1HX1B

Crystal structure of a bag domain in complex with the hsc70 atpase domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/chaperone inhibitor
molecule keywords Heat shock 70 kDa protein 8
publication title Structure of a Bag/Hsc70 complex: convergent functional evolution of Hsp70 nucleotide exchange factors.
pubmed doi rcsb
source organism Bos taurus
total genus 45
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2001-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1hx1B00
1HX1B 3FZKB 5AQRB 2D9DA 5AQUB 5AQNB 1M62A 1I6ZA 3LDQB 1UK5A 5AQHB 3A8YC 5AQLB 5AQTB 3M3ZB 5AQPB 5AQFB 1M7KA 5AQVB 5AQMB 3FZHB 1T7SA 5AQKB 5AQSB 5AQOB 4HWDA 5AQIB 3FZLB 3FZMB 5AQJB 1UGOA 4HWIB 4HWCA 5AQQB 5AQGB 3FZFB 4HWHA 4HWFA
chains in the Genus database with same CATH superfamily
1WYCA 2HH7A 1N32T 2XASB 1M62A 4DUZT 3AE8A 3T1HT 4EXTA 4HN9A 5C2TA 3JADA 2QYWA 2KWHA 5FYMA 5JREA 5AQKB 4LF8T 3KVAA 1KEYA 2VQET 3ABVA 4O4IE 4ZI3C 2WCAA 2XY8B 4YHHT 5FY7A 5HEJA 2CCQA 3H3MA 3QUJA 4CZZB 4TNVA 1XMQT 4YFSA 3AE2A 1LRZA 4JI1T 1FIOA 3AE4A 3AXJA 4U33A 2UXDT 2YU2A 4ZI2C 4GKKT 2YDRA 4DVDA 1LVKA 2X0HA 4UVBB 5FXZA 3CQGB 4JI6T 2A3DA 2D0UA 4LF9T 4A98A 4EOZB 1OEDC 3N5LA 2NW9A 2WY2A 4ADZA 3SOLA 2WM9A 1NAFA 2LOPA 3SRZA 4QHOA 2V7JA 3AA7B 2FUPA 4BA9A 1ZHCA 2Q9QA 5HEOA 3AAIA 3HKBE 4TWHA 2WP9A 3OYZA 4TV9E 3AE1A 4AIUA 2LRKA 2E9XA 3I9YA 2ZM2A 4EAHA 3ZCJA 2SPCA 2X9XA 5JH7E 3AAEB 4DR2T 2IMLA 1W9RA 2FJDA 4UR9A 3KV6A 3J9X1 4DV7T 2X0YA 3QOFA 2K24A 3ZEFB 5C3JA 2CBJA 2LSKA 4WBNE 4B3TT 4DV3T 3JCFA 2WDQA 4ZI3D 1FJGT 5FP3A 3PU3A 2X9HA 3UFEA 3OKQA 4DMWA 1DU2A 4HE8A 3ETVA 5HCMA 2WMOA 3GMIA 4G2AA 2ZM8A 3AE9A 2YOEA 3FZHB 2XQ3A 5HEGA 5AQIB 2ACZA 5CJ5A 3PURA 1IJ6A 1AJ3A 2JRKA 3N9MA 3N2KE 3C50A 2J47A 5C8YE 3C4ZA 3ZMSB 4EYYR 5DQVA 4P1NA 3TLWA 2OLTA 3B5MA 3RIUC 5LGUB 4YLHA 3KV5A 4IL4A 3EDUA 3J7Yq 3QK6A 2KWIB 1D1BA 2W61A 2QRXA 3Q5DA 4ILUA 3NWIA 4IE0A 2KINB 5AQPB 2X67A 3ANWB 3TKLB 3QNUA 1MMDA 4PK4A 4U7YA 4YSXA 5FVKA 4OYKA 2V5DA 2XAJB 1OWAA 4XAXB 3OJAA 3OPCA 3QC9A 4IE6A 5ABFB 3UT5E 2UXCT 2C5JA 1KK7A 2NWBA 4ZS2A 4GK5E 4Z90A 3RYHE 3UU3A 4HGAA 3VR9A 4U2YA 3CIRA 5KXJA 4NIQA 3ZC1A 4AQYT 3LK42 2CM0A 3F57A 2IDOB 2E8IA 5LHHB 2J4GA 4HWFA 3VKHA 3SFDA 1YXRA 3HI2A 3EDVA 4DV4T 3Q5XA 4ISSA 2GK9A 4KHPT 2WZHA 4YTMA 4QXHB 2MTQA 4OYJA 3Q5WA 3RYIE 5HXHA 1N36T 4UXNB 2WB5A 3VRBA 4I4TE 4LFCT 4LF4T 3AE6A 3EVYA 4IDOA 4MFRA 2Q9QC 2NOXA 5ABEA 4EGWA 2RPAA 5AFUL 3I0QA 3K1SA 2XUEA 3HKCE 3T8OA 2MOZA 2JIWA 3PU8A 2XZEA 1D1AA 3K3NA 3HL6A 2V26A 4QH5A 2LM9A 1YW0A 5JQGE 1NENA 3AA0B 1B7TA 2V6XA 2BG9A 3KBUA 4N78D 3C98B 4EV6A 4F8HA 3RKOA 3NZPA 3VRAA 4PNIA 5LXTE 3P50A 4ZI7E 3CQXC 4HFCA 1XWMA 4I0UA 5AQJB 1O3XA 2WS3A 1V9DA 3CPZA 3IHRA 5IYZE 5ABGA 4Z8XA 4G63A 2L8KA 4JYAT 5L3FB 3X1DA 2VB6A 2D0TA 1IJ5A 2YN6A 1H7CA 2A2FX 2ES0A 4O8SA 2LSYA 4IDNA 5AQFB 2YINA 3HA4A 3NRXA 2WWUA 4XBFB 3DJBA 5LP6E 2XSAA 3PDYA 4KX6A 4B3RT 3PUVF 5JDNA 4IGUA 3AEDA 1UURA 3SWHA 2Y6XA 3WI3A 3ETUA 2V7LA 3AE7A 4DR4T 3I0OA 2VQFT 3CX8B 3WAJA 4ILAA 3N9LA 1E1HB 1SUMB 3HKDE 3PV0F 5ABHA 3RX6A 4A5XA 4UEMA 3QB5A 2X9YA 1WFDA 2HN2A 5JRCA 2CBIA 4EZHA 4GYSA 4IE7A 2OV9A 5EK4A 4A56A 4GOUA 3IF8B 3ESLA 2NW7A 3RPUA 5L3BB 3MKDA 5LCYA 2P9BA 1ZKEA 1HX8A 2DWGA 4H9NC 2CXLA 3OBVE 1OEDE 4YSYA 4JI3T 2W4XA 1WYBA 3ZYLA 4A97A 3PJAJ 2K48A 3F2EA 2LSIA 2YDQA 2BVLA 3UUNA 2KT9A 2PBIA 2Z6EA 3ONJA 4QH1A 4AKGA 2L9QA 2Y8DA 4JEHB 2C0SA 2CWOA 5F5WA 5HXRA 4BAYB 2WDRA 3ZSSA 5F3JA 3LG7A 3ONXA 5LB7B 3TLTA 2IUBA 3FZFB 1WLXA 4HWHA 1KF6A 4TWFA 3LK2B 3AVRA 2EHOA 5AQTB 2CLYC 2CHOA 2LHNA 4ILBA 3ZCIA 2XHEB 3QB5K 1N33T 5IWAT 5CA1E 5IHYA 4E7SA 4P09A 3UU8A 5L3DB 3EUHA 3PE0A 4LFBT 2NW8A 3GN5A 4K0KT 4FJOA 3ZMTB 2HPJA 3JC6D 2JPFA 5JDHA 2LJLA 3Q9DA 4CI3B 1BR2A 2UXXB 3RRCA 3UTKA 2CRBA 1CHUA 1HX1B 1Z8UA 2WDVA 4TX5A 1HG5A 3KV9A 4IT4A 3PUXF 5L3EB 2XAGB 2XQ7A 4HFVA 1HFAA 2VL0A 1T7SA 2VK9A 4B6XA 2DCFA 3RYCE 2BBHA 4HKAA 1MMNA 3I9WA 1UCUA 1UUSA 2VKDA 4YT0A 4HFDA 3V5SA 2XQYA 2JMKA 5HEUA 3RC3A 2HHHT 4QX8B 1WCRA 3AE5A 4IDQA 2BDEA 2IC9A 4U3CA 3FBLA 4U7IA 3B57A 2ZM6T 2A72A 3RI5A 4TN7B 5A1LA 4Q25A 5HCJA 1MNEA 4IE4A 2JQHA 5JR9C 2W63A 2LRLA 3ZPOA 3S4UA 4OK0A 1IAPA 5AQVB 2CWYA 4X1IE 2H7VC 1Y01A 2X51A 4HEAA 1JNRA 2VVSA 2BS2A 3TLVA 4JI5T 4XZCA 1QLBA 2N9DA 2MAWA 2YDSA 4QXBB 1YKEB 5LBMA 2CMRA 1T8BA 2J1DG 4H63H 1W0AA 3MACA 5HWYA 3GA8A 3LJCA 1HS7A 3U3IA 3CX6B 4HWIB 1R8IA 2JQQA 1VCTA 1IBKT 2IHR1 3BQLA 3AB3B 4JBWF 3LBXB 2G0UA 2CLYB 2BZBA 5HXEA 4HFIA 4YJ3E 4ZI2D 4ZZBA 3BQKA 4AI6A 2V7KA 3RLFF 4JI0T 3AEBA 4U2ZA 4H9RC 2W2UA 5JDGA 4DR7T 2QGSA 5HXCA 5CFBA 3P4WA 1MNDA 2NTXA 3EAMA 1Z0PA 3ZT7A 5GONE 4H9PC 1BR0A 5L4EA 1US7B 2XM2A 3N2GE 4WYVA 5FY0A 2W00A 2DWKA 3Q5EA 4DR6T 2LLYA 1OEDB 4HWDA 3ZMUB 2BKOA 4PK6A 4OHFA 5DJQC 3PTRB 2XQ9A 4BJMA 5JDQA 2EHOC 2D9DA 3A7MA 4B3ST 3AEGA 2D2SA 4KHZF 3AE3A 2XAHB 1I94T 1KNRA 3KV4A 3N2OA 3SS1A 2ZLYA 3NKZA 1SA0E 3ZN0B 2IAKA 4P0AA 4GKJT 3HKEE 3UUBA 4IE5A 3R6NA 2ODVA 3UULA 2X66A 1I6ZA 4DO0A 5LA6E 4LMKA 2NP9A 5LMNT 2E5VA 2XSBA 3AEFA 2VKHA 1MIYA 4X5TA 4WNKA 5DABA 3EI0A 3FZKB 2XQ6A 1YD8G 1VOMA 3AA6B 5AQLB 3M3ZB 4DNDA 4KBMB 4ZXLA 4PJMA 1ZOYA 4LF7T 4X65T 2NR4A 3IEEA 4E7ZA 4QWNB 5LGTB 3UUMA 2V6YB 1J5WA 1E7PA 2VVNA 4UIGA 3RYFE 3OVUA 4DR3T 3ZYKA 4X1YE 3C4WA 3P7IA 1HR0T 4CN1A 4BJNA 4ASKA 3CVRA 2E9XC 3LK3B 1UK5A 4QH4A 2W62A 2XAFB 2FBWA 2X0LB 2B76A 5FXXA 4NXMT 4UF0B 2N1GA 2V8SV 1T72A 2BKNA 4GK0E 4PK5A 2WMNA 4IL9A 4LMLA 4X1KE 1LKXA 2BKPA 4NPPA 2QVAA 2JQ9A 1U4QA 1HCIA 3V5UA 2WQYA 2CE7A 2HN1A 4KUMB 5FXWA 3NZQA 1W09A 3ZJ1A 4QX7B 4WBOA 3KDSE 4UV9B 5H6QB 4CQIA 3MXZA 2Y48B 3MA9A 2CEAA 3ANWA 4UVCB 1YQ3A 5KX5E 2XQ5A 3L8RA 1S35A 3P4PA 4Z91A 4ZS3A 4YJ2E 3F31A 1XNQT 3T1YT 5ABFA 3N9NA 4H9SE 3UU5A 3N9PA 2N2NA 5J2UE 1KNPA 5AQOB 2XJ7A 3AXJB 2NTYA 4U72A 4H9OC 4FI5A 4LMJA 2I0MA 2DNXA 5CGMA 5DQWA 5LG3A 5AQUB 2W66A 4OX9T 2BBJA 3VU7H 3RIFA 4L5GA 2Q9QD 1IBLT 5JDMA 2V7IA 4O2BE 2BVMA 1HTJF 3K8PC 2K3WA 2I6HA 4JI4T 5J0ZA 2H7OA 4IDZA 4EYUA 2E9XD 3RQUA 2JMHA 2ODUA 2KLQA 3BQIA 4WW0A 4TV8E 4COFA 3BK9A 2Q9QB 3OTOT 2LKHA 5LMUT 4YSZA 5M4YA 3VHLA 1QUUA 5AQGB 2UXBT 3EABA 2E2AA 2H88A 3G06A 1QSDA 5AQNB 1LVFA 4ANJA 2X68A 3RHWA 2PFVA 5BMVE 4J2CA 3JAFA 2LT3A 3P4QA 3L39A 4O4JE 2DL1A 4DMVA 5FKYA 4DV5T 4EEBA 3ZKRA 2XQAA 3LDQB 2B1EA 1X79A 4ISTA 4ZEYA 4DV6T 4JV5T 2CPTA 4O2AE 2PG8A 4IREA 3AECA 2KXPB 4AQGA 1SE7A 2MYSA 4JEUB 3UUXB 2MPKA 4I55E 4NXNT 3RC8A 2HPLA 2BS3A 3CMLA 3EHZA 5ADXL 2M6BA 5HAXA 3ZYMA 2K9AA 3ZN1B 3AEEA 1KNZA 1MIVA 1KFYA 4CXYA 1XDPA 1YKHB 4UV8B 4PW8A 1L0VA 2PTFA 1EZ3A 3PUQA 5L47A 5KDMC 1NEKA 2FJEA 4AKHA 4OFZA 2BG9C 3AAAB 2OA5A 5L4HA 3CQCB 4CXWA 4QKNA 3NVOA 3RIAA 3U78A 4DV0T 1SHZC 2XTLA 2H3RA 2CHNA 3UFGA 3L3PA 2WAUA 3PUGA 4QXCB 1HNWT 4HTEA 5FXVA 4DIDB 3LFMA 5F8PA 1XMOT 4IIJE 3E22E 4HFEA 3ZMZB 1UX5A 5AQMB 3L09A 1ZEEA 2E5LT 3O4XE 1HNZT 5LYJE 3K3OA 5LJMA 4P0BA 2V7MA 1T98A 3ZJ2A 2WZIA 1VRBA 3LSVA 5EK2A 3IA3A 2D5UA 4ILCA 4X62T 3K3QC 5L3CB 3M65A 3P4RA 2V1DB 3AEAA 3ZSTA 1X9BA 3E0ZA 3CKDA 5IUXA 1FMVA 4ZOLE 3ZLIA 4U31A 2H89A 2BS4A 4JLEA 1OXZA 5E0OA 1E2AA 5LBQB 4TUYE 2J62A 5CA0E 2CXFA 3O1HA 1D0ZA 3RRWA 4JI7T 2UUAT 4AQFA 3PUWF 3JAEA 2A9UA 4CI1B 5FL1A 4IHJE 4EIWA 4YY3T 2XM1A 4L9IA 2XQ8A 4X20E 3DTOA 4H63V 1M7KA 3KFWX 2FJBA 3N9QA 5JDLA 3NRYA 3UQ7A 1WR6A 2IW5B 5FNVE 2KSRA 3AA1B 3WAKA 5ETWA 1IBMT 1G73A 4ZZCA 3FXEB 4L0RA 1HF8A 4UELA 3CK6A 5KMGP 2RA1A 1WR0A 5FVLA 4EEDA 1S94A 3MK7C 4YHJA 2C5KT 2BG9B 3NBXX 4PJNA 4GYRA 5LJNA 3ZMVB 4IDPA 3N9OA 4DR1T 2XQ4A 4DUYT 2X9WA 1XNRT 4KP3C 4DR5T 2LOSA 2KMFA 4F6RC 2L3LA 3O9XA 4ERRA 3D0TA 1JNZA 5HWXA 3P8CD 5EZYE 3HR0A 2FJAA 2R6GF 4TWDA 1CUNA 2LE8A 4DV1T 3FZMB 4C91A 4U74A 5AQHB 3TLUA 5LG4A 5TAOA 5LHIB 3Q2MA 2M6IA 4K0UA 5JR9B 2LEHA 2WU5A 2YKSA 2AE9A 2YK0A 2VKJA 4EB6E 3SFEA 4MBQA 1MMGA 5L2LA 3RGLA 2DLRA 2F4VT 3A8YC 3ONLC 2ACXA 2YEVC 1N34T 4NUUA 3RQWA 1WRDA 5JDFA 1IZNB 4GIWA 4DBQA 4CXXA 5J1GA 2K5BB 1BR4A 5FY1A 4UVAB 1UX4A 4PFOA 4I43B 2WBLA 5JTGA 2LSGA 4DV2T 2ZM0A 3A5XA 1U5PA 4JI2T 3C4XA 4LF6T 4X66T 5JRCB 3RF1A 4AISA 4C90A 4MALA 2WU2A 1BR1A 4AKRB 3LBXA 3O1IA 2JJ9A 4CN6A 1HNXT 2I59A 3MJXA 4JUYA 3CWZB 3MZKB 2V5CA 4X64T 3H37A 3KINB 4PJLA 5HEHA 2W0GA 2W67A 2EHOD 4YTPA 4PAGA 4O4HE 2UU9T 3C64A 2VASA 4O4LE 2AXDS 5AQSB 4AQFC 4MHCA 1GQEA 3FXDB 1XZYA 3ZT5A 2LSJA 5BR8T 4HFBA 3R84B 1ZP0A 4AXPA 3PUYF 5FL0A 3H3AA 3IBPA 2KZ7B 3RKGA 3I1AA 4AKLA 2EHOB 4ZHQE 4EZ4A 1J5ET 1FEWA 1OEDA 1W0BA 1ZV4X 4HFHA 3AVSA 4HWCA 5JVDE 2DI4A 3ZT6A 1D0XA 3FB2A 2VURA 3PUZF 5EK3A 2UUBT 3GN5B 4H9QC 2CXDA 2IC6A 2XAQB 4I50E 5L3GB 2VWAA 1G8XA 4AKIA 4CI2B 1MIWA 2C5IT 2MBGA 1HG2A 3PUAA 2ZMAA 3DP7A 5JR9A 2VKOA 3KBTA 3FBZA 2YU1A 2LHRA 2KNDA 2PJQA 4B3MT 2QA7A 4JI8T 2XPKA 3TLSA 2LKGA 1XDOA 3B13A 3UQ4A 2VL8A 3P4SA 5AQRB 1VCSA 3JC6C 4YTNA 3OYXA 3RH3A 1MMAA 5H6RB 4PJJA 1FMWA 5LNKA 1Y64B 5HXSA 4TZ4C 3W15B 2RP4A 1YQ4A 3PUSA 2V6YA 3UU4A 3PJAA 4LF5T 5J2TE 2UUCT 2BG9E 2E9XB 4M1PA 1D0YA 2CA5A 2WWVA 4DBRA 1UGOA 3UU6A 2M67A 3E08A 5LOVE 4MLKA 5FMNA 4V1Av 2DHRA 5CB4E 4YXDA 4UF0A 3CX7B 1D1CA 4KI0F 4TNWA 3FHNA 3RIUA 1NWMX 3FZLB 2JQKA 5LHGB 5LGNB 2UXNB 4PFPA 3KVBA 2LM2A 5HYAA 2IIUA 3VR8A 3GWHA 4KMCA 3O1JA 4WZXA 2WSSV 3ZC0A 4CN4A 1J1JA 4LFAT 5AQQB 4NUVA 3C51A 3VKGA
chains in the Genus database with same CATH topology
1HX1B 3FZKB 5AQRB 2D9DA 5AQUB 5AQNB 1M62A 1I6ZA 3LDQB 1UK5A 5AQHB 3A8YC 5AQLB 5AQTB 3M3ZB 5AQPB 5AQFB 1M7KA 5AQVB 5AQMB 3FZHB 1T7SA 5AQKB 5AQSB 5AQOB 4HWDA 5AQIB 3FZLB 3FZMB 5AQJB 1UGOA 4HWIB 4HWCA 5AQQB 5AQGB 3FZFB 4HWHA 4HWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 B;  3FZK B;  5AQR B;  2D9D A;  5AQU B;  5AQN B;  1M62 A;  1I6Z A;  3LDQ B;  1UK5 A;  5AQH B;  3A8Y C;  5AQL B;  5AQT B;  3M3Z B;  5AQP B;  5AQF B;  1M7K A;  5AQV B;  5AQM B;  3FZH B;  1T7S A;  5AQK B;  5AQS B;  5AQO B;  4HWD A;  5AQI B;  3FZL B;  3FZM B;  5AQJ B;  1UGO A;  4HWI B;  4HWC A;  5AQQ B;  5AQG B;  3FZF B;  4HWH A;  4HWF A; 
#chains in the Genus database with same CATH topology
 1WYC A;  2HH7 A;  1N32 T;  2XAS B;  1M62 A;  4DUZ T;  3AE8 A;  3T1H T;  4EXT A;  4HN9 A;  5C2T A;  3JAD A;  2QYW A;  2KWH A;  5FYM A;  5JRE A;  5AQK B;  4LF8 T;  3KVA A;  1KEY A;  2VQE T;  3ABV A;  4O4I E;  4ZI3 C;  2WCA A;  2XY8 B;  4YHH T;  5FY7 A;  5HEJ A;  2CCQ A;  3H3M A;  3QUJ A;  4CZZ B;  4TNV A;  1XMQ T;  4YFS A;  3AE2 A;  1LRZ A;  4JI1 T;  1FIO A;  3AE4 A;  3AXJ A;  4U33 A;  2UXD T;  2YU2 A;  4ZI2 C;  4GKK T;  2YDR A;  4DVD A;  1LVK A;  2X0H A;  4UVB B;  5FXZ A;  3CQG B;  4JI6 T;  2A3D A;  2D0U A;  4LF9 T;  4A98 A;  4EOZ B;  1OED C;  3N5L A;  2NW9 A;  2WY2 A;  4ADZ A;  3SOL A;  2WM9 A;  1NAF A;  2LOP A;  3SRZ A;  4QHO A;  2V7J A;  3AA7 B;  2FUP A;  4BA9 A;  1ZHC A;  2Q9Q A;  5HEO A;  3AAI A;  3HKB E;  4TWH A;  2WP9 A;  3OYZ A;  4TV9 E;  3AE1 A;  4AIU A;  2LRK A;  2E9X A;  3I9Y A;  2ZM2 A;  4EAH A;  3ZCJ A;  2SPC A;  2X9X A;  5JH7 E;  3AAE B;  4DR2 T;  2IML A;  1W9R A;  2FJD A;  4UR9 A;  3KV6 A;  3J9X 1;  4DV7 T;  2X0Y A;  3QOF A;  2K24 A;  3ZEF B;  5C3J A;  2CBJ A;  2LSK A;  4WBN E;  4B3T T;  4DV3 T;  3JCF A;  2WDQ A;  4ZI3 D;  1FJG T;  5FP3 A;  3PU3 A;  2X9H A;  3UFE A;  3OKQ A;  4DMW A;  1DU2 A;  4HE8 A;  3ETV A;  5HCM A;  2WMO A;  3GMI A;  4G2A A;  2ZM8 A;  3AE9 A;  2YOE A;  3FZH B;  2XQ3 A;  5HEG A;  5AQI B;  2ACZ A;  5CJ5 A;  3PUR A;  1IJ6 A;  1AJ3 A;  2JRK A;  3N9M A;  3N2K E;  3C50 A;  2J47 A;  5C8Y E;  3C4Z A;  3ZMS B;  4EYY R;  5DQV A;  4P1N A;  3TLW A;  2OLT A;  3B5M A;  3RIU C;  5LGU B;  4YLH A;  3KV5 A;  4IL4 A;  3EDU A;  3J7Y q;  3QK6 A;  2KWI B;  1D1B A;  2W61 A;  2QRX A;  3Q5D A;  4ILU A;  3NWI A;  4IE0 A;  2KIN B;  5AQP B;  2X67 A;  3ANW B;  3TKL B;  3QNU A;  1MMD A;  4PK4 A;  4U7Y A;  4YSX A;  5FVK A;  4OYK A;  2V5D A;  2XAJ B;  1OWA A;  4XAX B;  3OJA A;  3OPC A;  3QC9 A;  4IE6 A;  5ABF B;  3UT5 E;  2UXC T;  2C5J A;  1KK7 A;  2NWB A;  4ZS2 A;  4GK5 E;  4Z90 A;  3RYH E;  3UU3 A;  4HGA A;  3VR9 A;  4U2Y A;  3CIR A;  5KXJ A;  4NIQ A;  3ZC1 A;  4AQY T;  3LK4 2;  2CM0 A;  3F57 A;  2IDO B;  2E8I A;  5LHH B;  2J4G A;  4HWF A;  3VKH A;  3SFD A;  1YXR A;  3HI2 A;  3EDV A;  4DV4 T;  3Q5X A;  4ISS A;  2GK9 A;  4KHP T;  2WZH A;  4YTM A;  4QXH B;  2MTQ A;  4OYJ A;  3Q5W A;  3RYI E;  5HXH A;  1N36 T;  4UXN B;  2WB5 A;  3VRB A;  4I4T E;  4LFC T;  4LF4 T;  3AE6 A;  3EVY A;  4IDO A;  4MFR A;  2Q9Q C;  2NOX A;  5ABE A;  4EGW A;  2RPA A;  5AFU L;  3I0Q A;  3K1S A;  2XUE A;  3HKC E;  3T8O A;  2MOZ A;  2JIW A;  3PU8 A;  2XZE A;  1D1A A;  3K3N A;  3HL6 A;  2V26 A;  4QH5 A;  2LM9 A;  1YW0 A;  5JQG E;  1NEN A;  3AA0 B;  1B7T A;  2V6X A;  2BG9 A;  3KBU A;  4N78 D;  3C98 B;  4EV6 A;  4F8H A;  3RKO A;  3NZP A;  3VRA A;  4PNI A;  5LXT E;  3P50 A;  4ZI7 E;  3CQX C;  4HFC A;  1XWM A;  4I0U A;  5AQJ B;  1O3X A;  2WS3 A;  1V9D A;  3CPZ A;  3IHR A;  5IYZ E;  5ABG A;  4Z8X A;  4G63 A;  2L8K A;  4JYA T;  5L3F B;  3X1D A;  2VB6 A;  2D0T A;  1IJ5 A;  2YN6 A;  1H7C A;  2A2F X;  2ES0 A;  4O8S A;  2LSY A;  4IDN A;  5AQF B;  2YIN A;  3HA4 A;  3NRX A;  2WWU A;  4XBF B;  3DJB A;  5LP6 E;  2XSA A;  3PDY A;  4KX6 A;  4B3R T;  3PUV F;  5JDN A;  4IGU A;  3AED A;  1UUR A;  3SWH A;  2Y6X A;  3WI3 A;  3ETU A;  2V7L A;  3AE7 A;  4DR4 T;  3I0O A;  2VQF T;  3CX8 B;  3WAJ A;  4ILA A;  3N9L A;  1E1H B;  1SUM B;  3HKD E;  3PV0 F;  5ABH A;  3RX6 A;  4A5X A;  4UEM A;  3QB5 A;  2X9Y A;  1WFD A;  2HN2 A;  5JRC A;  2CBI A;  4EZH A;  4GYS A;  4IE7 A;  2OV9 A;  5EK4 A;  4A56 A;  4GOU A;  3IF8 B;  3ESL A;  2NW7 A;  3RPU A;  5L3B B;  3MKD A;  5LCY A;  2P9B A;  1ZKE A;  1HX8 A;  2DWG A;  4H9N C;  2CXL A;  3OBV E;  1OED E;  4YSY A;  4JI3 T;  2W4X A;  1WYB A;  3ZYL A;  4A97 A;  3PJA J;  2K48 A;  3F2E A;  2LSI A;  2YDQ A;  2BVL A;  3UUN A;  2KT9 A;  2PBI A;  2Z6E A;  3ONJ A;  4QH1 A;  4AKG A;  2L9Q A;  2Y8D A;  4JEH B;  2C0S A;  2CWO A;  5F5W A;  5HXR A;  4BAY B;  2WDR A;  3ZSS A;  5F3J A;  3LG7 A;  3ONX A;  5LB7 B;  3TLT A;  2IUB A;  3FZF B;  1WLX A;  4HWH A;  1KF6 A;  4TWF A;  3LK2 B;  3AVR A;  2EHO A;  5AQT B;  2CLY C;  2CHO A;  2LHN A;  4ILB A;  3ZCI A;  2XHE B;  3QB5 K;  1N33 T;  5IWA T;  5CA1 E;  5IHY A;  4E7S A;  4P09 A;  3UU8 A;  5L3D B;  3EUH A;  3PE0 A;  4LFB T;  2NW8 A;  3GN5 A;  4K0K T;  4FJO A;  3ZMT B;  2HPJ A;  3JC6 D;  2JPF A;  5JDH A;  2LJL A;  3Q9D A;  4CI3 B;  1BR2 A;  2UXX B;  3RRC A;  3UTK A;  2CRB A;  1CHU A;  1HX1 B;  1Z8U A;  2WDV A;  4TX5 A;  1HG5 A;  3KV9 A;  4IT4 A;  3PUX F;  5L3E B;  2XAG B;  2XQ7 A;  4HFV A;  1HFA A;  2VL0 A;  1T7S A;  2VK9 A;  4B6X A;  2DCF A;  3RYC E;  2BBH A;  4HKA A;  1MMN A;  3I9W A;  1UCU A;  1UUS A;  2VKD A;  4YT0 A;  4HFD A;  3V5S A;  2XQY A;  2JMK A;  5HEU A;  3RC3 A;  2HHH T;  4QX8 B;  1WCR A;  3AE5 A;  4IDQ A;  2BDE A;  2IC9 A;  4U3C A;  3FBL A;  4U7I A;  3B57 A;  2ZM6 T;  2A72 A;  3RI5 A;  4TN7 B;  5A1L A;  4Q25 A;  5HCJ A;  1MNE A;  4IE4 A;  2JQH A;  5JR9 C;  2W63 A;  2LRL A;  3ZPO A;  3S4U A;  4OK0 A;  1IAP A;  5AQV B;  2CWY A;  4X1I E;  2H7V C;  1Y01 A;  2X51 A;  4HEA A;  1JNR A;  2VVS A;  2BS2 A;  3TLV A;  4JI5 T;  4XZC A;  1QLB A;  2N9D A;  2MAW A;  2YDS A;  4QXB B;  1YKE B;  5LBM A;  2CMR A;  1T8B A;  2J1D G;  4H63 H;  1W0A A;  3MAC A;  5HWY A;  3GA8 A;  3LJC A;  1HS7 A;  3U3I A;  3CX6 B;  4HWI B;  1R8I A;  2JQQ A;  1VCT A;  1IBK T;  2IHR 1;  3BQL A;  3AB3 B;  4JBW F;  3LBX B;  2G0U A;  2CLY B;  2BZB A;  5HXE A;  4HFI A;  4YJ3 E;  4ZI2 D;  4ZZB A;  3BQK A;  4AI6 A;  2V7K A;  3RLF F;  4JI0 T;  3AEB A;  4U2Z A;  4H9R C;  2W2U A;  5JDG A;  4DR7 T;  2QGS A;  5HXC A;  5CFB A;  3P4W A;  1MND A;  2NTX A;  3EAM A;  1Z0P A;  3ZT7 A;  5GON E;  4H9P C;  1BR0 A;  5L4E A;  1US7 B;  2XM2 A;  3N2G E;  4WYV A;  5FY0 A;  2W00 A;  2DWK A;  3Q5E A;  4DR6 T;  2LLY A;  1OED B;  4HWD A;  3ZMU B;  2BKO A;  4PK6 A;  4OHF A;  5DJQ C;  3PTR B;  2XQ9 A;  4BJM A;  5JDQ A;  2EHO C;  2D9D A;  3A7M A;  4B3S T;  3AEG A;  2D2S A;  4KHZ F;  3AE3 A;  2XAH B;  1I94 T;  1KNR A;  3KV4 A;  3N2O A;  3SS1 A;  2ZLY A;  3NKZ A;  1SA0 E;  3ZN0 B;  2IAK A;  4P0A A;  4GKJ T;  3HKE E;  3UUB A;  4IE5 A;  3R6N A;  2ODV A;  3UUL A;  2X66 A;  1I6Z A;  4DO0 A;  5LA6 E;  4LMK A;  2NP9 A;  5LMN T;  2E5V A;  2XSB A;  3AEF A;  2VKH A;  1MIY A;  4X5T A;  4WNK A;  5DAB A;  3EI0 A;  3FZK B;  2XQ6 A;  1YD8 G;  1VOM A;  3AA6 B;  5AQL B;  3M3Z B;  4DND A;  4KBM B;  4ZXL A;  4PJM A;  1ZOY A;  4LF7 T;  4X65 T;  2NR4 A;  3IEE A;  4E7Z A;  4QWN B;  5LGT B;  3UUM A;  2V6Y B;  1J5W A;  1E7P A;  2VVN A;  4UIG A;  3RYF E;  3OVU A;  4DR3 T;  3ZYK A;  4X1Y E;  3C4W A;  3P7I A;  1HR0 T;  4CN1 A;  4BJN A;  4ASK A;  3CVR A;  2E9X C;  3LK3 B;  1UK5 A;  4QH4 A;  2W62 A;  2XAF B;  2FBW A;  2X0L B;  2B76 A;  5FXX A;  4NXM T;  4UF0 B;  2N1G A;  2V8S V;  1T72 A;  2BKN A;  4GK0 E;  4PK5 A;  2WMN A;  4IL9 A;  4LML A;  4X1K E;  1LKX A;  2BKP A;  4NPP A;  2QVA A;  2JQ9 A;  1U4Q A;  1HCI A;  3V5U A;  2WQY A;  2CE7 A;  2HN1 A;  4KUM B;  5FXW A;  3NZQ A;  1W09 A;  3ZJ1 A;  4QX7 B;  4WBO A;  3KDS E;  4UV9 B;  5H6Q B;  4CQI A;  3MXZ A;  2Y48 B;  3MA9 A;  2CEA A;  3ANW A;  4UVC B;  1YQ3 A;  5KX5 E;  2XQ5 A;  3L8R A;  1S35 A;  3P4P A;  4Z91 A;  4ZS3 A;  4YJ2 E;  3F31 A;  1XNQ T;  3T1Y T;  5ABF A;  3N9N A;  4H9S E;  3UU5 A;  3N9P A;  2N2N A;  5J2U E;  1KNP A;  5AQO B;  2XJ7 A;  3AXJ B;  2NTY A;  4U72 A;  4H9O C;  4FI5 A;  4LMJ A;  2I0M A;  2DNX A;  5CGM A;  5DQW A;  5LG3 A;  5AQU B;  2W66 A;  4OX9 T;  2BBJ A;  3VU7 H;  3RIF A;  4L5G A;  2Q9Q D;  1IBL T;  5JDM A;  2V7I A;  4O2B E;  2BVM A;  1HTJ F;  3K8P C;  2K3W A;  2I6H A;  4JI4 T;  5J0Z A;  2H7O A;  4IDZ A;  4EYU A;  2E9X D;  3RQU A;  2JMH A;  2ODU A;  2KLQ A;  3BQI A;  4WW0 A;  4TV8 E;  4COF A;  3BK9 A;  2Q9Q B;  3OTO T;  2LKH A;  5LMU T;  4YSZ A;  5M4Y A;  3VHL A;  1QUU A;  5AQG B;  2UXB T;  3EAB A;  2E2A A;  2H88 A;  3G06 A;  1QSD A;  5AQN B;  1LVF A;  4ANJ A;  2X68 A;  3RHW A;  2PFV A;  5BMV E;  4J2C A;  3JAF A;  2LT3 A;  3P4Q A;  3L39 A;  4O4J E;  2DL1 A;  4DMV A;  5FKY A;  4DV5 T;  4EEB A;  3ZKR A;  2XQA A;  3LDQ B;  2B1E A;  1X79 A;  4IST A;  4ZEY A;  4DV6 T;  4JV5 T;  2CPT A;  4O2A E;  2PG8 A;  4IRE A;  3AEC A;  2KXP B;  4AQG A;  1SE7 A;  2MYS A;  4JEU B;  3UUX B;  2MPK A;  4I55 E;  4NXN T;  3RC8 A;  2HPL A;  2BS3 A;  3CML A;  3EHZ A;  5ADX L;  2M6B A;  5HAX A;  3ZYM A;  2K9A A;  3ZN1 B;  3AEE A;  1KNZ A;  1MIV A;  1KFY A;  4CXY A;  1XDP A;  1YKH B;  4UV8 B;  4PW8 A;  1L0V A;  2PTF A;  1EZ3 A;  3PUQ A;  5L47 A;  5KDM C;  1NEK A;  2FJE A;  4AKH A;  4OFZ A;  2BG9 C;  3AAA B;  2OA5 A;  5L4H A;  3CQC B;  4CXW A;  4QKN A;  3NVO A;  3RIA A;  3U78 A;  4DV0 T;  1SHZ C;  2XTL A;  2H3R A;  2CHN A;  3UFG A;  3L3P A;  2WAU A;  3PUG A;  4QXC B;  1HNW T;  4HTE A;  5FXV A;  4DID B;  3LFM A;  5F8P A;  1XMO T;  4IIJ E;  3E22 E;  4HFE A;  3ZMZ B;  1UX5 A;  5AQM B;  3L09 A;  1ZEE A;  2E5L T;  3O4X E;  1HNZ T;  5LYJ E;  3K3O A;  5LJM A;  4P0B A;  2V7M A;  1T98 A;  3ZJ2 A;  2WZI A;  1VRB A;  3LSV A;  5EK2 A;  3IA3 A;  2D5U A;  4ILC A;  4X62 T;  3K3Q C;  5L3C B;  3M65 A;  3P4R A;  2V1D B;  3AEA A;  3ZST A;  1X9B A;  3E0Z A;  3CKD A;  5IUX A;  1FMV A;  4ZOL E;  3ZLI A;  4U31 A;  2H89 A;  2BS4 A;  4JLE A;  1OXZ A;  5E0O A;  1E2A A;  5LBQ B;  4TUY E;  2J62 A;  5CA0 E;  2CXF A;  3O1H A;  1D0Z A;  3RRW A;  4JI7 T;  2UUA T;  4AQF A;  3PUW F;  3JAE A;  2A9U A;  4CI1 B;  5FL1 A;  4IHJ E;  4EIW A;  4YY3 T;  2XM1 A;  4L9I A;  2XQ8 A;  4X20 E;  3DTO A;  4H63 V;  1M7K A;  3KFW X;  2FJB A;  3N9Q A;  5JDL A;  3NRY A;  3UQ7 A;  1WR6 A;  2IW5 B;  5FNV E;  2KSR A;  3AA1 B;  3WAK A;  5ETW A;  1IBM T;  1G73 A;  4ZZC A;  3FXE B;  4L0R A;  1HF8 A;  4UEL A;  3CK6 A;  5KMG P;  2RA1 A;  1WR0 A;  5FVL A;  4EED A;  1S94 A;  3MK7 C;  4YHJ A;  2C5K T;  2BG9 B;  3NBX X;  4PJN A;  4GYR A;  5LJN A;  3ZMV B;  4IDP A;  3N9O A;  4DR1 T;  2XQ4 A;  4DUY T;  2X9W A;  1XNR T;  4KP3 C;  4DR5 T;  2LOS A;  2KMF A;  4F6R C;  2L3L A;  3O9X A;  4ERR A;  3D0T A;  1JNZ A;  5HWX A;  3P8C D;  5EZY E;  3HR0 A;  2FJA A;  2R6G F;  4TWD A;  1CUN A;  2LE8 A;  4DV1 T;  3FZM B;  4C91 A;  4U74 A;  5AQH B;  3TLU A;  5LG4 A;  5TAO A;  5LHI B;  3Q2M A;  2M6I A;  4K0U A;  5JR9 B;  2LEH A;  2WU5 A;  2YKS A;  2AE9 A;  2YK0 A;  2VKJ A;  4EB6 E;  3SFE A;  4MBQ A;  1MMG A;  5L2L A;  3RGL A;  2DLR A;  2F4V T;  3A8Y C;  3ONL C;  2ACX A;  2YEV C;  1N34 T;  4NUU A;  3RQW A;  1WRD A;  5JDF A;  1IZN B;  4GIW A;  4DBQ A;  4CXX A;  5J1G A;  2K5B B;  1BR4 A;  5FY1 A;  4UVA B;  1UX4 A;  4PFO A;  4I43 B;  2WBL A;  5JTG A;  2LSG A;  4DV2 T;  2ZM0 A;  3A5X A;  1U5P A;  4JI2 T;  3C4X A;  4LF6 T;  4X66 T;  5JRC B;  3RF1 A;  4AIS A;  4C90 A;  4MAL A;  2WU2 A;  1BR1 A;  4AKR B;  3LBX A;  3O1I A;  2JJ9 A;  4CN6 A;  1HNX T;  2I59 A;  3MJX A;  4JUY A;  3CWZ B;  3MZK B;  2V5C A;  4X64 T;  3H37 A;  3KIN B;  4PJL A;  5HEH A;  2W0G A;  2W67 A;  2EHO D;  4YTP A;  4PAG A;  4O4H E;  2UU9 T;  3C64 A;  2VAS A;  4O4L E;  2AXD S;  5AQS B;  4AQF C;  4MHC A;  1GQE A;  3FXD B;  1XZY A;  3ZT5 A;  2LSJ A;  5BR8 T;  4HFB A;  3R84 B;  1ZP0 A;  4AXP A;  3PUY F;  5FL0 A;  3H3A A;  3IBP A;  2KZ7 B;  3RKG A;  3I1A A;  4AKL A;  2EHO B;  4ZHQ E;  4EZ4 A;  1J5E T;  1FEW A;  1OED A;  1W0B A;  1ZV4 X;  4HFH A;  3AVS A;  4HWC A;  5JVD E;  2DI4 A;  3ZT6 A;  1D0X A;  3FB2 A;  2VUR A;  3PUZ F;  5EK3 A;  2UUB T;  3GN5 B;  4H9Q C;  2CXD A;  2IC6 A;  2XAQ B;  4I50 E;  5L3G B;  2VWA A;  1G8X A;  4AKI A;  4CI2 B;  1MIW A;  2C5I T;  2MBG A;  1HG2 A;  3PUA A;  2ZMA A;  3DP7 A;  5JR9 A;  2VKO A;  3KBT A;  3FBZ A;  2YU1 A;  2LHR A;  2KND A;  2PJQ A;  4B3M T;  2QA7 A;  4JI8 T;  2XPK A;  3TLS A;  2LKG A;  1XDO A;  3B13 A;  3UQ4 A;  2VL8 A;  3P4S A;  5AQR B;  1VCS A;  3JC6 C;  4YTN A;  3OYX A;  3RH3 A;  1MMA A;  5H6R B;  4PJJ A;  1FMW A;  5LNK A;  1Y64 B;  5HXS A;  4TZ4 C;  3W15 B;  2RP4 A;  1YQ4 A;  3PUS A;  2V6Y A;  3UU4 A;  3PJA A;  4LF5 T;  5J2T E;  2UUC T;  2BG9 E;  2E9X B;  4M1P A;  1D0Y A;  2CA5 A;  2WWV A;  4DBR A;  1UGO A;  3UU6 A;  2M67 A;  3E08 A;  5LOV E;  4MLK A;  5FMN A;  4V1A v;  2DHR A;  5CB4 E;  4YXD A;  4UF0 A;  3CX7 B;  1D1C A;  4KI0 F;  4TNW A;  3FHN A;  3RIU A;  1NWM X;  3FZL B;  2JQK A;  5LHG B;  5LGN B;  2UXN B;  4PFP A;  3KVB A;  2LM2 A;  5HYA A;  2IIU A;  3VR8 A;  3GWH A;  4KMC A;  3O1J A;  4WZX A;  2WSS V;  3ZC0 A;  4CN4 A;  1J1J A;  4LFA T;  5AQQ B;  4NUV A;  3C51 A;  3VKG A; 
#chains in the Genus database with same CATH homology
 1HX1 B;  3FZK B;  5AQR B;  2D9D A;  5AQU B;  5AQN B;  1M62 A;  1I6Z A;  3LDQ B;  1UK5 A;  5AQH B;  3A8Y C;  5AQL B;  5AQT B;  3M3Z B;  5AQP B;  5AQF B;  1M7K A;  5AQV B;  5AQM B;  3FZH B;  1T7S A;  5AQK B;  5AQS B;  5AQO B;  4HWD A;  5AQI B;  3FZL B;  3FZM B;  5AQJ B;  1UGO A;  4HWI B;  4HWC A;  5AQQ B;  5AQG B;  3FZF B;  4HWH A;  4HWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...