1HX1B

Crystal structure of a bag domain in complex with the hsc70 atpase domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock 70 kDa protein 8
publication title Structure of a Bag/Hsc70 complex: convergent functional evolution of Hsp70 nucleotide exchange factors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone/chaperone inhibitor
total genus 45
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2001-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1hx1B00
5AQOB 5AQJB 3FZHB 1UK5A 1HX1B 1M7KA 1I6ZA 4HWFA 3FZKB 3FZFB 5AQHB 3FZLB 4HWHA 5AQPB 5AQSB 3LDQB 5AQQB 3M3ZB 5AQLB 5AQNB 5AQTB 5AQIB 5AQVB 2D9DA 3FZMB 5AQKB 5AQGB 1UGOA 4HWIB 5AQRB 1T7SA 1M62A 4HWDA 5AQMB 3A8YC 5AQUB 4HWCA 5AQFB
chains in the Genus database with same CATH superfamily
2KSRA 3JAFA 2ZMAA 1IJ5A 3NKZA 4HE8A 3ZKRA 2XAHB 4I0UA 2Y8DA 5HXCA 2KT9A 5FY1A 4YY3T 1QUUA 4HFEA 4NXNT 2CHNA 5JDMA 4BJMA 4PFPA 4WNKA 2X67A 4HEAA 4JEHB 5M4YA 3ZCJA 4NUUA 5AQHB 4I50E 4HWHA 1VCSA 4DV5T 3RKGA 4QH5A 4EZHA 3FZMB 1WLXA 3AEGA 3N2OA 3HR0A 3GN5A 2BKPA 4BJNA 2CXDA 3ZT5A 2LSIA 2BVMA 3FXDB 4YTMA 5J2UE 3FB2A 3M3ZB 1FEWA 1UX4A 1LVKA 3WI3A 2NTYA 2KINB 3C4XA 2B76A 4NXMT 2D0UA 2L9QA 2W61A 4LFBT 3TLTA 3BK9A 3AVRA 3C64A 4IE0A 5LNKA 2CCQA 3JCFA 2I0MA 3JADA 4YJ2E 3T8OA 4HWIB 2E5VA 2A2FX 3BQLA 3SOLA 4KUMB 4DR3T 4DR5T 4TWFA 3LK3B 4HFHA 1HX1B 3L3PA 2CXLA 1XWMA 2H89A 4LF7T 2JQHA 4GK5E 4ZI3C 5BMVE 3KBTA 1MNEA 4DV4T 4QX7B 2XSAA 3H3AA 5FVLA 3RYHE 2MAWA 1D1AA 3ESLA 5FNVE 4PK5A 3P7IA 2EHOB 2R6GF 3QUJA 3RC8A 1T8BA 4P0AA 5L3DB 2UUCT 3PUXF 2KWHA 2KWIB 3AE4A 4DUYT 3SFDA 2UXXB 4IREA 2KMFA 5ETWA 2L8KA 2WQYA 2V6YB 4U33A 1D0XA 1J5WA 3DTOA 3N9QA 2LHNA 3RRWA 3AEAA 3R84B 1XMQT 2PTFA 1W09A 2DWGA 2XQ7A 5HEOA 4UXNB 1R8IA 2J62A 4UVCB 3KBUA 2N1GA 5CFBA 1HG5A 1NWMX 2Q9QA 5CJ5A 4EOZB 2IUBA 3AA7B 3IHRA 5LHHB 1N33T 3NWIA 1YKHB 2JRKA 1WCRA 4PW8A 4U2YA 4XBFB 4JI3T 2BZBA 3ZSSA 4CXXA 2CA5A 2IC6A 4CQIA 2CE7A 1OEDA 2LEHA 4DV1T 3P4WA 2HPJA 5LHIB 2D9DA 5AQKB 3KVBA 1YXRA 2H7VC 1KFYA 3RF1A 4IE6A 3VU7H 1YD8G 5L3GB 2PG8A 3E0ZA 3KINB 3OYZA 5LGTB 2DNXA 3MZKB 4O8SA 2V7KA 4JI1T 4ASKA 4GOUA 4LF9T 4JI5T 2D0TA 4NIQA 2CWOA 3SFEA 4BA9A 4H63V 2C5IT 3RGLA 4MFRA 2FJEA 2IHR1 4V1Av 3GMIA 1X79A 3RIAA 2HPLA 5HEUA 4TNWA 1ZEEA 3I9WA 2VVSA 5J1GA 2YINA 1FMWA 4YT0A 5EK4A 3ZMVB 3O9XA 3F31A 2DI4A 2V7LA 3JAEA 2WS3A 3ZMTB 3LK2B 2XASB 2HHHT 5FY0A 2IMLA 2VL0A 4IDNA 3MACA 2VWAA 2WBLA 3IF8B 1FMVA 4JI7T 3JC6D 4PAGA 4ZI7E 3CKDA 3P4SA 4JUYA 2XQ8A 3OTOT 2VQFT 2VKJA 4DV0T 2X9HA 5JDNA 2Y48B 3EAMA 2Q9QC 4ZI3D 5LJMA 4GKJT 3ZEFB 1U5PA 3AE5A 2X66A 3LFMA 2Z6EA 3VKGA 3ZN1B 4ILBA 5AQLB 4ZEYA 4OK0A 2L3LA 1X9BA 2WU2A 3FXEB 2NWBA 4DMVA 5L3BB 3N9OA 3NBXX 4O4LE 2XQ3A 4CI2B 1OEDC 4O2BE 3RKOA 4C90A 3RHWA 3P50A 5L2LA 4LFAT 4ZI2C 2I6HA 4F6RC 5CA1E 1VRBA 3GN5B 2XSBA 2W63A 4JI6T 2CEAA 5JDGA 2MPKA 5HXHA 5L3FB 3OVUA 5AQTB 2YOEA 2VASA 4GIWA 4AKHA 3AE1A 2XQ9A 4UELA 4UF0A 5FYMA 1ZKEA 3K1SA 4YFSA 2VKDA 3AECA 3O1JA 5FXXA 3UTKA 1VCTA 5FMNA 2A3DA 3Q9DA 4A97A 3O1IA 2CPTA 4CXYA 3NRXA 3K3NA 5J2TE 1GQEA 4YHJA 4HWDA 3ZMZB 2WZHA 3G06A 5LHGB 5LCYA 1I94T 2DCFA 1UURA 3UQ7A 4B3RT 2CBJA 5FL1A 2X68A 4YSYA 5DABA 5JH7E 5AQRB 1HCIA 2X9XA 3IBPA 4H9OC 5HXRA 3OBVE 2NP9A 4KHZF 3RRCA 2DWKA 4YSXA 2OA5A 2M67A 2X9WA 1BR4A 4J2CA 5FXZA 2CRBA 4AQGA 4EGWA 4DBRA 2EHOC 4ZHQE 3RIFA 3AA0B 4KBMB 2NW7A 2JJ9A 4CN4A 1BR1A 3LK42 3ZYKA 3RYIE 1IBLT 4U2ZA 3T1HT 1IJ6A 4F8HA 3LBXA 2BKOA 1OEDE 2ACZA 2RP4A 5L4HA 4YTNA 4PFOA 2CWYA 3RC3A 4OYJA 2FJAA 4ANJA 3RIUA 4LF8T 1W9RA 1HFAA 5DQWA 2Q9QB 3UUBA 5LGNB 1WYCA 4X5TA 2W66A 1KF6A 4U72A 4JLEA 3EDUA 2VK9A 2E5LT 4B3TT 4AQFA 4OX9T 1WR6A 4EYYR 3PUVF 3O1HA 2P9BA 1ZP0A 4IT4A 5GONE 1BR2A 3N5LA 1W0BA 2W2UA 3CX7B 2Q9QD 2BKNA 1OEDB 3I0QA 1T98A 4Q25A 5A1LA 4QHOA 3PUWF 4IE4A 5E0OA 2WB5A 3ZLIA 2YK0A 2UXDT 4G2AA 3HL6A 1G73A 2XQYA 2K9AA 3WAKA 4PK4A 3AAEB 4Z8XA 5JRCA 3KV9A 4ZI2D 5HWXA 3K3QC 3UUNA 4DUZT 2V7MA 5F5WA 3RQUA 1KNZA 4ISSA 3PUAA 5AQQB 3UT5E 3AE3A 3JC6C 2JMHA 1MIVA 3PUGA 2G0UA 2N9DA 4LMJA 1YQ3A 2XM2A 2K3WA 3AEDA 3I0OA 3AE7A 5AQNB 3X1DA 3NVOA 2XQ5A 4JEUB 3PDYA 4EXTA 4DBQA 2UUBT 3UULA 2XJ7A 2W62A 1O3XA 3B13A 1XNRT 4COFA 3L8RA 3PJAJ 3LSVA 4JYAT 5ABFA 3FBZA 3MXZA 3ZSTA 3K8PC 4L0RA 4AQFC 1HNWT 3AA1B 2M6IA 1N34T 3ZC0A 5JTGA 2VVNA 5HXSA 3ZJ2A 4EIWA 4P09A 2EHOD 4ZOLE 3ANWB 1HR0T 4M1PA 2WSSV 4X66T 1W0AA 2RPAA 3EVYA 4CI3B 4IDPA 4TV9E 2WWVA 3A8YC 4DV3T 2LRKA 2JIWA 5LYJE 1SE7A 3BQIA 3QK6A 4HFIA 3LDQB 4LFCT 5FY7A 2CLYC 5FVKA 5ABHA 4HFBA 3Q5EA 2J4GA 5L3CB 5ADXL 1MMAA 2V6XA 3AEEA 4IIJE 1S35A 3P4PA 4UF0B 4HWFA 5IHYA 1JNRA 4ZS3A 2QRXA 4JBWF 4N78D 4U7IA 1N36T 1XDPA 3L39A 3CQXC 2UXCT 2YU1A 4L9IA 1H7CA 4B6XA 4GKKT 3CVRA 5FKYA 4CI1B 4DV7T 2CXFA 4TN7B 5LA6E 4DNDA 3OPCA 2QGSA 4WW0A 2LSKA 3HA4A 3VRAA 4Z90A 5L47A 4TWDA 4OFZA 4YSZA 1MNDA 4PK6A 4U31A 2Y6XA 4QXCB 4TNVA 3HKDE 3UUXB 2V26A 2LHRA 4HFCA 4A5XA 4GK0E 5HEGA 4WBNE 2WMOA 5LGUB 4HKAA 3KVAA 1MIYA 3EDVA 3UQ4A 4U7YA 2I59A 2XQ6A 4H9SE 2ZM0A 1Z0PA 3HI2A 2E9XA 2YDQA 3AAAB 5JDHA 3CQGB 3KFWX 4JI0T 5HAXA 3MKDA 4AXPA 5HXEA 3AE2A 4X20E 3LBXB 1MMDA 4CN6A 2XAQB 3ZMSB 2LKHA 1Z8UA 4EEBA 3FZKB 3UU8A 2W0GA 5EZYE 4DR4T 2C5JA 2LLYA 3ZMUB 2K24A 2MYSA 3Q5DA 1M62A 4O2AE 4FI5A 3MK7C 4UR9A 4EEDA 2VL8A 3ONXA 5JR9A 3VHLA 5BR8T 5F8PA 4DR6T 1UUSA 1LKXA 3ZT6A 3Q5WA 4UVBB 4Z91A 3RX6A 3SRZA 4IDQA 3QB5K 1WFDA 3CWZB 3R6NA 3A5XA 3K3OA 3PE0A 3DP7A 2ZM6T 2WDVA 2X9YA 1UCUA 5AQSB 3P4QA 2DL1A 5FXWA 2X0HA 4OYKA 2UXBT 2LE8A 4ZXLA 2CM0A 3J7Yq 2YEVC 1HS7A 4P0BA 1Y64B 1ZHCA 3TLVA 1E2AA 2CLYB 2IC9A 3M65A 4EYUA 4QKNA 3ZPOA 2XM1A 5JRCB 1D0ZA 5LMNT 3C98B 2HN1A 2VB6A 3PV0F 3ZT7A 4IL4A 2N2NA 1KNRA 1IBMT 4JI8T 2BG9A 4UEMA 5JVDE 4ILCA 4TV8E 3N9LA 3IEEA 2IIUA 2NTXA 1NEKA 2XHEB 2WZIA 4MLKA 1OWAA 3QNUA 1YW0A 2RA1A 1MMNA 3LG7A 5KDMC 2XQ4A 3GWHA 3FBLA 4X1IE 5TAOA 2W67A 5HEJA 4DV6T 2PBIA 3PUQA 2J47A 3AXJA 5L4EA 2D2SA 5LP6E 4PJMA 2LT3A 5AQJB 2V8SV 2E9XC 4DIDB 3CIRA 4CXWA 1KK7A 3BQKA 2KNDA 1XMOT 2NR4A 4IGUA 2YKSA 3E08A 2KXPB 5CB4E 5AQGB 3L09A 1UX5A 2A9UA 2H88A 2K48A 1IZNB 4X1YE 2V5DA 3NZQA 2LSGA 4HTEA 1HF8A 3ETVA 2J1DG 2E2AA 5LBQB 5ABFB 5HEHA 3UU6A 4JV5T 3P4RA 5JR9C 3C4ZA 4XZCA 4IE7A 3IA3A 5FXVA 5DJQC 2CHOA 5IUXA 1HG2A 1I6ZA 3CX8B 2H3RA 5AQPB 2NW8A 1ZV4X 5JQGE 1NAFA 1IBKT 2V7IA 3PUZF 3AAIA 2W4XA 3MJXA 2WCAA 1XZYA 1J1JA 5EK3A 1HNZT 4AIUA 2GK9A 4I55E 2E8IA 3AE6A 2JQQA 4P1NA 1CHUA 1WRDA 3U78A 4X64T 1JNZA 4KI0F 5AQMB 4KMCA 3AVSA 4PNIA 2IAKA 3UFEA 1D1CA 3UU3A 2BG9C 2FBWA 4YXDA 3UU4A 3VRBA 2MOZA 3E22E 2JQKA 1OXZA 3PJAA 3KV6A 1WR0A 2H7OA 3AEFA 3FHNA 1LRZA 3ZCIA 1ZOYA 5H6QB 2PFVA 2FJDA 2WAUA 3VR8A 3EUHA 1L0VA 2XPKA 4WZXA 2D5UA 5EK2A 2LSYA 5FL0A 3CX6B 4MHCA 5LBMA 3MA9A 2XZEA 3OJAA 1US7B 3W15B 3DJBA 4HN9A 4DR1T 4UIGA 2YU2A 4NUVA 2QYWA 2XUEA 4HFVA 3KV5A 2CBIA 3TLSA 2XAJB 4A56A 3C51A 4LF5T 1XDOA 4YJ3E 3PUYF 4CZZB 5HYAA 4BAYB 1HTJF 3EI0A 4DMWA 1VOMA 3HKCE 4UV9B 4O4JE 3NZPA 5JREA 4IL9A 2E9XB 1SUMB 2MBGA 4MBQA 3C4WA 1S94A 4AI6A 1J5ET 4JI4T 3UUMA 3Q2MA 2WM9A 2XTLA 5LG3A 3ZC1A 2C5KT 2WP9A 4IHJE 2JQ9A 2DHRA 5DQVA 3EHZA 2X0YA 2E9XD 2BS3A 4I4TE 1E1HB 2ACXA 4IE5A 3RIUC 4IDZA 2JMKA 1FIOA 3CK6A 3B57A 4K0UA 4ILAA 2V5CA 1D1BA 5JR9B 5JDFA 4E7SA 2NOXA 5J0ZA 3RH3A 2CMRA 5LMUT 2BG9E 4EAHA 3Q5XA 2ZLYA 1YQ4A 3RQWA 2LSJA 4WBOA 5IWAT 5LG4A 4TUYE 3PURA 1G8XA 3T1YT 4X1KE 3S4UA 3RLFF 1T7SA 1MMGA 4IDOA 5AQUB 2BVLA 2BS4A 3ABVA 2QA7A 4AKRB 4K0KT 4H63H 2LM9A 4LMLA 3PUSA 5CA0E 3RI5A 2BG9B 1QLBA 2HN2A 2AE9A 2KZ7B 2OLTA 2C0SA 2QVAA 4EB6E 2ES0A 5LJNA 4DV2T 3PU8A 5HCMA 1BR0A 4O4HE 4HFDA 3N9NA 4UV8B 4A98A 5AQIB 2WU5A 3ZJ1A 3H3MA 4X65T 4H9QC 4AQYT 4U74A 4XAXB 3AXJB 4GYSA 2YDSA 3PU3A 5LOVE 4U3CA 4H9RC 2DLRA 3N2GE 3F2EA 5AQVB 3PTRB 4KP3C 2LJLA 1QSDA 3RPUA 4LF6T 1XNQT 3AE9A 3N9MA 3VR9A 4AISA 3CQCB 4ISTA 2ODUA 4WYVA 3ETUA 4ZS2A 4C91A 4JI2T 3QC9A 3V5UA 2XAGB 4ZZCA 1E7PA 5HCJA 2YDRA 5HWYA 4PJLA 1UK5A 1M7KA 2AXDS 3V5SA 1AJ3A 2VURA 3I9YA 3J9X1 3RYFE 1YKEB 1FJGT 4TX5A 5IYZE 5AQFB 1NENA 5AQOB 2B1EA 1DU2A 2LKGA 2UXNB 2XAFB 4HGAA 3ZYLA 2BS2A 3KV4A 3LJCA 4MALA 1LVFA 3N9PA 3SS1A 1WYBA 1KNPA 2WDQA 4EV6A 3FZFB 1T72A 4UVAB 2YN6A 4YHHT 1MIWA 3RYCE 3AE8A 3ONLC 2EHOA 2BBHA 4FJOA 3KDSE 3GA8A 5F3JA 3TLUA 1D0YA 4AKIA 4G63A 3HKEE 3QOFA 1SHZC 5AFUL 3A7MA 5C3JA 2IDOB 4L5GA 4QH4A 2FUPA 2WMNA 4HWCA 5C8YE 3N2KE 3QB5A 1KEYA 4QH1A 2V1DB 3ANWA 2PJQA 4DVDA 4NPPA 2V6YA 2MTQA 1HNXT 3ONJA 4DR2T 5H6RB 4ZZBA 4PJJA 4CN1A 3H37A 2V7JA 2VQET 4B3ST 5CGMA 2ODVA 3D0TA 1U4QA 4QXHB 4AKGA 4QXBB 4PJNA 4YTPA 5ABEA 4TWHA 2BDEA 3C50A 3F57A 3FZHB 2LRLA 5C2TA 4DR7T 4X62T 4QX8B 2HH7A 1B7TA 2WWUA 2M6BA 2UU9T 1V9DA 3WAJA 4KX6A 4ADZA 3OKQA 5KMGP 2VKOA 2VKHA 4E7ZA 3AEBA 4QWNB 2K5BB 5JDLA 4H9NC 2XY8B 4OHFA 1EZ3A 2JPFA 4DO0A 3ZYMA 3AA6B 3EABA 1UGOA 3CPZA 3HKBE 4GYRA 2XQAA 2X51A 5KXJA 1N32T 4O4IE 4H9PC 3U3IA 2F4VT 2ZM2A 3OYXA 3FZLB 3NRYA 3TKLB 2WDRA 3AB3B 2WY2A 2OV9A 3TLWA 5LB7B 5ABGA 4EZ4A 3B5MA 3UU5A 2A72A 2IW5B 2W00A 4ERRA 2LOPA 2SPCA 1Y01A 4ILUA 4TZ4C 4KHPT 3O4XE 5JDQA 3P8CD 2ZM8A 3I1AA 4YLHA 2LM2A 5KX5E 4B3MT 3UFGA 5L3EB 4AKLA 1SA0E 4LMKA 5FP3A 2KLQA 3ZN0B 2BBJA 3SWHA 3VKHA 2LOSA 5LXTE 4LF4T 2X0LB 2NW9A 1HX8A 2FJBA 1CUNA 4I43B 3CMLA 2UUAT 1IAPA
chains in the Genus database with same CATH topology
5AQOB 5AQJB 3FZHB 1UK5A 1HX1B 1M7KA 1I6ZA 4HWFA 3FZKB 3FZFB 5AQHB 3FZLB 4HWHA 5AQPB 5AQSB 3LDQB 5AQQB 3M3ZB 5AQLB 5AQNB 5AQTB 5AQIB 5AQVB 2D9DA 3FZMB 5AQKB 5AQGB 1UGOA 4HWIB 5AQRB 1T7SA 1M62A 4HWDA 5AQMB 3A8YC 5AQUB 4HWCA 5AQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQO B;  5AQJ B;  3FZH B;  1UK5 A;  1HX1 B;  1M7K A;  1I6Z A;  4HWF A;  3FZK B;  3FZF B;  5AQH B;  3FZL B;  4HWH A;  5AQP B;  5AQS B;  3LDQ B;  5AQQ B;  3M3Z B;  5AQL B;  5AQN B;  5AQT B;  5AQI B;  5AQV B;  2D9D A;  3FZM B;  5AQK B;  5AQG B;  1UGO A;  4HWI B;  5AQR B;  1T7S A;  1M62 A;  4HWD A;  5AQM B;  3A8Y C;  5AQU B;  4HWC A;  5AQF B; 
#chains in the Genus database with same CATH topology
 2KSR A;  3JAF A;  2ZMA A;  1IJ5 A;  3NKZ A;  4HE8 A;  3ZKR A;  2XAH B;  4I0U A;  2Y8D A;  5HXC A;  2KT9 A;  5FY1 A;  4YY3 T;  1QUU A;  4HFE A;  4NXN T;  2CHN A;  5JDM A;  4BJM A;  4PFP A;  4WNK A;  2X67 A;  4HEA A;  4JEH B;  5M4Y A;  3ZCJ A;  4NUU A;  5AQH B;  4I50 E;  4HWH A;  1VCS A;  4DV5 T;  3RKG A;  4QH5 A;  4EZH A;  3FZM B;  1WLX A;  3AEG A;  3N2O A;  3HR0 A;  3GN5 A;  2BKP A;  4BJN A;  2CXD A;  3ZT5 A;  2LSI A;  2BVM A;  3FXD B;  4YTM A;  5J2U E;  3FB2 A;  3M3Z B;  1FEW A;  1UX4 A;  1LVK A;  3WI3 A;  2NTY A;  2KIN B;  3C4X A;  2B76 A;  4NXM T;  2D0U A;  2L9Q A;  2W61 A;  4LFB T;  3TLT A;  3BK9 A;  3AVR A;  3C64 A;  4IE0 A;  5LNK A;  2CCQ A;  3JCF A;  2I0M A;  3JAD A;  4YJ2 E;  3T8O A;  4HWI B;  2E5V A;  2A2F X;  3BQL A;  3SOL A;  4KUM B;  4DR3 T;  4DR5 T;  4TWF A;  3LK3 B;  4HFH A;  1HX1 B;  3L3P A;  2CXL A;  1XWM A;  2H89 A;  4LF7 T;  2JQH A;  4GK5 E;  4ZI3 C;  5BMV E;  3KBT A;  1MNE A;  4DV4 T;  4QX7 B;  2XSA A;  3H3A A;  5FVL A;  3RYH E;  2MAW A;  1D1A A;  3ESL A;  5FNV E;  4PK5 A;  3P7I A;  2EHO B;  2R6G F;  3QUJ A;  3RC8 A;  1T8B A;  4P0A A;  5L3D B;  2UUC T;  3PUX F;  2KWH A;  2KWI B;  3AE4 A;  4DUY T;  3SFD A;  2UXX B;  4IRE A;  2KMF A;  5ETW A;  2L8K A;  2WQY A;  2V6Y B;  4U33 A;  1D0X A;  1J5W A;  3DTO A;  3N9Q A;  2LHN A;  3RRW A;  3AEA A;  3R84 B;  1XMQ T;  2PTF A;  1W09 A;  2DWG A;  2XQ7 A;  5HEO A;  4UXN B;  1R8I A;  2J62 A;  4UVC B;  3KBU A;  2N1G A;  5CFB A;  1HG5 A;  1NWM X;  2Q9Q A;  5CJ5 A;  4EOZ B;  2IUB A;  3AA7 B;  3IHR A;  5LHH B;  1N33 T;  3NWI A;  1YKH B;  2JRK A;  1WCR A;  4PW8 A;  4U2Y A;  4XBF B;  4JI3 T;  2BZB A;  3ZSS A;  4CXX A;  2CA5 A;  2IC6 A;  4CQI A;  2CE7 A;  1OED A;  2LEH A;  4DV1 T;  3P4W A;  2HPJ A;  5LHI B;  2D9D A;  5AQK B;  3KVB A;  1YXR A;  2H7V C;  1KFY A;  3RF1 A;  4IE6 A;  3VU7 H;  1YD8 G;  5L3G B;  2PG8 A;  3E0Z A;  3KIN B;  3OYZ A;  5LGT B;  2DNX A;  3MZK B;  4O8S A;  2V7K A;  4JI1 T;  4ASK A;  4GOU A;  4LF9 T;  4JI5 T;  2D0T A;  4NIQ A;  2CWO A;  3SFE A;  4BA9 A;  4H63 V;  2C5I T;  3RGL A;  4MFR A;  2FJE A;  2IHR 1;  4V1A v;  3GMI A;  1X79 A;  3RIA A;  2HPL A;  5HEU A;  4TNW A;  1ZEE A;  3I9W A;  2VVS A;  5J1G A;  2YIN A;  1FMW A;  4YT0 A;  5EK4 A;  3ZMV B;  3O9X A;  3F31 A;  2DI4 A;  2V7L A;  3JAE A;  2WS3 A;  3ZMT B;  3LK2 B;  2XAS B;  2HHH T;  5FY0 A;  2IML A;  2VL0 A;  4IDN A;  3MAC A;  2VWA A;  2WBL A;  3IF8 B;  1FMV A;  4JI7 T;  3JC6 D;  4PAG A;  4ZI7 E;  3CKD A;  3P4S A;  4JUY A;  2XQ8 A;  3OTO T;  2VQF T;  2VKJ A;  4DV0 T;  2X9H A;  5JDN A;  2Y48 B;  3EAM A;  2Q9Q C;  4ZI3 D;  5LJM A;  4GKJ T;  3ZEF B;  1U5P A;  3AE5 A;  2X66 A;  3LFM A;  2Z6E A;  3VKG A;  3ZN1 B;  4ILB A;  5AQL B;  4ZEY A;  4OK0 A;  2L3L A;  1X9B A;  2WU2 A;  3FXE B;  2NWB A;  4DMV A;  5L3B B;  3N9O A;  3NBX X;  4O4L E;  2XQ3 A;  4CI2 B;  1OED C;  4O2B E;  3RKO A;  4C90 A;  3RHW A;  3P50 A;  5L2L A;  4LFA T;  4ZI2 C;  2I6H A;  4F6R C;  5CA1 E;  1VRB A;  3GN5 B;  2XSB A;  2W63 A;  4JI6 T;  2CEA A;  5JDG A;  2MPK A;  5HXH A;  5L3F B;  3OVU A;  5AQT B;  2YOE A;  2VAS A;  4GIW A;  4AKH A;  3AE1 A;  2XQ9 A;  4UEL A;  4UF0 A;  5FYM A;  1ZKE A;  3K1S A;  4YFS A;  2VKD A;  3AEC A;  3O1J A;  5FXX A;  3UTK A;  1VCT A;  5FMN A;  2A3D A;  3Q9D A;  4A97 A;  3O1I A;  2CPT A;  4CXY A;  3NRX A;  3K3N A;  5J2T E;  1GQE A;  4YHJ A;  4HWD A;  3ZMZ B;  2WZH A;  3G06 A;  5LHG B;  5LCY A;  1I94 T;  2DCF A;  1UUR A;  3UQ7 A;  4B3R T;  2CBJ A;  5FL1 A;  2X68 A;  4YSY A;  5DAB A;  5JH7 E;  5AQR B;  1HCI A;  2X9X A;  3IBP A;  4H9O C;  5HXR A;  3OBV E;  2NP9 A;  4KHZ F;  3RRC A;  2DWK A;  4YSX A;  2OA5 A;  2M67 A;  2X9W A;  1BR4 A;  4J2C A;  5FXZ A;  2CRB A;  4AQG A;  4EGW A;  4DBR A;  2EHO C;  4ZHQ E;  3RIF A;  3AA0 B;  4KBM B;  2NW7 A;  2JJ9 A;  4CN4 A;  1BR1 A;  3LK4 2;  3ZYK A;  3RYI E;  1IBL T;  4U2Z A;  3T1H T;  1IJ6 A;  4F8H A;  3LBX A;  2BKO A;  1OED E;  2ACZ A;  2RP4 A;  5L4H A;  4YTN A;  4PFO A;  2CWY A;  3RC3 A;  4OYJ A;  2FJA A;  4ANJ A;  3RIU A;  4LF8 T;  1W9R A;  1HFA A;  5DQW A;  2Q9Q B;  3UUB A;  5LGN B;  1WYC A;  4X5T A;  2W66 A;  1KF6 A;  4U72 A;  4JLE A;  3EDU A;  2VK9 A;  2E5L T;  4B3T T;  4AQF A;  4OX9 T;  1WR6 A;  4EYY R;  3PUV F;  3O1H A;  2P9B A;  1ZP0 A;  4IT4 A;  5GON E;  1BR2 A;  3N5L A;  1W0B A;  2W2U A;  3CX7 B;  2Q9Q D;  2BKN A;  1OED B;  3I0Q A;  1T98 A;  4Q25 A;  5A1L A;  4QHO A;  3PUW F;  4IE4 A;  5E0O A;  2WB5 A;  3ZLI A;  2YK0 A;  2UXD T;  4G2A A;  3HL6 A;  1G73 A;  2XQY A;  2K9A A;  3WAK A;  4PK4 A;  3AAE B;  4Z8X A;  5JRC A;  3KV9 A;  4ZI2 D;  5HWX A;  3K3Q C;  3UUN A;  4DUZ T;  2V7M A;  5F5W A;  3RQU A;  1KNZ A;  4ISS A;  3PUA A;  5AQQ B;  3UT5 E;  3AE3 A;  3JC6 C;  2JMH A;  1MIV A;  3PUG A;  2G0U A;  2N9D A;  4LMJ A;  1YQ3 A;  2XM2 A;  2K3W A;  3AED A;  3I0O A;  3AE7 A;  5AQN B;  3X1D A;  3NVO A;  2XQ5 A;  4JEU B;  3PDY A;  4EXT A;  4DBQ A;  2UUB T;  3UUL A;  2XJ7 A;  2W62 A;  1O3X A;  3B13 A;  1XNR T;  4COF A;  3L8R A;  3PJA J;  3LSV A;  4JYA T;  5ABF A;  3FBZ A;  3MXZ A;  3ZST A;  3K8P C;  4L0R A;  4AQF C;  1HNW T;  3AA1 B;  2M6I A;  1N34 T;  3ZC0 A;  5JTG A;  2VVN A;  5HXS A;  3ZJ2 A;  4EIW A;  4P09 A;  2EHO D;  4ZOL E;  3ANW B;  1HR0 T;  4M1P A;  2WSS V;  4X66 T;  1W0A A;  2RPA A;  3EVY A;  4CI3 B;  4IDP A;  4TV9 E;  2WWV A;  3A8Y C;  4DV3 T;  2LRK A;  2JIW A;  5LYJ E;  1SE7 A;  3BQI A;  3QK6 A;  4HFI A;  3LDQ B;  4LFC T;  5FY7 A;  2CLY C;  5FVK A;  5ABH A;  4HFB A;  3Q5E A;  2J4G A;  5L3C B;  5ADX L;  1MMA A;  2V6X A;  3AEE A;  4IIJ E;  1S35 A;  3P4P A;  4UF0 B;  4HWF A;  5IHY A;  1JNR A;  4ZS3 A;  2QRX A;  4JBW F;  4N78 D;  4U7I A;  1N36 T;  1XDP A;  3L39 A;  3CQX C;  2UXC T;  2YU1 A;  4L9I A;  1H7C A;  4B6X A;  4GKK T;  3CVR A;  5FKY A;  4CI1 B;  4DV7 T;  2CXF A;  4TN7 B;  5LA6 E;  4DND A;  3OPC A;  2QGS A;  4WW0 A;  2LSK A;  3HA4 A;  3VRA A;  4Z90 A;  5L47 A;  4TWD A;  4OFZ A;  4YSZ A;  1MND A;  4PK6 A;  4U31 A;  2Y6X A;  4QXC B;  4TNV A;  3HKD E;  3UUX B;  2V26 A;  2LHR A;  4HFC A;  4A5X A;  4GK0 E;  5HEG A;  4WBN E;  2WMO A;  5LGU B;  4HKA A;  3KVA A;  1MIY A;  3EDV A;  3UQ4 A;  4U7Y A;  2I59 A;  2XQ6 A;  4H9S E;  2ZM0 A;  1Z0P A;  3HI2 A;  2E9X A;  2YDQ A;  3AAA B;  5JDH A;  3CQG B;  3KFW X;  4JI0 T;  5HAX A;  3MKD A;  4AXP A;  5HXE A;  3AE2 A;  4X20 E;  3LBX B;  1MMD A;  4CN6 A;  2XAQ B;  3ZMS B;  2LKH A;  1Z8U A;  4EEB A;  3FZK B;  3UU8 A;  2W0G A;  5EZY E;  4DR4 T;  2C5J A;  2LLY A;  3ZMU B;  2K24 A;  2MYS A;  3Q5D A;  1M62 A;  4O2A E;  4FI5 A;  3MK7 C;  4UR9 A;  4EED A;  2VL8 A;  3ONX A;  5JR9 A;  3VHL A;  5BR8 T;  5F8P A;  4DR6 T;  1UUS A;  1LKX A;  3ZT6 A;  3Q5W A;  4UVB B;  4Z91 A;  3RX6 A;  3SRZ A;  4IDQ A;  3QB5 K;  1WFD A;  3CWZ B;  3R6N A;  3A5X A;  3K3O A;  3PE0 A;  3DP7 A;  2ZM6 T;  2WDV A;  2X9Y A;  1UCU A;  5AQS B;  3P4Q A;  2DL1 A;  5FXW A;  2X0H A;  4OYK A;  2UXB T;  2LE8 A;  4ZXL A;  2CM0 A;  3J7Y q;  2YEV C;  1HS7 A;  4P0B A;  1Y64 B;  1ZHC A;  3TLV A;  1E2A A;  2CLY B;  2IC9 A;  3M65 A;  4EYU A;  4QKN A;  3ZPO A;  2XM1 A;  5JRC B;  1D0Z A;  5LMN T;  3C98 B;  2HN1 A;  2VB6 A;  3PV0 F;  3ZT7 A;  4IL4 A;  2N2N A;  1KNR A;  1IBM T;  4JI8 T;  2BG9 A;  4UEM A;  5JVD E;  4ILC A;  4TV8 E;  3N9L A;  3IEE A;  2IIU A;  2NTX A;  1NEK A;  2XHE B;  2WZI A;  4MLK A;  1OWA A;  3QNU A;  1YW0 A;  2RA1 A;  1MMN A;  3LG7 A;  5KDM C;  2XQ4 A;  3GWH A;  3FBL A;  4X1I E;  5TAO A;  2W67 A;  5HEJ A;  4DV6 T;  2PBI A;  3PUQ A;  2J47 A;  3AXJ A;  5L4E A;  2D2S A;  5LP6 E;  4PJM A;  2LT3 A;  5AQJ B;  2V8S V;  2E9X C;  4DID B;  3CIR A;  4CXW A;  1KK7 A;  3BQK A;  2KND A;  1XMO T;  2NR4 A;  4IGU A;  2YKS A;  3E08 A;  2KXP B;  5CB4 E;  5AQG B;  3L09 A;  1UX5 A;  2A9U A;  2H88 A;  2K48 A;  1IZN B;  4X1Y E;  2V5D A;  3NZQ A;  2LSG A;  4HTE A;  1HF8 A;  3ETV A;  2J1D G;  2E2A A;  5LBQ B;  5ABF B;  5HEH A;  3UU6 A;  4JV5 T;  3P4R A;  5JR9 C;  3C4Z A;  4XZC A;  4IE7 A;  3IA3 A;  5FXV A;  5DJQ C;  2CHO A;  5IUX A;  1HG2 A;  1I6Z A;  3CX8 B;  2H3R A;  5AQP B;  2NW8 A;  1ZV4 X;  5JQG E;  1NAF A;  1IBK T;  2V7I A;  3PUZ F;  3AAI A;  2W4X A;  3MJX A;  2WCA A;  1XZY A;  1J1J A;  5EK3 A;  1HNZ T;  4AIU A;  2GK9 A;  4I55 E;  2E8I A;  3AE6 A;  2JQQ A;  4P1N A;  1CHU A;  1WRD A;  3U78 A;  4X64 T;  1JNZ A;  4KI0 F;  5AQM B;  4KMC A;  3AVS A;  4PNI A;  2IAK A;  3UFE A;  1D1C A;  3UU3 A;  2BG9 C;  2FBW A;  4YXD A;  3UU4 A;  3VRB A;  2MOZ A;  3E22 E;  2JQK A;  1OXZ A;  3PJA A;  3KV6 A;  1WR0 A;  2H7O A;  3AEF A;  3FHN A;  1LRZ A;  3ZCI A;  1ZOY A;  5H6Q B;  2PFV A;  2FJD A;  2WAU A;  3VR8 A;  3EUH A;  1L0V A;  2XPK A;  4WZX A;  2D5U A;  5EK2 A;  2LSY A;  5FL0 A;  3CX6 B;  4MHC A;  5LBM A;  3MA9 A;  2XZE A;  3OJA A;  1US7 B;  3W15 B;  3DJB A;  4HN9 A;  4DR1 T;  4UIG A;  2YU2 A;  4NUV A;  2QYW A;  2XUE A;  4HFV A;  3KV5 A;  2CBI A;  3TLS A;  2XAJ B;  4A56 A;  3C51 A;  4LF5 T;  1XDO A;  4YJ3 E;  3PUY F;  4CZZ B;  5HYA A;  4BAY B;  1HTJ F;  3EI0 A;  4DMW A;  1VOM A;  3HKC E;  4UV9 B;  4O4J E;  3NZP A;  5JRE A;  4IL9 A;  2E9X B;  1SUM B;  2MBG A;  4MBQ A;  3C4W A;  1S94 A;  4AI6 A;  1J5E T;  4JI4 T;  3UUM A;  3Q2M A;  2WM9 A;  2XTL A;  5LG3 A;  3ZC1 A;  2C5K T;  2WP9 A;  4IHJ E;  2JQ9 A;  2DHR A;  5DQV A;  3EHZ A;  2X0Y A;  2E9X D;  2BS3 A;  4I4T E;  1E1H B;  2ACX A;  4IE5 A;  3RIU C;  4IDZ A;  2JMK A;  1FIO A;  3CK6 A;  3B57 A;  4K0U A;  4ILA A;  2V5C A;  1D1B A;  5JR9 B;  5JDF A;  4E7S A;  2NOX A;  5J0Z A;  3RH3 A;  2CMR A;  5LMU T;  2BG9 E;  4EAH A;  3Q5X A;  2ZLY A;  1YQ4 A;  3RQW A;  2LSJ A;  4WBO A;  5IWA T;  5LG4 A;  4TUY E;  3PUR A;  1G8X A;  3T1Y T;  4X1K E;  3S4U A;  3RLF F;  1T7S A;  1MMG A;  4IDO A;  5AQU B;  2BVL A;  2BS4 A;  3ABV A;  2QA7 A;  4AKR B;  4K0K T;  4H63 H;  2LM9 A;  4LML A;  3PUS A;  5CA0 E;  3RI5 A;  2BG9 B;  1QLB A;  2HN2 A;  2AE9 A;  2KZ7 B;  2OLT A;  2C0S A;  2QVA A;  4EB6 E;  2ES0 A;  5LJN A;  4DV2 T;  3PU8 A;  5HCM A;  1BR0 A;  4O4H E;  4HFD A;  3N9N A;  4UV8 B;  4A98 A;  5AQI B;  2WU5 A;  3ZJ1 A;  3H3M A;  4X65 T;  4H9Q C;  4AQY T;  4U74 A;  4XAX B;  3AXJ B;  4GYS A;  2YDS A;  3PU3 A;  5LOV E;  4U3C A;  4H9R C;  2DLR A;  3N2G E;  3F2E A;  5AQV B;  3PTR B;  4KP3 C;  2LJL A;  1QSD A;  3RPU A;  4LF6 T;  1XNQ T;  3AE9 A;  3N9M A;  3VR9 A;  4AIS A;  3CQC B;  4IST A;  2ODU A;  4WYV A;  3ETU A;  4ZS2 A;  4C91 A;  4JI2 T;  3QC9 A;  3V5U A;  2XAG B;  4ZZC A;  1E7P A;  5HCJ A;  2YDR A;  5HWY A;  4PJL A;  1UK5 A;  1M7K A;  2AXD S;  3V5S A;  1AJ3 A;  2VUR A;  3I9Y A;  3J9X 1;  3RYF E;  1YKE B;  1FJG T;  4TX5 A;  5IYZ E;  5AQF B;  1NEN A;  5AQO B;  2B1E A;  1DU2 A;  2LKG A;  2UXN B;  2XAF B;  4HGA A;  3ZYL A;  2BS2 A;  3KV4 A;  3LJC A;  4MAL A;  1LVF A;  3N9P A;  3SS1 A;  1WYB A;  1KNP A;  2WDQ A;  4EV6 A;  3FZF B;  1T72 A;  4UVA B;  2YN6 A;  4YHH T;  1MIW A;  3RYC E;  3AE8 A;  3ONL C;  2EHO A;  2BBH A;  4FJO A;  3KDS E;  3GA8 A;  5F3J A;  3TLU A;  1D0Y A;  4AKI A;  4G63 A;  3HKE E;  3QOF A;  1SHZ C;  5AFU L;  3A7M A;  5C3J A;  2IDO B;  4L5G A;  4QH4 A;  2FUP A;  2WMN A;  4HWC A;  5C8Y E;  3N2K E;  3QB5 A;  1KEY A;  4QH1 A;  2V1D B;  3ANW A;  2PJQ A;  4DVD A;  4NPP A;  2V6Y A;  2MTQ A;  1HNX T;  3ONJ A;  4DR2 T;  5H6R B;  4ZZB A;  4PJJ A;  4CN1 A;  3H37 A;  2V7J A;  2VQE T;  4B3S T;  5CGM A;  2ODV A;  3D0T A;  1U4Q A;  4QXH B;  4AKG A;  4QXB B;  4PJN A;  4YTP A;  5ABE A;  4TWH A;  2BDE A;  3C50 A;  3F57 A;  3FZH B;  2LRL A;  5C2T A;  4DR7 T;  4X62 T;  4QX8 B;  2HH7 A;  1B7T A;  2WWU A;  2M6B A;  2UU9 T;  1V9D A;  3WAJ A;  4KX6 A;  4ADZ A;  3OKQ A;  5KMG P;  2VKO A;  2VKH A;  4E7Z A;  3AEB A;  4QWN B;  2K5B B;  5JDL A;  4H9N C;  2XY8 B;  4OHF A;  1EZ3 A;  2JPF A;  4DO0 A;  3ZYM A;  3AA6 B;  3EAB A;  1UGO A;  3CPZ A;  3HKB E;  4GYR A;  2XQA A;  2X51 A;  5KXJ A;  1N32 T;  4O4I E;  4H9P C;  3U3I A;  2F4V T;  2ZM2 A;  3OYX A;  3FZL B;  3NRY A;  3TKL B;  2WDR A;  3AB3 B;  2WY2 A;  2OV9 A;  3TLW A;  5LB7 B;  5ABG A;  4EZ4 A;  3B5M A;  3UU5 A;  2A72 A;  2IW5 B;  2W00 A;  4ERR A;  2LOP A;  2SPC A;  1Y01 A;  4ILU A;  4TZ4 C;  4KHP T;  3O4X E;  5JDQ A;  3P8C D;  2ZM8 A;  3I1A A;  4YLH A;  2LM2 A;  5KX5 E;  4B3M T;  3UFG A;  5L3E B;  4AKL A;  1SA0 E;  4LMK A;  5FP3 A;  2KLQ A;  3ZN0 B;  2BBJ A;  3SWH A;  3VKH A;  2LOS A;  5LXT E;  4LF4 T;  2X0L B;  2NW9 A;  1HX8 A;  2FJB A;  1CUN A;  4I43 B;  3CML A;  2UUA T;  1IAP A; 
#chains in the Genus database with same CATH homology
 5AQO B;  5AQJ B;  3FZH B;  1UK5 A;  1HX1 B;  1M7K A;  1I6Z A;  4HWF A;  3FZK B;  3FZF B;  5AQH B;  3FZL B;  4HWH A;  5AQP B;  5AQS B;  3LDQ B;  5AQQ B;  3M3Z B;  5AQL B;  5AQN B;  5AQT B;  5AQI B;  5AQV B;  2D9D A;  3FZM B;  5AQK B;  5AQG B;  1UGO A;  4HWI B;  5AQR B;  1T7S A;  1M62 A;  4HWD A;  5AQM B;  3A8Y C;  5AQU B;  4HWC A;  5AQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...