5H6RB

Crystal structure of lsd1-corest in complex with peptide 13
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
KPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific histone demethylase 1A
publication title Development and crystallographic evaluation of histone H3 peptide with N-terminal serine substitution as a potent inhibitor of lysine-specific demethylase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription/inhibitor
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2016-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5h6rB00
2X0LB 4UXNB 2UXNB 2Y48B 2XAGB 4UVBB 4UVAB 2XASB 2IW5B 5LGNB 2UXXB 4CZZB 4UV9B 3ZN1B 5L3CB 2V1DB 5LHGB 5L3FB 5LBQB 5LGTB 5H6QB 5L3EB 3ZMTB 4XBFB 4UV8B 3ZMSB 2XAHB 5LGUB 3ZMUB 5H6RB 5L3DB 2XAQB 4UVCB 5L3GB 3ZN0B 3ZMZB 5L3BB 5LHHB 3ZMVB 5LHIB 2XAJB 4BAYB 2XAFB 4KUMB
chains in the Genus database with same CATH superfamily
3QK6A 3N9NA 5FNVE 4EIWA 1YKHB 3AVSA 3ZMTB 1KFYA 5AQTB 2IIUA 3UU6A 3ZMZB 4EOZB 5LG4A 3F2EA 4GKKT 3PUZF 4CXWA 4DR4T 5KDMC 2C5JA 2JQHA 2ZM0A 1US7B 5JR9A 1FEWA 2X68A 4HWCA 5LG3A 5LNKA 2LLYA 2JPFA 5LGUB 1OEDB 3ZYLA 3MACA 2A2FX 4ZXLA 4YTPA 1XWMA 5C8YE 1ZOYA 3AE2A 4PFPA 5FXVA 2IW5B 2CRBA 4JLEA 3F57A 3AEDA 5LHGB 5L4HA 4O4LE 4PAGA 3LK2B 4YHJA 4BA9A 3QB5K 2MBGA 3NZPA 4B3TT 5F8PA 4P09A 1R8IA 3OVUA 4YTNA 3Q2MA 2LHRA 1MIYA 3W15B 1V9DA 2AE9A 2FBWA 4ZI2D 3VKHA 2RA1A 3AEAA 4QHOA 1LVFA 2JQKA 4LMLA 3JCFA 3O9XA 1QUUA 2W61A 4EB6E 2D2SA 4L5GA 2IHR1 3KV5A 3T1YT 3FXDB 3UUMA 1LKXA 5LCYA 2X0HA 3CMLA 3RH3A 2XQAA 4CN4A 2D9DA 4EEDA 5IUXA 2WS3A 2Q9QA 3IEEA 5C3JA 5JDHA 3FBZA 2V6XA 1HG2A 2M6BA 4U7YA 3ZYKA 5JR9B 3C51A 2LOSA 5ABFA 4L9IA 2D0TA 1NEKA 4O4IE 5TAOA 4DV3T 4AI6A 4K0KT 5FXXA 3RRCA 3CWZB 2XUEA 3N9PA 4X62T 5HAXA 4YXDA 4GK0E 3HKEE 3LDQB 4DBQA 4MLKA 2X9YA 1VCSA 1OEDE 1HX8A 2CEAA 4IDZA 3AEFA 1VOMA 4DR3T 3FZMB 2ZM6T 1IJ5A 3AEGA 2MTQA 3A5XA 3D0TA 5AQNB 4O4HE 4N78D 2BS2A 3ZT5A 2HPJA 4V1Av 3MKDA 1E7PA 3PJAJ 4WW0A 5KX5E 4K0UA 3SS1A 2E9XA 3QUJA 2XHEB 4QX7B 2W0GA 5LHIB 4BAYB 4YSXA 3FBLA 3A8YC 3K8PC 1HX1B 4ZHQE 4YJ2E 3EUHA 2KXPB 3Q5WA 2PG8A 3UU5A 1M7KA 2Q9QB 3B13A 4HFIA 2XM1A 4X65T 3B5MA 4AIUA 4OK0A 3SFDA 3J7Yq 2CWYA 4ZI7E 3PTRB 4DIDB 5ABFB 3CX7B 3AVRA 5LMNT 3BQLA 5LGTB 2DWKA 1EZ3A 3P4QA 4OHFA 2VL8A 3AB3B 3KV9A 3UFEA 3RGLA 3TLWA 5AQRB 3ZKRA 3LK42 5JR9C 2WCAA 4TV8E 2UXXB 2XQ7A 2LKGA 5HEJA 1HG5A 2C0SA 4QH1A 1JNZA 3CVRA 2FJEA 1OWAA 5AQMB 2D5UA 2XAQB 1HNWT 2WQYA 3UUXB 2XQ5A 2KWIB 4JI5T 4WYVA 4DVDA 3RYFE 5LOVE 3MA9A 4COFA 3RHWA 5LYJE 2DCFA 3CQXC 4H9RC 2E9XB 3JAFA 4PK6A 1D0YA 2Z6EA 1XNQT 4BJMA 5ABEA 4I43B 1IZNB 4NPPA 5M4YA 3ONXA 3IBPA 3VRAA 4JYAT 1U4QA 5LB7B 2LSYA 3RKOA 3AECA 4DV4T 4IGUA 5J2UE 5IYZE 3P4SA 3OYXA 4ZZCA 2NOXA 2E8IA 3N2OA 2W66A 3NRXA 3ZCJA 2UXNB 4BJNA 2XASB 3C4WA 5CA0E 1WR6A 3FZHB 5AQPB 2LEHA 2W2UA 5FVKA 1UX4A 1YQ3A 4DV1T 4WNKA 5DJQC 2WWUA 2KSRA 5EZYE 4IHJE 1MMNA 3L09A 2FJAA 1Y01A 4A98A 4KHZF 1QSDA 3RIUA 3JC6D 3AE8A 4NXNT 2A9UA 3NWIA 1W0AA 2M6IA 4O8SA 3ZSTA 4ILAA 4LFCT 2XAHB 3AE3A 2LKHA 3ETUA 2A72A 4O4JE 4KX6A 5F3JA 5ABGA 5EK4A 2IC6A 2WU5A 2WDRA 2X9WA 3OPCA 3V5SA 5LJMA 2BBHA 4DV7T 5HCJA 3RIFA 1HNXT 2IDOB 2VKDA 3KBTA 3SRZA 2CLYB 1AJ3A 2WB5A 4IE5A 1YKEB 2XJ7A 4NIQA 1I6ZA 5IWAT 5CJ5A 5JRCA 1LRZA 2GK9A 4DR6T 4J2CA 3ZJ1A 4X5TA 3TLTA 3OKQA 2CE7A 4HGAA 3V5UA 5BR8T 5FY7A 1H7CA 3N9MA 3IF8B 4LF7T 3UT5E 4TUYE 2CBIA 4AKGA 5AQLB 5LMUT 3ZJ2A 3RYCE 3ZMSB 4MFRA 4PJNA 2CMRA 4GYSA 2XQ9A 1KNZA 4L0RA 3AE5A 1KF6A 3J9X1 3MXZA 2W67A 1WYBA 2R6GF 2Y48B 2L3LA 1HF8A 3FXEB 2XY8B 1WYCA 1NWMX 4KHPT 4TNWA 4HFCA 4ZOLE 2UUBT 4TNVA 4ILUA 2XAJB 2HPLA 4HWDA 3B57A 2X67A 4ZI3D 3UU3A 1GQEA 3GA8A 2LSJA 3ZT6A 3P4RA 2LJLA 3PUQA 4UV9B 2WWVA 5DQVA 5F5WA 4IL9A 3NBXX 2P9BA 2LM9A 4B3ST 2XQ3A 2V26A 3DTOA 5HWYA 2CXLA 4X1IE 4KUMB 1XDOA 5JREA 3R84B 4DR7T 2V7LA 5JRCB 2YEVC 4GYRA 2V1DB 3E0ZA 2BG9E 3FHNA 4H63H 3ZT7A 2H3RA 2JIWA 5EK2A 2CLYC 4AISA 3UULA 2KMFA 4IL4A 3TLUA 5LBMA 1UUSA 2KWHA 5J0ZA 2XQ6A 2X0YA 4Q25A 4LMJA 5AQOB 2B76A 2NWBA 2JQQA 4EV6A 3GWHA 3RQWA 1WCRA 5H6QB 4YSZA 3Q9DA 3TLSA 4PJLA 4EYYR 3ZN0B 2K24A 2L9QA 2XAFB 3PUGA 1DU2A 5CGMA 2K5BB 5LP6E 2CHNA 1XMOT 1KK7A 1BR0A 3RIAA 2NTXA 2X9XA 5DABA 4YTMA 4PJMA 3RIUC 1O3XA 4PNIA 2BZBA 4M1PA 2QA7A 2NR4A 3CIRA 5JH7E 1D0XA 3RYHE 2ACZA 3PURA 3SOLA 5JQGE 2DL1A 3SWHA 2UU9T 4HFVA 4Z91A 4B3MT 1MMDA 2J62A 1VRBA 1XDPA 3ABVA 5L4EA 4WBNE 1T7SA 2YK0A 2WAUA 3AE4A 3P50A 1FJGT 2WDVA 3N5LA 2NTYA 3GMIA 4UV8B 5AQIB 2H7VC 4YLHA 4ADZA 3OJAA 5KMGP 1FIOA 4U33A 5HEUA 3CK6A 4KI0F 2VURA 2HN1A 4NXMT 2VQET 3KBUA 4UVAB 2IC9A 4B6XA 2J1DG 3EHZA 5JDLA 3T8OA 4AKIA 4GK5E 4E7SA 3HKBE 2ZMAA 1HFAA 3OBVE 3DP7A 3I9WA 3RPUA 1D0ZA 5HXCA 2BVLA 5IHYA 2K48A 2Y8DA 1U5PA 2Q9QD 4F8HA 2BVMA 1HTJF 2XQYA 5L3FB 2CXDA 3N9LA 2YKSA 3K3OA 2JMHA 2ZM2A 3NKZA 4H9NC 2PJQA 5AQGB 4DV0T 3EI0A 4JI3T 2H88A 5L3CB 3RRWA 3ZCIA 3QNUA 3ZLIA 4ZZBA 5FL1A 1WFDA 4DR2T 2V6YA 4HWHA 4DO0A 4U2YA 3BQIA 5HXEA 4U3CA 2WMOA 4ISTA 3LJCA 5ETWA 4YHHT 2HH7A 2KLQA 4IREA 3VR8A 2V7KA 4NUUA 1YXRA 2M67A 2PFVA 3N9QA 5FY0A 2VWAA 2UXBT 4A97A 2E9XD 3PJAA 2VQFT 4U7IA 2IUBA 4FI5A 1N34T 5JDQA 5JDGA 2I59A 3NZQA 2E2AA 2NW8A 3PUYF 3VR9A 2XSBA 4LF6T 1T72A 3UTKA 4U31A 2WM9A 3RX6A 3UU8A 1E1HB 3KINB 1XZYA 2V5CA 3FZFB 3WI3A 4QXHB 4LFAT 5CB4E 4G2AA 4JBWF 1MIWA 4JI4T 2UUCT 4AQFC 3ZC0A 2JRKA 4OYKA 5LBQB 4X66T 1D1CA 3HKCE 4ZI2C 3NVOA 3ESLA 5KXJA 1T8BA 3EAMA 2V7IA 1D1AA 3AA6B 5AQUB 2UXCT 4E7ZA 2RP4A 4TX5A 4ZEYA 3QB5A 4EZ4A 4QXCB 3MK7C 3T1HT 2RPAA 2LRKA 4XBFB 4DBRA 3KV4A 3I0OA 2BKPA 3L39A 3PDYA 4DMVA 3N2GE 2WP9A 3MJXA 3PE0A 4IE4A 4P0AA 3LFMA 4QKNA 2A3DA 1YQ4A 1W0BA 3C4XA 4EXTA 1JNRA 4QH5A 2BS3A 2WBLA 2EHOD 5LHHB 1XMQT 1B7TA 4JUYA 2YU2A 1G8XA 3M65A 2ZM8A 2JJ9A 3AE7A 2I6HA 2G0UA 4CXXA 3H3AA 5GONE 3RKGA 3ZEFB 4KMCA 4QWNB 1WLXA 2DWGA 4EYUA 2JQ9A 5L3DB 5HXRA 4U72A 3U3IA 2F4VT 3P7IA 2XQ4A 3AAIA 3EDUA 4P1NA 2X0LB 2YOEA 3UUBA 5LGNB 2NW9A 4DR5T 3L3PA 3AE6A 2QVAA 3KVAA 4U74A 3AA0B 5H6RB 3SFEA 4IIJE 4JI1T 1N33T 4CQIA 3ZMVB 1S35A 2LOPA 2PBIA 3N2KE 3LK3B 4B3RT 5HXHA 3PUWF 5FMNA 2VASA 4IE0A 4TWFA 2XSAA 3S4UA 4GOUA 3BK9A 1Z8UA 4UF0A 3RQUA 1ZKEA 4JI6T 5HXSA 4X1KE 4ANJA 3R6NA 3A7MA 2ZLYA 1SA0E 2NW7A 5AFUL 3FB2A 4YJ3E 2OLTA 3UFGA 4ZS2A 3JADA 2WU2A 3HL6A 4UEMA 4OFZA 1UGOA 4H63V 4IE7A 4C90A 2J4GA 1BR1A 2VVSA 1J5ET 2LE8A 3HKDE 3GN5A 1HS7A 4A5XA 3ZPOA 2LM2A 4UVCB 1KNPA 4QH4A 3AA7B 4H9OC 2V7MA 1S94A 5HCMA 3ETVA 1IBMT 2X9HA 1X79A 5A1LA 4CXYA 5HEOA 2LSIA 4AXPA 3ZC1A 1N32T 5CA1E 1W09A 3K1SA 5AQJB 2UUAT 2W62A 4EZHA 3PV0F 3DJBA 2QGSA 2N1GA 2CXFA 2C5IT 2BKNA 4CI2B 4AKRB 2CWOA 5FYMA 1I94T 4DUZT 4HFEA 4UF0B 5FKYA 4X1YE 2PTFA 4LF4T 2BKOA 2NP9A 4I0UA 2CHOA 2K9AA 2SPCA 5JTGA 3RC3A 4P0BA 4H9QC 1UURA 4Z90A 2DI4A 5C2TA 2K3WA 4HWFA 1ZP0A 3JAEA 5E0OA 1QLBA 3H3MA 3O4XE 2X66A 2BG9C 4IDOA 4TWHA 3ZYMA 4JI7T 2LSKA 5HWXA 3PU8A 1T98A 1VCTA 3F31A 3GN5B 2E5VA 4Z8XA 2KZ7B 5L2LA 2DLRA 4X64T 3CPZA 4EAHA 2IAKA 3MZKB 3Q5EA 3JC6C 4H9PC 3RLFF 4DMWA 4DV5T 5FVLA 3UU4A 3ONLC 2V7JA 2MOZA 3H37A 3L8RA 5ADXL 3AXJA 4AQFA 4PFOA 3ZMUB 3IA3A 1G73A 5FY1A 2ODVA 3ZSSA 5L3BB 4LMKA 1IBLT 3FZLB 4JI2T 2VL0A 3I1AA 3AAEB 5HEGA 5ABHA 3C50A 3C64A 4MALA 3FZKB 3O1IA 4GKJT 4LFBT 3M3ZB 4ILCA 4PK4A 1FMVA 2YU1A 4HFDA 3PUAA 4IDQA 1IBKT 3BQKA 1MNEA 5AQHB 5L3EB 2KT9A 4MBQA 4DV2T 4KP3C 1BR2A 3I9YA 5AQFB 4QX8B 3K3QC 3O1JA 1SHZC 2H7OA 4PK5A 3E22E 3AAAB 2VK9A 4CN6A 4ISSA 4C91A 2MYSA 3IHRA 5J1GA 3X1DA 2W63A 1MNDA 3K3NA 2AXDS 3WAJA 2V5DA 4QXBB 2QYWA 2X51A 4CZZB 4H9SE 4MHCA 3AXJB 2UXDT 4X20E 3AE9A 5DQWA 3RF1A 2CPTA 3ONJA 4I50E 1CHUA 5EK3A 2FJDA 1IAPA 3QC9A 1SE7A 4ZI3C 4HTEA 1W9RA 4CI3B 3UQ7A 4HWIB 3UQ4A 2DNXA 2LHNA 1OEDC 3VHLA 4FJOA 5HEHA 3PU3A 3HI2A 5JDMA 4DUYT 4TV9E 5BMVE 4DV6T 2WY2A 1HR0T 4EGWA 4AQYT 1LVKA 5HYAA 2HN2A 5J2TE 1MIVA 4CN1A 3Q5DA 3NRYA 4JEHB 2QRXA 4YY3T 4HKAA 3LBXA 4DR1T 4JI0T 3CKDA 3RI5A 4LF5T 2J47A 1CUNA 3KDSE 2BDEA 4LF9T 5LXTE 4F6RC 3PUXF 2YN6A 4NUVA 5FXZA 2XPKA 4I4TE 3C98B 3LG7A 2ACXA 3OTOT 3E08A 4OX9T 3EDVA 3LSVA 1SUMB 2LSGA 1UK5A 2VKOA 4UR9A 4EEBA 3WAKA 2CA5A 3EVYA 3VRBA 2E5LT 2V6YB 4WBOA 3C4ZA 3TLVA 3QOFA 3P4PA 3UUNA 3KFWX 2C5KT 5FXWA 2I0MA 1MMGA 1BR4A 2N9DA 4HEAA 4AKHA 4XAXB 4I55E 3U78A 4HN9A 3LBXB 3O1HA 4UXNB 1E2AA 1UCUA 2JMKA 2EHOA 3CQGB 3ZN1B 2FUPA 4KBMB 2BG9A 1WR0A 2D0UA 3KVBA 4HFHA 1MMAA 2XZEA 1OXZA 1D1BA 1IJ6A 3VKGA 2H89A 4A56A 1NAFA 2VB6A 5AQSB 4JV5T 2YDSA 5AQKB 2V8SV 2Q9QC 4AKLA 1HCIA 2OV9A 2YINA 2LRLA 4CI1B 4XZCA 4HFBA 3AA1B 3CX8B 3ANWA 2VVNA 4IT4A 5LA6E 2VKJA 2YDRA 3KV6A 2XAGB 4YSYA 2WZIA 3AEBA 4O2BE 2CM0A 3VU7H 3HA4A 2YDQA 4YT0A 2B1EA 3EABA 5AQVB 5JDFA 4ZS3A 5FL0A 3I0QA 1KNRA 4TZ4C 1WRDA 3AEEA 5L3GB 4TWDA 2HHHT 2ES0A 3N9OA 4HE8A 2ODUA 2EHOB 4G63A 4UVBB 5JDNA 2KNDA 4PJJA 2BG9B 2E9XC 4TN7B 4JEUB 3RC8A 1HNZT 3PUVF 2MPKA 1NENA 2BBJA 2DHRA 5JVDE 2IMLA 3HR0A 2MAWA 5LJNA 3P8CD 4GIWA 2W4XA 1ZEEA 3Q5XA 5FP3A 1YW0A 1J1JA 2BS4A 5CFBA 2FJBA 4O2AE 4IDNA 3RYIE 2CCQA 4U2ZA 1ZV4X 2WDQA 3ANWB 1UX5A 2XTLA 4IDPA 3PUSA 1YD8G 3AE1A 2Y6XA 1Z0PA 1ZHCA 1XNRT 1OEDA 1N36T 1FMWA 1L0VA 5L47A 1X9BA 4PW8A 4ERRA 2OA5A 5AQQB 2N2NA 4YFSA 1Y64B 4UELA 4JI8T 2WSSV 3TKLB 1KEYA 2LT3A 3CX6B 4AQGA 2XQ8A 3P4WA 3CQCB 1J5WA 4IE6A 2XM2A 2VKHA 2KINB 4WZXA 2CBJA 2WMNA 2WZHA 2L8KA 4ASKA 2W00A 3OYZA 1M62A 4UIGA 4LF8T 4ILBA 4DNDA 3G06A 2EHOC 4OYJA
chains in the Genus database with same CATH topology
5EK4A 3QK6A 2IC6A 3N9NA 4QXBB 2X51A 5FNVE 4AQFC 4EIWA 4CZZB 1YKHB 3ZC0A 2JRKA 2X9WA 4OYKA 5LBQB 4H9SE 4MHCA 3AVSA 1D1CA 3HKCE 3ZMTB 4ZI2C 3V5SA 5LJMA 4X20E 5DQWA 3ESLA 4I50E 5EK3A 3ZMZB 2V7IA 1D1AA 3AA6B 2VKDA 3KBTA 4EOZB 5LG4A 3SRZA 1IAPA 2CLYB 3F2EA 3QC9A 1AJ3A 4E7ZA 4CXWA 2RP4A 4ZI3C 4IE5A 4TX5A 5KDMC 1YKEB 4HTEA 4CI3B 2C5JA 4EZ4A 2DNXA 4QXCB 2ZM0A 1LRZA 5JRCA 1US7B 2LHNA 5JR9A 3MK7C 2GK9A 1FEWA 2X68A 4J2CA 3ZJ1A 5LNKA 4XBFB 2JPFA 3VHLA 4DBRA 3KV4A 3OKQA 5LGUB 2CE7A 3I0OA 3ZYLA 3MACA 4FJOA 4HGAA 3V5UA 2A2FX 3PU3A 5FY7A 3HI2A 1H7CA 3N9MA 5JDMA 4TV9E 3IF8B 5C8YE 3PDYA 5BMVE 3UT5E 4DMVA 4TUYE 4PFPA 5FXVA 2IW5B 3N2GE 4AKGA 4JLEA 3F57A 3MJXA 3PE0A 1LVKA 5LHGB 5HYAA 4O4LE 4PAGA 5J2TE 4IE4A 4P0AA 1MIVA 3LK2B 4YHJA 4BA9A 3ZJ2A 3LFMA 4QKNA 3NRYA 3RYCE 2A3DA 3C4XA 2MBGA 3ZMSB 4JEHB 4MFRA 4EXTA 4PJNA 3NZPA 2CMRA 4GYSA 1KNZA 2WBLA 4L0RA 5F8PA 2EHOD 4P09A 5LHHB 3J9X1 3MXZA 1B7TA 4JUYA 2YU2A 3Q2MA 1G8XA 1WYBA 3M65A 2ZM8A 2LHRA 2JJ9A 4HKAA 1MIYA 2G0UA 3W15B 2Y48B 3LBXA 2L3LA 1HF8A 3H3AA 4CXXA 5GONE 1V9DA 3CKDA 3FXEB 3ZEFB 4KMCA 4QWNB 1WYCA 4ZI2D 1NWMX 1WLXA 1CUNA 2DWGA 3VKHA 3KDSE 2BDEA 2RA1A 4EYUA 4QHOA 5LXTE 5L3DB 5HXRA 4ZOLE 4U72A 1LVFA 3U3IA 4ILUA 4F6RC 3P7IA 2XAJB 3AAIA 2HPLA 3O9XA 3B57A 2X67A 1QUUA 4ZI3D 2W61A 3EDUA 2D2SA 4NUVA 4EB6E 4L5GA 5FXZA 2X0LB 3GA8A 2LSJA 5LGNB 4I4TE 3KV5A 2LJLA 3PUQA 3C98B 4UV9B 3FXDB 2NW9A 5DQVA 3UUMA 1LKXA 3LG7A 3NBXX 2ACXA 3L3PA 5LCYA 3KVAA 4U74A 3AA0B 2P9BA 3E08A 3CMLA 2LM9A 3RH3A 5H6RB 2Q9QA 4IIJE 3EDVA 3IEEA 4CQIA 2V26A 3ZMVB 3DTOA 5HWYA 5JDHA 1S35A 2CXLA 4X1IE 3FBZA 4KUMB 1HG2A 2LOPA 5JREA 3R84B 2PBIA 3N2KE 3LK3B 2V7LA 5JRCB 2YEVC 3ZYKA 5HXHA 4GYRA 5JR9B 3C51A 2LSGA 2LOSA 2V1DB 5FMNA 3E0ZA 4L9IA 2D0TA 2VKOA 3FHNA 4H63H 2H3RA 2VASA 4IE0A 4O4IE 5TAOA 5EK2A 3WAKA 3S4UA 2CA5A 2CLYC 3EVYA 4GOUA 4AI6A 3BK9A 3UULA 4UF0A 2KMFA 5FXXA 5LBMA 3RRCA 3CWZB 2KWHA 1ZKEA 2XUEA 5HXSA 3N9PA 4WBOA 3C4ZA 5HAXA 4X1KE 4GK0E 3UUNA 4ANJA 3KFWX 2C5KT 3HKEE 5FXWA 4DBQA 3R6NA 1MMGA 2NWBA 2JQQA 2ZLYA 3GWHA 1SA0E 4MLKA 5H6QB 2X9YA 2NW7A 3Q9DA 5AFUL 1BR4A 2N9DA 3FB2A 1HX8A 2CEAA 4HEAA 4AKHA 4IDZA 4PJLA 4YJ3E 4EYYR 1VOMA 4XAXB 4ZS2A 3ZN0B 2K24A 2L9QA 4UEMA 3HL6A 4I55E 4OFZA 4H63V 4IE7A 2XAFB 3PUGA 3U78A 4C90A 1IJ5A 2K5BB 2MTQA 1BR1A 4HN9A 5LP6E 3LBXB 3O1HA 3A5XA 3D0TA 4UXNB 1UCUA 2JMKA 2EHOA 4O4HE 4N78D 1KK7A 3CQGB 1BR0A 3ZN1B 4KBMB 2HPJA 4V1Av 2NTXA 2LE8A 2D0UA 2X9XA 3HKDE 3MKDA 5DABA 3KVBA 4WW0A 1MMAA 3GN5A 1HS7A 5KX5E 4PJMA 4K0UA 3SS1A 3ZPOA 1OXZA 4UVCB 2E9XA 1D1BA 3QUJA 2XHEB 4QX7B 1IJ6A 2W0GA 3VKGA 5LHIB 4A56A 4BAYB 1O3XA 1NAFA 2VB6A 3FBLA 4PNIA 2BZBA 4M1PA 3AA7B 3K8PC 2QA7A 4H9OC 2V7MA 4ZHQE 1S94A 5JH7E 4YJ2E 1D0XA 3ETVA 2Q9QC 3RYHE 3EUHA 3PURA 3SOLA 2KXPB 3Q5WA 5JQGE 2PG8A 4AKLA 1HCIA 2X9HA 1X79A 5A1LA 4CXYA 2Q9QB 3SWHA 2LSIA 3B13A 2YINA 4HFVA 3ZC1A 4AXPA 4CI1B 4XZCA 1MMDA 5CA1E 1VRBA 4WBNE 3AA1B 3CX8B 3ANWA 4OK0A 5LA6E 3J7Yq 2CWYA 2VKJA 4ZI7E 2YK0A 3PTRB 3KV6A 2XAGB 2W62A 2WAUA 4EZHA 3CX7B 3AVRA 3BQLA 3DJBA 3N5LA 5LGTB 2NTYA 2QGSA 2N1GA 2CXFA 3GMIA 2C5IT 2DWKA 1EZ3A 4UV8B 4OHFA 2VL8A 4CI2B 4O2BE 4AKRB 2CM0A 3AB3B 2H7VC 3VU7H 2CWOA 3KV9A 4YLHA 5FYMA 3UFEA 4ADZA 3OJAA 3HA4A 5KMGP 4UF0B 1FIOA 2B1EA 4X1YE 3LK42 5JR9C 5JDFA 2NP9A 4ZS3A 2K9AA 2SPCA 3I0QA 3KBUA 4UVAB 4TV8E 2UXXB 3RC3A 2IC9A 4P0BA 4H9QC 4B6XA 2J1DG 1HG5A 2DI4A 2C0SA 5JDLA 3CVRA 4TZ4C 3T8OA 4AKIA 1WRDA 1OWAA 4GK5E 4E7SA 3HKBE 2ZMAA 2D5UA 2XAQB 5E0OA 5L3GB 3UUXB 1HFAA 3OBVE 3DP7A 3I9WA 2ES0A 3RPUA 1D0ZA 2KWIB 3N9OA 4DVDA 4HE8A 5HXCA 2BVLA 2ODUA 3O4XE 2X66A 5IHYA 2K48A 2Y8DA 2EHOB 3RYFE 4G63A 1U5PA 3ZYMA 4UVBB 5JDNA 5LOVE 3MA9A 2LSKA 2Q9QD 2KNDA 5HWXA 4PJJA 3PU8A 2BVMA 1HTJF 1T98A 2XQYA 2E9XC 5L3FB 4TN7B 3F31A 4JEUB 3RC8A 5LYJE 3GN5B 4Z8XA 2DCFA 2KZ7B 3CQXC 5L2LA 4H9RC 2E9XB 2CXDA 2DLRA 1D0YA 3N9LA 4PK6A 3K3OA 3CPZA 2Z6EA 2DHRA 4OYJA 5JVDE 4EAHA 2IAKA 3HR0A 4BJMA 3MZKB 4I43B 2JMHA 5LJNA 4H9PC 3JC6C 1IZNB 4DMWA 3P8CD 2ZM2A 5M4YA 4H9NC 3ONXA 2PJQA 3IBPA 4GIWA 2V7JA 5L3CB 1U4QA 1ZEEA 2LSYA 2MOZA 3H37A 3RKOA 3Q5XA 5FP3A 3RRWA 3ZCIA 4IGUA 5ADXL 5IYZE 5J2UE 3ZLIA 1YW0A 3OYXA 4AQFA 4O2AE 4PFOA 3ZMUB 3RYIE 2NOXA 2CCQA 1ZV4X 1G73A 5FY1A 2ODVA 2E8IA 5L3BB 3N2OA 3ANWB 3NRXA 1UX5A 3ZCJA 4DO0A 3BQIA 2XTLA 5HXEA 3I1AA 3PUSA 3AAEB 2UXNB 4BJNA 2XASB 2WMOA 1YD8G 2Y6XA 3C4WA 1Z0PA 5CA0E 4ISTA 1ZHCA 3LJCA 3C50A 5ETWA 3C64A 1WR6A 2LEHA 2HH7A 4MALA 2KLQA 1UX4A 3O1IA 4WNKA 2V7KA 1FMWA 4NUUA 5DJQC 2M67A 2PFVA 4PK4A 3N9QA 5FY0A 2VWAA 1FMVA 2WWUA 2YU1A 4PW8A 4ERRA 2OA5A 2N2NA 4YFSA 1Y64B 2E9XD 3PUAA 5EZYE 4UELA 4IHJE 2WSSV 1MMNA 3BQKA 1MNEA 3TKLB 2LT3A 4FI5A 5L3EB 3CX6B 2KT9A 4MBQA 5JDQA 3L09A 5JDGA 2I59A 3NZQA 4AQGA 2NW8A 4KP3C 1BR2A 3CQCB 3I9YA 3O1JA 1QSDA 3K3QC 4QX8B 3JC6D 1SHZC 2H7OA 4IE6A 4PK5A 3E22E 3AAAB 2VKHA 2KINB 2VK9A 2WMNA 3UTKA 2L8KA 4O8SA 2WM9A 4ISSA 3RX6A 4ASKA 2W00A 1E1HB 3KINB 4C91A 2MYSA 2XAHB 3OYZA 3IHRA 3WI3A 3ETUA 4UIGA 4QXHB 5J1GA 2A72A 4O4JE 2W63A 1MNDA 3K3NA 5CB4E 4DNDA 2EHOC 5F3JA 4G2AA 1MIWA 3WAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X0L B;  4UXN B;  2UXN B;  2Y48 B;  2XAG B;  4UVB B;  4UVA B;  2XAS B;  2IW5 B;  5LGN B;  2UXX B;  4CZZ B;  4UV9 B;  3ZN1 B;  5L3C B;  2V1D B;  5LHG B;  5L3F B;  5LBQ B;  5LGT B;  5H6Q B;  5L3E B;  3ZMT B;  4XBF B;  4UV8 B;  3ZMS B;  2XAH B;  5LGU B;  3ZMU B;  5H6R B;  5L3D B;  2XAQ B;  4UVC B;  5L3G B;  3ZN0 B;  3ZMZ B;  5L3B B;  5LHH B;  3ZMV B;  5LHI B;  2XAJ B;  4BAY B;  2XAF B;  4KUM B; 
#chains in the Genus database with same CATH topology
 3QK6 A;  3N9N A;  5FNV E;  4EIW A;  1YKH B;  3AVS A;  3ZMT B;  1KFY A;  5AQT B;  2IIU A;  3UU6 A;  3ZMZ B;  4EOZ B;  5LG4 A;  3F2E A;  4GKK T;  3PUZ F;  4CXW A;  4DR4 T;  5KDM C;  2C5J A;  2JQH A;  2ZM0 A;  1US7 B;  5JR9 A;  1FEW A;  2X68 A;  4HWC A;  5LG3 A;  5LNK A;  2LLY A;  2JPF A;  5LGU B;  1OED B;  3ZYL A;  3MAC A;  2A2F X;  4ZXL A;  4YTP A;  1XWM A;  5C8Y E;  1ZOY A;  3AE2 A;  4PFP A;  5FXV A;  2IW5 B;  2CRB A;  4JLE A;  3F57 A;  3AED A;  5LHG B;  5L4H A;  4O4L E;  4PAG A;  3LK2 B;  4YHJ A;  4BA9 A;  3QB5 K;  2MBG A;  3NZP A;  4B3T T;  5F8P A;  4P09 A;  1R8I A;  3OVU A;  4YTN A;  3Q2M A;  2LHR A;  1MIY A;  3W15 B;  1V9D A;  2AE9 A;  2FBW A;  4ZI2 D;  3VKH A;  2RA1 A;  3AEA A;  4QHO A;  1LVF A;  2JQK A;  4LML A;  3JCF A;  3O9X A;  1QUU A;  2W61 A;  4EB6 E;  2D2S A;  4L5G A;  2IHR 1;  3KV5 A;  3T1Y T;  3FXD B;  3UUM A;  1LKX A;  5LCY A;  2X0H A;  3CML A;  3RH3 A;  2XQA A;  4CN4 A;  2D9D A;  4EED A;  5IUX A;  2WS3 A;  2Q9Q A;  3IEE A;  5C3J A;  5JDH A;  3FBZ A;  2V6X A;  1HG2 A;  2M6B A;  4U7Y A;  3ZYK A;  5JR9 B;  3C51 A;  2LOS A;  5ABF A;  4L9I A;  2D0T A;  1NEK A;  4O4I E;  5TAO A;  4DV3 T;  4AI6 A;  4K0K T;  5FXX A;  3RRC A;  3CWZ B;  2XUE A;  3N9P A;  4X62 T;  5HAX A;  4YXD A;  4GK0 E;  3HKE E;  3LDQ B;  4DBQ A;  4MLK A;  2X9Y A;  1VCS A;  1OED E;  1HX8 A;  2CEA A;  4IDZ A;  3AEF A;  1VOM A;  4DR3 T;  3FZM B;  2ZM6 T;  1IJ5 A;  3AEG A;  2MTQ A;  3A5X A;  3D0T A;  5AQN B;  4O4H E;  4N78 D;  2BS2 A;  3ZT5 A;  2HPJ A;  4V1A v;  3MKD A;  1E7P A;  3PJA J;  4WW0 A;  5KX5 E;  4K0U A;  3SS1 A;  2E9X A;  3QUJ A;  2XHE B;  4QX7 B;  2W0G A;  5LHI B;  4BAY B;  4YSX A;  3FBL A;  3A8Y C;  3K8P C;  1HX1 B;  4ZHQ E;  4YJ2 E;  3EUH A;  2KXP B;  3Q5W A;  2PG8 A;  3UU5 A;  1M7K A;  2Q9Q B;  3B13 A;  4HFI A;  2XM1 A;  4X65 T;  3B5M A;  4AIU A;  4OK0 A;  3SFD A;  3J7Y q;  2CWY A;  4ZI7 E;  3PTR B;  4DID B;  5ABF B;  3CX7 B;  3AVR A;  5LMN T;  3BQL A;  5LGT B;  2DWK A;  1EZ3 A;  3P4Q A;  4OHF A;  2VL8 A;  3AB3 B;  3KV9 A;  3UFE A;  3RGL A;  3TLW A;  5AQR B;  3ZKR A;  3LK4 2;  5JR9 C;  2WCA A;  4TV8 E;  2UXX B;  2XQ7 A;  2LKG A;  5HEJ A;  1HG5 A;  2C0S A;  4QH1 A;  1JNZ A;  3CVR A;  2FJE A;  1OWA A;  5AQM B;  2D5U A;  2XAQ B;  1HNW T;  2WQY A;  3UUX B;  2XQ5 A;  2KWI B;  4JI5 T;  4WYV A;  4DVD A;  3RYF E;  5LOV E;  3MA9 A;  4COF A;  3RHW A;  5LYJ E;  2DCF A;  3CQX C;  4H9R C;  2E9X B;  3JAF A;  4PK6 A;  1D0Y A;  2Z6E A;  1XNQ T;  4BJM A;  5ABE A;  4I43 B;  1IZN B;  4NPP A;  5M4Y A;  3ONX A;  3IBP A;  3VRA A;  4JYA T;  1U4Q A;  5LB7 B;  2LSY A;  3RKO A;  3AEC A;  4DV4 T;  4IGU A;  5J2U E;  5IYZ E;  3P4S A;  3OYX A;  4ZZC A;  2NOX A;  2E8I A;  3N2O A;  2W66 A;  3NRX A;  3ZCJ A;  2UXN B;  4BJN A;  2XAS B;  3C4W A;  5CA0 E;  1WR6 A;  3FZH B;  5AQP B;  2LEH A;  2W2U A;  5FVK A;  1UX4 A;  1YQ3 A;  4DV1 T;  4WNK A;  5DJQ C;  2WWU A;  2KSR A;  5EZY E;  4IHJ E;  1MMN A;  3L09 A;  2FJA A;  1Y01 A;  4A98 A;  4KHZ F;  1QSD A;  3RIU A;  3JC6 D;  3AE8 A;  4NXN T;  2A9U A;  3NWI A;  1W0A A;  2M6I A;  4O8S A;  3ZST A;  4ILA A;  4LFC T;  2XAH B;  3AE3 A;  2LKH A;  3ETU A;  2A72 A;  4O4J E;  4KX6 A;  5F3J A;  5ABG A;  5EK4 A;  2IC6 A;  2WU5 A;  2WDR A;  2X9W A;  3OPC A;  3V5S A;  5LJM A;  2BBH A;  4DV7 T;  5HCJ A;  3RIF A;  1HNX T;  2IDO B;  2VKD A;  3KBT A;  3SRZ A;  2CLY B;  1AJ3 A;  2WB5 A;  4IE5 A;  1YKE B;  2XJ7 A;  4NIQ A;  1I6Z A;  5IWA T;  5CJ5 A;  5JRC A;  1LRZ A;  2GK9 A;  4DR6 T;  4J2C A;  3ZJ1 A;  4X5T A;  3TLT A;  3OKQ A;  2CE7 A;  4HGA A;  3V5U A;  5BR8 T;  5FY7 A;  1H7C A;  3N9M A;  3IF8 B;  4LF7 T;  3UT5 E;  4TUY E;  2CBI A;  4AKG A;  5AQL B;  5LMU T;  3ZJ2 A;  3RYC E;  3ZMS B;  4MFR A;  4PJN A;  2CMR A;  4GYS A;  2XQ9 A;  1KNZ A;  4L0R A;  3AE5 A;  1KF6 A;  3J9X 1;  3MXZ A;  2W67 A;  1WYB A;  2R6G F;  2Y48 B;  2L3L A;  1HF8 A;  3FXE B;  2XY8 B;  1WYC A;  1NWM X;  4KHP T;  4TNW A;  4HFC A;  4ZOL E;  2UUB T;  4TNV A;  4ILU A;  2XAJ B;  2HPL A;  4HWD A;  3B57 A;  2X67 A;  4ZI3 D;  3UU3 A;  1GQE A;  3GA8 A;  2LSJ A;  3ZT6 A;  3P4R A;  2LJL A;  3PUQ A;  4UV9 B;  2WWV A;  5DQV A;  5F5W A;  4IL9 A;  3NBX X;  2P9B A;  2LM9 A;  4B3S T;  2XQ3 A;  2V26 A;  3DTO A;  5HWY A;  2CXL A;  4X1I E;  4KUM B;  1XDO A;  5JRE A;  3R84 B;  4DR7 T;  2V7L A;  5JRC B;  2YEV C;  4GYR A;  2V1D B;  3E0Z A;  2BG9 E;  3FHN A;  4H63 H;  3ZT7 A;  2H3R A;  2JIW A;  5EK2 A;  2CLY C;  4AIS A;  3UUL A;  2KMF A;  4IL4 A;  3TLU A;  5LBM A;  1UUS A;  2KWH A;  5J0Z A;  2XQ6 A;  2X0Y A;  4Q25 A;  4LMJ A;  5AQO B;  2B76 A;  2NWB A;  2JQQ A;  4EV6 A;  3GWH A;  3RQW A;  1WCR A;  5H6Q B;  4YSZ A;  3Q9D A;  3TLS A;  4PJL A;  4EYY R;  3ZN0 B;  2K24 A;  2L9Q A;  2XAF B;  3PUG A;  1DU2 A;  5CGM A;  2K5B B;  5LP6 E;  2CHN A;  1XMO T;  1KK7 A;  1BR0 A;  3RIA A;  2NTX A;  2X9X A;  5DAB A;  4YTM A;  4PJM A;  3RIU C;  1O3X A;  4PNI A;  2BZB A;  4M1P A;  2QA7 A;  2NR4 A;  3CIR A;  5JH7 E;  1D0X A;  3RYH E;  2ACZ A;  3PUR A;  3SOL A;  5JQG E;  2DL1 A;  3SWH A;  2UU9 T;  4HFV A;  4Z91 A;  4B3M T;  1MMD A;  2J62 A;  1VRB A;  1XDP A;  3ABV A;  5L4E A;  4WBN E;  1T7S A;  2YK0 A;  2WAU A;  3AE4 A;  3P50 A;  1FJG T;  2WDV A;  3N5L A;  2NTY A;  3GMI A;  4UV8 B;  5AQI B;  2H7V C;  4YLH A;  4ADZ A;  3OJA A;  5KMG P;  1FIO A;  4U33 A;  5HEU A;  3CK6 A;  4KI0 F;  2VUR A;  2HN1 A;  4NXM T;  2VQE T;  3KBU A;  4UVA B;  2IC9 A;  4B6X A;  2J1D G;  3EHZ A;  5JDL A;  3T8O A;  4AKI A;  4GK5 E;  4E7S A;  3HKB E;  2ZMA A;  1HFA A;  3OBV E;  3DP7 A;  3I9W A;  3RPU A;  1D0Z A;  5HXC A;  2BVL A;  5IHY A;  2K48 A;  2Y8D A;  1U5P A;  2Q9Q D;  4F8H A;  2BVM A;  1HTJ F;  2XQY A;  5L3F B;  2CXD A;  3N9L A;  2YKS A;  3K3O A;  2JMH A;  2ZM2 A;  3NKZ A;  4H9N C;  2PJQ A;  5AQG B;  4DV0 T;  3EI0 A;  4JI3 T;  2H88 A;  5L3C B;  3RRW A;  3ZCI A;  3QNU A;  3ZLI A;  4ZZB A;  5FL1 A;  1WFD A;  4DR2 T;  2V6Y A;  4HWH A;  4DO0 A;  4U2Y A;  3BQI A;  5HXE A;  4U3C A;  2WMO A;  4IST A;  3LJC A;  5ETW A;  4YHH T;  2HH7 A;  2KLQ A;  4IRE A;  3VR8 A;  2V7K A;  4NUU A;  1YXR A;  2M67 A;  2PFV A;  3N9Q A;  5FY0 A;  2VWA A;  2UXB T;  4A97 A;  2E9X D;  3PJA A;  2VQF T;  4U7I A;  2IUB A;  4FI5 A;  1N34 T;  5JDQ A;  5JDG A;  2I59 A;  3NZQ A;  2E2A A;  2NW8 A;  3PUY F;  3VR9 A;  2XSB A;  4LF6 T;  1T72 A;  3UTK A;  4U31 A;  2WM9 A;  3RX6 A;  3UU8 A;  1E1H B;  3KIN B;  1XZY A;  2V5C A;  3FZF B;  3WI3 A;  4QXH B;  4LFA T;  5CB4 E;  4G2A A;  4JBW F;  1MIW A;  4JI4 T;  2UUC T;  4AQF C;  3ZC0 A;  2JRK A;  4OYK A;  5LBQ B;  4X66 T;  1D1C A;  3HKC E;  4ZI2 C;  3NVO A;  3ESL A;  5KXJ A;  1T8B A;  3EAM A;  2V7I A;  1D1A A;  3AA6 B;  5AQU B;  2UXC T;  4E7Z A;  2RP4 A;  4TX5 A;  4ZEY A;  3QB5 A;  4EZ4 A;  4QXC B;  3MK7 C;  3T1H T;  2RPA A;  2LRK A;  4XBF B;  4DBR A;  3KV4 A;  3I0O A;  2BKP A;  3L39 A;  3PDY A;  4DMV A;  3N2G E;  2WP9 A;  3MJX A;  3PE0 A;  4IE4 A;  4P0A A;  3LFM A;  4QKN A;  2A3D A;  1YQ4 A;  1W0B A;  3C4X A;  4EXT A;  1JNR A;  4QH5 A;  2BS3 A;  2WBL A;  2EHO D;  5LHH B;  1XMQ T;  1B7T A;  4JUY A;  2YU2 A;  1G8X A;  3M65 A;  2ZM8 A;  2JJ9 A;  3AE7 A;  2I6H A;  2G0U A;  4CXX A;  3H3A A;  5GON E;  3RKG A;  3ZEF B;  4KMC A;  4QWN B;  1WLX A;  2DWG A;  4EYU A;  2JQ9 A;  5L3D B;  5HXR A;  4U72 A;  3U3I A;  2F4V T;  3P7I A;  2XQ4 A;  3AAI A;  3EDU A;  4P1N A;  2X0L B;  2YOE A;  3UUB A;  5LGN B;  2NW9 A;  4DR5 T;  3L3P A;  3AE6 A;  2QVA A;  3KVA A;  4U74 A;  3AA0 B;  5H6R B;  3SFE A;  4IIJ E;  4JI1 T;  1N33 T;  4CQI A;  3ZMV B;  1S35 A;  2LOP A;  2PBI A;  3N2K E;  3LK3 B;  4B3R T;  5HXH A;  3PUW F;  5FMN A;  2VAS A;  4IE0 A;  4TWF A;  2XSA A;  3S4U A;  4GOU A;  3BK9 A;  1Z8U A;  4UF0 A;  3RQU A;  1ZKE A;  4JI6 T;  5HXS A;  4X1K E;  4ANJ A;  3R6N A;  3A7M A;  2ZLY A;  1SA0 E;  2NW7 A;  5AFU L;  3FB2 A;  4YJ3 E;  2OLT A;  3UFG A;  4ZS2 A;  3JAD A;  2WU2 A;  3HL6 A;  4UEM A;  4OFZ A;  1UGO A;  4H63 V;  4IE7 A;  4C90 A;  2J4G A;  1BR1 A;  2VVS A;  1J5E T;  2LE8 A;  3HKD E;  3GN5 A;  1HS7 A;  4A5X A;  3ZPO A;  2LM2 A;  4UVC B;  1KNP A;  4QH4 A;  3AA7 B;  4H9O C;  2V7M A;  1S94 A;  5HCM A;  3ETV A;  1IBM T;  2X9H A;  1X79 A;  5A1L A;  4CXY A;  5HEO A;  2LSI A;  4AXP A;  3ZC1 A;  1N32 T;  5CA1 E;  1W09 A;  3K1S A;  5AQJ B;  2UUA T;  2W62 A;  4EZH A;  3PV0 F;  3DJB A;  2QGS A;  2N1G A;  2CXF A;  2C5I T;  2BKN A;  4CI2 B;  4AKR B;  2CWO A;  5FYM A;  1I94 T;  4DUZ T;  4HFE A;  4UF0 B;  5FKY A;  4X1Y E;  2PTF A;  4LF4 T;  2BKO A;  2NP9 A;  4I0U A;  2CHO A;  2K9A A;  2SPC A;  5JTG A;  3RC3 A;  4P0B A;  4H9Q C;  1UUR A;  4Z90 A;  2DI4 A;  5C2T A;  2K3W A;  4HWF A;  1ZP0 A;  3JAE A;  5E0O A;  1QLB A;  3H3M A;  3O4X E;  2X66 A;  2BG9 C;  4IDO A;  4TWH A;  3ZYM A;  4JI7 T;  2LSK A;  5HWX A;  3PU8 A;  1T98 A;  1VCT A;  3F31 A;  3GN5 B;  2E5V A;  4Z8X A;  2KZ7 B;  5L2L A;  2DLR A;  4X64 T;  3CPZ A;  4EAH A;  2IAK A;  3MZK B;  3Q5E A;  3JC6 C;  4H9P C;  3RLF F;  4DMW A;  4DV5 T;  5FVL A;  3UU4 A;  3ONL C;  2V7J A;  2MOZ A;  3H37 A;  3L8R A;  5ADX L;  3AXJ A;  4AQF A;  4PFO A;  3ZMU B;  3IA3 A;  1G73 A;  5FY1 A;  2ODV A;  3ZSS A;  5L3B B;  4LMK A;  1IBL T;  3FZL B;  4JI2 T;  2VL0 A;  3I1A A;  3AAE B;  5HEG A;  5ABH A;  3C50 A;  3C64 A;  4MAL A;  3FZK B;  3O1I A;  4GKJ T;  4LFB T;  3M3Z B;  4ILC A;  4PK4 A;  1FMV A;  2YU1 A;  4HFD A;  3PUA A;  4IDQ A;  1IBK T;  3BQK A;  1MNE A;  5AQH B;  5L3E B;  2KT9 A;  4MBQ A;  4DV2 T;  4KP3 C;  1BR2 A;  3I9Y A;  5AQF B;  4QX8 B;  3K3Q C;  3O1J A;  1SHZ C;  2H7O A;  4PK5 A;  3E22 E;  3AAA B;  2VK9 A;  4CN6 A;  4ISS A;  4C91 A;  2MYS A;  3IHR A;  5J1G A;  3X1D A;  2W63 A;  1MND A;  3K3N A;  2AXD S;  3WAJ A;  2V5D A;  4QXB B;  2QYW A;  2X51 A;  4CZZ B;  4H9S E;  4MHC A;  3AXJ B;  2UXD T;  4X20 E;  3AE9 A;  5DQW A;  3RF1 A;  2CPT A;  3ONJ A;  4I50 E;  1CHU A;  5EK3 A;  2FJD A;  1IAP A;  3QC9 A;  1SE7 A;  4ZI3 C;  4HTE A;  1W9R A;  4CI3 B;  3UQ7 A;  4HWI B;  3UQ4 A;  2DNX A;  2LHN A;  1OED C;  3VHL A;  4FJO A;  5HEH A;  3PU3 A;  3HI2 A;  5JDM A;  4DUY T;  4TV9 E;  5BMV E;  4DV6 T;  2WY2 A;  1HR0 T;  4EGW A;  4AQY T;  1LVK A;  5HYA A;  2HN2 A;  5J2T E;  1MIV A;  4CN1 A;  3Q5D A;  3NRY A;  4JEH B;  2QRX A;  4YY3 T;  4HKA A;  3LBX A;  4DR1 T;  4JI0 T;  3CKD A;  3RI5 A;  4LF5 T;  2J47 A;  1CUN A;  3KDS E;  2BDE A;  4LF9 T;  5LXT E;  4F6R C;  3PUX F;  2YN6 A;  4NUV A;  5FXZ A;  2XPK A;  4I4T E;  3C98 B;  3LG7 A;  2ACX A;  3OTO T;  3E08 A;  4OX9 T;  3EDV A;  3LSV A;  1SUM B;  2LSG A;  1UK5 A;  2VKO A;  4UR9 A;  4EEB A;  3WAK A;  2CA5 A;  3EVY A;  3VRB A;  2E5L T;  2V6Y B;  4WBO A;  3C4Z A;  3TLV A;  3QOF A;  3P4P A;  3UUN A;  3KFW X;  2C5K T;  5FXW A;  2I0M A;  1MMG A;  1BR4 A;  2N9D A;  4HEA A;  4AKH A;  4XAX B;  4I55 E;  3U78 A;  4HN9 A;  3LBX B;  3O1H A;  4UXN B;  1E2A A;  1UCU A;  2JMK A;  2EHO A;  3CQG B;  3ZN1 B;  2FUP A;  4KBM B;  2BG9 A;  1WR0 A;  2D0U A;  3KVB A;  4HFH A;  1MMA A;  2XZE A;  1OXZ A;  1D1B A;  1IJ6 A;  3VKG A;  2H89 A;  4A56 A;  1NAF A;  2VB6 A;  5AQS B;  4JV5 T;  2YDS A;  5AQK B;  2V8S V;  2Q9Q C;  4AKL A;  1HCI A;  2OV9 A;  2YIN A;  2LRL A;  4CI1 B;  4XZC A;  4HFB A;  3AA1 B;  3CX8 B;  3ANW A;  2VVN A;  4IT4 A;  5LA6 E;  2VKJ A;  2YDR A;  3KV6 A;  2XAG B;  4YSY A;  2WZI A;  3AEB A;  4O2B E;  2CM0 A;  3VU7 H;  3HA4 A;  2YDQ A;  4YT0 A;  2B1E A;  3EAB A;  5AQV B;  5JDF A;  4ZS3 A;  5FL0 A;  3I0Q A;  1KNR A;  4TZ4 C;  1WRD A;  3AEE A;  5L3G B;  4TWD A;  2HHH T;  2ES0 A;  3N9O A;  4HE8 A;  2ODU A;  2EHO B;  4G63 A;  4UVB B;  5JDN A;  2KND A;  4PJJ A;  2BG9 B;  2E9X C;  4TN7 B;  4JEU B;  3RC8 A;  1HNZ T;  3PUV F;  2MPK A;  1NEN A;  2BBJ A;  2DHR A;  5JVD E;  2IML A;  3HR0 A;  2MAW A;  5LJN A;  3P8C D;  4GIW A;  2W4X A;  1ZEE A;  3Q5X A;  5FP3 A;  1YW0 A;  1J1J A;  2BS4 A;  5CFB A;  2FJB A;  4O2A E;  4IDN A;  3RYI E;  2CCQ A;  4U2Z A;  1ZV4 X;  2WDQ A;  3ANW B;  1UX5 A;  2XTL A;  4IDP A;  3PUS A;  1YD8 G;  3AE1 A;  2Y6X A;  1Z0P A;  1ZHC A;  1XNR T;  1OED A;  1N36 T;  1FMW A;  1L0V A;  5L47 A;  1X9B A;  4PW8 A;  4ERR A;  2OA5 A;  5AQQ B;  2N2N A;  4YFS A;  1Y64 B;  4UEL A;  4JI8 T;  2WSS V;  3TKL B;  1KEY A;  2LT3 A;  3CX6 B;  4AQG A;  2XQ8 A;  3P4W A;  3CQC B;  1J5W A;  4IE6 A;  2XM2 A;  2VKH A;  2KIN B;  4WZX A;  2CBJ A;  2WMN A;  2WZH A;  2L8K A;  4ASK A;  2W00 A;  3OYZ A;  1M62 A;  4UIG A;  4LF8 T;  4ILB A;  4DND A;  3G06 A;  2EHO C;  4OYJ A; 
#chains in the Genus database with same CATH homology
 5EK4 A;  3QK6 A;  2IC6 A;  3N9N A;  4QXB B;  2X51 A;  5FNV E;  4AQF C;  4EIW A;  4CZZ B;  1YKH B;  3ZC0 A;  2JRK A;  2X9W A;  4OYK A;  5LBQ B;  4H9S E;  4MHC A;  3AVS A;  1D1C A;  3HKC E;  3ZMT B;  4ZI2 C;  3V5S A;  5LJM A;  4X20 E;  5DQW A;  3ESL A;  4I50 E;  5EK3 A;  3ZMZ B;  2V7I A;  1D1A A;  3AA6 B;  2VKD A;  3KBT A;  4EOZ B;  5LG4 A;  3SRZ A;  1IAP A;  2CLY B;  3F2E A;  3QC9 A;  1AJ3 A;  4E7Z A;  4CXW A;  2RP4 A;  4ZI3 C;  4IE5 A;  4TX5 A;  5KDM C;  1YKE B;  4HTE A;  4CI3 B;  2C5J A;  4EZ4 A;  2DNX A;  4QXC B;  2ZM0 A;  1LRZ A;  5JRC A;  1US7 B;  2LHN A;  5JR9 A;  3MK7 C;  2GK9 A;  1FEW A;  2X68 A;  4J2C A;  3ZJ1 A;  5LNK A;  4XBF B;  2JPF A;  3VHL A;  4DBR A;  3KV4 A;  3OKQ A;  5LGU B;  2CE7 A;  3I0O A;  3ZYL A;  3MAC A;  4FJO A;  4HGA A;  3V5U A;  2A2F X;  3PU3 A;  5FY7 A;  3HI2 A;  1H7C A;  3N9M A;  5JDM A;  4TV9 E;  3IF8 B;  5C8Y E;  3PDY A;  5BMV E;  3UT5 E;  4DMV A;  4TUY E;  4PFP A;  5FXV A;  2IW5 B;  3N2G E;  4AKG A;  4JLE A;  3F57 A;  3MJX A;  3PE0 A;  1LVK A;  5LHG B;  5HYA A;  4O4L E;  4PAG A;  5J2T E;  4IE4 A;  4P0A A;  1MIV A;  3LK2 B;  4YHJ A;  4BA9 A;  3ZJ2 A;  3LFM A;  4QKN A;  3NRY A;  3RYC E;  2A3D A;  3C4X A;  2MBG A;  3ZMS B;  4JEH B;  4MFR A;  4EXT A;  4PJN A;  3NZP A;  2CMR A;  4GYS A;  1KNZ A;  2WBL A;  4L0R A;  5F8P A;  2EHO D;  4P09 A;  5LHH B;  3J9X 1;  3MXZ A;  1B7T A;  4JUY A;  2YU2 A;  3Q2M A;  1G8X A;  1WYB A;  3M65 A;  2ZM8 A;  2LHR A;  2JJ9 A;  4HKA A;  1MIY A;  2G0U A;  3W15 B;  2Y48 B;  3LBX A;  2L3L A;  1HF8 A;  3H3A A;  4CXX A;  5GON E;  1V9D A;  3CKD A;  3FXE B;  3ZEF B;  4KMC A;  4QWN B;  1WYC A;  4ZI2 D;  1NWM X;  1WLX A;  1CUN A;  2DWG A;  3VKH A;  3KDS E;  2BDE A;  2RA1 A;  4EYU A;  4QHO A;  5LXT E;  5L3D B;  5HXR A;  4ZOL E;  4U72 A;  1LVF A;  3U3I A;  4ILU A;  4F6R C;  3P7I A;  2XAJ B;  3AAI A;  2HPL A;  3O9X A;  3B57 A;  2X67 A;  1QUU A;  4ZI3 D;  2W61 A;  3EDU A;  2D2S A;  4NUV A;  4EB6 E;  4L5G A;  5FXZ A;  2X0L B;  3GA8 A;  2LSJ A;  5LGN B;  4I4T E;  3KV5 A;  2LJL A;  3PUQ A;  3C98 B;  4UV9 B;  3FXD B;  2NW9 A;  5DQV A;  3UUM A;  1LKX A;  3LG7 A;  3NBX X;  2ACX A;  3L3P A;  5LCY A;  3KVA A;  4U74 A;  3AA0 B;  2P9B A;  3E08 A;  3CML A;  2LM9 A;  3RH3 A;  5H6R B;  2Q9Q A;  4IIJ E;  3EDV A;  3IEE A;  4CQI A;  2V26 A;  3ZMV B;  3DTO A;  5HWY A;  5JDH A;  1S35 A;  2CXL A;  4X1I E;  3FBZ A;  4KUM B;  1HG2 A;  2LOP A;  5JRE A;  3R84 B;  2PBI A;  3N2K E;  3LK3 B;  2V7L A;  5JRC B;  2YEV C;  3ZYK A;  5HXH A;  4GYR A;  5JR9 B;  3C51 A;  2LSG A;  2LOS A;  2V1D B;  5FMN A;  3E0Z A;  4L9I A;  2D0T A;  2VKO A;  3FHN A;  4H63 H;  2H3R A;  2VAS A;  4IE0 A;  4O4I E;  5TAO A;  5EK2 A;  3WAK A;  3S4U A;  2CA5 A;  2CLY C;  3EVY A;  4GOU A;  4AI6 A;  3BK9 A;  3UUL A;  4UF0 A;  2KMF A;  5FXX A;  5LBM A;  3RRC A;  3CWZ B;  2KWH A;  1ZKE A;  2XUE A;  5HXS A;  3N9P A;  4WBO A;  3C4Z A;  5HAX A;  4X1K E;  4GK0 E;  3UUN A;  4ANJ A;  3KFW X;  2C5K T;  3HKE E;  5FXW A;  4DBQ A;  3R6N A;  1MMG A;  2NWB A;  2JQQ A;  2ZLY A;  3GWH A;  1SA0 E;  4MLK A;  5H6Q B;  2X9Y A;  2NW7 A;  3Q9D A;  5AFU L;  1BR4 A;  2N9D A;  3FB2 A;  1HX8 A;  2CEA A;  4HEA A;  4AKH A;  4IDZ A;  4PJL A;  4YJ3 E;  4EYY R;  1VOM A;  4XAX B;  4ZS2 A;  3ZN0 B;  2K24 A;  2L9Q A;  4UEM A;  3HL6 A;  4I55 E;  4OFZ A;  4H63 V;  4IE7 A;  2XAF B;  3PUG A;  3U78 A;  4C90 A;  1IJ5 A;  2K5B B;  2MTQ A;  1BR1 A;  4HN9 A;  5LP6 E;  3LBX B;  3O1H A;  3A5X A;  3D0T A;  4UXN B;  1UCU A;  2JMK A;  2EHO A;  4O4H E;  4N78 D;  1KK7 A;  3CQG B;  1BR0 A;  3ZN1 B;  4KBM B;  2HPJ A;  4V1A v;  2NTX A;  2LE8 A;  2D0U A;  2X9X A;  3HKD E;  3MKD A;  5DAB A;  3KVB A;  4WW0 A;  1MMA A;  3GN5 A;  1HS7 A;  5KX5 E;  4PJM A;  4K0U A;  3SS1 A;  3ZPO A;  1OXZ A;  4UVC B;  2E9X A;  1D1B A;  3QUJ A;  2XHE B;  4QX7 B;  1IJ6 A;  2W0G A;  3VKG A;  5LHI B;  4A56 A;  4BAY B;  1O3X A;  1NAF A;  2VB6 A;  3FBL A;  4PNI A;  2BZB A;  4M1P A;  3AA7 B;  3K8P C;  2QA7 A;  4H9O C;  2V7M A;  4ZHQ E;  1S94 A;  5JH7 E;  4YJ2 E;  1D0X A;  3ETV A;  2Q9Q C;  3RYH E;  3EUH A;  3PUR A;  3SOL A;  2KXP B;  3Q5W A;  5JQG E;  2PG8 A;  4AKL A;  1HCI A;  2X9H A;  1X79 A;  5A1L A;  4CXY A;  2Q9Q B;  3SWH A;  2LSI A;  3B13 A;  2YIN A;  4HFV A;  3ZC1 A;  4AXP A;  4CI1 B;  4XZC A;  1MMD A;  5CA1 E;  1VRB A;  4WBN E;  3AA1 B;  3CX8 B;  3ANW A;  4OK0 A;  5LA6 E;  3J7Y q;  2CWY A;  2VKJ A;  4ZI7 E;  2YK0 A;  3PTR B;  3KV6 A;  2XAG B;  2W62 A;  2WAU A;  4EZH A;  3CX7 B;  3AVR A;  3BQL A;  3DJB A;  3N5L A;  5LGT B;  2NTY A;  2QGS A;  2N1G A;  2CXF A;  3GMI A;  2C5I T;  2DWK A;  1EZ3 A;  4UV8 B;  4OHF A;  2VL8 A;  4CI2 B;  4O2B E;  4AKR B;  2CM0 A;  3AB3 B;  2H7V C;  3VU7 H;  2CWO A;  3KV9 A;  4YLH A;  5FYM A;  3UFE A;  4ADZ A;  3OJA A;  3HA4 A;  5KMG P;  4UF0 B;  1FIO A;  2B1E A;  4X1Y E;  3LK4 2;  5JR9 C;  5JDF A;  2NP9 A;  4ZS3 A;  2K9A A;  2SPC A;  3I0Q A;  3KBU A;  4UVA B;  4TV8 E;  2UXX B;  3RC3 A;  2IC9 A;  4P0B A;  4H9Q C;  4B6X A;  2J1D G;  1HG5 A;  2DI4 A;  2C0S A;  5JDL A;  3CVR A;  4TZ4 C;  3T8O A;  4AKI A;  1WRD A;  1OWA A;  4GK5 E;  4E7S A;  3HKB E;  2ZMA A;  2D5U A;  2XAQ B;  5E0O A;  5L3G B;  3UUX B;  1HFA A;  3OBV E;  3DP7 A;  3I9W A;  2ES0 A;  3RPU A;  1D0Z A;  2KWI B;  3N9O A;  4DVD A;  4HE8 A;  5HXC A;  2BVL A;  2ODU A;  3O4X E;  2X66 A;  5IHY A;  2K48 A;  2Y8D A;  2EHO B;  3RYF E;  4G63 A;  1U5P A;  3ZYM A;  4UVB B;  5JDN A;  5LOV E;  3MA9 A;  2LSK A;  2Q9Q D;  2KND A;  5HWX A;  4PJJ A;  3PU8 A;  2BVM A;  1HTJ F;  1T98 A;  2XQY A;  2E9X C;  5L3F B;  4TN7 B;  3F31 A;  4JEU B;  3RC8 A;  5LYJ E;  3GN5 B;  4Z8X A;  2DCF A;  2KZ7 B;  3CQX C;  5L2L A;  4H9R C;  2E9X B;  2CXD A;  2DLR A;  1D0Y A;  3N9L A;  4PK6 A;  3K3O A;  3CPZ A;  2Z6E A;  2DHR A;  4OYJ A;  5JVD E;  4EAH A;  2IAK A;  3HR0 A;  4BJM A;  3MZK B;  4I43 B;  2JMH A;  5LJN A;  4H9P C;  3JC6 C;  1IZN B;  4DMW A;  3P8C D;  2ZM2 A;  5M4Y A;  4H9N C;  3ONX A;  2PJQ A;  3IBP A;  4GIW A;  2V7J A;  5L3C B;  1U4Q A;  1ZEE A;  2LSY A;  2MOZ A;  3H37 A;  3RKO A;  3Q5X A;  5FP3 A;  3RRW A;  3ZCI A;  4IGU A;  5ADX L;  5IYZ E;  5J2U E;  3ZLI A;  1YW0 A;  3OYX A;  4AQF A;  4O2A E;  4PFO A;  3ZMU B;  3RYI E;  2NOX A;  2CCQ A;  1ZV4 X;  1G73 A;  5FY1 A;  2ODV A;  2E8I A;  5L3B B;  3N2O A;  3ANW B;  3NRX A;  1UX5 A;  3ZCJ A;  4DO0 A;  3BQI A;  2XTL A;  5HXE A;  3I1A A;  3PUS A;  3AAE B;  2UXN B;  4BJN A;  2XAS B;  2WMO A;  1YD8 G;  2Y6X A;  3C4W A;  1Z0P A;  5CA0 E;  4IST A;  1ZHC A;  3LJC A;  3C50 A;  5ETW A;  3C64 A;  1WR6 A;  2LEH A;  2HH7 A;  4MAL A;  2KLQ A;  1UX4 A;  3O1I A;  4WNK A;  2V7K A;  1FMW A;  4NUU A;  5DJQ C;  2M67 A;  2PFV A;  4PK4 A;  3N9Q A;  5FY0 A;  2VWA A;  1FMV A;  2WWU A;  2YU1 A;  4PW8 A;  4ERR A;  2OA5 A;  2N2N A;  4YFS A;  1Y64 B;  2E9X D;  3PUA A;  5EZY E;  4UEL A;  4IHJ E;  2WSS V;  1MMN A;  3BQK A;  1MNE A;  3TKL B;  2LT3 A;  4FI5 A;  5L3E B;  3CX6 B;  2KT9 A;  4MBQ A;  5JDQ A;  3L09 A;  5JDG A;  2I59 A;  3NZQ A;  4AQG A;  2NW8 A;  4KP3 C;  1BR2 A;  3CQC B;  3I9Y A;  3O1J A;  1QSD A;  3K3Q C;  4QX8 B;  3JC6 D;  1SHZ C;  2H7O A;  4IE6 A;  4PK5 A;  3E22 E;  3AAA B;  2VKH A;  2KIN B;  2VK9 A;  2WMN A;  3UTK A;  2L8K A;  4O8S A;  2WM9 A;  4ISS A;  3RX6 A;  4ASK A;  2W00 A;  1E1H B;  3KIN B;  4C91 A;  2MYS A;  2XAH B;  3OYZ A;  3IHR A;  3WI3 A;  3ETU A;  4UIG A;  4QXH B;  5J1G A;  2A72 A;  4O4J E;  2W63 A;  1MND A;  3K3N A;  5CB4 E;  4DND A;  2EHO C;  5F3J A;  4G2A A;  1MIW A;  3WAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...