4H9QC

Complex structure 4 of daxx(e225a)/h3.3(sub5)/h4
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQAARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
total genus 76
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9qC00
4H9NC 4H9OC 4HGAA 4H9SE 4H9RC 4H9PC 4H9QC 5KDMC
chains in the Genus database with same CATH superfamily
3T1YT 5DABA 3RKOA 3OYZA 5IYZE 2UXNB 4FJOA 4JI1T 2M6IA 2K9AA 3RRWA 2BG9A 5AQPB 2XM1A 1G8XA 3IBPA 2NTXA 5LNKA 3WAJA 3L3PA 5JRCA 4LFCT 4IDPA 2RPAA 4HFEA 5LYJE 4KHPT 3VU7H 3L09A 2FBWA 5FKYA 4HWIB 5ABFB 4UR9A 2Q9QC 2D2SA 5L3BB 2X9XA 4UF0A 2XASB 3CK6A 2E9XB 1DU2A 3O9XA 4O4HE 4XBFB 4O2BE 5HXSA 1IBKT 1YKEB 2VURA 4IE4A 2LT3A 2BKOA 3OBVE 4YHJA 1QSDA 2BBJA 4AKLA 3FZKB 1OEDA 3UU6A 2X9YA 4IE7A 3OVUA 4DV0T 3UT5E 2B1EA 2VKHA 4JEHB 5L3DB 2CRBA 2YINA 2ACZA 2CHOA 2VWAA 2W2UA 3ONXA 5HWXA 4P0BA 5LXTE 3ZLIA 5LJNA 1Y64B 4LF7T 4CXYA 2UUBT 1MNDA 3LJCA 4IHJE 1E2AA 2QYWA 4P09A 2CXDA 2X68A 3I9YA 4ISTA 4G63A 2IW5B 3N9LA 2D9DA 2UXDT 2BS4A 1XDOA 3VKGA 5F5WA 4QXHB 3CKDA 5HAXA 4PFOA 4TUYE 4CXXA 5AQMB 1X79A 2XZEA 3AE9A 1GQEA 4LMJA 3BQLA 4DBQA 4EGWA 5FP3A 2WDVA 2LRKA 2HPLA 4EEBA 2H89A 2XAGB 1W0BA 4ISSA 4DV7T 5AQHB 3P50A 2YDRA 1V9DA 2DHRA 2CHNA 4C91A 1FMVA 3UTKA 1ZKEA 5LG3A 5FVKA 3ZT7A 3GN5B 2JMHA 2IUBA 3E0ZA 3HA4A 5FXZA 3PURA 2X66A 4QX7B 4OX9T 3RGLA 5FL0A 2I59A 4IDNA 3VRAA 3U78A 5AQRB 1HR0T 2DWGA 4EIWA 4DV6T 1HF8A 4KBMB 4BJMA 2XHEB 4H9PC 3N9NA 1E7PA 4B3ST 2LOSA 2VKDA 3MJXA 4G2AA 5L47A 5FVLA 2CA5A 4AKHA 5JTGA 2XUEA 4QH1A 4B6XA 4YY3T 3I0OA 5JDHA 2CXLA 3O1IA 2LOPA 3NRYA 3RPUA 3VKHA 4YFSA 4JI3T 3RIAA 4U3CA 2AE9A 4A5XA 2XPKA 1W9RA 3DP7A 1KF6A 2BDEA 1YQ3A 1KEYA 4IL4A 2XSAA 3F31A 5AQSB 2QVAA 3ZPOA 2JMKA 2CCQA 4PJMA 3RIUC 3ZN0B 1UUSA 2XQYA 3JADA 1SE7A 2V1DB 4DV5T 5HWYA 5JVDE 3UUBA 1OXZA 2DNXA 4I4TE 3ONJA 4KP3C 1O3XA 5J2UE 2E9XC 4U7YA 5L2LA 5FY7A 4IGUA 4LMLA 3H3AA 4ZOLE 3SFEA 1FIOA 4JUYA 2WU5A 3HI2A 2NR4A 2HPJA 4TWFA 2D0UA 4O4IE 1Y01A 1HG5A 4QXCB 4H9OC 2A3DA 3TLWA 1FMWA 1US7B 2VQET 2R6GF 4F6RC 4Z90A 3Q5WA 4IE5A 2KMFA 4EZ4A 2X67A 3O1HA 5AQVB 2YDSA 4TN7B 2F4VT 1HNXT 4DV1T 3ZMTB 2LRLA 2V7MA 3KBTA 4ILBA 3HKDE 2K48A 5JDQA 3AA1B 1B7TA 2V6YA 4IT4A 2NP9A 5HEJA 3C98B 2CEAA 5DJQC 3ETVA 3PUWF 2IIUA 3B57A 5AQIB 2W66A 4DIDB 3N9OA 5JRCB 2HN1A 3AE2A 5HCJA 2QRXA 3LBXA 2J62A 1XWMA 2KWHA 3CPZA 4EEDA 1OEDE 3G06A 1T8BA 2K24A 3AEEA 4UVCB 5AQQB 3HL6A 4CQIA 3BQKA 5JDMA 4J2CA 3ZSTA 2L8KA 3K8PC 4WW0A 2WDRA 2XQ5A 4UF0B 4CI1B 5LOVE 3QB5K 4DR5T 4OYJA 2M67A 4P1NA 2CPTA 2OV9A 3C51A 3ZN1B 4ASKA 5LGUB 1OEDB 3WAKA 5KDMC 4DUYT 2V7IA 4HE8A 5HEGA 2G0UA 3RQUA 4X66T 3T1HT 4HGAA 4UIGA 1HCIA 4AIUA 4ZS3A 1S35A 2BBHA 3IA3A 2MOZA 5AQNB 2FJAA 2X0HA 4DR6T 1OWAA 1H7CA 4DNDA 3PUYF 3MACA 4JI0T 4ZI7E 2ZM0A 2KLQA 3S4UA 2PBIA 2LKGA 5CJ5A 4PNIA 3O1JA 4EV6A 1D0YA 4UELA 2YKSA 4YJ2E 5KX5E 1T72A 2XSBA 3EUHA 5JDLA 3RI5A 4GYSA 4IDZA 3LSVA 2H7VC 3UFGA 3ZMSB 5J2TE 1D0XA 1SHZC 5HEOA 2JQKA 4PK4A 4IREA 2WWVA 1AJ3A 3UQ7A 4HFVA 4P0AA 1IBLT 1R8IA 2WP9A 2BVMA 1HFAA 2CMRA 4X5TA 3RQWA 3A8YC 4CXWA 3EHZA 4HKAA 4NIQA 2XAFB 5FXVA 3A7MA 2Y8DA 1ZP0A 2IDOB 2CM0A 3ZC0A 2WB5A 3AVSA 2PFVA 3VHLA 2I6HA 2Q9QD 2IC6A 2JQQA 3MK7C 5FXWA 2LJLA 1HG2A 3MZKB 1NWMX 2Z6EA 2LKHA 4JI8T 4LF5T 1KK7A 2EHOA 2XAQB 3P8CD 2MPKA 3K3OA 5JH7E 3AXJA 3L39A 4PAGA 1IBMT 3VR9A 4GOUA 4ZEYA 2PG8A 2A9UA 5J1GA 1D1BA 5AQFB 4A56A 2DI4A 2NWBA 5ABGA 5AQLB 2V5CA 2WMNA 3PJAJ 3F57A 3RYCE 3RRCA 5FXXA 5JDFA 2V26A 2JPFA 2BKPA 5BR8T 5HXEA 4COFA 4NXNT 2LSJA 4OHFA 2XAHB 2L9QA 2BS2A 2BVLA 5AFUL 4AQFA 1D1AA 5JR9A 2BG9C 3JC6C 3AVRA 5AQKB 2WS3A 4MALA 3N9QA 2WU2A 2PJQA 4IL9A 5H6QB 3V5SA 2ACXA 1WYCA 3FBZA 4UV9B 2X9HA 5LCYA 3P4RA 1NENA 5GONE 4YJ3E 3SOLA 2CBIA 5EZYE 1KNPA 4DV4T 5FYMA 2QA7A 3QNUA 5LB7B 2FJDA 2C5JA 2JRKA 3SFDA 1N33T 2L3LA 3HKCE 2X9WA 4E7SA 2X51A 5LGTB 3R84B 5E0OA 1OEDC 4JI6T 2NTYA 3AE5A 3C4XA 1M62A 3UFEA 2FUPA 2AXDS 1WRDA 2XJ7A 4HWFA 4MHCA 5JREA 2I0MA 4MBQA 2FJEA 4PJNA 2WQYA 1J1JA 1YXRA 3FXDB 3H37A 3AE3A 3ETUA 4UV8B 3FB2A 4X1KE 3AEAA 1MMNA 2YU2A 4ZI3C 2V6YB 2ZM6T 3ZMZB 2DCFA 3M3ZB 4TNVA 1U4QA 4AXPA 2QGSA 1WR0A 1XZYA 2WY2A 4IIJE 3CX6B 3FXEB 2M6BA 4PFPA 3PV0F 1IAPA 3LBXB 3UUMA 3NZPA 4YHHT 3UUXB 3ZYKA 1J5ET 3RIFA 2WDQA 4X1YE 3AEBA 3AA0B 3EDVA 2J47A 5LGNB 2W63A 3ZYMA 1HNWT 4U2ZA 1HTJF 3HKEE 4C90A 4DR2T 5HXRA 4JBWF 1XDPA 3RIUA 1N36T 4NUUA 3KV5A 3AECA 4PJJA 4AQYT 4WNKA 2E9XD 2D5UA 4H9SE 1JNRA 3ZCIA 2XQ7A 3LK2B 4HWCA 3AAEB 2IAKA 2V7LA 2XQ8A 4EYYR 4H9QC 5KXJA 3LFMA 2E9XA 4AISA 4XAXB 2GK9A 3PUQA 4TX5A 2LM9A 1L0VA 1XMQT 4JI7T 1ZOYA 1E1HB 3OPCA 5CB4E 4O4JE 3LK3B 3AE1A 3KV6A 2E5VA 3UULA 1HX1B 2IMLA 4X1IE 2BKNA 2VK9A 3CX8B 3KINB 4IE0A 4GKKT 2LSYA 3Q5DA 2IHR1 1NEKA 4QX8B 3R6NA 2XQ3A 1BR0A 2P9BA 5C8YE 4FI5A 4UVAB 3QUJA 4K0KT 4PK5A 2MAWA 4Q25A 3CMLA 4GK0E 2BG9E 4CN1A 4AQGA 4O2AE 4DR7T 4QH5A 4IE6A 2LSIA 3ABVA 2W67A 3TLTA 3C4WA 1IJ6A 3LG7A 5LHHB 3I0QA 3P4QA 4H63V 5LMNT 2H88A 4UVBB 2JJ9A 2WM9A 2BG9B 3AXJB 2E2AA 1FJGT 5IWAT 1UGOA 2XQ4A 5ABHA 4EYUA 2KWIB 3PDYA 1XNRT 4PJLA 2WZIA 4OK0A 5CFBA 3L8RA 3GN5A 2X0LB 3ZJ1A 4TWDA 3SS1A 1I6ZA 3UQ4A 3DTOA 5EK3A 2WMOA 3RYHE 3CQXC 1XNQT 3JAEA 4F8HA 5CGMA 4ILUA 5IHYA 3TKLB 4DV3T 2VL0A 5JR9B 1CUNA 4OYKA 5L4EA 5LHGB 5IUXA 5TAOA 4DV2T 3X1DA 3IHRA 4O4LE 3C50A 3AE4A 2LLYA 1VCTA 2WCAA 2XQ9A 4ILAA 3Q5EA 4K0UA 1SUMB 1HS7A 4YT0A 3AE6A 3GMIA 3ANWA 2OLTA 2UU9T 4ADZA 2W61A 2BS3A 2VVNA 2VASA 3HKBE 4X64T 4LFBT 4YSXA 2UXCT 3VR8A 4QKNA 5F8PA 3KV4A 4NPPA 3NZQA 3T8OA 3PTRB 1EZ3A 4HEAA 3RYIE 3AE8A 4QH4A 4ZS2A 4NXMT 2XAJB 4YSZA 3KV9A 1KNRA 4JI2T 4GKJT 2ODVA 4DO0A 1D0ZA 3B5MA 3RX6A 3MA9A 2VQFT 4ZHQE 2UXXB 4QHOA 2LHRA 3O4XE 1Z0PA 5LJMA 3UU4A 2LE8A 5HXCA 3N9PA 4JYAT 5L3EB 1I94T 2HN2A 5LG4A 5FL1A 5JDGA 1BR2A 3DJBA 3RKGA 1N34T 4EXTA 2VKOA 3RC8A 2B76A 3RLFF 4LF9T 2JIWA 3ZMVB 2RA1A 3FZFB 4DMWA 3C64A 2XQAA 4WBNE 3ZYLA 2V5DA 4ANJA 1ZHCA 3BK9A 2WWUA 5LBMA 4TV8E 3WI3A 4DBRA 2IC9A 2CWOA 1VCSA 1SA0E 3PUXF 4ZI2C 2Q9QA 3Q9DA 3JC6D 2J1DG 3GWHA 3D0TA 5HXHA 5HYAA 2LM2A 3H3MA 3I9WA 2Y6XA 3N5LA 4HFCA 5AQJB 3PUZF 1FEWA 3KVBA 4AKRB 4X65T 1M7KA 4MFRA 3J7Yq 3JCFA 2YU1A 3LK42 1UCUA 3A5XA 3FBLA 4AI6A 4HFIA 2V6XA 2DL1A 3EDUA 1WLXA 3KDSE 1MIVA 3LDQB 3NBXX 1MNEA 5L3CB 1MIWA 2EHOC 4H9NC 2ZMAA 3TLVA 4DUZT 3QOFA 4JEUB 1YKHB 1VOMA 5AQUB 4DR1T 4WZXA 2LSKA 4GYRA 2ES0A 2H3RA 5LP6E 4PK6A 3FZMB 2KNDA 1WR6A 3HR0A 5FY1A 5LA6E 3TLSA 3PUGA 4ZZBA 5DQVA 2NW7A 2DLRA 2MBGA 2WAUA 3N2OA 4L5GA 2LHNA 4JLEA 1IJ5A 4I43B 1QUUA 4ERRA 4NUVA 4B3RT 3KFWX 3K3QC 2H7OA 4MLKA 4B3MT 4AQFC 5JR9C 4LFAT 3EVYA 3EABA 2YEVC 5J0ZA 2WZHA 5ADXL 4AKIA 3PJAA 4ZI3D 3NWIA 4DMVA 2YDQA 3RHWA 2VB6A 1UURA 3AA7B 2HH7A 4LF8T 3CX7B 2YK0A 4WBOA 2SPCA 4IDOA 1U5PA 2YOEA 5FMNA 3CQGB 2W62A 4AKGA 5BMVE 3KBUA 4HWDA 4BAYB 3OKQA 3FZHB 2E5LT 4GK5E 4L9IA 5A1LA 3PU3A 1NAFA 4I0UA 5HEUA 5M4YA 2XM2A 4UEMA 5C3JA 1YD8G 4PW8A 3KVAA 4H9RC 3CIRA 2NW9A 3NVOA 3ZEFB 4EOZB 4BA9A 2CXFA 2VKJA 3W15B 3OJAA 3AB3B 3PUSA 4U72A 3SRZA 1KFYA 4Z8XA 4YSYA 5LHIB 3ZMUB 2NOXA 2MYSA 2CLYB 2X0YA 3P4PA 3ONLC 5FY0A 3UU8A 3E08A 3E22E 2ZM8A 2N1GA 3N9MA 2UXBT 3MKDA 4JV5T 1T98A 3QC9A 4DR3T 5H6RB 3NKZA 3N2KE 5F3JA 5EK4A 2C5KT 1W0AA 2KINB 5L3FB 5DQWA 1IZNB 3V5UA 3PE0A 3ZT5A 4X20E 3IF8B 3AEFA 4JI4T 3EAMA 5ABFA 3I1AA 2XQ6A 1LVKA 2W4XA 4A97A 2N2NA 1HNZT 3ANWB 2YN6A 2C0SA 3PUAA 3ESLA 2V8SV 2CBJA 3P7IA 5FNVE 3RC3A 4ZXLA 3MXZA 4HN9A 4E7ZA 5JQGE 3NRXA 4U74A 2PTFA 4QWNB 3AEGA 4TZ4C 1S94A 2CWYA 3RF1A 2D0TA 2E8IA 4U31A 3CVRA 2KZ7B 2RP4A 4HFDA 4N78D 3QB5A 3AEDA 4YLHA 2UUAT 4DR4T 4LMKA 4KX6A 2W00A 4CN6A 1X9BA 2ZM2A 4DVDA 4ZZCA 4XZCA 3PU8A 3AAIA 2CE7A 2KXPB 3JAFA 4CN4A 5L3GB 5AQGB 4TV9E 4BJNA 3FZLB 2JQ9A 1XMOT 4EZHA 4TWHA 4LF6T 3N2GE 1UX5A 3P4WA 2V7KA 4I50E 1KNZA 4QXBB 4YTPA 4HFBA 5L4HA 1LVFA 1WFDA 3BQIA 3K1SA 4ILCA 4I55E 4KUMB 3ZC1A 2EHOB 2WSSV 1BR1A 2LEHA 4UXNB 2WBLA 2Q9QB 2K5BB 4KHZF 2BZBA 1Z8UA 4U33A 2MTQA 5HCMA 3ZSSA 1J5WA 4V1Av 1D1CA 2A2FX 4JI5T 1G73A 2V7JA 3C4ZA 2DWKA 1MIYA 4M1PA 1CHUA 1MMDA 5KMGP 3EI0A 3FHNA 2W0GA 4O8SA 5AQTB 2KSRA 2ZLYA 2LSGA 4GIWA 2HHHT 3QK6A 3UU3A 1ZEEA 5AQOB 5LBQB 4OFZA 3J9X1 4TNWA 3AE7A 2CLYC 1UX4A 3VRBA 2NW8A 3CQCB 3ZKRA 3ZJ2A 1ZV4X 2OA5A 4HTEA 2C5IT 5LMUT 1N32T 4X62T 1YW0A 1VRBA 2K3WA 1WCRA 3RH3A 3UUNA 3F2EA 3M65A 3OYXA 3IEEA 4LF4T 5ETWA 5C2TA 4CZZB 4KMCA 3UU5A 2KT9A 3P4SA 4CI3B 1MMAA 5CA1E 3OTOT 1YQ4A 3B13A 2ODUA 3AA6B 3CWZB 4HFHA 2N9DA 5HEHA 3K3NA 2UUCT 4CI2B 2VL8A 3Q5XA 4L0RA 4WYVA 5CA0E 3AAAB 3SWHA 4U2YA 2JQHA 4ZI2D 2XTLA 1QLBA 1UK5A 2FJBA 4HWHA 1W09A 2VVSA 4YXDA 1BR4A 5JDNA 3GA8A 1JNZA 3ZCJA 1MMGA 4B3TT 3ZT6A 4H63H 2Y48B 4U7IA 4Z91A 3RYFE 4IDQA 4KI0F 4YTNA 5ABEA 4YTMA 1WYBA 3TLUA 1LKXA 3Q2MA 4A98A 1HX8A 4EB6E 3PUVF 5EK2A 1T7SA 2A72A 2EHOD 2J4GA 1LRZA 2XY8B 4EAHA 3U3IA
chains in the Genus database with same CATH topology
1E1HB 5DABA 5BMVE 3KBUA 4BAYB 5CB4E 3RKOA 3OYZA 4O4JE 3C51A 3LK3B 3OKQA 5IYZE 2UXNB 4FJOA 3ZN1B 4GK5E 4L9IA 3KV6A 5A1LA 3PU3A 2K9AA 3UULA 3RRWA 4ASKA 1NAFA 4X1IE 5LGUB 2VK9A 3CX8B 4UEMA 5M4YA 3WAKA 1G8XA 3IBPA 3KINB 4IE0A 1YD8G 5KDMC 4PW8A 2NTXA 3KVAA 5LNKA 2V7IA 4HE8A 3WAJA 2LSYA 2G0UA 4H9RC 2NW9A 3L3PA 5JRCA 3ZEFB 4EOZB 4BA9A 4QX8B 3R6NA 4HGAA 4UIGA 1HCIA 2CXFA 2VKJA 3W15B 3OJAA 2P9BA 1BR0A 3AB3B 3PUSA 4ZS3A 1S35A 4U72A 3SRZA 5LYJE 4Z8XA 2MOZA 3VU7H 5C8YE 4FI5A 4UVAB 3L09A 3QUJA 1OWAA 4PK5A 5LHIB 1H7CA 4DNDA 3ZMUB 3MACA 2Q9QC 4ZI7E 2ZM0A 2KLQA 2NOXA 2D2SA 2MYSA 2CLYB 5L3BB 3CMLA 4GK0E 3S4UA 2PBIA 2X9XA 4UF0A 2XASB 5FY0A 2E9XB 3E08A 4AQGA 3O9XA 3E22E 2ZM8A 4O4HE 4O2AE 2N1GA 4XBFB 4O2BE 4PNIA 3O1JA 4IE6A 3N9MA 5HXSA 2LSIA 1D0YA 3MKDA 1YKEB 4UELA 4IE4A 4YJ2E 2LT3A 1T98A 3OBVE 4YHJA 1QSDA 5KX5E 3QC9A 4AKLA 3EUHA 3C4WA 1IJ6A 3LG7A 5H6RB 2X9YA 3I0QA 4IE7A 5LHHB 5JDLA 4GYSA 4IDZA 3N2KE 5F3JA 4H63V 2H7VC 5EK4A 3UT5E 2B1EA 2C5KT 2KINB 5L3FB 2VKHA 4JEHB 3ZMSB 5J2TE 1D0XA 1SHZC 5DQWA 5L3DB 1IZNB 3V5UA 4UVBB 2JJ9A 2YINA 4PK4A 2WM9A 1AJ3A 3PE0A 4HFVA 4P0AA 2VWAA 4EYUA 4X20E 3IF8B 2KWIB 3ONXA 5HWXA 4P0BA 3I1AA 3PDYA 5LXTE 1LVKA 2BVMA 4PJLA 3ZLIA 5LJNA 1HFAA 2CMRA 1Y64B 4OK0A 3GN5A 2X0LB 2N2NA 4CXWA 4CXYA 3ANWB 4HKAA 2C0SA 3ZJ1A 1MNDA 3LJCA 3PUAA 3ESLA 2XAFB 5FXVA 3SS1A 4IHJE 2Y8DA 3P7IA 4P09A 5FNVE 2CXDA 3DTOA 3RC3A 5EK3A 3MXZA 2X68A 3I9YA 4HN9A 4E7ZA 5JQGE 2WMOA 3NRXA 3RYHE 2CM0A 4ISTA 4U74A 3ZC0A 4QWNB 3AVSA 3CQXC 4G63A 4TZ4C 4ILUA 2PFVA 1S94A 2IW5B 5IHYA 3VHLA 3TKLB 2CWYA 2Q9QD 3N9LA 2IC6A 2JQQA 3MK7C 2D0TA 5FXWA 2LJLA 2E8IA 4AKGA 3VKGA 1HG2A 3MZKB 4QXHB 3CKDA 1NWMX 5JR9B 2Z6EA 1CUNA 4OYKA 4PFOA 5HAXA 3CVRA 2KZ7B 4TUYE 4CXXA 5LHGB 1KK7A 2EHOA 2XAQB 2RP4A 3P8CD 3K3OA 5TAOA 4N78D 1X79A 5JH7E 3IHRA 3BQLA 4O4LE 4DBQA 3C50A 4PAGA 4YLHA 5FP3A 4GOUA 2HPLA 4K0UA 2W00A 2PG8A 5J1GA 1D1BA 2ZM2A 4DVDA 1HS7A 2XAGB 4ISSA 3GMIA 4XZCA 4A56A 2DI4A 2NWBA 3ANWA 3PU8A 4ADZA 2W61A 2WMNA 1V9DA 3AAIA 2DHRA 2CE7A 3F57A 2VASA 3RYCE 3RRCA 4C91A 3HKBE 1FMVA 2KXPB 3UTKA 5FXXA 5JDFA 2V26A 1ZKEA 5L3GB 4TV9E 2JPFA 4QKNA 3GN5B 5F8PA 2JMHA 5HXEA 3KV4A 4BJNA 3E0ZA 3HA4A 3NZQA 2LSJA 5FXZA 4OHFA 2XAHB 2L9QA 3PURA 3T8OA 2X66A 3PTRB 4QX7B 1EZ3A 2BVLA 2I59A 4HEAA 3RYIE 5AFUL 4EZHA 4AQFA 1D1AA 4ZS2A 3N2GE 5JR9A 1UX5A 2XAJB 2V7KA 3KV9A 4I50E 1KNZA 2ODVA 4DO0A 3JC6C 3AVRA 1D0ZA 3U78A 4QXBB 4MALA 2DWGA 3RX6A 4EIWA 3MA9A 3N9QA 1LVFA 1HF8A 2PJQA 3BQIA 4ZHQE 4KBMB 4BJMA 2UXXB 2XHEB 5H6QB 4QHOA 3V5SA 2ACXA 1WYCA 2LHRA 4I55E 3FBZA 3O4XE 4UV9B 2X9HA 4H9PC 1Z0PA 5LCYA 5LJMA 3N9NA 4KUMB 3ZC1A 2EHOB 2LE8A 2WSSV 1BR1A 2LEHA 5GONE 4YJ3E 2LOSA 4UXNB 2WBLA 5HXCA 3SOLA 2VKDA 2Q9QB 3N9PA 5EZYE 3MJXA 5L3EB 4G2AA 2K5BB 2BZBA 5FYMA 2QA7A 5JDGA 5LG4A 2CA5A 4AKHA 2MTQA 2XUEA 4B6XA 1BR2A 3DJBA 2C5JA 2JRKA 4EXTA 3I0OA 2L3LA 4V1Av 3HKCE 2VKOA 5JDHA 2CXLA 3RC8A 2X9WA 1D1CA 2A2FX 3O1IA 2LOPA 3NRYA 3RPUA 1G73A 4E7SA 3VKHA 2V7JA 2X51A 4YFSA 3ZMVB 5LGTB 3C4ZA 2DWKA 2RA1A 1MIYA 4M1PA 1MMDA 4DMWA 3DP7A 3R84B 2BDEA 5E0OA 3C64A 5KMGP 2NTYA 4WBNE 3FHNA 3C4XA 3ZYLA 2W0GA 4O8SA 3UFEA 3F31A 4ANJA 2ZLYA 1ZHCA 3BK9A 3ZPOA 2JMKA 1WRDA 2WWUA 2LSGA 5LBMA 2CCQA 4GIWA 4PJMA 4TV8E 3QK6A 3ZN0B 3WI3A 4DBRA 2IC9A 2CWOA 2XQYA 4MHCA 2V1DB 1ZEEA 1SA0E 5JREA 4ZI2C 5HWYA 2Q9QA 4MBQA 5JVDE 1OXZA 4PJNA 2DNXA 3Q9DA 5LBQB 3JC6D 4OFZA 4I4TE 2J1DG 3J9X1 3FXDB 3H37A 3GWHA 3D0TA 2CLYC 5HXHA 5HYAA 1UX4A 3ETUA 4KP3C 3I9WA 2Y6XA 3N5LA 4UV8B 1O3XA 2NW8A 5J2UE 2E9XC 3CQCB 3FB2A 4X1KE 1FEWA 3KVBA 4AKRB 3ZJ2A 1MMNA 2YU2A 4IGUA 5FY7A 4ZI3C 4MFRA 5L2LA 3J7Yq 2YU1A 3LK42 3H3AA 1ZV4X 4ZOLE 3ZMZB 2DCFA 2OA5A 1FIOA 1UCUA 3A5XA 3FBLA 4HTEA 4JUYA 2C5IT 1U4QA 3HI2A 4AI6A 4AXPA 2HPJA 2QGSA 2D0UA 4O4IE 1YW0A 3EDUA 1HG5A 1VRBA 1WLXA 3KDSE 1MIVA 4QXCB 4IIJE 3RH3A 4H9OC 3UUNA 3NBXX 2A3DA 3CX6B 3F2EA 1FMWA 1US7B 3FXEB 1MNEA 4F6RC 5L3CB 1MIWA 3M65A 3OYXA 2EHOC 4H9NC 3IEEA 2ZMAA 4PFPA 5ETWA 3Q5WA 1IAPA 3LBXB 3UUMA 3NZPA 4JEUB 4CZZB 1YKHB 4IE5A 4KMCA 2KT9A 1VOMA 2KMFA 4EZ4A 4CI3B 2X67A 3O1HA 3UUXB 1MMAA 4TN7B 5CA1E 2LSKA 3B13A 2ODUA 4GYRA 3ZMTB 3ZYKA 3AA6B 2V7MA 3CWZB 2ES0A 2N9DA 2H3RA 5LP6E 4PK6A 3KBTA 4X1YE 3K3NA 2KNDA 3AA0B 1WR6A 3EDVA 4CI2B 2VL8A 3HKDE 5LGNB 2W63A 2K48A 3HR0A 5JDQA 3Q5XA 4L0RA 5FY1A 3AA1B 1B7TA 3ZYMA 5LA6E 5CA0E 3AAAB 3SWHA 3PUGA 1HTJF 3HKEE 4C90A 5DQVA 2NW7A 2DLRA 2MBGA 4ZI2D 2WAUA 5HXRA 2NP9A 3N2OA 2XTLA 4L5GA 2LHNA 3C98B 4JLEA 2CEAA 4NUUA 5DJQC 1IJ5A 3ETVA 1QUUA 3KV5A 4I43B 4ERRA 4NUVA 3KFWX 1BR4A 4PJJA 3K3QC 2H7OA 4MLKA 3B57A 4AQFC 5JDNA 3GA8A 4WNKA 5JR9C 3ZCJA 2E9XD 2D5UA 1MMGA 3EVYA 4H9SE 2YEVC 3N9OA 3ZCIA 5ADXL 4AKIA 3LK2B 5JRCB 4H63H 2Y48B 4ZI3D 3RYFE 4DMVA 3AAEB 3LBXA 2IAKA 2V7LA 4EYYR 4H9QC 2VB6A 2KWHA 1WYBA 3CPZA 3AA7B 1LKXA 2HH7A 2K24A 3LFMA 3Q2MA 2E9XA 4XAXB 1HX8A 4UVCB 4EB6E 3CX7B 2YK0A 2GK9A 3PUQA 4TX5A 2LM9A 3HL6A 4CQIA 3BQKA 5JDMA 4J2CA 4WBOA 2SPCA 2L8KA 1U5PA 5EK2A 3K8PC 2A72A 5FMNA 2EHOD 3CQGB 4WW0A 4UF0B 1LRZA 4CI1B 5LOVE 2W62A 4EAHA 4OYJA 3U3IA 2M67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9N C;  4H9O C;  4HGA A;  4H9S E;  4H9R C;  4H9P C;  4H9Q C;  5KDM C; 
#chains in the Genus database with same CATH topology
 3T1Y T;  5DAB A;  3RKO A;  3OYZ A;  5IYZ E;  2UXN B;  4FJO A;  4JI1 T;  2M6I A;  2K9A A;  3RRW A;  2BG9 A;  5AQP B;  2XM1 A;  1G8X A;  3IBP A;  2NTX A;  5LNK A;  3WAJ A;  3L3P A;  5JRC A;  4LFC T;  4IDP A;  2RPA A;  4HFE A;  5LYJ E;  4KHP T;  3VU7 H;  3L09 A;  2FBW A;  5FKY A;  4HWI B;  5ABF B;  4UR9 A;  2Q9Q C;  2D2S A;  5L3B B;  2X9X A;  4UF0 A;  2XAS B;  3CK6 A;  2E9X B;  1DU2 A;  3O9X A;  4O4H E;  4XBF B;  4O2B E;  5HXS A;  1IBK T;  1YKE B;  2VUR A;  4IE4 A;  2LT3 A;  2BKO A;  3OBV E;  4YHJ A;  1QSD A;  2BBJ A;  4AKL A;  3FZK B;  1OED A;  3UU6 A;  2X9Y A;  4IE7 A;  3OVU A;  4DV0 T;  3UT5 E;  2B1E A;  2VKH A;  4JEH B;  5L3D B;  2CRB A;  2YIN A;  2ACZ A;  2CHO A;  2VWA A;  2W2U A;  3ONX A;  5HWX A;  4P0B A;  5LXT E;  3ZLI A;  5LJN A;  1Y64 B;  4LF7 T;  4CXY A;  2UUB T;  1MND A;  3LJC A;  4IHJ E;  1E2A A;  2QYW A;  4P09 A;  2CXD A;  2X68 A;  3I9Y A;  4IST A;  4G63 A;  2IW5 B;  3N9L A;  2D9D A;  2UXD T;  2BS4 A;  1XDO A;  3VKG A;  5F5W A;  4QXH B;  3CKD A;  5HAX A;  4PFO A;  4TUY E;  4CXX A;  5AQM B;  1X79 A;  2XZE A;  3AE9 A;  1GQE A;  4LMJ A;  3BQL A;  4DBQ A;  4EGW A;  5FP3 A;  2WDV A;  2LRK A;  2HPL A;  4EEB A;  2H89 A;  2XAG B;  1W0B A;  4ISS A;  4DV7 T;  5AQH B;  3P50 A;  2YDR A;  1V9D A;  2DHR A;  2CHN A;  4C91 A;  1FMV A;  3UTK A;  1ZKE A;  5LG3 A;  5FVK A;  3ZT7 A;  3GN5 B;  2JMH A;  2IUB A;  3E0Z A;  3HA4 A;  5FXZ A;  3PUR A;  2X66 A;  4QX7 B;  4OX9 T;  3RGL A;  5FL0 A;  2I59 A;  4IDN A;  3VRA A;  3U78 A;  5AQR B;  1HR0 T;  2DWG A;  4EIW A;  4DV6 T;  1HF8 A;  4KBM B;  4BJM A;  2XHE B;  4H9P C;  3N9N A;  1E7P A;  4B3S T;  2LOS A;  2VKD A;  3MJX A;  4G2A A;  5L47 A;  5FVL A;  2CA5 A;  4AKH A;  5JTG A;  2XUE A;  4QH1 A;  4B6X A;  4YY3 T;  3I0O A;  5JDH A;  2CXL A;  3O1I A;  2LOP A;  3NRY A;  3RPU A;  3VKH A;  4YFS A;  4JI3 T;  3RIA A;  4U3C A;  2AE9 A;  4A5X A;  2XPK A;  1W9R A;  3DP7 A;  1KF6 A;  2BDE A;  1YQ3 A;  1KEY A;  4IL4 A;  2XSA A;  3F31 A;  5AQS B;  2QVA A;  3ZPO A;  2JMK A;  2CCQ A;  4PJM A;  3RIU C;  3ZN0 B;  1UUS A;  2XQY A;  3JAD A;  1SE7 A;  2V1D B;  4DV5 T;  5HWY A;  5JVD E;  3UUB A;  1OXZ A;  2DNX A;  4I4T E;  3ONJ A;  4KP3 C;  1O3X A;  5J2U E;  2E9X C;  4U7Y A;  5L2L A;  5FY7 A;  4IGU A;  4LML A;  3H3A A;  4ZOL E;  3SFE A;  1FIO A;  4JUY A;  2WU5 A;  3HI2 A;  2NR4 A;  2HPJ A;  4TWF A;  2D0U A;  4O4I E;  1Y01 A;  1HG5 A;  4QXC B;  4H9O C;  2A3D A;  3TLW A;  1FMW A;  1US7 B;  2VQE T;  2R6G F;  4F6R C;  4Z90 A;  3Q5W A;  4IE5 A;  2KMF A;  4EZ4 A;  2X67 A;  3O1H A;  5AQV B;  2YDS A;  4TN7 B;  2F4V T;  1HNX T;  4DV1 T;  3ZMT B;  2LRL A;  2V7M A;  3KBT A;  4ILB A;  3HKD E;  2K48 A;  5JDQ A;  3AA1 B;  1B7T A;  2V6Y A;  4IT4 A;  2NP9 A;  5HEJ A;  3C98 B;  2CEA A;  5DJQ C;  3ETV A;  3PUW F;  2IIU A;  3B57 A;  5AQI B;  2W66 A;  4DID B;  3N9O A;  5JRC B;  2HN1 A;  3AE2 A;  5HCJ A;  2QRX A;  3LBX A;  2J62 A;  1XWM A;  2KWH A;  3CPZ A;  4EED A;  1OED E;  3G06 A;  1T8B A;  2K24 A;  3AEE A;  4UVC B;  5AQQ B;  3HL6 A;  4CQI A;  3BQK A;  5JDM A;  4J2C A;  3ZST A;  2L8K A;  3K8P C;  4WW0 A;  2WDR A;  2XQ5 A;  4UF0 B;  4CI1 B;  5LOV E;  3QB5 K;  4DR5 T;  4OYJ A;  2M67 A;  4P1N A;  2CPT A;  2OV9 A;  3C51 A;  3ZN1 B;  4ASK A;  5LGU B;  1OED B;  3WAK A;  5KDM C;  4DUY T;  2V7I A;  4HE8 A;  5HEG A;  2G0U A;  3RQU A;  4X66 T;  3T1H T;  4HGA A;  4UIG A;  1HCI A;  4AIU A;  4ZS3 A;  1S35 A;  2BBH A;  3IA3 A;  2MOZ A;  5AQN B;  2FJA A;  2X0H A;  4DR6 T;  1OWA A;  1H7C A;  4DND A;  3PUY F;  3MAC A;  4JI0 T;  4ZI7 E;  2ZM0 A;  2KLQ A;  3S4U A;  2PBI A;  2LKG A;  5CJ5 A;  4PNI A;  3O1J A;  4EV6 A;  1D0Y A;  4UEL A;  2YKS A;  4YJ2 E;  5KX5 E;  1T72 A;  2XSB A;  3EUH A;  5JDL A;  3RI5 A;  4GYS A;  4IDZ A;  3LSV A;  2H7V C;  3UFG A;  3ZMS B;  5J2T E;  1D0X A;  1SHZ C;  5HEO A;  2JQK A;  4PK4 A;  4IRE A;  2WWV A;  1AJ3 A;  3UQ7 A;  4HFV A;  4P0A A;  1IBL T;  1R8I A;  2WP9 A;  2BVM A;  1HFA A;  2CMR A;  4X5T A;  3RQW A;  3A8Y C;  4CXW A;  3EHZ A;  4HKA A;  4NIQ A;  2XAF B;  5FXV A;  3A7M A;  2Y8D A;  1ZP0 A;  2IDO B;  2CM0 A;  3ZC0 A;  2WB5 A;  3AVS A;  2PFV A;  3VHL A;  2I6H A;  2Q9Q D;  2IC6 A;  2JQQ A;  3MK7 C;  5FXW A;  2LJL A;  1HG2 A;  3MZK B;  1NWM X;  2Z6E A;  2LKH A;  4JI8 T;  4LF5 T;  1KK7 A;  2EHO A;  2XAQ B;  3P8C D;  2MPK A;  3K3O A;  5JH7 E;  3AXJ A;  3L39 A;  4PAG A;  1IBM T;  3VR9 A;  4GOU A;  4ZEY A;  2PG8 A;  2A9U A;  5J1G A;  1D1B A;  5AQF B;  4A56 A;  2DI4 A;  2NWB A;  5ABG A;  5AQL B;  2V5C A;  2WMN A;  3PJA J;  3F57 A;  3RYC E;  3RRC A;  5FXX A;  5JDF A;  2V26 A;  2JPF A;  2BKP A;  5BR8 T;  5HXE A;  4COF A;  4NXN T;  2LSJ A;  4OHF A;  2XAH B;  2L9Q A;  2BS2 A;  2BVL A;  5AFU L;  4AQF A;  1D1A A;  5JR9 A;  2BG9 C;  3JC6 C;  3AVR A;  5AQK B;  2WS3 A;  4MAL A;  3N9Q A;  2WU2 A;  2PJQ A;  4IL9 A;  5H6Q B;  3V5S A;  2ACX A;  1WYC A;  3FBZ A;  4UV9 B;  2X9H A;  5LCY A;  3P4R A;  1NEN A;  5GON E;  4YJ3 E;  3SOL A;  2CBI A;  5EZY E;  1KNP A;  4DV4 T;  5FYM A;  2QA7 A;  3QNU A;  5LB7 B;  2FJD A;  2C5J A;  2JRK A;  3SFD A;  1N33 T;  2L3L A;  3HKC E;  2X9W A;  4E7S A;  2X51 A;  5LGT B;  3R84 B;  5E0O A;  1OED C;  4JI6 T;  2NTY A;  3AE5 A;  3C4X A;  1M62 A;  3UFE A;  2FUP A;  2AXD S;  1WRD A;  2XJ7 A;  4HWF A;  4MHC A;  5JRE A;  2I0M A;  4MBQ A;  2FJE A;  4PJN A;  2WQY A;  1J1J A;  1YXR A;  3FXD B;  3H37 A;  3AE3 A;  3ETU A;  4UV8 B;  3FB2 A;  4X1K E;  3AEA A;  1MMN A;  2YU2 A;  4ZI3 C;  2V6Y B;  2ZM6 T;  3ZMZ B;  2DCF A;  3M3Z B;  4TNV A;  1U4Q A;  4AXP A;  2QGS A;  1WR0 A;  1XZY A;  2WY2 A;  4IIJ E;  3CX6 B;  3FXE B;  2M6B A;  4PFP A;  3PV0 F;  1IAP A;  3LBX B;  3UUM A;  3NZP A;  4YHH T;  3UUX B;  3ZYK A;  1J5E T;  3RIF A;  2WDQ A;  4X1Y E;  3AEB A;  3AA0 B;  3EDV A;  2J47 A;  5LGN B;  2W63 A;  3ZYM A;  1HNW T;  4U2Z A;  1HTJ F;  3HKE E;  4C90 A;  4DR2 T;  5HXR A;  4JBW F;  1XDP A;  3RIU A;  1N36 T;  4NUU A;  3KV5 A;  3AEC A;  4PJJ A;  4AQY T;  4WNK A;  2E9X D;  2D5U A;  4H9S E;  1JNR A;  3ZCI A;  2XQ7 A;  3LK2 B;  4HWC A;  3AAE B;  2IAK A;  2V7L A;  2XQ8 A;  4EYY R;  4H9Q C;  5KXJ A;  3LFM A;  2E9X A;  4AIS A;  4XAX B;  2GK9 A;  3PUQ A;  4TX5 A;  2LM9 A;  1L0V A;  1XMQ T;  4JI7 T;  1ZOY A;  1E1H B;  3OPC A;  5CB4 E;  4O4J E;  3LK3 B;  3AE1 A;  3KV6 A;  2E5V A;  3UUL A;  1HX1 B;  2IML A;  4X1I E;  2BKN A;  2VK9 A;  3CX8 B;  3KIN B;  4IE0 A;  4GKK T;  2LSY A;  3Q5D A;  2IHR 1;  1NEK A;  4QX8 B;  3R6N A;  2XQ3 A;  1BR0 A;  2P9B A;  5C8Y E;  4FI5 A;  4UVA B;  3QUJ A;  4K0K T;  4PK5 A;  2MAW A;  4Q25 A;  3CML A;  4GK0 E;  2BG9 E;  4CN1 A;  4AQG A;  4O2A E;  4DR7 T;  4QH5 A;  4IE6 A;  2LSI A;  3ABV A;  2W67 A;  3TLT A;  3C4W A;  1IJ6 A;  3LG7 A;  5LHH B;  3I0Q A;  3P4Q A;  4H63 V;  5LMN T;  2H88 A;  4UVB B;  2JJ9 A;  2WM9 A;  2BG9 B;  3AXJ B;  2E2A A;  1FJG T;  5IWA T;  1UGO A;  2XQ4 A;  5ABH A;  4EYU A;  2KWI B;  3PDY A;  1XNR T;  4PJL A;  2WZI A;  4OK0 A;  5CFB A;  3L8R A;  3GN5 A;  2X0L B;  3ZJ1 A;  4TWD A;  3SS1 A;  1I6Z A;  3UQ4 A;  3DTO A;  5EK3 A;  2WMO A;  3RYH E;  3CQX C;  1XNQ T;  3JAE A;  4F8H A;  5CGM A;  4ILU A;  5IHY A;  3TKL B;  4DV3 T;  2VL0 A;  5JR9 B;  1CUN A;  4OYK A;  5L4E A;  5LHG B;  5IUX A;  5TAO A;  4DV2 T;  3X1D A;  3IHR A;  4O4L E;  3C50 A;  3AE4 A;  2LLY A;  1VCT A;  2WCA A;  2XQ9 A;  4ILA A;  3Q5E A;  4K0U A;  1SUM B;  1HS7 A;  4YT0 A;  3AE6 A;  3GMI A;  3ANW A;  2OLT A;  2UU9 T;  4ADZ A;  2W61 A;  2BS3 A;  2VVN A;  2VAS A;  3HKB E;  4X64 T;  4LFB T;  4YSX A;  2UXC T;  3VR8 A;  4QKN A;  5F8P A;  3KV4 A;  4NPP A;  3NZQ A;  3T8O A;  3PTR B;  1EZ3 A;  4HEA A;  3RYI E;  3AE8 A;  4QH4 A;  4ZS2 A;  4NXM T;  2XAJ B;  4YSZ A;  3KV9 A;  1KNR A;  4JI2 T;  4GKJ T;  2ODV A;  4DO0 A;  1D0Z A;  3B5M A;  3RX6 A;  3MA9 A;  2VQF T;  4ZHQ E;  2UXX B;  4QHO A;  2LHR A;  3O4X E;  1Z0P A;  5LJM A;  3UU4 A;  2LE8 A;  5HXC A;  3N9P A;  4JYA T;  5L3E B;  1I94 T;  2HN2 A;  5LG4 A;  5FL1 A;  5JDG A;  1BR2 A;  3DJB A;  3RKG A;  1N34 T;  4EXT A;  2VKO A;  3RC8 A;  2B76 A;  3RLF F;  4LF9 T;  2JIW A;  3ZMV B;  2RA1 A;  3FZF B;  4DMW A;  3C64 A;  2XQA A;  4WBN E;  3ZYL A;  2V5D A;  4ANJ A;  1ZHC A;  3BK9 A;  2WWU A;  5LBM A;  4TV8 E;  3WI3 A;  4DBR A;  2IC9 A;  2CWO A;  1VCS A;  1SA0 E;  3PUX F;  4ZI2 C;  2Q9Q A;  3Q9D A;  3JC6 D;  2J1D G;  3GWH A;  3D0T A;  5HXH A;  5HYA A;  2LM2 A;  3H3M A;  3I9W A;  2Y6X A;  3N5L A;  4HFC A;  5AQJ B;  3PUZ F;  1FEW A;  3KVB A;  4AKR B;  4X65 T;  1M7K A;  4MFR A;  3J7Y q;  3JCF A;  2YU1 A;  3LK4 2;  1UCU A;  3A5X A;  3FBL A;  4AI6 A;  4HFI A;  2V6X A;  2DL1 A;  3EDU A;  1WLX A;  3KDS E;  1MIV A;  3LDQ B;  3NBX X;  1MNE A;  5L3C B;  1MIW A;  2EHO C;  4H9N C;  2ZMA A;  3TLV A;  4DUZ T;  3QOF A;  4JEU B;  1YKH B;  1VOM A;  5AQU B;  4DR1 T;  4WZX A;  2LSK A;  4GYR A;  2ES0 A;  2H3R A;  5LP6 E;  4PK6 A;  3FZM B;  2KND A;  1WR6 A;  3HR0 A;  5FY1 A;  5LA6 E;  3TLS A;  3PUG A;  4ZZB A;  5DQV A;  2NW7 A;  2DLR A;  2MBG A;  2WAU A;  3N2O A;  4L5G A;  2LHN A;  4JLE A;  1IJ5 A;  4I43 B;  1QUU A;  4ERR A;  4NUV A;  4B3R T;  3KFW X;  3K3Q C;  2H7O A;  4MLK A;  4B3M T;  4AQF C;  5JR9 C;  4LFA T;  3EVY A;  3EAB A;  2YEV C;  5J0Z A;  2WZH A;  5ADX L;  4AKI A;  3PJA A;  4ZI3 D;  3NWI A;  4DMV A;  2YDQ A;  3RHW A;  2VB6 A;  1UUR A;  3AA7 B;  2HH7 A;  4LF8 T;  3CX7 B;  2YK0 A;  4WBO A;  2SPC A;  4IDO A;  1U5P A;  2YOE A;  5FMN A;  3CQG B;  2W62 A;  4AKG A;  5BMV E;  3KBU A;  4HWD A;  4BAY B;  3OKQ A;  3FZH B;  2E5L T;  4GK5 E;  4L9I A;  5A1L A;  3PU3 A;  1NAF A;  4I0U A;  5HEU A;  5M4Y A;  2XM2 A;  4UEM A;  5C3J A;  1YD8 G;  4PW8 A;  3KVA A;  4H9R C;  3CIR A;  2NW9 A;  3NVO A;  3ZEF B;  4EOZ B;  4BA9 A;  2CXF A;  2VKJ A;  3W15 B;  3OJA A;  3AB3 B;  3PUS A;  4U72 A;  3SRZ A;  1KFY A;  4Z8X A;  4YSY A;  5LHI B;  3ZMU B;  2NOX A;  2MYS A;  2CLY B;  2X0Y A;  3P4P A;  3ONL C;  5FY0 A;  3UU8 A;  3E08 A;  3E22 E;  2ZM8 A;  2N1G A;  3N9M A;  2UXB T;  3MKD A;  4JV5 T;  1T98 A;  3QC9 A;  4DR3 T;  5H6R B;  3NKZ A;  3N2K E;  5F3J A;  5EK4 A;  2C5K T;  1W0A A;  2KIN B;  5L3F B;  5DQW A;  1IZN B;  3V5U A;  3PE0 A;  3ZT5 A;  4X20 E;  3IF8 B;  3AEF A;  4JI4 T;  3EAM A;  5ABF A;  3I1A A;  2XQ6 A;  1LVK A;  2W4X A;  4A97 A;  2N2N A;  1HNZ T;  3ANW B;  2YN6 A;  2C0S A;  3PUA A;  3ESL A;  2V8S V;  2CBJ A;  3P7I A;  5FNV E;  3RC3 A;  4ZXL A;  3MXZ A;  4HN9 A;  4E7Z A;  5JQG E;  3NRX A;  4U74 A;  2PTF A;  4QWN B;  3AEG A;  4TZ4 C;  1S94 A;  2CWY A;  3RF1 A;  2D0T A;  2E8I A;  4U31 A;  3CVR A;  2KZ7 B;  2RP4 A;  4HFD A;  4N78 D;  3QB5 A;  3AED A;  4YLH A;  2UUA T;  4DR4 T;  4LMK A;  4KX6 A;  2W00 A;  4CN6 A;  1X9B A;  2ZM2 A;  4DVD A;  4ZZC A;  4XZC A;  3PU8 A;  3AAI A;  2CE7 A;  2KXP B;  3JAF A;  4CN4 A;  5L3G B;  5AQG B;  4TV9 E;  4BJN A;  3FZL B;  2JQ9 A;  1XMO T;  4EZH A;  4TWH A;  4LF6 T;  3N2G E;  1UX5 A;  3P4W A;  2V7K A;  4I50 E;  1KNZ A;  4QXB B;  4YTP A;  4HFB A;  5L4H A;  1LVF A;  1WFD A;  3BQI A;  3K1S A;  4ILC A;  4I55 E;  4KUM B;  3ZC1 A;  2EHO B;  2WSS V;  1BR1 A;  2LEH A;  4UXN B;  2WBL A;  2Q9Q B;  2K5B B;  4KHZ F;  2BZB A;  1Z8U A;  4U33 A;  2MTQ A;  5HCM A;  3ZSS A;  1J5W A;  4V1A v;  1D1C A;  2A2F X;  4JI5 T;  1G73 A;  2V7J A;  3C4Z A;  2DWK A;  1MIY A;  4M1P A;  1CHU A;  1MMD A;  5KMG P;  3EI0 A;  3FHN A;  2W0G A;  4O8S A;  5AQT B;  2KSR A;  2ZLY A;  2LSG A;  4GIW A;  2HHH T;  3QK6 A;  3UU3 A;  1ZEE A;  5AQO B;  5LBQ B;  4OFZ A;  3J9X 1;  4TNW A;  3AE7 A;  2CLY C;  1UX4 A;  3VRB A;  2NW8 A;  3CQC B;  3ZKR A;  3ZJ2 A;  1ZV4 X;  2OA5 A;  4HTE A;  2C5I T;  5LMU T;  1N32 T;  4X62 T;  1YW0 A;  1VRB A;  2K3W A;  1WCR A;  3RH3 A;  3UUN A;  3F2E A;  3M65 A;  3OYX A;  3IEE A;  4LF4 T;  5ETW A;  5C2T A;  4CZZ B;  4KMC A;  3UU5 A;  2KT9 A;  3P4S A;  4CI3 B;  1MMA A;  5CA1 E;  3OTO T;  1YQ4 A;  3B13 A;  2ODU A;  3AA6 B;  3CWZ B;  4HFH A;  2N9D A;  5HEH A;  3K3N A;  2UUC T;  4CI2 B;  2VL8 A;  3Q5X A;  4L0R A;  4WYV A;  5CA0 E;  3AAA B;  3SWH A;  4U2Y A;  2JQH A;  4ZI2 D;  2XTL A;  1QLB A;  1UK5 A;  2FJB A;  4HWH A;  1W09 A;  2VVS A;  4YXD A;  1BR4 A;  5JDN A;  3GA8 A;  1JNZ A;  3ZCJ A;  1MMG A;  4B3T T;  3ZT6 A;  4H63 H;  2Y48 B;  4U7I A;  4Z91 A;  3RYF E;  4IDQ A;  4KI0 F;  4YTN A;  5ABE A;  4YTM A;  1WYB A;  3TLU A;  1LKX A;  3Q2M A;  4A98 A;  1HX8 A;  4EB6 E;  3PUV F;  5EK2 A;  1T7S A;  2A72 A;  2EHO D;  2J4G A;  1LRZ A;  2XY8 B;  4EAH A;  3U3I A; 
#chains in the Genus database with same CATH homology
 1E1H B;  5DAB A;  5BMV E;  3KBU A;  4BAY B;  5CB4 E;  3RKO A;  3OYZ A;  4O4J E;  3C51 A;  3LK3 B;  3OKQ A;  5IYZ E;  2UXN B;  4FJO A;  3ZN1 B;  4GK5 E;  4L9I A;  3KV6 A;  5A1L A;  3PU3 A;  2K9A A;  3UUL A;  3RRW A;  4ASK A;  1NAF A;  4X1I E;  5LGU B;  2VK9 A;  3CX8 B;  4UEM A;  5M4Y A;  3WAK A;  1G8X A;  3IBP A;  3KIN B;  4IE0 A;  1YD8 G;  5KDM C;  4PW8 A;  2NTX A;  3KVA A;  5LNK A;  2V7I A;  4HE8 A;  3WAJ A;  2LSY A;  2G0U A;  4H9R C;  2NW9 A;  3L3P A;  5JRC A;  3ZEF B;  4EOZ B;  4BA9 A;  4QX8 B;  3R6N A;  4HGA A;  4UIG A;  1HCI A;  2CXF A;  2VKJ A;  3W15 B;  3OJA A;  2P9B A;  1BR0 A;  3AB3 B;  3PUS A;  4ZS3 A;  1S35 A;  4U72 A;  3SRZ A;  5LYJ E;  4Z8X A;  2MOZ A;  3VU7 H;  5C8Y E;  4FI5 A;  4UVA B;  3L09 A;  3QUJ A;  1OWA A;  4PK5 A;  5LHI B;  1H7C A;  4DND A;  3ZMU B;  3MAC A;  2Q9Q C;  4ZI7 E;  2ZM0 A;  2KLQ A;  2NOX A;  2D2S A;  2MYS A;  2CLY B;  5L3B B;  3CML A;  4GK0 E;  3S4U A;  2PBI A;  2X9X A;  4UF0 A;  2XAS B;  5FY0 A;  2E9X B;  3E08 A;  4AQG A;  3O9X A;  3E22 E;  2ZM8 A;  4O4H E;  4O2A E;  2N1G A;  4XBF B;  4O2B E;  4PNI A;  3O1J A;  4IE6 A;  3N9M A;  5HXS A;  2LSI A;  1D0Y A;  3MKD A;  1YKE B;  4UEL A;  4IE4 A;  4YJ2 E;  2LT3 A;  1T98 A;  3OBV E;  4YHJ A;  1QSD A;  5KX5 E;  3QC9 A;  4AKL A;  3EUH A;  3C4W A;  1IJ6 A;  3LG7 A;  5H6R B;  2X9Y A;  3I0Q A;  4IE7 A;  5LHH B;  5JDL A;  4GYS A;  4IDZ A;  3N2K E;  5F3J A;  4H63 V;  2H7V C;  5EK4 A;  3UT5 E;  2B1E A;  2C5K T;  2KIN B;  5L3F B;  2VKH A;  4JEH B;  3ZMS B;  5J2T E;  1D0X A;  1SHZ C;  5DQW A;  5L3D B;  1IZN B;  3V5U A;  4UVB B;  2JJ9 A;  2YIN A;  4PK4 A;  2WM9 A;  1AJ3 A;  3PE0 A;  4HFV A;  4P0A A;  2VWA A;  4EYU A;  4X20 E;  3IF8 B;  2KWI B;  3ONX A;  5HWX A;  4P0B A;  3I1A A;  3PDY A;  5LXT E;  1LVK A;  2BVM A;  4PJL A;  3ZLI A;  5LJN A;  1HFA A;  2CMR A;  1Y64 B;  4OK0 A;  3GN5 A;  2X0L B;  2N2N A;  4CXW A;  4CXY A;  3ANW B;  4HKA A;  2C0S A;  3ZJ1 A;  1MND A;  3LJC A;  3PUA A;  3ESL A;  2XAF B;  5FXV A;  3SS1 A;  4IHJ E;  2Y8D A;  3P7I A;  4P09 A;  5FNV E;  2CXD A;  3DTO A;  3RC3 A;  5EK3 A;  3MXZ A;  2X68 A;  3I9Y A;  4HN9 A;  4E7Z A;  5JQG E;  2WMO A;  3NRX A;  3RYH E;  2CM0 A;  4IST A;  4U74 A;  3ZC0 A;  4QWN B;  3AVS A;  3CQX C;  4G63 A;  4TZ4 C;  4ILU A;  2PFV A;  1S94 A;  2IW5 B;  5IHY A;  3VHL A;  3TKL B;  2CWY A;  2Q9Q D;  3N9L A;  2IC6 A;  2JQQ A;  3MK7 C;  2D0T A;  5FXW A;  2LJL A;  2E8I A;  4AKG A;  3VKG A;  1HG2 A;  3MZK B;  4QXH B;  3CKD A;  1NWM X;  5JR9 B;  2Z6E A;  1CUN A;  4OYK A;  4PFO A;  5HAX A;  3CVR A;  2KZ7 B;  4TUY E;  4CXX A;  5LHG B;  1KK7 A;  2EHO A;  2XAQ B;  2RP4 A;  3P8C D;  3K3O A;  5TAO A;  4N78 D;  1X79 A;  5JH7 E;  3IHR A;  3BQL A;  4O4L E;  4DBQ A;  3C50 A;  4PAG A;  4YLH A;  5FP3 A;  4GOU A;  2HPL A;  4K0U A;  2W00 A;  2PG8 A;  5J1G A;  1D1B A;  2ZM2 A;  4DVD A;  1HS7 A;  2XAG B;  4ISS A;  3GMI A;  4XZC A;  4A56 A;  2DI4 A;  2NWB A;  3ANW A;  3PU8 A;  4ADZ A;  2W61 A;  2WMN A;  1V9D A;  3AAI A;  2DHR A;  2CE7 A;  3F57 A;  2VAS A;  3RYC E;  3RRC A;  4C91 A;  3HKB E;  1FMV A;  2KXP B;  3UTK A;  5FXX A;  5JDF A;  2V26 A;  1ZKE A;  5L3G B;  4TV9 E;  2JPF A;  4QKN A;  3GN5 B;  5F8P A;  2JMH A;  5HXE A;  3KV4 A;  4BJN A;  3E0Z A;  3HA4 A;  3NZQ A;  2LSJ A;  5FXZ A;  4OHF A;  2XAH B;  2L9Q A;  3PUR A;  3T8O A;  2X66 A;  3PTR B;  4QX7 B;  1EZ3 A;  2BVL A;  2I59 A;  4HEA A;  3RYI E;  5AFU L;  4EZH A;  4AQF A;  1D1A A;  4ZS2 A;  3N2G E;  5JR9 A;  1UX5 A;  2XAJ B;  2V7K A;  3KV9 A;  4I50 E;  1KNZ A;  2ODV A;  4DO0 A;  3JC6 C;  3AVR A;  1D0Z A;  3U78 A;  4QXB B;  4MAL A;  2DWG A;  3RX6 A;  4EIW A;  3MA9 A;  3N9Q A;  1LVF A;  1HF8 A;  2PJQ A;  3BQI A;  4ZHQ E;  4KBM B;  4BJM A;  2UXX B;  2XHE B;  5H6Q B;  4QHO A;  3V5S A;  2ACX A;  1WYC A;  2LHR A;  4I55 E;  3FBZ A;  3O4X E;  4UV9 B;  2X9H A;  4H9P C;  1Z0P A;  5LCY A;  5LJM A;  3N9N A;  4KUM B;  3ZC1 A;  2EHO B;  2LE8 A;  2WSS V;  1BR1 A;  2LEH A;  5GON E;  4YJ3 E;  2LOS A;  4UXN B;  2WBL A;  5HXC A;  3SOL A;  2VKD A;  2Q9Q B;  3N9P A;  5EZY E;  3MJX A;  5L3E B;  4G2A A;  2K5B B;  2BZB A;  5FYM A;  2QA7 A;  5JDG A;  5LG4 A;  2CA5 A;  4AKH A;  2MTQ A;  2XUE A;  4B6X A;  1BR2 A;  3DJB A;  2C5J A;  2JRK A;  4EXT A;  3I0O A;  2L3L A;  4V1A v;  3HKC E;  2VKO A;  5JDH A;  2CXL A;  3RC8 A;  2X9W A;  1D1C A;  2A2F X;  3O1I A;  2LOP A;  3NRY A;  3RPU A;  1G73 A;  4E7S A;  3VKH A;  2V7J A;  2X51 A;  4YFS A;  3ZMV B;  5LGT B;  3C4Z A;  2DWK A;  2RA1 A;  1MIY A;  4M1P A;  1MMD A;  4DMW A;  3DP7 A;  3R84 B;  2BDE A;  5E0O A;  3C64 A;  5KMG P;  2NTY A;  4WBN E;  3FHN A;  3C4X A;  3ZYL A;  2W0G A;  4O8S A;  3UFE A;  3F31 A;  4ANJ A;  2ZLY A;  1ZHC A;  3BK9 A;  3ZPO A;  2JMK A;  1WRD A;  2WWU A;  2LSG A;  5LBM A;  2CCQ A;  4GIW A;  4PJM A;  4TV8 E;  3QK6 A;  3ZN0 B;  3WI3 A;  4DBR A;  2IC9 A;  2CWO A;  2XQY A;  4MHC A;  2V1D B;  1ZEE A;  1SA0 E;  5JRE A;  4ZI2 C;  5HWY A;  2Q9Q A;  4MBQ A;  5JVD E;  1OXZ A;  4PJN A;  2DNX A;  3Q9D A;  5LBQ B;  3JC6 D;  4OFZ A;  4I4T E;  2J1D G;  3J9X 1;  3FXD B;  3H37 A;  3GWH A;  3D0T A;  2CLY C;  5HXH A;  5HYA A;  1UX4 A;  3ETU A;  4KP3 C;  3I9W A;  2Y6X A;  3N5L A;  4UV8 B;  1O3X A;  2NW8 A;  5J2U E;  2E9X C;  3CQC B;  3FB2 A;  4X1K E;  1FEW A;  3KVB A;  4AKR B;  3ZJ2 A;  1MMN A;  2YU2 A;  4IGU A;  5FY7 A;  4ZI3 C;  4MFR A;  5L2L A;  3J7Y q;  2YU1 A;  3LK4 2;  3H3A A;  1ZV4 X;  4ZOL E;  3ZMZ B;  2DCF A;  2OA5 A;  1FIO A;  1UCU A;  3A5X A;  3FBL A;  4HTE A;  4JUY A;  2C5I T;  1U4Q A;  3HI2 A;  4AI6 A;  4AXP A;  2HPJ A;  2QGS A;  2D0U A;  4O4I E;  1YW0 A;  3EDU A;  1HG5 A;  1VRB A;  1WLX A;  3KDS E;  1MIV A;  4QXC B;  4IIJ E;  3RH3 A;  4H9O C;  3UUN A;  3NBX X;  2A3D A;  3CX6 B;  3F2E A;  1FMW A;  1US7 B;  3FXE B;  1MNE A;  4F6R C;  5L3C B;  1MIW A;  3M65 A;  3OYX A;  2EHO C;  4H9N C;  3IEE A;  2ZMA A;  4PFP A;  5ETW A;  3Q5W A;  1IAP A;  3LBX B;  3UUM A;  3NZP A;  4JEU B;  4CZZ B;  1YKH B;  4IE5 A;  4KMC A;  2KT9 A;  1VOM A;  2KMF A;  4EZ4 A;  4CI3 B;  2X67 A;  3O1H A;  3UUX B;  1MMA A;  4TN7 B;  5CA1 E;  2LSK A;  3B13 A;  2ODU A;  4GYR A;  3ZMT B;  3ZYK A;  3AA6 B;  2V7M A;  3CWZ B;  2ES0 A;  2N9D A;  2H3R A;  5LP6 E;  4PK6 A;  3KBT A;  4X1Y E;  3K3N A;  2KND A;  3AA0 B;  1WR6 A;  3EDV A;  4CI2 B;  2VL8 A;  3HKD E;  5LGN B;  2W63 A;  2K48 A;  3HR0 A;  5JDQ A;  3Q5X A;  4L0R A;  5FY1 A;  3AA1 B;  1B7T A;  3ZYM A;  5LA6 E;  5CA0 E;  3AAA B;  3SWH A;  3PUG A;  1HTJ F;  3HKE E;  4C90 A;  5DQV A;  2NW7 A;  2DLR A;  2MBG A;  4ZI2 D;  2WAU A;  5HXR A;  2NP9 A;  3N2O A;  2XTL A;  4L5G A;  2LHN A;  3C98 B;  4JLE A;  2CEA A;  4NUU A;  5DJQ C;  1IJ5 A;  3ETV A;  1QUU A;  3KV5 A;  4I43 B;  4ERR A;  4NUV A;  3KFW X;  1BR4 A;  4PJJ A;  3K3Q C;  2H7O A;  4MLK A;  3B57 A;  4AQF C;  5JDN A;  3GA8 A;  4WNK A;  5JR9 C;  3ZCJ A;  2E9X D;  2D5U A;  1MMG A;  3EVY A;  4H9S E;  2YEV C;  3N9O A;  3ZCI A;  5ADX L;  4AKI A;  3LK2 B;  5JRC B;  4H63 H;  2Y48 B;  4ZI3 D;  3RYF E;  4DMV A;  3AAE B;  3LBX A;  2IAK A;  2V7L A;  4EYY R;  4H9Q C;  2VB6 A;  2KWH A;  1WYB A;  3CPZ A;  3AA7 B;  1LKX A;  2HH7 A;  2K24 A;  3LFM A;  3Q2M A;  2E9X A;  4XAX B;  1HX8 A;  4UVC B;  4EB6 E;  3CX7 B;  2YK0 A;  2GK9 A;  3PUQ A;  4TX5 A;  2LM9 A;  3HL6 A;  4CQI A;  3BQK A;  5JDM A;  4J2C A;  4WBO A;  2SPC A;  2L8K A;  1U5P A;  5EK2 A;  3K8P C;  2A72 A;  5FMN A;  2EHO D;  3CQG B;  4WW0 A;  4UF0 B;  1LRZ A;  4CI1 B;  5LOV E;  2W62 A;  4EAH A;  4OYJ A;  3U3I A;  2M67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...