5H6RB

Crystal structure of lsd1-corest in complex with peptide 13
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
KPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/transcription/inhibitor
molecule keywords Lysine-specific histone demethylase 1A
publication title Development and crystallographic evaluation of histone H3 peptide with N-terminal serine substitution as a potent inhibitor of lysine-specific demethylase 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2016-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5h6rB00
2Y48B 5LBQB 5L3EB 2XAGB 5LGNB 3ZMSB 3ZMUB 4UV9B 2UXNB 4UVBB 2X0LB 3ZN1B 5LHHB 2XAJB 4CZZB 5H6QB 2XAFB 5LHGB 5L3FB 2XAHB 2XASB 3ZN0B 5L3GB 4UVAB 5L3CB 5L3BB 2IW5B 4UVCB 5L3DB 4BAYB 5LHIB 2V1DB 2UXXB 2XAQB 4XBFB 3ZMTB 5H6RB 4UXNB 5LGTB 4KUMB 3ZMVB 4UV8B 3ZMZB 5LGUB
chains in the Genus database with same CATH superfamily
3HKBE 1HNWT 3AAIA 3NBXX 3GN5A 2R6GF 4HWDA 4QXCB 2YKSA 4DV1T 2JQHA 3ZMTB 4AQYT 3RYIE 2JIWA 3AA7B 3PUAA 3A8YC 3D0TA 4OYKA 3S4UA 4LF6T 2WMOA 3C4XA 2VKHA 2L3LA 3Q5XA 3KBUA 5AQPB 3F57A 3FXDB 3F31A 3FXEB 3C51A 2W62A 3N2GE 2J1DG 5LJMA 2YOEA 4QX8B 3HKCE 4DV4T 3L39A 3C98B 1S35A 5F3JA 4MFRA 2M6BA 5BR8T 2VASA 3PDYA 1UURA 4WZXA 4U72A 4NXMT 5FMNA 3ONXA 3ZSSA 3RIUA 2D5UA 4DV7T 3ZJ1A 2CXDA 4EV6A 2CM0A 4I0UA 4YJ3E 2K48A 3LK42 3L09A 3LBXA 4ZZBA 2LRKA 3GN5B 4AKLA 4KX6A 2PG8A 2WZHA 4PW8A 3P8CD 2FJDA 3ZC0A 2KINB 4JEHB 2XQAA 1HNZT 5FKYA 3RQUA 1E2AA 4LMLA 4AKRB 3IF8B 4KBMB 4AQGA 2ODUA 2LOPA 2CA5A 4GK0E 3AEGA 2DL1A 3ZC1A 5L3FB 3LK3B 3GMIA 5JDGA 4YHHT 2YEVC 3E0ZA 2NP9A 5IUXA 3RGLA 2E9XD 2XQ6A 2WDRA 3O4XE 4TUYE 5F5WA 1L0VA 2XPKA 2XAFB 3KDSE 5AQRB 4U2ZA 2FJAA 1FJGT 4JBWF 3VKGA 1XWMA 4JI5T 2KNDA 4MALA 3EDUA 5IHYA 1MMGA 5LXTE 1YKEB 3R84B 4YXDA 4TWFA 4X1KE 3SFEA 3MXZA 3I9WA 3O1HA 3U3IA 2X0LB 3LBXB 3N9LA 3KVBA 2V8SV 3IEEA 3N9OA 4K0KT 2YDRA 4LF5T 2CXFA 5L4HA 2XHEB 2RP4A 2K9AA 3OPCA 1HS7A 4JI6T 3N2KE 2VWAA 2FUPA 1MIYA 1Z8UA 1JNZA 2ZM8A 4L0RA 2Q9QC 2XM1A 4LMKA 1W0BA 4AQFA 1IBLT 4IDZA 2V6YA 4LFBT 2VKDA 4TV8E 3B13A 4ZHQE 5FXVA 5AQQB 3ESLA 5LG3A 5J0ZA 2DWGA 3AXJB 2CRBA 3EAMA 4P09A 1BR1A 1OEDE 2LM2A 2XSBA 2BBJA 3PUGA 2LM9A 5DJQC 3V5SA 5LYJE 2IW5B 4DR2T 1KNRA 3PTRB 4IDNA 4O4JE 3CVRA 3ZMZB 1VCSA 2WP9A 2HN2A 3AA1B 2NTYA 3ZYKA 2MTQA 3PU3A 4QWNB 4L5GA 1GQEA 3RI5A 1YXRA 3EI0A 1HR0T 5AQSB 4B3ST 3K3NA 1D1CA 2WWVA 4O4HE 2ZMAA 4KMCA 3L3PA 3AE6A 5H6QB 2BKPA 3EUHA 1W9RA 4ILBA 4ILCA 5HXRA 1IZNB 2MAWA 3ZPOA 3OBVE 2LHRA 4H9NC 2CXLA 1E1HB 4WNKA 4E7ZA 4WYVA 3EVYA 3BQLA 2A72A 3ANWA 3AVSA 3NRYA 3KVAA 3AEEA 2LE8A 4ADZA 2V6YB 1ZV4X 4NUUA 1BR2A 5JR9C 5EK4A 2WY2A 3NWIA 3RKGA 3QK6A 5LHHB 1LVFA 2C0SA 2VK9A 2W67A 4X20E 2UXXB 1UCUA 3U78A 4O8SA 3H3MA 4DVDA 4IDOA 2SPCA 4ZS3A 2XAJB 3JCFA 3BK9A 3EDVA 2FJEA 4H9QC 4YT0A 2LOSA 2DLRA 2VKOA 4H9RC 3ZMVB 4AKGA 3ZEFB 1FEWA 2Y48B 4YY3T 3JAFA 4JUYA 1AJ3A 1MNEA 4HEAA 1QLBA 3CKDA 2E5LT 2LHNA 2X66A 2UXCT 3RC8A 2C5JA 3ANWB 1NAFA 5FXXA 2IHR1 3AE8A 3OVUA 2JQ9A 2CHOA 2M67A 3HI2A 4HFIA 4ZI3D 3AE9A 5LHIB 1UX5A 5IWAT 4ILUA 5KX5E 4HKAA 2X67A 3HA4A 3BQIA 4XAXB 3ZMUB 4X65T 4PJLA 2V7LA 2FJBA 3TKLB 5LA6E 5JQGE 3ZCIA 3ZKRA 1WR6A 2ACZA 5LGTB 4WBNE 1I6ZA 3OJAA 2XY8B 3I0QA 4DR4T 2Y6XA 3RIFA 3X1DA 4U2YA 5HCJA 4O2BE 3Q5WA 5KMGP 3ABVA 1OEDC 1MIVA 2WU2A 2LSKA 2OLTA 2XJ7A 1J5WA 3HKEE 4GYRA 3M3ZB 3AA0B 2X51A 5AQTB 4CZZB 3MZKB 5HCMA 1D0YA 2KT9A 3TLTA 1HX1B 3UFGA 2LLYA 2UUBT 4DBQA 4BJNA 2F4VT 3SRZA 3FZHB 4JI3T 4GKKT 2GK9A 2EHOB 3PUYF 3EHZA 2MBGA 3LG7A 1Y01A 5J2UE 2XSAA 2V26A 2PFVA 3ZCJA 4HWFA 4DR7T 2H7VC 4XBFB 3AE5A 4B3RT 3RX6A 4LFAT 3ZT5A 3QC9A 2BG9B 5A1LA 2IC6A 3UT5E 3P4PA 1B7TA 1KK7A 5HWYA 3RLFF 2DCFA 3SWHA 4IIJE 3AB3B 5HXCA 2LSGA 1WR0A 4LF8T 4IE5A 5FVLA 3G06A 1HG5A 1FMVA 4B3TT 5CFBA 4Z91A 2NR4A 5ABHA 1LRZA 2LKHA 3N5LA 1W09A 5C8YE 3SS1A 4UEMA 3FZFB 4XZCA 2ZM2A 4P0BA 2CEAA 4JI8T 4E7SA 4PAGA 4FI5A 5FVKA 2PTFA 2JRKA 1UK5A 2AE9A 2BZBA 4ZZCA 5JDHA 2H89A 2BKNA 4IE0A 3VRBA 4UVAB 4O4IE 2VQET 4J2CA 1SUMB 2K24A 4JI7T 1N33T 3VRAA 3ETUA 5KXJA 2CBIA 2Q9QA 1XNRT 3C64A 3KV9A 5EK3A 3JAEA 2UU9T 4HWHA 2KLQA 1T7SA 2CLYB 1JNRA 1X79A 2E2AA 3PE0A 4CN4A 3RC3A 4PJJA 5HEHA 3UU5A 2X9WA 2V7KA 3MJXA 5EK2A 4DV6T 1SA0E 2BS2A 2HN1A 5L2LA 3N9PA 4EOZB 3Q5DA 1CUNA 4IL9A 4ZS2A 4H63H 4BAYB 2BVMA 4NPPA 1HCIA 2E8IA 5CA0E 4HTEA 1NWMX 3PU8A 4U7IA 3NZPA 3P4QA 1YW0A 1G8XA 4QHOA 4DV5T 1U4QA 4ISSA 4HFHA 1CHUA 2OA5A 4O2AE 4H9PC 2XAHB 3PJAJ 4C91A 3C4ZA 5AQLB 5KDMC 2J62A 2XZEA 1NEKA 3PV0F 4YTPA 3AVRA 2QA7A 3I1AA 5CJ5A 2D0UA 4DR5T 5L3DB 3PUXF 5L47A 3KINB 3PURA 2VVSA 4TNWA 5FNVE 2Q9QB 4JI0T 1YQ4A 4BJMA 3NVOA 5HYAA 1WLXA 2NWBA 3CPZA 5JR9A 2MOZA 4IE6A 4LMJA 2YDSA 4P1NA 4CN6A 2W0GA 2DHRA 3J7Yq 4EB6E 3OYXA 1MNDA 4GYSA 3V5UA 1ZP0A 3ZT7A 3UUXB 3N9NA 3RRWA 4EXTA 1BR4A 3T1HT 3LK2B 2D2SA 4AXPA 4PNIA 1FMWA 1HF8A 4HWIB 2L8KA 4Z90A 5E0OA 2ODVA 3DJBA 2AXDS 2FBWA 4ZEYA 3P4SA 5LCYA 4QX7B 3UTKA 4UV9B 2E9XC 4HFVA 3UUNA 3AEFA 4PK4A 2I6HA 3PUVF 3VR9A 3E08A 5LGUB 3UULA 4ISTA 3WAJA 2WM9A 4A5XA 2Z6EA 4WW0A 3J9X1 4DMVA 5LNKA 4I4TE 3RYHE 2WMNA 2H7OA 4PK5A 5BMVE 3PUSA 3AE1A 2CHNA 3FZLB 2W61A 4TWDA 4DNDA 2VKJA 4UF0A 3MK7C 5LP6E 2XAGB 1WYBA 3NZQA 3ONLC 5ABEA 4U3CA 2A9UA 3UU3A 1VRBA 4YFSA 2V6XA 2I59A 2N1GA 4OHFA 5AQMB 4GOUA 2ZM0A 3B5MA 3P50A 2XQ7A 5LBQB 1SE7A 2XQYA 2BS4A 3FBZA 4WBOA 4ASKA 2MPKA 2D0TA 4NIQA 1US7B 4HFDA 2DNXA 3KV6A 3MKDA 5HEJA 2BBHA 5AQGB 4AKIA 2VL0A 2WS3A 2CE7A 1OEDA 3UQ4A 2JPFA 4PJMA 5LOVE 2XQ3A 2WBLA 1IJ5A 4IE4A 4IDPA 2X9YA 4A56A 3N2OA 4DR1T 2DWKA 4DUZT 4HFBA 1D1BA 2J4GA 4YSZA 3AE7A 3FZMB 3TLSA 1XMQT 1Z0PA 3AA6B 3VU7H 4JI2T 2RA1A 5CB4E 3P7IA 5JRCA 4HWCA 3NRXA 1J5ET 5FXZA 4KP3C 5AQOB 2BG9E 3JC6D 5J1GA 4HE8A 3BQKA 5C2TA 3UUBA 4EEDA 3OTOT 3O9XA 4EGWA 2WSSV 5J2TE 2ACXA 2WZIA 2BVLA 2JMHA 1KEYA 2V1DB 4N78D 5DABA 3I0OA 4TN7B 5FL0A 3TLWA 4HGAA 2YDQA 4EYUA 1XDPA 5AQKB 4QXBB 4UIGA 4GKJT 3RHWA 1OEDB 4UXNB 4YJ2E 3CX8B 4DV3T 3AE2A 1NENA 5LMUT 2QYWA 4DUYT 3DP7A 2VVNA 3RQWA 5EZYE 2DI4A 2N9DA 4G2AA 5FYMA 4UVCB 3UUMA 1VOMA 3WAKA 3CX7B 4MBQA 3KFWX 1UX4A 3KBTA 5JRCB 2K5BB 2WQYA 4Q25A 4ANJA 2D9DA 2NOXA 4EYYR 2IC9A 1YKHB 2V5DA 2UXNB 2V5CA 2WAUA 5FY1A 4ZXLA 1D0ZA 5JDNA 4YLHA 4B3MT 3KV4A 1DU2A 4CXXA 1XMOT 2A2FX 4GK5E 4TZ4C 3ZMSB 4P0AA 1N36T 3A7MA 4PK6A 4DR3T 3PJAA 1WRDA 3JADA 4IDQA 1M7KA 4IT4A 3L8RA 1IJ6A 2UXBT 3C4WA 1MMDA 3ZSTA 2H88A 4ZI3C 2B1EA 4LFCT 3QUJA 4G63A 1BR0A 2EHOD 2MYSA 1ZKEA 4OFZA 1W0AA 3A5XA 4AKHA 4C90A 4U74A 3HR0A 3AEDA 3H37A 2I0MA 5HEGA 1SHZC 2OV9A 4IL4A 1QUUA 1G73A 1VCTA 2VL8A 4OX9T 4IREA 1HTJF 1OXZA 4L9IA 3IHRA 4DBRA 5ABFA 3N9QA 1J1JA 5DQWA 3K1SA 2VQFT 4QXHB 2V7IA 5JDQA 5IYZE 2QVAA 2WCAA 4UR9A 2X0HA 3PUWF 4HFEA 4CXYA 3CMLA 1N32T 5L3BB 3RH3A 4M1PA 2IAKA 5TAOA 5LB7B 2CPTA 1YD8G 2EHOC 2JMKA 5DQVA 4YSYA 4CQIA 3UU4A 2G0UA 3KV5A 3FZKB 3OKQA 2XAQB 3I9YA 2LSJA 4DIDB 2BG9C 2BDEA 2KXPB 3K3QC 1U5PA 5AQHB 2Y8DA 4IE7A 1WCRA 3Q2MA 3F2EA 4X66T 1XDOA 4X1YE 1T8BA 3GWHA 3UU6A 4JYAT 2YN6A 4DO0A 2E9XA 3DTOA 2NTXA 4IGUA 3CX6B 3GA8A 4DR6T 2ES0A 2LRLA 5LG4A 3CQXC 5AQVB 2KSRA 4JLEA 5AFUL 4BA9A 2IIUA 4MLKA 2P9BA 4KI0F 4AISA 3K8PC 2LJLA 5ABFB 2UUAT 5JH7E 4U7YA 5AQIB 3CK6A 4AIUA 2JQKA 5JREA 3CIRA 4I50E 3QB5A 3AE4A 4DMWA 2XQ5A 4EEBA 5HAXA 3C50A 2LSYA 2KMFA 2RPAA 5LHGB 4NXNT 5HXEA 3IBPA 3T1YT 3ZYLA 5LGNB 3LFMA 4JI4T 1Y64B 2YINA 3O1JA 3UU8A 2CWYA 2Q9QD 4U31A 3ZN0B 3AXJA 2CLYC 2JQQA 3AAEB 2W4XA 4X62T 5LBMA 1FIOA 5JTGA 2IUBA 1XZYA 2E9XB 5FP3A 2CCQA 2XASB 1V9DA 2X9XA 4X5TA 5H6RB 4DV0T 4TWHA 3SFDA 4YHJA 2ZM6T 2HPJA 2XQ9A 3T8OA 1ZEEA 1YQ3A 4A97A 2XM2A 2E5VA 3RIAA 2C5KT 3P4WA 4LF7T 4CI1B 5M4YA 4EAHA 1HNXT 5CA1E 3HL6A 3ETVA 5FY7A 4JV5T 2HPLA 5ADXL 4H9OC 1KFYA 2A3DA 4I55E 4JEUB 5AQUB 3ZJ2A 2KWHA 2W2UA 4PFPA 3ZT6A 2VURA 1T98A 2UUCT 5JDMA 3RIUC 3K3OA 3LSVA 4Z8XA 4MHCA 3UFEA 1O3XA 4B6XA 1UGOA 3M65A 3H3AA 2KZ7B 2J47A 1LKXA 2NW9A 2WDQA 4ZOLE 2JJ9A 5C3JA 3CWZB 2CMRA 2V7JA 3E22E 4K0UA 4EIWA 4TX5A 4FJOA 4EZHA 4A98A 4YTNA 1IAPA 1MIWA 5JR9B 4X64T 3LDQB 2YU1A 3PUZF 1I94T 4LF4T 5L4EA 3CQGB 3NKZA 2L9QA 1XNQT 5LMNT 4LF9T 3PUQA 4YSXA 2XUEA 4QH1A 4I43B 3FHNA 2N2NA 3VKHA 5HXHA 4PJNA 5CGMA 2WDVA 3N9MA 2ZLYA 1KF6A 1R8IA 3ZN1B 4DV2T 2HH7A 4O4LE 4UELA 4HFCA 2V7MA 3QOFA 1HFAA 4KUMB 2YU2A 3AEBA 1X9BA 3HKDE 2NW7A 5AQNB 3RF1A 3QB5K 4OK0A 4COFA 4PFOA 1S94A 2X0YA 2YK0A 1M62A 3ZLIA 4F8HA 5FY0A 4HN9A 1E7PA 3WI3A 4QH4A 1ZHCA 3RYCE 4IHJE 2UXDT 3AE3A 2XTLA 3FB2A 4TNVA 3RRCA 3VR8A 1LVKA 3RPUA 2LEHA 2X9HA 2BS3A 4UF0B 2KWIB 3AEAA 3AECA 2PBIA 1UUSA 2W00A 3FBLA 2NW8A 2X68A 3Q9DA 4EZ4A 3AAAB 4ZI2D 5AQFB 4UVBB 2IDOB 4AQFC 1IBMT 3ZYMA 1HX8A 5LJNA 5L3CB 4U33A 2IMLA 2W66A 1KNPA 5L3EB 1D0XA 3MACA 2WWUA 3QNUA 2XQ4A 3W15B 4H63V 4OYJA 3B57A 3RYFE 5FL1A 5JVDE 2K3WA 3CQCB 5AQJB 4JI1T 5FXWA 1MMNA 3RKOA 2EHOA 2QGSA 2W63A 4CN1A 5HEOA 3TLUA 1OWAA 3R6NA 3JC6C 3MA9A 4CI2B 4AI6A 2BG9A 4V1Av 2CBJA 4QKNA 4KHZF 3Q5EA 1H7CA 1WYCA 3SOLA 4ZI2C 2H3RA 5JDLA 1D1AA 5F8PA 5L3GB 4ILAA 4ERRA 5HWXA 2QRXA 4TV9E 5GONE 2B76A 4GIWA 4X1IE 2HHHT 1MMAA 2C5IT 5ETWA 3EABA 1QSDA 5HXSA 4YTMA 1WFDA 2CWOA 2PJQA 4F6RC 2XQ8A 3LJCA 4CXWA 4KHPT 5ABGA 4H9SE 2BKOA 4CI3B 3UQ7A 1KNZA 3O1IA 2LKGA 4NUVA 1HG2A 3VHLA 2LT3A 2WU5A 4ZI7E 3TLVA 2WB5A 3OYZA 2VB6A 3P4RA 4QH5A 5JDFA 2M6IA 3ONJA 1N34T 1IBKT 1T72A 5HEUA 1EZ3A 3IA3A 1ZOYA 4UV8B 2LSIA
chains in the Genus database with same CATH topology
3ZYLA 2XAGB 3HKBE 5LGNB 1WYBA 3NZQA 5FXXA 3LFMA 3AAIA 3NBXX 3GN5A 1Y64B 2YINA 4QXCB 2M67A 1VRBA 4YFSA 3O1JA 3HI2A 2I59A 2N1GA 4OHFA 2CWYA 2Q9QD 3ZN0B 4ZI3D 4GOUA 5LHIB 2ZM0A 2CLYC 1UX5A 2JQQA 4ILUA 3ZMTB 3AAEB 5KX5E 4HKAA 5LBMA 3RYIE 2X67A 3HA4A 3AA7B 3PUAA 3BQIA 4XAXB 5LBQB 3D0TA 3ZMUB 4OYKA 1FIOA 2XQYA 3S4UA 2WMOA 3C4XA 2VKHA 4PJLA 3FBZA 2L3LA 3Q5XA 2E9XB 2V7LA 3KBUA 5FP3A 2CCQA 3F57A 3FXDB 4WBOA 4ASKA 3F31A 3TKLB 3FXEB 2XASB 2D0TA 5LA6E 1V9DA 3C51A 2W62A 3N2GE 5JQGE 2J1DG 5LJMA 3ZCIA 1US7B 2X9XA 2DNXA 3KV6A 3MKDA 1WR6A 4QX8B 5H6RB 5LGTB 4AKIA 3HKCE 4WBNE 3OJAA 2CE7A 3I0QA 2JPFA 4PJMA 2Y6XA 4YHJA 5LOVE 2HPJA 2WBLA 3C98B 1IJ5A 4IE4A 2X9YA 1S35A 3T8OA 4A56A 3N2OA 5F3JA 4MFRA 1ZEEA 4O2BE 3Q5WA 5KMGP 2DWKA 1D1BA 2VASA 2C5KT 4CI1B 5M4YA 4EAHA 3PDYA 5CA1E 3HL6A 1MIVA 3ETVA 5FY7A 4U72A 2HPLA 5ADXL 5FMNA 3ONXA 2LSKA 4H9OC 2D5UA 3HKEE 2A3DA 4I55E 4JEUB 1Z0PA 3ZJ1A 3AA6B 2CXDA 3ZJ2A 3VU7H 2KWHA 4GYRA 2RA1A 4PFPA 5CB4E 3P7IA 3AA0B 2X51A 5JRCA 2CM0A 4CZZB 1T98A 3MZKB 4YJ3E 5JDMA 2K48A 3LK42 3NRXA 3L09A 3K3OA 4Z8XA 1D0YA 2KT9A 5FXZA 3LBXA 4KP3C 3JC6D 4MHCA 3UFEA 1O3XA 5J1GA 3GN5B 4HE8A 4B6XA 3BQKA 3M65A 4DBQA 3H3AA 2KZ7B 4BJNA 3SRZA 4AKLA 3O9XA 2PG8A 2WSSV 2GK9A 5J2TE 1LKXA 2EHOB 2ACXA 2NW9A 2MBGA 3LG7A 4ZOLE 2JJ9A 4PW8A 2BVLA 3P8CD 5J2UE 2V26A 3CWZB 2PFVA 2CMRA 2V7JA 2JMHA 3E22E 4K0UA 4EIWA 3ZCJA 4TX5A 4FJOA 2H7VC 2V1DB 4N78D 5DABA 4EZHA 3I0OA 3ZC0A 4TN7B 4XBFB 2KINB 4JEHB 1IAPA 3RX6A 3QC9A 4HGAA 1MIWA 5A1LA 5JR9B 4AKRB 3IF8B 2IC6A 4KBMB 2ODUA 3UT5E 2LOPA 2YU1A 4AQGA 2CA5A 4EYUA 1B7TA 4GK0E 1KK7A 5HWYA 3CQGB 2DCFA 3SWHA 4QXBB 4IIJE 4UIGA 2L9QA 3AB3B 3ZC1A 3LK3B 2LSGA 5HXCA 5L3FB 3PUQA 4IE5A 1HG5A 1FMVA 3GMIA 2XUEA 4UXNB 3FHNA 2N2NA 4I43B 5JDGA 4YJ2E 1LRZA 5HXHA 3N5LA 4PJNA 3VKHA 2YEVC 3E0ZA 3CX8B 2NP9A 5C8YE 3N9MA 3SS1A 2E9XD 2ZLYA 3DP7A 4UEMA 3O4XE 4TUYE 3ZN1B 4XZCA 5EZYE 2DI4A 2N9DA 2XAFB 4G2AA 2ZM2A 3KDSE 4P0BA 2HH7A 5FYMA 2CEAA 4O4LE 4UVCB 3UUMA 4UELA 1VOMA 3VKGA 4E7SA 4PAGA 3CX7B 3WAKA 4FI5A 2V7MA 1HFAA 4KUMB 2KNDA 4MBQA 3KFWX 4MALA 1UX4A 2YU2A 3EDUA 3KBTA 5JRCB 5IHYA 2K5BB 1MMGA 5LXTE 1YKEB 3R84B 4ANJA 2JRKA 3HKDE 2NW7A 4X1KE 2NOXA 4EYYR 2IC9A 1YKHB 3MXZA 3I9WA 2UXNB 4OK0A 2BZBA 3O1HA 3U3IA 2X0LB 4PFOA 3LBXB 5JDHA 1S94A 2WAUA 3N9LA 5FY1A 2YK0A 1D0ZA 5JDNA 4YLHA 3KVBA 3ZLIA 4IE0A 5FY0A 3KV4A 4HN9A 3IEEA 3N9OA 4UVAB 4CXXA 4O4IE 3WI3A 4J2CA 2K24A 1ZHCA 2CXFA 3ETUA 3RYCE 4IHJE 2A2FX 4GK5E 2XHEB 4TZ4C 3ZMSB 2RP4A 4P0AA 2XTLA 2K9AA 3FB2A 2Q9QA 1HS7A 4PK6A 3RRCA 3N2KE 1LVKA 1WRDA 2VWAA 3RPUA 3C64A 3KV9A 2LEHA 1MIYA 5EK3A 2X9HA 2ZM8A 1IJ6A 4UF0B 4L0RA 2KWIB 3C4WA 1MMDA 2PBIA 2KLQA 2Q9QC 2W00A 4ZI3C 2B1EA 4AQFA 4IDZA 2CLYB 3FBLA 2NW8A 3QUJA 2X68A 4G63A 1X79A 2VKDA 4TV8E 3B13A 3PE0A 1BR0A 3Q9DA 2EHOD 4ZHQE 2MYSA 1ZKEA 3RC3A 4PJJA 4EZ4A 3AAAB 5FXVA 2X9WA 4ZI2D 3ESLA 2V7KA 4UVBB 3MJXA 2DWGA 5EK2A 4AQFC 1BR1A 1SA0E 4OFZA 3N9PA 3A5XA 4P09A 3ZYMA 5L2LA 3PUGA 4EOZB 2LM9A 5DJQC 3V5SA 1HX8A 5LJNA 5L3CB 4AKHA 5LYJE 1CUNA 4ZS2A 2IW5B 4H63H 4BAYB 4C90A 4U74A 2BVMA 3HR0A 3PTRB 4O4JE 3H37A 1HCIA 3CVRA 3ZMZB 1SHZC 2E8IA 5CA0E 4HTEA 5L3EB 1NWMX 3AA1B 2NTYA 3PU8A 3NZPA 3ZYKA 1QUUA 1YW0A 2MTQA 3PU3A 1G73A 1D0XA 1G8XA 4QWNB 4QHOA 1U4QA 4ISSA 2VL8A 3MACA 2WWUA 2OA5A 4O2AE 4H9PC 2XAHB 4L5GA 1HTJF 4C91A 1OXZA 4L9IA 3C4ZA 3IHRA 4DBRA 5KDMC 3W15B 4H63V 4OYJA 3B57A 3RYFE 3N9QA 5DQWA 3K3NA 4QXHB 2V7IA 5JDQA 5IYZE 1D1CA 4O4HE 5JVDE 2ZMAA 3AVRA 4KMCA 2QA7A 3I1AA 3CQCB 3L3PA 5H6QB 5FXWA 2D0UA 3EUHA 1MMNA 3CMLA 4CXYA 5HXRA 1IZNB 3RKOA 2EHOA 2QGSA 3ZPOA 5L3BB 2W63A 5L3DB 3OBVE 3RH3A 4M1PA 3KINB 3PURA 2LHRA 4H9NC 2CXLA 5FNVE 2IAKA 2Q9QB 5TAOA 1OWAA 1E1HB 4WNKA 4E7ZA 4BJMA 3R6NA 5HYAA 3JC6C 3EVYA 3MA9A 3BQLA 4CI2B 1WLXA 4AI6A 2A72A 1YD8G 3ANWA 2EHOC 2JMKA 3AVSA 2NWBA 4V1Av 3CPZA 3NRYA 5JR9A 5DQVA 2MOZA 4QKNA 3KVAA 1H7CA 1WYCA 2LE8A 4IE6A 3SOLA 4ZI2C 2W0GA 2H3RA 4ADZA 2DHRA 4CQIA 5JDLA 3J7Yq 4EB6E 1D1AA 5F8PA 5L3GB 1ZV4X 3OYXA 2G0UA 3KV5A 3OKQA 4NUUA 1MNDA 4ERRA 4GYSA 1BR2A 2XAQB 3I9YA 2LSJA 5HWXA 3V5UA 5JR9C 2BDEA 4TV9E 5GONE 5EK4A 3UUXB 2KXPB 3N9NA 3RRWA 4EXTA 3K3QC 1BR4A 4GIWA 4X1IE 1U5PA 1MMAA 2C5IT 2Y8DA 3LK2B 4IE7A 5ETWA 3QK6A 2D2SA 3Q2MA 5LHHB 3F2EA 4AXPA 1LVFA 4X1YE 2C0SA 1QSDA 4PNIA 1FMWA 5HXSA 2VK9A 1HF8A 3GWHA 2L8KA 4DO0A 2E9XA 3DTOA 2NTXA 4IGUA 3CX6B 3GA8A 4X20E 2UXXB 1UCUA 5E0OA 3U78A 2CWOA 2ODVA 2ES0A 2PJQA 4F6RC 3DJBA 4O8SA 5LG4A 3CQXC 3LJCA 5LCYA 4JLEA 4CXWA 5AFUL 4BA9A 4QX7B 4H9SE 3UTKA 4MLKA 4CI3B 4UV9B 4DVDA 2SPCA 2P9BA 2E9XC 3O1IA 4HFVA 3UUNA 1KNZA 4ZS3A 2XAJB 3K8PC 4NUVA 1HG2A 3BK9A 3VHLA 2LT3A 3EDVA 2LJLA 4PK4A 5JH7E 4H9QC 4ZI7E 3OYZA 2LOSA 2DLRA 2VB6A 2VKOA 4H9RC 3ZMVB 3E08A 3ZEFB 1FEWA 5JREA 4AKGA 3UULA 4I50E 5JDFA 4ISTA 2Y48B 4DMWA 5LGUB 2WM9A 3WAJA 4JUYA 2Z6EA 4WW0A 3J9X1 4DMVA 5LNKA 5HAXA 3C50A 2LSYA 2KMFA 1AJ3A 4I4TE 3RYHE 5LHGB 2WMNA 1MNEA 2H7OA 4PK5A 5BMVE 5HXEA 4HEAA 3CKDA 3PUSA 2LHNA 1EZ3A 2X66A 2W61A 4DNDA 3IBPA 2VKJA 3RC8A 2C5JA 3ANWB 3MK7C 4UF0A 5LP6E 4UV8B 2LSIA 1NAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y48 B;  5LBQ B;  5L3E B;  2XAG B;  5LGN B;  3ZMS B;  3ZMU B;  4UV9 B;  2UXN B;  4UVB B;  2X0L B;  3ZN1 B;  5LHH B;  2XAJ B;  4CZZ B;  5H6Q B;  2XAF B;  5LHG B;  5L3F B;  2XAH B;  2XAS B;  3ZN0 B;  5L3G B;  4UVA B;  5L3C B;  5L3B B;  2IW5 B;  4UVC B;  5L3D B;  4BAY B;  5LHI B;  2V1D B;  2UXX B;  2XAQ B;  4XBF B;  3ZMT B;  5H6R B;  4UXN B;  5LGT B;  4KUM B;  3ZMV B;  4UV8 B;  3ZMZ B;  5LGU B; 
#chains in the Genus database with same CATH topology
 3HKB E;  1HNW T;  3AAI A;  3NBX X;  3GN5 A;  2R6G F;  4HWD A;  4QXC B;  2YKS A;  4DV1 T;  2JQH A;  3ZMT B;  4AQY T;  3RYI E;  2JIW A;  3AA7 B;  3PUA A;  3A8Y C;  3D0T A;  4OYK A;  3S4U A;  4LF6 T;  2WMO A;  3C4X A;  2VKH A;  2L3L A;  3Q5X A;  3KBU A;  5AQP B;  3F57 A;  3FXD B;  3F31 A;  3FXE B;  3C51 A;  2W62 A;  3N2G E;  2J1D G;  5LJM A;  2YOE A;  4QX8 B;  3HKC E;  4DV4 T;  3L39 A;  3C98 B;  1S35 A;  5F3J A;  4MFR A;  2M6B A;  5BR8 T;  2VAS A;  3PDY A;  1UUR A;  4WZX A;  4U72 A;  4NXM T;  5FMN A;  3ONX A;  3ZSS A;  3RIU A;  2D5U A;  4DV7 T;  3ZJ1 A;  2CXD A;  4EV6 A;  2CM0 A;  4I0U A;  4YJ3 E;  2K48 A;  3LK4 2;  3L09 A;  3LBX A;  4ZZB A;  2LRK A;  3GN5 B;  4AKL A;  4KX6 A;  2PG8 A;  2WZH A;  4PW8 A;  3P8C D;  2FJD A;  3ZC0 A;  2KIN B;  4JEH B;  2XQA A;  1HNZ T;  5FKY A;  3RQU A;  1E2A A;  4LML A;  4AKR B;  3IF8 B;  4KBM B;  4AQG A;  2ODU A;  2LOP A;  2CA5 A;  4GK0 E;  3AEG A;  2DL1 A;  3ZC1 A;  5L3F B;  3LK3 B;  3GMI A;  5JDG A;  4YHH T;  2YEV C;  3E0Z A;  2NP9 A;  5IUX A;  3RGL A;  2E9X D;  2XQ6 A;  2WDR A;  3O4X E;  4TUY E;  5F5W A;  1L0V A;  2XPK A;  2XAF B;  3KDS E;  5AQR B;  4U2Z A;  2FJA A;  1FJG T;  4JBW F;  3VKG A;  1XWM A;  4JI5 T;  2KND A;  4MAL A;  3EDU A;  5IHY A;  1MMG A;  5LXT E;  1YKE B;  3R84 B;  4YXD A;  4TWF A;  4X1K E;  3SFE A;  3MXZ A;  3I9W A;  3O1H A;  3U3I A;  2X0L B;  3LBX B;  3N9L A;  3KVB A;  2V8S V;  3IEE A;  3N9O A;  4K0K T;  2YDR A;  4LF5 T;  2CXF A;  5L4H A;  2XHE B;  2RP4 A;  2K9A A;  3OPC A;  1HS7 A;  4JI6 T;  3N2K E;  2VWA A;  2FUP A;  1MIY A;  1Z8U A;  1JNZ A;  2ZM8 A;  4L0R A;  2Q9Q C;  2XM1 A;  4LMK A;  1W0B A;  4AQF A;  1IBL T;  4IDZ A;  2V6Y A;  4LFB T;  2VKD A;  4TV8 E;  3B13 A;  4ZHQ E;  5FXV A;  5AQQ B;  3ESL A;  5LG3 A;  5J0Z A;  2DWG A;  3AXJ B;  2CRB A;  3EAM A;  4P09 A;  1BR1 A;  1OED E;  2LM2 A;  2XSB A;  2BBJ A;  3PUG A;  2LM9 A;  5DJQ C;  3V5S A;  5LYJ E;  2IW5 B;  4DR2 T;  1KNR A;  3PTR B;  4IDN A;  4O4J E;  3CVR A;  3ZMZ B;  1VCS A;  2WP9 A;  2HN2 A;  3AA1 B;  2NTY A;  3ZYK A;  2MTQ A;  3PU3 A;  4QWN B;  4L5G A;  1GQE A;  3RI5 A;  1YXR A;  3EI0 A;  1HR0 T;  5AQS B;  4B3S T;  3K3N A;  1D1C A;  2WWV A;  4O4H E;  2ZMA A;  4KMC A;  3L3P A;  3AE6 A;  5H6Q B;  2BKP A;  3EUH A;  1W9R A;  4ILB A;  4ILC A;  5HXR A;  1IZN B;  2MAW A;  3ZPO A;  3OBV E;  2LHR A;  4H9N C;  2CXL A;  1E1H B;  4WNK A;  4E7Z A;  4WYV A;  3EVY A;  3BQL A;  2A72 A;  3ANW A;  3AVS A;  3NRY A;  3KVA A;  3AEE A;  2LE8 A;  4ADZ A;  2V6Y B;  1ZV4 X;  4NUU A;  1BR2 A;  5JR9 C;  5EK4 A;  2WY2 A;  3NWI A;  3RKG A;  3QK6 A;  5LHH B;  1LVF A;  2C0S A;  2VK9 A;  2W67 A;  4X20 E;  2UXX B;  1UCU A;  3U78 A;  4O8S A;  3H3M A;  4DVD A;  4IDO A;  2SPC A;  4ZS3 A;  2XAJ B;  3JCF A;  3BK9 A;  3EDV A;  2FJE A;  4H9Q C;  4YT0 A;  2LOS A;  2DLR A;  2VKO A;  4H9R C;  3ZMV B;  4AKG A;  3ZEF B;  1FEW A;  2Y48 B;  4YY3 T;  3JAF A;  4JUY A;  1AJ3 A;  1MNE A;  4HEA A;  1QLB A;  3CKD A;  2E5L T;  2LHN A;  2X66 A;  2UXC T;  3RC8 A;  2C5J A;  3ANW B;  1NAF A;  5FXX A;  2IHR 1;  3AE8 A;  3OVU A;  2JQ9 A;  2CHO A;  2M67 A;  3HI2 A;  4HFI A;  4ZI3 D;  3AE9 A;  5LHI B;  1UX5 A;  5IWA T;  4ILU A;  5KX5 E;  4HKA A;  2X67 A;  3HA4 A;  3BQI A;  4XAX B;  3ZMU B;  4X65 T;  4PJL A;  2V7L A;  2FJB A;  3TKL B;  5LA6 E;  5JQG E;  3ZCI A;  3ZKR A;  1WR6 A;  2ACZ A;  5LGT B;  4WBN E;  1I6Z A;  3OJA A;  2XY8 B;  3I0Q A;  4DR4 T;  2Y6X A;  3RIF A;  3X1D A;  4U2Y A;  5HCJ A;  4O2B E;  3Q5W A;  5KMG P;  3ABV A;  1OED C;  1MIV A;  2WU2 A;  2LSK A;  2OLT A;  2XJ7 A;  1J5W A;  3HKE E;  4GYR A;  3M3Z B;  3AA0 B;  2X51 A;  5AQT B;  4CZZ B;  3MZK B;  5HCM A;  1D0Y A;  2KT9 A;  3TLT A;  1HX1 B;  3UFG A;  2LLY A;  2UUB T;  4DBQ A;  4BJN A;  2F4V T;  3SRZ A;  3FZH B;  4JI3 T;  4GKK T;  2GK9 A;  2EHO B;  3PUY F;  3EHZ A;  2MBG A;  3LG7 A;  1Y01 A;  5J2U E;  2XSA A;  2V26 A;  2PFV A;  3ZCJ A;  4HWF A;  4DR7 T;  2H7V C;  4XBF B;  3AE5 A;  4B3R T;  3RX6 A;  4LFA T;  3ZT5 A;  3QC9 A;  2BG9 B;  5A1L A;  2IC6 A;  3UT5 E;  3P4P A;  1B7T A;  1KK7 A;  5HWY A;  3RLF F;  2DCF A;  3SWH A;  4IIJ E;  3AB3 B;  5HXC A;  2LSG A;  1WR0 A;  4LF8 T;  4IE5 A;  5FVL A;  3G06 A;  1HG5 A;  1FMV A;  4B3T T;  5CFB A;  4Z91 A;  2NR4 A;  5ABH A;  1LRZ A;  2LKH A;  3N5L A;  1W09 A;  5C8Y E;  3SS1 A;  4UEM A;  3FZF B;  4XZC A;  2ZM2 A;  4P0B A;  2CEA A;  4JI8 T;  4E7S A;  4PAG A;  4FI5 A;  5FVK A;  2PTF A;  2JRK A;  1UK5 A;  2AE9 A;  2BZB A;  4ZZC A;  5JDH A;  2H89 A;  2BKN A;  4IE0 A;  3VRB A;  4UVA B;  4O4I E;  2VQE T;  4J2C A;  1SUM B;  2K24 A;  4JI7 T;  1N33 T;  3VRA A;  3ETU A;  5KXJ A;  2CBI A;  2Q9Q A;  1XNR T;  3C64 A;  3KV9 A;  5EK3 A;  3JAE A;  2UU9 T;  4HWH A;  2KLQ A;  1T7S A;  2CLY B;  1JNR A;  1X79 A;  2E2A A;  3PE0 A;  4CN4 A;  3RC3 A;  4PJJ A;  5HEH A;  3UU5 A;  2X9W A;  2V7K A;  3MJX A;  5EK2 A;  4DV6 T;  1SA0 E;  2BS2 A;  2HN1 A;  5L2L A;  3N9P A;  4EOZ B;  3Q5D A;  1CUN A;  4IL9 A;  4ZS2 A;  4H63 H;  4BAY B;  2BVM A;  4NPP A;  1HCI A;  2E8I A;  5CA0 E;  4HTE A;  1NWM X;  3PU8 A;  4U7I A;  3NZP A;  3P4Q A;  1YW0 A;  1G8X A;  4QHO A;  4DV5 T;  1U4Q A;  4ISS A;  4HFH A;  1CHU A;  2OA5 A;  4O2A E;  4H9P C;  2XAH B;  3PJA J;  4C91 A;  3C4Z A;  5AQL B;  5KDM C;  2J62 A;  2XZE A;  1NEK A;  3PV0 F;  4YTP A;  3AVR A;  2QA7 A;  3I1A A;  5CJ5 A;  2D0U A;  4DR5 T;  5L3D B;  3PUX F;  5L47 A;  3KIN B;  3PUR A;  2VVS A;  4TNW A;  5FNV E;  2Q9Q B;  4JI0 T;  1YQ4 A;  4BJM A;  3NVO A;  5HYA A;  1WLX A;  2NWB A;  3CPZ A;  5JR9 A;  2MOZ A;  4IE6 A;  4LMJ A;  2YDS A;  4P1N A;  4CN6 A;  2W0G A;  2DHR A;  3J7Y q;  4EB6 E;  3OYX A;  1MND A;  4GYS A;  3V5U A;  1ZP0 A;  3ZT7 A;  3UUX B;  3N9N A;  3RRW A;  4EXT A;  1BR4 A;  3T1H T;  3LK2 B;  2D2S A;  4AXP A;  4PNI A;  1FMW A;  1HF8 A;  4HWI B;  2L8K A;  4Z90 A;  5E0O A;  2ODV A;  3DJB A;  2AXD S;  2FBW A;  4ZEY A;  3P4S A;  5LCY A;  4QX7 B;  3UTK A;  4UV9 B;  2E9X C;  4HFV A;  3UUN A;  3AEF A;  4PK4 A;  2I6H A;  3PUV F;  3VR9 A;  3E08 A;  5LGU B;  3UUL A;  4IST A;  3WAJ A;  2WM9 A;  4A5X A;  2Z6E A;  4WW0 A;  3J9X 1;  4DMV A;  5LNK A;  4I4T E;  3RYH E;  2WMN A;  2H7O A;  4PK5 A;  5BMV E;  3PUS A;  3AE1 A;  2CHN A;  3FZL B;  2W61 A;  4TWD A;  4DND A;  2VKJ A;  4UF0 A;  3MK7 C;  5LP6 E;  2XAG B;  1WYB A;  3NZQ A;  3ONL C;  5ABE A;  4U3C A;  2A9U A;  3UU3 A;  1VRB A;  4YFS A;  2V6X A;  2I59 A;  2N1G A;  4OHF A;  5AQM B;  4GOU A;  2ZM0 A;  3B5M A;  3P50 A;  2XQ7 A;  5LBQ B;  1SE7 A;  2XQY A;  2BS4 A;  3FBZ A;  4WBO A;  4ASK A;  2MPK A;  2D0T A;  4NIQ A;  1US7 B;  4HFD A;  2DNX A;  3KV6 A;  3MKD A;  5HEJ A;  2BBH A;  5AQG B;  4AKI A;  2VL0 A;  2WS3 A;  2CE7 A;  1OED A;  3UQ4 A;  2JPF A;  4PJM A;  5LOV E;  2XQ3 A;  2WBL A;  1IJ5 A;  4IE4 A;  4IDP A;  2X9Y A;  4A56 A;  3N2O A;  4DR1 T;  2DWK A;  4DUZ T;  4HFB A;  1D1B A;  2J4G A;  4YSZ A;  3AE7 A;  3FZM B;  3TLS A;  1XMQ T;  1Z0P A;  3AA6 B;  3VU7 H;  4JI2 T;  2RA1 A;  5CB4 E;  3P7I A;  5JRC A;  4HWC A;  3NRX A;  1J5E T;  5FXZ A;  4KP3 C;  5AQO B;  2BG9 E;  3JC6 D;  5J1G A;  4HE8 A;  3BQK A;  5C2T A;  3UUB A;  4EED A;  3OTO T;  3O9X A;  4EGW A;  2WSS V;  5J2T E;  2ACX A;  2WZI A;  2BVL A;  2JMH A;  1KEY A;  2V1D B;  4N78 D;  5DAB A;  3I0O A;  4TN7 B;  5FL0 A;  3TLW A;  4HGA A;  2YDQ A;  4EYU A;  1XDP A;  5AQK B;  4QXB B;  4UIG A;  4GKJ T;  3RHW A;  1OED B;  4UXN B;  4YJ2 E;  3CX8 B;  4DV3 T;  3AE2 A;  1NEN A;  5LMU T;  2QYW A;  4DUY T;  3DP7 A;  2VVN A;  3RQW A;  5EZY E;  2DI4 A;  2N9D A;  4G2A A;  5FYM A;  4UVC B;  3UUM A;  1VOM A;  3WAK A;  3CX7 B;  4MBQ A;  3KFW X;  1UX4 A;  3KBT A;  5JRC B;  2K5B B;  2WQY A;  4Q25 A;  4ANJ A;  2D9D A;  2NOX A;  4EYY R;  2IC9 A;  1YKH B;  2V5D A;  2UXN B;  2V5C A;  2WAU A;  5FY1 A;  4ZXL A;  1D0Z A;  5JDN A;  4YLH A;  4B3M T;  3KV4 A;  1DU2 A;  4CXX A;  1XMO T;  2A2F X;  4GK5 E;  4TZ4 C;  3ZMS B;  4P0A A;  1N36 T;  3A7M A;  4PK6 A;  4DR3 T;  3PJA A;  1WRD A;  3JAD A;  4IDQ A;  1M7K A;  4IT4 A;  3L8R A;  1IJ6 A;  2UXB T;  3C4W A;  1MMD A;  3ZST A;  2H88 A;  4ZI3 C;  2B1E A;  4LFC T;  3QUJ A;  4G63 A;  1BR0 A;  2EHO D;  2MYS A;  1ZKE A;  4OFZ A;  1W0A A;  3A5X A;  4AKH A;  4C90 A;  4U74 A;  3HR0 A;  3AED A;  3H37 A;  2I0M A;  5HEG A;  1SHZ C;  2OV9 A;  4IL4 A;  1QUU A;  1G73 A;  1VCT A;  2VL8 A;  4OX9 T;  4IRE A;  1HTJ F;  1OXZ A;  4L9I A;  3IHR A;  4DBR A;  5ABF A;  3N9Q A;  1J1J A;  5DQW A;  3K1S A;  2VQF T;  4QXH B;  2V7I A;  5JDQ A;  5IYZ E;  2QVA A;  2WCA A;  4UR9 A;  2X0H A;  3PUW F;  4HFE A;  4CXY A;  3CML A;  1N32 T;  5L3B B;  3RH3 A;  4M1P A;  2IAK A;  5TAO A;  5LB7 B;  2CPT A;  1YD8 G;  2EHO C;  2JMK A;  5DQV A;  4YSY A;  4CQI A;  3UU4 A;  2G0U A;  3KV5 A;  3FZK B;  3OKQ A;  2XAQ B;  3I9Y A;  2LSJ A;  4DID B;  2BG9 C;  2BDE A;  2KXP B;  3K3Q C;  1U5P A;  5AQH B;  2Y8D A;  4IE7 A;  1WCR A;  3Q2M A;  3F2E A;  4X66 T;  1XDO A;  4X1Y E;  1T8B A;  3GWH A;  3UU6 A;  4JYA T;  2YN6 A;  4DO0 A;  2E9X A;  3DTO A;  2NTX A;  4IGU A;  3CX6 B;  3GA8 A;  4DR6 T;  2ES0 A;  2LRL A;  5LG4 A;  3CQX C;  5AQV B;  2KSR A;  4JLE A;  5AFU L;  4BA9 A;  2IIU A;  4MLK A;  2P9B A;  4KI0 F;  4AIS A;  3K8P C;  2LJL A;  5ABF B;  2UUA T;  5JH7 E;  4U7Y A;  5AQI B;  3CK6 A;  4AIU A;  2JQK A;  5JRE A;  3CIR A;  4I50 E;  3QB5 A;  3AE4 A;  4DMW A;  2XQ5 A;  4EEB A;  5HAX A;  3C50 A;  2LSY A;  2KMF A;  2RPA A;  5LHG B;  4NXN T;  5HXE A;  3IBP A;  3T1Y T;  3ZYL A;  5LGN B;  3LFM A;  4JI4 T;  1Y64 B;  2YIN A;  3O1J A;  3UU8 A;  2CWY A;  2Q9Q D;  4U31 A;  3ZN0 B;  3AXJ A;  2CLY C;  2JQQ A;  3AAE B;  2W4X A;  4X62 T;  5LBM A;  1FIO A;  5JTG A;  2IUB A;  1XZY A;  2E9X B;  5FP3 A;  2CCQ A;  2XAS B;  1V9D A;  2X9X A;  4X5T A;  5H6R B;  4DV0 T;  4TWH A;  3SFD A;  4YHJ A;  2ZM6 T;  2HPJ A;  2XQ9 A;  3T8O A;  1ZEE A;  1YQ3 A;  4A97 A;  2XM2 A;  2E5V A;  3RIA A;  2C5K T;  3P4W A;  4LF7 T;  4CI1 B;  5M4Y A;  4EAH A;  1HNX T;  5CA1 E;  3HL6 A;  3ETV A;  5FY7 A;  4JV5 T;  2HPL A;  5ADX L;  4H9O C;  1KFY A;  2A3D A;  4I55 E;  4JEU B;  5AQU B;  3ZJ2 A;  2KWH A;  2W2U A;  4PFP A;  3ZT6 A;  2VUR A;  1T98 A;  2UUC T;  5JDM A;  3RIU C;  3K3O A;  3LSV A;  4Z8X A;  4MHC A;  3UFE A;  1O3X A;  4B6X A;  1UGO A;  3M65 A;  3H3A A;  2KZ7 B;  2J47 A;  1LKX A;  2NW9 A;  2WDQ A;  4ZOL E;  2JJ9 A;  5C3J A;  3CWZ B;  2CMR A;  2V7J A;  3E22 E;  4K0U A;  4EIW A;  4TX5 A;  4FJO A;  4EZH A;  4A98 A;  4YTN A;  1IAP A;  1MIW A;  5JR9 B;  4X64 T;  3LDQ B;  2YU1 A;  3PUZ F;  1I94 T;  4LF4 T;  5L4E A;  3CQG B;  3NKZ A;  2L9Q A;  1XNQ T;  5LMN T;  4LF9 T;  3PUQ A;  4YSX A;  2XUE A;  4QH1 A;  4I43 B;  3FHN A;  2N2N A;  3VKH A;  5HXH A;  4PJN A;  5CGM A;  2WDV A;  3N9M A;  2ZLY A;  1KF6 A;  1R8I A;  3ZN1 B;  4DV2 T;  2HH7 A;  4O4L E;  4UEL A;  4HFC A;  2V7M A;  3QOF A;  1HFA A;  4KUM B;  2YU2 A;  3AEB A;  1X9B A;  3HKD E;  2NW7 A;  5AQN B;  3RF1 A;  3QB5 K;  4OK0 A;  4COF A;  4PFO A;  1S94 A;  2X0Y A;  2YK0 A;  1M62 A;  3ZLI A;  4F8H A;  5FY0 A;  4HN9 A;  1E7P A;  3WI3 A;  4QH4 A;  1ZHC A;  3RYC E;  4IHJ E;  2UXD T;  3AE3 A;  2XTL A;  3FB2 A;  4TNV A;  3RRC A;  3VR8 A;  1LVK A;  3RPU A;  2LEH A;  2X9H A;  2BS3 A;  4UF0 B;  2KWI B;  3AEA A;  3AEC A;  2PBI A;  1UUS A;  2W00 A;  3FBL A;  2NW8 A;  2X68 A;  3Q9D A;  4EZ4 A;  3AAA B;  4ZI2 D;  5AQF B;  4UVB B;  2IDO B;  4AQF C;  1IBM T;  3ZYM A;  1HX8 A;  5LJN A;  5L3C B;  4U33 A;  2IML A;  2W66 A;  1KNP A;  5L3E B;  1D0X A;  3MAC A;  2WWU A;  3QNU A;  2XQ4 A;  3W15 B;  4H63 V;  4OYJ A;  3B57 A;  3RYF E;  5FL1 A;  5JVD E;  2K3W A;  3CQC B;  5AQJ B;  4JI1 T;  5FXW A;  1MMN A;  3RKO A;  2EHO A;  2QGS A;  2W63 A;  4CN1 A;  5HEO A;  3TLU A;  1OWA A;  3R6N A;  3JC6 C;  3MA9 A;  4CI2 B;  4AI6 A;  2BG9 A;  4V1A v;  2CBJ A;  4QKN A;  4KHZ F;  3Q5E A;  1H7C A;  1WYC A;  3SOL A;  4ZI2 C;  2H3R A;  5JDL A;  1D1A A;  5F8P A;  5L3G B;  4ILA A;  4ERR A;  5HWX A;  2QRX A;  4TV9 E;  5GON E;  2B76 A;  4GIW A;  4X1I E;  2HHH T;  1MMA A;  2C5I T;  5ETW A;  3EAB A;  1QSD A;  5HXS A;  4YTM A;  1WFD A;  2CWO A;  2PJQ A;  4F6R C;  2XQ8 A;  3LJC A;  4CXW A;  4KHP T;  5ABG A;  4H9S E;  2BKO A;  4CI3 B;  3UQ7 A;  1KNZ A;  3O1I A;  2LKG A;  4NUV A;  1HG2 A;  3VHL A;  2LT3 A;  2WU5 A;  4ZI7 E;  3TLV A;  2WB5 A;  3OYZ A;  2VB6 A;  3P4R A;  4QH5 A;  5JDF A;  2M6I A;  3ONJ A;  1N34 T;  1IBK T;  1T72 A;  5HEU A;  1EZ3 A;  3IA3 A;  1ZOY A;  4UV8 B;  2LSI A; 
#chains in the Genus database with same CATH homology
 3ZYL A;  2XAG B;  3HKB E;  5LGN B;  1WYB A;  3NZQ A;  5FXX A;  3LFM A;  3AAI A;  3NBX X;  3GN5 A;  1Y64 B;  2YIN A;  4QXC B;  2M67 A;  1VRB A;  4YFS A;  3O1J A;  3HI2 A;  2I59 A;  2N1G A;  4OHF A;  2CWY A;  2Q9Q D;  3ZN0 B;  4ZI3 D;  4GOU A;  5LHI B;  2ZM0 A;  2CLY C;  1UX5 A;  2JQQ A;  4ILU A;  3ZMT B;  3AAE B;  5KX5 E;  4HKA A;  5LBM A;  3RYI E;  2X67 A;  3HA4 A;  3AA7 B;  3PUA A;  3BQI A;  4XAX B;  5LBQ B;  3D0T A;  3ZMU B;  4OYK A;  1FIO A;  2XQY A;  3S4U A;  2WMO A;  3C4X A;  2VKH A;  4PJL A;  3FBZ A;  2L3L A;  3Q5X A;  2E9X B;  2V7L A;  3KBU A;  5FP3 A;  2CCQ A;  3F57 A;  3FXD B;  4WBO A;  4ASK A;  3F31 A;  3TKL B;  3FXE B;  2XAS B;  2D0T A;  5LA6 E;  1V9D A;  3C51 A;  2W62 A;  3N2G E;  5JQG E;  2J1D G;  5LJM A;  3ZCI A;  1US7 B;  2X9X A;  2DNX A;  3KV6 A;  3MKD A;  1WR6 A;  4QX8 B;  5H6R B;  5LGT B;  4AKI A;  3HKC E;  4WBN E;  3OJA A;  2CE7 A;  3I0Q A;  2JPF A;  4PJM A;  2Y6X A;  4YHJ A;  5LOV E;  2HPJ A;  2WBL A;  3C98 B;  1IJ5 A;  4IE4 A;  2X9Y A;  1S35 A;  3T8O A;  4A56 A;  3N2O A;  5F3J A;  4MFR A;  1ZEE A;  4O2B E;  3Q5W A;  5KMG P;  2DWK A;  1D1B A;  2VAS A;  2C5K T;  4CI1 B;  5M4Y A;  4EAH A;  3PDY A;  5CA1 E;  3HL6 A;  1MIV A;  3ETV A;  5FY7 A;  4U72 A;  2HPL A;  5ADX L;  5FMN A;  3ONX A;  2LSK A;  4H9O C;  2D5U A;  3HKE E;  2A3D A;  4I55 E;  4JEU B;  1Z0P A;  3ZJ1 A;  3AA6 B;  2CXD A;  3ZJ2 A;  3VU7 H;  2KWH A;  4GYR A;  2RA1 A;  4PFP A;  5CB4 E;  3P7I A;  3AA0 B;  2X51 A;  5JRC A;  2CM0 A;  4CZZ B;  1T98 A;  3MZK B;  4YJ3 E;  5JDM A;  2K48 A;  3LK4 2;  3NRX A;  3L09 A;  3K3O A;  4Z8X A;  1D0Y A;  2KT9 A;  5FXZ A;  3LBX A;  4KP3 C;  3JC6 D;  4MHC A;  3UFE A;  1O3X A;  5J1G A;  3GN5 B;  4HE8 A;  4B6X A;  3BQK A;  3M65 A;  4DBQ A;  3H3A A;  2KZ7 B;  4BJN A;  3SRZ A;  4AKL A;  3O9X A;  2PG8 A;  2WSS V;  2GK9 A;  5J2T E;  1LKX A;  2EHO B;  2ACX A;  2NW9 A;  2MBG A;  3LG7 A;  4ZOL E;  2JJ9 A;  4PW8 A;  2BVL A;  3P8C D;  5J2U E;  2V26 A;  3CWZ B;  2PFV A;  2CMR A;  2V7J A;  2JMH A;  3E22 E;  4K0U A;  4EIW A;  3ZCJ A;  4TX5 A;  4FJO A;  2H7V C;  2V1D B;  4N78 D;  5DAB A;  4EZH A;  3I0O A;  3ZC0 A;  4TN7 B;  4XBF B;  2KIN B;  4JEH B;  1IAP A;  3RX6 A;  3QC9 A;  4HGA A;  1MIW A;  5A1L A;  5JR9 B;  4AKR B;  3IF8 B;  2IC6 A;  4KBM B;  2ODU A;  3UT5 E;  2LOP A;  2YU1 A;  4AQG A;  2CA5 A;  4EYU A;  1B7T A;  4GK0 E;  1KK7 A;  5HWY A;  3CQG B;  2DCF A;  3SWH A;  4QXB B;  4IIJ E;  4UIG A;  2L9Q A;  3AB3 B;  3ZC1 A;  3LK3 B;  2LSG A;  5HXC A;  5L3F B;  3PUQ A;  4IE5 A;  1HG5 A;  1FMV A;  3GMI A;  2XUE A;  4UXN B;  3FHN A;  2N2N A;  4I43 B;  5JDG A;  4YJ2 E;  1LRZ A;  5HXH A;  3N5L A;  4PJN A;  3VKH A;  2YEV C;  3E0Z A;  3CX8 B;  2NP9 A;  5C8Y E;  3N9M A;  3SS1 A;  2E9X D;  2ZLY A;  3DP7 A;  4UEM A;  3O4X E;  4TUY E;  3ZN1 B;  4XZC A;  5EZY E;  2DI4 A;  2N9D A;  2XAF B;  4G2A A;  2ZM2 A;  3KDS E;  4P0B A;  2HH7 A;  5FYM A;  2CEA A;  4O4L E;  4UVC B;  3UUM A;  4UEL A;  1VOM A;  3VKG A;  4E7S A;  4PAG A;  3CX7 B;  3WAK A;  4FI5 A;  2V7M A;  1HFA A;  4KUM B;  2KND A;  4MBQ A;  3KFW X;  4MAL A;  1UX4 A;  2YU2 A;  3EDU A;  3KBT A;  5JRC B;  5IHY A;  2K5B B;  1MMG A;  5LXT E;  1YKE B;  3R84 B;  4ANJ A;  2JRK A;  3HKD E;  2NW7 A;  4X1K E;  2NOX A;  4EYY R;  2IC9 A;  1YKH B;  3MXZ A;  3I9W A;  2UXN B;  4OK0 A;  2BZB A;  3O1H A;  3U3I A;  2X0L B;  4PFO A;  3LBX B;  5JDH A;  1S94 A;  2WAU A;  3N9L A;  5FY1 A;  2YK0 A;  1D0Z A;  5JDN A;  4YLH A;  3KVB A;  3ZLI A;  4IE0 A;  5FY0 A;  3KV4 A;  4HN9 A;  3IEE A;  3N9O A;  4UVA B;  4CXX A;  4O4I E;  3WI3 A;  4J2C A;  2K24 A;  1ZHC A;  2CXF A;  3ETU A;  3RYC E;  4IHJ E;  2A2F X;  4GK5 E;  2XHE B;  4TZ4 C;  3ZMS B;  2RP4 A;  4P0A A;  2XTL A;  2K9A A;  3FB2 A;  2Q9Q A;  1HS7 A;  4PK6 A;  3RRC A;  3N2K E;  1LVK A;  1WRD A;  2VWA A;  3RPU A;  3C64 A;  3KV9 A;  2LEH A;  1MIY A;  5EK3 A;  2X9H A;  2ZM8 A;  1IJ6 A;  4UF0 B;  4L0R A;  2KWI B;  3C4W A;  1MMD A;  2PBI A;  2KLQ A;  2Q9Q C;  2W00 A;  4ZI3 C;  2B1E A;  4AQF A;  4IDZ A;  2CLY B;  3FBL A;  2NW8 A;  3QUJ A;  2X68 A;  4G63 A;  1X79 A;  2VKD A;  4TV8 E;  3B13 A;  3PE0 A;  1BR0 A;  3Q9D A;  2EHO D;  4ZHQ E;  2MYS A;  1ZKE A;  3RC3 A;  4PJJ A;  4EZ4 A;  3AAA B;  5FXV A;  2X9W A;  4ZI2 D;  3ESL A;  2V7K A;  4UVB B;  3MJX A;  2DWG A;  5EK2 A;  4AQF C;  1BR1 A;  1SA0 E;  4OFZ A;  3N9P A;  3A5X A;  4P09 A;  3ZYM A;  5L2L A;  3PUG A;  4EOZ B;  2LM9 A;  5DJQ C;  3V5S A;  1HX8 A;  5LJN A;  5L3C B;  4AKH A;  5LYJ E;  1CUN A;  4ZS2 A;  2IW5 B;  4H63 H;  4BAY B;  4C90 A;  4U74 A;  2BVM A;  3HR0 A;  3PTR B;  4O4J E;  3H37 A;  1HCI A;  3CVR A;  3ZMZ B;  1SHZ C;  2E8I A;  5CA0 E;  4HTE A;  5L3E B;  1NWM X;  3AA1 B;  2NTY A;  3PU8 A;  3NZP A;  3ZYK A;  1QUU A;  1YW0 A;  2MTQ A;  3PU3 A;  1G73 A;  1D0X A;  1G8X A;  4QWN B;  4QHO A;  1U4Q A;  4ISS A;  2VL8 A;  3MAC A;  2WWU A;  2OA5 A;  4O2A E;  4H9P C;  2XAH B;  4L5G A;  1HTJ F;  4C91 A;  1OXZ A;  4L9I A;  3C4Z A;  3IHR A;  4DBR A;  5KDM C;  3W15 B;  4H63 V;  4OYJ A;  3B57 A;  3RYF E;  3N9Q A;  5DQW A;  3K3N A;  4QXH B;  2V7I A;  5JDQ A;  5IYZ E;  1D1C A;  4O4H E;  5JVD E;  2ZMA A;  3AVR A;  4KMC A;  2QA7 A;  3I1A A;  3CQC B;  3L3P A;  5H6Q B;  5FXW A;  2D0U A;  3EUH A;  1MMN A;  3CML A;  4CXY A;  5HXR A;  1IZN B;  3RKO A;  2EHO A;  2QGS A;  3ZPO A;  5L3B B;  2W63 A;  5L3D B;  3OBV E;  3RH3 A;  4M1P A;  3KIN B;  3PUR A;  2LHR A;  4H9N C;  2CXL A;  5FNV E;  2IAK A;  2Q9Q B;  5TAO A;  1OWA A;  1E1H B;  4WNK A;  4E7Z A;  4BJM A;  3R6N A;  5HYA A;  3JC6 C;  3EVY A;  3MA9 A;  3BQL A;  4CI2 B;  1WLX A;  4AI6 A;  2A72 A;  1YD8 G;  3ANW A;  2EHO C;  2JMK A;  3AVS A;  2NWB A;  4V1A v;  3CPZ A;  3NRY A;  5JR9 A;  5DQV A;  2MOZ A;  4QKN A;  3KVA A;  1H7C A;  1WYC A;  2LE8 A;  4IE6 A;  3SOL A;  4ZI2 C;  2W0G A;  2H3R A;  4ADZ A;  2DHR A;  4CQI A;  5JDL A;  3J7Y q;  4EB6 E;  1D1A A;  5F8P A;  5L3G B;  1ZV4 X;  3OYX A;  2G0U A;  3KV5 A;  3OKQ A;  4NUU A;  1MND A;  4ERR A;  4GYS A;  1BR2 A;  2XAQ B;  3I9Y A;  2LSJ A;  5HWX A;  3V5U A;  5JR9 C;  2BDE A;  4TV9 E;  5GON E;  5EK4 A;  3UUX B;  2KXP B;  3N9N A;  3RRW A;  4EXT A;  3K3Q C;  1BR4 A;  4GIW A;  4X1I E;  1U5P A;  1MMA A;  2C5I T;  2Y8D A;  3LK2 B;  4IE7 A;  5ETW A;  3QK6 A;  2D2S A;  3Q2M A;  5LHH B;  3F2E A;  4AXP A;  1LVF A;  4X1Y E;  2C0S A;  1QSD A;  4PNI A;  1FMW A;  5HXS A;  2VK9 A;  1HF8 A;  3GWH A;  2L8K A;  4DO0 A;  2E9X A;  3DTO A;  2NTX A;  4IGU A;  3CX6 B;  3GA8 A;  4X20 E;  2UXX B;  1UCU A;  5E0O A;  3U78 A;  2CWO A;  2ODV A;  2ES0 A;  2PJQ A;  4F6R C;  3DJB A;  4O8S A;  5LG4 A;  3CQX C;  3LJC A;  5LCY A;  4JLE A;  4CXW A;  5AFU L;  4BA9 A;  4QX7 B;  4H9S E;  3UTK A;  4MLK A;  4CI3 B;  4UV9 B;  4DVD A;  2SPC A;  2P9B A;  2E9X C;  3O1I A;  4HFV A;  3UUN A;  1KNZ A;  4ZS3 A;  2XAJ B;  3K8P C;  4NUV A;  1HG2 A;  3BK9 A;  3VHL A;  2LT3 A;  3EDV A;  2LJL A;  4PK4 A;  5JH7 E;  4H9Q C;  4ZI7 E;  3OYZ A;  2LOS A;  2DLR A;  2VB6 A;  2VKO A;  4H9R C;  3ZMV B;  3E08 A;  3ZEF B;  1FEW A;  5JRE A;  4AKG A;  3UUL A;  4I50 E;  5JDF A;  4IST A;  2Y48 B;  4DMW A;  5LGU B;  2WM9 A;  3WAJ A;  4JUY A;  2Z6E A;  4WW0 A;  3J9X 1;  4DMV A;  5LNK A;  5HAX A;  3C50 A;  2LSY A;  2KMF A;  1AJ3 A;  4I4T E;  3RYH E;  5LHG B;  2WMN A;  1MNE A;  2H7O A;  4PK5 A;  5BMV E;  5HXE A;  4HEA A;  3CKD A;  3PUS A;  2LHN A;  1EZ3 A;  2X66 A;  2W61 A;  4DND A;  3IBP A;  2VKJ A;  3RC8 A;  2C5J A;  3ANW B;  3MK7 C;  4UF0 A;  5LP6 E;  4UV8 B;  2LSI A;  1NAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...