1HX1B

Crystal structure of a bag domain in complex with the hsc70 atpase domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
b'GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock 70 kDa protein 8
publication title Structure of a Bag/Hsc70 complex: convergent functional evolution of Hsp70 nucleotide exchange factors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone/chaperone inhibitor
total genus 45
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2001-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1hx1B00
3FZMB 5AQQB 5AQRB 5AQMB 4HWCA 3FZFB 5AQJB 1UGOA 1M7KA 5AQUB 5AQHB 3A8YC 5AQSB 5AQIB 5AQLB 3FZHB 5AQNB 4HWFA 4HWDA 3FZLB 4HWHA 3M3ZB 5AQVB 1UK5A 1I6ZA 5AQFB 5AQKB 5AQTB 3FZKB 3LDQB 5AQOB 1T7SA 2D9DA 5AQPB 4HWIB 1M62A 1HX1B 5AQGB
chains in the Genus database with same CATH superfamily
4EXTA 5J2UE 1H7CA 4LF4T 2JQ9A 3UUMA 1U5PA 4YSZA 4HN9A 4OK0A 5FYMA 2LT3A 5FNVE 4YJ3E 5FXXA 4U72A 4ISSA 2XAFB 4JYAT 4UXNB 4FI5A 4HGAA 4CQIA 1XDPA 3K3OA 4H9NC 1J5ET 2JRKA 2NP9A 4Z91A 2I0MA 2A2FX 4DVDA 2WM9A 3CQCB 3FZFB 2LOSA 2VQET 4WBOA 4HFEA 3SFDA 4AQFA 5HYAA 1OEDC 3FHNA 2PTFA 4YHHT 1D1AA 4EIWA 4BAYB 2XSAA 1D0ZA 3UU8A 4AQFC 1N34T 3VRAA 2R6GF 4NUUA 5JDLA 2H89A 3MACA 1NWMX 1LKXA 4G63A 1LRZA 1YXRA 3UFEA 1E7PA 3E22E 1KNZA 2CHOA 4A98A 4KMCA 4F6RC 2XQ6A 3O1IA 2XSBA 4DV1T 4GIWA 3VU7H 4LF5T 1D1CA 5HAXA 2IDOB 2V8SV 3QC9A 2CBJA 2ZM0A 4OFZA 2VKDA 2X67A 3SRZA 2FJEA 3O1HA 3KBTA 3KDSE 5CB4E 4A56A 2XQ3A 2WY2A 5FP3A 2UUCT 3M3ZB 2KZ7B 3UT5E 1SE7A 2CM0A 2JQQA 4UEMA 5FVLA 3PU8A 4ERRA 4IT4A 5GONE 3TLSA 5JRCA 2KXPB 5JDHA 5JR9A 3WAKA 4IREA 3O9XA 2XY8B 3QB5K 1BR2A 2UUBT 4X65T 2XHEB 2XPKA 3N2GE 5FKYA 4GYSA 1FEWA 2WQYA 3FBLA 4QX8B 5C3JA 1VOMA 5LG4A 2E2AA 3GA8A 1NAFA 1CHUA 3CQXC 3WI3A 2J62A 3N9OA 2F4VT 4PAGA 3AEFA 2RPAA 3NVOA 3K8PC 3DTOA 4U31A 3ZMUB 2DWKA 2BKOA 2BBJA 1UCUA 2VL0A 3LK2B 4IHJE 2DLRA 2XQ7A 1UUSA 3HKBE 1ZHCA 2CHNA 3T1HT 4F8HA 2E9XB 2WU2A 3L8RA 3UFGA 1MMGA 1ZKEA 2XM2A 3VR8A 4DR2T 2VVNA 4KUMB 5HEGA 3UUXB 2EHOB 1HG2A 1O3XA 4UF0A 2K3WA 4WZXA 2LKHA 4NPPA 4YTMA 4IGUA 4U2ZA 4WW0A 4UVAB 2H7VC 2Q9QB 2L8KA 3RH3A 4B3MT 4MBQA 5LA6E 4DV7T 2D2SA 4Z8XA 2YK0A 5LXTE 4EZHA 4O2BE 1IBMT 2WB5A 4AKLA 2IHR1 3I0QA 2JIWA 5LHHB 3ZC0A 1FJGT 3T1YT 3FZHB 2E8IA 1SHZC 4DMWA 2C0SA 4ZI3C 2WP9A 5LGNB 4BA9A 2YN6A 3F57A 4KP3C 5ABGA 2XZEA 2N2NA 3Q5XA 5DABA 3UUNA 3KV4A 3TLVA 1R8IA 1QSDA 1CUNA 1IJ5A 2RP4A 3IA3A 3ABVA 4HWHA 2PG8A 2WCAA 3ZLIA 4LFBT 2MYSA 2LLYA 2NTYA 1J1JA 2KMFA 4EYUA 1HFAA 3OVUA 4KHPT 3GWHA 4DBQA 2V5DA 4HWIB 4ZHQE 3JCFA 2XQ4A 4HWCA 5F5WA 2VK9A 2JQKA 4HFVA 3P4PA 1QUUA 3ETVA 4G2AA 3RHWA 3F31A 3R84B 5FL0A 3JADA 2D0TA 4IL9A 5DQWA 2M6BA 2XAGB 2A3DA 3UU3A 4UELA 4IE0A 3AB3B 3RRCA 2CWYA 2LHNA 3CX8B 4O4HE 2UUAT 2E9XA 3BQIA 1UURA 1ZP0A 1OWAA 5CA1E 3H3AA 2CRBA 3AA7B 3PUWF 4DNDA 3V5SA 4MALA 3ONXA 2MAWA 3NBXX 3NKZA 3T8OA 2SPCA 4PJMA 1WLXA 2IIUA 4H63H 4NIQA 4O4IE 2XAJB 4HWFA 4OYJA 4CI1B 5C8YE 4P0AA 3KVAA 1WFDA 3EDUA 3X1DA 4NUVA 1HNXT 5LG3A 2V7IA 3A5XA 2LHRA 1XNQT 3IF8B 4YTNA 1MIWA 4PFOA 4JI8T 3AVRA 2V26A 2XUEA 4ZI2C 4AKHA 4ILBA 5ABEA 2J1DG 4ZXLA 4QXHB 2XQ5A 1IZNB 2LRKA 4HFIA 5L4HA 2IAKA 3OTOT 5A1LA 4U2YA 5TAOA 2C5JA 4ISTA 4DO0A 4IE5A 4YLHA 2KWIB 2CE7A 3MXZA 4GK0E 3LJCA 4UVCB 3ZCJA 3ZKRA 2WSSV 3GN5B 4IDZA 3FB2A 1YQ3A 2JJ9A 1UGOA 2FUPA 3RIFA 5AQSB 3I1AA 1BR4A 3KV5A 3LK3B 4QX7B 2YOEA 3MK7C 5FY0A 3ANWA 5AQTB 2DL1A 1JNZA 2E5VA 2XTLA 1ZEEA 4EEBA 3AA6B 3HL6A 4JUYA 3B5MA 3RYCE 4QKNA 1MIVA 2KWHA 2ACZA 2ZM2A 2XM1A 5LBQB 2FJDA 2YDRA 1V9DA 4X20E 2B76A 3ONLC 2E9XD 1Z8UA 5JQGE 2QA7A 3RC3A 3AE5A 3PUYF 2KINB 1X9BA 4Q25A 3RF1A 2E5LT 2EHOD 2X9HA 2HPJA 5LB7B 4JI3T 3HKCE 3O1JA 2FJBA 1MNDA 2WWVA 3CVRA 1WYBA 2ZMAA 3HI2A 3K3QC 3ZMVB 2X9WA 1FMWA 1OEDA 2BG9C 1T8BA 2MTQA 2PBIA 2Q9QD 4TWDA 2H3RA 4UF0B 2FJAA 4UR9A 2UXCT 5FXVA 3AAAB 1I94T 3ZJ1A 3C64A 3HKDE 3I9YA 5HEJA 2DHRA 3VRBA 1YKEB 2CXLA 2DWGA 4HEAA 2IC6A 4DBRA 4YFSA 4ZOLE 5JDQA 3KV6A 5FVKA 4TNVA 4QHOA 3VKGA 1M62A 1N36T 4AXPA 5HXCA 1B7TA 3AECA 5CJ5A 4GKJT 4YSXA 1E1HB 2CEAA 4IDQA 5LNKA 4PK6A 5LHGB 1VCTA 2YKSA 4CXYA 2XJ7A 2IUBA 3Q5WA 1L0VA 4AKGA 4B3TT 3ZCIA 4KBMB 2W62A 5AQNB 4LF7T 3ZMTB 5EZYE 3CMLA 1LVFA 4XBFB 1ZOYA 5FY1A 1MMDA 3C4WA 1HTJF 3GN5A 3K3NA 3SFEA 2LSYA 4I43B 5LYJE 4CN6A 5L3BB 2KNDA 2VASA 1S94A 2UXNB 4XAXB 1JNRA 4E7ZA 3IBPA 4XZCA 3RX6A 4I55E 5CA0E 3MA9A 3AEEA 3JC6C 2XAHB 2VL8A 2UXXB 4JI1T 2V7LA 2MPKA 4YSYA 3Q2MA 5HEUA 2K9AA 5JTGA 4P1NA 3OYZA 2Y48B 4A97A 4DV0T 3QB5A 3ONJA 3EDVA 2AXDS 4X1YE 2X66A 4U7IA 4ANJA 3AA1B 3AEBA 4H9QC 1YD8G 4X1KE 2WMNA 3H3MA 5L3DB 4DR7T 4EV6A 3P4QA 2NW7A 4A5XA 3PUAA 2V6YB 2JMKA 1XNRT 3RLFF 4ZZBA 4QXBB 5AQFB 4JI6T 3KINB 3EI0A 4O2AE 5H6QB 3O4XE 3C50A 3PUVF 5AQQB 3IEEA 2YINA 2V1DB 4QWNB 4GKKT 4ASKA 3N5LA 3SS1A 2XQYA 3ZSTA 1AJ3A 4MLKA 3RRWA 5LP6E 1KNRA 1KFYA 3Q9DA 5AQPB 4DIDB 2BS2A 5EK2A 2L9QA 3N9MA 5DJQC 3NRYA 5LJMA 2X0LB 5L47A 4I50E 3UTKA 2FBWA 4AQGA 3WAJA 2H7OA 3UU4A 3RKGA 2VKHA 2OV9A 3AE1A 3UQ4A 5FY7A 1US7B 2BKNA 3P4WA 4ILCA 1ZV4X 3AE7A 1XMQT 3UQ7A 1MMNA 3RQWA 1NEKA 5JVDE 4KHZF 3UU6A 2UXDT 4JEHB 2XQAA 2K48A 4GK5E 4TWFA 4J2CA 1SUMB 3HA4A 3EHZA 5HWYA 3CPZA 5LBMA 4CN1A 5HXRA 5HWXA 3ZYMA 1D0XA 3Q5DA 5AQIB 4CI3B 2X68A 3RI5A 1KNPA 3KV9A 3P4RA 3ANWB 3LDQB 3LSVA 4TX5A 4NXMT 3E0ZA 4QH1A 1Z0PA 2C5IT 5CFBA 1N33T 4YJ2E 1NENA 3AVSA 3G06A 4B3RT 1UX5A 4ZS2A 4X1IE 4B3ST 1IBKT 4U3CA 2VQFT 1HS7A 3ETUA 1D1BA 2CXDA 3QK6A 4BJNA 2I59A 4CXWA 4TN7B 4AI6A 1Y01A 4LF9T 3AEGA 3VKHA 1KK7A 3AE9A 3W15B 2DI4A 3P4SA 5AQLB 2WZIA 3ZT6A 1D0YA 4EB6E 2HPLA 4IDOA 2ODUA 2P9BA 2BG9B 2A72A 2XAQB 2PJQA 3ZT5A 4TV9E 3PTRB 5HCJA 5HXSA 1WRDA 2V6YA 3N9QA 1OEDB 1BR1A 3NRXA 5L3FB 4X64T 5IWAT 4COFA 1HG5A 2V5CA 2LOPA 2J4GA 2VVSA 1W09A 4JEUB 4TWHA 3QNUA 3UU5A 3ZJ2A 3RC8A 2IC9A 3LFMA 4L9IA 3CKDA 1UX4A 2D0UA 5JREA 1HCIA 4ZI3D 2YEVC 3FXEB 3TLTA 2ZLYA 1J5WA 2QRXA 3JAEA 4PK5A 2UU9T 2HN2A 3FZMB 5IYZE 4DV2T 1FIOA 5AQUB 4DUYT 3PV0F 4H63V 1FMVA 4X62T 3ZYKA 2W0GA 5ABHA 4L5GA 4UVBB 4AQYT 4IE7A 4EZ4A 3CQGB 4DR3T 5HEHA 3OPCA 3L39A 4DR6T 2X9YA 4P09A 2YU1A 4YXDA 1LVKA 3BQLA 4DUZT 2W67A 4DV3T 2NW9A 2XQ9A 3S4UA 5ABFB 3M65A 3RQUA 2KLQA 4IE6A 2DCFA 3CX7B 5AQVB 4JI4T 5FXWA 4HTEA 5LHIB 2D5UA 1OEDE 4OX9T 5LJNA 5LOVE 4GOUA 5AQRB 3ESLA 3RGLA 4DR1T 3ZN1B 4IDPA 3L09A 1UK5A 4LF6T 3ZN0B 3U3IA 4PFPA 2WDRA 4U33A 3H37A 3PUXF 4ZZCA 5JDMA 2LM9A 3VHLA 4I4TE 5L2LA 4H9SE 3QUJA 1IJ6A 5AQJB 4ILUA 2VKJA 4YY3T 2XQ8A 4H9RC 3C98B 4HFDA 2V7JA 4H9PC 4AIUA 3C4ZA 4CZZB 2WS3A 4ADZA 2BG9A 3ZC1A 5KXJA 3MKDA 4LMLA 2AE9A 3MZKB 2NR4A 3ZSSA 2WMOA 4DMVA 3EAMA 3KFWX 1XWMA 3CX6B 2C5KT 4O8SA 1HNZT 4UIGA 3N9LA 1XMOT 5LMNT 2A9UA 2GK9A 4ZI2D 3AXJA 4JI7T 2N9DA 4DR5T 3HKEE 2LRLA 1U4QA 4NXNT 3JAFA 5L3EB 3L3PA 4KX6A 3PUQA 1BR0A 4JV5T 4FJOA 3LBXB 4PW8A 4I0UA 2CXFA 3PJAJ 3RIAA 1T72A 2M6IA 3FXDB 2YU2A 3PURA 4ILAA 5JDNA 4TZ4C 4IE4A 5HCMA 3BK9A 4JLEA 4HKAA 2WDQA 2WU5A 2Z6EA 5EK4A 2H88A 1YKHB 2V7MA 5LCYA 4X66T 2YDSA 3IHRA 4JBWF 4MHCA 2BBHA 1T7SA 5FMNA 4DV5T 3AAEB 2CLYC 2K24A 4KI0F 2UXBT 4QH4A 3C51A 5ABFA 2X9XA 2MBGA 5J2TE 5F8PA 2I6HA 1GQEA 4HWDA 2G0UA 3CWZB 5IUXA 2DNXA 4C91A 3R6NA 2IMLA 3AA0B 4YHJA 2JQHA 2HH7A 5CGMA 4K0UA 5HEOA 4ZEYA 1WCRA 3PUSA 4N78D 4PJNA 3RKOA 3ZT7A 4HFCA 2WZHA 2V7KA 5JR9C 2OA5A 1S35A 5ETWA 5L4EA 1VCSA 5BR8T 1MMAA 3UULA 2ACXA 3F2EA 4WNKA 3C4XA 4E7SA 1HF8A 3PJAA 4P0BA 4EGWA 3OKQA 2WWUA 2W63A 5EK3A 4U7YA 1HNWT 5AQGB 3NWIA 2CMRA 3RIUA 2VB6A 4LF8T 1QLBA 1DU2A 4QH5A 3RIUC 2NW8A 4CI2B 5FL1A 2CA5A 2QVAA 3EUHA 3RYIE 3AAIA 5LGTB 5FXZA 3NZPA 4PK4A 2BDEA 2BVMA 2PFVA 2QYWA 1W9RA 5H6RB 2WBLA 5J1GA 4AISA 5L3GB 3ZYLA 3AE2A 4TNWA 2ES0A 1HR0T 2BZBA 4L0RA 3OJAA 4EOZB 1T98A 3LBXA 4OYKA 3RPUA 5LGUB 2LEHA 2W00A 4JI0T 3SWHA 1WR0A 2N1GA 2OLTA 2RA1A 3AE4A 2IW5B 5C2TA 4H9OC 1VRBA 4EEDA 1W0BA 2LKGA 1IAPA 2CCQA 5M4YA 2HHHT 3DJBA 3AE3A 4ZI7E 4ZS3A 1Y64B 2M67A 2LSJA 3N2KE 4HE8A 4U74A 3I9WA 3SOLA 3ZMSB 1HX1B 2NWBA 2HN1A 3P7IA 4Z90A 4QXCB 1X79A 3JC6D 4PNIA 4DR4T 1EZ3A 3PDYA 4YTPA 3N2OA 3CIRA 3A7MA 4MFRA 5AQOB 1W0AA 3UUBA 3D0TA 2KSRA 2ODVA 2QGSA 5AFUL 4LFCT 1WYCA 4AKRB 2LJLA 1MNEA 4GYRA 1IBLT 5ADXL 4CN4A 2BVLA 3Q5EA 3TLUA 3PUZF 1SA0E 2NOXA 4WBNE 3TKLB 5L3CB 3HR0A 3I0OA 2J47A 2Y8DA 2BKPA 4B6XA 4X5TA 3NZQA 4JI2T 4YT0A 2LSGA 2JMHA 2W66A 3A8YC 2B1EA 1OXZA 3AEAA 2V6XA 2ZM6T 5HXEA 3J7Yq 5F3JA 2W4XA 3E08A 3VR9A 3MJXA 1YW0A 5E0OA 2W61A 2KT9A 3ZPOA 4M1PA 2XASB 3U78A 4O4JE 4UV8B 5BMVE 4BJMA 3N9NA 3CK6A 3P8CD 4DV6T 4IIJE 3P50A 4IDNA 2VWAA 2E9XC 3LG7A 4JI5T 5LMUT 1G73A 2LE8A 5KDMC 1M7KA 3EABA 3AXJB 2EHOA 3OBVE 4OHFA 3QOFA 1MIYA 2LSKA 2CWOA 3DP7A 2EHOC 4LMJA 2X0YA 5AQMB 3B13A 3KBUA 5J0ZA 4EYYR 2Q9QA 4PJLA 2Y6XA 1KEYA 2BS4A 3FZLB 1G8XA 3V5UA 3EVYA 2JPFA 5AQKB 3BQKA 2Q9QC 3J9X1 2MOZA 4TUYE 3GMIA 4DV4T 3RYHE 3PUGA 2ZM8A 1XZYA 3RYFE 3KVBA 2VURA 2WAUA 3LK42 4EAHA 2LM2A 5JDGA 2CLYB 1I6ZA 2CBIA 4CXXA 4TV8E 1N32T 2NTXA 3AEDA 3OYXA 4C90A 3K1SA 2K5BB 5KX5E 3N9PA 4LMKA 1XDOA 5HXHA 1WR6A 3ZEFB 4PJJA 1YQ4A 4LFAT 5JH7E 3PU3A 2L3LA 5AQHB 3TLWA 3AE8A 2W2UA 4HFBA 2BG9E 2LSIA 2WDVA 5IHYA 4V1Av 1E2AA 4AKIA 3AE6A 4K0KT 4IL4A 4WYVA 2YDQA 2VKOA 5JDFA 5DQVA 5JRCB 1KF6A 5JR9B 4HFHA 3B57A 2X0HA 3ZMZB 3FBZA 4O4LE 3FZKB 3PE0A 2D9DA 4UV9B 2BS3A 2CPTA 2X51A 1HX8A 5KMGP
chains in the Genus database with same CATH topology
3FZMB 5AQQB 5AQRB 5AQMB 4HWCA 3FZFB 5AQJB 1UGOA 1M7KA 5AQUB 5AQHB 3A8YC 5AQSB 5AQIB 5AQLB 3FZHB 5AQNB 4HWFA 4HWDA 3FZLB 4HWHA 3M3ZB 5AQVB 1UK5A 1I6ZA 5AQFB 5AQKB 5AQTB 3FZKB 3LDQB 5AQOB 1T7SA 2D9DA 5AQPB 4HWIB 1M62A 1HX1B 5AQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZM B;  5AQQ B;  5AQR B;  5AQM B;  4HWC A;  3FZF B;  5AQJ B;  1UGO A;  1M7K A;  5AQU B;  5AQH B;  3A8Y C;  5AQS B;  5AQI B;  5AQL B;  3FZH B;  5AQN B;  4HWF A;  4HWD A;  3FZL B;  4HWH A;  3M3Z B;  5AQV B;  1UK5 A;  1I6Z A;  5AQF B;  5AQK B;  5AQT B;  3FZK B;  3LDQ B;  5AQO B;  1T7S A;  2D9D A;  5AQP B;  4HWI B;  1M62 A;  1HX1 B;  5AQG B; 
#chains in the Genus database with same CATH topology
 4EXT A;  5J2U E;  1H7C A;  4LF4 T;  2JQ9 A;  3UUM A;  1U5P A;  4YSZ A;  4HN9 A;  4OK0 A;  5FYM A;  2LT3 A;  5FNV E;  4YJ3 E;  5FXX A;  4U72 A;  4ISS A;  2XAF B;  4JYA T;  4UXN B;  4FI5 A;  4HGA A;  4CQI A;  1XDP A;  3K3O A;  4H9N C;  1J5E T;  2JRK A;  2NP9 A;  4Z91 A;  2I0M A;  2A2F X;  4DVD A;  2WM9 A;  3CQC B;  3FZF B;  2LOS A;  2VQE T;  4WBO A;  4HFE A;  3SFD A;  4AQF A;  5HYA A;  1OED C;  3FHN A;  2PTF A;  4YHH T;  1D1A A;  4EIW A;  4BAY B;  2XSA A;  1D0Z A;  3UU8 A;  4AQF C;  1N34 T;  3VRA A;  2R6G F;  4NUU A;  5JDL A;  2H89 A;  3MAC A;  1NWM X;  1LKX A;  4G63 A;  1LRZ A;  1YXR A;  3UFE A;  1E7P A;  3E22 E;  1KNZ A;  2CHO A;  4A98 A;  4KMC A;  4F6R C;  2XQ6 A;  3O1I A;  2XSB A;  4DV1 T;  4GIW A;  3VU7 H;  4LF5 T;  1D1C A;  5HAX A;  2IDO B;  2V8S V;  3QC9 A;  2CBJ A;  2ZM0 A;  4OFZ A;  2VKD A;  2X67 A;  3SRZ A;  2FJE A;  3O1H A;  3KBT A;  3KDS E;  5CB4 E;  4A56 A;  2XQ3 A;  2WY2 A;  5FP3 A;  2UUC T;  3M3Z B;  2KZ7 B;  3UT5 E;  1SE7 A;  2CM0 A;  2JQQ A;  4UEM A;  5FVL A;  3PU8 A;  4ERR A;  4IT4 A;  5GON E;  3TLS A;  5JRC A;  2KXP B;  5JDH A;  5JR9 A;  3WAK A;  4IRE A;  3O9X A;  2XY8 B;  3QB5 K;  1BR2 A;  2UUB T;  4X65 T;  2XHE B;  2XPK A;  3N2G E;  5FKY A;  4GYS A;  1FEW A;  2WQY A;  3FBL A;  4QX8 B;  5C3J A;  1VOM A;  5LG4 A;  2E2A A;  3GA8 A;  1NAF A;  1CHU A;  3CQX C;  3WI3 A;  2J62 A;  3N9O A;  2F4V T;  4PAG A;  3AEF A;  2RPA A;  3NVO A;  3K8P C;  3DTO A;  4U31 A;  3ZMU B;  2DWK A;  2BKO A;  2BBJ A;  1UCU A;  2VL0 A;  3LK2 B;  4IHJ E;  2DLR A;  2XQ7 A;  1UUS A;  3HKB E;  1ZHC A;  2CHN A;  3T1H T;  4F8H A;  2E9X B;  2WU2 A;  3L8R A;  3UFG A;  1MMG A;  1ZKE A;  2XM2 A;  3VR8 A;  4DR2 T;  2VVN A;  4KUM B;  5HEG A;  3UUX B;  2EHO B;  1HG2 A;  1O3X A;  4UF0 A;  2K3W A;  4WZX A;  2LKH A;  4NPP A;  4YTM A;  4IGU A;  4U2Z A;  4WW0 A;  4UVA B;  2H7V C;  2Q9Q B;  2L8K A;  3RH3 A;  4B3M T;  4MBQ A;  5LA6 E;  4DV7 T;  2D2S A;  4Z8X A;  2YK0 A;  5LXT E;  4EZH A;  4O2B E;  1IBM T;  2WB5 A;  4AKL A;  2IHR 1;  3I0Q A;  2JIW A;  5LHH B;  3ZC0 A;  1FJG T;  3T1Y T;  3FZH B;  2E8I A;  1SHZ C;  4DMW A;  2C0S A;  4ZI3 C;  2WP9 A;  5LGN B;  4BA9 A;  2YN6 A;  3F57 A;  4KP3 C;  5ABG A;  2XZE A;  2N2N A;  3Q5X A;  5DAB A;  3UUN A;  3KV4 A;  3TLV A;  1R8I A;  1QSD A;  1CUN A;  1IJ5 A;  2RP4 A;  3IA3 A;  3ABV A;  4HWH A;  2PG8 A;  2WCA A;  3ZLI A;  4LFB T;  2MYS A;  2LLY A;  2NTY A;  1J1J A;  2KMF A;  4EYU A;  1HFA A;  3OVU A;  4KHP T;  3GWH A;  4DBQ A;  2V5D A;  4HWI B;  4ZHQ E;  3JCF A;  2XQ4 A;  4HWC A;  5F5W A;  2VK9 A;  2JQK A;  4HFV A;  3P4P A;  1QUU A;  3ETV A;  4G2A A;  3RHW A;  3F31 A;  3R84 B;  5FL0 A;  3JAD A;  2D0T A;  4IL9 A;  5DQW A;  2M6B A;  2XAG B;  2A3D A;  3UU3 A;  4UEL A;  4IE0 A;  3AB3 B;  3RRC A;  2CWY A;  2LHN A;  3CX8 B;  4O4H E;  2UUA T;  2E9X A;  3BQI A;  1UUR A;  1ZP0 A;  1OWA A;  5CA1 E;  3H3A A;  2CRB A;  3AA7 B;  3PUW F;  4DND A;  3V5S A;  4MAL A;  3ONX A;  2MAW A;  3NBX X;  3NKZ A;  3T8O A;  2SPC A;  4PJM A;  1WLX A;  2IIU A;  4H63 H;  4NIQ A;  4O4I E;  2XAJ B;  4HWF A;  4OYJ A;  4CI1 B;  5C8Y E;  4P0A A;  3KVA A;  1WFD A;  3EDU A;  3X1D A;  4NUV A;  1HNX T;  5LG3 A;  2V7I A;  3A5X A;  2LHR A;  1XNQ T;  3IF8 B;  4YTN A;  1MIW A;  4PFO A;  4JI8 T;  3AVR A;  2V26 A;  2XUE A;  4ZI2 C;  4AKH A;  4ILB A;  5ABE A;  2J1D G;  4ZXL A;  4QXH B;  2XQ5 A;  1IZN B;  2LRK A;  4HFI A;  5L4H A;  2IAK A;  3OTO T;  5A1L A;  4U2Y A;  5TAO A;  2C5J A;  4IST A;  4DO0 A;  4IE5 A;  4YLH A;  2KWI B;  2CE7 A;  3MXZ A;  4GK0 E;  3LJC A;  4UVC B;  3ZCJ A;  3ZKR A;  2WSS V;  3GN5 B;  4IDZ A;  3FB2 A;  1YQ3 A;  2JJ9 A;  1UGO A;  2FUP A;  3RIF A;  5AQS B;  3I1A A;  1BR4 A;  3KV5 A;  3LK3 B;  4QX7 B;  2YOE A;  3MK7 C;  5FY0 A;  3ANW A;  5AQT B;  2DL1 A;  1JNZ A;  2E5V A;  2XTL A;  1ZEE A;  4EEB A;  3AA6 B;  3HL6 A;  4JUY A;  3B5M A;  3RYC E;  4QKN A;  1MIV A;  2KWH A;  2ACZ A;  2ZM2 A;  2XM1 A;  5LBQ B;  2FJD A;  2YDR A;  1V9D A;  4X20 E;  2B76 A;  3ONL C;  2E9X D;  1Z8U A;  5JQG E;  2QA7 A;  3RC3 A;  3AE5 A;  3PUY F;  2KIN B;  1X9B A;  4Q25 A;  3RF1 A;  2E5L T;  2EHO D;  2X9H A;  2HPJ A;  5LB7 B;  4JI3 T;  3HKC E;  3O1J A;  2FJB A;  1MND A;  2WWV A;  3CVR A;  1WYB A;  2ZMA A;  3HI2 A;  3K3Q C;  3ZMV B;  2X9W A;  1FMW A;  1OED A;  2BG9 C;  1T8B A;  2MTQ A;  2PBI A;  2Q9Q D;  4TWD A;  2H3R A;  4UF0 B;  2FJA A;  4UR9 A;  2UXC T;  5FXV A;  3AAA B;  1I94 T;  3ZJ1 A;  3C64 A;  3HKD E;  3I9Y A;  5HEJ A;  2DHR A;  3VRB A;  1YKE B;  2CXL A;  2DWG A;  4HEA A;  2IC6 A;  4DBR A;  4YFS A;  4ZOL E;  5JDQ A;  3KV6 A;  5FVK A;  4TNV A;  4QHO A;  3VKG A;  1M62 A;  1N36 T;  4AXP A;  5HXC A;  1B7T A;  3AEC A;  5CJ5 A;  4GKJ T;  4YSX A;  1E1H B;  2CEA A;  4IDQ A;  5LNK A;  4PK6 A;  5LHG B;  1VCT A;  2YKS A;  4CXY A;  2XJ7 A;  2IUB A;  3Q5W A;  1L0V A;  4AKG A;  4B3T T;  3ZCI A;  4KBM B;  2W62 A;  5AQN B;  4LF7 T;  3ZMT B;  5EZY E;  3CML A;  1LVF A;  4XBF B;  1ZOY A;  5FY1 A;  1MMD A;  3C4W A;  1HTJ F;  3GN5 A;  3K3N A;  3SFE A;  2LSY A;  4I43 B;  5LYJ E;  4CN6 A;  5L3B B;  2KND A;  2VAS A;  1S94 A;  2UXN B;  4XAX B;  1JNR A;  4E7Z A;  3IBP A;  4XZC A;  3RX6 A;  4I55 E;  5CA0 E;  3MA9 A;  3AEE A;  3JC6 C;  2XAH B;  2VL8 A;  2UXX B;  4JI1 T;  2V7L A;  2MPK A;  4YSY A;  3Q2M A;  5HEU A;  2K9A A;  5JTG A;  4P1N A;  3OYZ A;  2Y48 B;  4A97 A;  4DV0 T;  3QB5 A;  3ONJ A;  3EDV A;  2AXD S;  4X1Y E;  2X66 A;  4U7I A;  4ANJ A;  3AA1 B;  3AEB A;  4H9Q C;  1YD8 G;  4X1K E;  2WMN A;  3H3M A;  5L3D B;  4DR7 T;  4EV6 A;  3P4Q A;  2NW7 A;  4A5X A;  3PUA A;  2V6Y B;  2JMK A;  1XNR T;  3RLF F;  4ZZB A;  4QXB B;  5AQF B;  4JI6 T;  3KIN B;  3EI0 A;  4O2A E;  5H6Q B;  3O4X E;  3C50 A;  3PUV F;  5AQQ B;  3IEE A;  2YIN A;  2V1D B;  4QWN B;  4GKK T;  4ASK A;  3N5L A;  3SS1 A;  2XQY A;  3ZST A;  1AJ3 A;  4MLK A;  3RRW A;  5LP6 E;  1KNR A;  1KFY A;  3Q9D A;  5AQP B;  4DID B;  2BS2 A;  5EK2 A;  2L9Q A;  3N9M A;  5DJQ C;  3NRY A;  5LJM A;  2X0L B;  5L47 A;  4I50 E;  3UTK A;  2FBW A;  4AQG A;  3WAJ A;  2H7O A;  3UU4 A;  3RKG A;  2VKH A;  2OV9 A;  3AE1 A;  3UQ4 A;  5FY7 A;  1US7 B;  2BKN A;  3P4W A;  4ILC A;  1ZV4 X;  3AE7 A;  1XMQ T;  3UQ7 A;  1MMN A;  3RQW A;  1NEK A;  5JVD E;  4KHZ F;  3UU6 A;  2UXD T;  4JEH B;  2XQA A;  2K48 A;  4GK5 E;  4TWF A;  4J2C A;  1SUM B;  3HA4 A;  3EHZ A;  5HWY A;  3CPZ A;  5LBM A;  4CN1 A;  5HXR A;  5HWX A;  3ZYM A;  1D0X A;  3Q5D A;  5AQI B;  4CI3 B;  2X68 A;  3RI5 A;  1KNP A;  3KV9 A;  3P4R A;  3ANW B;  3LDQ B;  3LSV A;  4TX5 A;  4NXM T;  3E0Z A;  4QH1 A;  1Z0P A;  2C5I T;  5CFB A;  1N33 T;  4YJ2 E;  1NEN A;  3AVS A;  3G06 A;  4B3R T;  1UX5 A;  4ZS2 A;  4X1I E;  4B3S T;  1IBK T;  4U3C A;  2VQF T;  1HS7 A;  3ETU A;  1D1B A;  2CXD A;  3QK6 A;  4BJN A;  2I59 A;  4CXW A;  4TN7 B;  4AI6 A;  1Y01 A;  4LF9 T;  3AEG A;  3VKH A;  1KK7 A;  3AE9 A;  3W15 B;  2DI4 A;  3P4S A;  5AQL B;  2WZI A;  3ZT6 A;  1D0Y A;  4EB6 E;  2HPL A;  4IDO A;  2ODU A;  2P9B A;  2BG9 B;  2A72 A;  2XAQ B;  2PJQ A;  3ZT5 A;  4TV9 E;  3PTR B;  5HCJ A;  5HXS A;  1WRD A;  2V6Y A;  3N9Q A;  1OED B;  1BR1 A;  3NRX A;  5L3F B;  4X64 T;  5IWA T;  4COF A;  1HG5 A;  2V5C A;  2LOP A;  2J4G A;  2VVS A;  1W09 A;  4JEU B;  4TWH A;  3QNU A;  3UU5 A;  3ZJ2 A;  3RC8 A;  2IC9 A;  3LFM A;  4L9I A;  3CKD A;  1UX4 A;  2D0U A;  5JRE A;  1HCI A;  4ZI3 D;  2YEV C;  3FXE B;  3TLT A;  2ZLY A;  1J5W A;  2QRX A;  3JAE A;  4PK5 A;  2UU9 T;  2HN2 A;  3FZM B;  5IYZ E;  4DV2 T;  1FIO A;  5AQU B;  4DUY T;  3PV0 F;  4H63 V;  1FMV A;  4X62 T;  3ZYK A;  2W0G A;  5ABH A;  4L5G A;  4UVB B;  4AQY T;  4IE7 A;  4EZ4 A;  3CQG B;  4DR3 T;  5HEH A;  3OPC A;  3L39 A;  4DR6 T;  2X9Y A;  4P09 A;  2YU1 A;  4YXD A;  1LVK A;  3BQL A;  4DUZ T;  2W67 A;  4DV3 T;  2NW9 A;  2XQ9 A;  3S4U A;  5ABF B;  3M65 A;  3RQU A;  2KLQ A;  4IE6 A;  2DCF A;  3CX7 B;  5AQV B;  4JI4 T;  5FXW A;  4HTE A;  5LHI B;  2D5U A;  1OED E;  4OX9 T;  5LJN A;  5LOV E;  4GOU A;  5AQR B;  3ESL A;  3RGL A;  4DR1 T;  3ZN1 B;  4IDP A;  3L09 A;  1UK5 A;  4LF6 T;  3ZN0 B;  3U3I A;  4PFP A;  2WDR A;  4U33 A;  3H37 A;  3PUX F;  4ZZC A;  5JDM A;  2LM9 A;  3VHL A;  4I4T E;  5L2L A;  4H9S E;  3QUJ A;  1IJ6 A;  5AQJ B;  4ILU A;  2VKJ A;  4YY3 T;  2XQ8 A;  4H9R C;  3C98 B;  4HFD A;  2V7J A;  4H9P C;  4AIU A;  3C4Z A;  4CZZ B;  2WS3 A;  4ADZ A;  2BG9 A;  3ZC1 A;  5KXJ A;  3MKD A;  4LML A;  2AE9 A;  3MZK B;  2NR4 A;  3ZSS A;  2WMO A;  4DMV A;  3EAM A;  3KFW X;  1XWM A;  3CX6 B;  2C5K T;  4O8S A;  1HNZ T;  4UIG A;  3N9L A;  1XMO T;  5LMN T;  2A9U A;  2GK9 A;  4ZI2 D;  3AXJ A;  4JI7 T;  2N9D A;  4DR5 T;  3HKE E;  2LRL A;  1U4Q A;  4NXN T;  3JAF A;  5L3E B;  3L3P A;  4KX6 A;  3PUQ A;  1BR0 A;  4JV5 T;  4FJO A;  3LBX B;  4PW8 A;  4I0U A;  2CXF A;  3PJA J;  3RIA A;  1T72 A;  2M6I A;  3FXD B;  2YU2 A;  3PUR A;  4ILA A;  5JDN A;  4TZ4 C;  4IE4 A;  5HCM A;  3BK9 A;  4JLE A;  4HKA A;  2WDQ A;  2WU5 A;  2Z6E A;  5EK4 A;  2H88 A;  1YKH B;  2V7M A;  5LCY A;  4X66 T;  2YDS A;  3IHR A;  4JBW F;  4MHC A;  2BBH A;  1T7S A;  5FMN A;  4DV5 T;  3AAE B;  2CLY C;  2K24 A;  4KI0 F;  2UXB T;  4QH4 A;  3C51 A;  5ABF A;  2X9X A;  2MBG A;  5J2T E;  5F8P A;  2I6H A;  1GQE A;  4HWD A;  2G0U A;  3CWZ B;  5IUX A;  2DNX A;  4C91 A;  3R6N A;  2IML A;  3AA0 B;  4YHJ A;  2JQH A;  2HH7 A;  5CGM A;  4K0U A;  5HEO A;  4ZEY A;  1WCR A;  3PUS A;  4N78 D;  4PJN A;  3RKO A;  3ZT7 A;  4HFC A;  2WZH A;  2V7K A;  5JR9 C;  2OA5 A;  1S35 A;  5ETW A;  5L4E A;  1VCS A;  5BR8 T;  1MMA A;  3UUL A;  2ACX A;  3F2E A;  4WNK A;  3C4X A;  4E7S A;  1HF8 A;  3PJA A;  4P0B A;  4EGW A;  3OKQ A;  2WWU A;  2W63 A;  5EK3 A;  4U7Y A;  1HNW T;  5AQG B;  3NWI A;  2CMR A;  3RIU A;  2VB6 A;  4LF8 T;  1QLB A;  1DU2 A;  4QH5 A;  3RIU C;  2NW8 A;  4CI2 B;  5FL1 A;  2CA5 A;  2QVA A;  3EUH A;  3RYI E;  3AAI A;  5LGT B;  5FXZ A;  3NZP A;  4PK4 A;  2BDE A;  2BVM A;  2PFV A;  2QYW A;  1W9R A;  5H6R B;  2WBL A;  5J1G A;  4AIS A;  5L3G B;  3ZYL A;  3AE2 A;  4TNW A;  2ES0 A;  1HR0 T;  2BZB A;  4L0R A;  3OJA A;  4EOZ B;  1T98 A;  3LBX A;  4OYK A;  3RPU A;  5LGU B;  2LEH A;  2W00 A;  4JI0 T;  3SWH A;  1WR0 A;  2N1G A;  2OLT A;  2RA1 A;  3AE4 A;  2IW5 B;  5C2T A;  4H9O C;  1VRB A;  4EED A;  1W0B A;  2LKG A;  1IAP A;  2CCQ A;  5M4Y A;  2HHH T;  3DJB A;  3AE3 A;  4ZI7 E;  4ZS3 A;  1Y64 B;  2M67 A;  2LSJ A;  3N2K E;  4HE8 A;  4U74 A;  3I9W A;  3SOL A;  3ZMS B;  1HX1 B;  2NWB A;  2HN1 A;  3P7I A;  4Z90 A;  4QXC B;  1X79 A;  3JC6 D;  4PNI A;  4DR4 T;  1EZ3 A;  3PDY A;  4YTP A;  3N2O A;  3CIR A;  3A7M A;  4MFR A;  5AQO B;  1W0A A;  3UUB A;  3D0T A;  2KSR A;  2ODV A;  2QGS A;  5AFU L;  4LFC T;  1WYC A;  4AKR B;  2LJL A;  1MNE A;  4GYR A;  1IBL T;  5ADX L;  4CN4 A;  2BVL A;  3Q5E A;  3TLU A;  3PUZ F;  1SA0 E;  2NOX A;  4WBN E;  3TKL B;  5L3C B;  3HR0 A;  3I0O A;  2J47 A;  2Y8D A;  2BKP A;  4B6X A;  4X5T A;  3NZQ A;  4JI2 T;  4YT0 A;  2LSG A;  2JMH A;  2W66 A;  3A8Y C;  2B1E A;  1OXZ A;  3AEA A;  2V6X A;  2ZM6 T;  5HXE A;  3J7Y q;  5F3J A;  2W4X A;  3E08 A;  3VR9 A;  3MJX A;  1YW0 A;  5E0O A;  2W61 A;  2KT9 A;  3ZPO A;  4M1P A;  2XAS B;  3U78 A;  4O4J E;  4UV8 B;  5BMV E;  4BJM A;  3N9N A;  3CK6 A;  3P8C D;  4DV6 T;  4IIJ E;  3P50 A;  4IDN A;  2VWA A;  2E9X C;  3LG7 A;  4JI5 T;  5LMU T;  1G73 A;  2LE8 A;  5KDM C;  1M7K A;  3EAB A;  3AXJ B;  2EHO A;  3OBV E;  4OHF A;  3QOF A;  1MIY A;  2LSK A;  2CWO A;  3DP7 A;  2EHO C;  4LMJ A;  2X0Y A;  5AQM B;  3B13 A;  3KBU A;  5J0Z A;  4EYY R;  2Q9Q A;  4PJL A;  2Y6X A;  1KEY A;  2BS4 A;  3FZL B;  1G8X A;  3V5U A;  3EVY A;  2JPF A;  5AQK B;  3BQK A;  2Q9Q C;  3J9X 1;  2MOZ A;  4TUY E;  3GMI A;  4DV4 T;  3RYH E;  3PUG A;  2ZM8 A;  1XZY A;  3RYF E;  3KVB A;  2VUR A;  2WAU A;  3LK4 2;  4EAH A;  2LM2 A;  5JDG A;  2CLY B;  1I6Z A;  2CBI A;  4CXX A;  4TV8 E;  1N32 T;  2NTX A;  3AED A;  3OYX A;  4C90 A;  3K1S A;  2K5B B;  5KX5 E;  3N9P A;  4LMK A;  1XDO A;  5HXH A;  1WR6 A;  3ZEF B;  4PJJ A;  1YQ4 A;  4LFA T;  5JH7 E;  3PU3 A;  2L3L A;  5AQH B;  3TLW A;  3AE8 A;  2W2U A;  4HFB A;  2BG9 E;  2LSI A;  2WDV A;  5IHY A;  4V1A v;  1E2A A;  4AKI A;  3AE6 A;  4K0K T;  4IL4 A;  4WYV A;  2YDQ A;  2VKO A;  5JDF A;  5DQV A;  5JRC B;  1KF6 A;  5JR9 B;  4HFH A;  3B57 A;  2X0H A;  3ZMZ B;  3FBZ A;  4O4L E;  3FZK B;  3PE0 A;  2D9D A;  4UV9 B;  2BS3 A;  2CPT A;  2X51 A;  1HX8 A;  5KMG P; 
#chains in the Genus database with same CATH homology
 3FZM B;  5AQQ B;  5AQR B;  5AQM B;  4HWC A;  3FZF B;  5AQJ B;  1UGO A;  1M7K A;  5AQU B;  5AQH B;  3A8Y C;  5AQS B;  5AQI B;  5AQL B;  3FZH B;  5AQN B;  4HWF A;  4HWD A;  3FZL B;  4HWH A;  3M3Z B;  5AQV B;  1UK5 A;  1I6Z A;  5AQF B;  5AQK B;  5AQT B;  3FZK B;  3LDQ B;  5AQO B;  1T7S A;  2D9D A;  5AQP B;  4HWI B;  1M62 A;  1HX1 B;  5AQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...