4H9QC

Complex structure 4 of daxx(e225a)/h3.3(sub5)/h4
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
205
structure length
205
Chain Sequence
b'RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQAARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
molecule tags Dna binding protein/apoptosis
source organism Homo sapiens
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
total genus 76
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9qC00
4H9OC 4H9QC 4H9RC 4HGAA 4H9NC 5KDMC 4H9SE 4H9PC
chains in the Genus database with same CATH superfamily
1Z0PA 4YSYA 2NTXA 2X0YA 1XZYA 3NBXX 4EV6A 3ZCJA 3P50A 3FZMB 3NRXA 3X1DA 4PAGA 1WCRA 5IWAT 3O9XA 3TLWA 3F2EA 3ZMTB 2ZM0A 3HKCE 2XUEA 4X64T 1MMGA 1W9RA 4TNVA 2BVMA 3AECA 4DR6T 3A5XA 3AAIA 1O3XA 4LMKA 4OFZA 3T1YT 5JRCB 5GONE 4ILUA 2J47A 4AQFC 1VOMA 4HKAA 2DHRA 2XAJB 4HWIB 4IE7A 3ZT7A 4EGWA 4H9QC 2XQ7A 4J2CA 1D0XA 5AQVB 2E5LT 2Q9QA 3UQ7A 2AXDS 4NUUA 2LOSA 1NENA 4UEMA 2IIUA 4ILAA 5LGTB 2A72A 4YSZA 4X66T 2WSSV 3PUSA 3UT5E 3ZSSA 5LJNA 3KFWX 2BG9A 2WWVA 2VVSA 5HEGA 4HE8A 5EK4A 4IDZA 2WZHA 3M65A 2N2NA 2XM2A 3KVBA 4ILCA 2V1DB 4JYAT 4DV5T 2KWHA 1G73A 2KNDA 2LEHA 3RRCA 3B5MA 4DNDA 2UUAT 2NP9A 3GMIA 2JQKA 3PTRB 4MLKA 4O2BE 3CPZA 5F5WA 4IGUA 4ERRA 4ILBA 1M7KA 3RKGA 1OXZA 3P4RA 5F3JA 3AA7B 1YKEB 3LG7A 4DV6T 1XMOT 2XJ7A 3ABVA 4NXMT 4NXNT 2BG9E 3L09A 4MFRA 2V6XA 2V8SV 4YY3T 1VCSA 2LKHA 1OEDC 2WM9A 2E5VA 4DMVA 2WS3A 4O2AE 3AAEB 2M6IA 4CXXA 2K3WA 2XQ9A 4MHCA 4LFBT 1UK5A 3DP7A 4OHFA 4DBQA 4HFCA 4HEAA 1MMNA 5CA0E 2EHOD 3SWHA 4M1PA 4OYKA 2LSKA 3KV9A 2CHOA 4ISTA 3AA0B 2RPAA 3CWZB 2EHOB 4O8SA 3OJAA 4TUYE 2ZM8A 4TV8E 5DQWA 4XAXB 3UUBA 3ZN1B 4DVDA 5ABFB 5KDMC 5L3CB 4GK0E 4O4LE 1BR2A 2C5IT 3CKDA 2XAFB 3HKEE 2A3DA 3PUZF 5AQUB 5HCMA 2V5DA 4AISA 1V9DA 1N32T 4GKKT 2WU5A 3AAAB 4U2YA 5JR9A 3ZMVB 3HL6A 5J2UE 5TAOA 3ZPOA 2E9XB 3ANWB 2XAGB 3C4XA 3HR0A 5AQJB 2CCQA 5AQSB 4AKIA 4DR1T 5LXTE 4PNIA 2Z6EA 2XASB 3GA8A 4UVCB 5IUXA 3TLSA 2HN2A 2PJQA 2LRLA 2MBGA 5C2TA 5BR8T 2V7LA 4O4HE 4DV3T 1UURA 2YEVC 4GKJT 4K0KT 2QA7A 2Q9QD 1E7PA 5JDLA 3E22E 1W0BA 4OYJA 5AQLB 5LOVE 2WMNA 1FMVA 2V7JA 3Q5DA 3P4WA 2LT3A 4IREA 4PJMA 4IDPA 2DCFA 4P0BA 3AE8A 3AEAA 5LGUB 4EB6E 2KSRA 4H63V 2CRBA 4DV0T 1KF6A 1T8BA 3IA3A 3L39A 4FI5A 4JLEA 5AQPB 4G2AA 1HX8A 3FBZA 5HEOA 3RHWA 5HXHA 3EABA 2CE7A 4IL4A 4JI4T 4PK5A 4LFCT 4CQIA 4AQYT 2LJLA 5L3EB 2IC6A 2BG9B 2EHOA 3AE2A 3BQIA 3C4WA 2HPLA 4I55E 4FJOA 3CK6A 2ZM2A 4AKLA 4LF5T 3NZPA 4U72A 1OEDE 1UX4A 3N2GE 2W00A 4WYVA 5FXXA 3UFEA 3JC6D 2W62A 1S94A 4JI7T 1VCTA 2D5UA 2XHEB 4IT4A 5LBMA 3K8PC 5EK3A 5HXCA 1E1HB 3N2OA 2E9XA 1HFAA 3ANWA 3OBVE 4CN6A 4DR5T 2WDRA 2HH7A 2WP9A 2AE9A 3PU3A 5HAXA 3L8RA 4EYUA 4TWDA 2Q9QC 2YOEA 3P4PA 2X51A 3QK6A 3UUXB 2VQFT 4QXHB 3I1AA 2I59A 1HF8A 1IJ5A 1WFDA 2XQYA 3C64A 1Z8UA 2CBJA 5HXEA 5JDQA 3N5LA 4JV5T 3NWIA 4KHPT 5HYAA 3ZLIA 5FYMA 2WWUA 4LMJA 3AA1B 3LK42 1ZKEA 1W0AA 3B13A 1J5WA 2XQ4A 2XSBA 4XZCA 4MBQA 3SRZA 4E7ZA 5JDMA 3CQXC 3R6NA 1CHUA 4K0UA 1Y01A 3RF1A 1D0ZA 4YTPA 3PUQA 4F8HA 3ZC1A 2IMLA 3D0TA 3E08A 5E0OA 4DR2T 3N9QA 2H89A 3Q5EA 4QH4A 1CUNA 1XNRT 1UGOA 3M3ZB 2WU2A 2BS3A 2YDRA 3EI0A 3MJXA 2KT9A 5FXZA 3K1SA 2YDQA 3CX7B 3DTOA 2H88A 2CM0A 4O4IE 2VKJA 3MXZA 1M62A 2W66A 4IE4A 5LHIB 4AQFA 2X67A 4JUYA 2XQAA 4EEBA 5FMNA 4CI2B 2X68A 3EDUA 2ZM6T 5FY7A 3RIAA 3NKZA 3P4QA 1OWAA 3EUHA 3Q2MA 2CLYC 2WZIA 2E9XD 2P9BA 3PDYA 1BR4A 2N1GA 2VWAA 1WRDA 2YKSA 3OYZA 2WAUA 3ONJA 2VURA 5DJQC 3RH3A 3EVYA 4DV1T 3AEGA 4H9PC 2NOXA 3JC6C 3EHZA 5LP6E 3I9YA 5J0ZA 4O4JE 3ZYMA 1IBMT 4KP3C 4HFDA 4TWFA 5JDFA 4AKHA 1XDPA 5AQKB 1W09A 5LHGB 2UUCT 2LKGA 3AVRA 4YTMA 5C8YE 2ODUA 2MYSA 4A97A 3N2KE 5DABA 3AE9A 3UU6A 1YW0A 3CVRA 1XMQT 5CJ5A 4JI8T 2K9AA 2Y6XA 2VQET 4DR4T 2I0MA 1ZHCA 4IE6A 4G63A 3BK9A 4EEDA 3VKGA 3KV5A 1UX5A 2OA5A 4AKGA 4AKRB 2JRKA 2V7IA 3C51A 4A5XA 5HEUA 1LVKA 4QH5A 3ZCIA 5JQGE 2LLYA 1WR0A 1KFYA 2W0GA 4CN4A 3VKHA 4QXCB 1YQ3A 3J7Yq 1R8IA 5LBQB 2XZEA 3HA4A 5HXRA 4X1IE 2UXCT 1BR1A 2LSIA 2X9HA 2Y8DA 4LF8T 5LJMA 3P8CD 3ZJ1A 4JI0T 2VKOA 1KNPA 4BA9A 1N33T 1D1CA 4B3MT 3JAFA 2XM1A 3LBXA 2OLTA 4PK6A 2BDEA 3BQKA 1KNZA 3C4ZA 3ZYKA 5FNVE 3AB3B 4NIQA 4NUVA 4X1KE 5FP3A 2YDSA 2DL1A 4HFVA 2F4VT 2CWYA 2BBHA 2HPJA 4U74A 3ZEFB 4YT0A 5ABEA 3FZHB 2E2AA 2X9WA 5C3JA 4PK4A 4EIWA 4B6XA 4HWDA 3QB5K 3PUYF 4IE5A 4DMWA 1EZ3A 2C5KT 2WBLA 4LF9T 2XAQB 2IDOB 3IBPA 1KEYA 3I0OA 2G0UA 2D9DA 3VU7H 2XQ5A 3AE6A 3UTKA 2NR4A 2XAHB 1QLBA 3H37A 3HI2A 4YHJA 1MMAA 4ZZCA 3UULA 4BJMA 3QUJA 2YU1A 5JDNA 2WCAA 5JR9C 5HEJA 3C98B 5AQRB 3ETVA 4DV2T 4YXDA 2FUPA 5J2TE 1XNQT 2NW7A 5HEHA 4QXBB 5CB4E 3RYHE 3ZC0A 1HNWT 2CXDA 5A1LA 1KNRA 2DLRA 4TWHA 5AQMB 2LOPA 2VASA 2WQYA 3CX8B 4DUYT 2W67A 4HN9A 4COFA 4C91A 4YTNA 1WYCA 4ADZA 5AFUL 2L8KA 4B3TT 4QH1A 2MOZA 3RQWA 4ZI7E 5FL0A 3OTOT 4KX6A 4CI3B 4TNWA 2EHOC 2PFVA 3RIUA 4CXYA 4BAYB 2H7OA 3FZLB 2JIWA 2IAKA 4ISSA 4QX8B 3OPCA 3IHRA 2LE8A 3F31A 2J1DG 3AEFA 3K3QC 3SOLA 1Y64B 4YJ2E 4CI1B 2CHNA 4P1NA 4CN1A 4ZI2D 2WY2A 5FY1A 3FBLA 4PJLA 2ACZA 1IAPA 1U4QA 1FMWA 2XPKA 3RLFF 4ZEYA 2E9XC 5BMVE 1HNZT 4Z90A 3T1HT 4C90A 4LF4T 5HWXA 4U3CA 3H3AA 2DI4A 2JPFA 4QKNA 2BKPA 4JEHB 3WAJA 3UFGA 2MTQA 2X0LB 3RYIE 4EAHA 4GK5E 2KINB 2VKHA 4UELA 2ES0A 2JQHA 3VRAA 4HWCA 4WW0A 1D0YA 3U78A 2LRKA 1SE7A 3AA6B 2JQ9A 3I0QA 3ZMZB 4EOZB 2KZ7B 3H3MA 4ZS2A 1DU2A 2ACXA 4ANJA 5LG4A 3NZQA 3HKDE 1ZV4X 2YK0A 3N9OA 1BR0A 1I94T 2C5JA 2A2FX 2VKDA 4QX7B 4U33A 3LBXB 3BQLA 3A7MA 1X9BA 2CA5A 2NW8A 3SFDA 3WAKA 4AIUA 2D0TA 2GK9A 2HN1A 2BS4A 1WLXA 4XBFB 1YKHB 3AE4A 4L5GA 3FXEB 5J1GA 3O1HA 2K5BB 4QHOA 5AQOB 3KV6A 3UU4A 3GN5B 5HXSA 4HFHA 1NEKA 2KWIB 2J4GA 4U31A 2A9UA 2X9XA 4ZOLE 3JAEA 5AQQB 2DWGA 1FEWA 1ZOYA 1XDOA 4DV4T 4AQGA 4I4TE 3QB5A 3K3NA 2PG8A 3VHLA 1XWMA 1X79A 5LMNT 1FIOA 2FJAA 3PUAA 3ZT5A 2FJBA 4EYYR 4JBWF 1ZEEA 2K24A 4YSXA 4X62T 3MA9A 3PUXF 5M4YA 3O4XE 3TKLB 1J1JA 5FKYA 2CMRA 2CXFA 3IF8B 2UXNB 3AE7A 2VVNA 4I0UA 5ADXL 5FL1A 5LNKA 3PUWF 3AXJB 1IBLT 5CFBA 2N9DA 1L0VA 2BKNA 4B3RT 2C0SA 3VR8A 1NAFA 1YXRA 3ZN0B 4F6RC 1JNRA 4IDNA 3O1JA 4CXWA 2IHR1 4OX9T 1E2AA 4L0RA 3RIUC 1HTJF 2J62A 1VRBA 5ABFA 1D1BA 1T7SA 4I50E 4JI5T 4Z91A 2UU9T 2NWBA 4H63H 3UQ4A 4KUMB 2QVAA 4IIJE 2V7MA 3OYXA 1S35A 3AE3A 3ZMSB 2LSYA 2XQ8A 4CZZB 2VB6A 3FXDB 3OKQA 3T8OA 2M67A 2UXXB 5H6QB 3W15B 2L9QA 2PBIA 1IJ6A 2H3RA 3GN5A 4ZZBA 4B3ST 2FJDA 3ZSTA 2D0UA 4ZI3D 3ONXA 2DNXA 2YU2A 4HFEA 3RQUA 2KMFA 3S4UA 4BJNA 4WBNE 2QYWA 2V26A 1SUMB 4Q25A 3A8YC 4ZS3A 1OEDB 2QGSA 1MIVA 2RA1A 3FHNA 4UV9B 5JVDE 2FBWA 2V7KA 3FZKB 4PFOA 3CQCB 3PU8A 3Q5WA 4WNKA 2XTLA 5HWYA 4KBMB 4LF7T 2WMOA 3PURA 5JRCA 5AQHB 4A56A 3AE1A 5AQNB 3RC3A 4E7SA 4ZHQE 2L3LA 1IZNB 3Q5XA 4UF0B 4YJ3E 5AQGB 3RIFA 5LYJE 2UUBT 5H6RB 1B7TA 4DUZT 2LSGA 4IDQA 3CX6B 3NRYA 4DR7T 5JDHA 3ZKRA 3K3OA 3ZJ2A 4U7YA 4HFBA 3UU8A 3HKBE 3AEEA 3DJBA 1U5PA 4U2ZA 4X20E 2JMKA 4EZHA 4X65T 5JDGA 2BVLA 1GQEA 2DWKA 4HFIA 4WBOA 1QSDA 4UVBB 4YFSA 2W2UA 3LK2B 3QOFA 4H9OC 1N34T 1AJ3A 4JI2T 1WR6A 2BZBA 3KV4A 3JCFA 4TZ4C 3ESLA 1SA0E 4H9NC 2IC9A 4PJJA 2KXPB 2ODVA 3QNUA 3L3PA 2NW9A 2XY8B 3R84B 3U3IA 2H7VC 3ZYLA 1J5ET 2W61A 3B57A 5AQTB 2M6BA 3EDVA 3MZKB 5LA6E 3RI5A 5LG3A 2K48A 2BS2A 1T98A 3FZFB 5L2LA 2X66A 4QWNB 3LSVA 2CWOA 3KBUA 1I6ZA 3N9PA 3CMLA 5FXVA 3TLVA 5FY0A 1OEDA 1YD8G 3P7IA 3UUNA 4EXTA 3TLTA 5L3GB 4ZI2C 3G06A 4L9IA 3VR9A 5L3FB 1HCIA 3V5UA 4X5TA 4HWHA 1UUSA 1NWMX 1YQ4A 1SHZC 4DR3T 2R6GF 3RGLA 3LFMA 2E8IA 2MPKA 4UVAB 4PFPA 3RYFE 3PE0A 3TLUA 1KK7A 5ABGA 2XQ3A 3E0ZA 4UF0A 4H9SE 2XQ6A 5DQVA 5HCJA 5L4EA 5LGNB 4U7IA 1US7B 2BG9C 3LJCA 2IW5B 5KXJA 5L3BB 3P4SA 3RRWA 2FJEA 5LCYA 5CA1E 2D2SA 5FXWA 5KMGP 5EZYE 4JEUB 3J9X1 5L47A 1HG2A 3LK3B 3WI3A 3FB2A 4IE0A 1MIWA 4HTEA 4DV7T 1LRZA 4P09A 1ZP0A 3EAMA 1QUUA 5CGMA 3O1IA 1T72A 3PJAA 2JJ9A 5ABHA 4KI0F 4EZ4A 2OV9A 4UIGA 5JR9B 3I9WA 3IEEA 5L4HA 4UR9A 2Q9QB 5IHYA 4GIWA 3UU5A 1LKXA 3KDSE 3RKOA 2W63A 4HGAA 3V5SA 1MIYA 2ZLYA 3MK7C 4DIDB 2V5CA 1MMDA 4GYSA 5JREA 4Z8XA 4MALA 2UXDT 3PJAJ 2VL8A 3QC9A 2CEAA 3KVAA 2YINA 3PUVF 4ASKA 3JADA 4TV9E 4TN7B 3C50A 4P0AA 4ZI3C 2LHRA 2X0HA 4KMCA 5F8PA 5EK2A 2VK9A 3NVOA 4DO0A 2WB5A 2MAWA 2V6YA 2WDQA 3F57A 3PV0F 2CBIA 2SPCA 3ETUA 3UUMA 3ZMUB 3PUGA 1IBKT 4AI6A 3AEBA 1D1AA 3RPUA 4LMLA 5JH7E 2LM2A 2LSJA 4X1YE 4JI6T 2B1EA 2JQQA 5L3DB 2Y48B 4PW8A 5LB7B 3RYCE 4LFAT 2LHNA 2X9YA 2CPTA 3N9MA 3KBTA 3ONLC 3OVUA 4AXPA 4GYRA 4YHHT 5AQIB 3N9NA 1WYBA 4UV8B 3SS1A 5LHHB 2HHHT 4JI3T 4GOUA 3UU3A 2UXBT 2NTYA 3AEDA 3AXJA 2BBJA 4A98A 1FJGT 1JNZA 4N78D 1H7CA 1G8XA 2LM9A 2B76A 2VL0A 2XSAA 2ZMAA 3N9LA 3RC8A 2RP4A 3MACA 4PJNA 2QRXA 4YLHA 4H9RC 3KINB 3VRBA 5LMUT 5IYZE 2W4XA 2CLYB 3RX6A 3AE5A 1MNEA 1UCUA 3LDQB 5AQFB 2BKOA 5KX5E 2YN6A 4DBRA 2JMHA 3MKDA 4WZXA 4I43B 4ZXLA 1N36T 4JI1T 1HG5A 5JTGA 1HNXT 1LVFA 2CXLA 5FVKA 2IUBA 3SFEA 4LF6T 4UXNB 3AVSA 4V1Av 3ZT6A 3Q9DA 1MNDA 4NPPA 2WDVA 5FVLA 1HR0T 4IHJE 4TX5A 4HWFA 1HX1B 4IDOA 2I6HA 2V6YB 3CIRA 3CQGB 3GWHA 4IL9A 5ETWA 1HS7A 2PTFA 4OK0A 4KHZF 2KLQA
chains in the Genus database with same CATH topology
1Z0PA 2NTXA 3NBXX 3ZCJA 3NRXA 3O9XA 4PAGA 3F2EA 3ZMTB 2ZM0A 3HKCE 2XUEA 1MMGA 2BVMA 5JRCB 3A5XA 3AAIA 1O3XA 4OFZA 5GONE 4ILUA 4AQFC 1VOMA 4HKAA 2DHRA 2XAJB 4IE7A 4H9QC 4J2CA 1D0XA 2Q9QA 4NUUA 2LOSA 4UEMA 5LGTB 2A72A 2WSSV 3PUSA 3UT5E 5LJNA 3KFWX 4HE8A 5EK4A 4IDZA 3M65A 2N2NA 3KVBA 2V1DB 2KWHA 1G73A 2KNDA 2LEHA 3RRCA 4DNDA 2NP9A 3GMIA 3PTRB 4MLKA 4O2BE 3CPZA 4IGUA 1OXZA 5F3JA 3AA7B 1YKEB 3LG7A 3L09A 4MFRA 2WM9A 4DMVA 4O2AE 4CXXA 3AAEB 4MHCA 3DP7A 4DBQA 4OHFA 4HEAA 1MMNA 5CA0E 2EHOD 3SWHA 4M1PA 4OYKA 2LSKA 3KV9A 4ISTA 3AA0B 3CWZB 5DQWA 2EHOB 4O8SA 3OJAA 4TUYE 2ZM8A 4TV8E 3ZN1B 4XAXB 4DVDA 4ERRA 5KDMC 5L3CB 4GK0E 4O4LE 1BR2A 2C5IT 3CKDA 2XAFB 3HKEE 2A3DA 1V9DA 3AAAB 5JR9A 3ZMVB 5J2UE 3HL6A 5TAOA 3ZPOA 2E9XB 3ANWB 2XAGB 3C4XA 3HR0A 2CCQA 5LXTE 4PNIA 2Z6EA 2XASB 3GA8A 4UVCB 2PJQA 2MBGA 2V7LA 4O4HE 2YEVC 2QA7A 2Q9QD 5JDLA 3E22E 4OYJA 5LOVE 2WMNA 1FMVA 2V7JA 2LT3A 4PJMA 2DCFA 4P0BA 5LGUB 4EB6E 4H63V 4JLEA 4FI5A 4G2AA 1HX8A 3FBZA 5HXHA 2CE7A 4PK5A 4CQIA 2LJLA 5L3EB 2IC6A 4E7ZA 2EHOA 3BQIA 3C4WA 4I55E 2HPLA 4FJOA 2ZM2A 4AKLA 3NZPA 4U72A 1UX4A 3N2GE 2W00A 5FXXA 3UFEA 3JC6D 2W62A 1S94A 2D5UA 2XHEB 5LBMA 3K8PC 5EK3A 5HXCA 1E1HB 3N2OA 2E9XA 3ANWA 1HFAA 3OBVE 2HH7A 3PU3A 5HAXA 4EYUA 2Q9QC 2X51A 3QK6A 3UUXB 4QXHB 3I1AA 2I59A 1HF8A 1IJ5A 2XQYA 3C64A 5HXEA 5JDQA 3N5LA 5HYAA 3ZLIA 5FYMA 2WWUA 3AA1B 3LK42 1ZKEA 3B13A 4XZCA 4MBQA 3SRZA 5JDMA 3CQXC 3R6NA 4K0UA 1D0ZA 3PUQA 3ZC1A 3D0TA 3E08A 5E0OA 3N9QA 1CUNA 3MJXA 5FXZA 2KT9A 3CX7B 3DTOA 2CM0A 4O4IE 2VKJA 3MXZA 4IE4A 5LHIB 4AQFA 2X67A 4JUYA 5FMNA 4CI2B 2X68A 3EDUA 5FY7A 1OWAA 3EUHA 3Q2MA 2CLYC 2E9XD 2P9BA 3PDYA 1BR4A 2N1GA 2VWAA 1WRDA 3OYZA 5DJQC 2WAUA 3RH3A 3EVYA 4H9PC 2NOXA 3JC6C 5LP6E 4AKIA 3I9YA 4O4JE 3ZYMA 4AKHA 4KP3C 5JDFA 5LHGB 3AVRA 5C8YE 2ODUA 2MYSA 3N2KE 5DABA 1YW0A 3CVRA 2K9AA 2Y6XA 3VKGA 1ZHCA 4IE6A 4G63A 3BK9A 3KV5A 1UX5A 2OA5A 4AKGA 4AKRB 2JRKA 2V7IA 3C51A 1LVKA 3ZCIA 5JQGE 2W0GA 3VKHA 4QXCB 3J7Yq 5LBQB 3HA4A 5HXRA 4X1IE 1BR1A 2LSIA 2X9HA 2Y8DA 5LJMA 3P8CD 3ZJ1A 2VKOA 4BA9A 1D1CA 3LBXA 4PK6A 2BDEA 3BQKA 1KNZA 3C4ZA 3ZYKA 5FNVE 3AB3B 4NUVA 4X1KE 5FP3A 4HFVA 2CWYA 2HPJA 4U74A 3ZEFB 2X9WA 4PK4A 4EIWA 4B6XA 4IE5A 4DMWA 1EZ3A 2C5KT 2WBLA 2XAQB 3IBPA 3I0OA 2G0UA 3VU7H 3UTKA 2XAHB 3HI2A 3H37A 4YHJA 1MMAA 3UULA 4BJMA 3QUJA 2YU1A 5JDNA 5JR9C 3C98B 3ETVA 5J2TE 2NW7A 3RYHE 4QXBB 5CB4E 3ZC0A 2CXDA 5A1LA 2DLRA 2LOPA 2VASA 3CX8B 4HN9A 4C91A 5AFUL 1WYCA 4ADZA 2L8KA 2MOZA 4ZI7E 4CI3B 2EHOC 2PFVA 4CXYA 4BAYB 2H7OA 2IAKA 4ISSA 4QX8B 3IHRA 2LE8A 3F31A 2J1DG 3K3QC 3SOLA 4YJ2E 1Y64B 4CI1B 4ZI2D 5FY1A 3FBLA 4PJLA 1IAPA 1U4QA 1FMWA 2E9XC 5BMVE 4C90A 5HWXA 3H3AA 2DI4A 2JPFA 4QKNA 4JEHB 3WAJA 2MTQA 2X0LB 3RYIE 4EAHA 4GK5E 2KINB 2VKHA 4UELA 2ES0A 4WW0A 3U78A 1D0YA 3ZMZB 3AA6B 3I0QA 4EOZB 2KZ7B 4ZS2A 2ACXA 4ANJA 5LG4A 3NZQA 3HKDE 1ZV4X 2YK0A 3N9OA 1BR0A 2C5JA 2A2FX 2VKDA 4QX7B 3LBXB 3BQLA 2CA5A 2NW8A 3WAKA 2D0TA 2GK9A 1WLXA 4XBFB 1YKHB 4L5GA 3FXEB 5J1GA 3O1HA 2K5BB 4QHOA 5HXSA 3KV6A 3GN5B 2KWIB 2X9XA 4ZOLE 2DWGA 1FEWA 4AQGA 4I4TE 3K3NA 2PG8A 3VHLA 1X79A 1FIOA 3PUAA 4EYYR 1ZEEA 2K24A 3MA9A 5M4YA 3O4XE 3TKLB 5ADXL 2CMRA 2CXFA 3IF8B 2UXNB 5LNKA 2N9DA 2C0SA 1NAFA 3ZN0B 4F6RC 3O1JA 4CXWA 4L0RA 1HTJF 1VRBA 1D1BA 4I50E 2NWBA 4H63H 4KUMB 4IIJE 2V7MA 3OYXA 1S35A 3ZMSB 2LSYA 4CZZB 2VB6A 3FXDB 3OKQA 3T8OA 2M67A 2UXXB 5H6QB 3W15B 2L9QA 2PBIA 1IJ6A 2H3RA 3GN5A 2D0UA 3ONXA 2DNXA 2YU2A 4BJNA 2KMFA 3S4UA 4WBNE 2V26A 4ZS3A 5JVDE 2QGSA 3FHNA 1MIVA 2RA1A 4UV9B 2V7KA 4PFOA 3CQCB 3PU8A 3Q5WA 4WNKA 2XTLA 5HWYA 4KBMB 2WMOA 3PURA 5JRCA 4A56A 3RC3A 4E7SA 4ZHQE 2L3LA 1IZNB 3Q5XA 4UF0B 4YJ3E 5LYJE 5H6RB 1B7TA 2LSGA 3CX6B 3NRYA 5JDHA 3K3OA 3ZJ2A 3HKBE 3DJBA 1U5PA 4X20E 2JMKA 4EZHA 5JDGA 2BVLA 4YFSA 2DWKA 4WBOA 1QSDA 4UVBB 3LK2B 4H9OC 1AJ3A 1WR6A 2BZBA 3KV4A 4TZ4C 3ESLA 1SA0E 4H9NC 2IC9A 4PJJA 2KXPB 2ODVA 3U3IA 3L3PA 2NW9A 3R84B 3ZYLA 2H7VC 2W61A 3B57A 3EDVA 3MZKB 5LA6E 2K48A 1T98A 5L2LA 2X66A 4QWNB 2CWOA 3KBUA 3N9PA 3CMLA 5FXVA 5FY0A 1YD8G 3P7IA 3UUNA 4EXTA 5L3GB 4ZI2C 4L9IA 5L3FB 1HCIA 3V5UA 1NWMX 1SHZC 3LFMA 2E8IA 4UVAB 3RYFE 4PFPA 3PE0A 1KK7A 3E0ZA 4UF0A 4H9SE 5DQVA 5LGNB 1US7B 2IW5B 3LJCA 5L3BB 3RRWA 5LCYA 5CA1E 2D2SA 5FXWA 5KMGP 5EZYE 4JEUB 3J9X1 1HG2A 3LK3B 3WI3A 3FB2A 4IE0A 1MIWA 4HTEA 1LRZA 4P09A 1QUUA 3O1IA 2JJ9A 4EZ4A 4UIGA 5JR9B 3I9WA 3IEEA 2Q9QB 5IHYA 4GIWA 1LKXA 3KDSE 3RKOA 2W63A 4HGAA 3V5SA 1MIYA 2ZLYA 3MK7C 5JREA 1MMDA 4GYSA 4Z8XA 4MALA 2VL8A 3QC9A 2CEAA 3KVAA 2YINA 4ASKA 4TV9E 4TN7B 3C50A 4P0AA 4ZI3C 2LHRA 4KMCA 5F8PA 5EK2A 2VK9A 4DO0A 4ZI3D 3F57A 3ZMUB 2SPCA 3ETUA 3UUMA 3PUGA 4AI6A 1D1AA 3RPUA 5JH7E 2LSJA 4X1YE 2B1EA 2JQQA 5L3DB 2Y48B 4PW8A 3RYCE 2LHNA 2X9YA 3N9MA 3KBTA 4AXPA 4GYRA 3SS1A 3N9NA 1WYBA 4UV8B 5LHHB 4GOUA 2NTYA 4N78D 1H7CA 1G8XA 2LM9A 3N9LA 2ZMAA 3RC8A 2RP4A 3MACA 4PJNA 4YLHA 4H9RC 3KINB 5IYZE 2CLYB 3RX6A 1MNEA 1UCUA 5KX5E 4DBRA 2JMHA 3MKDA 4I43B 1HG5A 1LVFA 2CXLA 4UXNB 3AVSA 4V1Av 3Q9DA 1MNDA 4IHJE 4TX5A 5ETWA 3GWHA 3CQGB 1HS7A 4OK0A 2KLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O C;  4H9Q C;  4H9R C;  4HGA A;  4H9N C;  5KDM C;  4H9S E;  4H9P C; 
#chains in the Genus database with same CATH topology
 1Z0P A;  4YSY A;  2NTX A;  2X0Y A;  1XZY A;  3NBX X;  4EV6 A;  3ZCJ A;  3P50 A;  3FZM B;  3NRX A;  3X1D A;  4PAG A;  1WCR A;  5IWA T;  3O9X A;  3TLW A;  3F2E A;  3ZMT B;  2ZM0 A;  3HKC E;  2XUE A;  4X64 T;  1MMG A;  1W9R A;  4TNV A;  2BVM A;  3AEC A;  4DR6 T;  3A5X A;  3AAI A;  1O3X A;  4LMK A;  4OFZ A;  3T1Y T;  5JRC B;  5GON E;  4ILU A;  2J47 A;  4AQF C;  1VOM A;  4HKA A;  2DHR A;  2XAJ B;  4HWI B;  4IE7 A;  3ZT7 A;  4EGW A;  4H9Q C;  2XQ7 A;  4J2C A;  1D0X A;  5AQV B;  2E5L T;  2Q9Q A;  3UQ7 A;  2AXD S;  4NUU A;  2LOS A;  1NEN A;  4UEM A;  2IIU A;  4ILA A;  5LGT B;  2A72 A;  4YSZ A;  4X66 T;  2WSS V;  3PUS A;  3UT5 E;  3ZSS A;  5LJN A;  3KFW X;  2BG9 A;  2WWV A;  2VVS A;  5HEG A;  4HE8 A;  5EK4 A;  4IDZ A;  2WZH A;  3M65 A;  2N2N A;  2XM2 A;  3KVB A;  4ILC A;  2V1D B;  4JYA T;  4DV5 T;  2KWH A;  1G73 A;  2KND A;  2LEH A;  3RRC A;  3B5M A;  4DND A;  2UUA T;  2NP9 A;  3GMI A;  2JQK A;  3PTR B;  4MLK A;  4O2B E;  3CPZ A;  5F5W A;  4IGU A;  4ERR A;  4ILB A;  1M7K A;  3RKG A;  1OXZ A;  3P4R A;  5F3J A;  3AA7 B;  1YKE B;  3LG7 A;  4DV6 T;  1XMO T;  2XJ7 A;  3ABV A;  4NXM T;  4NXN T;  2BG9 E;  3L09 A;  4MFR A;  2V6X A;  2V8S V;  4YY3 T;  1VCS A;  2LKH A;  1OED C;  2WM9 A;  2E5V A;  4DMV A;  2WS3 A;  4O2A E;  3AAE B;  2M6I A;  4CXX A;  2K3W A;  2XQ9 A;  4MHC A;  4LFB T;  1UK5 A;  3DP7 A;  4OHF A;  4DBQ A;  4HFC A;  4HEA A;  1MMN A;  5CA0 E;  2EHO D;  3SWH A;  4M1P A;  4OYK A;  2LSK A;  3KV9 A;  2CHO A;  4IST A;  3AA0 B;  2RPA A;  3CWZ B;  2EHO B;  4O8S A;  3OJA A;  4TUY E;  2ZM8 A;  4TV8 E;  5DQW A;  4XAX B;  3UUB A;  3ZN1 B;  4DVD A;  5ABF B;  5KDM C;  5L3C B;  4GK0 E;  4O4L E;  1BR2 A;  2C5I T;  3CKD A;  2XAF B;  3HKE E;  2A3D A;  3PUZ F;  5AQU B;  5HCM A;  2V5D A;  4AIS A;  1V9D A;  1N32 T;  4GKK T;  2WU5 A;  3AAA B;  4U2Y A;  5JR9 A;  3ZMV B;  3HL6 A;  5J2U E;  5TAO A;  3ZPO A;  2E9X B;  3ANW B;  2XAG B;  3C4X A;  3HR0 A;  5AQJ B;  2CCQ A;  5AQS B;  4AKI A;  4DR1 T;  5LXT E;  4PNI A;  2Z6E A;  2XAS B;  3GA8 A;  4UVC B;  5IUX A;  3TLS A;  2HN2 A;  2PJQ A;  2LRL A;  2MBG A;  5C2T A;  5BR8 T;  2V7L A;  4O4H E;  4DV3 T;  1UUR A;  2YEV C;  4GKJ T;  4K0K T;  2QA7 A;  2Q9Q D;  1E7P A;  5JDL A;  3E22 E;  1W0B A;  4OYJ A;  5AQL B;  5LOV E;  2WMN A;  1FMV A;  2V7J A;  3Q5D A;  3P4W A;  2LT3 A;  4IRE A;  4PJM A;  4IDP A;  2DCF A;  4P0B A;  3AE8 A;  3AEA A;  5LGU B;  4EB6 E;  2KSR A;  4H63 V;  2CRB A;  4DV0 T;  1KF6 A;  1T8B A;  3IA3 A;  3L39 A;  4FI5 A;  4JLE A;  5AQP B;  4G2A A;  1HX8 A;  3FBZ A;  5HEO A;  3RHW A;  5HXH A;  3EAB A;  2CE7 A;  4IL4 A;  4JI4 T;  4PK5 A;  4LFC T;  4CQI A;  4AQY T;  2LJL A;  5L3E B;  2IC6 A;  2BG9 B;  2EHO A;  3AE2 A;  3BQI A;  3C4W A;  2HPL A;  4I55 E;  4FJO A;  3CK6 A;  2ZM2 A;  4AKL A;  4LF5 T;  3NZP A;  4U72 A;  1OED E;  1UX4 A;  3N2G E;  2W00 A;  4WYV A;  5FXX A;  3UFE A;  3JC6 D;  2W62 A;  1S94 A;  4JI7 T;  1VCT A;  2D5U A;  2XHE B;  4IT4 A;  5LBM A;  3K8P C;  5EK3 A;  5HXC A;  1E1H B;  3N2O A;  2E9X A;  1HFA A;  3ANW A;  3OBV E;  4CN6 A;  4DR5 T;  2WDR A;  2HH7 A;  2WP9 A;  2AE9 A;  3PU3 A;  5HAX A;  3L8R A;  4EYU A;  4TWD A;  2Q9Q C;  2YOE A;  3P4P A;  2X51 A;  3QK6 A;  3UUX B;  2VQF T;  4QXH B;  3I1A A;  2I59 A;  1HF8 A;  1IJ5 A;  1WFD A;  2XQY A;  3C64 A;  1Z8U A;  2CBJ A;  5HXE A;  5JDQ A;  3N5L A;  4JV5 T;  3NWI A;  4KHP T;  5HYA A;  3ZLI A;  5FYM A;  2WWU A;  4LMJ A;  3AA1 B;  3LK4 2;  1ZKE A;  1W0A A;  3B13 A;  1J5W A;  2XQ4 A;  2XSB A;  4XZC A;  4MBQ A;  3SRZ A;  4E7Z A;  5JDM A;  3CQX C;  3R6N A;  1CHU A;  4K0U A;  1Y01 A;  3RF1 A;  1D0Z A;  4YTP A;  3PUQ A;  4F8H A;  3ZC1 A;  2IML A;  3D0T A;  3E08 A;  5E0O A;  4DR2 T;  3N9Q A;  2H89 A;  3Q5E A;  4QH4 A;  1CUN A;  1XNR T;  1UGO A;  3M3Z B;  2WU2 A;  2BS3 A;  2YDR A;  3EI0 A;  3MJX A;  2KT9 A;  5FXZ A;  3K1S A;  2YDQ A;  3CX7 B;  3DTO A;  2H88 A;  2CM0 A;  4O4I E;  2VKJ A;  3MXZ A;  1M62 A;  2W66 A;  4IE4 A;  5LHI B;  4AQF A;  2X67 A;  4JUY A;  2XQA A;  4EEB A;  5FMN A;  4CI2 B;  2X68 A;  3EDU A;  2ZM6 T;  5FY7 A;  3RIA A;  3NKZ A;  3P4Q A;  1OWA A;  3EUH A;  3Q2M A;  2CLY C;  2WZI A;  2E9X D;  2P9B A;  3PDY A;  1BR4 A;  2N1G A;  2VWA A;  1WRD A;  2YKS A;  3OYZ A;  2WAU A;  3ONJ A;  2VUR A;  5DJQ C;  3RH3 A;  3EVY A;  4DV1 T;  3AEG A;  4H9P C;  2NOX A;  3JC6 C;  3EHZ A;  5LP6 E;  3I9Y A;  5J0Z A;  4O4J E;  3ZYM A;  1IBM T;  4KP3 C;  4HFD A;  4TWF A;  5JDF A;  4AKH A;  1XDP A;  5AQK B;  1W09 A;  5LHG B;  2UUC T;  2LKG A;  3AVR A;  4YTM A;  5C8Y E;  2ODU A;  2MYS A;  4A97 A;  3N2K E;  5DAB A;  3AE9 A;  3UU6 A;  1YW0 A;  3CVR A;  1XMQ T;  5CJ5 A;  4JI8 T;  2K9A A;  2Y6X A;  2VQE T;  4DR4 T;  2I0M A;  1ZHC A;  4IE6 A;  4G63 A;  3BK9 A;  4EED A;  3VKG A;  3KV5 A;  1UX5 A;  2OA5 A;  4AKG A;  4AKR B;  2JRK A;  2V7I A;  3C51 A;  4A5X A;  5HEU A;  1LVK A;  4QH5 A;  3ZCI A;  5JQG E;  2LLY A;  1WR0 A;  1KFY A;  2W0G A;  4CN4 A;  3VKH A;  4QXC B;  1YQ3 A;  3J7Y q;  1R8I A;  5LBQ B;  2XZE A;  3HA4 A;  5HXR A;  4X1I E;  2UXC T;  1BR1 A;  2LSI A;  2X9H A;  2Y8D A;  4LF8 T;  5LJM A;  3P8C D;  3ZJ1 A;  4JI0 T;  2VKO A;  1KNP A;  4BA9 A;  1N33 T;  1D1C A;  4B3M T;  3JAF A;  2XM1 A;  3LBX A;  2OLT A;  4PK6 A;  2BDE A;  3BQK A;  1KNZ A;  3C4Z A;  3ZYK A;  5FNV E;  3AB3 B;  4NIQ A;  4NUV A;  4X1K E;  5FP3 A;  2YDS A;  2DL1 A;  4HFV A;  2F4V T;  2CWY A;  2BBH A;  2HPJ A;  4U74 A;  3ZEF B;  4YT0 A;  5ABE A;  3FZH B;  2E2A A;  2X9W A;  5C3J A;  4PK4 A;  4EIW A;  4B6X A;  4HWD A;  3QB5 K;  3PUY F;  4IE5 A;  4DMW A;  1EZ3 A;  2C5K T;  2WBL A;  4LF9 T;  2XAQ B;  2IDO B;  3IBP A;  1KEY A;  3I0O A;  2G0U A;  2D9D A;  3VU7 H;  2XQ5 A;  3AE6 A;  3UTK A;  2NR4 A;  2XAH B;  1QLB A;  3H37 A;  3HI2 A;  4YHJ A;  1MMA A;  4ZZC A;  3UUL A;  4BJM A;  3QUJ A;  2YU1 A;  5JDN A;  2WCA A;  5JR9 C;  5HEJ A;  3C98 B;  5AQR B;  3ETV A;  4DV2 T;  4YXD A;  2FUP A;  5J2T E;  1XNQ T;  2NW7 A;  5HEH A;  4QXB B;  5CB4 E;  3RYH E;  3ZC0 A;  1HNW T;  2CXD A;  5A1L A;  1KNR A;  2DLR A;  4TWH A;  5AQM B;  2LOP A;  2VAS A;  2WQY A;  3CX8 B;  4DUY T;  2W67 A;  4HN9 A;  4COF A;  4C91 A;  4YTN A;  1WYC A;  4ADZ A;  5AFU L;  2L8K A;  4B3T T;  4QH1 A;  2MOZ A;  3RQW A;  4ZI7 E;  5FL0 A;  3OTO T;  4KX6 A;  4CI3 B;  4TNW A;  2EHO C;  2PFV A;  3RIU A;  4CXY A;  4BAY B;  2H7O A;  3FZL B;  2JIW A;  2IAK A;  4ISS A;  4QX8 B;  3OPC A;  3IHR A;  2LE8 A;  3F31 A;  2J1D G;  3AEF A;  3K3Q C;  3SOL A;  1Y64 B;  4YJ2 E;  4CI1 B;  2CHN A;  4P1N A;  4CN1 A;  4ZI2 D;  2WY2 A;  5FY1 A;  3FBL A;  4PJL A;  2ACZ A;  1IAP A;  1U4Q A;  1FMW A;  2XPK A;  3RLF F;  4ZEY A;  2E9X C;  5BMV E;  1HNZ T;  4Z90 A;  3T1H T;  4C90 A;  4LF4 T;  5HWX A;  4U3C A;  3H3A A;  2DI4 A;  2JPF A;  4QKN A;  2BKP A;  4JEH B;  3WAJ A;  3UFG A;  2MTQ A;  2X0L B;  3RYI E;  4EAH A;  4GK5 E;  2KIN B;  2VKH A;  4UEL A;  2ES0 A;  2JQH A;  3VRA A;  4HWC A;  4WW0 A;  1D0Y A;  3U78 A;  2LRK A;  1SE7 A;  3AA6 B;  2JQ9 A;  3I0Q A;  3ZMZ B;  4EOZ B;  2KZ7 B;  3H3M A;  4ZS2 A;  1DU2 A;  2ACX A;  4ANJ A;  5LG4 A;  3NZQ A;  3HKD E;  1ZV4 X;  2YK0 A;  3N9O A;  1BR0 A;  1I94 T;  2C5J A;  2A2F X;  2VKD A;  4QX7 B;  4U33 A;  3LBX B;  3BQL A;  3A7M A;  1X9B A;  2CA5 A;  2NW8 A;  3SFD A;  3WAK A;  4AIU A;  2D0T A;  2GK9 A;  2HN1 A;  2BS4 A;  1WLX A;  4XBF B;  1YKH B;  3AE4 A;  4L5G A;  3FXE B;  5J1G A;  3O1H A;  2K5B B;  4QHO A;  5AQO B;  3KV6 A;  3UU4 A;  3GN5 B;  5HXS A;  4HFH A;  1NEK A;  2KWI B;  2J4G A;  4U31 A;  2A9U A;  2X9X A;  4ZOL E;  3JAE A;  5AQQ B;  2DWG A;  1FEW A;  1ZOY A;  1XDO A;  4DV4 T;  4AQG A;  4I4T E;  3QB5 A;  3K3N A;  2PG8 A;  3VHL A;  1XWM A;  1X79 A;  5LMN T;  1FIO A;  2FJA A;  3PUA A;  3ZT5 A;  2FJB A;  4EYY R;  4JBW F;  1ZEE A;  2K24 A;  4YSX A;  4X62 T;  3MA9 A;  3PUX F;  5M4Y A;  3O4X E;  3TKL B;  1J1J A;  5FKY A;  2CMR A;  2CXF A;  3IF8 B;  2UXN B;  3AE7 A;  2VVN A;  4I0U A;  5ADX L;  5FL1 A;  5LNK A;  3PUW F;  3AXJ B;  1IBL T;  5CFB A;  2N9D A;  1L0V A;  2BKN A;  4B3R T;  2C0S A;  3VR8 A;  1NAF A;  1YXR A;  3ZN0 B;  4F6R C;  1JNR A;  4IDN A;  3O1J A;  4CXW A;  2IHR 1;  4OX9 T;  1E2A A;  4L0R A;  3RIU C;  1HTJ F;  2J62 A;  1VRB A;  5ABF A;  1D1B A;  1T7S A;  4I50 E;  4JI5 T;  4Z91 A;  2UU9 T;  2NWB A;  4H63 H;  3UQ4 A;  4KUM B;  2QVA A;  4IIJ E;  2V7M A;  3OYX A;  1S35 A;  3AE3 A;  3ZMS B;  2LSY A;  2XQ8 A;  4CZZ B;  2VB6 A;  3FXD B;  3OKQ A;  3T8O A;  2M67 A;  2UXX B;  5H6Q B;  3W15 B;  2L9Q A;  2PBI A;  1IJ6 A;  2H3R A;  3GN5 A;  4ZZB A;  4B3S T;  2FJD A;  3ZST A;  2D0U A;  4ZI3 D;  3ONX A;  2DNX A;  2YU2 A;  4HFE A;  3RQU A;  2KMF A;  3S4U A;  4BJN A;  4WBN E;  2QYW A;  2V26 A;  1SUM B;  4Q25 A;  3A8Y C;  4ZS3 A;  1OED B;  2QGS A;  1MIV A;  2RA1 A;  3FHN A;  4UV9 B;  5JVD E;  2FBW A;  2V7K A;  3FZK B;  4PFO A;  3CQC B;  3PU8 A;  3Q5W A;  4WNK A;  2XTL A;  5HWY A;  4KBM B;  4LF7 T;  2WMO A;  3PUR A;  5JRC A;  5AQH B;  4A56 A;  3AE1 A;  5AQN B;  3RC3 A;  4E7S A;  4ZHQ E;  2L3L A;  1IZN B;  3Q5X A;  4UF0 B;  4YJ3 E;  5AQG B;  3RIF A;  5LYJ E;  2UUB T;  5H6R B;  1B7T A;  4DUZ T;  2LSG A;  4IDQ A;  3CX6 B;  3NRY A;  4DR7 T;  5JDH A;  3ZKR A;  3K3O A;  3ZJ2 A;  4U7Y A;  4HFB A;  3UU8 A;  3HKB E;  3AEE A;  3DJB A;  1U5P A;  4U2Z A;  4X20 E;  2JMK A;  4EZH A;  4X65 T;  5JDG A;  2BVL A;  1GQE A;  2DWK A;  4HFI A;  4WBO A;  1QSD A;  4UVB B;  4YFS A;  2W2U A;  3LK2 B;  3QOF A;  4H9O C;  1N34 T;  1AJ3 A;  4JI2 T;  1WR6 A;  2BZB A;  3KV4 A;  3JCF A;  4TZ4 C;  3ESL A;  1SA0 E;  4H9N C;  2IC9 A;  4PJJ A;  2KXP B;  2ODV A;  3QNU A;  3L3P A;  2NW9 A;  2XY8 B;  3R84 B;  3U3I A;  2H7V C;  3ZYL A;  1J5E T;  2W61 A;  3B57 A;  5AQT B;  2M6B A;  3EDV A;  3MZK B;  5LA6 E;  3RI5 A;  5LG3 A;  2K48 A;  2BS2 A;  1T98 A;  3FZF B;  5L2L A;  2X66 A;  4QWN B;  3LSV A;  2CWO A;  3KBU A;  1I6Z A;  3N9P A;  3CML A;  5FXV A;  3TLV A;  5FY0 A;  1OED A;  1YD8 G;  3P7I A;  3UUN A;  4EXT A;  3TLT A;  5L3G B;  4ZI2 C;  3G06 A;  4L9I A;  3VR9 A;  5L3F B;  1HCI A;  3V5U A;  4X5T A;  4HWH A;  1UUS A;  1NWM X;  1YQ4 A;  1SHZ C;  4DR3 T;  2R6G F;  3RGL A;  3LFM A;  2E8I A;  2MPK A;  4UVA B;  4PFP A;  3RYF E;  3PE0 A;  3TLU A;  1KK7 A;  5ABG A;  2XQ3 A;  3E0Z A;  4UF0 A;  4H9S E;  2XQ6 A;  5DQV A;  5HCJ A;  5L4E A;  5LGN B;  4U7I A;  1US7 B;  2BG9 C;  3LJC A;  2IW5 B;  5KXJ A;  5L3B B;  3P4S A;  3RRW A;  2FJE A;  5LCY A;  5CA1 E;  2D2S A;  5FXW A;  5KMG P;  5EZY E;  4JEU B;  3J9X 1;  5L47 A;  1HG2 A;  3LK3 B;  3WI3 A;  3FB2 A;  4IE0 A;  1MIW A;  4HTE A;  4DV7 T;  1LRZ A;  4P09 A;  1ZP0 A;  3EAM A;  1QUU A;  5CGM A;  3O1I A;  1T72 A;  3PJA A;  2JJ9 A;  5ABH A;  4KI0 F;  4EZ4 A;  2OV9 A;  4UIG A;  5JR9 B;  3I9W A;  3IEE A;  5L4H A;  4UR9 A;  2Q9Q B;  5IHY A;  4GIW A;  3UU5 A;  1LKX A;  3KDS E;  3RKO A;  2W63 A;  4HGA A;  3V5S A;  1MIY A;  2ZLY A;  3MK7 C;  4DID B;  2V5C A;  1MMD A;  4GYS A;  5JRE A;  4Z8X A;  4MAL A;  2UXD T;  3PJA J;  2VL8 A;  3QC9 A;  2CEA A;  3KVA A;  2YIN A;  3PUV F;  4ASK A;  3JAD A;  4TV9 E;  4TN7 B;  3C50 A;  4P0A A;  4ZI3 C;  2LHR A;  2X0H A;  4KMC A;  5F8P A;  5EK2 A;  2VK9 A;  3NVO A;  4DO0 A;  2WB5 A;  2MAW A;  2V6Y A;  2WDQ A;  3F57 A;  3PV0 F;  2CBI A;  2SPC A;  3ETU A;  3UUM A;  3ZMU B;  3PUG A;  1IBK T;  4AI6 A;  3AEB A;  1D1A A;  3RPU A;  4LML A;  5JH7 E;  2LM2 A;  2LSJ A;  4X1Y E;  4JI6 T;  2B1E A;  2JQQ A;  5L3D B;  2Y48 B;  4PW8 A;  5LB7 B;  3RYC E;  4LFA T;  2LHN A;  2X9Y A;  2CPT A;  3N9M A;  3KBT A;  3ONL C;  3OVU A;  4AXP A;  4GYR A;  4YHH T;  5AQI B;  3N9N A;  1WYB A;  4UV8 B;  3SS1 A;  5LHH B;  2HHH T;  4JI3 T;  4GOU A;  3UU3 A;  2UXB T;  2NTY A;  3AED A;  3AXJ A;  2BBJ A;  4A98 A;  1FJG T;  1JNZ A;  4N78 D;  1H7C A;  1G8X A;  2LM9 A;  2B76 A;  2VL0 A;  2XSA A;  2ZMA A;  3N9L A;  3RC8 A;  2RP4 A;  3MAC A;  4PJN A;  2QRX A;  4YLH A;  4H9R C;  3KIN B;  3VRB A;  5LMU T;  5IYZ E;  2W4X A;  2CLY B;  3RX6 A;  3AE5 A;  1MNE A;  1UCU A;  3LDQ B;  5AQF B;  2BKO A;  5KX5 E;  2YN6 A;  4DBR A;  2JMH A;  3MKD A;  4WZX A;  4I43 B;  4ZXL A;  1N36 T;  4JI1 T;  1HG5 A;  5JTG A;  1HNX T;  1LVF A;  2CXL A;  5FVK A;  2IUB A;  3SFE A;  4LF6 T;  4UXN B;  3AVS A;  4V1A v;  3ZT6 A;  3Q9D A;  1MND A;  4NPP A;  2WDV A;  5FVL A;  1HR0 T;  4IHJ E;  4TX5 A;  4HWF A;  1HX1 B;  4IDO A;  2I6H A;  2V6Y B;  3CIR A;  3CQG B;  3GWH A;  4IL9 A;  5ETW A;  1HS7 A;  2PTF A;  4OK0 A;  4KHZ F;  2KLQ A; 
#chains in the Genus database with same CATH homology
 1Z0P A;  2NTX A;  3NBX X;  3ZCJ A;  3NRX A;  3O9X A;  4PAG A;  3F2E A;  3ZMT B;  2ZM0 A;  3HKC E;  2XUE A;  1MMG A;  2BVM A;  5JRC B;  3A5X A;  3AAI A;  1O3X A;  4OFZ A;  5GON E;  4ILU A;  4AQF C;  1VOM A;  4HKA A;  2DHR A;  2XAJ B;  4IE7 A;  4H9Q C;  4J2C A;  1D0X A;  2Q9Q A;  4NUU A;  2LOS A;  4UEM A;  5LGT B;  2A72 A;  2WSS V;  3PUS A;  3UT5 E;  5LJN A;  3KFW X;  4HE8 A;  5EK4 A;  4IDZ A;  3M65 A;  2N2N A;  3KVB A;  2V1D B;  2KWH A;  1G73 A;  2KND A;  2LEH A;  3RRC A;  4DND A;  2NP9 A;  3GMI A;  3PTR B;  4MLK A;  4O2B E;  3CPZ A;  4IGU A;  1OXZ A;  5F3J A;  3AA7 B;  1YKE B;  3LG7 A;  3L09 A;  4MFR A;  2WM9 A;  4DMV A;  4O2A E;  4CXX A;  3AAE B;  4MHC A;  3DP7 A;  4DBQ A;  4OHF A;  4HEA A;  1MMN A;  5CA0 E;  2EHO D;  3SWH A;  4M1P A;  4OYK A;  2LSK A;  3KV9 A;  4IST A;  3AA0 B;  3CWZ B;  5DQW A;  2EHO B;  4O8S A;  3OJA A;  4TUY E;  2ZM8 A;  4TV8 E;  3ZN1 B;  4XAX B;  4DVD A;  4ERR A;  5KDM C;  5L3C B;  4GK0 E;  4O4L E;  1BR2 A;  2C5I T;  3CKD A;  2XAF B;  3HKE E;  2A3D A;  1V9D A;  3AAA B;  5JR9 A;  3ZMV B;  5J2U E;  3HL6 A;  5TAO A;  3ZPO A;  2E9X B;  3ANW B;  2XAG B;  3C4X A;  3HR0 A;  2CCQ A;  5LXT E;  4PNI A;  2Z6E A;  2XAS B;  3GA8 A;  4UVC B;  2PJQ A;  2MBG A;  2V7L A;  4O4H E;  2YEV C;  2QA7 A;  2Q9Q D;  5JDL A;  3E22 E;  4OYJ A;  5LOV E;  2WMN A;  1FMV A;  2V7J A;  2LT3 A;  4PJM A;  2DCF A;  4P0B A;  5LGU B;  4EB6 E;  4H63 V;  4JLE A;  4FI5 A;  4G2A A;  1HX8 A;  3FBZ A;  5HXH A;  2CE7 A;  4PK5 A;  4CQI A;  2LJL A;  5L3E B;  2IC6 A;  4E7Z A;  2EHO A;  3BQI A;  3C4W A;  4I55 E;  2HPL A;  4FJO A;  2ZM2 A;  4AKL A;  3NZP A;  4U72 A;  1UX4 A;  3N2G E;  2W00 A;  5FXX A;  3UFE A;  3JC6 D;  2W62 A;  1S94 A;  2D5U A;  2XHE B;  5LBM A;  3K8P C;  5EK3 A;  5HXC A;  1E1H B;  3N2O A;  2E9X A;  3ANW A;  1HFA A;  3OBV E;  2HH7 A;  3PU3 A;  5HAX A;  4EYU A;  2Q9Q C;  2X51 A;  3QK6 A;  3UUX B;  4QXH B;  3I1A A;  2I59 A;  1HF8 A;  1IJ5 A;  2XQY A;  3C64 A;  5HXE A;  5JDQ A;  3N5L A;  5HYA A;  3ZLI A;  5FYM A;  2WWU A;  3AA1 B;  3LK4 2;  1ZKE A;  3B13 A;  4XZC A;  4MBQ A;  3SRZ A;  5JDM A;  3CQX C;  3R6N A;  4K0U A;  1D0Z A;  3PUQ A;  3ZC1 A;  3D0T A;  3E08 A;  5E0O A;  3N9Q A;  1CUN A;  3MJX A;  5FXZ A;  2KT9 A;  3CX7 B;  3DTO A;  2CM0 A;  4O4I E;  2VKJ A;  3MXZ A;  4IE4 A;  5LHI B;  4AQF A;  2X67 A;  4JUY A;  5FMN A;  4CI2 B;  2X68 A;  3EDU A;  5FY7 A;  1OWA A;  3EUH A;  3Q2M A;  2CLY C;  2E9X D;  2P9B A;  3PDY A;  1BR4 A;  2N1G A;  2VWA A;  1WRD A;  3OYZ A;  5DJQ C;  2WAU A;  3RH3 A;  3EVY A;  4H9P C;  2NOX A;  3JC6 C;  5LP6 E;  4AKI A;  3I9Y A;  4O4J E;  3ZYM A;  4AKH A;  4KP3 C;  5JDF A;  5LHG B;  3AVR A;  5C8Y E;  2ODU A;  2MYS A;  3N2K E;  5DAB A;  1YW0 A;  3CVR A;  2K9A A;  2Y6X A;  3VKG A;  1ZHC A;  4IE6 A;  4G63 A;  3BK9 A;  3KV5 A;  1UX5 A;  2OA5 A;  4AKG A;  4AKR B;  2JRK A;  2V7I A;  3C51 A;  1LVK A;  3ZCI A;  5JQG E;  2W0G A;  3VKH A;  4QXC B;  3J7Y q;  5LBQ B;  3HA4 A;  5HXR A;  4X1I E;  1BR1 A;  2LSI A;  2X9H A;  2Y8D A;  5LJM A;  3P8C D;  3ZJ1 A;  2VKO A;  4BA9 A;  1D1C A;  3LBX A;  4PK6 A;  2BDE A;  3BQK A;  1KNZ A;  3C4Z A;  3ZYK A;  5FNV E;  3AB3 B;  4NUV A;  4X1K E;  5FP3 A;  4HFV A;  2CWY A;  2HPJ A;  4U74 A;  3ZEF B;  2X9W A;  4PK4 A;  4EIW A;  4B6X A;  4IE5 A;  4DMW A;  1EZ3 A;  2C5K T;  2WBL A;  2XAQ B;  3IBP A;  3I0O A;  2G0U A;  3VU7 H;  3UTK A;  2XAH B;  3HI2 A;  3H37 A;  4YHJ A;  1MMA A;  3UUL A;  4BJM A;  3QUJ A;  2YU1 A;  5JDN A;  5JR9 C;  3C98 B;  3ETV A;  5J2T E;  2NW7 A;  3RYH E;  4QXB B;  5CB4 E;  3ZC0 A;  2CXD A;  5A1L A;  2DLR A;  2LOP A;  2VAS A;  3CX8 B;  4HN9 A;  4C91 A;  5AFU L;  1WYC A;  4ADZ A;  2L8K A;  2MOZ A;  4ZI7 E;  4CI3 B;  2EHO C;  2PFV A;  4CXY A;  4BAY B;  2H7O A;  2IAK A;  4ISS A;  4QX8 B;  3IHR A;  2LE8 A;  3F31 A;  2J1D G;  3K3Q C;  3SOL A;  4YJ2 E;  1Y64 B;  4CI1 B;  4ZI2 D;  5FY1 A;  3FBL A;  4PJL A;  1IAP A;  1U4Q A;  1FMW A;  2E9X C;  5BMV E;  4C90 A;  5HWX A;  3H3A A;  2DI4 A;  2JPF A;  4QKN A;  4JEH B;  3WAJ A;  2MTQ A;  2X0L B;  3RYI E;  4EAH A;  4GK5 E;  2KIN B;  2VKH A;  4UEL A;  2ES0 A;  4WW0 A;  3U78 A;  1D0Y A;  3ZMZ B;  3AA6 B;  3I0Q A;  4EOZ B;  2KZ7 B;  4ZS2 A;  2ACX A;  4ANJ A;  5LG4 A;  3NZQ A;  3HKD E;  1ZV4 X;  2YK0 A;  3N9O A;  1BR0 A;  2C5J A;  2A2F X;  2VKD A;  4QX7 B;  3LBX B;  3BQL A;  2CA5 A;  2NW8 A;  3WAK A;  2D0T A;  2GK9 A;  1WLX A;  4XBF B;  1YKH B;  4L5G A;  3FXE B;  5J1G A;  3O1H A;  2K5B B;  4QHO A;  5HXS A;  3KV6 A;  3GN5 B;  2KWI B;  2X9X A;  4ZOL E;  2DWG A;  1FEW A;  4AQG A;  4I4T E;  3K3N A;  2PG8 A;  3VHL A;  1X79 A;  1FIO A;  3PUA A;  4EYY R;  1ZEE A;  2K24 A;  3MA9 A;  5M4Y A;  3O4X E;  3TKL B;  5ADX L;  2CMR A;  2CXF A;  3IF8 B;  2UXN B;  5LNK A;  2N9D A;  2C0S A;  1NAF A;  3ZN0 B;  4F6R C;  3O1J A;  4CXW A;  4L0R A;  1HTJ F;  1VRB A;  1D1B A;  4I50 E;  2NWB A;  4H63 H;  4KUM B;  4IIJ E;  2V7M A;  3OYX A;  1S35 A;  3ZMS B;  2LSY A;  4CZZ B;  2VB6 A;  3FXD B;  3OKQ A;  3T8O A;  2M67 A;  2UXX B;  5H6Q B;  3W15 B;  2L9Q A;  2PBI A;  1IJ6 A;  2H3R A;  3GN5 A;  2D0U A;  3ONX A;  2DNX A;  2YU2 A;  4BJN A;  2KMF A;  3S4U A;  4WBN E;  2V26 A;  4ZS3 A;  5JVD E;  2QGS A;  3FHN A;  1MIV A;  2RA1 A;  4UV9 B;  2V7K A;  4PFO A;  3CQC B;  3PU8 A;  3Q5W A;  4WNK A;  2XTL A;  5HWY A;  4KBM B;  2WMO A;  3PUR A;  5JRC A;  4A56 A;  3RC3 A;  4E7S A;  4ZHQ E;  2L3L A;  1IZN B;  3Q5X A;  4UF0 B;  4YJ3 E;  5LYJ E;  5H6R B;  1B7T A;  2LSG A;  3CX6 B;  3NRY A;  5JDH A;  3K3O A;  3ZJ2 A;  3HKB E;  3DJB A;  1U5P A;  4X20 E;  2JMK A;  4EZH A;  5JDG A;  2BVL A;  4YFS A;  2DWK A;  4WBO A;  1QSD A;  4UVB B;  3LK2 B;  4H9O C;  1AJ3 A;  1WR6 A;  2BZB A;  3KV4 A;  4TZ4 C;  3ESL A;  1SA0 E;  4H9N C;  2IC9 A;  4PJJ A;  2KXP B;  2ODV A;  3U3I A;  3L3P A;  2NW9 A;  3R84 B;  3ZYL A;  2H7V C;  2W61 A;  3B57 A;  3EDV A;  3MZK B;  5LA6 E;  2K48 A;  1T98 A;  5L2L A;  2X66 A;  4QWN B;  2CWO A;  3KBU A;  3N9P A;  3CML A;  5FXV A;  5FY0 A;  1YD8 G;  3P7I A;  3UUN A;  4EXT A;  5L3G B;  4ZI2 C;  4L9I A;  5L3F B;  1HCI A;  3V5U A;  1NWM X;  1SHZ C;  3LFM A;  2E8I A;  4UVA B;  3RYF E;  4PFP A;  3PE0 A;  1KK7 A;  3E0Z A;  4UF0 A;  4H9S E;  5DQV A;  5LGN B;  1US7 B;  2IW5 B;  3LJC A;  5L3B B;  3RRW A;  5LCY A;  5CA1 E;  2D2S A;  5FXW A;  5KMG P;  5EZY E;  4JEU B;  3J9X 1;  1HG2 A;  3LK3 B;  3WI3 A;  3FB2 A;  4IE0 A;  1MIW A;  4HTE A;  1LRZ A;  4P09 A;  1QUU A;  3O1I A;  2JJ9 A;  4EZ4 A;  4UIG A;  5JR9 B;  3I9W A;  3IEE A;  2Q9Q B;  5IHY A;  4GIW A;  1LKX A;  3KDS E;  3RKO A;  2W63 A;  4HGA A;  3V5S A;  1MIY A;  2ZLY A;  3MK7 C;  5JRE A;  1MMD A;  4GYS A;  4Z8X A;  4MAL A;  2VL8 A;  3QC9 A;  2CEA A;  3KVA A;  2YIN A;  4ASK A;  4TV9 E;  4TN7 B;  3C50 A;  4P0A A;  4ZI3 C;  2LHR A;  4KMC A;  5F8P A;  5EK2 A;  2VK9 A;  4DO0 A;  4ZI3 D;  3F57 A;  3ZMU B;  2SPC A;  3ETU A;  3UUM A;  3PUG A;  4AI6 A;  1D1A A;  3RPU A;  5JH7 E;  2LSJ A;  4X1Y E;  2B1E A;  2JQQ A;  5L3D B;  2Y48 B;  4PW8 A;  3RYC E;  2LHN A;  2X9Y A;  3N9M A;  3KBT A;  4AXP A;  4GYR A;  3SS1 A;  3N9N A;  1WYB A;  4UV8 B;  5LHH B;  4GOU A;  2NTY A;  4N78 D;  1H7C A;  1G8X A;  2LM9 A;  3N9L A;  2ZMA A;  3RC8 A;  2RP4 A;  3MAC A;  4PJN A;  4YLH A;  4H9R C;  3KIN B;  5IYZ E;  2CLY B;  3RX6 A;  1MNE A;  1UCU A;  5KX5 E;  4DBR A;  2JMH A;  3MKD A;  4I43 B;  1HG5 A;  1LVF A;  2CXL A;  4UXN B;  3AVS A;  4V1A v;  3Q9D A;  1MND A;  4IHJ E;  4TX5 A;  5ETW A;  3GWH A;  3CQG B;  1HS7 A;  4OK0 A;  2KLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...