5H6RB

Crystal structure of lsd1-corest in complex with peptide 13
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
b'KPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific histone demethylase 1A
publication title Development and crystallographic evaluation of histone H3 peptide with N-terminal serine substitution as a potent inhibitor of lysine-specific demethylase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription/inhibitor
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2016-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5h6rB00
5LHGB 5LGNB 2XAFB 3ZMZB 5L3GB 4UXNB 3ZMTB 2XAGB 5LHIB 2IW5B 2XASB 5L3FB 5L3DB 5H6RB 2XAHB 2Y48B 4UVAB 3ZMUB 4UV9B 3ZMVB 5LBQB 3ZN0B 4UV8B 3ZN1B 2UXXB 4CZZB 5L3CB 4XBFB 2XAQB 2V1DB 5LGUB 5LHHB 4UVCB 5L3EB 5H6QB 4KUMB 4UVBB 2UXNB 2XAJB 3ZMSB 5LGTB 5L3BB 4BAYB 2X0LB
chains in the Genus database with same CATH superfamily
2X0HA 5LGNB 4DNDA 2HN2A 3AA7B 2IUBA 3CQGB 3ONXA 5BMVE 2M6IA 3AE4A 4ZZBA 2HHHT 3O1IA 4PK4A 3PUZF 3AAAB 4GIWA 4KUMB 2W4XA 3EAMA 3TLTA 2X67A 3O4XE 2XQ3A 3SOLA 3R6NA 4IIJE 4LFCT 3PUYF 3HR0A 4UF0A 3ZCJA 3SFDA 2UXXB 3VU7H 2E8IA 1Y01A 1HS7A 5AQVB 5JQGE 3ZMSB 3JCFA 2W66A 1U4QA 2XM2A 4X1KE 3FBZA 3ZMTB 1KF6A 1FEWA 1HCIA 4AQYT 4UELA 4EAHA 5CB4E 4Z8XA 5JR9A 1XWMA 1G73A 3H3AA 5ETWA 2WWUA 4FI5A 3NBXX 3HKDE 2BG9C 3W15B 4KP3C 3CPZA 1IBMT 4IT4A 2XQ7A 3KV5A 1WRDA 2K5BB 1B7TA 4IL9A 2V5DA 2MAWA 4ILBA 4UEMA 5HEGA 3K3QC 4X65T 5LCYA 2D9DA 5BR8T 3LFMA 4JI8T 1JNZA 4DR1T 2MTQA 1HTJF 2A3DA 1ZOYA 1LRZA 5FP3A 2E9XC 1QSDA 1E1HB 2YKSA 3UFGA 2UUBT 2ZMAA 4TV8E 4IE0A 2NOXA 2V6YA 1KNPA 1FIOA 4H63V 2XQAA 3S4UA 2UXDT 3IEEA 4AKGA 1BR2A 2KNDA 4O4HE 2Q9QD 1IJ5A 5HXEA 2VURA 3EDVA 4BAYB 2V7IA 4O2AE 3HA4A 2VVSA 2J47A 1IAPA 2FUPA 3VRBA 2LSYA 4BJNA 5JRCA 3J9X1 4KI0F 1MMAA 5JREA 4JEUB 1YQ3A 4G2AA 3ANWB 2CWYA 5IYZE 3ABVA 5LA6E 3P4SA 3H37A 4C91A 5FKYA 5LGTB 2IIUA 1WFDA 3SRZA 3UTKA 2XQ4A 3RI5A 4DV3T 4AQGA 2EHOB 3VKGA 5LG3A 4GK5E 4DMWA 1HG2A 4PFOA 2W61A 3LBXB 3TLVA 5AQJB 4PJLA 3NVOA 3ESLA 3AE8A 3N9LA 1LKXA 3UT5E 5L3EB 1T98A 2VKOA 1R8IA 3N2OA 4HE8A 4AQFA 1J1JA 4ZEYA 2WB5A 3PJAA 3LDQB 2Y8DA 2XPKA 4K0UA 2I0MA 4DR2T 2BS4A 4B3RT 4WBNE 3UU6A 3UU4A 1W09A 1T8BA 2BVLA 5FXWA 3RIUA 4H63H 1XZYA 4H9PC 3FHNA 3FXDB 2WU2A 4ASKA 3JAFA 2OLTA 4CN1A 4P0BA 1XDPA 4L5GA 3EVYA 4HFCA 2K3WA 5LHGB 3MK7C 4PJMA 4WYVA 4H9OC 4LMKA 2RA1A 2W00A 3PUAA 5HEOA 2XQ5A 5KDMC 1AJ3A 3PE0A 4AIUA 5LOVE 3ZT7A 4DR6T 2WWVA 2V7LA 4AKRB 5HEUA 2YK0A 3KFWX 4YT0A 2FJAA 2VWAA 1I94T 3QUJA 2VQET 4O2BE 1N34T 4CI1B 2XUEA 3FXEB 2CBIA 3AE3A 1X79A 3N9PA 2W63A 3ZPOA 2OA5A 4P0AA 3RF1A 4YTNA 2JQKA 4OYKA 2W62A 2MPKA 4X66T 3AE5A 3VRAA 4YSXA 5JDLA 1Y64B 3CK6A 3JADA 4ZI2C 4KHPT 3PU8A 4GK0E 4DO0A 3O1JA 2MOZA 1HNXT 5GONE 1JNRA 2NTXA 4H9SE 4QXCB 3FZMB 3I0QA 3E08A 2XAQB 4HFDA 5ABEA 3ZYKA 3K8PC 4JI2T 3FZFB 3CX6B 2X9HA 1S35A 1MIYA 5LP6E 5FL1A 3CVRA 3C4ZA 1XNRT 4X5TA 5AQIB 2XJ7A 3EDUA 4YHJA 4UVAB 1NAFA 1XMOT 2FBWA 2H89A 5FNVE 3IHRA 3E22E 2IMLA 2IDOB 1SUMB 2LSKA 4DV1T 4UR9A 3ZSSA 3N9NA 2WSSV 4TN7B 3FBLA 2CCQA 5HXSA 4U72A 3RRWA 4A98A 2BS2A 3ZMZB 2BG9B 3AXJB 3UQ4A 3GMIA 3ZSTA 4DIDB 1D1AA 4J2CA 3T8OA 3PUWF 4DV6T 2M6BA 2X9YA 3B57A 2CXDA 4LFAT 4LF5T 3RKOA 3R84B 4EV6A 2NW7A 1XDOA 5CFBA 1OEDC 2RP4A 2A2FX 2K9AA 4YFSA 2WM9A 3GN5B 3WAKA 3LG7A 4NPPA 3OPCA 3I0OA 4UXNB 1M62A 4TV9E 1IBLT 2LM9A 3SWHA 1CHUA 2XSAA 4P09A 5EK4A 1UX5A 2KINB 1D1BA 4IE7A 3ZMVB 1MMDA 4CI2B 3J7Yq 2LJLA 4LF7T 4TNVA 4WW0A 3ZEFB 4C90A 4IREA 4QXHB 2E5VA 1ZV4X 5H6RB 2WBLA 4COFA 4CN6A 1UX4A 4L0RA 4MFRA 4PJNA 4UV9B 4DV0T 4XBFB 3RRCA 2FJBA 4IE6A 2KSRA 3ETUA 5ABFA 4DR7T 3JC6C 4BA9A 3KBTA 2CHOA 3RLFF 3RC8A 2XQ8A 2W0GA 1FMVA 4HN9A 4CN4A 1UGOA 2Y48B 3MA9A 1SA0E 4O4IE 2NR4A 4IDZA 2Q9QB 2YOEA 3BQKA 5L47A 4IGUA 1VRBA 1O3XA 1N36T 4YTPA 4A56A 4AKHA 2E2AA 2WQYA 2V8SV 2UXCT 4ILUA 1VCSA 4X1YE 4ILAA 5C2TA 2M67A 5J0ZA 5LHHB 5FY1A 1XMQT 2W67A 3FZHB 3Q5DA 5HEHA 5CJ5A 5CA0E 2HN1A 4CZZB 1WR0A 2D0TA 2H88A 3I1AA 3WAJA 3EUHA 4B3TT 2X0LB 2LHRA 3PDYA 2I59A 4QH4A 2XAGB 1VCTA 3FZLB 2IC6A 5EK3A 2KWIB 3ZN0B 5LXTE 3IBPA 5LG4A 4PFPA 4ZHQE 1MIVA 5LYJE 4N78D 4Z91A 5HCJA 4X62T 3RGLA 4EXTA 1M7KA 1Z0PA 1D1CA 4XZCA 3N9MA 3RHWA 4MBQA 3WI3A 5LGUB 3CIRA 3K1SA 3SFEA 3O9XA 4O8SA 4EGWA 2CHNA 2KT9A 5LMUT 4M1PA 5LB7B 5LHIB 1BR4A 3KBUA 1W0BA 3F2EA 1WYBA 3QB5K 1KEYA 3ANWA 4ZS3A 4ADZA 4NUVA 2CM0A 5ABHA 5AQKB 2JRKA 3V5SA 2QVAA 2DCFA 2EHOA 3PV0F 3LBXA 5AQPB 2PBIA 2YU2A 2BZBA 1L0VA 2WS3A 3PUSA 5HWYA 4WZXA 2C5KT 1BR1A 4HWHA 4DV4T 1KNRA 3LK42 5HEJA 2JQ9A 4Z90A 3RH3A 4LF8T 3A7MA 4YSYA 5FXVA 2X9XA 1HX1B 3MKDA 3A5XA 2N9DA 2WDQA 2WDRA 4IDPA 4JI3T 4DMVA 4FJOA 4H9NC 4K0KT 1KK7A 4JV5T 3AE1A 5JDNA 2G0UA 2BS3A 4JI1T 1LVFA 5J2TE 4DV5T 1NEKA 2Q9QC 4IE5A 3DTOA 1N32T 4F6RC 3F57A 5HWXA 3NRXA 3C50A 2JQQA 3VKHA 4UIGA 2YDRA 2VVNA 5AFUL 4H9RC 3A8YC 3T1HT 4YSZA 4HWFA 2E5LT 5JRCB 1OEDB 3V5UA 3UU3A 2BKNA 1UUSA 2DLRA 1IJ6A 1D0XA 3CKDA 3C4WA 4ISSA 4X64T 1MIWA 4GYRA 3N2KE 4GOUA 3RYCE 3HI2A 2WZHA 1YKHB 2V7KA 5DQVA 3AE9A 3TKLB 5JH7E 1YW0A 4PK6A 3UULA 3DJBA 3P4PA 2IHR1 4IDQA 5AQTB 3AE2A 3C98B 5E0OA 2CXLA 2YDQA 5L4EA 3E0ZA 3UU8A 2HPJA 4DR5T 2CLYB 2XTLA 2QA7A 2ZM2A 2X68A 5FXZA 1VOMA 4DR4T 2I6HA 3AA1B 3ZMUB 2Z6EA 4JI6T 1MNDA 2CA5A 2MBGA 5JDFA 1HF8A 1YD8G 4DBQA 1OEDE 2NWBA 5EK2A 4OYJA 4HWDA 3OBVE 4TZ4C 5J2UE 4X20E 1ZHCA 1FMWA 2VKDA 2WP9A 2KLQA 4B3MT 3CQXC 3AA0B 4YLHA 3P4RA 2EHOD 4OHFA 3X1DA 2UUCT 3KV6A 4QKNA 2IC9A 2BG9A 3AXJA 4YHHT 1LVKA 1QLBA 4OX9T 3PUXF 5TAOA 1U5PA 5C8YE 2XQYA 3AVRA 4TNWA 5AQHB 4ZI3D 2VK9A 4MHCA 2JMKA 3BQIA 2LT3A 4ERRA 3ZT5A 5FVKA 2AXDS 5A1LA 3QNUA 1WR6A 1FJGT 2JJ9A 3ZYLA 4JYAT 2E9XA 5AQOB 3IA3A 4DUYT 2ZM0A 3SS1A 3K3NA 2ACXA 2VASA 5DJQC 3GN5A 4I0UA 4AXPA 2RPAA 2QYWA 3AEFA 3AE6A 5AQSB 1BR0A 4TX5A 5DQWA 4IL4A 1NENA 3PUGA 4AISA 3AVSA 3RKGA 4JEHB 4EZHA 2BBHA 2PJQA 5AQFB 4JLEA 3JAEA 3RQWA 3I9YA 4GYSA 2CMRA 5AQGB 5CA1E 2WMNA 3N9QA 1HR0T 2XY8B 4HFIA 1KFYA 3F31A 1Z8UA 3KVAA 4WBOA 2HPLA 3ZLIA 4ILCA 3Q5WA 1GQEA 3ZCIA 4EYUA 4GKJT 5F5WA 2C5IT 2CBJA 1WYCA 5CGMA 2DNXA 3BQLA 2ES0A 2X51A 2Q9QA 4MALA 5J1GA 3AA6B 4EIWA 5KXJA 2CPTA 1W0AA 3LSVA 2B76A 5JTGA 1X9BA 4AQFC 5HCMA 3KINB 2H3RA 3VHLA 2WZIA 5FMNA 4QH5A 2N1GA 4LF4T 4V1Av 2C0SA 2BG9E 4PAGA 3HKCE 4QWNB 4YJ2E 5IHYA 1WLXA 3Q5XA 2VKHA 4ZXLA 3QOFA 3RYIE 3CWZB 3CMLA 2CLYC 3RIUC 5FXXA 2VKJA 5AQMB 3PU3A 1DU2A 3UUXB 3UUBA 3I9WA 1ZEEA 4IHJE 4HWCA 3HKEE 3B5MA 4EEBA 4HFBA 4B3ST 3ZC1A 2XAJB 3NZPA 3AEBA 4NXNT 2BKPA 4EOZB 5AQUB 2ZM6T 2CEAA 3MJXA 3Q2MA 4DR3T 2CE7A 4U74A 3L3PA 1MNEA 4NXMT 4U7IA 2DL1A 1V9DA 3N2GE 3AEDA 1IBKT 2UXBT 2XQ9A 4KMCA 4QX8B 2CRBA 1E7PA 3N5LA 4HWIB 5ABFB 4P1NA 2UXNB 3FB2A 5HYAA 2DWGA 3RYFE 3N9OA 2MYSA 3AECA 2V7MA 2KZ7B 2V6XA 3PUVF 1MMGA 5JDMA 5JDHA 2L8KA 1J5ET 3ZKRA 2DWKA 4I50E 3U3IA 2VQFT 2HH7A 2QRXA 3NZQA 1H7CA 2Y6XA 2E9XD 2LSJA 4AI6A 3OYXA 4E7ZA 3AEEA 2D2SA 4QX7B 3G06A 3OKQA 3MZKB 3ZJ1A 2ACZA 3TLWA 4O4JE 3RIFA 2GK9A 1I6ZA 4UF0B 1WCRA 2JQHA 3P8CD 3KV9A 2XSBA 4YY3T 3NWIA 2PG8A 3ZYMA 3KV4A 1YKEB 3AAEB 3LK2B 5DABA 3NKZA 3ETVA 4LF9T 4IE4A 4MLKA 4IDNA 5AQLB 4QXBB 2LRKA 4IDOA 4CXYA 1HG5A 2R6GF 2C5JA 2XHEB 2AE9A 5F8PA 3UUNA 5JR9B 2IAKA 2OV9A 2L9QA 2N2NA 2V26A 1US7B 4X1IE 4AKLA 1QUUA 2A9UA 5LJMA 3PURA 1UCUA 2H7OA 4F8HA 4JBWF 5KMGP 1HNWT 4JI0T 4JI7T 3ZN1B 4ZS2A 1S94A 4PK5A 2W2UA 2D0UA 3C51A 3ZJ2A 5L3BB 3QB5A 3P4QA 3OYZA 2NP9A 3PJAJ 4PNIA 4GKKT 2LM2A 1NWMX 1OEDA 5HXHA 3ONLC 4KX6A 2H7VC 2BBJA 4Q25A 3C4XA 2V6YB 3AE7A 4HEAA 1UURA 2XAFB 4HFVA 3HKBE 4U7YA 4U31A 4CQIA 4I43B 4EYYR 4U2ZA 1T7SA 4WNKA 2DHRA 5KX5E 4XAXB 4TWHA 4YTMA 3Q9DA 4I4TE 5JDGA 1HNZT 2V5CA 3UQ7A 3EHZA 3CX8B 2LKHA 1YQ4A 2JMHA 4OFZA 1W9RA 1E2AA 3QC9A 3L8RA 5FY0A 2LLYA 5LBQB 3OVUA 4YJ3E 3PUQA 4JUYA 2WU5A 4AKIA 4KHZF 2WMOA 2NTYA 3RQUA 4DBRA 3AB3B 1OXZA 5LBMA 3D0TA 2J4GA 3B13A 3VR8A 4LMLA 2KMFA 4ZZCA 4ZOLE 1CUNA 3U78A 1OWAA 4B6XA 2BVMA 4QH1A 5M4YA 5LNKA 2LSIA 1UK5A 5HAXA 3P7IA 3LJCA 1SE7A 2IW5B 4ZI7E 1D0YA 4U33A 3AEGA 4PW8A 4ZI2D 1ZKEA 5FYMA 4UV8B 3AEAA 2ZM8A 3NRYA 4UVCB 5L2LA 3RX6A 2XQ6A 2YEVC 4EB6E 5L3GB 4U3CA 1EZ3A 2DI4A 2X9WA 4TWDA 4NIQA 3KDSE 3ZC0A 2PTFA 3LK3B 3TLSA 5L3CB 4EZ4A 2FJDA 2JIWA 4PJJA 1HX8A 2LHNA 4HKAA 4DVDA 4H9QC 1KNZA 4LF6T 3K3OA 4CI3B 3ZT6A 2D5UA 2XZEA 4HFHA 3VR9A 2LSGA 2X66A 4JI4T 3M3ZB 4HFEA 3FZKB 2LOSA 3Q5EA 2F4VT 5AQNB 4ANJA 1T72A 2CWOA 5JR9C 2A72A 2WCAA 2B1EA 3RPUA 2NW8A 3PTRB 5L3DB 3TLUA 2K48A 4I55E 4DV7T 2J62A 3UU5A 2YDSA 2K24A 2V1DB 3P50A 3H3MA 2LEHA 3EI0A 3AAIA 4YXDA 2JPFA 3L09A 2UUAT 2KXPB 5F3JA 3GWHA 2XASB 5EZYE 3L39A 2QGSA 3BK9A 2CXFA 1YXRA 4CXXA 3O1HA 4EEDA 4L9IA 4HGAA 3OTOT 5JVDE 4TWFA 2P9BA 5H6QB 2KWHA 3C64A 2WY2A 1D0ZA 2L3LA 1ZP0A 5ABGA 2EHOC 2LE8A 2ODVA 4ISTA 5IUXA 2VB6A 4BJMA 1XNQT 2ZLYA 5FVLA 4ZI3C 5FY7A 4CXWA 2XAHB 3UFEA 5C3JA 4KBMB 3RYHE 2LRLA 3OJAA 2V7JA 2XM1A 2YU1A 3HL6A 2UU9T 3MXZA 5FL0A 3CX7B 5JDQA 1MMNA 3M65A 2E9XB 4DUZT 2FJEA 2YN6A 4OK0A 2NW9A 4G63A 3JC6D 5LJNA 2ODUA 4O4LE 1IZNB 4A5XA 4UVBB 1HFAA 2X0YA 2BKOA 2J1DG 2YINA 2PFVA 5L3FB 2VL0A 3RIAA 5AQRB 5LMNT 5IWAT 2LKGA 2LOPA 3KVBA 4DV2T 2WDVA 5HXRA 4LMJA 2WAUA 4HTEA 4LFBT 4TUYE 5ADXL 3GA8A 2VL8A 3UUMA 5HXCA 3MACA 3T1YT 3IF8B 1SHZC 4E7SA 1N33T 4U2YA 3DP7A 5L4HA 1G8XA 3ONJA 3RC3A 5AQQB 2BDEA 2SPCA 4QHOA 4JI5T 3EABA 4NUUA 3P4WA 3CQCB 4A97A 1J5WA 3QK6A
chains in the Genus database with same CATH topology
1YW0A 5LGNB 4PK6A 4DNDA 3ZMZB 3UULA 3DJBA 3AA7B 3CQGB 3GMIA 5LJMA 3ONXA 3PURA 1UCUA 2H7OA 5BMVE 5KMGP 1D1AA 4J2CA 3T8OA 3C98B 5E0OA 3ZN1B 3O1IA 4ZS2A 4PK4A 1S94A 3AAAB 4PK5A 2CXLA 4GIWA 4KUMB 2X9YA 3C51A 2D0UA 3ZJ2A 3E0ZA 5L3BB 2HPJA 3B57A 2CXDA 2X67A 3O4XE 3OYZA 2CLYB 2XTLA 2NP9A 3R6NA 3SOLA 2QA7A 4IIJE 3RKOA 2ZM2A 3R84B 2NW7A 2X68A 4PNIA 3HR0A 4UF0A 5FXZA 1NWMX 1VOMA 5HXHA 3AA1B 3ZMUB 2RP4A 2Z6EA 1MNDA 2CA5A 2MBGA 3ZCJA 2A2FX 2H7VC 2K9AA 5JDFA 2UXXB 3VU7H 1HF8A 1YD8G 4YFSA 2E8IA 2WM9A 3GN5B 4DBQA 1HS7A 3C4XA 5JQGE 3ZMSB 4HEAA 3WAKA 1U4QA 3LG7A 2XAFB 4HFVA 2NWBA 3HKBE 4X1KE 3I0OA 4UXNB 5EK2A 3FBZA 4OYJA 3OBVE 4TZ4C 3ZMTB 4TV9E 5J2UE 4X20E 2LM9A 3SWHA 1ZHCA 1FMWA 2VKDA 1FEWA 4P09A 5EK4A 2KLQA 4CQIA 1UX5A 2KINB 1D1BA 4IE7A 4I43B 3ZMVB 1HCIA 1MMDA 4CI2B 4UELA 4EYYR 4EAHA 4WNKA 3J7Yq 2LJLA 4Z8XA 3CQXC 2DHRA 5JR9A 5CB4E 3AA0B 4YLHA 4WW0A 4XAXB 5KX5E 3ZEFB 3Q9DA 4C90A 4I4TE 2EHOD 4OHFA 4QXHB 5JDGA 1G73A 3H3AA 3KV6A 4QKNA 5ETWA 2WWUA 1ZV4X 4FI5A 2IC9A 3CX8B 3NBXX 3HKDE 2JMHA 5H6RB 2WBLA 4OFZA 3QC9A 1LVKA 5FY0A 3W15B 4KP3C 1UX4A 3CPZA 4L0RA 4MFRA 4PJNA 4UV9B 5LBQB 5TAOA 4XBFB 1U5PA 5C8YE 2XQYA 3AVRA 3RRCA 4IE6A 3KV5A 1WRDA 4YJ3E 4ZI3D 3PUQA 3ETUA 2K5BB 4JUYA 2VK9A 1B7TA 4MHCA 2JMKA 3BQIA 2LT3A 4UEMA 4ERRA 4AKIA 2WMOA 3JC6C 4BA9A 2NTYA 3K3QC 3KBTA 5LCYA 3RC8A 4DBRA 2W0GA 1FMVA 5A1LA 3LFMA 3AB3B 1OXZA 5LBMA 3D0TA 4HN9A 1WR6A 2JJ9A 2MTQA 2Y48B 3ZYLA 3B13A 3MA9A 1HTJF 2A3DA 2E9XA 1SA0E 4O4IE 1LRZA 2KMFA 5FP3A 2E9XC 2ZM0A 4ZOLE 1CUNA 3SS1A 3K3NA 4IDZA 2ACXA 1QSDA 3U78A 2Q9QB 1OWAA 1E1HB 2VASA 5DJQC 3GN5A 4B6XA 2BVMA 3BQKA 5M4YA 2ZMAA 4TV8E 5LNKA 4IE0A 4AXPA 2NOXA 2LSIA 4IGUA 1VRBA 1O3XA 5HAXA 3P7IA 1BR0A 3LJCA 1FIOA 4TX5A 5DQWA 4H63V 3S4UA 2IW5B 4A56A 4ZI7E 1D0YA 3IEEA 3PUGA 4AKHA 4AKGA 3AVSA 4ILUA 4PW8A 4JEHB 1BR2A 2KNDA 4O4HE 4X1YE 4ZI2D 4EZHA 1ZKEA 5FYMA 2Q9QD 1IJ5A 4UV8B 5HXEA 2M67A 2PJQA 5LHHB 4UVCB 2ZM8A 3NRYA 5FY1A 4JLEA 5L2LA 3EDVA 3RX6A 4BAYB 2V7IA 2YEVC 4O2AE 4EB6E 3HA4A 3I9YA 5L3GB 4GYSA 1EZ3A 2DI4A 2X9WA 1IAPA 2CMRA 5CA1E 2LSYA 4BJNA 5JRCA 3J9X1 2WMNA 1MMAA 3KDSE 3N9QA 5JREA 3ZC0A 4JEUB 5CA0E 3LK3B 3F31A 4CZZB 3KVAA 5L3CB 4EZ4A 4G2AA 3ANWB 2CWYA 2D0TA 4PJJA 4WBOA 5IYZE 1HX8A 2LHNA 5LA6E 3H37A 3I1AA 4HKAA 4DVDA 2HPLA 4H9QC 4C91A 3WAJA 1KNZA 5LGTB 3EUHA 3ZLIA 3K3OA 4CI3B 2X0LB 2LHRA 3Q5WA 3SRZA 2D5UA 3UTKA 3PDYA 3ZCIA 4EYUA 4AQGA 2I59A 2EHOB 2XAGB 2LSGA 3VKGA 2X66A 4GK5E 4DMWA 1HG2A 4PFOA 2LOSA 2IC6A 2W61A 5EK3A 2C5IT 3LBXB 2KWIB 4PJLA 3ZN0B 5LXTE 3IBPA 3ESLA 4ANJA 5LG4A 4PFPA 1WYCA 1MIVA 3N9LA 1LKXA 3UT5E 4ZHQE 5LYJE 2CWOA 2DNXA 3BQLA 5L3EB 2ES0A 2X51A 2Q9QA 4N78D 4MALA 5J1GA 3AA6B 4EIWA 5JR9C 1T98A 2A72A 2VKOA 2B1EA 3N2OA 4HE8A 4AQFA 4AQFC 3RPUA 2NW8A 4EXTA 3PTRB 5L3DB 1Z0PA 3KINB 2H3RA 3VHLA 2K48A 4I55E 5FMNA 1D1CA 2Y8DA 4K0UA 4XZCA 3N9MA 2N1GA 2K24A 4MBQA 4V1Av 2C0SA 3WI3A 2V1DB 5LGUB 4PAGA 3O9XA 3HKCE 4O8SA 4QWNB 2LEHA 4YJ2E 5IHYA 2KT9A 1WLXA 3Q5XA 4WBNE 3AAIA 2VKHA 2JPFA 3L09A 4M1PA 3RYIE 2BVLA 2KXPB 5FXWA 5F3JA 5LHIB 3GWHA 2XASB 3CWZB 3CMLA 5EZYE 4H63H 2CLYC 4H9PC 3FHNA 2QGSA 3FXDB 5FXXA 2VKJA 3BK9A 2CXFA 1BR4A 3PU3A 4CXXA 3O1HA 4ASKA 3UUXB 3I9WA 1ZEEA 3KBUA 4L9IA 4HGAA 4IHJE 3HKEE 3F2EA 5JVDE 4P0BA 1WYBA 3ANWA 3ZC1A 4L5GA 2P9BA 3EVYA 2KWHA 2XAJB 4ZS3A 5H6QB 4ADZA 3NZPA 4NUVA 2CM0A 3C64A 2JRKA 5LHGB 1D0ZA 3V5SA 3MK7C 2L3LA 4PJMA 4H9OC 2DCFA 2RA1A 2EHOA 2W00A 3PUAA 2EHOC 2LE8A 2ODVA 4EOZB 5KDMC 4ISTA 2VB6A 1AJ3A 3LBXA 3PE0A 4BJMA 2PBIA 2YU2A 2BZBA 2CEAA 3MJXA 3Q2MA 5LOVE 2CE7A 2ZLYA 4U74A 3L3PA 2V7LA 3PUSA 5HWYA 1MNEA 4AKRB 2C5KT 1BR1A 2YK0A 3KFWX 1V9DA 3N2GE 4ZI3C 5FY7A 4CXWA 2VWAA 2XAHB 4KMCA 3LK42 4QX8B 3UFEA 3QUJA 4KBMB 3RYHE 3N5LA 4O2BE 3RH3A 3OJAA 2V7JA 4CI1B 2XUEA 2YU1A 3FXEB 3HL6A 3MXZA 5FXVA 2UXNB 3FB2A 2X9XA 5HYAA 3MKDA 2DWGA 3A5XA 2N9DA 1X79A 3N9PA 2MYSA 3N9OA 3RYFE 4DMVA 2V7MA 2W63A 3CX7B 4FJOA 5JDQA 3ZPOA 1MMNA 2OA5A 2KZ7B 4P0AA 3M65A 1MMGA 5JDMA 2E9XB 4H9NC 5JDHA 4OYKA 1KK7A 2W62A 2L8KA 4OK0A 2NW9A 2DWKA 4I50E 4G63A 3JC6D 5JDNA 2G0UA 3U3IA 5LJNA 2ODUA 4O4LE 1IZNB 4UVBB 1LVFA 5JDLA 1HFAA 1Y64B 2HH7A 4ZI2C 5J2TE 3PU8A 4IE5A 2Q9QC 4GK0E 3NZQA 1H7CA 2Y6XA 3DTOA 4DO0A 2E9XD 2J1DG 4F6RC 3O1JA 2MOZA 2YINA 2PFVA 5L3FB 2LSJA 5GONE 3F57A 5HWXA 3NRXA 2NTXA 4H9SE 4AI6A 4QXCB 3C50A 3OYXA 4E7ZA 3I0QA 2D2SA 2JQQA 3E08A 2XAQB 2LOPA 3KVBA 3VKHA 4QX7B 3ZYKA 3K8PC 5HXRA 3CX6B 4UIGA 3OKQA 3MZKB 4H9RC 3ZJ1A 2X9HA 1S35A 5AFUL 2WAUA 4HTEA 4O4JE 1MIYA 5LP6E 3CVRA 2GK9A 5JRCB 3C4ZA 4UF0B 3P8CD 4TUYE 3KV9A 3V5UA 3EDUA 4YHJA 5ADXL 4UVAB 1NAFA 3GA8A 2VL8A 2PG8A 3UUMA 2DLRA 3ZYMA 1IJ6A 5HXCA 1D0XA 3MACA 3KV4A 1YKEB 3CKDA 3AAEB 3IF8B 1SHZC 3C4WA 3LK2B 5FNVE 5DABA 4ISSA 4E7SA 3ETVA 3IHRA 4IE4A 1MIWA 3E22E 3DP7A 4MLKA 2LSKA 1G8XA 4GYRA 3N2KE 4QXBB 3RC3A 2BDEA 4GOUA 3RYCE 2SPCA 4QHOA 4CXYA 1HG5A 3N9NA 2C5JA 3HI2A 2XHEB 2WSSV 4NUUA 5F8PA 1YKHB 2V7KA 4TN7B 3UUNA 2IAKA 5JR9B 3FBLA 5DQVA 2CCQA 2L9QA 2N2NA 2V26A 1US7B 3CQCB 3TKLB 4X1IE 4AKLA 4U72A 3RRWA 5HXSA 5JH7E 1QUUA 3QK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LHG B;  5LGN B;  2XAF B;  3ZMZ B;  5L3G B;  4UXN B;  3ZMT B;  2XAG B;  5LHI B;  2IW5 B;  2XAS B;  5L3F B;  5L3D B;  5H6R B;  2XAH B;  2Y48 B;  4UVA B;  3ZMU B;  4UV9 B;  3ZMV B;  5LBQ B;  3ZN0 B;  4UV8 B;  3ZN1 B;  2UXX B;  4CZZ B;  5L3C B;  4XBF B;  2XAQ B;  2V1D B;  5LGU B;  5LHH B;  4UVC B;  5L3E B;  5H6Q B;  4KUM B;  4UVB B;  2UXN B;  2XAJ B;  3ZMS B;  5LGT B;  5L3B B;  4BAY B;  2X0L B; 
#chains in the Genus database with same CATH topology
 2X0H A;  5LGN B;  4DND A;  2HN2 A;  3AA7 B;  2IUB A;  3CQG B;  3ONX A;  5BMV E;  2M6I A;  3AE4 A;  4ZZB A;  2HHH T;  3O1I A;  4PK4 A;  3PUZ F;  3AAA B;  4GIW A;  4KUM B;  2W4X A;  3EAM A;  3TLT A;  2X67 A;  3O4X E;  2XQ3 A;  3SOL A;  3R6N A;  4IIJ E;  4LFC T;  3PUY F;  3HR0 A;  4UF0 A;  3ZCJ A;  3SFD A;  2UXX B;  3VU7 H;  2E8I A;  1Y01 A;  1HS7 A;  5AQV B;  5JQG E;  3ZMS B;  3JCF A;  2W66 A;  1U4Q A;  2XM2 A;  4X1K E;  3FBZ A;  3ZMT B;  1KF6 A;  1FEW A;  1HCI A;  4AQY T;  4UEL A;  4EAH A;  5CB4 E;  4Z8X A;  5JR9 A;  1XWM A;  1G73 A;  3H3A A;  5ETW A;  2WWU A;  4FI5 A;  3NBX X;  3HKD E;  2BG9 C;  3W15 B;  4KP3 C;  3CPZ A;  1IBM T;  4IT4 A;  2XQ7 A;  3KV5 A;  1WRD A;  2K5B B;  1B7T A;  4IL9 A;  2V5D A;  2MAW A;  4ILB A;  4UEM A;  5HEG A;  3K3Q C;  4X65 T;  5LCY A;  2D9D A;  5BR8 T;  3LFM A;  4JI8 T;  1JNZ A;  4DR1 T;  2MTQ A;  1HTJ F;  2A3D A;  1ZOY A;  1LRZ A;  5FP3 A;  2E9X C;  1QSD A;  1E1H B;  2YKS A;  3UFG A;  2UUB T;  2ZMA A;  4TV8 E;  4IE0 A;  2NOX A;  2V6Y A;  1KNP A;  1FIO A;  4H63 V;  2XQA A;  3S4U A;  2UXD T;  3IEE A;  4AKG A;  1BR2 A;  2KND A;  4O4H E;  2Q9Q D;  1IJ5 A;  5HXE A;  2VUR A;  3EDV A;  4BAY B;  2V7I A;  4O2A E;  3HA4 A;  2VVS A;  2J47 A;  1IAP A;  2FUP A;  3VRB A;  2LSY A;  4BJN A;  5JRC A;  3J9X 1;  4KI0 F;  1MMA A;  5JRE A;  4JEU B;  1YQ3 A;  4G2A A;  3ANW B;  2CWY A;  5IYZ E;  3ABV A;  5LA6 E;  3P4S A;  3H37 A;  4C91 A;  5FKY A;  5LGT B;  2IIU A;  1WFD A;  3SRZ A;  3UTK A;  2XQ4 A;  3RI5 A;  4DV3 T;  4AQG A;  2EHO B;  3VKG A;  5LG3 A;  4GK5 E;  4DMW A;  1HG2 A;  4PFO A;  2W61 A;  3LBX B;  3TLV A;  5AQJ B;  4PJL A;  3NVO A;  3ESL A;  3AE8 A;  3N9L A;  1LKX A;  3UT5 E;  5L3E B;  1T98 A;  2VKO A;  1R8I A;  3N2O A;  4HE8 A;  4AQF A;  1J1J A;  4ZEY A;  2WB5 A;  3PJA A;  3LDQ B;  2Y8D A;  2XPK A;  4K0U A;  2I0M A;  4DR2 T;  2BS4 A;  4B3R T;  4WBN E;  3UU6 A;  3UU4 A;  1W09 A;  1T8B A;  2BVL A;  5FXW A;  3RIU A;  4H63 H;  1XZY A;  4H9P C;  3FHN A;  3FXD B;  2WU2 A;  4ASK A;  3JAF A;  2OLT A;  4CN1 A;  4P0B A;  1XDP A;  4L5G A;  3EVY A;  4HFC A;  2K3W A;  5LHG B;  3MK7 C;  4PJM A;  4WYV A;  4H9O C;  4LMK A;  2RA1 A;  2W00 A;  3PUA A;  5HEO A;  2XQ5 A;  5KDM C;  1AJ3 A;  3PE0 A;  4AIU A;  5LOV E;  3ZT7 A;  4DR6 T;  2WWV A;  2V7L A;  4AKR B;  5HEU A;  2YK0 A;  3KFW X;  4YT0 A;  2FJA A;  2VWA A;  1I94 T;  3QUJ A;  2VQE T;  4O2B E;  1N34 T;  4CI1 B;  2XUE A;  3FXE B;  2CBI A;  3AE3 A;  1X79 A;  3N9P A;  2W63 A;  3ZPO A;  2OA5 A;  4P0A A;  3RF1 A;  4YTN A;  2JQK A;  4OYK A;  2W62 A;  2MPK A;  4X66 T;  3AE5 A;  3VRA A;  4YSX A;  5JDL A;  1Y64 B;  3CK6 A;  3JAD A;  4ZI2 C;  4KHP T;  3PU8 A;  4GK0 E;  4DO0 A;  3O1J A;  2MOZ A;  1HNX T;  5GON E;  1JNR A;  2NTX A;  4H9S E;  4QXC B;  3FZM B;  3I0Q A;  3E08 A;  2XAQ B;  4HFD A;  5ABE A;  3ZYK A;  3K8P C;  4JI2 T;  3FZF B;  3CX6 B;  2X9H A;  1S35 A;  1MIY A;  5LP6 E;  5FL1 A;  3CVR A;  3C4Z A;  1XNR T;  4X5T A;  5AQI B;  2XJ7 A;  3EDU A;  4YHJ A;  4UVA B;  1NAF A;  1XMO T;  2FBW A;  2H89 A;  5FNV E;  3IHR A;  3E22 E;  2IML A;  2IDO B;  1SUM B;  2LSK A;  4DV1 T;  4UR9 A;  3ZSS A;  3N9N A;  2WSS V;  4TN7 B;  3FBL A;  2CCQ A;  5HXS A;  4U72 A;  3RRW A;  4A98 A;  2BS2 A;  3ZMZ B;  2BG9 B;  3AXJ B;  3UQ4 A;  3GMI A;  3ZST A;  4DID B;  1D1A A;  4J2C A;  3T8O A;  3PUW F;  4DV6 T;  2M6B A;  2X9Y A;  3B57 A;  2CXD A;  4LFA T;  4LF5 T;  3RKO A;  3R84 B;  4EV6 A;  2NW7 A;  1XDO A;  5CFB A;  1OED C;  2RP4 A;  2A2F X;  2K9A A;  4YFS A;  2WM9 A;  3GN5 B;  3WAK A;  3LG7 A;  4NPP A;  3OPC A;  3I0O A;  4UXN B;  1M62 A;  4TV9 E;  1IBL T;  2LM9 A;  3SWH A;  1CHU A;  2XSA A;  4P09 A;  5EK4 A;  1UX5 A;  2KIN B;  1D1B A;  4IE7 A;  3ZMV B;  1MMD A;  4CI2 B;  3J7Y q;  2LJL A;  4LF7 T;  4TNV A;  4WW0 A;  3ZEF B;  4C90 A;  4IRE A;  4QXH B;  2E5V A;  1ZV4 X;  5H6R B;  2WBL A;  4COF A;  4CN6 A;  1UX4 A;  4L0R A;  4MFR A;  4PJN A;  4UV9 B;  4DV0 T;  4XBF B;  3RRC A;  2FJB A;  4IE6 A;  2KSR A;  3ETU A;  5ABF A;  4DR7 T;  3JC6 C;  4BA9 A;  3KBT A;  2CHO A;  3RLF F;  3RC8 A;  2XQ8 A;  2W0G A;  1FMV A;  4HN9 A;  4CN4 A;  1UGO A;  2Y48 B;  3MA9 A;  1SA0 E;  4O4I E;  2NR4 A;  4IDZ A;  2Q9Q B;  2YOE A;  3BQK A;  5L47 A;  4IGU A;  1VRB A;  1O3X A;  1N36 T;  4YTP A;  4A56 A;  4AKH A;  2E2A A;  2WQY A;  2V8S V;  2UXC T;  4ILU A;  1VCS A;  4X1Y E;  4ILA A;  5C2T A;  2M67 A;  5J0Z A;  5LHH B;  5FY1 A;  1XMQ T;  2W67 A;  3FZH B;  3Q5D A;  5HEH A;  5CJ5 A;  5CA0 E;  2HN1 A;  4CZZ B;  1WR0 A;  2D0T A;  2H88 A;  3I1A A;  3WAJ A;  3EUH A;  4B3T T;  2X0L B;  2LHR A;  3PDY A;  2I59 A;  4QH4 A;  2XAG B;  1VCT A;  3FZL B;  2IC6 A;  5EK3 A;  2KWI B;  3ZN0 B;  5LXT E;  3IBP A;  5LG4 A;  4PFP A;  4ZHQ E;  1MIV A;  5LYJ E;  4N78 D;  4Z91 A;  5HCJ A;  4X62 T;  3RGL A;  4EXT A;  1M7K A;  1Z0P A;  1D1C A;  4XZC A;  3N9M A;  3RHW A;  4MBQ A;  3WI3 A;  5LGU B;  3CIR A;  3K1S A;  3SFE A;  3O9X A;  4O8S A;  4EGW A;  2CHN A;  2KT9 A;  5LMU T;  4M1P A;  5LB7 B;  5LHI B;  1BR4 A;  3KBU A;  1W0B A;  3F2E A;  1WYB A;  3QB5 K;  1KEY A;  3ANW A;  4ZS3 A;  4ADZ A;  4NUV A;  2CM0 A;  5ABH A;  5AQK B;  2JRK A;  3V5S A;  2QVA A;  2DCF A;  2EHO A;  3PV0 F;  3LBX A;  5AQP B;  2PBI A;  2YU2 A;  2BZB A;  1L0V A;  2WS3 A;  3PUS A;  5HWY A;  4WZX A;  2C5K T;  1BR1 A;  4HWH A;  4DV4 T;  1KNR A;  3LK4 2;  5HEJ A;  2JQ9 A;  4Z90 A;  3RH3 A;  4LF8 T;  3A7M A;  4YSY A;  5FXV A;  2X9X A;  1HX1 B;  3MKD A;  3A5X A;  2N9D A;  2WDQ A;  2WDR A;  4IDP A;  4JI3 T;  4DMV A;  4FJO A;  4H9N C;  4K0K T;  1KK7 A;  4JV5 T;  3AE1 A;  5JDN A;  2G0U A;  2BS3 A;  4JI1 T;  1LVF A;  5J2T E;  4DV5 T;  1NEK A;  2Q9Q C;  4IE5 A;  3DTO A;  1N32 T;  4F6R C;  3F57 A;  5HWX A;  3NRX A;  3C50 A;  2JQQ A;  3VKH A;  4UIG A;  2YDR A;  2VVN A;  5AFU L;  4H9R C;  3A8Y C;  3T1H T;  4YSZ A;  4HWF A;  2E5L T;  5JRC B;  1OED B;  3V5U A;  3UU3 A;  2BKN A;  1UUS A;  2DLR A;  1IJ6 A;  1D0X A;  3CKD A;  3C4W A;  4ISS A;  4X64 T;  1MIW A;  4GYR A;  3N2K E;  4GOU A;  3RYC E;  3HI2 A;  2WZH A;  1YKH B;  2V7K A;  5DQV A;  3AE9 A;  3TKL B;  5JH7 E;  1YW0 A;  4PK6 A;  3UUL A;  3DJB A;  3P4P A;  2IHR 1;  4IDQ A;  5AQT B;  3AE2 A;  3C98 B;  5E0O A;  2CXL A;  2YDQ A;  5L4E A;  3E0Z A;  3UU8 A;  2HPJ A;  4DR5 T;  2CLY B;  2XTL A;  2QA7 A;  2ZM2 A;  2X68 A;  5FXZ A;  1VOM A;  4DR4 T;  2I6H A;  3AA1 B;  3ZMU B;  2Z6E A;  4JI6 T;  1MND A;  2CA5 A;  2MBG A;  5JDF A;  1HF8 A;  1YD8 G;  4DBQ A;  1OED E;  2NWB A;  5EK2 A;  4OYJ A;  4HWD A;  3OBV E;  4TZ4 C;  5J2U E;  4X20 E;  1ZHC A;  1FMW A;  2VKD A;  2WP9 A;  2KLQ A;  4B3M T;  3CQX C;  3AA0 B;  4YLH A;  3P4R A;  2EHO D;  4OHF A;  3X1D A;  2UUC T;  3KV6 A;  4QKN A;  2IC9 A;  2BG9 A;  3AXJ A;  4YHH T;  1LVK A;  1QLB A;  4OX9 T;  3PUX F;  5TAO A;  1U5P A;  5C8Y E;  2XQY A;  3AVR A;  4TNW A;  5AQH B;  4ZI3 D;  2VK9 A;  4MHC A;  2JMK A;  3BQI A;  2LT3 A;  4ERR A;  3ZT5 A;  5FVK A;  2AXD S;  5A1L A;  3QNU A;  1WR6 A;  1FJG T;  2JJ9 A;  3ZYL A;  4JYA T;  2E9X A;  5AQO B;  3IA3 A;  4DUY T;  2ZM0 A;  3SS1 A;  3K3N A;  2ACX A;  2VAS A;  5DJQ C;  3GN5 A;  4I0U A;  4AXP A;  2RPA A;  2QYW A;  3AEF A;  3AE6 A;  5AQS B;  1BR0 A;  4TX5 A;  5DQW A;  4IL4 A;  1NEN A;  3PUG A;  4AIS A;  3AVS A;  3RKG A;  4JEH B;  4EZH A;  2BBH A;  2PJQ A;  5AQF B;  4JLE A;  3JAE A;  3RQW A;  3I9Y A;  4GYS A;  2CMR A;  5AQG B;  5CA1 E;  2WMN A;  3N9Q A;  1HR0 T;  2XY8 B;  4HFI A;  1KFY A;  3F31 A;  1Z8U A;  3KVA A;  4WBO A;  2HPL A;  3ZLI A;  4ILC A;  3Q5W A;  1GQE A;  3ZCI A;  4EYU A;  4GKJ T;  5F5W A;  2C5I T;  2CBJ A;  1WYC A;  5CGM A;  2DNX A;  3BQL A;  2ES0 A;  2X51 A;  2Q9Q A;  4MAL A;  5J1G A;  3AA6 B;  4EIW A;  5KXJ A;  2CPT A;  1W0A A;  3LSV A;  2B76 A;  5JTG A;  1X9B A;  4AQF C;  5HCM A;  3KIN B;  2H3R A;  3VHL A;  2WZI A;  5FMN A;  4QH5 A;  2N1G A;  4LF4 T;  4V1A v;  2C0S A;  2BG9 E;  4PAG A;  3HKC E;  4QWN B;  4YJ2 E;  5IHY A;  1WLX A;  3Q5X A;  2VKH A;  4ZXL A;  3QOF A;  3RYI E;  3CWZ B;  3CML A;  2CLY C;  3RIU C;  5FXX A;  2VKJ A;  5AQM B;  3PU3 A;  1DU2 A;  3UUX B;  3UUB A;  3I9W A;  1ZEE A;  4IHJ E;  4HWC A;  3HKE E;  3B5M A;  4EEB A;  4HFB A;  4B3S T;  3ZC1 A;  2XAJ B;  3NZP A;  3AEB A;  4NXN T;  2BKP A;  4EOZ B;  5AQU B;  2ZM6 T;  2CEA A;  3MJX A;  3Q2M A;  4DR3 T;  2CE7 A;  4U74 A;  3L3P A;  1MNE A;  4NXM T;  4U7I A;  2DL1 A;  1V9D A;  3N2G E;  3AED A;  1IBK T;  2UXB T;  2XQ9 A;  4KMC A;  4QX8 B;  2CRB A;  1E7P A;  3N5L A;  4HWI B;  5ABF B;  4P1N A;  2UXN B;  3FB2 A;  5HYA A;  2DWG A;  3RYF E;  3N9O A;  2MYS A;  3AEC A;  2V7M A;  2KZ7 B;  2V6X A;  3PUV F;  1MMG A;  5JDM A;  5JDH A;  2L8K A;  1J5E T;  3ZKR A;  2DWK A;  4I50 E;  3U3I A;  2VQF T;  2HH7 A;  2QRX A;  3NZQ A;  1H7C A;  2Y6X A;  2E9X D;  2LSJ A;  4AI6 A;  3OYX A;  4E7Z A;  3AEE A;  2D2S A;  4QX7 B;  3G06 A;  3OKQ A;  3MZK B;  3ZJ1 A;  2ACZ A;  3TLW A;  4O4J E;  3RIF A;  2GK9 A;  1I6Z A;  4UF0 B;  1WCR A;  2JQH A;  3P8C D;  3KV9 A;  2XSB A;  4YY3 T;  3NWI A;  2PG8 A;  3ZYM A;  3KV4 A;  1YKE B;  3AAE B;  3LK2 B;  5DAB A;  3NKZ A;  3ETV A;  4LF9 T;  4IE4 A;  4MLK A;  4IDN A;  5AQL B;  4QXB B;  2LRK A;  4IDO A;  4CXY A;  1HG5 A;  2R6G F;  2C5J A;  2XHE B;  2AE9 A;  5F8P A;  3UUN A;  5JR9 B;  2IAK A;  2OV9 A;  2L9Q A;  2N2N A;  2V26 A;  1US7 B;  4X1I E;  4AKL A;  1QUU A;  2A9U A;  5LJM A;  3PUR A;  1UCU A;  2H7O A;  4F8H A;  4JBW F;  5KMG P;  1HNW T;  4JI0 T;  4JI7 T;  3ZN1 B;  4ZS2 A;  1S94 A;  4PK5 A;  2W2U A;  2D0U A;  3C51 A;  3ZJ2 A;  5L3B B;  3QB5 A;  3P4Q A;  3OYZ A;  2NP9 A;  3PJA J;  4PNI A;  4GKK T;  2LM2 A;  1NWM X;  1OED A;  5HXH A;  3ONL C;  4KX6 A;  2H7V C;  2BBJ A;  4Q25 A;  3C4X A;  2V6Y B;  3AE7 A;  4HEA A;  1UUR A;  2XAF B;  4HFV A;  3HKB E;  4U7Y A;  4U31 A;  4CQI A;  4I43 B;  4EYY R;  4U2Z A;  1T7S A;  4WNK A;  2DHR A;  5KX5 E;  4XAX B;  4TWH A;  4YTM A;  3Q9D A;  4I4T E;  5JDG A;  1HNZ T;  2V5C A;  3UQ7 A;  3EHZ A;  3CX8 B;  2LKH A;  1YQ4 A;  2JMH A;  4OFZ A;  1W9R A;  1E2A A;  3QC9 A;  3L8R A;  5FY0 A;  2LLY A;  5LBQ B;  3OVU A;  4YJ3 E;  3PUQ A;  4JUY A;  2WU5 A;  4AKI A;  4KHZ F;  2WMO A;  2NTY A;  3RQU A;  4DBR A;  3AB3 B;  1OXZ A;  5LBM A;  3D0T A;  2J4G A;  3B13 A;  3VR8 A;  4LML A;  2KMF A;  4ZZC A;  4ZOL E;  1CUN A;  3U78 A;  1OWA A;  4B6X A;  2BVM A;  4QH1 A;  5M4Y A;  5LNK A;  2LSI A;  1UK5 A;  5HAX A;  3P7I A;  3LJC A;  1SE7 A;  2IW5 B;  4ZI7 E;  1D0Y A;  4U33 A;  3AEG A;  4PW8 A;  4ZI2 D;  1ZKE A;  5FYM A;  4UV8 B;  3AEA A;  2ZM8 A;  3NRY A;  4UVC B;  5L2L A;  3RX6 A;  2XQ6 A;  2YEV C;  4EB6 E;  5L3G B;  4U3C A;  1EZ3 A;  2DI4 A;  2X9W A;  4TWD A;  4NIQ A;  3KDS E;  3ZC0 A;  2PTF A;  3LK3 B;  3TLS A;  5L3C B;  4EZ4 A;  2FJD A;  2JIW A;  4PJJ A;  1HX8 A;  2LHN A;  4HKA A;  4DVD A;  4H9Q C;  1KNZ A;  4LF6 T;  3K3O A;  4CI3 B;  3ZT6 A;  2D5U A;  2XZE A;  4HFH A;  3VR9 A;  2LSG A;  2X66 A;  4JI4 T;  3M3Z B;  4HFE A;  3FZK B;  2LOS A;  3Q5E A;  2F4V T;  5AQN B;  4ANJ A;  1T72 A;  2CWO A;  5JR9 C;  2A72 A;  2WCA A;  2B1E A;  3RPU A;  2NW8 A;  3PTR B;  5L3D B;  3TLU A;  2K48 A;  4I55 E;  4DV7 T;  2J62 A;  3UU5 A;  2YDS A;  2K24 A;  2V1D B;  3P50 A;  3H3M A;  2LEH A;  3EI0 A;  3AAI A;  4YXD A;  2JPF A;  3L09 A;  2UUA T;  2KXP B;  5F3J A;  3GWH A;  2XAS B;  5EZY E;  3L39 A;  2QGS A;  3BK9 A;  2CXF A;  1YXR A;  4CXX A;  3O1H A;  4EED A;  4L9I A;  4HGA A;  3OTO T;  5JVD E;  4TWF A;  2P9B A;  5H6Q B;  2KWH A;  3C64 A;  2WY2 A;  1D0Z A;  2L3L A;  1ZP0 A;  5ABG A;  2EHO C;  2LE8 A;  2ODV A;  4IST A;  5IUX A;  2VB6 A;  4BJM A;  1XNQ T;  2ZLY A;  5FVL A;  4ZI3 C;  5FY7 A;  4CXW A;  2XAH B;  3UFE A;  5C3J A;  4KBM B;  3RYH E;  2LRL A;  3OJA A;  2V7J A;  2XM1 A;  2YU1 A;  3HL6 A;  2UU9 T;  3MXZ A;  5FL0 A;  3CX7 B;  5JDQ A;  1MMN A;  3M65 A;  2E9X B;  4DUZ T;  2FJE A;  2YN6 A;  4OK0 A;  2NW9 A;  4G63 A;  3JC6 D;  5LJN A;  2ODU A;  4O4L E;  1IZN B;  4A5X A;  4UVB B;  1HFA A;  2X0Y A;  2BKO A;  2J1D G;  2YIN A;  2PFV A;  5L3F B;  2VL0 A;  3RIA A;  5AQR B;  5LMN T;  5IWA T;  2LKG A;  2LOP A;  3KVB A;  4DV2 T;  2WDV A;  5HXR A;  4LMJ A;  2WAU A;  4HTE A;  4LFB T;  4TUY E;  5ADX L;  3GA8 A;  2VL8 A;  3UUM A;  5HXC A;  3MAC A;  3T1Y T;  3IF8 B;  1SHZ C;  4E7S A;  1N33 T;  4U2Y A;  3DP7 A;  5L4H A;  1G8X A;  3ONJ A;  3RC3 A;  5AQQ B;  2BDE A;  2SPC A;  4QHO A;  4JI5 T;  3EAB A;  4NUU A;  3P4W A;  3CQC B;  4A97 A;  1J5W A;  3QK6 A; 
#chains in the Genus database with same CATH homology
 1YW0 A;  5LGN B;  4PK6 A;  4DND A;  3ZMZ B;  3UUL A;  3DJB A;  3AA7 B;  3CQG B;  3GMI A;  5LJM A;  3ONX A;  3PUR A;  1UCU A;  2H7O A;  5BMV E;  5KMG P;  1D1A A;  4J2C A;  3T8O A;  3C98 B;  5E0O A;  3ZN1 B;  3O1I A;  4ZS2 A;  4PK4 A;  1S94 A;  3AAA B;  4PK5 A;  2CXL A;  4GIW A;  4KUM B;  2X9Y A;  3C51 A;  2D0U A;  3ZJ2 A;  3E0Z A;  5L3B B;  2HPJ A;  3B57 A;  2CXD A;  2X67 A;  3O4X E;  3OYZ A;  2CLY B;  2XTL A;  2NP9 A;  3R6N A;  3SOL A;  2QA7 A;  4IIJ E;  3RKO A;  2ZM2 A;  3R84 B;  2NW7 A;  2X68 A;  4PNI A;  3HR0 A;  4UF0 A;  5FXZ A;  1NWM X;  1VOM A;  5HXH A;  3AA1 B;  3ZMU B;  2RP4 A;  2Z6E A;  1MND A;  2CA5 A;  2MBG A;  3ZCJ A;  2A2F X;  2H7V C;  2K9A A;  5JDF A;  2UXX B;  3VU7 H;  1HF8 A;  1YD8 G;  4YFS A;  2E8I A;  2WM9 A;  3GN5 B;  4DBQ A;  1HS7 A;  3C4X A;  5JQG E;  3ZMS B;  4HEA A;  3WAK A;  1U4Q A;  3LG7 A;  2XAF B;  4HFV A;  2NWB A;  3HKB E;  4X1K E;  3I0O A;  4UXN B;  5EK2 A;  3FBZ A;  4OYJ A;  3OBV E;  4TZ4 C;  3ZMT B;  4TV9 E;  5J2U E;  4X20 E;  2LM9 A;  3SWH A;  1ZHC A;  1FMW A;  2VKD A;  1FEW A;  4P09 A;  5EK4 A;  2KLQ A;  4CQI A;  1UX5 A;  2KIN B;  1D1B A;  4IE7 A;  4I43 B;  3ZMV B;  1HCI A;  1MMD A;  4CI2 B;  4UEL A;  4EYY R;  4EAH A;  4WNK A;  3J7Y q;  2LJL A;  4Z8X A;  3CQX C;  2DHR A;  5JR9 A;  5CB4 E;  3AA0 B;  4YLH A;  4WW0 A;  4XAX B;  5KX5 E;  3ZEF B;  3Q9D A;  4C90 A;  4I4T E;  2EHO D;  4OHF A;  4QXH B;  5JDG A;  1G73 A;  3H3A A;  3KV6 A;  4QKN A;  5ETW A;  2WWU A;  1ZV4 X;  4FI5 A;  2IC9 A;  3CX8 B;  3NBX X;  3HKD E;  2JMH A;  5H6R B;  2WBL A;  4OFZ A;  3QC9 A;  1LVK A;  5FY0 A;  3W15 B;  4KP3 C;  1UX4 A;  3CPZ A;  4L0R A;  4MFR A;  4PJN A;  4UV9 B;  5LBQ B;  5TAO A;  4XBF B;  1U5P A;  5C8Y E;  2XQY A;  3AVR A;  3RRC A;  4IE6 A;  3KV5 A;  1WRD A;  4YJ3 E;  4ZI3 D;  3PUQ A;  3ETU A;  2K5B B;  4JUY A;  2VK9 A;  1B7T A;  4MHC A;  2JMK A;  3BQI A;  2LT3 A;  4UEM A;  4ERR A;  4AKI A;  2WMO A;  3JC6 C;  4BA9 A;  2NTY A;  3K3Q C;  3KBT A;  5LCY A;  3RC8 A;  4DBR A;  2W0G A;  1FMV A;  5A1L A;  3LFM A;  3AB3 B;  1OXZ A;  5LBM A;  3D0T A;  4HN9 A;  1WR6 A;  2JJ9 A;  2MTQ A;  2Y48 B;  3ZYL A;  3B13 A;  3MA9 A;  1HTJ F;  2A3D A;  2E9X A;  1SA0 E;  4O4I E;  1LRZ A;  2KMF A;  5FP3 A;  2E9X C;  2ZM0 A;  4ZOL E;  1CUN A;  3SS1 A;  3K3N A;  4IDZ A;  2ACX A;  1QSD A;  3U78 A;  2Q9Q B;  1OWA A;  1E1H B;  2VAS A;  5DJQ C;  3GN5 A;  4B6X A;  2BVM A;  3BQK A;  5M4Y A;  2ZMA A;  4TV8 E;  5LNK A;  4IE0 A;  4AXP A;  2NOX A;  2LSI A;  4IGU A;  1VRB A;  1O3X A;  5HAX A;  3P7I A;  1BR0 A;  3LJC A;  1FIO A;  4TX5 A;  5DQW A;  4H63 V;  3S4U A;  2IW5 B;  4A56 A;  4ZI7 E;  1D0Y A;  3IEE A;  3PUG A;  4AKH A;  4AKG A;  3AVS A;  4ILU A;  4PW8 A;  4JEH B;  1BR2 A;  2KND A;  4O4H E;  4X1Y E;  4ZI2 D;  4EZH A;  1ZKE A;  5FYM A;  2Q9Q D;  1IJ5 A;  4UV8 B;  5HXE A;  2M67 A;  2PJQ A;  5LHH B;  4UVC B;  2ZM8 A;  3NRY A;  5FY1 A;  4JLE A;  5L2L A;  3EDV A;  3RX6 A;  4BAY B;  2V7I A;  2YEV C;  4O2A E;  4EB6 E;  3HA4 A;  3I9Y A;  5L3G B;  4GYS A;  1EZ3 A;  2DI4 A;  2X9W A;  1IAP A;  2CMR A;  5CA1 E;  2LSY A;  4BJN A;  5JRC A;  3J9X 1;  2WMN A;  1MMA A;  3KDS E;  3N9Q A;  5JRE A;  3ZC0 A;  4JEU B;  5CA0 E;  3LK3 B;  3F31 A;  4CZZ B;  3KVA A;  5L3C B;  4EZ4 A;  4G2A A;  3ANW B;  2CWY A;  2D0T A;  4PJJ A;  4WBO A;  5IYZ E;  1HX8 A;  2LHN A;  5LA6 E;  3H37 A;  3I1A A;  4HKA A;  4DVD A;  2HPL A;  4H9Q C;  4C91 A;  3WAJ A;  1KNZ A;  5LGT B;  3EUH A;  3ZLI A;  3K3O A;  4CI3 B;  2X0L B;  2LHR A;  3Q5W A;  3SRZ A;  2D5U A;  3UTK A;  3PDY A;  3ZCI A;  4EYU A;  4AQG A;  2I59 A;  2EHO B;  2XAG B;  2LSG A;  3VKG A;  2X66 A;  4GK5 E;  4DMW A;  1HG2 A;  4PFO A;  2LOS A;  2IC6 A;  2W61 A;  5EK3 A;  2C5I T;  3LBX B;  2KWI B;  4PJL A;  3ZN0 B;  5LXT E;  3IBP A;  3ESL A;  4ANJ A;  5LG4 A;  4PFP A;  1WYC A;  1MIV A;  3N9L A;  1LKX A;  3UT5 E;  4ZHQ E;  5LYJ E;  2CWO A;  2DNX A;  3BQL A;  5L3E B;  2ES0 A;  2X51 A;  2Q9Q A;  4N78 D;  4MAL A;  5J1G A;  3AA6 B;  4EIW A;  5JR9 C;  1T98 A;  2A72 A;  2VKO A;  2B1E A;  3N2O A;  4HE8 A;  4AQF A;  4AQF C;  3RPU A;  2NW8 A;  4EXT A;  3PTR B;  5L3D B;  1Z0P A;  3KIN B;  2H3R A;  3VHL A;  2K48 A;  4I55 E;  5FMN A;  1D1C A;  2Y8D A;  4K0U A;  4XZC A;  3N9M A;  2N1G A;  2K24 A;  4MBQ A;  4V1A v;  2C0S A;  3WI3 A;  2V1D B;  5LGU B;  4PAG A;  3O9X A;  3HKC E;  4O8S A;  4QWN B;  2LEH A;  4YJ2 E;  5IHY A;  2KT9 A;  1WLX A;  3Q5X A;  4WBN E;  3AAI A;  2VKH A;  2JPF A;  3L09 A;  4M1P A;  3RYI E;  2BVL A;  2KXP B;  5FXW A;  5F3J A;  5LHI B;  3GWH A;  2XAS B;  3CWZ B;  3CML A;  5EZY E;  4H63 H;  2CLY C;  4H9P C;  3FHN A;  2QGS A;  3FXD B;  5FXX A;  2VKJ A;  3BK9 A;  2CXF A;  1BR4 A;  3PU3 A;  4CXX A;  3O1H A;  4ASK A;  3UUX B;  3I9W A;  1ZEE A;  3KBU A;  4L9I A;  4HGA A;  4IHJ E;  3HKE E;  3F2E A;  5JVD E;  4P0B A;  1WYB A;  3ANW A;  3ZC1 A;  4L5G A;  2P9B A;  3EVY A;  2KWH A;  2XAJ B;  4ZS3 A;  5H6Q B;  4ADZ A;  3NZP A;  4NUV A;  2CM0 A;  3C64 A;  2JRK A;  5LHG B;  1D0Z A;  3V5S A;  3MK7 C;  2L3L A;  4PJM A;  4H9O C;  2DCF A;  2RA1 A;  2EHO A;  2W00 A;  3PUA A;  2EHO C;  2LE8 A;  2ODV A;  4EOZ B;  5KDM C;  4IST A;  2VB6 A;  1AJ3 A;  3LBX A;  3PE0 A;  4BJM A;  2PBI A;  2YU2 A;  2BZB A;  2CEA A;  3MJX A;  3Q2M A;  5LOV E;  2CE7 A;  2ZLY A;  4U74 A;  3L3P A;  2V7L A;  3PUS A;  5HWY A;  1MNE A;  4AKR B;  2C5K T;  1BR1 A;  2YK0 A;  3KFW X;  1V9D A;  3N2G E;  4ZI3 C;  5FY7 A;  4CXW A;  2VWA A;  2XAH B;  4KMC A;  3LK4 2;  4QX8 B;  3UFE A;  3QUJ A;  4KBM B;  3RYH E;  3N5L A;  4O2B E;  3RH3 A;  3OJA A;  2V7J A;  4CI1 B;  2XUE A;  2YU1 A;  3FXE B;  3HL6 A;  3MXZ A;  5FXV A;  2UXN B;  3FB2 A;  2X9X A;  5HYA A;  3MKD A;  2DWG A;  3A5X A;  2N9D A;  1X79 A;  3N9P A;  2MYS A;  3N9O A;  3RYF E;  4DMV A;  2V7M A;  2W63 A;  3CX7 B;  4FJO A;  5JDQ A;  3ZPO A;  1MMN A;  2OA5 A;  2KZ7 B;  4P0A A;  3M65 A;  1MMG A;  5JDM A;  2E9X B;  4H9N C;  5JDH A;  4OYK A;  1KK7 A;  2W62 A;  2L8K A;  4OK0 A;  2NW9 A;  2DWK A;  4I50 E;  4G63 A;  3JC6 D;  5JDN A;  2G0U A;  3U3I A;  5LJN A;  2ODU A;  4O4L E;  1IZN B;  4UVB B;  1LVF A;  5JDL A;  1HFA A;  1Y64 B;  2HH7 A;  4ZI2 C;  5J2T E;  3PU8 A;  4IE5 A;  2Q9Q C;  4GK0 E;  3NZQ A;  1H7C A;  2Y6X A;  3DTO A;  4DO0 A;  2E9X D;  2J1D G;  4F6R C;  3O1J A;  2MOZ A;  2YIN A;  2PFV A;  5L3F B;  2LSJ A;  5GON E;  3F57 A;  5HWX A;  3NRX A;  2NTX A;  4H9S E;  4AI6 A;  4QXC B;  3C50 A;  3OYX A;  4E7Z A;  3I0Q A;  2D2S A;  2JQQ A;  3E08 A;  2XAQ B;  2LOP A;  3KVB A;  3VKH A;  4QX7 B;  3ZYK A;  3K8P C;  5HXR A;  3CX6 B;  4UIG A;  3OKQ A;  3MZK B;  4H9R C;  3ZJ1 A;  2X9H A;  1S35 A;  5AFU L;  2WAU A;  4HTE A;  4O4J E;  1MIY A;  5LP6 E;  3CVR A;  2GK9 A;  5JRC B;  3C4Z A;  4UF0 B;  3P8C D;  4TUY E;  3KV9 A;  3V5U A;  3EDU A;  4YHJ A;  5ADX L;  4UVA B;  1NAF A;  3GA8 A;  2VL8 A;  2PG8 A;  3UUM A;  2DLR A;  3ZYM A;  1IJ6 A;  5HXC A;  1D0X A;  3MAC A;  3KV4 A;  1YKE B;  3CKD A;  3AAE B;  3IF8 B;  1SHZ C;  3C4W A;  3LK2 B;  5FNV E;  5DAB A;  4ISS A;  4E7S A;  3ETV A;  3IHR A;  4IE4 A;  1MIW A;  3E22 E;  3DP7 A;  4MLK A;  2LSK A;  1G8X A;  4GYR A;  3N2K E;  4QXB B;  3RC3 A;  2BDE A;  4GOU A;  3RYC E;  2SPC A;  4QHO A;  4CXY A;  1HG5 A;  3N9N A;  2C5J A;  3HI2 A;  2XHE B;  2WSS V;  4NUU A;  5F8P A;  1YKH B;  2V7K A;  4TN7 B;  3UUN A;  2IAK A;  5JR9 B;  3FBL A;  5DQV A;  2CCQ A;  2L9Q A;  2N2N A;  2V26 A;  1US7 B;  3CQC B;  3TKL B;  4X1I E;  4AKL A;  4U72 A;  3RRW A;  5HXS A;  5JH7 E;  1QUU A;  3QK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...