1HX1B

Crystal structure of a bag domain in complex with the hsc70 atpase domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Bag/Hsc70 complex: convergent functional evolution of Hsp70 nucleotide exchange factors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone/chaperone inhibitor
molecule keywords Heat shock 70 kDa protein 8
total genus 45
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2001-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1hx1B00
5AQKB 2D9DA 3LDQB 5AQIB 5AQOB 1UGOA 3FZLB 5AQNB 5AQRB 5AQHB 1M62A 4HWFA 1T7SA 5AQPB 1I6ZA 5AQSB 3A8YC 3M3ZB 4HWDA 4HWHA 1M7KA 4HWCA 4HWIB 3FZHB 5AQUB 5AQQB 5AQJB 5AQTB 5AQMB 1UK5A 3FZKB 5AQVB 5AQGB 3FZMB 3FZFB 1HX1B 5AQFB 5AQLB
chains in the Genus database with same CATH superfamily
3RQUA 1NWMX 4PAGA 3K3OA 2WQYA 3SRZA 5FNVE 4EB6E 2UXNB 2GK9A 3K3NA 2BG9A 4WYVA 3UFGA 2PTFA 4LMKA 1DU2A 4JYAT 2CLYB 4LF7T 4JI2T 5AFUL 1US7B 4CZZB 4M1PA 2AXDS 2WWVA 1XZYA 2N9DA 2ZM8A 3AE7A 4JBWF 4AKLA 3AEAA 3RIUC 3KBTA 3UT5E 5M4YA 2DWKA 1GQEA 2KXPB 1D0XA 3D0TA 1E1HB 2VL8A 2VASA 2FJEA 1SHZC 3AA7B 4O4JE 3HA4A 2LLYA 1OXZA 3FZHB 4H63V 3C64A 4Z8XA 3SFEA 2VVSA 1UK5A 4BA9A 4HE8A 5AQGB 2MAWA 4DUYT 4DR7T 4YTNA 2ES0A 5LJMA 2YOEA 3MACA 3N2OA 3ZT5A 2LT3A 4B3TT 2VURA 1XWMA 3VRBA 2XY8B 4AXPA 3JADA 3ONJA 2XPKA 2K3WA 3U78A 2WAUA 4HN9A 3RIFA 3KVAA 3O4XE 4U72A 5ABFB 3L8RA 1S94A 1UGOA 4C90A 4LMJA 1CUNA 2BBHA 4MALA 3AE6A 3VHLA 3X1DA 3ZMSB 3QUJA 2YEVC 2YU1A 3NRYA 3QB5A 1FIOA 4AKRB 4ERRA 2JQQA 3LK3B 2I6HA 4ZZCA 4TZ4C 4ZOLE 2Y8DA 3JC6D 3J9X1 2Z6EA 2X67A 3VKHA 4DV3T 4KHPT 4UV8B 1HG2A 3ZSTA 2ZM6T 2CLYC 4IDPA 4CN4A 4ZHQE 2K24A 3K8PC 2V7LA 3NRXA 3J7Yq 3I0OA 5LP6E 5JRCB 4KI0F 4L9IA 4TV9E 2OV9A 3EAMA 4IE4A 4LFBT 2V6YB 2X0LB 1HX1B 4DMWA 5AQLB 3AE9A 3EDUA 4KMCA 3ZYKA 4ADZA 4EXTA 2VQFT 4OYJA 3RYCE 4AQYT 4EYYR 1HX8A 3EHZA 4PFOA 3ETVA 4U7YA 4ZXLA 3RRWA 5LHHB 4DUZT 4PK5A 1H7CA 4NXNT 1UUSA 3T1YT 4YJ3E 3BQLA 4DNDA 4CI1B 2V7KA 4HFBA 4IE0A 4EYUA 3EUHA 5FP3A 2CWYA 2HN2A 3C4XA 3CQXC 2JMKA 1MNEA 3UU5A 5LXTE 2J4GA 3N2KE 4DBRA 5ABEA 3M3ZB 5HXHA 4HTEA 4ISTA 3GWHA 2UXXB 4TWHA 4A5XA 1YQ3A 5ABGA 2KNDA 1HTJF 2UXDT 2Q9QA 4QXBB 4DV7T 4HFIA 5JVDE 1WYBA 2KLQA 3AE8A 3HR0A 5AQVB 3ZSSA 2UUAT 2LSIA 4ZS2A 2C5JA 2WDVA 3ZJ2A 3RC8A 2YDSA 1IZNB 4I43B 2CXLA 2WB5A 1IBLT 4JI6T 2FJBA 2WWUA 3F2EA 2L3LA 2CM0A 4PW8A 5LCYA 3Q5WA 4TNVA 5CB4E 4UIGA 4HKAA 1UCUA 1U4QA 3P8CD 5HAXA 4CI3B 5ABFA 2LSJA 3WAJA 4PJJA 2PFVA 4DV6T 1B7TA 4HFVA 2QVAA 3C51A 3OBVE 5EK3A 5JREA 1MMGA 3TLVA 5KMGP 5LNKA 2IW5B 1NAFA 1CHUA 2CBIA 4B3ST 4TV8E 4COFA 3P50A 3FXDB 1FMWA 2KINB 3GN5B 4CXWA 4GKJT 3VRAA 3FXEB 3ZCIA 3CIRA 3CMLA 3QOFA 2Q9QB 4O4HE 2BG9B 1MMAA 3F57A 3NWIA 4DVDA 4EV6A 4PJMA 3O9XA 1R8IA 4B3RT 2V1DB 5E0OA 2BKNA 2AE9A 3CVRA 4G2AA 4H9RC 5JR9C 4UVAB 4X1IE 4YFSA 2VK9A 2I59A 3Q5XA 5KX5E 4HFCA 2DWGA 5L3EB 4TNWA 4AI6A 3DJBA 4TN7B 5FMNA 2IIUA 2LJLA 3TLSA 3ZYMA 2BVLA 1XDOA 4JV5T 1M62A 1QLBA 3AEBA 1J5WA 4HFHA 3KV6A 4YHJA 1OEDC 2NOXA 2QGSA 2XAGB 3ZMZB 4CXXA 5IWAT 3A8YC 2D2SA 3RIAA 3WAKA 4ILBA 2N1GA 2XQAA 4HWDA 3PUWF 3ZMUB 2WY2A 3LFMA 4HWIB 3P4WA 4PJNA 3VR9A 5HWYA 4PNIA 5AQUB 2WCAA 4CI2B 5AQJB 2J62A 4HEAA 5TAOA 4ZI2D 4ZS3A 3MZKB 5JRCA 3PUGA 3O1JA 4OYKA 4YY3T 4DR1T 3UUNA 5HEGA 3V5SA 2D9DA 4NUUA 1LKXA 5BMVE 2XASB 4UVCB 5AQOB 5HEOA 2KZ7B 3RQWA 3Q5DA 3I9YA 3HL6A 4EOZB 5FXZA 4ZI2C 5CGMA 5HWXA 2XSAA 3PUAA 3CX6B 3PV0F 3HI2A 4QWNB 2ZM0A 1MIVA 1WLXA 5J2TE 4JI0T 3Q5EA 2B1EA 4KHZF 4X1KE 2J47A 3PUSA 1QSDA 5AQSB 4KBMB 1YD8G 2H89A 3C98B 2Q9QD 3L3PA 3H3AA 3PUYF 2BVMA 4IDQA 4U2ZA 5FKYA 2K5BB 4CQIA 2LKGA 2ODUA 2Y48B 3U3IA 4YXDA 4NPPA 5JDMA 2BDEA 2MPKA 4L5GA 4U3CA 3MK7C 1XNRT 4TUYE 3EI0A 4AKIA 1IAPA 3CX7B 4ISSA 4PK6A 2QYWA 5CA1E 2XZEA 1YW0A 3DTOA 1MIWA 1W09A 2OA5A 4ILUA 4ZI7E 4LF6T 3NZPA 1WRDA 4K0UA 3K3QC 2Q9QC 5AQKB 2E5VA 5HXEA 5HYAA 4U74A 5LG3A 2CRBA 3AVRA 4P0AA 3RH3A 3CPZA 1OEDA 3AEDA 3OYZA 3PTRB 3AE3A 3ETUA 1T72A 3T8OA 3ZC0A 2UXCT 2WZIA 2LHNA 3LK42 3ONLC 2W2UA 4PK4A 2E9XB 1MMDA 5L4HA 4DMVA 4HGAA 5L3GB 4LF5T 1HCIA 2A9UA 2QA7A 3LBXB 3PU3A 5GONE 2YN6A 3ESLA 3M65A 4XZCA 5J0ZA 1X9BA 3RYIE 1HFAA 4JI4T 5L3DB 4I0UA 4XBFB 3PUXF 4TX5A 4EGWA 3RHWA 2DI4A 5L2LA 1HR0T 2HHHT 2V7IA 3IBPA 2CXFA 2VKDA 5EK2A 1MNDA 2BS4A 2X0HA 3HKEE 4QX8B 2XAHB 3UUMA 4X66T 5CJ5A 2HN1A 2IAKA 3ZC1A 2IC9A 2V8SV 3HKBE 4OFZA 2YKSA 4Q25A 1JNRA 4NXMT 3RKGA 1XNQT 4MBQA 3FBZA 1YXRA 5DQVA 3FZLB 5FY7A 1OEDB 1W9RA 4WBOA 3E22E 4X20E 2FUPA 3AAEB 4YHHT 5BR8T 4OHFA 2V6XA 5EZYE 3RGLA 1SA0E 4AISA 1BR4A 1SE7A 3AE1A 4DR2T 3VKGA 2W66A 4GOUA 4EZHA 5JR9B 4JEUB 4OK0A 5JDNA 3OPCA 1LVKA 4OX9T 1BR0A 3DP7A 3FHNA 2CXDA 4WW0A 2WM9A 5HCMA 3Q9DA 4YSYA 4DR6T 3P4PA 1BR1A 2XJ7A 3A5XA 2N2NA 3PJAA 2XQYA 3JCFA 2V7JA 2XUEA 2KMFA 2LM2A 3LSVA 1HNZT 1VRBA 2WZHA 1G8XA 2DNXA 2WDRA 3AE4A 1WCRA 1YKHB 1ZHCA 2CMRA 2WBLA 3S4UA 5JDLA 4DR4T 3KBUA 3LDQB 4WNKA 4JI7T 3UQ4A 1OWAA 3AXJA 3OJAA 2VL0A 3RI5A 2JMHA 3HKDE 5HEUA 1KNZA 3N9OA 1NENA 4DR3T 2D0UA 2UUCT 3KDSE 3Q2MA 1EZ3A 3KFWX 1T8BA 2JJ9A 2WU5A 3WI3A 3ONXA 5C2TA 1IBKT 3I9WA 5L3FB 4JI3T 2YINA 1VCTA 4QXCB 3JC6C 4DV4T 2LRKA 4A56A 5LGTB 5FYMA 4QH4A 3TLTA 3UU4A 2W62A 4QXHB 2HPJA 3EVYA 1N36T 4BJNA 4DO0A 1UURA 2LSGA 4IDNA 3TKLB 1FMVA 3SFDA 4GKKT 1HS7A 4QKNA 2W63A 3UTKA 5DABA 2MOZA 4QH5A 2XQ5A 1YKEB 3MXZA 5HXCA 5A1LA 2YDQA 5JH7E 1W0BA 4EEBA 5LMNT 2VWAA 2YU2A 2NW9A 2JQKA 4IE5A 2OLTA 2R6GF 4UEMA 5LOVE 2M6IA 4JI8T 4AKGA 3W15B 2XAFB 5EK4A 3I1AA 1IJ6A 2C5IT 2BKPA 2E8IA 2WS3A 4H9OC 4PJLA 3R84B 3VR8A 1SUMB 4IHJE 4DR5T 4AKHA 2ZLYA 1D1BA 5JDGA 3IF8B 4TWFA 2A2FX 3RLFF 2JPFA 4FI5A 1ZOYA 5FXVA 4U7IA 4KUMB 5ETWA 2JQHA 2ACZA 5AQQB 4Z91A 5KXJA 2E5LT 4QHOA 1Y64B 4JI1T 5FL0A 3N9MA 4P1NA 4WBNE 1T98A 2M67A 3H3MA 1G73A 3IA3A 2KT9A 2A3DA 3AEFA 3CK6A 3FZFB 2C0SA 4JUYA 2VB6A 3CX8B 5JDQA 2XQ9A 3ZN1B 4GYSA 4X5TA 4E7ZA 1BR2A 1D0YA 3SOLA 2BS2A 4E7SA 3SWHA 4H9NC 5FVKA 3QC9A 5AQNB 1KNPA 3EDVA 2LSKA 4X1YE 4X64T 2CCQA 3N9LA 4IDZA 4O4IE 5JQGE 3IHRA 2XSBA 2V7MA 3PUZF 4HFDA 3RF1A 2IUBA 4UVBB 5HXRA 4JEHB 4DV0T 2K9AA 4AIUA 3RIUA 2XQ6A 4IGUA 1WR0A 4BAYB 2M6BA 1N34T 4J2CA 4UF0B 1X79A 4Z90A 2VKHA 1N33T 2PG8A 2VKJA 2CWOA 5AQTB 4CXYA 1UX5A 3FZKB 5H6QB 3VU7H 2J1DG 2K48A 2L8KA 1I94T 1N32T 4GYRA 2BKOA 5LGUB 3F31A 2XM2A 2ODVA 3OYXA 2HH7A 4ASKA 5J2UE 4IL4A 3B57A 1ZKEA 3MA9A 2C5KT 2MBGA 1VOMA 4LFAT 3UU3A 1QUUA 2FJDA 4AQGA 2JRKA 3N9PA 1XDPA 4HFEA 3UFEA 4A98A 2WSSV 1OEDE 2NP9A 2F4VT 5J1GA 2NTYA 1JNZA 1V9DA 4U31A 5IUXA 3CQCB 1HNWT 2FJAA 4X62T 4MLKA 2L9QA 4H9QC 5FXXA 3RYFE 2V26A 4EZ4A 5JR9A 2XQ3A 1KK7A 3HKCE 4F6RC 2XTLA 5L47A 4L0RA 2XAJB 4O4LE 5C3JA 5LBMA 3AAAB 1Z0PA 1J1JA 4IT4A 4MHCA 1WYCA 5H6RB 2X68A 3NVOA 2LKHA 4LF8T 3CWZB 3UUBA 1W0AA 5CA0E 5LG4A 3UQ7A 4DV5T 4P0BA 2NW7A 3FB2A 4IE7A 3PDYA 3C4WA 3GA8A 3LK2B 3KV9A 3ABVA 3OVUA 5FVLA 3AXJB 4N78D 4EIWA 1FEWA 2I0MA 5JDFA 2HPLA 2KSRA 3PJAJ 2NR4A 5LA6E 4C91A 4EAHA 3ZLIA 2Y6XA 3OKQA 4ZZBA 2G0UA 3BK9A 4LMLA 3R6NA 2H3RA 1WR6A 2UUBT 4V1Av 2RA1A 5F8PA 1IBMT 3ZJ1A 4CN6A 1J5ET 1D0ZA 4H9SE 4AQFC 4DIDB 5JTGA 3ZYLA 3O1HA 3T1HT 2X9WA 2CPTA 5FY0A 3CKDA 1WFDA 4KP3C 2H88A 4NUVA 4HWFA 1T7SA 5AQPB 2EHOC 3KVBA 3LG7A 2CBJA 1XMQT 3KV5A 2LRLA 4AQFA 3AE5A 2LM9A 2V5CA 2LE8A 2W67A 3PUQA 5HCJA 4TWDA 3RPUA 1D1AA 4HWHA 3RX6A 5CFBA 5L4EA 2XQ7A 1M7KA 1Z8UA 3P4SA 4IIJE 5LMUT 2NW8A 2WDQA 2VQET 2X66A 3AB3B 3B5MA 2IMLA 4FJOA 1VCSA 2SPCA 3RC3A 5HXSA 3PU8A 4KX6A 3IEEA 3TLUA 5DJQC 3OTOT 3ANWA 2PJQA 5LHIB 4DBQA 3P7IA 2H7VC 4BJMA 3E08A 2BZBA 5LBQB 4I55E 2XHEB 2D5UA 4JI5T 4EEDA 2W4XA 3AAIA 3PUVF 2FBWA 2H7OA 5FXWA 4MFRA 5LJNA 4DV1T 4YLHA 2V6YA 3ZEFB 2P9BA 1HG5A 2CHNA 4ZI3D 3QK6A 1LVFA 2CA5A 2E9XC 1ZEEA 3NBXX 4GIWA 4LF9T 2W00A 3QNUA 2KWHA 3ZN0B 2DLRA 1FJGT 2CEAA 3FBLA 4UELA 3AA6B 4A97A 3NKZA 5JDHA 2YK0A 2RPAA 3P4QA 4QH1A 5L3CB 4X65T 3AEEA 2D0TA 3N5LA 1YQ4A 4IL9A 4GK0E 3JAEA 1KEYA 3ZKRA 2W61A 4UR9A 3PE0A 4XAXB 1O3XA 2X51A 1KF6A 3L39A 3NZQA 3ZT7A 2QRXA 5F5WA 2CE7A 5HEJA 2UU9T 2JIWA 5ADXL 5LGNB 3K1SA 4H9PC 2V5DA 4WZXA 3H37A 2E2AA 3L09A 2LHRA 2VVNA 3E0ZA 3AECA 2KWIB 1XMOT 1HNXT 3CQGB 1KFYA 1D1CA 3AVSA 4O2BE 5FY1A 3ZCJA 4YT0A 3ANWB 1U5PA 5FL1A 1LRZA 1Y01A 2IDOB 1IJ5A 2IHR1 4IREA 2WMOA 2XQ8A 2E9XD 2MTQA 3MJXA 5AQHB 5F3JA 3AA1B 2X9YA 4ZI3C 4YSZA 5LHGB 2BBJA 2WU2A 3AA0B 5HEHA 3UUXB 3ZMVB 4ANJA 4ZEYA 4DV2T 1MMNA 4LFCT 2ACXA 4UV9B 4YJ2E 4K0KT 2X9XA 1E2AA 4LF4T 4IDOA 4U33A 2PBIA 5L3BB 1MIYA 5IHYA 1AJ3A 3KINB 3B13A 3EABA 4U2YA 4O8SA 4B3MT 3A7MA 5IYZE 3GN5A 5AQMB 5C8YE 3C4ZA 4ILAA 3FZMB 1E7PA 2LSYA 3UU8A 2NWBA 2XM1A 2A72A 3LBXA 4IE6A 2WMNA 2RP4A 2E9XA 4O2AE 3ZT6A 4F8HA 4I4TE 2DHRA 2EHOD 4G63A 1KNRA 4H63H 5AQIB 3RRCA 2BG9E 5KDMC 4JLEA 2MYSA 2X0YA 2EHOA 3TLWA 4NIQA 4CN1A 3BQKA 2EHOB 2LOSA 3GMIA 4I50E 2ZM2A 5AQRB 3RYHE 3MKDA 3N9NA 5LYJE 1I6ZA 2NTXA 1ZV4X 2LOPA 2VKOA 4YSXA 5ABHA 4P09A 4ILCA 2W0GA 4QX7B 2CHOA 3LJCA 3O1IA 3UULA 3N2GE 2UXBT 3JAFA 4HWCA 1NEKA 2BS3A 2IC6A 2XQ4A 2JQ9A 2DCFA 3BQIA 3P4RA 4PFPA 2B76A 1HF8A 3G06A 3KV4A 4UXNB 1L0VA 3RKOA 4B6XA 1ZP0A 1UX4A 2XAQB 2X9HA 3I0QA 4UF0A 2DL1A 2BG9C 5LB7B 2ZMAA 3QB5K 3UU6A 3AEGA 3PURA 3ZMTB 2LEHA 4YTPA 2WP9A 3N9QA 4GK5E 1S35A 4YTMA 3SS1A 3C50A 3ZPOA 5AQFB 3AE2A 5DQWA 3V5UA 2YDRA
chains in the Genus database with same CATH topology
5AQKB 2D9DA 3LDQB 5AQIB 5AQOB 1UGOA 3FZLB 5AQNB 5AQRB 5AQHB 1M62A 4HWFA 1T7SA 5AQPB 1I6ZA 5AQSB 3A8YC 3M3ZB 4HWDA 4HWHA 1M7KA 4HWCA 4HWIB 3FZHB 5AQUB 5AQQB 5AQJB 5AQTB 5AQMB 1UK5A 3FZKB 5AQVB 5AQGB 3FZMB 3FZFB 1HX1B 5AQFB 5AQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQK B;  2D9D A;  3LDQ B;  5AQI B;  5AQO B;  1UGO A;  3FZL B;  5AQN B;  5AQR B;  5AQH B;  1M62 A;  4HWF A;  1T7S A;  5AQP B;  1I6Z A;  5AQS B;  3A8Y C;  3M3Z B;  4HWD A;  4HWH A;  1M7K A;  4HWC A;  4HWI B;  3FZH B;  5AQU B;  5AQQ B;  5AQJ B;  5AQT B;  5AQM B;  1UK5 A;  3FZK B;  5AQV B;  5AQG B;  3FZM B;  3FZF B;  1HX1 B;  5AQF B;  5AQL B; 
#chains in the Genus database with same CATH topology
 3RQU A;  1NWM X;  4PAG A;  3K3O A;  2WQY A;  3SRZ A;  5FNV E;  4EB6 E;  2UXN B;  2GK9 A;  3K3N A;  2BG9 A;  4WYV A;  3UFG A;  2PTF A;  4LMK A;  1DU2 A;  4JYA T;  2CLY B;  4LF7 T;  4JI2 T;  5AFU L;  1US7 B;  4CZZ B;  4M1P A;  2AXD S;  2WWV A;  1XZY A;  2N9D A;  2ZM8 A;  3AE7 A;  4JBW F;  4AKL A;  3AEA A;  3RIU C;  3KBT A;  3UT5 E;  5M4Y A;  2DWK A;  1GQE A;  2KXP B;  1D0X A;  3D0T A;  1E1H B;  2VL8 A;  2VAS A;  2FJE A;  1SHZ C;  3AA7 B;  4O4J E;  3HA4 A;  2LLY A;  1OXZ A;  3FZH B;  4H63 V;  3C64 A;  4Z8X A;  3SFE A;  2VVS A;  1UK5 A;  4BA9 A;  4HE8 A;  5AQG B;  2MAW A;  4DUY T;  4DR7 T;  4YTN A;  2ES0 A;  5LJM A;  2YOE A;  3MAC A;  3N2O A;  3ZT5 A;  2LT3 A;  4B3T T;  2VUR A;  1XWM A;  3VRB A;  2XY8 B;  4AXP A;  3JAD A;  3ONJ A;  2XPK A;  2K3W A;  3U78 A;  2WAU A;  4HN9 A;  3RIF A;  3KVA A;  3O4X E;  4U72 A;  5ABF B;  3L8R A;  1S94 A;  1UGO A;  4C90 A;  4LMJ A;  1CUN A;  2BBH A;  4MAL A;  3AE6 A;  3VHL A;  3X1D A;  3ZMS B;  3QUJ A;  2YEV C;  2YU1 A;  3NRY A;  3QB5 A;  1FIO A;  4AKR B;  4ERR A;  2JQQ A;  3LK3 B;  2I6H A;  4ZZC A;  4TZ4 C;  4ZOL E;  2Y8D A;  3JC6 D;  3J9X 1;  2Z6E A;  2X67 A;  3VKH A;  4DV3 T;  4KHP T;  4UV8 B;  1HG2 A;  3ZST A;  2ZM6 T;  2CLY C;  4IDP A;  4CN4 A;  4ZHQ E;  2K24 A;  3K8P C;  2V7L A;  3NRX A;  3J7Y q;  3I0O A;  5LP6 E;  5JRC B;  4KI0 F;  4L9I A;  4TV9 E;  2OV9 A;  3EAM A;  4IE4 A;  4LFB T;  2V6Y B;  2X0L B;  1HX1 B;  4DMW A;  5AQL B;  3AE9 A;  3EDU A;  4KMC A;  3ZYK A;  4ADZ A;  4EXT A;  2VQF T;  4OYJ A;  3RYC E;  4AQY T;  4EYY R;  1HX8 A;  3EHZ A;  4PFO A;  3ETV A;  4U7Y A;  4ZXL A;  3RRW A;  5LHH B;  4DUZ T;  4PK5 A;  1H7C A;  4NXN T;  1UUS A;  3T1Y T;  4YJ3 E;  3BQL A;  4DND A;  4CI1 B;  2V7K A;  4HFB A;  4IE0 A;  4EYU A;  3EUH A;  5FP3 A;  2CWY A;  2HN2 A;  3C4X A;  3CQX C;  2JMK A;  1MNE A;  3UU5 A;  5LXT E;  2J4G A;  3N2K E;  4DBR A;  5ABE A;  3M3Z B;  5HXH A;  4HTE A;  4IST A;  3GWH A;  2UXX B;  4TWH A;  4A5X A;  1YQ3 A;  5ABG A;  2KND A;  1HTJ F;  2UXD T;  2Q9Q A;  4QXB B;  4DV7 T;  4HFI A;  5JVD E;  1WYB A;  2KLQ A;  3AE8 A;  3HR0 A;  5AQV B;  3ZSS A;  2UUA T;  2LSI A;  4ZS2 A;  2C5J A;  2WDV A;  3ZJ2 A;  3RC8 A;  2YDS A;  1IZN B;  4I43 B;  2CXL A;  2WB5 A;  1IBL T;  4JI6 T;  2FJB A;  2WWU A;  3F2E A;  2L3L A;  2CM0 A;  4PW8 A;  5LCY A;  3Q5W A;  4TNV A;  5CB4 E;  4UIG A;  4HKA A;  1UCU A;  1U4Q A;  3P8C D;  5HAX A;  4CI3 B;  5ABF A;  2LSJ A;  3WAJ A;  4PJJ A;  2PFV A;  4DV6 T;  1B7T A;  4HFV A;  2QVA A;  3C51 A;  3OBV E;  5EK3 A;  5JRE A;  1MMG A;  3TLV A;  5KMG P;  5LNK A;  2IW5 B;  1NAF A;  1CHU A;  2CBI A;  4B3S T;  4TV8 E;  4COF A;  3P50 A;  3FXD B;  1FMW A;  2KIN B;  3GN5 B;  4CXW A;  4GKJ T;  3VRA A;  3FXE B;  3ZCI A;  3CIR A;  3CML A;  3QOF A;  2Q9Q B;  4O4H E;  2BG9 B;  1MMA A;  3F57 A;  3NWI A;  4DVD A;  4EV6 A;  4PJM A;  3O9X A;  1R8I A;  4B3R T;  2V1D B;  5E0O A;  2BKN A;  2AE9 A;  3CVR A;  4G2A A;  4H9R C;  5JR9 C;  4UVA B;  4X1I E;  4YFS A;  2VK9 A;  2I59 A;  3Q5X A;  5KX5 E;  4HFC A;  2DWG A;  5L3E B;  4TNW A;  4AI6 A;  3DJB A;  4TN7 B;  5FMN A;  2IIU A;  2LJL A;  3TLS A;  3ZYM A;  2BVL A;  1XDO A;  4JV5 T;  1M62 A;  1QLB A;  3AEB A;  1J5W A;  4HFH A;  3KV6 A;  4YHJ A;  1OED C;  2NOX A;  2QGS A;  2XAG B;  3ZMZ B;  4CXX A;  5IWA T;  3A8Y C;  2D2S A;  3RIA A;  3WAK A;  4ILB A;  2N1G A;  2XQA A;  4HWD A;  3PUW F;  3ZMU B;  2WY2 A;  3LFM A;  4HWI B;  3P4W A;  4PJN A;  3VR9 A;  5HWY A;  4PNI A;  5AQU B;  2WCA A;  4CI2 B;  5AQJ B;  2J62 A;  4HEA A;  5TAO A;  4ZI2 D;  4ZS3 A;  3MZK B;  5JRC A;  3PUG A;  3O1J A;  4OYK A;  4YY3 T;  4DR1 T;  3UUN A;  5HEG A;  3V5S A;  2D9D A;  4NUU A;  1LKX A;  5BMV E;  2XAS B;  4UVC B;  5AQO B;  5HEO A;  2KZ7 B;  3RQW A;  3Q5D A;  3I9Y A;  3HL6 A;  4EOZ B;  5FXZ A;  4ZI2 C;  5CGM A;  5HWX A;  2XSA A;  3PUA A;  3CX6 B;  3PV0 F;  3HI2 A;  4QWN B;  2ZM0 A;  1MIV A;  1WLX A;  5J2T E;  4JI0 T;  3Q5E A;  2B1E A;  4KHZ F;  4X1K E;  2J47 A;  3PUS A;  1QSD A;  5AQS B;  4KBM B;  1YD8 G;  2H89 A;  3C98 B;  2Q9Q D;  3L3P A;  3H3A A;  3PUY F;  2BVM A;  4IDQ A;  4U2Z A;  5FKY A;  2K5B B;  4CQI A;  2LKG A;  2ODU A;  2Y48 B;  3U3I A;  4YXD A;  4NPP A;  5JDM A;  2BDE A;  2MPK A;  4L5G A;  4U3C A;  3MK7 C;  1XNR T;  4TUY E;  3EI0 A;  4AKI A;  1IAP A;  3CX7 B;  4ISS A;  4PK6 A;  2QYW A;  5CA1 E;  2XZE A;  1YW0 A;  3DTO A;  1MIW A;  1W09 A;  2OA5 A;  4ILU A;  4ZI7 E;  4LF6 T;  3NZP A;  1WRD A;  4K0U A;  3K3Q C;  2Q9Q C;  5AQK B;  2E5V A;  5HXE A;  5HYA A;  4U74 A;  5LG3 A;  2CRB A;  3AVR A;  4P0A A;  3RH3 A;  3CPZ A;  1OED A;  3AED A;  3OYZ A;  3PTR B;  3AE3 A;  3ETU A;  1T72 A;  3T8O A;  3ZC0 A;  2UXC T;  2WZI A;  2LHN A;  3LK4 2;  3ONL C;  2W2U A;  4PK4 A;  2E9X B;  1MMD A;  5L4H A;  4DMV A;  4HGA A;  5L3G B;  4LF5 T;  1HCI A;  2A9U A;  2QA7 A;  3LBX B;  3PU3 A;  5GON E;  2YN6 A;  3ESL A;  3M65 A;  4XZC A;  5J0Z A;  1X9B A;  3RYI E;  1HFA A;  4JI4 T;  5L3D B;  4I0U A;  4XBF B;  3PUX F;  4TX5 A;  4EGW A;  3RHW A;  2DI4 A;  5L2L A;  1HR0 T;  2HHH T;  2V7I A;  3IBP A;  2CXF A;  2VKD A;  5EK2 A;  1MND A;  2BS4 A;  2X0H A;  3HKE E;  4QX8 B;  2XAH B;  3UUM A;  4X66 T;  5CJ5 A;  2HN1 A;  2IAK A;  3ZC1 A;  2IC9 A;  2V8S V;  3HKB E;  4OFZ A;  2YKS A;  4Q25 A;  1JNR A;  4NXM T;  3RKG A;  1XNQ T;  4MBQ A;  3FBZ A;  1YXR A;  5DQV A;  3FZL B;  5FY7 A;  1OED B;  1W9R A;  4WBO A;  3E22 E;  4X20 E;  2FUP A;  3AAE B;  4YHH T;  5BR8 T;  4OHF A;  2V6X A;  5EZY E;  3RGL A;  1SA0 E;  4AIS A;  1BR4 A;  1SE7 A;  3AE1 A;  4DR2 T;  3VKG A;  2W66 A;  4GOU A;  4EZH A;  5JR9 B;  4JEU B;  4OK0 A;  5JDN A;  3OPC A;  1LVK A;  4OX9 T;  1BR0 A;  3DP7 A;  3FHN A;  2CXD A;  4WW0 A;  2WM9 A;  5HCM A;  3Q9D A;  4YSY A;  4DR6 T;  3P4P A;  1BR1 A;  2XJ7 A;  3A5X A;  2N2N A;  3PJA A;  2XQY A;  3JCF A;  2V7J A;  2XUE A;  2KMF A;  2LM2 A;  3LSV A;  1HNZ T;  1VRB A;  2WZH A;  1G8X A;  2DNX A;  2WDR A;  3AE4 A;  1WCR A;  1YKH B;  1ZHC A;  2CMR A;  2WBL A;  3S4U A;  5JDL A;  4DR4 T;  3KBU A;  3LDQ B;  4WNK A;  4JI7 T;  3UQ4 A;  1OWA A;  3AXJ A;  3OJA A;  2VL0 A;  3RI5 A;  2JMH A;  3HKD E;  5HEU A;  1KNZ A;  3N9O A;  1NEN A;  4DR3 T;  2D0U A;  2UUC T;  3KDS E;  3Q2M A;  1EZ3 A;  3KFW X;  1T8B A;  2JJ9 A;  2WU5 A;  3WI3 A;  3ONX A;  5C2T A;  1IBK T;  3I9W A;  5L3F B;  4JI3 T;  2YIN A;  1VCT A;  4QXC B;  3JC6 C;  4DV4 T;  2LRK A;  4A56 A;  5LGT B;  5FYM A;  4QH4 A;  3TLT A;  3UU4 A;  2W62 A;  4QXH B;  2HPJ A;  3EVY A;  1N36 T;  4BJN A;  4DO0 A;  1UUR A;  2LSG A;  4IDN A;  3TKL B;  1FMV A;  3SFD A;  4GKK T;  1HS7 A;  4QKN A;  2W63 A;  3UTK A;  5DAB A;  2MOZ A;  4QH5 A;  2XQ5 A;  1YKE B;  3MXZ A;  5HXC A;  5A1L A;  2YDQ A;  5JH7 E;  1W0B A;  4EEB A;  5LMN T;  2VWA A;  2YU2 A;  2NW9 A;  2JQK A;  4IE5 A;  2OLT A;  2R6G F;  4UEM A;  5LOV E;  2M6I A;  4JI8 T;  4AKG A;  3W15 B;  2XAF B;  5EK4 A;  3I1A A;  1IJ6 A;  2C5I T;  2BKP A;  2E8I A;  2WS3 A;  4H9O C;  4PJL A;  3R84 B;  3VR8 A;  1SUM B;  4IHJ E;  4DR5 T;  4AKH A;  2ZLY A;  1D1B A;  5JDG A;  3IF8 B;  4TWF A;  2A2F X;  3RLF F;  2JPF A;  4FI5 A;  1ZOY A;  5FXV A;  4U7I A;  4KUM B;  5ETW A;  2JQH A;  2ACZ A;  5AQQ B;  4Z91 A;  5KXJ A;  2E5L T;  4QHO A;  1Y64 B;  4JI1 T;  5FL0 A;  3N9M A;  4P1N A;  4WBN E;  1T98 A;  2M67 A;  3H3M A;  1G73 A;  3IA3 A;  2KT9 A;  2A3D A;  3AEF A;  3CK6 A;  3FZF B;  2C0S A;  4JUY A;  2VB6 A;  3CX8 B;  5JDQ A;  2XQ9 A;  3ZN1 B;  4GYS A;  4X5T A;  4E7Z A;  1BR2 A;  1D0Y A;  3SOL A;  2BS2 A;  4E7S A;  3SWH A;  4H9N C;  5FVK A;  3QC9 A;  5AQN B;  1KNP A;  3EDV A;  2LSK A;  4X1Y E;  4X64 T;  2CCQ A;  3N9L A;  4IDZ A;  4O4I E;  5JQG E;  3IHR A;  2XSB A;  2V7M A;  3PUZ F;  4HFD A;  3RF1 A;  2IUB A;  4UVB B;  5HXR A;  4JEH B;  4DV0 T;  2K9A A;  4AIU A;  3RIU A;  2XQ6 A;  4IGU A;  1WR0 A;  4BAY B;  2M6B A;  1N34 T;  4J2C A;  4UF0 B;  1X79 A;  4Z90 A;  2VKH A;  1N33 T;  2PG8 A;  2VKJ A;  2CWO A;  5AQT B;  4CXY A;  1UX5 A;  3FZK B;  5H6Q B;  3VU7 H;  2J1D G;  2K48 A;  2L8K A;  1I94 T;  1N32 T;  4GYR A;  2BKO A;  5LGU B;  3F31 A;  2XM2 A;  2ODV A;  3OYX A;  2HH7 A;  4ASK A;  5J2U E;  4IL4 A;  3B57 A;  1ZKE A;  3MA9 A;  2C5K T;  2MBG A;  1VOM A;  4LFA T;  3UU3 A;  1QUU A;  2FJD A;  4AQG A;  2JRK A;  3N9P A;  1XDP A;  4HFE A;  3UFE A;  4A98 A;  2WSS V;  1OED E;  2NP9 A;  2F4V T;  5J1G A;  2NTY A;  1JNZ A;  1V9D A;  4U31 A;  5IUX A;  3CQC B;  1HNW T;  2FJA A;  4X62 T;  4MLK A;  2L9Q A;  4H9Q C;  5FXX A;  3RYF E;  2V26 A;  4EZ4 A;  5JR9 A;  2XQ3 A;  1KK7 A;  3HKC E;  4F6R C;  2XTL A;  5L47 A;  4L0R A;  2XAJ B;  4O4L E;  5C3J A;  5LBM A;  3AAA B;  1Z0P A;  1J1J A;  4IT4 A;  4MHC A;  1WYC A;  5H6R B;  2X68 A;  3NVO A;  2LKH A;  4LF8 T;  3CWZ B;  3UUB A;  1W0A A;  5CA0 E;  5LG4 A;  3UQ7 A;  4DV5 T;  4P0B A;  2NW7 A;  3FB2 A;  4IE7 A;  3PDY A;  3C4W A;  3GA8 A;  3LK2 B;  3KV9 A;  3ABV A;  3OVU A;  5FVL A;  3AXJ B;  4N78 D;  4EIW A;  1FEW A;  2I0M A;  5JDF A;  2HPL A;  2KSR A;  3PJA J;  2NR4 A;  5LA6 E;  4C91 A;  4EAH A;  3ZLI A;  2Y6X A;  3OKQ A;  4ZZB A;  2G0U A;  3BK9 A;  4LML A;  3R6N A;  2H3R A;  1WR6 A;  2UUB T;  4V1A v;  2RA1 A;  5F8P A;  1IBM T;  3ZJ1 A;  4CN6 A;  1J5E T;  1D0Z A;  4H9S E;  4AQF C;  4DID B;  5JTG A;  3ZYL A;  3O1H A;  3T1H T;  2X9W A;  2CPT A;  5FY0 A;  3CKD A;  1WFD A;  4KP3 C;  2H88 A;  4NUV A;  4HWF A;  1T7S A;  5AQP B;  2EHO C;  3KVB A;  3LG7 A;  2CBJ A;  1XMQ T;  3KV5 A;  2LRL A;  4AQF A;  3AE5 A;  2LM9 A;  2V5C A;  2LE8 A;  2W67 A;  3PUQ A;  5HCJ A;  4TWD A;  3RPU A;  1D1A A;  4HWH A;  3RX6 A;  5CFB A;  5L4E A;  2XQ7 A;  1M7K A;  1Z8U A;  3P4S A;  4IIJ E;  5LMU T;  2NW8 A;  2WDQ A;  2VQE T;  2X66 A;  3AB3 B;  3B5M A;  2IML A;  4FJO A;  1VCS A;  2SPC A;  3RC3 A;  5HXS A;  3PU8 A;  4KX6 A;  3IEE A;  3TLU A;  5DJQ C;  3OTO T;  3ANW A;  2PJQ A;  5LHI B;  4DBQ A;  3P7I A;  2H7V C;  4BJM A;  3E08 A;  2BZB A;  5LBQ B;  4I55 E;  2XHE B;  2D5U A;  4JI5 T;  4EED A;  2W4X A;  3AAI A;  3PUV F;  2FBW A;  2H7O A;  5FXW A;  4MFR A;  5LJN A;  4DV1 T;  4YLH A;  2V6Y A;  3ZEF B;  2P9B A;  1HG5 A;  2CHN A;  4ZI3 D;  3QK6 A;  1LVF A;  2CA5 A;  2E9X C;  1ZEE A;  3NBX X;  4GIW A;  4LF9 T;  2W00 A;  3QNU A;  2KWH A;  3ZN0 B;  2DLR A;  1FJG T;  2CEA A;  3FBL A;  4UEL A;  3AA6 B;  4A97 A;  3NKZ A;  5JDH A;  2YK0 A;  2RPA A;  3P4Q A;  4QH1 A;  5L3C B;  4X65 T;  3AEE A;  2D0T A;  3N5L A;  1YQ4 A;  4IL9 A;  4GK0 E;  3JAE A;  1KEY A;  3ZKR A;  2W61 A;  4UR9 A;  3PE0 A;  4XAX B;  1O3X A;  2X51 A;  1KF6 A;  3L39 A;  3NZQ A;  3ZT7 A;  2QRX A;  5F5W A;  2CE7 A;  5HEJ A;  2UU9 T;  2JIW A;  5ADX L;  5LGN B;  3K1S A;  4H9P C;  2V5D A;  4WZX A;  3H37 A;  2E2A A;  3L09 A;  2LHR A;  2VVN A;  3E0Z A;  3AEC A;  2KWI B;  1XMO T;  1HNX T;  3CQG B;  1KFY A;  1D1C A;  3AVS A;  4O2B E;  5FY1 A;  3ZCJ A;  4YT0 A;  3ANW B;  1U5P A;  5FL1 A;  1LRZ A;  1Y01 A;  2IDO B;  1IJ5 A;  2IHR 1;  4IRE A;  2WMO A;  2XQ8 A;  2E9X D;  2MTQ A;  3MJX A;  5AQH B;  5F3J A;  3AA1 B;  2X9Y A;  4ZI3 C;  4YSZ A;  5LHG B;  2BBJ A;  2WU2 A;  3AA0 B;  5HEH A;  3UUX B;  3ZMV B;  4ANJ A;  4ZEY A;  4DV2 T;  1MMN A;  4LFC T;  2ACX A;  4UV9 B;  4YJ2 E;  4K0K T;  2X9X A;  1E2A A;  4LF4 T;  4IDO A;  4U33 A;  2PBI A;  5L3B B;  1MIY A;  5IHY A;  1AJ3 A;  3KIN B;  3B13 A;  3EAB A;  4U2Y A;  4O8S A;  4B3M T;  3A7M A;  5IYZ E;  3GN5 A;  5AQM B;  5C8Y E;  3C4Z A;  4ILA A;  3FZM B;  1E7P A;  2LSY A;  3UU8 A;  2NWB A;  2XM1 A;  2A72 A;  3LBX A;  4IE6 A;  2WMN A;  2RP4 A;  2E9X A;  4O2A E;  3ZT6 A;  4F8H A;  4I4T E;  2DHR A;  2EHO D;  4G63 A;  1KNR A;  4H63 H;  5AQI B;  3RRC A;  2BG9 E;  5KDM C;  4JLE A;  2MYS A;  2X0Y A;  2EHO A;  3TLW A;  4NIQ A;  4CN1 A;  3BQK A;  2EHO B;  2LOS A;  3GMI A;  4I50 E;  2ZM2 A;  5AQR B;  3RYH E;  3MKD A;  3N9N A;  5LYJ E;  1I6Z A;  2NTX A;  1ZV4 X;  2LOP A;  2VKO A;  4YSX A;  5ABH A;  4P09 A;  4ILC A;  2W0G A;  4QX7 B;  2CHO A;  3LJC A;  3O1I A;  3UUL A;  3N2G E;  2UXB T;  3JAF A;  4HWC A;  1NEK A;  2BS3 A;  2IC6 A;  2XQ4 A;  2JQ9 A;  2DCF A;  3BQI A;  3P4R A;  4PFP A;  2B76 A;  1HF8 A;  3G06 A;  3KV4 A;  4UXN B;  1L0V A;  3RKO A;  4B6X A;  1ZP0 A;  1UX4 A;  2XAQ B;  2X9H A;  3I0Q A;  4UF0 A;  2DL1 A;  2BG9 C;  5LB7 B;  2ZMA A;  3QB5 K;  3UU6 A;  3AEG A;  3PUR A;  3ZMT B;  2LEH A;  4YTP A;  2WP9 A;  3N9Q A;  4GK5 E;  1S35 A;  4YTM A;  3SS1 A;  3C50 A;  3ZPO A;  5AQF B;  3AE2 A;  5DQW A;  3V5U A;  2YDR A; 
#chains in the Genus database with same CATH homology
 5AQK B;  2D9D A;  3LDQ B;  5AQI B;  5AQO B;  1UGO A;  3FZL B;  5AQN B;  5AQR B;  5AQH B;  1M62 A;  4HWF A;  1T7S A;  5AQP B;  1I6Z A;  5AQS B;  3A8Y C;  3M3Z B;  4HWD A;  4HWH A;  1M7K A;  4HWC A;  4HWI B;  3FZH B;  5AQU B;  5AQQ B;  5AQJ B;  5AQT B;  5AQM B;  1UK5 A;  3FZK B;  5AQV B;  5AQG B;  3FZM B;  3FZF B;  1HX1 B;  5AQF B;  5AQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...