4H9QC

Complex structure 4 of daxx(e225a)/h3.3(sub5)/h4
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
205
structure length
205
Chain Sequence
b'RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQAARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 76
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9qC00
4H9PC 4H9OC 4H9NC 4H9RC 5KDMC 4H9SE 4HGAA 4H9QC
chains in the Genus database with same CATH superfamily
4IDZA 4DUYT 1LVKA 4IL9A 2E9XA 2XPKA 4KUMB 4CQIA 4EXTA 2KXPB 3ZMZB 2CPTA 2V6YA 4HFHA 2UUAT 2UUCT 4JI4T 4EEDA 5TAOA 3ZMVB 5L3FB 2JQQA 2LHRA 3RRWA 2E9XD 4Z8XA 4K0KT 1HG2A 2LRLA 4ZI3D 1MIYA 3DP7A 1N33T 5HEUA 2LSKA 5KDMC 3RLFF 3SS1A 3JAFA 3DJBA 4BJMA 4WNKA 4HWDA 2QA7A 3UFEA 2CLYB 2WZIA 3NRYA 4YTPA 3P4PA 2LSGA 1W09A 1ZOYA 5JVDE 3UULA 1M7KA 2N9DA 1YW0A 2CEAA 3PU3A 1QUUA 2VQFT 5ABEA 4GKJT 4MALA 1OXZA 5LXTE 3FZFB 3L39A 5JR9A 4IDOA 4LFCT 5JDMA 3OYZA 3PV0F 4YTMA 3AE3A 3KV4A 2B1EA 3O1JA 4TX5A 5F5WA 5C8YE 2ZM6T 3N2KE 2HPLA 3E08A 1I94T 4MLKA 2XASB 2CWOA 4HGAA 3QC9A 2MTQA 1S94A 3QOFA 3ZJ2A 4U2ZA 4GYRA 2V26A 3JCFA 5FXZA 3SFEA 5LMUT 2LHNA 2ZLYA 1D1CA 4E7SA 2CCQA 1NENA 2BVMA 2X9XA 1DU2A 3IHRA 2W66A 3C98B 3PURA 3P4WA 2WDVA 4HWCA 3OTOT 4ADZA 4LMKA 5LHHB 4ZI2D 5EK2A 5FXXA 4LF6T 3QB5A 4HEAA 2XQ3A 4HWFA 5IUXA 4DR1T 3GWHA 1J1JA 2BG9E 3OKQA 4ANJA 4UR9A 4PNIA 4ZI3C 3LJCA 5LP6E 2WP9A 3ZPOA 2KZ7B 3PUWF 3Q5WA 1LKXA 4U74A 3EAMA 2XQ5A 3AE7A 3ONJA 3OYXA 3EABA 3M65A 1N36T 3O4XE 1WR0A 1AJ3A 2XAGB 5HEGA 4O2BE 5HXEA 1LRZA 2NWBA 3O1HA 4HWIB 1D0XA 4DV6T 4AI6A 3ZC0A 3O1IA 2BBJA 3KVAA 1FJGT 5AQRB 1H7CA 4TNWA 4PAGA 4JV5T 2E5LT 1HF8A 1QLBA 5FY1A 2HPJA 2J47A 5FKYA 2B76A 5JTGA 3RIUA 2ZM0A 5JR9C 4JI2T 4PFPA 3V5SA 2KWIB 4QH4A 3CPZA 2LKHA 4I0UA 4PW8A 3AE6A 2AXDS 1E1HB 4BAYB 3PUSA 3CK6A 3NVOA 3I9WA 4ISSA 5L3DB 4WYVA 1JNRA 2CHNA 2XZEA 4GK5E 2YU2A 4TV8E 2J62A 4P09A 4ZS3A 5EK3A 2XTLA 5F3JA 4MFRA 4Q25A 3ZCJA 5AQJB 2E9XB 4EOZB 1NEKA 5ABGA 4YLHA 4TUYE 4H9NC 3VR9A 2V6YB 4QXHB 4B3ST 4QXBB 4DR6T 1I6ZA 1S35A 5EZYE 3N9PA 2ODVA 2BKPA 2IAKA 3K8PC 5HAXA 4DBRA 3ZC1A 4P1NA 4NUVA 4EZ4A 4IE7A 2DHRA 1HTJF 4H9SE 2Y6XA 3Q5XA 4UVAB 1WRDA 5CJ5A 4JYAT 3AB3B 4ZHQE 4U7YA 4QH1A 4TN7B 2LKGA 3CQGB 3PJAA 3TLWA 1XDOA 4L5GA 4N78D 1VCSA 2UU9T 3H3AA 3AEAA 4HFBA 2WDQA 4H9OC 3TLTA 1NWMX 3UUXB 5JR9B 4YXDA 2VKJA 2H3RA 3K3QC 2XAQB 2JJ9A 5AQLB 4HWHA 3EHZA 5HXHA 2UXBT 3ZT5A 2P9BA 4YJ3E 3AE4A 4DBQA 4NUUA 3RPUA 4CXXA 3RH3A 4LMJA 2LRKA 4KI0F 3RX6A 2UXDT 3NWIA 3AAEB 2LT3A 3PTRB 4IDQA 4NXNT 3QB5K 2JMKA 2QYWA 3FZMB 3EI0A 3ZT6A 1FMWA 4COFA 4GKKT 3IBPA 1J5WA 3GA8A 4L9IA 1J5ET 2FJEA 5HEOA 4C90A 4ILCA 2XQ6A 4A98A 3VRAA 5L4EA 3TLUA 2A3DA 2EHOA 2Y8DA 2PG8A 4X64T 2UXXB 3UUNA 5CFBA 4AQFA 5KX5E 4EAHA 2LSIA 3JAEA 2WCAA 4YT0A 4Z90A 2OV9A 1XWMA 2IW5B 5ABFA 3VKHA 3RQUA 1HX8A 1BR1A 3T8OA 1UX5A 2EHOD 2E2AA 3VR8A 3KDSE 2A72A 1IBKT 3R84B 4AKGA 5GONE 2V5CA 2PJQA 4DV4T 3LSVA 5AQKB 3IF8B 2WWVA 4ZZBA 3IEEA 3MZKB 2FJBA 2VURA 3SRZA 1XMQT 2W62A 3NRXA 3EDVA 2PBIA 1W9RA 3KFWX 3NZQA 2CM0A 2K9AA 4ZS2A 1OEDE 3P4RA 4AKIA 5HEJA 3FZKB 3UQ7A 2H88A 2WQYA 3MKDA 2NR4A 4AKRB 2VKDA 4JBWF 2C5JA 5AQNB 2YDSA 5H6RB 3JC6D 5J2TE 2MOZA 2CE7A 4PK4A 4IT4A 1MMDA 4A56A 2FBWA 3RC3A 4AIUA 2CMRA 2CBJA 5FNVE 1E7PA 4PJNA 4I4TE 3RKOA 4XAXB 2SPCA 5DQWA 4XBFB 4OYJA 3L09A 5BR8T 3B13A 1O3XA 4B3MT 3PUGA 3N9MA 4PK6A 1MNDA 5IWAT 2C5IT 1Y01A 3TKLB 2DNXA 2XJ7A 1BR4A 3RC8A 5AQFB 3MK7C 2EHOC 3CKDA 3ETUA 3J9X1 2XAHB 1WYBA 2LEHA 4AQFC 3AE9A 2W67A 4CN6A 3ABVA 4OHFA 1N32T 4O8SA 4JLEA 2W0GA 5HXSA 3AA1B 5AQSB 3PUAA 3QUJA 3ZN1B 4UVCB 1XDPA 4QX8B 3UU8A 3I0QA 3AE5A 3PUQA 4ZZCA 3AVRA 4X1KE 3TLSA 4YSYA 2FUPA 4A97A 2I59A 2WDRA 3BQLA 4IREA 4FJOA 4WZXA 3AEBA 4I43B 3F31A 3FHNA 1YQ3A 3JC6C 3ONLC 1SUMB 3ZKRA 2XY8B 3OVUA 1YQ4A 3N9QA 3S4UA 1D1AA 3BK9A 3P8CD 3MJXA 3X1DA 4CXWA 2WU5A 3BQKA 3HKCE 3AA7B 4I55E 4QH5A 5AQMB 4FI5A 2XAJB 4YFSA 5LBMA 3CX7B 1W0BA 2E8IA 1R8IA 5AQIB 1L0VA 2V7MA 4JI8T 1HFAA 2IUBA 2IDOB 3UUMA 1IJ6A 2Y48B 3AECA 4IL4A 2D2SA 1MMAA 3KV6A 5JQGE 3GN5A 5JDGA 4X65T 2VKOA 2EHOB 4UV8B 4U7IA 2W2UA 2E5VA 2E9XC 5BMVE 4ISTA 2V7JA 4NPPA 3C4WA 2VL8A 1KK7A 5ABFB 4ZEYA 3RYCE 4QX7B 2ZM8A 4CN1A 3HI2A 2YINA 4M1PA 5LA6E 1SHZC 3ZT7A 2YDQA 4IE6A 2V6XA 5C2TA 1QSDA 1SA0E 5LHIB 3MACA 3ZMUB 2OLTA 3Q9DA 4LF5T 3WI3A 4JI5T 1HS7A 3N9NA 5FY0A 3AA6B 3MXZA 2X9HA 3E22E 4YHHT 4AQGA 5L3EB 3AE8A 4YY3T 4A5XA 2G0UA 3RQWA 4F8HA 3R6NA 1D0YA 2OA5A 4X62T 2ZM2A 1HNWT 2WAUA 2LLYA 2X51A 4EGWA 4X20E 4DMVA 2W00A 3MA9A 2DCFA 4O4LE 4DNDA 2NTXA 2XQ4A 3AEFA 3VHLA 2DLRA 3ZMTB 3D0TA 2X0LB 2YKSA 2IC9A 2NW8A 2VKHA 3ZMSB 3O9XA 2WB5A 3VRBA 3N2GE 2W4XA 3HL6A 2BG9A 4IE0A 2XSBA 1CHUA 3FXDB 2KMFA 5ABHA 3ZYKA 2CXFA 4ZI2C 4UIGA 1HCIA 2X0YA 3KBTA 3CIRA 4IHJE 1VCTA 1T8BA 2DL1A 2NW9A 2VASA 3KINB 5L4HA 4YSXA 1KNRA 3H37A 1HG5A 2YEVC 4O2AE 1IBMT 4OFZA 1YKEB 4QKNA 2WZHA 4I50E 4H9RC 5KMGP 5AQUB 2VL0A 4KBMB 2WM9A 4KMCA 1T72A 2LM2A 5C3JA 2A9UA 5FYMA 2PFVA 2PTFA 3AAIA 4F6RC 4YTNA 2HHHT 2AE9A 2YK0A 3GMIA 5LJNA 4DIDB 2WBLA 5HYAA 4YHJA 3UFGA 3ZSSA 2KINB 2VVNA 2LE8A 4EZHA 3ONXA 3LDQB 3UUBA 4X1IE 1B7TA 2JIWA 2RP4A 2D0TA 1YXRA 4IE4A 3SFDA 3UU4A 2KWHA 3LK42 2N2NA 5CA0E 4JI1T 2VWAA 2BBHA 3SOLA 4G2AA 3PE0A 2M67A 4KX6A 4X5TA 4OK0A 1HR0T 2UXNB 3HKBE 2JMHA 3RIUC 1KEYA 3C50A 2QRXA 2K3WA 3RRCA 3IA3A 2CBIA 1T98A 4JI3T 1V9DA 4ZI7E 1D1BA 1X9BA 4EB6E 1XNQT 3FBZA 3AAAB 2W63A 2LOPA 2VB6A 4DVDA 4P0AA 4OX9T 1JNZA 3T1HT 1KNZA 4ILUA 2BG9C 1UK5A 4H63V 3PDYA 5HCJA 5JDFA 3GN5B 3Q5DA 4U33A 4DMWA 4EEBA 2RPAA 5A1LA 4HFDA 1IJ5A 4XZCA 3B5MA 1Z0PA 2KNDA 3F57A 5DQVA 4B6XA 4DR7T 2I6HA 2CXLA 3ANWA 4JEHB 2D0UA 3AA0B 3ZEFB 5LJMA 5AQPB 5J0ZA 4PK5A 5CB4E 4GOUA 2WWUA 3U78A 5FVKA 3RYIE 5HXCA 5FXWA 4DR4T 2M6BA 1IBLT 3AEDA 3AE2A 3EUHA 4DV5T 3PUZF 2X66A 3W15B 5AQOB 1N34T 1YD8G 4O4JE 2DI4A 3QNUA 4AXPA 1BR0A 3A7MA 2ODUA 4IDPA 1X79A 5LCYA 1XZYA 1ZHCA 4EV6A 2XSAA 4HTEA 1LVFA 3OJAA 1ZEEA 4JI7T 1XMOT 3AE1A 3K1SA 2BZBA 4DV7T 2WSSV 5ETWA 1U5PA 2ZMAA 4DUZT 4JI0T 4LFAT 2BS3A 4WW0A 5HWXA 4ILAA 4TWHA 1WLXA 5LGTB 2JQHA 2UUBT 3C4XA 1WYCA 2BG9B 3ZJ1A 4CI2B 2C5KT 4UF0A 4QWNB 3G06A 4TNVA 3K3NA 5DJQC 4EYUA 5LGNB 5CGMA 3ZN0B 4DR2T 2V1DB 5DABA 4UXNB 3OBVE 3FZHB 4IDNA 4P0BA 2XHEB 2V8SV 4CI3B 3AXJA 4H63H 1KF6A 1FEWA 5L3GB 4X1YE 2LOSA 4MHCA 4B3RT 1G8XA 1WR6A 2MAWA 3QK6A 2D9DA 4QXCB 4HFCA 4CN4A 4LF9T 2WY2A 1E2AA 5HWYA 3CX8B 1OEDA 2XQ8A 5AQGB 5L3CB 4CXYA 2CWYA 1IAPA 5EK4A 2XM1A 3AEEA 4AKLA 4PJLA 4Z91A 5LB7B 2D5UA 1UCUA 4KP3C 4O4IE 3A8YC 2C0SA 2KSRA 1IZNB 1ZV4X 3L3PA 3N9LA 2IHR1 4X66T 5L3BB 1VRBA 5HEHA 2ACZA 4HKAA 3KV5A 3LBXA 3ZYMA 4H9QC 2IIUA 3L8RA 2CA5A 5FL1A 3FZLB 1ZP0A 3FB2A 3BQIA 3RIAA 2V7KA 5FXVA 5J2UE 2WMOA 2WS3A 5JH7E 3P7IA 4DO0A 2BDEA 2YN6A 2DWKA 1BR2A 2F4VT 1WCRA 5IHYA 2HN2A 5JRCA 5HCMA 4U2YA 5IYZE 2I0MA 3PJAJ 5KXJA 1MMGA 3V5UA 3M3ZB 4UVBB 3RF1A 4MBQA 4OYKA 3F2EA 4U3CA 3ZSTA 2ES0A 2X9YA 4QHOA 4ASKA 4ERRA 2L8KA 3PUYF 3N2OA 2XQYA 1FMVA 2K5BB 5F8PA 1US7B 3KVBA 3ANWB 3ZCIA 2YDRA 3EDUA 5FP3A 3ZLIA 1Z8UA 3A5XA 4J2CA 4LF7T 2YOEA 2CXDA 2MYSA 3RGLA 5FMNA 3CWZB 4HN9A 1OEDC 5AQTB 2VK9A 2LM9A 4KHZF 1ZKEA 3WAKA 3EVYA 2VVSA 3PUXF 1OWAA 3FXEB 3U3IA 3CMLA 5ADXL 3CX6B 5AQHB 4NXMT 1MIWA 2FJDA 3NZPA 4UEMA 2CRBA 3AVSA 2MBGA 3B57A 2CHOA 1WFDA 2K24A 2N1GA 1MMNA 2HH7A 3LK2B 3HKEE 1GQEA 2IC6A 5JDHA 3HR0A 3ETVA 4WBOA 3VKGA 3RYFE 3VU7H 4LF8T 5JDLA 1YKHB 3RKGA 1VOMA 2WU2A 4ZOLE 2J4GA 5L47A 3KV9A 4TWDA 2LJLA 4UF0B 5J1GA 4CI1B 2Q9QA 3UU5A 2KT9A 3I9YA 2QVAA 2WMNA 3UT5E 4DV1T 3AXJB 5FY7A 2XQ9A 2UXCT 2BS4A 4LF4T 2BKOA 1XNRT 2Q9QD 1UX4A 2J1DG 3PU8A 3Q5EA 4HFIA 2XQ7A 4ILBA 2VQET 4TZ4C 4L0RA 3Q2MA 1MIVA 2DWGA 1OEDB 3JADA 4IE5A 4DV3T 5LG3A 2LSYA 4AKHA 3ESLA 5JREA 2NP9A 1D0ZA 2R6GF 5AQQB 5JDQA 2X68A 1KFYA 4PJMA 3KBUA 1KNPA 2YU1A 3NBXX 3P4QA 2X0HA 3LFMA 3SWHA 5M4YA 2A2FX 2BKNA 3CQXC 4O4HE 4B3TT 2JQKA 1EZ3A 2V7LA 2QGSA 3K3OA 2HN1A 3T1YT 2JRKA 5LMNT 4HE8A 4E7ZA 5LNKA 4JEUB 5HXRA 2L9QA 3LBXB 1UURA 4C91A 2ACXA 4EIWA 4JI6T 2GK9A 5LGUB 1FIOA 4BA9A 3PUVF 4TWFA 4HFEA 5LG4A 3P4SA 4WBNE 3UU6A 5H6QB 3CQCB 4TV9E 3OPCA 4IIJE 4AQYT 4DV2T 2H7VC 5JRCB 3HKDE 4LFBT 2MPKA 4ZXLA 3CVRA 5JDNA 2X9WA 2Q9QC 4KHPT 4UV9B 2IMLA 2H7OA 3DTOA 3I1AA 4DR5T 2XAFB 3UU3A 4BJNA 5AQVB 2NOXA 2BS2A 5L2LA 3J7Yq 3RI5A 1NAFA 4V1Av 3WAJA 4DR3T 4YSZA 1CUNA 1W0AA 2V5DA 3AEGA 3LG7A 1HNXT 2FJAA 3H3MA 1U4QA 4UELA 4G63A 2V7IA 3UTKA 4U72A 2Z6EA 2K48A 4H9PC 2LSJA 3C4ZA 2NW7A 5LYJE 5LOVE 3TLVA 3P50A 4U31A 2X67A 4IGUA 4YJ2E 2XM2A 3NKZA 2XUEA 1G73A 4CZZB 3RHWA 4JUYA 5FVLA 2L3LA 1Y64B 2RA1A 3C51A 3LK3B 4K0UA 2CLYC 4PJJA 4GYSA 4GIWA 3E0ZA 1MNEA 3RIFA 4NIQA 4EYYR 1HX1B 3I0OA 2XQAA 4GK0E 3ZYLA 1UUSA 4LMLA 2H89A 5LHGB 2JPFA 3UQ4A 2JQ9A 4AISA 1M62A 3RYHE 1T7SA 5E0OA 3HA4A 3FBLA 2Q9QB 5LBQB 2KLQA 2BVLA 2W61A 4HFVA 4PFOA 3N5LA 5FL0A 2M6IA 3N9OA 5AFUL 4DV0T 1UGOA 3C64A 2NTYA 5CA1E 1HNZT 1SE7A
chains in the Genus database with same CATH topology
2VASA 3KINB 2L8KA 4IDZA 3H37A 1LVKA 4C90A 1HG5A 3N2OA 2YEVC 4O2AE 4OFZA 1YKEB 2XQYA 1FMVA 2K5BB 4QKNA 5F8PA 2E9XA 4I50E 4KUMB 4CQIA 2A3DA 4EXTA 2EHOA 1US7B 2PG8A 2Y8DA 2KXPB 3ZMZB 3KVBA 2UXXB 4H9RC 3UUNA 3ANWB 5KMGP 4AQFA 4KBMB 3ZCIA 5KX5E 4EAHA 2LSIA 3EDUA 2WM9A 5FP3A 5TAOA 2IW5B 4KMCA 3ZLIA 3VKHA 3ZMVB 3A5XA 4J2CA 5FYMA 1HX8A 2JQQA 5L3FB 1BR1A 3T8OA 2LHRA 1UX5A 2PFVA 3AAIA 2E9XD 2CXDA 3RRWA 4Z8XA 2MYSA 4F6RC 2EHOD 5FMNA 1HG2A 2YK0A 3GMIA 5LJNA 3KDSE 3CWZB 4HN9A 2A72A 4ZI3D 2WBLA 1MIYA 2VK9A 2LM9A 3DP7A 5HYAA 3R84B 4AKGA 4YHJA 5GONE 2LSKA 2KINB 2PJQA 1ZKEA 3WAKA 5KDMC 3EVYA 3SS1A 2LE8A 4EZHA 1OWAA 3ONXA 3FXEB 3U3IA 3DJBA 4BJMA 3CMLA 4WNKA 5ADXL 3CX6B 3IF8B 2QA7A 3UFEA 4X1IE 1B7TA 3IEEA 2CLYB 3MZKB 3NRYA 1MIWA 2RP4A 2LSGA 2D0TA 3NZPA 4UEMA 5JVDE 3UULA 3SRZA 2N9DA 3AVSA 4IE4A 1YW0A 2CEAA 2MBGA 3B57A 2W62A 3PU3A 1QUUA 3NRXA 2K24A 2N1GA 3EDVA 2PBIA 3KFWX 3NZQA 2CM0A 2K9AA 4ZS2A 1MMNA 2KWHA 2HH7A 3LK2B 3HKEE 4AKIA 3LK42 2N2NA 2IC6A 4MALA 5CA0E 1OXZA 5LXTE 5JDHA 2VWAA 5JR9A 3SOLA 3HR0A 4G2AA 3PE0A 3MKDA 2M67A 3ETVA 5JDMA 4AKRB 4WBOA 2VKDA 3OYZA 3VKGA 4OK0A 2C5JA 3RYFE 5H6RB 3KV4A 3VU7H 2UXNB 3JC6D 3HKBE 5J2TE 2JMHA 2B1EA 3O1JA 4TX5A 5C8YE 5JDLA 1YKHB 3N2KE 2HPLA 2MOZA 2CE7A 3C50A 3E08A 1VOMA 4PK4A 4ZOLE 1MMDA 3RRCA 4A56A 3KV9A 2LJLA 4MLKA 1T98A 2XASB 2CWOA 1V9DA 3RC3A 4HGAA 4ZI7E 1D1BA 4EB6E 4UF0B 2CMRA 3QC9A 5FNVE 2MTQA 3FBZA 3AAAB 5J1GA 4CI1B 2Q9QA 2W63A 4PJNA 1S94A 2LOPA 3ZJ2A 2VB6A 2KT9A 4GYRA 2V26A 5FXZA 4I4TE 3I9YA 3RKOA 4DVDA 4XAXB 4P0AA 2LHNA 2ZLYA 1D1CA 2SPCA 5DQWA 2WMNA 4E7SA 1KNZA 4XBFB 2CCQA 4ILUA 4OYJA 2BVMA 2X9XA 3L09A 3IHRA 3B13A 3UT5E 1O3XA 5FY7A 3PUGA 3C98B 4H63V 3PDYA 3N9MA 4ASKA 3PURA 5JDFA 4PK6A 3GN5B 1MNDA 2Q9QD 4ADZA 1UX4A 2J1DG 4DMWA 5LHHB 4ZI2D 5EK2A 5A1LA 3PU8A 4XZCA 1IJ5A 5FXXA 2C5IT 1Z0PA 4HEAA 3TKLB 2KNDA 2DNXA 3F57A 4TZ4C 5DQVA 4B6XA 4L0RA 3Q2MA 1MIVA 3GWHA 1BR4A 3RC8A 2DWGA 2CXLA 3ANWA 4JEHB 2D0UA 3AA0B 3MK7C 2EHOC 3OKQA 3CKDA 3ZEFB 4ANJA 3ETUA 4IE5A 4PNIA 3J9X1 5LJMA 2XAHB 1WYBA 2LEHA 4AQFC 4ZI3C 3LJCA 5LP6E 4PK5A 4OHFA 3ZPOA 2LSYA 2KZ7B 3ESLA 5CB4E 4O8SA 2NP9A 2WWUA 3Q5WA 4GOUA 3U78A 5JREA 4JLEA 3RYIE 1D0ZA 5HXCA 1LKXA 2W0GA 5FXWA 5HXSA 5JDQA 4AKHA 4U74A 2X68A 3AA1B 3PUAA 4PJMA 3QUJA 3ZN1B 3KBUA 2YU1A 4UVCB 3EUHA 4QX8B 3OYXA 2X66A 3M65A 3W15B 3O4XE 3I0QA 3NBXX 1AJ3A 3PUQA 2XAGB 1YD8G 3LFMA 4O4JE 3AVRA 3SWHA 4X1KE 5M4YA 2A2FX 2DI4A 4O2BE 3CQXC 4O4HE 1LRZA 4AXPA 5HXEA 2NWBA 1BR0A 2ODUA 3O1HA 1EZ3A 2I59A 2V7LA 1X79A 5LCYA 1D0XA 2QGSA 3K3OA 1ZHCA 4AI6A 4HTEA 3ZC0A 1LVFA 2JRKA 3O1IA 3BQLA 4HE8A 4E7ZA 4FJOA 3OJAA 4JEUB 5HXRA 5LNKA 2L9QA 3KVAA 3LBXB 1ZEEA 4I43B 1H7CA 3F31A 4C91A 2ACXA 3FHNA 4PAGA 1HF8A 3JC6C 5FY1A 4EIWA 2HPJA 2GK9A 5LGUB 1FIOA 2BZBA 4BA9A 2ZM0A 5JR9C 4PFPA 5LG4A 3N9QA 4WBNE 2WSSV 3S4UA 3V5SA 5H6QB 3CQCB 5ETWA 1D1AA 1U5PA 2ZMAA 3BK9A 2KWIB 3P8CD 4TV9E 3MJXA 3CPZA 4CXWA 4WW0A 5HWXA 4IIJE 1WLXA 5LGTB 4PW8A 3C4XA 1WYCA 3ZJ1A 4CI2B 2H7VC 5JRCB 2C5KT 1E1HB 3BQKA 3HKCE 4UF0A 4BAYB 4QWNB 3AA7B 4I55E 3HKDE 3PUSA 3K3NA 5DJQC 3I9WA 4ISSA 5L3DB 4FI5A 4EYUA 2XAJB 4YFSA 5LBMA 3CX7B 5LGNB 3CVRA 2E8IA 4GK5E 5JDNA 2X9WA 2YU2A 3ZN0B 2V1DB 2V7MA 4TV8E 5DABA 2Q9QC 1HFAA 4P09A 4UXNB 3UUMA 1IJ6A 2Y48B 3OBVE 4ZS3A 4UV9B 5EK3A 4P0BA 2XHEB 4CI3B 2H7OA 2D2SA 4H63H 1MMAA 2XTLA 3DTOA 5F3JA 4MFRA 1FEWA 5L3GB 4X1YE 2LOSA 3KV6A 3ZCJA 5JQGE 3GN5A 5JDGA 3I1AA 4MHCA 2E9XB 2XAFB 1G8XA 4EOZB 2VKOA 2EHOB 1WR6A 4YLHA 4TUYE 4UV8B 4H9NC 4BJNA 3QK6A 4QXCB 4QXHB 2NOXA 2E9XC 5L2LA 5BMVE 4ISTA 2V7JA 3J7Yq 5HWYA 1NAFA 3C4WA 2VL8A 4QXBB 1KK7A 4V1Av 3WAJA 3RYCE 1S35A 1CUNA 4QX7B 3CX8B 2ZM8A 5EZYE 3N9PA 2ODVA 3HI2A 5L3CB 4CXYA 3LG7A 2IAKA 2CWYA 2YINA 1IAPA 4M1PA 3K8PC 1SHZC 5LA6E 1U4QA 4UELA 5HAXA 4DBRA 4G63A 3ZC1A 2V7IA 5EK4A 4IE6A 4NUVA 4EZ4A 4IE7A 3UTKA 2DHRA 4U72A 1HTJF 1QSDA 2Z6EA 1SA0E 4H9SE 4AKLA 5LHIB 3MACA 3ZMUB 4PJLA 2K48A 2Y6XA 3Q9DA 4H9PC 2LSJA 3C4ZA 3Q5XA 2D5UA 2NW7A 1WRDA 4UVAB 5LYJE 5LOVE 3WI3A 1HS7A 1UCUA 3N9NA 4KP3C 3AB3B 5FY0A 3AA6B 4O4IE 3MXZA 4ZHQE 4TN7B 2X67A 2C0SA 2X9HA 4IGUA 3E22E 4YJ2E 3CQGB 4AQGA 5L3EB 2G0UA 2XUEA 1G73A 4L5GA 4CZZB 4N78D 4JUYA 1IZNB 1ZV4X 3L3PA 3N9LA 2L3LA 1Y64B 2RA1A 3C51A 3LK3B 4K0UA 3R6NA 1D0YA 3H3AA 2CLYC 4H9OC 4PJJA 1NWMX 2OA5A 4GYSA 5L3BB 2ZM2A 1VRBA 3UUXB 5JR9B 2VKJA 4GIWA 2H3RA 3K3QC 4HKAA 2WAUA 3E0ZA 1MNEA 2XAQB 3KV5A 2X51A 3LBXA 2JJ9A 4X20E 3ZYMA 4DMVA 2W00A 4H9QC 5HXHA 4EYYR 3MA9A 2CA5A 2DCFA 3I0OA 4GK0E 3ZYLA 2P9BA 4O4LE 4YJ3E 4DNDA 3FB2A 5LHGB 3BQIA 2NTXA 4DBQA 2V7KA 5FXVA 5J2UE 4NUUA 3RPUA 4CXXA 2JPFA 3RH3A 3VHLA 2DLRA 2WMOA 3ZMTB 3D0TA 2X0LB 3P7IA 3RYHE 4DO0A 5JH7E 2IC9A 2NW8A 2VKHA 3ZMSB 2BDEA 3RX6A 3O9XA 2DWKA 5E0OA 1BR2A 3HA4A 3FBLA 3N2GE 2Q9QB 5LBQB 2KLQA 3HL6A 3AAEB 2BVLA 2LT3A 2W61A 5IHYA 3PTRB 4IE0A 5JRCA 4HFVA 2JMKA 3FXDB 2KMFA 5IYZE 4PFOA 1MMGA 3V5UA 3N5LA 1FMWA 4UVBB 3ZYKA 2CXFA 3N9OA 4ZI2C 5AFUL 4UIGA 1HCIA 3IBPA 3C64A 2NTYA 4MBQA 4OYKA 3F2EA 5CA1E 3KBTA 4IHJE 2ES0A 3GA8A 2X9YA 4QHOA 4L9IA 4ERRA 2NW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P C;  4H9O C;  4H9N C;  4H9R C;  5KDM C;  4H9S E;  4HGA A;  4H9Q C; 
#chains in the Genus database with same CATH topology
 4IDZ A;  4DUY T;  1LVK A;  4IL9 A;  2E9X A;  2XPK A;  4KUM B;  4CQI A;  4EXT A;  2KXP B;  3ZMZ B;  2CPT A;  2V6Y A;  4HFH A;  2UUA T;  2UUC T;  4JI4 T;  4EED A;  5TAO A;  3ZMV B;  5L3F B;  2JQQ A;  2LHR A;  3RRW A;  2E9X D;  4Z8X A;  4K0K T;  1HG2 A;  2LRL A;  4ZI3 D;  1MIY A;  3DP7 A;  1N33 T;  5HEU A;  2LSK A;  5KDM C;  3RLF F;  3SS1 A;  3JAF A;  3DJB A;  4BJM A;  4WNK A;  4HWD A;  2QA7 A;  3UFE A;  2CLY B;  2WZI A;  3NRY A;  4YTP A;  3P4P A;  2LSG A;  1W09 A;  1ZOY A;  5JVD E;  3UUL A;  1M7K A;  2N9D A;  1YW0 A;  2CEA A;  3PU3 A;  1QUU A;  2VQF T;  5ABE A;  4GKJ T;  4MAL A;  1OXZ A;  5LXT E;  3FZF B;  3L39 A;  5JR9 A;  4IDO A;  4LFC T;  5JDM A;  3OYZ A;  3PV0 F;  4YTM A;  3AE3 A;  3KV4 A;  2B1E A;  3O1J A;  4TX5 A;  5F5W A;  5C8Y E;  2ZM6 T;  3N2K E;  2HPL A;  3E08 A;  1I94 T;  4MLK A;  2XAS B;  2CWO A;  4HGA A;  3QC9 A;  2MTQ A;  1S94 A;  3QOF A;  3ZJ2 A;  4U2Z A;  4GYR A;  2V26 A;  3JCF A;  5FXZ A;  3SFE A;  5LMU T;  2LHN A;  2ZLY A;  1D1C A;  4E7S A;  2CCQ A;  1NEN A;  2BVM A;  2X9X A;  1DU2 A;  3IHR A;  2W66 A;  3C98 B;  3PUR A;  3P4W A;  2WDV A;  4HWC A;  3OTO T;  4ADZ A;  4LMK A;  5LHH B;  4ZI2 D;  5EK2 A;  5FXX A;  4LF6 T;  3QB5 A;  4HEA A;  2XQ3 A;  4HWF A;  5IUX A;  4DR1 T;  3GWH A;  1J1J A;  2BG9 E;  3OKQ A;  4ANJ A;  4UR9 A;  4PNI A;  4ZI3 C;  3LJC A;  5LP6 E;  2WP9 A;  3ZPO A;  2KZ7 B;  3PUW F;  3Q5W A;  1LKX A;  4U74 A;  3EAM A;  2XQ5 A;  3AE7 A;  3ONJ A;  3OYX A;  3EAB A;  3M65 A;  1N36 T;  3O4X E;  1WR0 A;  1AJ3 A;  2XAG B;  5HEG A;  4O2B E;  5HXE A;  1LRZ A;  2NWB A;  3O1H A;  4HWI B;  1D0X A;  4DV6 T;  4AI6 A;  3ZC0 A;  3O1I A;  2BBJ A;  3KVA A;  1FJG T;  5AQR B;  1H7C A;  4TNW A;  4PAG A;  4JV5 T;  2E5L T;  1HF8 A;  1QLB A;  5FY1 A;  2HPJ A;  2J47 A;  5FKY A;  2B76 A;  5JTG A;  3RIU A;  2ZM0 A;  5JR9 C;  4JI2 T;  4PFP A;  3V5S A;  2KWI B;  4QH4 A;  3CPZ A;  2LKH A;  4I0U A;  4PW8 A;  3AE6 A;  2AXD S;  1E1H B;  4BAY B;  3PUS A;  3CK6 A;  3NVO A;  3I9W A;  4ISS A;  5L3D B;  4WYV A;  1JNR A;  2CHN A;  2XZE A;  4GK5 E;  2YU2 A;  4TV8 E;  2J62 A;  4P09 A;  4ZS3 A;  5EK3 A;  2XTL A;  5F3J A;  4MFR A;  4Q25 A;  3ZCJ A;  5AQJ B;  2E9X B;  4EOZ B;  1NEK A;  5ABG A;  4YLH A;  4TUY E;  4H9N C;  3VR9 A;  2V6Y B;  4QXH B;  4B3S T;  4QXB B;  4DR6 T;  1I6Z A;  1S35 A;  5EZY E;  3N9P A;  2ODV A;  2BKP A;  2IAK A;  3K8P C;  5HAX A;  4DBR A;  3ZC1 A;  4P1N A;  4NUV A;  4EZ4 A;  4IE7 A;  2DHR A;  1HTJ F;  4H9S E;  2Y6X A;  3Q5X A;  4UVA B;  1WRD A;  5CJ5 A;  4JYA T;  3AB3 B;  4ZHQ E;  4U7Y A;  4QH1 A;  4TN7 B;  2LKG A;  3CQG B;  3PJA A;  3TLW A;  1XDO A;  4L5G A;  4N78 D;  1VCS A;  2UU9 T;  3H3A A;  3AEA A;  4HFB A;  2WDQ A;  4H9O C;  3TLT A;  1NWM X;  3UUX B;  5JR9 B;  4YXD A;  2VKJ A;  2H3R A;  3K3Q C;  2XAQ B;  2JJ9 A;  5AQL B;  4HWH A;  3EHZ A;  5HXH A;  2UXB T;  3ZT5 A;  2P9B A;  4YJ3 E;  3AE4 A;  4DBQ A;  4NUU A;  3RPU A;  4CXX A;  3RH3 A;  4LMJ A;  2LRK A;  4KI0 F;  3RX6 A;  2UXD T;  3NWI A;  3AAE B;  2LT3 A;  3PTR B;  4IDQ A;  4NXN T;  3QB5 K;  2JMK A;  2QYW A;  3FZM B;  3EI0 A;  3ZT6 A;  1FMW A;  4COF A;  4GKK T;  3IBP A;  1J5W A;  3GA8 A;  4L9I A;  1J5E T;  2FJE A;  5HEO A;  4C90 A;  4ILC A;  2XQ6 A;  4A98 A;  3VRA A;  5L4E A;  3TLU A;  2A3D A;  2EHO A;  2Y8D A;  2PG8 A;  4X64 T;  2UXX B;  3UUN A;  5CFB A;  4AQF A;  5KX5 E;  4EAH A;  2LSI A;  3JAE A;  2WCA A;  4YT0 A;  4Z90 A;  2OV9 A;  1XWM A;  2IW5 B;  5ABF A;  3VKH A;  3RQU A;  1HX8 A;  1BR1 A;  3T8O A;  1UX5 A;  2EHO D;  2E2A A;  3VR8 A;  3KDS E;  2A72 A;  1IBK T;  3R84 B;  4AKG A;  5GON E;  2V5C A;  2PJQ A;  4DV4 T;  3LSV A;  5AQK B;  3IF8 B;  2WWV A;  4ZZB A;  3IEE A;  3MZK B;  2FJB A;  2VUR A;  3SRZ A;  1XMQ T;  2W62 A;  3NRX A;  3EDV A;  2PBI A;  1W9R A;  3KFW X;  3NZQ A;  2CM0 A;  2K9A A;  4ZS2 A;  1OED E;  3P4R A;  4AKI A;  5HEJ A;  3FZK B;  3UQ7 A;  2H88 A;  2WQY A;  3MKD A;  2NR4 A;  4AKR B;  2VKD A;  4JBW F;  2C5J A;  5AQN B;  2YDS A;  5H6R B;  3JC6 D;  5J2T E;  2MOZ A;  2CE7 A;  4PK4 A;  4IT4 A;  1MMD A;  4A56 A;  2FBW A;  3RC3 A;  4AIU A;  2CMR A;  2CBJ A;  5FNV E;  1E7P A;  4PJN A;  4I4T E;  3RKO A;  4XAX B;  2SPC A;  5DQW A;  4XBF B;  4OYJ A;  3L09 A;  5BR8 T;  3B13 A;  1O3X A;  4B3M T;  3PUG A;  3N9M A;  4PK6 A;  1MND A;  5IWA T;  2C5I T;  1Y01 A;  3TKL B;  2DNX A;  2XJ7 A;  1BR4 A;  3RC8 A;  5AQF B;  3MK7 C;  2EHO C;  3CKD A;  3ETU A;  3J9X 1;  2XAH B;  1WYB A;  2LEH A;  4AQF C;  3AE9 A;  2W67 A;  4CN6 A;  3ABV A;  4OHF A;  1N32 T;  4O8S A;  4JLE A;  2W0G A;  5HXS A;  3AA1 B;  5AQS B;  3PUA A;  3QUJ A;  3ZN1 B;  4UVC B;  1XDP A;  4QX8 B;  3UU8 A;  3I0Q A;  3AE5 A;  3PUQ A;  4ZZC A;  3AVR A;  4X1K E;  3TLS A;  4YSY A;  2FUP A;  4A97 A;  2I59 A;  2WDR A;  3BQL A;  4IRE A;  4FJO A;  4WZX A;  3AEB A;  4I43 B;  3F31 A;  3FHN A;  1YQ3 A;  3JC6 C;  3ONL C;  1SUM B;  3ZKR A;  2XY8 B;  3OVU A;  1YQ4 A;  3N9Q A;  3S4U A;  1D1A A;  3BK9 A;  3P8C D;  3MJX A;  3X1D A;  4CXW A;  2WU5 A;  3BQK A;  3HKC E;  3AA7 B;  4I55 E;  4QH5 A;  5AQM B;  4FI5 A;  2XAJ B;  4YFS A;  5LBM A;  3CX7 B;  1W0B A;  2E8I A;  1R8I A;  5AQI B;  1L0V A;  2V7M A;  4JI8 T;  1HFA A;  2IUB A;  2IDO B;  3UUM A;  1IJ6 A;  2Y48 B;  3AEC A;  4IL4 A;  2D2S A;  1MMA A;  3KV6 A;  5JQG E;  3GN5 A;  5JDG A;  4X65 T;  2VKO A;  2EHO B;  4UV8 B;  4U7I A;  2W2U A;  2E5V A;  2E9X C;  5BMV E;  4IST A;  2V7J A;  4NPP A;  3C4W A;  2VL8 A;  1KK7 A;  5ABF B;  4ZEY A;  3RYC E;  4QX7 B;  2ZM8 A;  4CN1 A;  3HI2 A;  2YIN A;  4M1P A;  5LA6 E;  1SHZ C;  3ZT7 A;  2YDQ A;  4IE6 A;  2V6X A;  5C2T A;  1QSD A;  1SA0 E;  5LHI B;  3MAC A;  3ZMU B;  2OLT A;  3Q9D A;  4LF5 T;  3WI3 A;  4JI5 T;  1HS7 A;  3N9N A;  5FY0 A;  3AA6 B;  3MXZ A;  2X9H A;  3E22 E;  4YHH T;  4AQG A;  5L3E B;  3AE8 A;  4YY3 T;  4A5X A;  2G0U A;  3RQW A;  4F8H A;  3R6N A;  1D0Y A;  2OA5 A;  4X62 T;  2ZM2 A;  1HNW T;  2WAU A;  2LLY A;  2X51 A;  4EGW A;  4X20 E;  4DMV A;  2W00 A;  3MA9 A;  2DCF A;  4O4L E;  4DND A;  2NTX A;  2XQ4 A;  3AEF A;  3VHL A;  2DLR A;  3ZMT B;  3D0T A;  2X0L B;  2YKS A;  2IC9 A;  2NW8 A;  2VKH A;  3ZMS B;  3O9X A;  2WB5 A;  3VRB A;  3N2G E;  2W4X A;  3HL6 A;  2BG9 A;  4IE0 A;  2XSB A;  1CHU A;  3FXD B;  2KMF A;  5ABH A;  3ZYK A;  2CXF A;  4ZI2 C;  4UIG A;  1HCI A;  2X0Y A;  3KBT A;  3CIR A;  4IHJ E;  1VCT A;  1T8B A;  2DL1 A;  2NW9 A;  2VAS A;  3KIN B;  5L4H A;  4YSX A;  1KNR A;  3H37 A;  1HG5 A;  2YEV C;  4O2A E;  1IBM T;  4OFZ A;  1YKE B;  4QKN A;  2WZH A;  4I50 E;  4H9R C;  5KMG P;  5AQU B;  2VL0 A;  4KBM B;  2WM9 A;  4KMC A;  1T72 A;  2LM2 A;  5C3J A;  2A9U A;  5FYM A;  2PFV A;  2PTF A;  3AAI A;  4F6R C;  4YTN A;  2HHH T;  2AE9 A;  2YK0 A;  3GMI A;  5LJN A;  4DID B;  2WBL A;  5HYA A;  4YHJ A;  3UFG A;  3ZSS A;  2KIN B;  2VVN A;  2LE8 A;  4EZH A;  3ONX A;  3LDQ B;  3UUB A;  4X1I E;  1B7T A;  2JIW A;  2RP4 A;  2D0T A;  1YXR A;  4IE4 A;  3SFD A;  3UU4 A;  2KWH A;  3LK4 2;  2N2N A;  5CA0 E;  4JI1 T;  2VWA A;  2BBH A;  3SOL A;  4G2A A;  3PE0 A;  2M67 A;  4KX6 A;  4X5T A;  4OK0 A;  1HR0 T;  2UXN B;  3HKB E;  2JMH A;  3RIU C;  1KEY A;  3C50 A;  2QRX A;  2K3W A;  3RRC A;  3IA3 A;  2CBI A;  1T98 A;  4JI3 T;  1V9D A;  4ZI7 E;  1D1B A;  1X9B A;  4EB6 E;  1XNQ T;  3FBZ A;  3AAA B;  2W63 A;  2LOP A;  2VB6 A;  4DVD A;  4P0A A;  4OX9 T;  1JNZ A;  3T1H T;  1KNZ A;  4ILU A;  2BG9 C;  1UK5 A;  4H63 V;  3PDY A;  5HCJ A;  5JDF A;  3GN5 B;  3Q5D A;  4U33 A;  4DMW A;  4EEB A;  2RPA A;  5A1L A;  4HFD A;  1IJ5 A;  4XZC A;  3B5M A;  1Z0P A;  2KND A;  3F57 A;  5DQV A;  4B6X A;  4DR7 T;  2I6H A;  2CXL A;  3ANW A;  4JEH B;  2D0U A;  3AA0 B;  3ZEF B;  5LJM A;  5AQP B;  5J0Z A;  4PK5 A;  5CB4 E;  4GOU A;  2WWU A;  3U78 A;  5FVK A;  3RYI E;  5HXC A;  5FXW A;  4DR4 T;  2M6B A;  1IBL T;  3AED A;  3AE2 A;  3EUH A;  4DV5 T;  3PUZ F;  2X66 A;  3W15 B;  5AQO B;  1N34 T;  1YD8 G;  4O4J E;  2DI4 A;  3QNU A;  4AXP A;  1BR0 A;  3A7M A;  2ODU A;  4IDP A;  1X79 A;  5LCY A;  1XZY A;  1ZHC A;  4EV6 A;  2XSA A;  4HTE A;  1LVF A;  3OJA A;  1ZEE A;  4JI7 T;  1XMO T;  3AE1 A;  3K1S A;  2BZB A;  4DV7 T;  2WSS V;  5ETW A;  1U5P A;  2ZMA A;  4DUZ T;  4JI0 T;  4LFA T;  2BS3 A;  4WW0 A;  5HWX A;  4ILA A;  4TWH A;  1WLX A;  5LGT B;  2JQH A;  2UUB T;  3C4X A;  1WYC A;  2BG9 B;  3ZJ1 A;  4CI2 B;  2C5K T;  4UF0 A;  4QWN B;  3G06 A;  4TNV A;  3K3N A;  5DJQ C;  4EYU A;  5LGN B;  5CGM A;  3ZN0 B;  4DR2 T;  2V1D B;  5DAB A;  4UXN B;  3OBV E;  3FZH B;  4IDN A;  4P0B A;  2XHE B;  2V8S V;  4CI3 B;  3AXJ A;  4H63 H;  1KF6 A;  1FEW A;  5L3G B;  4X1Y E;  2LOS A;  4MHC A;  4B3R T;  1G8X A;  1WR6 A;  2MAW A;  3QK6 A;  2D9D A;  4QXC B;  4HFC A;  4CN4 A;  4LF9 T;  2WY2 A;  1E2A A;  5HWY A;  3CX8 B;  1OED A;  2XQ8 A;  5AQG B;  5L3C B;  4CXY A;  2CWY A;  1IAP A;  5EK4 A;  2XM1 A;  3AEE A;  4AKL A;  4PJL A;  4Z91 A;  5LB7 B;  2D5U A;  1UCU A;  4KP3 C;  4O4I E;  3A8Y C;  2C0S A;  2KSR A;  1IZN B;  1ZV4 X;  3L3P A;  3N9L A;  2IHR 1;  4X66 T;  5L3B B;  1VRB A;  5HEH A;  2ACZ A;  4HKA A;  3KV5 A;  3LBX A;  3ZYM A;  4H9Q C;  2IIU A;  3L8R A;  2CA5 A;  5FL1 A;  3FZL B;  1ZP0 A;  3FB2 A;  3BQI A;  3RIA A;  2V7K A;  5FXV A;  5J2U E;  2WMO A;  2WS3 A;  5JH7 E;  3P7I A;  4DO0 A;  2BDE A;  2YN6 A;  2DWK A;  1BR2 A;  2F4V T;  1WCR A;  5IHY A;  2HN2 A;  5JRC A;  5HCM A;  4U2Y A;  5IYZ E;  2I0M A;  3PJA J;  5KXJ A;  1MMG A;  3V5U A;  3M3Z B;  4UVB B;  3RF1 A;  4MBQ A;  4OYK A;  3F2E A;  4U3C A;  3ZST A;  2ES0 A;  2X9Y A;  4QHO A;  4ASK A;  4ERR A;  2L8K A;  3PUY F;  3N2O A;  2XQY A;  1FMV A;  2K5B B;  5F8P A;  1US7 B;  3KVB A;  3ANW B;  3ZCI A;  2YDR A;  3EDU A;  5FP3 A;  3ZLI A;  1Z8U A;  3A5X A;  4J2C A;  4LF7 T;  2YOE A;  2CXD A;  2MYS A;  3RGL A;  5FMN A;  3CWZ B;  4HN9 A;  1OED C;  5AQT B;  2VK9 A;  2LM9 A;  4KHZ F;  1ZKE A;  3WAK A;  3EVY A;  2VVS A;  3PUX F;  1OWA A;  3FXE B;  3U3I A;  3CML A;  5ADX L;  3CX6 B;  5AQH B;  4NXM T;  1MIW A;  2FJD A;  3NZP A;  4UEM A;  2CRB A;  3AVS A;  2MBG A;  3B57 A;  2CHO A;  1WFD A;  2K24 A;  2N1G A;  1MMN A;  2HH7 A;  3LK2 B;  3HKE E;  1GQE A;  2IC6 A;  5JDH A;  3HR0 A;  3ETV A;  4WBO A;  3VKG A;  3RYF E;  3VU7 H;  4LF8 T;  5JDL A;  1YKH B;  3RKG A;  1VOM A;  2WU2 A;  4ZOL E;  2J4G A;  5L47 A;  3KV9 A;  4TWD A;  2LJL A;  4UF0 B;  5J1G A;  4CI1 B;  2Q9Q A;  3UU5 A;  2KT9 A;  3I9Y A;  2QVA A;  2WMN A;  3UT5 E;  4DV1 T;  3AXJ B;  5FY7 A;  2XQ9 A;  2UXC T;  2BS4 A;  4LF4 T;  2BKO A;  1XNR T;  2Q9Q D;  1UX4 A;  2J1D G;  3PU8 A;  3Q5E A;  4HFI A;  2XQ7 A;  4ILB A;  2VQE T;  4TZ4 C;  4L0R A;  3Q2M A;  1MIV A;  2DWG A;  1OED B;  3JAD A;  4IE5 A;  4DV3 T;  5LG3 A;  2LSY A;  4AKH A;  3ESL A;  5JRE A;  2NP9 A;  1D0Z A;  2R6G F;  5AQQ B;  5JDQ A;  2X68 A;  1KFY A;  4PJM A;  3KBU A;  1KNP A;  2YU1 A;  3NBX X;  3P4Q A;  2X0H A;  3LFM A;  3SWH A;  5M4Y A;  2A2F X;  2BKN A;  3CQX C;  4O4H E;  4B3T T;  2JQK A;  1EZ3 A;  2V7L A;  2QGS A;  3K3O A;  2HN1 A;  3T1Y T;  2JRK A;  5LMN T;  4HE8 A;  4E7Z A;  5LNK A;  4JEU B;  5HXR A;  2L9Q A;  3LBX B;  1UUR A;  4C91 A;  2ACX A;  4EIW A;  4JI6 T;  2GK9 A;  5LGU B;  1FIO A;  4BA9 A;  3PUV F;  4TWF A;  4HFE A;  5LG4 A;  3P4S A;  4WBN E;  3UU6 A;  5H6Q B;  3CQC B;  4TV9 E;  3OPC A;  4IIJ E;  4AQY T;  4DV2 T;  2H7V C;  5JRC B;  3HKD E;  4LFB T;  2MPK A;  4ZXL A;  3CVR A;  5JDN A;  2X9W A;  2Q9Q C;  4KHP T;  4UV9 B;  2IML A;  2H7O A;  3DTO A;  3I1A A;  4DR5 T;  2XAF B;  3UU3 A;  4BJN A;  5AQV B;  2NOX A;  2BS2 A;  5L2L A;  3J7Y q;  3RI5 A;  1NAF A;  4V1A v;  3WAJ A;  4DR3 T;  4YSZ A;  1CUN A;  1W0A A;  2V5D A;  3AEG A;  3LG7 A;  1HNX T;  2FJA A;  3H3M A;  1U4Q A;  4UEL A;  4G63 A;  2V7I A;  3UTK A;  4U72 A;  2Z6E A;  2K48 A;  4H9P C;  2LSJ A;  3C4Z A;  2NW7 A;  5LYJ E;  5LOV E;  3TLV A;  3P50 A;  4U31 A;  2X67 A;  4IGU A;  4YJ2 E;  2XM2 A;  3NKZ A;  2XUE A;  1G73 A;  4CZZ B;  3RHW A;  4JUY A;  5FVL A;  2L3L A;  1Y64 B;  2RA1 A;  3C51 A;  3LK3 B;  4K0U A;  2CLY C;  4PJJ A;  4GYS A;  4GIW A;  3E0Z A;  1MNE A;  3RIF A;  4NIQ A;  4EYY R;  1HX1 B;  3I0O A;  2XQA A;  4GK0 E;  3ZYL A;  1UUS A;  4LML A;  2H89 A;  5LHG B;  2JPF A;  3UQ4 A;  2JQ9 A;  4AIS A;  1M62 A;  3RYH E;  1T7S A;  5E0O A;  3HA4 A;  3FBL A;  2Q9Q B;  5LBQ B;  2KLQ A;  2BVL A;  2W61 A;  4HFV A;  4PFO A;  3N5L A;  5FL0 A;  2M6I A;  3N9O A;  5AFU L;  4DV0 T;  1UGO A;  3C64 A;  2NTY A;  5CA1 E;  1HNZ T;  1SE7 A; 
#chains in the Genus database with same CATH homology
 2VAS A;  3KIN B;  2L8K A;  4IDZ A;  3H37 A;  1LVK A;  4C90 A;  1HG5 A;  3N2O A;  2YEV C;  4O2A E;  4OFZ A;  1YKE B;  2XQY A;  1FMV A;  2K5B B;  4QKN A;  5F8P A;  2E9X A;  4I50 E;  4KUM B;  4CQI A;  2A3D A;  4EXT A;  2EHO A;  1US7 B;  2PG8 A;  2Y8D A;  2KXP B;  3ZMZ B;  3KVB A;  2UXX B;  4H9R C;  3UUN A;  3ANW B;  5KMG P;  4AQF A;  4KBM B;  3ZCI A;  5KX5 E;  4EAH A;  2LSI A;  3EDU A;  2WM9 A;  5FP3 A;  5TAO A;  2IW5 B;  4KMC A;  3ZLI A;  3VKH A;  3ZMV B;  3A5X A;  4J2C A;  5FYM A;  1HX8 A;  2JQQ A;  5L3F B;  1BR1 A;  3T8O A;  2LHR A;  1UX5 A;  2PFV A;  3AAI A;  2E9X D;  2CXD A;  3RRW A;  4Z8X A;  2MYS A;  4F6R C;  2EHO D;  5FMN A;  1HG2 A;  2YK0 A;  3GMI A;  5LJN A;  3KDS E;  3CWZ B;  4HN9 A;  2A72 A;  4ZI3 D;  2WBL A;  1MIY A;  2VK9 A;  2LM9 A;  3DP7 A;  5HYA A;  3R84 B;  4AKG A;  4YHJ A;  5GON E;  2LSK A;  2KIN B;  2PJQ A;  1ZKE A;  3WAK A;  5KDM C;  3EVY A;  3SS1 A;  2LE8 A;  4EZH A;  1OWA A;  3ONX A;  3FXE B;  3U3I A;  3DJB A;  4BJM A;  3CML A;  4WNK A;  5ADX L;  3CX6 B;  3IF8 B;  2QA7 A;  3UFE A;  4X1I E;  1B7T A;  3IEE A;  2CLY B;  3MZK B;  3NRY A;  1MIW A;  2RP4 A;  2LSG A;  2D0T A;  3NZP A;  4UEM A;  5JVD E;  3UUL A;  3SRZ A;  2N9D A;  3AVS A;  4IE4 A;  1YW0 A;  2CEA A;  2MBG A;  3B57 A;  2W62 A;  3PU3 A;  1QUU A;  3NRX A;  2K24 A;  2N1G A;  3EDV A;  2PBI A;  3KFW X;  3NZQ A;  2CM0 A;  2K9A A;  4ZS2 A;  1MMN A;  2KWH A;  2HH7 A;  3LK2 B;  3HKE E;  4AKI A;  3LK4 2;  2N2N A;  2IC6 A;  4MAL A;  5CA0 E;  1OXZ A;  5LXT E;  5JDH A;  2VWA A;  5JR9 A;  3SOL A;  3HR0 A;  4G2A A;  3PE0 A;  3MKD A;  2M67 A;  3ETV A;  5JDM A;  4AKR B;  4WBO A;  2VKD A;  3OYZ A;  3VKG A;  4OK0 A;  2C5J A;  3RYF E;  5H6R B;  3KV4 A;  3VU7 H;  2UXN B;  3JC6 D;  3HKB E;  5J2T E;  2JMH A;  2B1E A;  3O1J A;  4TX5 A;  5C8Y E;  5JDL A;  1YKH B;  3N2K E;  2HPL A;  2MOZ A;  2CE7 A;  3C50 A;  3E08 A;  1VOM A;  4PK4 A;  4ZOL E;  1MMD A;  3RRC A;  4A56 A;  3KV9 A;  2LJL A;  4MLK A;  1T98 A;  2XAS B;  2CWO A;  1V9D A;  3RC3 A;  4HGA A;  4ZI7 E;  1D1B A;  4EB6 E;  4UF0 B;  2CMR A;  3QC9 A;  5FNV E;  2MTQ A;  3FBZ A;  3AAA B;  5J1G A;  4CI1 B;  2Q9Q A;  2W63 A;  4PJN A;  1S94 A;  2LOP A;  3ZJ2 A;  2VB6 A;  2KT9 A;  4GYR A;  2V26 A;  5FXZ A;  4I4T E;  3I9Y A;  3RKO A;  4DVD A;  4XAX B;  4P0A A;  2LHN A;  2ZLY A;  1D1C A;  2SPC A;  5DQW A;  2WMN A;  4E7S A;  1KNZ A;  4XBF B;  2CCQ A;  4ILU A;  4OYJ A;  2BVM A;  2X9X A;  3L09 A;  3IHR A;  3B13 A;  3UT5 E;  1O3X A;  5FY7 A;  3PUG A;  3C98 B;  4H63 V;  3PDY A;  3N9M A;  4ASK A;  3PUR A;  5JDF A;  4PK6 A;  3GN5 B;  1MND A;  2Q9Q D;  4ADZ A;  1UX4 A;  2J1D G;  4DMW A;  5LHH B;  4ZI2 D;  5EK2 A;  5A1L A;  3PU8 A;  4XZC A;  1IJ5 A;  5FXX A;  2C5I T;  1Z0P A;  4HEA A;  3TKL B;  2KND A;  2DNX A;  3F57 A;  4TZ4 C;  5DQV A;  4B6X A;  4L0R A;  3Q2M A;  1MIV A;  3GWH A;  1BR4 A;  3RC8 A;  2DWG A;  2CXL A;  3ANW A;  4JEH B;  2D0U A;  3AA0 B;  3MK7 C;  2EHO C;  3OKQ A;  3CKD A;  3ZEF B;  4ANJ A;  3ETU A;  4IE5 A;  4PNI A;  3J9X 1;  5LJM A;  2XAH B;  1WYB A;  2LEH A;  4AQF C;  4ZI3 C;  3LJC A;  5LP6 E;  4PK5 A;  4OHF A;  3ZPO A;  2LSY A;  2KZ7 B;  3ESL A;  5CB4 E;  4O8S A;  2NP9 A;  2WWU A;  3Q5W A;  4GOU A;  3U78 A;  5JRE A;  4JLE A;  3RYI E;  1D0Z A;  5HXC A;  1LKX A;  2W0G A;  5FXW A;  5HXS A;  5JDQ A;  4AKH A;  4U74 A;  2X68 A;  3AA1 B;  3PUA A;  4PJM A;  3QUJ A;  3ZN1 B;  3KBU A;  2YU1 A;  4UVC B;  3EUH A;  4QX8 B;  3OYX A;  2X66 A;  3M65 A;  3W15 B;  3O4X E;  3I0Q A;  3NBX X;  1AJ3 A;  3PUQ A;  2XAG B;  1YD8 G;  3LFM A;  4O4J E;  3AVR A;  3SWH A;  4X1K E;  5M4Y A;  2A2F X;  2DI4 A;  4O2B E;  3CQX C;  4O4H E;  1LRZ A;  4AXP A;  5HXE A;  2NWB A;  1BR0 A;  2ODU A;  3O1H A;  1EZ3 A;  2I59 A;  2V7L A;  1X79 A;  5LCY A;  1D0X A;  2QGS A;  3K3O A;  1ZHC A;  4AI6 A;  4HTE A;  3ZC0 A;  1LVF A;  2JRK A;  3O1I A;  3BQL A;  4HE8 A;  4E7Z A;  4FJO A;  3OJA A;  4JEU B;  5HXR A;  5LNK A;  2L9Q A;  3KVA A;  3LBX B;  1ZEE A;  4I43 B;  1H7C A;  3F31 A;  4C91 A;  2ACX A;  3FHN A;  4PAG A;  1HF8 A;  3JC6 C;  5FY1 A;  4EIW A;  2HPJ A;  2GK9 A;  5LGU B;  1FIO A;  2BZB A;  4BA9 A;  2ZM0 A;  5JR9 C;  4PFP A;  5LG4 A;  3N9Q A;  4WBN E;  2WSS V;  3S4U A;  3V5S A;  5H6Q B;  3CQC B;  5ETW A;  1D1A A;  1U5P A;  2ZMA A;  3BK9 A;  2KWI B;  3P8C D;  4TV9 E;  3MJX A;  3CPZ A;  4CXW A;  4WW0 A;  5HWX A;  4IIJ E;  1WLX A;  5LGT B;  4PW8 A;  3C4X A;  1WYC A;  3ZJ1 A;  4CI2 B;  2H7V C;  5JRC B;  2C5K T;  1E1H B;  3BQK A;  3HKC E;  4UF0 A;  4BAY B;  4QWN B;  3AA7 B;  4I55 E;  3HKD E;  3PUS A;  3K3N A;  5DJQ C;  3I9W A;  4ISS A;  5L3D B;  4FI5 A;  4EYU A;  2XAJ B;  4YFS A;  5LBM A;  3CX7 B;  5LGN B;  3CVR A;  2E8I A;  4GK5 E;  5JDN A;  2X9W A;  2YU2 A;  3ZN0 B;  2V1D B;  2V7M A;  4TV8 E;  5DAB A;  2Q9Q C;  1HFA A;  4P09 A;  4UXN B;  3UUM A;  1IJ6 A;  2Y48 B;  3OBV E;  4ZS3 A;  4UV9 B;  5EK3 A;  4P0B A;  2XHE B;  4CI3 B;  2H7O A;  2D2S A;  4H63 H;  1MMA A;  2XTL A;  3DTO A;  5F3J A;  4MFR A;  1FEW A;  5L3G B;  4X1Y E;  2LOS A;  3KV6 A;  3ZCJ A;  5JQG E;  3GN5 A;  5JDG A;  3I1A A;  4MHC A;  2E9X B;  2XAF B;  1G8X A;  4EOZ B;  2VKO A;  2EHO B;  1WR6 A;  4YLH A;  4TUY E;  4UV8 B;  4H9N C;  4BJN A;  3QK6 A;  4QXC B;  4QXH B;  2NOX A;  2E9X C;  5L2L A;  5BMV E;  4IST A;  2V7J A;  3J7Y q;  5HWY A;  1NAF A;  3C4W A;  2VL8 A;  4QXB B;  1KK7 A;  4V1A v;  3WAJ A;  3RYC E;  1S35 A;  1CUN A;  4QX7 B;  3CX8 B;  2ZM8 A;  5EZY E;  3N9P A;  2ODV A;  3HI2 A;  5L3C B;  4CXY A;  3LG7 A;  2IAK A;  2CWY A;  2YIN A;  1IAP A;  4M1P A;  3K8P C;  1SHZ C;  5LA6 E;  1U4Q A;  4UEL A;  5HAX A;  4DBR A;  4G63 A;  3ZC1 A;  2V7I A;  5EK4 A;  4IE6 A;  4NUV A;  4EZ4 A;  4IE7 A;  3UTK A;  2DHR A;  4U72 A;  1HTJ F;  1QSD A;  2Z6E A;  1SA0 E;  4H9S E;  4AKL A;  5LHI B;  3MAC A;  3ZMU B;  4PJL A;  2K48 A;  2Y6X A;  3Q9D A;  4H9P C;  2LSJ A;  3C4Z A;  3Q5X A;  2D5U A;  2NW7 A;  1WRD A;  4UVA B;  5LYJ E;  5LOV E;  3WI3 A;  1HS7 A;  1UCU A;  3N9N A;  4KP3 C;  3AB3 B;  5FY0 A;  3AA6 B;  4O4I E;  3MXZ A;  4ZHQ E;  4TN7 B;  2X67 A;  2C0S A;  2X9H A;  4IGU A;  3E22 E;  4YJ2 E;  3CQG B;  4AQG A;  5L3E B;  2G0U A;  2XUE A;  1G73 A;  4L5G A;  4CZZ B;  4N78 D;  4JUY A;  1IZN B;  1ZV4 X;  3L3P A;  3N9L A;  2L3L A;  1Y64 B;  2RA1 A;  3C51 A;  3LK3 B;  4K0U A;  3R6N A;  1D0Y A;  3H3A A;  2CLY C;  4H9O C;  4PJJ A;  1NWM X;  2OA5 A;  4GYS A;  5L3B B;  2ZM2 A;  1VRB A;  3UUX B;  5JR9 B;  2VKJ A;  4GIW A;  2H3R A;  3K3Q C;  4HKA A;  2WAU A;  3E0Z A;  1MNE A;  2XAQ B;  3KV5 A;  2X51 A;  3LBX A;  2JJ9 A;  4X20 E;  3ZYM A;  4DMV A;  2W00 A;  4H9Q C;  5HXH A;  4EYY R;  3MA9 A;  2CA5 A;  2DCF A;  3I0O A;  4GK0 E;  3ZYL A;  2P9B A;  4O4L E;  4YJ3 E;  4DND A;  3FB2 A;  5LHG B;  3BQI A;  2NTX A;  4DBQ A;  2V7K A;  5FXV A;  5J2U E;  4NUU A;  3RPU A;  4CXX A;  2JPF A;  3RH3 A;  3VHL A;  2DLR A;  2WMO A;  3ZMT B;  3D0T A;  2X0L B;  3P7I A;  3RYH E;  4DO0 A;  5JH7 E;  2IC9 A;  2NW8 A;  2VKH A;  3ZMS B;  2BDE A;  3RX6 A;  3O9X A;  2DWK A;  5E0O A;  1BR2 A;  3HA4 A;  3FBL A;  3N2G E;  2Q9Q B;  5LBQ B;  2KLQ A;  3HL6 A;  3AAE B;  2BVL A;  2LT3 A;  2W61 A;  5IHY A;  3PTR B;  4IE0 A;  5JRC A;  4HFV A;  2JMK A;  3FXD B;  2KMF A;  5IYZ E;  4PFO A;  1MMG A;  3V5U A;  3N5L A;  1FMW A;  4UVB B;  3ZYK A;  2CXF A;  3N9O A;  4ZI2 C;  5AFU L;  4UIG A;  1HCI A;  3IBP A;  3C64 A;  2NTY A;  4MBQ A;  4OYK A;  3F2E A;  5CA1 E;  3KBT A;  4IHJ E;  2ES0 A;  3GA8 A;  2X9Y A;  4QHO A;  4L9I A;  4ERR A;  2NW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...