1HX1B

Crystal structure of a bag domain in complex with the hsc70 atpase domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Bag/Hsc70 complex: convergent functional evolution of Hsp70 nucleotide exchange factors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone/chaperone inhibitor
molecule keywords Heat shock 70 kDa protein 8
total genus 45
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2001-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1hx1B00
5AQMB 3FZHB 5AQJB 1M62A 5AQHB 2D9DA 5AQSB 1UGOA 5AQKB 4HWIB 3FZLB 5AQGB 1I6ZA 5AQIB 1UK5A 3M3ZB 3FZKB 5AQLB 1M7KA 5AQQB 5AQFB 3FZMB 5AQVB 4HWHA 1T7SA 3A8YC 5AQPB 5AQNB 5AQRB 4HWFA 3LDQB 5AQOB 4HWCA 5AQUB 1HX1B 5AQTB 3FZFB 4HWDA
chains in the Genus database with same CATH superfamily
3DTOA 2LEHA 3RYCE 2IC9A 4GOUA 5HXHA 4LF7T 5AQHB 2IUBA 2QRXA 3LG7A 2LM9A 3JAEA 2BG9C 2N2NA 3VR8A 4B3TT 3ONXA 4BAYB 4TV9E 2BBJA 5HXSA 1B7TA 2WDRA 2D2SA 2XAGB 2DWGA 4MALA 4I55E 4O4JE 4ZOLE 3MJXA 3BQKA 3GA8A 1D0ZA 3I9WA 2XAHB 1HG2A 4ILCA 4O4LE 2ZM6T 1ZOYA 3P8CD 2NTXA 2KT9A 4H63H 4HGAA 4KUMB 2VKHA 2EHOA 4XZCA 4ERRA 2C5IT 1MMGA 4UVBB 5KMGP 3HI2A 4U33A 2CWYA 4U72A 4X5TA 5L3BB 5J0ZA 3NZPA 4KHPT 2NOXA 5FXWA 1O3XA 3PUGA 4PJJA 5IHYA 3PE0A 4DR6T 3EUHA 2V7IA 3KINB 3NZQA 2VKJA 2YKSA 3AA6B 4KHZF 2K9AA 3UQ4A 3LK2B 3ZYLA 2CEAA 4DR1T 4CXXA 5E0OA 2Z6EA 1CHUA 4IGUA 4U2YA 4PFOA 4YXDA 3P50A 3AE5A 1HX8A 3GWHA 1IAPA 4DV6T 3UTKA 4AQFA 4O2AE 2XSBA 3AEAA 1E7PA 4KMCA 2L3LA 4AI6A 3CMLA 4TX5A 3UULA 5LGNB 2D0UA 3ESLA 1E1HB 4GIWA 5LG3A 2XM2A 2FJEA 1LVKA 3EHZA 4A5XA 4X1KE 3PURA 5AQVB 3VHLA 4N78D 2LKHA 3B5MA 4CQIA 4YY3T 4H9OC 4HFCA 2E5VA 4IDZA 1XNQT 1KFYA 2JJ9A 4P09A 2KXPB 4Z8XA 4DV1T 2VVSA 5A1LA 4YTMA 3AE2A 4BJNA 3HR0A 2VL8A 3AVSA 5LHGB 3F31A 5LJMA 2FJBA 5FXZA 2OV9A 1OEDE 2QA7A 3FZFB 2LE8A 3N9PA 2WDVA 1KNZA 4UV8B 1IBLT 2AE9A 2DNXA 3PJAA 4L5GA 4B3RT 5AQMB 1M62A 2V1DB 2VKOA 3G06A 4DR7T 4A98A 3PUAA 2CHNA 1W9RA 3WI3A 3Q2MA 5L3DB 4X62T 2VB6A 2X0YA 3F57A 3MZKB 3ZMSB 2M6BA 1XZYA 3RIUC 1LRZA 1OEDC 5DQVA 3WAKA 3IBPA 5AQQB 2X0LB 4C90A 2Y8DA 3O1JA 4TWFA 2WMNA 3N5LA 5AQPB 4YTNA 4PJNA 4NUVA 2DLRA 2JQ9A 3RH3A 3QB5A 3FHNA 2WZIA 4CN1A 4EEBA 2JIWA 4LMKA 3ANWA 4TNWA 2KSRA 3ZC1A 2D5UA 2PJQA 3ZT5A 5J2TE 2Q9QA 4DBRA 3L8RA 1J1JA 3IHRA 3LBXA 4DV0T 4NXMT 4HWDA 3IF8B 4X20E 3KV9A 5GONE 3ZT7A 3HKEE 2WMOA 4JI0T 3AE8A 3EVYA 2MTQA 4EOZB 4I0UA 4A56A 2LSJA 5LP6E 5JR9A 2OA5A 2W61A 1H7CA 3ZMTB 1AJ3A 4P0BA 1HF8A 4MLKA 5JR9B 4H63V 3ZPOA 3WAJA 1IBKT 4WBNE 3I1AA 2XSAA 1WLXA 5KXJA 3ZT6A 2IIUA 2VASA 5JRCB 1MIVA 5LMNT 4Q25A 4YTPA 3QUJA 4UR9A 2BG9B 2BVMA 2BKOA 3GN5A 3ZYMA 5BR8T 1WYBA 2UXDT 5L3CB 2XTLA 3CQGB 4TNVA 4IDPA 4L9IA 3SRZA 3SWHA 3KV6A 3UU3A 2QYWA 4DVDA 5AFUL 3FXDB 3B13A 3NKZA 3C64A 4JI8T 2EHOD 1YW0A 3ZMUB 4PK6A 2V6YA 2Y48B 4QH5A 2LHRA 1VCSA 2FJAA 2C5JA 1KEYA 4LF4T 3P4RA 4A97A 3OJAA 3RPUA 3Q9DA 5C8YE 3A7MA 4YSYA 2HH7A 4F8HA 3Q5WA 2R6GF 3K8PC 3LFMA 4PFPA 1QLBA 4ZI7E 4HN9A 5AQSB 4TN7B 4IE5A 2LOPA 1V9DA 2DWKA 4OFZA 4TZ4C 4I43B 5AQGB 5AQKB 2SPCA 5H6RB 3UU8A 3V5UA 3O1HA 3AAAB 2VWAA 3PUXF 2E9XD 4IE7A 5JDFA 4LF8T 2YU2A 2CE7A 5AQLB 4EXTA 3JCFA 1OEDA 3CX7B 4BJMA 1T7SA 3EDUA 3A8YC 5JDGA 3AXJB 3PJAJ 2NR4A 4QKNA 3T8OA 5LYJE 3ZMVB 1L0VA 2H3RA 3M65A 4WNKA 2P9BA 2XQ3A 2VL0A 2YINA 4QX8B 4KBMB 3LJCA 5DABA 3RRWA 3RHWA 3KV4A 4G63A 4IDOA 5EK4A 3UUNA 2CHOA 4CI1B 2UU9T 2ZM0A 2E9XC 3KBUA 2ACZA 1ZEEA 2UXNB 3HKBE 2XAQB 4OK0A 5ABEA 2UXXB 2KNDA 5LA6E 2WM9A 5CA1E 2PG8A 4JLEA 3OYXA 5HXRA 4LFBT 2W67A 5L47A 5LGTB 4ZZBA 3MACA 3RF1A 1MMDA 4G2AA 3H37A 1KK7A 3E08A 3FZLB 4H9QC 4U74A 4YJ3E 1HFAA 2IAKA 4UELA 5LBMA 3AE7A 2UXBT 2E9XB 3FXEB 3P4PA 3U3IA 2DI4A 1HR0T 2E9XA 2YN6A 1W09A 4B3ST 3D0TA 4YLHA 2A3DA 3AB3B 4QXHB 3ZSTA 3I0QA 1YXRA 4IDQA 3ABVA 3OPCA 2V7LA 2LSKA 3CWZB 3AECA 5FY1A 4DV5T 3CPZA 3NVOA 3ZC0A 3C51A 2DHRA 2CCQA 4HFEA 4IL4A 4LMLA 4O2BE 1OWAA 2XAJB 2JQKA 3KV5A 1JNZA 4HE8A 4JBWF 3ZSSA 4ASKA 1MMAA 5LGUB 1G8XA 1ZKEA 3VRBA 1HX1B 5AQTB 1KNRA 4OYKA 3K3QC 3ZMZB 2MYSA 1D1AA 3PUZF 5CB4E 3UUMA 3SFEA 3UQ7A 4NIQA 2UUBT 4JV5T 3AE9A 2XQ5A 4JI5T 2RP4A 3AVRA 3EABA 4EB6E 2N9DA 2CRBA 1SUMB 2ZLYA 3AE3A 3N9NA 4EYUA 3CKDA 2G0UA 5ABFB 1BR2A 3AAIA 3RKOA 2WS3A 4DIDB 2IW5B 4DR5T 1BR4A 1J5WA 2QVAA 5KDMC 3ZCJA 4Z90A 5KX5E 3HA4A 1WFDA 5TAOA 2M6IA 4JI2T 3H3AA 3ZJ1A 4YSZA 3ETUA 2B1EA 4UVCB 4BA9A 3RGLA 4AKGA 1G73A 2X9YA 3ANWB 3PU8A 1S35A 2BBHA 4HFDA 1S94A 1WR6A 3LDQB 3RRCA 2A2FX 5L4EA 4MFRA 1W0AA 2YOEA 1XMQT 4HWCA 4NXNT 4LF9T 2FUPA 5FKYA 2MAWA 4CN4A 2JQHA 2X0HA 3N2KE 4AKRB 3AA1B 3VKHA 1VOMA 4HTEA 1HNZT 4JYAT 5FXXA 2W4XA 3OYZA 3AA0B 1XDPA 2CBIA 2XJ7A 4H9NC 4C91A 3KVAA 3QOFA 4X66T 2W66A 3PUYF 4FI5A 1YD8G 4UXNB 4KX6A 2X67A 2XQ4A 4DV4T 1N34T 4QWNB 2XQAA 4LF5T 1ZHCA 3N9OA 1Y01A 2LRKA 5FMNA 5JREA 1T8BA 2Q9QD 5LBQB 1E2AA 1FJGT 4Z91A 4F6RC 3RYFE 4HFVA 4JUYA 4LFCT 2YU1A 1JNRA 5HYAA 4EEDA 5HEOA 3NRYA 4KP3C 4OX9T 4DR4T 4COFA 5HXEA 4EZHA 2PFVA 2KINB 2I59A 3K1SA 2EHOB 2PTFA 3R6NA 2JQQA 2BKPA 2JMHA 4HFBA 3TKLB 3UFEA 3QC9A 4HEAA 3P4QA 5HXCA 3UUXB 2WU2A 5HWXA 4PK4A 4EZ4A 4GKKT 5JVDE 5LHHB 2CLYC 2VQET 4LMJA 4ZS3A 5FVKA 1D0YA 3RIUA 2Q9QC 4IE4A 5EK3A 4UF0B 1YQ4A 2CMRA 1MIWA 3BQIA 4TWHA 1UGOA 4J2CA 3PU3A 4DUYT 5HWYA 1XDOA 3PDYA 3RI5A 3TLTA 4ZS2A 5DJQC 4L0RA 1NWMX 4PJMA 2V8SV 1US7B 4AISA 1J5ET 3B57A 3ZYKA 2J47A 3JADA 5ABHA 3PTRB 4O8SA 3RC8A 4U7IA 4O4IE 2FJDA 1QSDA 4FJOA 3P4SA 4DMVA 2ODVA 2AXDS 4XBFB 2CM0A 4XAXB 3AEEA 2WZHA 4I4TE 1U5PA 3CK6A 5HEJA 1D0XA 2HPLA 2WSSV 3S4UA 5JDLA 5ADXL 5AQUB 3CVRA 1FMVA 2ODUA 3NWIA 4HFIA 3ZN1B 2X66A 5LJNA 5HEUA 4B6XA 4B3MT 5HEGA 4YHHT 2C0SA 3SOLA 5HCJA 4DBQA 2LHNA 2MBGA 2NW8A 4EYYR 1IBMT 1WCRA 3C50A 5LHIB 2DL1A 3TLVA 2BS4A 3P4WA 3KVBA 3T1HT 4ILUA 4YSXA 2XPKA 4CN6A 5IYZE 4PW8A 3AE6A 5F3JA 2HHHT 4HKAA 4JI4T 1OEDB 3HKCE 3IA3A 2WY2A 2Y6XA 2UUCT 4DV7T 2J1DG 2WP9A 1N32T 2BVLA 5IUXA 1HNXT 2VVNA 2X51A 3AEGA 4UIGA 1QUUA 1ZP0A 2LSIA 2RA1A 3CIRA 5FVLA 2LT3A 5HAXA 1N33T 2JRKA 2BS2A 2LLYA 2I6HA 3QNUA 4KI0F 4NUUA 4DO0A 5FY0A 1X9BA 2LKGA 4OHFA 1WR0A 2W0GA 5CJ5A 3RC3A 2IHR1 2BS3A 5FL1A 3KBTA 2C5KT 2X68A 3MA9A 3PUQA 2XHEB 3ONLC 3A5XA 1BR1A 4IE0A 2RPAA 5FYMA 2KZ7B 4AKIA 1LVFA 4H9SE 5LMUT 4CXYA 2NWBA 1XNRT 1DU2A 4PK5A 4YJ2E 2DCFA 3O4XE 4QXCB 2CPTA 1LKXA 2IMLA 3AA7B 4WBOA 4EAHA 4U2ZA 2V7MA 1NENA 5H6QB 2V7JA 5M4YA 2ZM8A 3UUBA 1IJ5A 2K5BB 2KLQA 3QB5K 4IT4A 2XQ7A 5ETWA 5L4HA 3IEEA 4ISTA 4WW0A 4QH1A 3RLFF 1YKHB 2XM1A 3FZKB 4MHCA 5JTGA 3LSVA 3MKDA 2XQYA 2A9UA 2YEVC 2YDSA 4JI6T 1FIOA 1U4QA 4UEMA 2XQ9A 2JPFA 3Q5EA 5AQRB 3GMIA 2B76A 2VK9A 3NRXA 3SFDA 2XZEA 2H89A 4IIJE 4HWFA 4E7ZA 3GN5B 3UU5A 5LXTE 1KNPA 2XY8B 3N2OA 5EZYE 1HNWT 3LK42 3W15B 4CI3B 3AAEB 2LJLA 4UVAB 2K24A 3OKQA 1IJ6A 1Z8UA 3ZCIA 4K0KT 3VKGA 2X9XA 1VCTA 3C4XA 2NW7A 3EAMA 3JC6D 2E5LT 3C98B 4P1NA 3KDSE 3SS1A 3UU4A 1T72A 2HN2A 4ILBA 2HPJA 3FBZA 4ZEYA 4DUZT 5JH7E 2WWUA 1WRDA 4DV3T 1I6ZA 5LOVE 2CXDA 3N9MA 4TUYE 4JEUB 4ZI2C 1R8IA 3LK3B 5L2LA 4U31A 2ZMAA 1UUSA 2MPKA 2CBJA 3C4WA 2E2AA 2X9HA 3MK7C 4WZXA 4ZI3C 5AQFB 4DV2T 1UX4A 3AE1A 1I94T 1XWMA 4QH4A 3O1IA 2VURA 4ISSA 1HG5A 1NEKA 1UX5A 2N1GA 2V7KA 2HN1A 3JC6C 3L39A 3LBXB 4AQFC 1D1BA 3DP7A 5J2UE 1Y64B 3OBVE 2X9WA 4H9PC 4JEHB 1FEWA 5LCYA 3ZN0B 3E0ZA 3HKDE 5EK2A 4ZI2D 4O4HE 2NTYA 4AXPA 2NP9A 5FP3A 4QXBB 3Q5XA 2UUAT 1HTJF 2XQ6A 3Q5DA 3RIFA 5AQJB 3EI0A 1SA0E 2H7VC 2H88A 3EDVA 2W00A 2XQ8A 2GK9A 3L09A 4PNIA 4PJLA 4AKLA 4WYVA 4GKJT 1Z0PA 2V5DA 2J4GA 4AIUA 3J9X1 2PBIA 5AQIB 2L8KA 2BKNA 4IDNA 2L9QA 3UT5E 2BZBA 2OLTA 5JDQA 1UCUA 2W62A 2V26A 4X1YE 3VR9A 4AQGA 4K0UA 3RIAA 2D0TA 2K48A 4CI2B 4ZI3D 4ZZCA 5DQWA 4V1Av 1HCIA 3CX8B 3X1DA 3ZKRA 3DJBA 1EZ3A 3HL6A 2ES0A 2V6XA 2V6YB 1IZNB 2VQFT 4IREA 5L3EB 1ZV4X 4TV8E 3VRAA 3I0OA 2KWHA 1N36T 2ACXA 2A72A 5L3GB 5CA0E 2F4VT 4IL9A 2VKDA 2W2UA 3CQXC 3QK6A 4UF0A 1W0BA 4EV6A 4X1IE 4JI7T 3FZHB 2JMKA 2WU5A 1YQ3A 3L3PA 2D9DA 5CFBA 3I9YA 2YK0A 2I0MA 3H3MA 4PAGA 3PUWF 3UFGA 2LM2A 3TLWA 3PUVF 3ZEFB 5JR9C 2E8IA 3U78A 4LFAT 1MIYA 1SE7A 4CXWA 2UXCT 1UK5A 4QHOA 4GYRA 3M3ZB 2CXLA 2KWIB 3AXJA 3N2GE 4DNDA 4QX7B 3OTOT 2LSGA 3AE4A 5HCMA 5JDMA 2IC6A 4ILAA 1MNDA 5HEHA 3RYIE 3FB2A 3CX6B 4IE6A 3TLSA 3JAFA 1D1CA 5LNKA 2K3WA 4E7SA 4GK0E 3O9XA 4LF6T 3MXZA 3CQCB 3RX6A 5BMVE 4DR3T 3BK9A 1BR0A 4YT0A 1YKEB 2QGSA 2CXFA 2H7OA 2Q9QB 4IHJE 4AQYT 5LB7B 2ZM2A 3FBLA 2KMFA 3KFWX 3PV0F 4U7YA 3RKGA 3ZLIA 2WQYA 3AEFA 3RQWA 2BDEA 4JI1T 2WDQA 2IDOB 2EHOC 4HWIB 1GQEA 4OYJA 4TWDA 4UV9B 3RYHE 4DR2T 1VRBA 5C2TA 3J7Yq 4ZXLA 4MBQA 1SHZC 5FNVE 3PUSA 2MOZA 3OVUA 2CLYB 4I50E 2NW9A 4EGWA 3FZMB 4ANJA 4HFHA 4HWHA 3E22E 4DMWA 5AQNB 4ZHQE 2WAUA 4X65T 3ETVA 5F8PA 5JDNA 2BG9A 1KF6A 5AQOB 2LSYA 5JQGE 2LRLA 4X64T 5FL0A 5IWAT 2V5CA 4YFSA 3VU7H 5C3JA 3BQLA 3N9QA 2YDQA 4P0AA 3R84B 4CZZB 5F5WA 2FBWA 4ADZA 4YHJA 2CWOA 3AEDA 2XASB 4GK5E 5ABFA 1MMNA 1WYCA 3NBXX 5FXVA 4AKHA 2CA5A 3K3NA 5FY7A 2WWVA 1OXZA 3N9LA 2W63A 5LG4A 4NPPA 2WB5A 4H9RC 3ONJA 4U3CA 1NAFA 2XUEA 5ABGA 3ZJ2A 1MNEA 5JRCA 1M7KA 1CUNA 4GYSA 5L3FB 2WBLA 1XMOT 3T1YT 3V5SA 4M1PA 3F2EA 4JI3T 2M67A 3RQUA 2J62A 5JDHA 1HS7A 1FMWA 2BG9E 1X79A 3UU6A 5CGMA 1UURA 3C4ZA 1T98A 3K3OA 3P7IA 2LOSA 4EIWA 2XAFB 3AEBA 2WCAA 3TLUA 2YDRA 5J1GA
chains in the Genus database with same CATH topology
5AQMB 3FZHB 5AQJB 1M62A 5AQHB 2D9DA 5AQSB 1UGOA 5AQKB 4HWIB 3FZLB 5AQGB 1I6ZA 5AQIB 1UK5A 3M3ZB 3FZKB 5AQLB 1M7KA 5AQQB 5AQFB 3FZMB 5AQVB 4HWHA 1T7SA 3A8YC 5AQPB 5AQNB 5AQRB 4HWFA 3LDQB 5AQOB 4HWCA 5AQUB 1HX1B 5AQTB 3FZFB 4HWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQM B;  3FZH B;  5AQJ B;  1M62 A;  5AQH B;  2D9D A;  5AQS B;  1UGO A;  5AQK B;  4HWI B;  3FZL B;  5AQG B;  1I6Z A;  5AQI B;  1UK5 A;  3M3Z B;  3FZK B;  5AQL B;  1M7K A;  5AQQ B;  5AQF B;  3FZM B;  5AQV B;  4HWH A;  1T7S A;  3A8Y C;  5AQP B;  5AQN B;  5AQR B;  4HWF A;  3LDQ B;  5AQO B;  4HWC A;  5AQU B;  1HX1 B;  5AQT B;  3FZF B;  4HWD A; 
#chains in the Genus database with same CATH topology
 3DTO A;  2LEH A;  3RYC E;  2IC9 A;  4GOU A;  5HXH A;  4LF7 T;  5AQH B;  2IUB A;  2QRX A;  3LG7 A;  2LM9 A;  3JAE A;  2BG9 C;  2N2N A;  3VR8 A;  4B3T T;  3ONX A;  4BAY B;  4TV9 E;  2BBJ A;  5HXS A;  1B7T A;  2WDR A;  2D2S A;  2XAG B;  2DWG A;  4MAL A;  4I55 E;  4O4J E;  4ZOL E;  3MJX A;  3BQK A;  3GA8 A;  1D0Z A;  3I9W A;  2XAH B;  1HG2 A;  4ILC A;  4O4L E;  2ZM6 T;  1ZOY A;  3P8C D;  2NTX A;  2KT9 A;  4H63 H;  4HGA A;  4KUM B;  2VKH A;  2EHO A;  4XZC A;  4ERR A;  2C5I T;  1MMG A;  4UVB B;  5KMG P;  3HI2 A;  4U33 A;  2CWY A;  4U72 A;  4X5T A;  5L3B B;  5J0Z A;  3NZP A;  4KHP T;  2NOX A;  5FXW A;  1O3X A;  3PUG A;  4PJJ A;  5IHY A;  3PE0 A;  4DR6 T;  3EUH A;  2V7I A;  3KIN B;  3NZQ A;  2VKJ A;  2YKS A;  3AA6 B;  4KHZ F;  2K9A A;  3UQ4 A;  3LK2 B;  3ZYL A;  2CEA A;  4DR1 T;  4CXX A;  5E0O A;  2Z6E A;  1CHU A;  4IGU A;  4U2Y A;  4PFO A;  4YXD A;  3P50 A;  3AE5 A;  1HX8 A;  3GWH A;  1IAP A;  4DV6 T;  3UTK A;  4AQF A;  4O2A E;  2XSB A;  3AEA A;  1E7P A;  4KMC A;  2L3L A;  4AI6 A;  3CML A;  4TX5 A;  3UUL A;  5LGN B;  2D0U A;  3ESL A;  1E1H B;  4GIW A;  5LG3 A;  2XM2 A;  2FJE A;  1LVK A;  3EHZ A;  4A5X A;  4X1K E;  3PUR A;  5AQV B;  3VHL A;  4N78 D;  2LKH A;  3B5M A;  4CQI A;  4YY3 T;  4H9O C;  4HFC A;  2E5V A;  4IDZ A;  1XNQ T;  1KFY A;  2JJ9 A;  4P09 A;  2KXP B;  4Z8X A;  4DV1 T;  2VVS A;  5A1L A;  4YTM A;  3AE2 A;  4BJN A;  3HR0 A;  2VL8 A;  3AVS A;  5LHG B;  3F31 A;  5LJM A;  2FJB A;  5FXZ A;  2OV9 A;  1OED E;  2QA7 A;  3FZF B;  2LE8 A;  3N9P A;  2WDV A;  1KNZ A;  4UV8 B;  1IBL T;  2AE9 A;  2DNX A;  3PJA A;  4L5G A;  4B3R T;  5AQM B;  1M62 A;  2V1D B;  2VKO A;  3G06 A;  4DR7 T;  4A98 A;  3PUA A;  2CHN A;  1W9R A;  3WI3 A;  3Q2M A;  5L3D B;  4X62 T;  2VB6 A;  2X0Y A;  3F57 A;  3MZK B;  3ZMS B;  2M6B A;  1XZY A;  3RIU C;  1LRZ A;  1OED C;  5DQV A;  3WAK A;  3IBP A;  5AQQ B;  2X0L B;  4C90 A;  2Y8D A;  3O1J A;  4TWF A;  2WMN A;  3N5L A;  5AQP B;  4YTN A;  4PJN A;  4NUV A;  2DLR A;  2JQ9 A;  3RH3 A;  3QB5 A;  3FHN A;  2WZI A;  4CN1 A;  4EEB A;  2JIW A;  4LMK A;  3ANW A;  4TNW A;  2KSR A;  3ZC1 A;  2D5U A;  2PJQ A;  3ZT5 A;  5J2T E;  2Q9Q A;  4DBR A;  3L8R A;  1J1J A;  3IHR A;  3LBX A;  4DV0 T;  4NXM T;  4HWD A;  3IF8 B;  4X20 E;  3KV9 A;  5GON E;  3ZT7 A;  3HKE E;  2WMO A;  4JI0 T;  3AE8 A;  3EVY A;  2MTQ A;  4EOZ B;  4I0U A;  4A56 A;  2LSJ A;  5LP6 E;  5JR9 A;  2OA5 A;  2W61 A;  1H7C A;  3ZMT B;  1AJ3 A;  4P0B A;  1HF8 A;  4MLK A;  5JR9 B;  4H63 V;  3ZPO A;  3WAJ A;  1IBK T;  4WBN E;  3I1A A;  2XSA A;  1WLX A;  5KXJ A;  3ZT6 A;  2IIU A;  2VAS A;  5JRC B;  1MIV A;  5LMN T;  4Q25 A;  4YTP A;  3QUJ A;  4UR9 A;  2BG9 B;  2BVM A;  2BKO A;  3GN5 A;  3ZYM A;  5BR8 T;  1WYB A;  2UXD T;  5L3C B;  2XTL A;  3CQG B;  4TNV A;  4IDP A;  4L9I A;  3SRZ A;  3SWH A;  3KV6 A;  3UU3 A;  2QYW A;  4DVD A;  5AFU L;  3FXD B;  3B13 A;  3NKZ A;  3C64 A;  4JI8 T;  2EHO D;  1YW0 A;  3ZMU B;  4PK6 A;  2V6Y A;  2Y48 B;  4QH5 A;  2LHR A;  1VCS A;  2FJA A;  2C5J A;  1KEY A;  4LF4 T;  3P4R A;  4A97 A;  3OJA A;  3RPU A;  3Q9D A;  5C8Y E;  3A7M A;  4YSY A;  2HH7 A;  4F8H A;  3Q5W A;  2R6G F;  3K8P C;  3LFM A;  4PFP A;  1QLB A;  4ZI7 E;  4HN9 A;  5AQS B;  4TN7 B;  4IE5 A;  2LOP A;  1V9D A;  2DWK A;  4OFZ A;  4TZ4 C;  4I43 B;  5AQG B;  5AQK B;  2SPC A;  5H6R B;  3UU8 A;  3V5U A;  3O1H A;  3AAA B;  2VWA A;  3PUX F;  2E9X D;  4IE7 A;  5JDF A;  4LF8 T;  2YU2 A;  2CE7 A;  5AQL B;  4EXT A;  3JCF A;  1OED A;  3CX7 B;  4BJM A;  1T7S A;  3EDU A;  3A8Y C;  5JDG A;  3AXJ B;  3PJA J;  2NR4 A;  4QKN A;  3T8O A;  5LYJ E;  3ZMV B;  1L0V A;  2H3R A;  3M65 A;  4WNK A;  2P9B A;  2XQ3 A;  2VL0 A;  2YIN A;  4QX8 B;  4KBM B;  3LJC A;  5DAB A;  3RRW A;  3RHW A;  3KV4 A;  4G63 A;  4IDO A;  5EK4 A;  3UUN A;  2CHO A;  4CI1 B;  2UU9 T;  2ZM0 A;  2E9X C;  3KBU A;  2ACZ A;  1ZEE A;  2UXN B;  3HKB E;  2XAQ B;  4OK0 A;  5ABE A;  2UXX B;  2KND A;  5LA6 E;  2WM9 A;  5CA1 E;  2PG8 A;  4JLE A;  3OYX A;  5HXR A;  4LFB T;  2W67 A;  5L47 A;  5LGT B;  4ZZB A;  3MAC A;  3RF1 A;  1MMD A;  4G2A A;  3H37 A;  1KK7 A;  3E08 A;  3FZL B;  4H9Q C;  4U74 A;  4YJ3 E;  1HFA A;  2IAK A;  4UEL A;  5LBM A;  3AE7 A;  2UXB T;  2E9X B;  3FXE B;  3P4P A;  3U3I A;  2DI4 A;  1HR0 T;  2E9X A;  2YN6 A;  1W09 A;  4B3S T;  3D0T A;  4YLH A;  2A3D A;  3AB3 B;  4QXH B;  3ZST A;  3I0Q A;  1YXR A;  4IDQ A;  3ABV A;  3OPC A;  2V7L A;  2LSK A;  3CWZ B;  3AEC A;  5FY1 A;  4DV5 T;  3CPZ A;  3NVO A;  3ZC0 A;  3C51 A;  2DHR A;  2CCQ A;  4HFE A;  4IL4 A;  4LML A;  4O2B E;  1OWA A;  2XAJ B;  2JQK A;  3KV5 A;  1JNZ A;  4HE8 A;  4JBW F;  3ZSS A;  4ASK A;  1MMA A;  5LGU B;  1G8X A;  1ZKE A;  3VRB A;  1HX1 B;  5AQT B;  1KNR A;  4OYK A;  3K3Q C;  3ZMZ B;  2MYS A;  1D1A A;  3PUZ F;  5CB4 E;  3UUM A;  3SFE A;  3UQ7 A;  4NIQ A;  2UUB T;  4JV5 T;  3AE9 A;  2XQ5 A;  4JI5 T;  2RP4 A;  3AVR A;  3EAB A;  4EB6 E;  2N9D A;  2CRB A;  1SUM B;  2ZLY A;  3AE3 A;  3N9N A;  4EYU A;  3CKD A;  2G0U A;  5ABF B;  1BR2 A;  3AAI A;  3RKO A;  2WS3 A;  4DID B;  2IW5 B;  4DR5 T;  1BR4 A;  1J5W A;  2QVA A;  5KDM C;  3ZCJ A;  4Z90 A;  5KX5 E;  3HA4 A;  1WFD A;  5TAO A;  2M6I A;  4JI2 T;  3H3A A;  3ZJ1 A;  4YSZ A;  3ETU A;  2B1E A;  4UVC B;  4BA9 A;  3RGL A;  4AKG A;  1G73 A;  2X9Y A;  3ANW B;  3PU8 A;  1S35 A;  2BBH A;  4HFD A;  1S94 A;  1WR6 A;  3LDQ B;  3RRC A;  2A2F X;  5L4E A;  4MFR A;  1W0A A;  2YOE A;  1XMQ T;  4HWC A;  4NXN T;  4LF9 T;  2FUP A;  5FKY A;  2MAW A;  4CN4 A;  2JQH A;  2X0H A;  3N2K E;  4AKR B;  3AA1 B;  3VKH A;  1VOM A;  4HTE A;  1HNZ T;  4JYA T;  5FXX A;  2W4X A;  3OYZ A;  3AA0 B;  1XDP A;  2CBI A;  2XJ7 A;  4H9N C;  4C91 A;  3KVA A;  3QOF A;  4X66 T;  2W66 A;  3PUY F;  4FI5 A;  1YD8 G;  4UXN B;  4KX6 A;  2X67 A;  2XQ4 A;  4DV4 T;  1N34 T;  4QWN B;  2XQA A;  4LF5 T;  1ZHC A;  3N9O A;  1Y01 A;  2LRK A;  5FMN A;  5JRE A;  1T8B A;  2Q9Q D;  5LBQ B;  1E2A A;  1FJG T;  4Z91 A;  4F6R C;  3RYF E;  4HFV A;  4JUY A;  4LFC T;  2YU1 A;  1JNR A;  5HYA A;  4EED A;  5HEO A;  3NRY A;  4KP3 C;  4OX9 T;  4DR4 T;  4COF A;  5HXE A;  4EZH A;  2PFV A;  2KIN B;  2I59 A;  3K1S A;  2EHO B;  2PTF A;  3R6N A;  2JQQ A;  2BKP A;  2JMH A;  4HFB A;  3TKL B;  3UFE A;  3QC9 A;  4HEA A;  3P4Q A;  5HXC A;  3UUX B;  2WU2 A;  5HWX A;  4PK4 A;  4EZ4 A;  4GKK T;  5JVD E;  5LHH B;  2CLY C;  2VQE T;  4LMJ A;  4ZS3 A;  5FVK A;  1D0Y A;  3RIU A;  2Q9Q C;  4IE4 A;  5EK3 A;  4UF0 B;  1YQ4 A;  2CMR A;  1MIW A;  3BQI A;  4TWH A;  1UGO A;  4J2C A;  3PU3 A;  4DUY T;  5HWY A;  1XDO A;  3PDY A;  3RI5 A;  3TLT A;  4ZS2 A;  5DJQ C;  4L0R A;  1NWM X;  4PJM A;  2V8S V;  1US7 B;  4AIS A;  1J5E T;  3B57 A;  3ZYK A;  2J47 A;  3JAD A;  5ABH A;  3PTR B;  4O8S A;  3RC8 A;  4U7I A;  4O4I E;  2FJD A;  1QSD A;  4FJO A;  3P4S A;  4DMV A;  2ODV A;  2AXD S;  4XBF B;  2CM0 A;  4XAX B;  3AEE A;  2WZH A;  4I4T E;  1U5P A;  3CK6 A;  5HEJ A;  1D0X A;  2HPL A;  2WSS V;  3S4U A;  5JDL A;  5ADX L;  5AQU B;  3CVR A;  1FMV A;  2ODU A;  3NWI A;  4HFI A;  3ZN1 B;  2X66 A;  5LJN A;  5HEU A;  4B6X A;  4B3M T;  5HEG A;  4YHH T;  2C0S A;  3SOL A;  5HCJ A;  4DBQ A;  2LHN A;  2MBG A;  2NW8 A;  4EYY R;  1IBM T;  1WCR A;  3C50 A;  5LHI B;  2DL1 A;  3TLV A;  2BS4 A;  3P4W A;  3KVB A;  3T1H T;  4ILU A;  4YSX A;  2XPK A;  4CN6 A;  5IYZ E;  4PW8 A;  3AE6 A;  5F3J A;  2HHH T;  4HKA A;  4JI4 T;  1OED B;  3HKC E;  3IA3 A;  2WY2 A;  2Y6X A;  2UUC T;  4DV7 T;  2J1D G;  2WP9 A;  1N32 T;  2BVL A;  5IUX A;  1HNX T;  2VVN A;  2X51 A;  3AEG A;  4UIG A;  1QUU A;  1ZP0 A;  2LSI A;  2RA1 A;  3CIR A;  5FVL A;  2LT3 A;  5HAX A;  1N33 T;  2JRK A;  2BS2 A;  2LLY A;  2I6H A;  3QNU A;  4KI0 F;  4NUU A;  4DO0 A;  5FY0 A;  1X9B A;  2LKG A;  4OHF A;  1WR0 A;  2W0G A;  5CJ5 A;  3RC3 A;  2IHR 1;  2BS3 A;  5FL1 A;  3KBT A;  2C5K T;  2X68 A;  3MA9 A;  3PUQ A;  2XHE B;  3ONL C;  3A5X A;  1BR1 A;  4IE0 A;  2RPA A;  5FYM A;  2KZ7 B;  4AKI A;  1LVF A;  4H9S E;  5LMU T;  4CXY A;  2NWB A;  1XNR T;  1DU2 A;  4PK5 A;  4YJ2 E;  2DCF A;  3O4X E;  4QXC B;  2CPT A;  1LKX A;  2IML A;  3AA7 B;  4WBO A;  4EAH A;  4U2Z A;  2V7M A;  1NEN A;  5H6Q B;  2V7J A;  5M4Y A;  2ZM8 A;  3UUB A;  1IJ5 A;  2K5B B;  2KLQ A;  3QB5 K;  4IT4 A;  2XQ7 A;  5ETW A;  5L4H A;  3IEE A;  4IST A;  4WW0 A;  4QH1 A;  3RLF F;  1YKH B;  2XM1 A;  3FZK B;  4MHC A;  5JTG A;  3LSV A;  3MKD A;  2XQY A;  2A9U A;  2YEV C;  2YDS A;  4JI6 T;  1FIO A;  1U4Q A;  4UEM A;  2XQ9 A;  2JPF A;  3Q5E A;  5AQR B;  3GMI A;  2B76 A;  2VK9 A;  3NRX A;  3SFD A;  2XZE A;  2H89 A;  4IIJ E;  4HWF A;  4E7Z A;  3GN5 B;  3UU5 A;  5LXT E;  1KNP A;  2XY8 B;  3N2O A;  5EZY E;  1HNW T;  3LK4 2;  3W15 B;  4CI3 B;  3AAE B;  2LJL A;  4UVA B;  2K24 A;  3OKQ A;  1IJ6 A;  1Z8U A;  3ZCI A;  4K0K T;  3VKG A;  2X9X A;  1VCT A;  3C4X A;  2NW7 A;  3EAM A;  3JC6 D;  2E5L T;  3C98 B;  4P1N A;  3KDS E;  3SS1 A;  3UU4 A;  1T72 A;  2HN2 A;  4ILB A;  2HPJ A;  3FBZ A;  4ZEY A;  4DUZ T;  5JH7 E;  2WWU A;  1WRD A;  4DV3 T;  1I6Z A;  5LOV E;  2CXD A;  3N9M A;  4TUY E;  4JEU B;  4ZI2 C;  1R8I A;  3LK3 B;  5L2L A;  4U31 A;  2ZMA A;  1UUS A;  2MPK A;  2CBJ A;  3C4W A;  2E2A A;  2X9H A;  3MK7 C;  4WZX A;  4ZI3 C;  5AQF B;  4DV2 T;  1UX4 A;  3AE1 A;  1I94 T;  1XWM A;  4QH4 A;  3O1I A;  2VUR A;  4ISS A;  1HG5 A;  1NEK A;  1UX5 A;  2N1G A;  2V7K A;  2HN1 A;  3JC6 C;  3L39 A;  3LBX B;  4AQF C;  1D1B A;  3DP7 A;  5J2U E;  1Y64 B;  3OBV E;  2X9W A;  4H9P C;  4JEH B;  1FEW A;  5LCY A;  3ZN0 B;  3E0Z A;  3HKD E;  5EK2 A;  4ZI2 D;  4O4H E;  2NTY A;  4AXP A;  2NP9 A;  5FP3 A;  4QXB B;  3Q5X A;  2UUA T;  1HTJ F;  2XQ6 A;  3Q5D A;  3RIF A;  5AQJ B;  3EI0 A;  1SA0 E;  2H7V C;  2H88 A;  3EDV A;  2W00 A;  2XQ8 A;  2GK9 A;  3L09 A;  4PNI A;  4PJL A;  4AKL A;  4WYV A;  4GKJ T;  1Z0P A;  2V5D A;  2J4G A;  4AIU A;  3J9X 1;  2PBI A;  5AQI B;  2L8K A;  2BKN A;  4IDN A;  2L9Q A;  3UT5 E;  2BZB A;  2OLT A;  5JDQ A;  1UCU A;  2W62 A;  2V26 A;  4X1Y E;  3VR9 A;  4AQG A;  4K0U A;  3RIA A;  2D0T A;  2K48 A;  4CI2 B;  4ZI3 D;  4ZZC A;  5DQW A;  4V1A v;  1HCI A;  3CX8 B;  3X1D A;  3ZKR A;  3DJB A;  1EZ3 A;  3HL6 A;  2ES0 A;  2V6X A;  2V6Y B;  1IZN B;  2VQF T;  4IRE A;  5L3E B;  1ZV4 X;  4TV8 E;  3VRA A;  3I0O A;  2KWH A;  1N36 T;  2ACX A;  2A72 A;  5L3G B;  5CA0 E;  2F4V T;  4IL9 A;  2VKD A;  2W2U A;  3CQX C;  3QK6 A;  4UF0 A;  1W0B A;  4EV6 A;  4X1I E;  4JI7 T;  3FZH B;  2JMK A;  2WU5 A;  1YQ3 A;  3L3P A;  2D9D A;  5CFB A;  3I9Y A;  2YK0 A;  2I0M A;  3H3M A;  4PAG A;  3PUW F;  3UFG A;  2LM2 A;  3TLW A;  3PUV F;  3ZEF B;  5JR9 C;  2E8I A;  3U78 A;  4LFA T;  1MIY A;  1SE7 A;  4CXW A;  2UXC T;  1UK5 A;  4QHO A;  4GYR A;  3M3Z B;  2CXL A;  2KWI B;  3AXJ A;  3N2G E;  4DND A;  4QX7 B;  3OTO T;  2LSG A;  3AE4 A;  5HCM A;  5JDM A;  2IC6 A;  4ILA A;  1MND A;  5HEH A;  3RYI E;  3FB2 A;  3CX6 B;  4IE6 A;  3TLS A;  3JAF A;  1D1C A;  5LNK A;  2K3W A;  4E7S A;  4GK0 E;  3O9X A;  4LF6 T;  3MXZ A;  3CQC B;  3RX6 A;  5BMV E;  4DR3 T;  3BK9 A;  1BR0 A;  4YT0 A;  1YKE B;  2QGS A;  2CXF A;  2H7O A;  2Q9Q B;  4IHJ E;  4AQY T;  5LB7 B;  2ZM2 A;  3FBL A;  2KMF A;  3KFW X;  3PV0 F;  4U7Y A;  3RKG A;  3ZLI A;  2WQY A;  3AEF A;  3RQW A;  2BDE A;  4JI1 T;  2WDQ A;  2IDO B;  2EHO C;  4HWI B;  1GQE A;  4OYJ A;  4TWD A;  4UV9 B;  3RYH E;  4DR2 T;  1VRB A;  5C2T A;  3J7Y q;  4ZXL A;  4MBQ A;  1SHZ C;  5FNV E;  3PUS A;  2MOZ A;  3OVU A;  2CLY B;  4I50 E;  2NW9 A;  4EGW A;  3FZM B;  4ANJ A;  4HFH A;  4HWH A;  3E22 E;  4DMW A;  5AQN B;  4ZHQ E;  2WAU A;  4X65 T;  3ETV A;  5F8P A;  5JDN A;  2BG9 A;  1KF6 A;  5AQO B;  2LSY A;  5JQG E;  2LRL A;  4X64 T;  5FL0 A;  5IWA T;  2V5C A;  4YFS A;  3VU7 H;  5C3J A;  3BQL A;  3N9Q A;  2YDQ A;  4P0A A;  3R84 B;  4CZZ B;  5F5W A;  2FBW A;  4ADZ A;  4YHJ A;  2CWO A;  3AED A;  2XAS B;  4GK5 E;  5ABF A;  1MMN A;  1WYC A;  3NBX X;  5FXV A;  4AKH A;  2CA5 A;  3K3N A;  5FY7 A;  2WWV A;  1OXZ A;  3N9L A;  2W63 A;  5LG4 A;  4NPP A;  2WB5 A;  4H9R C;  3ONJ A;  4U3C A;  1NAF A;  2XUE A;  5ABG A;  3ZJ2 A;  1MNE A;  5JRC A;  1M7K A;  1CUN A;  4GYS A;  5L3F B;  2WBL A;  1XMO T;  3T1Y T;  3V5S A;  4M1P A;  3F2E A;  4JI3 T;  2M67 A;  3RQU A;  2J62 A;  5JDH A;  1HS7 A;  1FMW A;  2BG9 E;  1X79 A;  3UU6 A;  5CGM A;  1UUR A;  3C4Z A;  1T98 A;  3K3O A;  3P7I A;  2LOS A;  4EIW A;  2XAF B;  3AEB A;  2WCA A;  3TLU A;  2YDR A;  5J1G A; 
#chains in the Genus database with same CATH homology
 5AQM B;  3FZH B;  5AQJ B;  1M62 A;  5AQH B;  2D9D A;  5AQS B;  1UGO A;  5AQK B;  4HWI B;  3FZL B;  5AQG B;  1I6Z A;  5AQI B;  1UK5 A;  3M3Z B;  3FZK B;  5AQL B;  1M7K A;  5AQQ B;  5AQF B;  3FZM B;  5AQV B;  4HWH A;  1T7S A;  3A8Y C;  5AQP B;  5AQN B;  5AQR B;  4HWF A;  3LDQ B;  5AQO B;  4HWC A;  5AQU B;  1HX1 B;  5AQT B;  3FZF B;  4HWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...