K24 A;  1OWA A;  3F31 A;  4Z90 A;  4X1I E;  5AQN B;  3N9O A;  5JTG A;  1KNP A;  4UV9 B;  4P0A A;  4JLE A;  3UU4 A;  4K0K T;  3AEB A;  3IF8 B;  1IAP A;  1Y64 B;  1UGO A;  2CHN A;  4TNV A;  2HN1 A;  2W67 A;  4O4H E;  2FJD A;  2XZE A;  1HCI A;  1KNZ A;  2MPK A;  2XSA A;  2NWB A;  5KX5 E;  2RP4 A;  4HTE A;  3AE3 A;  2KWH A;  3AA7 B;  2XSB A;  4DO0 A;  4CI3 B;  4ILC A;  2WQY A;  4QXH B;  1MNE A;  2WBL A;  3I9Y A;  1M62 A;  2XQ4 A;  2ZM2 A;  3DJB A;  5FVK A;  1Z0P A;  4LF7 T;  3UUN A;  3UUB A;  1HTJ F;  4H9O C;  1U5P A;  5JR9 A;  4YHJ A;  5LBM A;  4IHJ E;  4UIG A;  5HCJ A;  3JAD A;  4O4L E;  4C91 A;  3RIU C;  2YU2 A;  4EZH A;  5L3E B;  3RC3 A;  3SRZ A;  3AA0 B;  4GIW A;  3FZF B;  1MIV A;  2MYS A;  2CXF A;  3O1J A;  4JV5 T;  2Q9Q A;  1YW0 A;  1WR6 A;  3U78 A;  4PK5 A;  1X79 A;  3TLT A;  4DBR A;  4DUZ T;  3TLU A;  3O9X A;  4Z91 A;  4HWD A;  3UFG A;  1MND A;  3P4P A;  4X1Y E;  4I4T E;  1ZKE A;  2EHO D;  3I0Q A;  3R84 B;  2XQA A;  3BQL A;  2YEV C;  3T1Y T;  5DQW A;  1SA0 E;  2MAW A;  4N78 D;  4J2C A;  3AED A;  3O4X E;  2VQF T;  4TWF A;  2H3R A;  3VR9 A;  3FZM B;  4PFP A;  5JDG A;  3L39 A;  3IBP A;  4YFS A;  3W15 B;  2JMK A;  3Q5E A;  5J2T E;  3CX7 B;  2SPC A;  4DR3 T;  3OYX A;  2VKO A;  2M67 A;  2YKS A;  3H3M A;  4DUY T;  4YXD A;  2XAS B;  3UQ7 A;  3QNU A;  3EI0 A;  5C3J A;  4DMW A;  5AQS B;  2HH7 A;  3J9X 1;  4UF0 A;  2XAJ B;  3ZN1 B;  4DMV A;  1LKX A;  2QVA A;  3Q5X A;  4OYJ A;  4ZI7 E;  1I6Z A;  3KV9 A;  2JJ9 A;  3J7Y q;  4HFH A;  1J5W A;  1MIW A;  3D0T A;  3P8C D;  3QB5 K;  4H9Q C;  3K3N A;  3LJC A;  1D1C A;  4HEA A;  4F6R C;  2X0Y A;  4AI6 A;  4GKJ T;  3ONX A;  2BG9 A;  3N2O A;  2LSY A;  4QX8 B;  2MOZ A;  3PJA J;  2HPJ A;  2XJ7 A;  2IW5 B;  2V8S V;  2F4V T;  3JC6 C;  4X66 T;  4DND A;  4EYU A;  3CVR A;  3JAE A;  4G63 A;  1IBL T;  1HX8 A;  3RYC E;  2XAF B;  5HXE A;  3P4W A;  4UXN B;  4LFB T;  3AXJ B;  2X67 A;  3MAC A;  4IRE A;  3TKL B;  1CUN A;  1WYC A;  3HA4 A;  3KBT A;  2LEH A;  3MZK B;  2BVM A;  1J5E T;  4ILA A;  2X66 A;  3P50 A;  4DR4 T;  5ABF B;  1UCU A;  3CML A;  2BBH A;  1H7C A;  4IDP A;  4KUM B;  2W2U A;  5JDM A;  4BJM A;  1VOM A;  3EHZ A;  3TLW A;  3KV5 A;  2BG9 E;  1D1A A;  3CX6 B;  4KX6 A;  3FZH B;  2H7V C;  2QGS A;  4ISS A;  4QXC B;  2ZLY A;  2MBG A;  1V9D A;  3AA1 B;  5M4Y A;  3FXD B;  5AQU B;  3UU3 A;  1AJ3 A;  1IBK T;  5L3B B;  4WW0 A;  3ZT6 A;  1EZ3 A;  3TLV A;  3UTK A;  2V6X A;  2KSR A;  1W9R A;  2AXD S;  3OVU A;  3H3A A;  3HKB E;  2BS2 A;  4AIU A;  3EDV A;  3AVR A;  4U31 A;  5HAX A;  2J47 A;  3PUR A;  4GK0 E;  3N9P A;  5AFU L;  3OTO T;  4U2Y A;  1WRD A;  1Z8U A;  2X51 A;  3PUW F;  4YT0 A;  4IDO A;  2WCA A;  3B13 A;  3PUX F;  4GOU A;  4QHO A;  1VCS A;  2WMN A;  2PG8 A;  4TWD A;  1B7T A;  3S4U A;  4KBM B;  4PNI A;  4HWH A;  5HXS A;  2LOP A;  4WYV A;  4GKK T;  4GYR A;  3AAA B;  3LFM A;  4AQF C;  3O1H A;  3LDQ B;  4JI6 T;  2FJB A;  4PFO A;  1MIY A;  5L4E A;  1D1B A;  5LB7 B;  3AE5 A;  5JR9 B;  3NZP A;  2AE9 A;  1KEY A;  2D5U A;  5HWY A;  2BZB A;  4JUY A;  1LVF A;  5L3C B;  4LF6 T;  3ABV A;  4NXM T;  2N2N A;  3Q5D A;  4WBO A;  4CZZ B;  1XNR T;  3AE4 A;  3ZYL A;  3LK2 B;  2XQ9 A;  3N2K E;  3HR0 A;  3RIA A;  5A1L A;  2ZM6 T;  5AQJ B;  2Q9Q B;  4YSX A;  4QKN A;  4H9P C;  2BDE A;  3MKD A;  4PK4 A;  2ODU A;  3BQK A;  2JPF A;  3C50 A;  4QH1 A;  3ZCJ A;  1T7S A;  3ZST A;  1YQ3 A;  2B76 A;  4Q25 A;  5LGU B;  2NW7 A;  3UU5 A;  4I50 E;  2NP9 A;  4H9N C;  2D0T A;  3ZJ1 A;  4C90 A;  4DV2 T;  3PDY A;  5EZY E;  2W62 A;  2KZ7 B;  3ANW B;  4G2A A;  5J1G A;  1UUS A;  5BR8 T;  4YTM A;  4WBN E;  3E22 E;  2CXL A;  1CHU A;  3PUG A;  4H63 H;  2WWU A;  2WDR A;  4NUU A;  3RRC A;  3ZKR A;  2LRK A;  3FBL A;  4L0R A;  4HFB A;  3ZYK A;  3ZMS B;  3AE8 A;  3ZYM A;  4MBQ A;  1ZEE A;  3UT5 E;  5JDF A;  2K5B B;  4YY3 T;  2ZM8 A;  4I0U A;  1UX4 A;  2XHE B;  2A3D A;  2CBI A;  3RKG A;  5JQG E;  3KBU A;  3E0Z A;  3PUA A;  5JDQ A;  5FKY A;  3VKG A;  4PJM A;  3AAI A;  5FY1 A;  2BBJ A;  5ABH A;  3QB5 A;  5LMU T;  2CCQ A;  4X64 T;  4EYY R;  5FXV A;  5CA0 E;  3LK4 2;  2UXC T;  4UF0 B;  4TX5 A;  2WZI A;  4JI2 T;  4YSY A;  3AE9 A;  2X9Y A;  4KHP T;  2I0M A;  3LSV A;  4EGW A;  4KMC A;  3JAF A;  3JC6 D;  2CE7 A;  3C98 B;  2ZMA A;  4U33 A;  5LG3 A;  2OLT A;  4XBF B;  5LGN B;  2KWI B;  5LJM A;  4IDN A;  3AE7 A;  2WAU A;  4DR1 T;  2G0U A;  2XTL A;  3OYZ A;  4EED A;  1SUM B;  1VCT A;  1N34 T;  4KHZ F;  5HEO A;  1US7 B;  2BS4 A;  2A9U A;  2E9X A;  2L3L A;  4ZI2 C;  5HEG A;  5LNK A;  1IJ6 A;  5IYZ E;  4CN4 A;  2HHH T;  1NEK A;  3AE6 A;  1WLX A;  3Q9D A;  3UUL A;  1YKH B;  4EZ4 A;  2L8K A;  1MMA A;  2BKO A;  4FI5 A;  2E8I A;  3B57 A;  2XM1 A;  3V5U A;  4I55 E;  2V5C A;  4EB6 E;  5KMG P;  3ONL C;  3PU8 A;  2YDS A;  1OED A;  4P0B A;  5FXX A;  1YKE B;  2XM2 A;  4UEL A;  2ACX A;  4A98 A;  1HNW T;  5LP6 E;  4TZ4 C;  4EAH A;  2PBI A;  5AQQ B;  3H37 A;  1MMD A;  3KVA A;  2UUC T;  3RHW A;  4CN1 A;  3Q2M A;  3T8O A;  2KT9 A;  3KV6 A;  2UUB T;  2WB5 A;  4QX7 B;  3RC8 A;  5C8Y E;  5HEJ A;  4LMK A;  5AQG B;  4LF5 T;  4HGA A;  3RGL A;  2K9A A;  2B1E A;  3K3O A;  3A8Y C;  3C4Z A;  2CWY A;  2DNX A;  4O4I E;  2RA1 A;  2HN2 A;  5CFB A;  2E2A A;  1OED E;  2LHN A;  4TWH A;  2K3W A;  4ZS2 A;  5LA6 E;  4DR6 T;  1U4Q A;  3RLF F;  5FP3 A;  4UVC B;  2R6G F;  4DVD A;  3IEE A;  4JI1 T;  2VUR A;  2W00 A;  2KXP B;  5IHY A;  3MK7 C;  4OK0 A;  3NWI A;  5TAO A;  4IL4 A;  4JI3 T;  4U72 A;  3GN5 B;  2V6Y A;  5HEH A;  2LSI A;  3IHR A;  1G8X A;  4AKI A;  3O1I A;  4OHF A;  2RPA A;  2XAG B;  4JI8 T;  2X0H A;  2VKH A;  4HN9 A;  5JDN A;  2C5I T;  2WM9 A;  3K1S A;  5FY7 A;  2XY8 B;  1MMG A;  1DU2 A;  1BR4 A;  1VRB A;  1QSD A;  3SOL A;  3DTO A;  4L5G A;  1IZN B;  4IL9 A;  5LHG B;  2WU2 A;  2EHO A;  3CQX C;  3V5S A;  2X9W A;  3AEE A;  2UXX B;  2PFV A;  5JR9 C;  1SHZ C;  4JI0 T;  3C4W A;  4ADZ A;  3B5M A;  2YU1 A;  3RRW A;  2J1D G;  2BS3 A;  3LBX A;  4HKA A;  4IT4 A;  4DID B;  1T98 A;  3SS1 A;  1Y01 A;  2Q9Q C;  5AQI B;  5LHH B;  2WMO A;  4B3R T;  4YLH A;  4LF9 T;  2XUE A;  4B3M T;  4EXT A;  2XQY A;  4OX9 T;  4UVA B;  1IBM T;  4B3T T;  4O2B E;  2K48 A;  2OA5 A;  2QRX A;  4ZI3 C;  4DV1 T;  3CQG B;  4H9R C;  4UVB B;  2VWA A;  3F2E A;  2H7O A;  4U7Y A;  4NPP A;  2UXB T;  2LKG A;  2JIW A;  5JVD E;  3NRY A;  2FUP A;  3C64 A;  2DLR A;  3KV4 A;  3LG7 A;  3PJA A;  4QH5 A;  5JRC A;  4U3C A;  2XQ3 A;  2VKD A;  1D0X A;  4YJ3 E;  1S35 A;  2WP9 A;  3N9M A;  4IE0 A;  4JI4 T;  3SFE A;  3ONJ A;  2YDR A;  2V26 A;  3EDU A;  5FY0 A;  4UV8 B;  1N33 T;  2JQK A;  2N9D A;  2VB6 A;  2X9X A;  5L2L A;  1HG5 A;  5CGM A;  5L3G B;  4EIW A;  4E7Z A;  3ZCI A;  3HL6 A;  4HFE A;  1XDP A;  4BAY B;  2V5D A;  3EVY A;  3PUV F;  3AE1 A;  3QK6 A;  2KIN B;  2WS3 A;  2C5J A;  4H9S E;  4X65 T;  2CXD A;  2H89 A;  4EOZ B;  1E2A A;  4DV7 T;  4HE8 A;  3AEC A;  2Y48 B;  2OV9 A;  4ZI2 D;  4CI2 B;  2X0L B;  4PJL A;  4A97 A;  2LHR A;  4GK5 E;  1FMV A;  4IST A;  5FL1 A;  5LXT E;  2V7I A;  1FJG T;  3FZL B;  2VL8 A;  4JYA T;  5ADX L;  5FYM A;  2CA5 A;  1SE7 A;  2FJA A;  2BG9 C;  2E5V A;  4NIQ A;  4DR5 T;  4DR7 T;  3MJX A;  3PE0 A;  2C5K T;  5L4H A;  3AEA A;  3M65 A;  3PU3 A;  4L9I A;  2E9X B;  2LJL A;  1M7K A;  3F57 A;  4UEM A;  4CXY A; 
#chains in the Genus database with same CATH homology
 5F3J A;  3NRX A;  4N78 D;  2CCQ A;  4J2C A;  2IC6 A;  3CQC B;  3KVB A;  1BR2 A;  3BQI A;  5LBQ B;  5FXV A;  4EYY R;  5HXC A;  5CA0 E;  5KDM C;  3ZC0 A;  3C51 A;  5EK2 A;  3LK4 2;  3O4X E;  1E1H B;  4UF0 B;  4PK6 A;  4TX5 A;  2H3R A;  2X9Y A;  4AKR B;  2ZM0 A;  2IAK A;  4PFP A;  5JDG A;  2D0U A;  3HI2 A;  1BR0 A;  4KMC A;  1ZHC A;  3UFE A;  1G73 A;  2I59 A;  3JC6 D;  2CE7 A;  3ZMT B;  3IBP A;  3C98 B;  4YFS A;  2ZMA A;  2LE8 A;  3ZPO A;  4CXW A;  3W15 B;  2DCF A;  2JMK A;  4HFV A;  5LGT B;  3VU7 H;  2Z6E A;  5J2T E;  3CX7 B;  2SPC A;  4E7S A;  3N9Q A;  2LOS A;  2NW9 A;  5LGN B;  2KWI B;  2V7L A;  2JRK A;  4XBF B;  3OYX A;  2VKO A;  5LJM A;  2QA7 A;  2WAU A;  2M67 A;  3PUS A;  2G0U A;  2XTL A;  1IJ5 A;  3OYZ A;  4JEU B;  2ES0 A;  1US7 B;  3RYI E;  2E9X A;  3FHN A;  3MXZ A;  2L3L A;  4ZI2 C;  5HXR A;  2XAS B;  5LNK A;  1IJ6 A;  4TV9 E;  5IYZ E;  3WAJ A;  5LCY A;  1WLX A;  3PTR B;  3Q9D A;  1MMN A;  3ZC1 A;  5JH7 E;  1BR1 A;  3UUL A;  4DMW A;  1YKH B;  4EZ4 A;  2L8K A;  1MMA A;  4FI5 A;  2E8I A;  3B57 A;  4H63 V;  3V5U A;  1YD8 G;  4I55 E;  4EB6 E;  4IE5 A;  4CQI A;  5KMG P;  3WI3 A;  2HH7 A;  3J9X 1;  3PU8 A;  5LOV E;  4ANJ A;  3ZN0 B;  4UF0 A;  4P0B A;  5FXX A;  2DI4 A;  2XAJ B;  1NWM X;  5GON E;  4IE7 A;  3ZN1 B;  1YKE B;  4AKL A;  3ESL A;  4DMV A;  4ASK A;  1LKX A;  3NZQ A;  4UEL A;  2ACX A;  2LSG A;  4BA9 A;  3GA8 A;  2EHO C;  3Q5X A;  2ODV A;  4OYJ A;  2DWK A;  4ZI7 E;  5LP6 E;  5LHI B;  4TZ4 C;  3KV9 A;  4EAH A;  2PBI A;  2JJ9 A;  4CXX A;  3J7Y q;  2W61 A;  1MIW A;  3D0T A;  3P8C D;  5H6R B;  3H37 A;  1MMD A;  3ETV A;  5HWX A;  3RYH E;  2CLY B;  3KVA A;  2YK0 A;  3PUQ A;  4H9Q C;  4M1P A;  3K3N A;  2A72 A;  3LJC A;  1D1C A;  3Q2M A;  4TUY E;  2YIN A;  4HEA A;  5HYA A;  3T8O A;  2KT9 A;  3KV6 A;  4F6R C;  3E08 A;  4AI6 A;  4QX7 B;  3GN5 A;  3ONX A;  3N2O A;  4WNK A;  2LSY A;  3RC8 A;  5C8Y E;  3EUH A;  4X20 E;  1HF8 A;  4QX8 B;  2MOZ A;  3R6N A;  4HGA A;  2HPJ A;  2CM0 A;  1O3X A;  3P7I A;  2IW5 B;  4OFZ A;  3RKO A;  4YJ2 E;  3JC6 C;  2K9A A;  2B1E A;  4E7Z A;  4DND A;  4EYU A;  3CVR A;  3K3O A;  2Y8D A;  5H6Q B;  3GWH A;  2LT3 A;  3C4Z A;  2BVL A;  4V1A v;  4G63 A;  2CWY A;  2DNX A;  2XAQ B;  4O4I E;  1FEW A;  2RA1 A;  4TV8 E;  5FXW A;  1HX8 A;  4TN7 B;  3I9W A;  3N2G E;  3RYC E;  2LHN A;  2XAF B;  4ZS2 A;  5LA6 E;  5HXE A;  1HG2 A;  3ETU A;  1U4Q A;  2DHR A;  5FP3 A;  4UVC B;  3RYF E;  3WAK A;  4DVD A;  3IEE A;  4UXN B;  4CI1 B;  2X67 A;  4QXB B;  3MAC A;  2NW8 A;  2EHO B;  2Q9Q D;  2P9B A;  2W00 A;  3TKL B;  1CUN A;  4B6X A;  5DJQ C;  1WYC A;  2KXP B;  3HA4 A;  3KBT A;  2LSJ A;  4IE6 A;  2LEH A;  2L9Q A;  3FXE B;  1HS7 A;  2X9H A;  3OKQ A;  3MZK B;  3N9L A;  2BVM A;  5IHY A;  3BK9 A;  3MK7 C;  4OK0 A;  2X66 A;  3HKE E;  5BMV E;  4PW8 A;  1UCU A;  3ZMV B;  3CML A;  3QC9 A;  1H7C A;  5TAO A;  4KUM B;  2V7J A;  3AAE B;  5JDM A;  3LBX B;  4BJM A;  2LM9 A;  1VOM A;  3KV5 A;  1D1A A;  2IC9 A;  2LSK A;  3RPU A;  1ZV4 X;  4U72 A;  2VKJ A;  4PAG A;  4O8S A;  5EK3 A;  3CX6 B;  4ZI3 D;  3GN5 B;  3OJA A;  2LSI A;  3IHR A;  3ZMZ B;  2VAS A;  1G8X A;  4KP3 C;  3L09 A;  4XAX B;  4AKI A;  2KLQ A;  5JRE A;  4ILU A;  2H7V C;  3N5L A;  3O1I A;  4OHF A;  4XZC A;  4Z8X A;  2QGS A;  2XAG B;  4ISS A;  5CB4 E;  2VKH A;  2V7M A;  4HN9 A;  3UUX B;  5JDN A;  2C5I T;  4QXC B;  2ZLY A;  2WM9 A;  2MBG A;  5DQV A;  1V9D A;  5FY7 A;  3AA1 B;  3AVS A;  3FXD B;  5M4Y A;  3MA9 A;  3CX8 B;  1MMG A;  3ZEF B;  2PJQ A;  1BR4 A;  2W0G A;  2V1D B;  1VRB A;  2VK9 A;  1AJ3 A;  1QSD A;  3SOL A;  5L3B B;  3DTO A;  4WW0 A;  4L5G A;  3Q5W A;  1IZN B;  1FMW A;  4DBQ A;  1LVK A;  5E0O A;  5ETW A;  5LHG B;  1EZ3 A;  2EHO A;  3UTK A;  5LJN A;  3CQX C;  3V5S A;  2WSS V;  2X9W A;  2GK9 A;  2UXX B;  2PFV A;  4K0U A;  5LG4 A;  4IDZ A;  5JR9 C;  4I43 B;  1SHZ C;  3H3A A;  2UXN B;  3HKB E;  4MFR A;  3ZMU B;  4O4J E;  3EDV A;  4ZOL E;  3AVR A;  3SWH A;  3C4W A;  3KDS E;  4ADZ A;  2YU1 A;  3RX6 A;  3RRW A;  2J1D G;  4AKH A;  5HAX A;  3PUR A;  4GK0 E;  5EK4 A;  3QUJ A;  3LBX A;  4HKA A;  3N9P A;  4ERR A;  4ZHQ E;  5AFU L;  3AB3 B;  1OXZ A;  5DAB A;  3AA6 B;  3HKC E;  2D2S A;  1WRD A;  2XAH B;  1T98 A;  2E9X D;  4IE4 A;  5FNV E;  3SS1 A;  2X51 A;  5JRC B;  4U74 A;  2KND A;  4MHC A;  2DWG A;  2Q9Q C;  1KK7 A;  3B13 A;  2Y6X A;  1UX5 A;  1D0Y A;  3UUM A;  1NAF A;  4GOU A;  3ZLI A;  4O2A E;  4BJN A;  5LHH B;  2WMO A;  4QHO A;  3U3I A;  4YLH A;  2WMN A;  2NTX A;  2PG8 A;  1B7T A;  2XUE A;  3L3P A;  3S4U A;  2XQY A;  4EXT A;  2CMR A;  4KBM B;  4PNI A;  4PJJ A;  3CWZ B;  5HXS A;  4IIJ E;  2LOP A;  4UVA B;  5FXZ A;  5FMN A;  3NBX X;  3K8P C;  4O2B E;  5F8P A;  3ANW A;  5LYJ E;  4JEH B;  2W63 A;  4GYR A;  3AAA B;  4ZS3 A;  2K48 A;  2HPL A;  5CA1 E;  3LFM A;  4AQF C;  2OA5 A;  4NUV A;  4ZI3 C;  1QUU A;  4OYK A;  4MLK A;  2JQQ A;  3O1H A;  3CQG B;  4H9R C;  4PFO A;  3I1A A;  1MIY A;  4P09 A;  1D1B A;  4UVB B;  2VWA A;  5JR9 B;  2K24 A;  3FBZ A;  3NZP A;  3F2E A;  1OWA A;  2H7O A;  3F31 A;  5J2U E;  3K3Q C;  4QWN B;  2D5U A;  4X1I E;  3N9O A;  5HWY A;  2BZB A;  2CWO A;  2MTQ A;  4JUY A;  1LVF A;  5L3C B;  3VKH A;  2KMF A;  4UV9 B;  5JVD E;  4P0A A;  4JLE A;  2N2N A;  3NRY A;  4CXY A;  3IF8 B;  1IAP A;  1Y64 B;  4WBO A;  3C64 A;  2DLR A;  3KV4 A;  3LG7 A;  4CZZ B;  3FB2 A;  3KFW X;  3ZYL A;  5JRC A;  5L3D B;  3LK2 B;  3N2K E;  3HR0 A;  4GYS A;  2NTY A;  2VKD A;  1FIO A;  1D0X A;  4O4H E;  5A1L A;  2Q9Q B;  1HCI A;  4YJ3 E;  5JDH A;  1S35 A;  1D0Z A;  5L3F B;  1KNZ A;  2CLY C;  4QKN A;  3N9M A;  4H9P C;  4IE0 A;  2BDE A;  3MKD A;  2C0S A;  2NWB A;  4PK4 A;  2ODU A;  5KX5 E;  2NOX A;  2V26 A;  3EDU A;  2RP4 A;  4HTE A;  3BQK A;  2CEA A;  4AXP A;  5JDL A;  2JPF A;  2KWH A;  3C50 A;  3ZCJ A;  2N1G A;  3AA7 B;  5FY0 A;  4UV8 B;  4DO0 A;  2N9D A;  2VB6 A;  4AQG A;  2X9X A;  5LGU B;  2NW7 A;  4CI3 B;  4IGU A;  5L2L A;  4I50 E;  2NP9 A;  1LRZ A;  2D0T A;  4H9N C;  3ZJ1 A;  1HG5 A;  4C90 A;  5L3G B;  4QXH B;  1MNE A;  3RH3 A;  3PDY A;  3ZCI A;  3HL6 A;  3C4X A;  2WBL A;  4EIW A;  3I9Y A;  5EZY E;  2W62 A;  2KZ7 B;  3ANW B;  4BAY B;  3EVY A;  4G2A A;  2ZM2 A;  3DJB A;  5J1G A;  1S94 A;  1Z0P A;  4MAL A;  2E9X C;  3UUN A;  3QK6 A;  1HTJ F;  3CPZ A;  4H9O C;  1U5P A;  5JR9 A;  4WBN E;  2KIN B;  4YHJ A;  5LBM A;  4IHJ E;  3E22 E;  4UIG A;  2CXL A;  1WYB A;  2C5J A;  4H9S E;  2CXD A;  4O4L E;  4FJO A;  3LK3 B;  3PUG A;  2V7K A;  4C91 A;  4H63 H;  2X68 A;  4EOZ B;  2WWU A;  4NUU A;  4X1K E;  3RRC A;  2YU2 A;  4EZH A;  5L3E B;  3FBL A;  4L0R A;  3RC3 A;  4HE8 A;  3SRZ A;  3AA0 B;  4GIW A;  3ZYK A;  3ZMS B;  1MIV A;  2MYS A;  2Y48 B;  2CXF A;  3O1J A;  3ZYM A;  4ZI2 D;  4CI2 B;  4MBQ A;  2Q9Q A;  1YW0 A;  1ZEE A;  2X0L B;  1WR6 A;  3DP7 A;  3U78 A;  4PK5 A;  4PJL A;  1X79 A;  3HKD E;  3UT5 E;  1HFA A;  5JDF A;  2LHR A;  4GK5 E;  2K5B B;  4DBR A;  2A2F X;  3O9X A;  4A56 A;  3I0O A;  3N9N A;  1FMV A;  4IST A;  2ZM8 A;  5LXT E;  2V7I A;  1UX4 A;  2XHE B;  4PJN A;  3ZJ2 A;  1MND A;  2VL8 A;  4AKG A;  2A3D A;  5HXH A;  5ADX L;  5FYM A;  2CA5 A;  3KIN B;  4X1Y E;  5JQG E;  3VHL A;  4I4T E;  1ZKE A;  3KBU A;  3E0Z A;  3PUA A;  4AQF A;  3MJX A;  5JDQ A;  3PE0 A;  2C5K T;  2EHO D;  3A5X A;  3I0Q A;  4PJM A;  2JMH A;  3AAI A;  3R84 B;  3VKG A;  5FY1 A;  3M65 A;  3PU3 A;  3BQL A;  2YEV C;  4L9I A;  2E9X B;  5DQW A;  3GMI A;  2LJL A;  3OBV E;  3F57 A;  4UEM A;  3CKD A;  1SA0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...