1HS7A

Vam3p n-terminal domain solution structure
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
97
structure length
97
Chain Sequence
TNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTAXIN VAM3
publication title Vam3p structure reveals conserved and divergent properties of syntaxins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
total genus 43
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2000-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hs7A00
1FEWA 2DNXA 1BR0A 1EZ3A 1S94A 1G73A 4TX5A 5M4YA 1HS7A 4JEHB 4JEUB 1FIOA 3C98B 2XHEB 3LG7A 5LG4A
chains in the Genus database with same CATH superfamily
4IHJE 2WM9A 4AQFA 4X1YE 4M1PA 1N36T 2WQYA 3RQUA 3PUZF 1E2AA 4PNIA 3CVRA 1IJ5A 3AA6B 1HX8A 3UULA 2BVMA 3RIFA 2LSJA 1HNXT 3KV9A 3C51A 4YFSA 4L9IA 4QH1A 4QXBB 4DV0T 3V5UA 3P4RA 2BKNA 5C2TA 5HAXA 3UQ7A 4CXXA 3GWHA 2NW8A 5LMUT 2VQET 2UXBT 1X79A 4B3TT 3AE8A 3WAKA 3F57A 5HWXA 4JI3T 3N9LA 5FVKA 2YN6A 3TLSA 4ILUA 3ZJ1A 1HR0T 3B13A 3RX6A 3UUNA 4ILAA 2X9WA 1AJ3A 2J4GA 2CPTA 4Z8XA 2XM1A 2BS2A 4U2YA 1E1HB 4JV5T 2DWKA 1ZKEA 3NZQA 3AEGA 3K3NA 4IDNA 5L3BB 2Y8DA 1YD8G 5JVDE 3PTRB 4H63V 1W0BA 2BBJA 2DNXA 4O4HE 1MNEA 4MLKA 2WP9A 3PV0F 5J0ZA 4ZI3C 3SFDA 4HFHA 4QHOA 4YY3T 2CM0A 3RYFE 4LF7T 5J2TE 3U3IA 3ZSSA 3ZT7A 2B76A 1SA0E 2BKPA 2E8IA 2WDRA 2V5CA 4YXDA 4WBOA 3FB2A 2JQ9A 3ZMUB 2PFVA 1QSDA 2NTYA 2UXCT 2BG9B 3K3QC 4JI4T 1IJ6A 2D5UA 3UQ4A 5JRCB 2YDRA 4HWIB 3DP7A 3L39A 2V7MA 4P09A 4TWFA 2E5VA 5ADXL 3UTKA 5JDQA 5E0OA 3OPCA 2XAHB 4HFVA 4DO0A 4DR3T 1WR0A 5LGNB 3HI2A 5FL1A 3A8YC 3AAAB 3B57A 4B3MT 2X9HA 2W2UA 4PK4A 2XPKA 4JI0T 4I0UA 4QH5A 3ZPOA 4O2BE 3AA1B 2KNDA 4X5TA 2L3LA 2H7OA 4H9PC 4YSZA 4FI5A 4YLHA 2XTLA 3KV4A 4CI1B 2UXXB 2DWGA 2WY2A 3NVOA 4GIWA 3GN5B 3ZMVB 1W09A 3OKQA 3AXJB 3J9X1 3O4XE 4CI2B 2P9BA 3PJAA 5AQUB 5JDHA 3CQGB 3PUGA 3A7MA 2K3WA 3AEDA 3FBLA 3F31A 1QUUA 5FY7A 5JREA 3VHLA 3PUQA 1JNRA 4ADZA 1UUSA 4X1KE 5EK4A 1J5WA 4OYJA 4UVCB 5LGTB 4DV7T 5TAOA 2CCQA 1J5ET 4B3RT 4OX9T 3RRCA 3UU3A 3HKBE 4TZ4C 3TLWA 3RH3A 3UFEA 2Y6XA 1EZ3A 4LFBT 4EEBA 2LSGA 5J1GA 3C4WA 2M6IA 4HN9A 3RIAA 3FZHB 4JI1T 4L0RA 1LKXA 3IHRA 4EIWA 4MFRA 5C8YE 4HWFA 5H6RB 3MKDA 3PU3A 2EHOC 1UGOA 1KNPA 3P4PA 4E7ZA 4ASKA 4DV5T 2UUAT 4DR1T 2JQHA 2VB6A 3CX7B 4F8HA 3EI0A 2XQAA 3D0TA 4QKNA 3CX8B 4LMKA 4OFZA 3FHNA 3RYIE 5LBQB 3RLFF 2BBHA 3PURA 1UCUA 1HTJF 3NRYA 1T7SA 4CXYA 3I0QA 4QX8B 3AE4A 3HL6A 4ZOLE 4KP3C 4O2AE 2K24A 3WAJA 1KNZA 2VVSA 3LK2B 2WB5A 2G0UA 3N2KE 4Z90A 2YU1A 2WMNA 2V5DA 1D0XA 2LHNA 3UU8A 3RC8A 4X1IE 4UIGA 2I6HA 3AE3A 2WU5A 4BJMA 1HS7A 1U5PA 2LJLA 4P0BA 3E08A 2LSKA 1YXRA 2LSYA 1XMQT 5F8PA 4YHHT 3ETUA 4AIUA 2XASB 2VASA 5JH7E 5L3FB 1N33T 3DTOA 3UU5A 5FKYA 3PDYA 4PJMA 4ISTA 5AQGB 2W61A 4IE0A 1WFDA 4AXPA 2X0YA 2N9DA 5HEOA 5IYZE 4A56A 2X51A 3MJXA 4U74A 2L8KA 3JAEA 3HKCE 4IE4A 3ZMSB 4LMLA 4C91A 3Q2MA 2QYWA 2YDQA 3ZYKA 4ZI7E 4WBNE 2XHEB 5EZYE 3EVYA 2E9XC 4K0UA 2UU9T 4O4IE 5BMVE 3EDVA 2ZM6T 3KDSE 1XDOA 5C3JA 1G8XA 3KFWX 3HKDE 4IIJE 4ILCA 3O1HA 1IAPA 4O4LE 2B1EA 2M6BA 2DHRA 5L4HA 4QXHB 4I50E 4QWNB 5FNVE 3CK6A 3AXJA 4EYYR 1OEDE 1Y01A 3UFGA 3ZEFB 2FBWA 3ESLA 4ZZBA 5HEJA 2K5BB 3T1YT 3HA4A 4IT4A 3I9WA 4AISA 2UXNB 2J47A 3K8PC 1FEWA 2JIWA 5CB4E 3LG7A 4B6XA 3ZN1B 3AE1A 5LP6E 1XWMA 3LDQB 3FBZA 4NXNT 5ABHA 5CFBA 2LRKA 2MAWA 5HEHA 3P8CD 5LCYA 3N2GE 4YSYA 3OBVE 3RIUC 4TN7B 3E22E 1WCRA 1UX5A 3P50A 3KV5A 1HCIA 1T98A 2E2AA 4GK0E 1HNZT 1NWMX 3N5LA 5AQJB 3LJCA 3RF1A 4AKRB 4DV1T 1T72A 3PUXF 2DL1A 2CWYA 2XJ7A 5A1LA 4ZXLA 3MACA 2XSAA 4KI0F 3OTOT 4LF6T 3MXZA 3C4XA 3VRAA 2EHOA 4X66T 3K3OA 4EZHA 2FJEA 4H9QC 1BR1A 5AQIB 1MIWA 1N34T 2XSBA 2LOPA 3ZYLA 5LBMA 1T8BA 3JCFA 4DR2T 2WWUA 2ZM0A 5L4EA 4KHZF 2XAFB 3JAFA 1R8IA 4YTNA 1MMNA 5HXRA 4P0AA 5LMNT 4DUZT 5LHGB 2V7LA 4HWHA 2V6YA 1HF8A 4DV4T 2JJ9A 2A3DA 4CN4A 3PE0A 1HG2A 3LBXA 4JI7T 2V1DB 2CWOA 2CXLA 4UELA 2J62A 4CN1A 5KX5E 5FXXA 1Y64B 4GOUA 2LT3A 4PK5A 3ANWA 3L8RA 4DV6T 3ZN0B 1G73A 1D0YA 2ES0A 4QH4A 4O4JE 3TLUA 1NENA 4CI3B 2XZEA 4G63A 4COFA 4ZI3D 4CZZB 4HEAA 5ABFA 3GA8A 3RI5A 3UU6A 3AE6A 4LF4T 5FXZA 2IAKA 4EYUA 2VK9A 5LHHB 2NR4A 2N1GA 3CPZA 2JPFA 3AE2A 5FYMA 4EXTA 1U4QA 2VKDA 2X9XA 2E9XA 5AQNB 3LK42 1YQ3A 2KINB 2OA5A 5HCMA 4CN6A 2UUCT 2JQKA 4AKHA 5GONE 3MZKB 3SOLA 4YJ2E 3ONJA 4U3CA 4PAGA 1LVKA 3I9YA 2H88A 2BS3A 4EEDA 2X9YA 4IE7A 2PG8A 1VCTA 3B5MA 3O1IA 4JEHB 4JEUB 5FP3A 2KT9A 4ISSA 2NTXA 2AXDS 2C5JA 4AKLA 2XY8B 4DR7T 2VL0A 5JDFA 2W62A 3OYXA 4U72A 5LXTE 2FUPA 3RKGA 5CJ5A 4TX5A 4DMWA 4JBWF 4BAYB 1S94A 1YKHB 3LSVA 3VRBA 5HWYA 5FL0A 4JUYA 3FZKB 3IF8B 3C4ZA 3QUJA 2YK0A 3CQCB 3Q5WA 1MMDA 3RIUA 4YT0A 3ETVA 3RGLA 4MHCA 3C64A 2JMHA 5AQPB 5AQHB 3ONXA 4KBMB 2WWVA 4KUMB 1GQEA 5FXVA 2W67A 4DUYT 2LOSA 4UVAB 2IW5B 4CXWA 5HXCA 4NIQA 1OXZA 3ZC0A 1X9BA 5HEGA 4TNWA 3PUVF 1YW0A 3U78A 1Z8UA 2CHNA 1HNWT 2VKOA 4V1Av 1I94T 2WZHA 5AQKB 4X62T 2D0TA 1HG5A 3TLVA 4TV8E 5HXSA 2HN2A 2W4XA 2K48A 2FJDA 2XAJB 2WU2A 2VURA 1ZHCA 4A5XA 5LA6E 1D0ZA 4AQYT 5AFUL 3ZKRA 3ZMZB 2XAQB 3UU4A 3T8OA 4UVBB 4KMCA 2V7IA 4MBQA 1WLXA 2EHOB 2BZBA 3EHZA 4ZI2C 3QNUA 4HTEA 2C5KT 1WYCA 3FZMB 3AE7A 4WNKA 5BR8T 5L2LA 1MIYA 2RA1A 2KMFA 4NUUA 2VKJA 5AQLB 1KEYA 1YKEB 3PUAA 5HXHA 2BDEA 5ABEA 1FJGT 2HPLA 4U31A 3HKEE 3KBTA 2XQYA 3QB5K 3ZSTA 4EZ4A 3RRWA 2EHOD 2YDSA 2QVAA 4DV3T 4DV2T 1WR6A 3AE9A 2QRXA 4A97A 3BQLA 4DR6T 1N32T 4G2AA 2JMKA 4ZZCA 3F2EA 4P1NA 3IBPA 2HHHT 1QLBA 2V6YB 2VWAA 4L5GA 5LYJE 2JRKA 1ZV4X 3N9QA 3Q5XA 1VRBA 3N2OA 3LBXB 3L3PA 5JDGA 5JR9C 3J7Yq 2I59A 1US7B 2K9AA 3EDUA 3ZT5A 1BR4A 3AEEA 2IUBA 5LG3A 1O3XA 4UXNB 5DABA 4HKAA 1OWAA 2CLYC 4FJOA 1IZNB 1D1AA 4EB6E 3ANWB 2R6GF 1H7CA 3LFMA 2IC9A 2V26A 4PJLA 4X20E 3NKZA 2Q9QA 3T1HT 4BJNA 3CMLA 5ABFB 4JYAT 3EAMA 2CXDA 1FMVA 3BQIA 3RC3A 1W9RA 2DLRA 2A72A 2VL8A 3SS1A 3VKHA 2IDOB 3PJAJ 4AI6A 3JADA 2E9XB 3NBXX 3X1DA 3JC6C 3S4UA 3R84B 1W0AA 2LM9A 4UF0B 2H89A 3RHWA 4F6RC 4Q25A 2Z6EA 5L3CB 2C5IT 4YTPA 3ABVA 3IEEA 4TUYE 2W00A 5HEUA 5LJMA 2YKSA 4I43B 2D9DA 1VOMA 5J2UE 2E9XD 2NP9A 2WSSV 2DI4A 1KNRA 1J1JA 3GMIA 2M67A 4QX7B 4BA9A 5LB7B 3NRXA 2LSIA 4H9SE 1KF6A 2J1DG 2IC6A 4JI5T 2XQ8A 2BS4A 4HWCA 4U33A 1ZEEA 3AVSA 4U2ZA 2HH7A 4DMVA 1E7PA 5H6QB 2BVLA 2LE8A 2X0LB 3SWHA 2NOXA 1Z0PA 1WRDA 1BR2A 3ZCIA 1HFAA 1BR0A 4YTMA 2FJBA 4H9RC 1OEDC 3AVRA 2VVNA 4IDQA 2ZLYA 3AAEB 5M4YA 2LRLA 3KVBA 3FZFB 1XNRT 4H9NC 2X68A 4IE5A 3CWZB 2VQFT 1FMWA 3AEAA 1LRZA 5JTGA 2LKHA 5JDLA 4LF8T 4HE8A 1M7KA 1M62A 3PUSA 4GYRA 4O8SA 3UUBA 3I1AA 1CHUA 2CA5A 5L3EB 3G06A 4IDPA 2XQ5A 3VR8A 4TWDA 3KBUA 5LOVE 2XQ4A 4TV9E 2W0GA 3V5SA 4IDOA 2XQ3A 2NW7A 5HYAA 1CUNA 2PJQA 2LEHA 5DQWA 3KINB 2XQ6A 3Q5DA 3ZMTB 4H9OC 1XZYA 2NWBA 1B7TA 4HFCA 3RKOA 3DJBA 4JI6T 2MTQA 4DBQA 3AB3B 4IL4A 1V9DA 3QB5A 2KZ7B 2X66A 3OVUA 1JNZA 1S35A 5DQVA 3LK3B 4DBRA 2MBGA 2IHR1 2V7KA 3AECA 4UEMA 1FIOA 3AEFA 5JR9A 2QA7A 2CHOA 4WW0A 2PTFA 3E0ZA 3CX6B 3UUMA 4LF9T 1UURA 3H3AA 3N9PA 1MMGA 2BG9E 3HR0A 5KDMC 3OYZA 4UV9B 4IL9A 3IA3A 4UV8B 3K1SA 3MK7C 4WYVA 3N9NA 4QXCB 5IUXA 2LKGA 5JDNA 3RYHE 2KWHA 3R6NA 2RP4A 2FJAA 2BG9C 5HCJA 4AQGA 2KXPB 1KFYA 3MA9A 2X0HA 4UF0A 3PU8A 2Q9QB 3P4SA 2Q9QC 3O1JA 2H7VC 1UX4A 3Q9DA 4YHJA 5FVLA 4YJ3E 2HN1A 3UUXB 3P7IA 4OK0A 3EABA 4TNVA 4WZXA 2UUBT 4MALA 3RPUA 3Q5EA 2RPAA 4H63H 2Q9QD 4XAXB 2ZM2A 4JI2T 2XUEA 2ZM8A 3TKLB 2CEAA 4PJNA 4J2CA 4DIDB 1XDPA 4DR5T 5EK3A 5IWAT 2WDQA 5DJQC 2WZIA 2SPCA 3BQKA 1OEDA 4I55E 1UK5A 1NEKA 3AE5A 4PK6A 4GKKT 4ILBA 4Z91A 2L9QA 5AQFB 2BKOA 1KK7A 3KV6A 3AAIA 4GYSA 3C50A 2MPKA 2PBIA 1D1CA 5LGUB 2XAGB 1XMOT 3ZT6A 5AQSB 3PUYF 4ERRA 5F5WA 4ZEYA 1SE7A 5KXJA 2DCFA 4HFBA 2C0SA 3NWIA 4OYKA 2IMLA 1VCSA 3N9MA 4UR9A 5KMGP 5FMNA 5LNKA 4KHPT 4GKJT 5IHYA 5AQMB 2KWIB 5AQQB 4PFOA 4LFCT 4EV6A 4E7SA 2WMOA 4NXMT 2LLYA 3L09A 3P4WA 3A5XA 4NPPA 5LJNA 3BK9A 3ZJ2A 4DNDA 3PUWF 4A98A 5LG4A 3KVAA 2GK9A 3P4QA 2IIUA 2ODUA 4HFIA 4AQFC 1D1BA 2CBIA 2D0UA 3ZCJA 1SHZC 4ZS3A 3RQWA 3M65A 1ZOYA 5JQGE 2A9UA 1I6ZA 4LF5T 2V8SV 1DU2A 3RYCE 2OV9A 3VU7H 2KLQA 3AEBA 4XZCA 4HFEA 3W15B 3I0OA 3NZPA 3ZLIA 4AKGA 2D2SA 4ZI2D 2A2FX 1NAFA 2YU2A 3O9XA 2XQ9A 2JQQA 2XQ7A 3WI3A 3H37A 5CGMA 3VKGA 4IGUA 3AA7B 2ACXA 2X67A 5CA1E 4DR4T 4PJJA 2F4VT 4X65T 4PFPA 5AQRB 5ABGA 5JDMA 5JR9B 4LFAT 4HGAA 3FXDB 2WS3A 4N78D 5AQTB 3QK6A 2ACZA 3C98B 2I0MA 2CLYB 2BG9A 5L47A 4PW8A 5AQOB 2Y48B 4IE6A 2XM2A 5JRCA 2CRBA 5FXWA 3SRZA 4DVDA 3CKDA 1MIVA 1HX1B 1SUMB 4XBFB 4JI8T 4LMJA 3ZC1A 2N2NA 4ZHQE 3FZLB 5L3GB 2WCAA 2WAUA 1MMAA 2MYSA 2AE9A 2W63A 2W66A 2ZMAA 5F3JA 1LVFA 2E5LT 3ONLC 3QOFA 2LM2A 3M3ZB 4NUVA 2V7JA 2CXFA 1MNDA 2LHRA 4EGWA 2VKHA 4IDZA 4K0KT 4EOZB 2MOZA 1WYBA 3FXEB 5FY1A 1YQ4A 5AQVB 3JC6D 3VR9A 4TWHA 2OLTA 1ZP0A 4U7YA 2CMRA 5L3DB 4GK5E 4I4TE 4ANJA 1IBMT 3TLTA 4HFDA 5ETWA 2YOEA 2HPJA 5EK2A 2YINA 2ODVA 3GN5A 3H3MA 1XNQT 4IREA 3AA0B 3UT5E 4YSXA 3EUHA 2WBLA 2WDVA 4X64T 4B3ST 2V6XA 1IBLT 5LHIB 3SFEA 3CQXC 4C90A 2CE7A 4ZS2A 2H3RA 4JLEA 3OJAA 4HWDA 1OEDB 4AKIA 2YEVC 2QGSA 1L0VA 5HXEA 2CBJA 1IBKT 4EAHA 4U7IA 2NW9A 3CIRA 3ZYMA 4KX6A 5CA0E 2KSRA 3QC9A 5FY0A 3N9OA 4CQIA 2UXDT 4OHFA
chains in the Genus database with same CATH topology
2LJLA 2WM9A 4IHJE 3R6NA 4AQFA 2RP4A 4P0BA 4X1YE 4M1PA 2VKOA 4V1Av 3E08A 2LSKA 2LSYA 5F8PA 4PNIA 3CVRA 1IJ5A 3ETUA 2XASB 2VASA 4AQGA 3AA6B 1HX8A 2KXPB 5JH7E 5L3FB 3DTOA 3MA9A 2D0TA 3UULA 3PDYA 4PJMA 1HG5A 4UF0A 2BVMA 4TV8E 4ISTA 3PU8A 5HXSA 2W61A 4IE0A 4AXPA 2Q9QB 2K48A 2Q9QC 2XAJB 1ZHCA 2N9DA 3O1JA 5IYZE 5LA6E 2H7VC 4A56A 2LSJA 2X51A 1UX4A 3KV9A 3MJXA 1D0ZA 4U74A 2L8KA 5AFUL 3C51A 3Q9DA 4YFSA 3HKCE 4IE4A 4L9IA 4YHJA 3ZMZB 4QXBB 3ZMSB 4YJ3E 4C91A 3Q2MA 3UUXB 2XAQB 3P7IA 3V5UA 3ZYKA 3T8OA 4OK0A 4ZI7E 4UVBB 4WBNE 2XHEB 5EZYE 3EVYA 4KMCA 2E9XC 2V7IA 4MBQA 4K0UA 5HAXA 1WLXA 4MALA 3RPUA 2EHOB 2BZBA 4CXXA 4O4IE 4ZI2C 3GWHA 5BMVE 4HTEA 4H63H 2Q9QD 2NW8A 2C5KT 1WYCA 1X79A 3EDVA 4XAXB 2ZM2A 4WNKA 3KDSE 3WAKA 5L2LA 1MIYA 2RA1A 1G8XA 3F57A 3KFWX 5HWXA 3HKDE 3N9LA 4IIJE 2KMFA 3O1HA 4NUUA 2XUEA 2VKJA 2ZM8A 1IAPA 4ILUA 3ZJ1A 4O4LE 3TKLB 2CEAA 1YKEB 2B1EA 4PJNA 2DHRA 3B13A 4J2CA 3RX6A 3PUAA 3UUNA 5HXHA 2X9WA 2BDEA 4QXHB 1AJ3A 4I50E 4QWNB 4Z8XA 5FNVE 2HPLA 1E1HB 3HKEE 4EYYR 3KBTA 2XQYA 4EZ4A 2DWKA 3RRWA 1ZKEA 2EHOD 5EK3A 3NZQA 5DJQC 3ZEFB 3K3NA 5L3BB 3ESLA 1WR6A 2SPCA 3BQKA 3BQLA 2Y8DA 1YD8G 4I55E 2K5BB 5JVDE 4G2AA 3HA4A 3I9WA 3PTRB 4H63V 4PK6A 2JMKA 2DNXA 2L9QA 1KK7A 3KV6A 4O4HE 3F2EA 1MNEA 4MLKA 2UXNB 3AAIA 4GYSA 3C50A 2PBIA 3K8PC 4ZI3C 1FEWA 1D1CA 3IBPA 5LGUB 4QHOA 2XAGB 4L5GA 2VWAA 5LYJE 5CB4E 3LG7A 2JRKA 3ZN1B 1ZV4X 2CM0A 3N9QA 1VRBA 3Q5XA 4B6XA 5LP6E 3N2OA 3LBXB 4ERRA 3FBZA 3L3PA 3RYFE 5JDGA 2DCFA 5JR9C 2C0SA 5J2TE 3J7Yq 2I59A 1US7B 3P8CD 2K9AA 5LCYA 3EDUA 3U3IA 3N2GE 4OYKA 1BR4A 3OBVE 1SA0E 3N9MA 4TN7B 3E22E 1O3XA 2E8IA 4UXNB 5DABA 1UX5A 5KMGP 5FMNA 3KV5A 5LNKA 1HCIA 1OWAA 2CLYC 1T98A 4HKAA 4GK0E 4FJOA 1IZNB 1D1AA 1NWMX 3ANWB 3FB2A 3N5LA 4WBOA 1H7CA 4EB6E 5IHYA 3ZMUB 2PFVA 3LFMA 3LJCA 2IC9A 1QSDA 2V26A 2KWIB 4PJLA 4PFOA 4AKRB 4X20E 2NTYA 2Q9QA 3K3QC 2CWYA 4BJNA 3CMLA 1IJ6A 4E7SA 2WMOA 3L09A 3A5XA 5LJNA 2CXDA 5A1LA 1FMVA 3BK9A 2D5UA 3ZJ2A 5JRCB 3BQIA 3MACA 3DP7A 4DNDA 3RC3A 2V7MA 2DLRA 5LG4A 3KVAA 2A72A 2VL8A 2GK9A 4P09A 3MXZA 3C4XA 2ODUA 3SS1A 4AQFC 2EHOA 3VKHA 3K3OA 1D1BA 2D0UA 4EZHA 5ADXL 4AI6A 4H9QC 1BR1A 2E9XB 3NBXX 1MIWA 3UTKA 3JC6C 3S4UA 5JDQA 5E0OA 3ZCJA 1SHZC 3R84B 2XAHB 4HFVA 2LM9A 4DO0A 4ZS3A 4UF0B 2LOPA 3ZYLA 5LBMA 3M65A 4F6RC 2Z6EA 5JQGE 5L3CB 2C5IT 3IEEA 3RYCE 5LGNB 3VU7H 4TUYE 3HI2A 2W00A 3AAAB 2KLQA 3B57A 4XZCA 5LJMA 2X9HA 2WWUA 4I43B 4PK4A 2ZM0A 1VOMA 3W15B 5J2UE 3I0OA 3NZPA 2E9XD 2NP9A 2WSSV 2XAFB 3ZLIA 4AKGA 2DI4A 2D2SA 3ZPOA 4O2BE 4ZI2D 2A2FX 1NAFA 2YU2A 3AA1B 3O9XA 2KNDA 2M67A 3GMIA 2L3LA 4QX7B 2H7OA 4BA9A 1MMNA 3NRXA 2JQQA 4H9PC 5HXRA 3WI3A 2LSIA 3H37A 4FI5A 3VKGA 4P0AA 4YLHA 5LHGB 2V7LA 4H9SE 2J1DG 2XTLA 3KV4A 2IC6A 4CI1B 1HF8A 2JJ9A 2A3DA 4IGUA 3PE0A 1HG2A 3AA7B 2UXXB 3LBXA 2DWGA 4GIWA 2ACXA 2X67A 5CA1E 1ZEEA 3AVSA 4PJJA 2V1DB 2CWOA 2CXLA 3GN5B 2HH7A 4UELA 3ZMVB 5KX5E 4DMVA 4PFPA 5H6QB 2BVLA 2LE8A 2X0LB 3OKQA 3SWHA 5FXXA 5JDMA 1Y64B 2NOXA 5JR9B 3J9X1 1Z0PA 1WRDA 1BR2A 4HGAA 4GOUA 2LT3A 3FXDB 3O4XE 4PK5A 3ZCIA 1HFAA 2P9BA 4CI2B 3ANWA 4N78D 1BR0A 3QK6A 3ZN0B 1G73A 5JDHA 1D0YA 2ES0A 4H9RC 3CQGB 3PUGA 3C98B 4O4JE 2CLYB 3AVRA 3AAEB 2ZLYA 3FBLA 4G63A 4CI3B 5M4YA 3F31A 3KVBA 4PW8A 1QUUA 5FY7A 4ZI3D 4CZZB 2Y48B 4H9NC 2X68A 3PUQA 4HEAA 4IE6A 4IE5A 3VHLA 5JREA 3CWZB 3GA8A 1FMWA 1LRZA 5JDLA 5JRCA 4ADZA 5FXWA 5FXZA 3SRZA 4DVDA 2IAKA 4HE8A 4X1KE 5EK4A 4EYUA 3PUSA 4GYRA 2VK9A 3CKDA 5LHHB 4O8SA 1MIVA 2N1GA 4OYJA 4UVCB 5LGTB 5TAOA 2CCQA 3CPZA 2JPFA 4XBFB 3I1AA 5FYMA 2CA5A 4EXTA 5L3EB 1U4QA 3ZC1A 3RRCA 2N2NA 2VKDA 2X9XA 3HKBE 2E9XA 3KBUA 4TZ4C 3RH3A 4ZHQE 5LOVE 5L3GB 3LK42 3UFEA 2WAUA 2Y6XA 1MMAA 4TV9E 2W0GA 3V5SA 2KINB 2OA5A 1EZ3A 2NW7A 2MYSA 5HYAA 2W63A 2ZMAA 1CUNA 5F3JA 2PJQA 1LVFA 2LSGA 4AKHA 5J1GA 2LEHA 3MZKB 5GONE 3SOLA 5DQWA 3C4WA 3KINB 4YJ2E 4PAGA 1LVKA 4HN9A 3I9YA 3ZMTB 4L0RA 4NUVA 2X9YA 2V7JA 2CXFA 4H9OC 4IE7A 2PG8A 2NWBA 1MNDA 2LHRA 1LKXA 1B7TA 3IHRA 4EIWA 4MFRA 5C8YE 3O1IA 2VKHA 3MKDA 5H6RB 4IDZA 3PU3A 4JEHB 2MOZA 4EOZB 1WYBA 3RKOA 4JEUB 5FP3A 2KT9A 2EHOC 4ISSA 3FXEB 5FY1A 3DJBA 2NTXA 4AKLA 2C5JA 4E7ZA 2MTQA 3JC6D 4DBQA 3AB3B 4ASKA 2CMRA 5L3DB 1V9DA 5JDFA 2KZ7B 4GK5E 2W62A 2X66A 2VB6A 4I4TE 4ANJA 3CX7B 3OYXA 4U72A 5ETWA 2HPJA 3D0TA 1S35A 4QKNA 3CX8B 4OFZA 5DQVA 5LXTE 5EK2A 3FHNA 2YINA 3LK3B 5LBQB 3RYIE 4DBRA 2MBGA 2ODVA 2V7KA 3GN5A 4UEMA 3PURA 4TX5A 4DMWA 1UCUA 3AA0B 1HTJF 1FIOA 3NRYA 3UT5E 4BAYB 1S94A 3EUHA 5JR9A 1YKHB 5HWYA 2WBLA 4JUYA 2QA7A 4CXYA 3IF8B 3C4ZA 3QUJA 2YK0A 3CQCB 3I0QA 3Q5WA 4QX8B 1MMDA 4WW0A 3HL6A 3ETVA 4ZOLE 3E0ZA 5LHIB 3CX6B 3UUMA 4MHCA 3C64A 3H3AA 3CQXC 4C90A 2CE7A 2JMHA 3N9PA 2H3RA 4JLEA 1MMGA 4ZS2A 3OJAA 4KP3C 4O2AE 2K24A 3ONXA 3WAJA 4KBMB 1KNZA 3LK2B 4AKIA 2YEVC 4KUMB 5FXVA 2G0UA 3HR0A 3N2KE 2YU1A 2QGSA 5KDMC 3OYZA 2WMNA 5HXEA 2LOSA 4UV9B 4UVAB 2IW5B 4EAHA 2NW9A 4CXWA 1D0XA 4UV8B 5HXCA 3ZYMA 5CA0E 2LHNA 3QC9A 3RC8A 1OXZA 4X1IE 3ZC0A 5FY0A 4UIGA 3MK7C 3N9NA 3N9OA 4CQIA 4QXCB 4BJMA 5JDNA 1U5PA 1YW0A 1HS7A 4OHFA 3U78A 3RYHE 2KWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEW A;  2DNX A;  1BR0 A;  1EZ3 A;  1S94 A;  1G73 A;  4TX5 A;  5M4Y A;  1HS7 A;  4JEH B;  4JEU B;  1FIO A;  3C98 B;  2XHE B;  3LG7 A;  5LG4 A; 
#chains in the Genus database with same CATH topology
 4IHJ E;  2WM9 A;  4AQF A;  4X1Y E;  4M1P A;  1N36 T;  2WQY A;  3RQU A;  3PUZ F;  1E2A A;  4PNI A;  3CVR A;  1IJ5 A;  3AA6 B;  1HX8 A;  3UUL A;  2BVM A;  3RIF A;  2LSJ A;  1HNX T;  3KV9 A;  3C51 A;  4YFS A;  4L9I A;  4QH1 A;  4QXB B;  4DV0 T;  3V5U A;  3P4R A;  2BKN A;  5C2T A;  5HAX A;  3UQ7 A;  4CXX A;  3GWH A;  2NW8 A;  5LMU T;  2VQE T;  2UXB T;  1X79 A;  4B3T T;  3AE8 A;  3WAK A;  3F57 A;  5HWX A;  4JI3 T;  3N9L A;  5FVK A;  2YN6 A;  3TLS A;  4ILU A;  3ZJ1 A;  1HR0 T;  3B13 A;  3RX6 A;  3UUN A;  4ILA A;  2X9W A;  1AJ3 A;  2J4G A;  2CPT A;  4Z8X A;  2XM1 A;  2BS2 A;  4U2Y A;  1E1H B;  4JV5 T;  2DWK A;  1ZKE A;  3NZQ A;  3AEG A;  3K3N A;  4IDN A;  5L3B B;  2Y8D A;  1YD8 G;  5JVD E;  3PTR B;  4H63 V;  1W0B A;  2BBJ A;  2DNX A;  4O4H E;  1MNE A;  4MLK A;  2WP9 A;  3PV0 F;  5J0Z A;  4ZI3 C;  3SFD A;  4HFH A;  4QHO A;  4YY3 T;  2CM0 A;  3RYF E;  4LF7 T;  5J2T E;  3U3I A;  3ZSS A;  3ZT7 A;  2B76 A;  1SA0 E;  2BKP A;  2E8I A;  2WDR A;  2V5C A;  4YXD A;  4WBO A;  3FB2 A;  2JQ9 A;  3ZMU B;  2PFV A;  1QSD A;  2NTY A;  2UXC T;  2BG9 B;  3K3Q C;  4JI4 T;  1IJ6 A;  2D5U A;  3UQ4 A;  5JRC B;  2YDR A;  4HWI B;  3DP7 A;  3L39 A;  2V7M A;  4P09 A;  4TWF A;  2E5V A;  5ADX L;  3UTK A;  5JDQ A;  5E0O A;  3OPC A;  2XAH B;  4HFV A;  4DO0 A;  4DR3 T;  1WR0 A;  5LGN B;  3HI2 A;  5FL1 A;  3A8Y C;  3AAA B;  3B57 A;  4B3M T;  2X9H A;  2W2U A;  4PK4 A;  2XPK A;  4JI0 T;  4I0U A;  4QH5 A;  3ZPO A;  4O2B E;  3AA1 B;  2KND A;  4X5T A;  2L3L A;  2H7O A;  4H9P C;  4YSZ A;  4FI5 A;  4YLH A;  2XTL A;  3KV4 A;  4CI1 B;  2UXX B;  2DWG A;  2WY2 A;  3NVO A;  4GIW A;  3GN5 B;  3ZMV B;  1W09 A;  3OKQ A;  3AXJ B;  3J9X 1;  3O4X E;  4CI2 B;  2P9B A;  3PJA A;  5AQU B;  5JDH A;  3CQG B;  3PUG A;  3A7M A;  2K3W A;  3AED A;  3FBL A;  3F31 A;  1QUU A;  5FY7 A;  5JRE A;  3VHL A;  3PUQ A;  1JNR A;  4ADZ A;  1UUS A;  4X1K E;  5EK4 A;  1J5W A;  4OYJ A;  4UVC B;  5LGT B;  4DV7 T;  5TAO A;  2CCQ A;  1J5E T;  4B3R T;  4OX9 T;  3RRC A;  3UU3 A;  3HKB E;  4TZ4 C;  3TLW A;  3RH3 A;  3UFE A;  2Y6X A;  1EZ3 A;  4LFB T;  4EEB A;  2LSG A;  5J1G A;  3C4W A;  2M6I A;  4HN9 A;  3RIA A;  3FZH B;  4JI1 T;  4L0R A;  1LKX A;  3IHR A;  4EIW A;  4MFR A;  5C8Y E;  4HWF A;  5H6R B;  3MKD A;  3PU3 A;  2EHO C;  1UGO A;  1KNP A;  3P4P A;  4E7Z A;  4ASK A;  4DV5 T;  2UUA T;  4DR1 T;  2JQH A;  2VB6 A;  3CX7 B;  4F8H A;  3EI0 A;  2XQA A;  3D0T A;  4QKN A;  3CX8 B;  4LMK A;  4OFZ A;  3FHN A;  3RYI E;  5LBQ B;  3RLF F;  2BBH A;  3PUR A;  1UCU A;  1HTJ F;  3NRY A;  1T7S A;  4CXY A;  3I0Q A;  4QX8 B;  3AE4 A;  3HL6 A;  4ZOL E;  4KP3 C;  4O2A E;  2K24 A;  3WAJ A;  1KNZ A;  2VVS A;  3LK2 B;  2WB5 A;  2G0U A;  3N2K E;  4Z90 A;  2YU1 A;  2WMN A;  2V5D A;  1D0X A;  2LHN A;  3UU8 A;  3RC8 A;  4X1I E;  4UIG A;  2I6H A;  3AE3 A;  2WU5 A;  4BJM A;  1HS7 A;  1U5P A;  2LJL A;  4P0B A;  3E08 A;  2LSK A;  1YXR A;  2LSY A;  1XMQ T;  5F8P A;  4YHH T;  3ETU A;  4AIU A;  2XAS B;  2VAS A;  5JH7 E;  5L3F B;  1N33 T;  3DTO A;  3UU5 A;  5FKY A;  3PDY A;  4PJM A;  4IST A;  5AQG B;  2W61 A;  4IE0 A;  1WFD A;  4AXP A;  2X0Y A;  2N9D A;  5HEO A;  5IYZ E;  4A56 A;  2X51 A;  3MJX A;  4U74 A;  2L8K A;  3JAE A;  3HKC E;  4IE4 A;  3ZMS B;  4LML A;  4C91 A;  3Q2M A;  2QYW A;  2YDQ A;  3ZYK A;  4ZI7 E;  4WBN E;  2XHE B;  5EZY E;  3EVY A;  2E9X C;  4K0U A;  2UU9 T;  4O4I E;  5BMV E;  3EDV A;  2ZM6 T;  3KDS E;  1XDO A;  5C3J A;  1G8X A;  3KFW X;  3HKD E;  4IIJ E;  4ILC A;  3O1H A;  1IAP A;  4O4L E;  2B1E A;  2M6B A;  2DHR A;  5L4H A;  4QXH B;  4I50 E;  4QWN B;  5FNV E;  3CK6 A;  3AXJ A;  4EYY R;  1OED E;  1Y01 A;  3UFG A;  3ZEF B;  2FBW A;  3ESL A;  4ZZB A;  5HEJ A;  2K5B B;  3T1Y T;  3HA4 A;  4IT4 A;  3I9W A;  4AIS A;  2UXN B;  2J47 A;  3K8P C;  1FEW A;  2JIW A;  5CB4 E;  3LG7 A;  4B6X A;  3ZN1 B;  3AE1 A;  5LP6 E;  1XWM A;  3LDQ B;  3FBZ A;  4NXN T;  5ABH A;  5CFB A;  2LRK A;  2MAW A;  5HEH A;  3P8C D;  5LCY A;  3N2G E;  4YSY A;  3OBV E;  3RIU C;  4TN7 B;  3E22 E;  1WCR A;  1UX5 A;  3P50 A;  3KV5 A;  1HCI A;  1T98 A;  2E2A A;  4GK0 E;  1HNZ T;  1NWM X;  3N5L A;  5AQJ B;  3LJC A;  3RF1 A;  4AKR B;  4DV1 T;  1T72 A;  3PUX F;  2DL1 A;  2CWY A;  2XJ7 A;  5A1L A;  4ZXL A;  3MAC A;  2XSA A;  4KI0 F;  3OTO T;  4LF6 T;  3MXZ A;  3C4X A;  3VRA A;  2EHO A;  4X66 T;  3K3O A;  4EZH A;  2FJE A;  4H9Q C;  1BR1 A;  5AQI B;  1MIW A;  1N34 T;  2XSB A;  2LOP A;  3ZYL A;  5LBM A;  1T8B A;  3JCF A;  4DR2 T;  2WWU A;  2ZM0 A;  5L4E A;  4KHZ F;  2XAF B;  3JAF A;  1R8I A;  4YTN A;  1MMN A;  5HXR A;  4P0A A;  5LMN T;  4DUZ T;  5LHG B;  2V7L A;  4HWH A;  2V6Y A;  1HF8 A;  4DV4 T;  2JJ9 A;  2A3D A;  4CN4 A;  3PE0 A;  1HG2 A;  3LBX A;  4JI7 T;  2V1D B;  2CWO A;  2CXL A;  4UEL A;  2J62 A;  4CN1 A;  5KX5 E;  5FXX A;  1Y64 B;  4GOU A;  2LT3 A;  4PK5 A;  3ANW A;  3L8R A;  4DV6 T;  3ZN0 B;  1G73 A;  1D0Y A;  2ES0 A;  4QH4 A;  4O4J E;  3TLU A;  1NEN A;  4CI3 B;  2XZE A;  4G63 A;  4COF A;  4ZI3 D;  4CZZ B;  4HEA A;  5ABF A;  3GA8 A;  3RI5 A;  3UU6 A;  3AE6 A;  4LF4 T;  5FXZ A;  2IAK A;  4EYU A;  2VK9 A;  5LHH B;  2NR4 A;  2N1G A;  3CPZ A;  2JPF A;  3AE2 A;  5FYM A;  4EXT A;  1U4Q A;  2VKD A;  2X9X A;  2E9X A;  5AQN B;  3LK4 2;  1YQ3 A;  2KIN B;  2OA5 A;  5HCM A;  4CN6 A;  2UUC T;  2JQK A;  4AKH A;  5GON E;  3MZK B;  3SOL A;  4YJ2 E;  3ONJ A;  4U3C A;  4PAG A;  1LVK A;  3I9Y A;  2H88 A;  2BS3 A;  4EED A;  2X9Y A;  4IE7 A;  2PG8 A;  1VCT A;  3B5M A;  3O1I A;  4JEH B;  4JEU B;  5FP3 A;  2KT9 A;  4ISS A;  2NTX A;  2AXD S;  2C5J A;  4AKL A;  2XY8 B;  4DR7 T;  2VL0 A;  5JDF A;  2W62 A;  3OYX A;  4U72 A;  5LXT E;  2FUP A;  3RKG A;  5CJ5 A;  4TX5 A;  4DMW A;  4JBW F;  4BAY B;  1S94 A;  1YKH B;  3LSV A;  3VRB A;  5HWY A;  5FL0 A;  4JUY A;  3FZK B;  3IF8 B;  3C4Z A;  3QUJ A;  2YK0 A;  3CQC B;  3Q5W A;  1MMD A;  3RIU A;  4YT0 A;  3ETV A;  3RGL A;  4MHC A;  3C64 A;  2JMH A;  5AQP B;  5AQH B;  3ONX A;  4KBM B;  2WWV A;  4KUM B;  1GQE A;  5FXV A;  2W67 A;  4DUY T;  2LOS A;  4UVA B;  2IW5 B;  4CXW A;  5HXC A;  4NIQ A;  1OXZ A;  3ZC0 A;  1X9B A;  5HEG A;  4TNW A;  3PUV F;  1YW0 A;  3U78 A;  1Z8U A;  2CHN A;  1HNW T;  2VKO A;  4V1A v;  1I94 T;  2WZH A;  5AQK B;  4X62 T;  2D0T A;  1HG5 A;  3TLV A;  4TV8 E;  5HXS A;  2HN2 A;  2W4X A;  2K48 A;  2FJD A;  2XAJ B;  2WU2 A;  2VUR A;  1ZHC A;  4A5X A;  5LA6 E;  1D0Z A;  4AQY T;  5AFU L;  3ZKR A;  3ZMZ B;  2XAQ B;  3UU4 A;  3T8O A;  4UVB B;  4KMC A;  2V7I A;  4MBQ A;  1WLX A;  2EHO B;  2BZB A;  3EHZ A;  4ZI2 C;  3QNU A;  4HTE A;  2C5K T;  1WYC A;  3FZM B;  3AE7 A;  4WNK A;  5BR8 T;  5L2L A;  1MIY A;  2RA1 A;  2KMF A;  4NUU A;  2VKJ A;  5AQL B;  1KEY A;  1YKE B;  3PUA A;  5HXH A;  2BDE A;  5ABE A;  1FJG T;  2HPL A;  4U31 A;  3HKE E;  3KBT A;  2XQY A;  3QB5 K;  3ZST A;  4EZ4 A;  3RRW A;  2EHO D;  2YDS A;  2QVA A;  4DV3 T;  4DV2 T;  1WR6 A;  3AE9 A;  2QRX A;  4A97 A;  3BQL A;  4DR6 T;  1N32 T;  4G2A A;  2JMK A;  4ZZC A;  3F2E A;  4P1N A;  3IBP A;  2HHH T;  1QLB A;  2V6Y B;  2VWA A;  4L5G A;  5LYJ E;  2JRK A;  1ZV4 X;  3N9Q A;  3Q5X A;  1VRB A;  3N2O A;  3LBX B;  3L3P A;  5JDG A;  5JR9 C;  3J7Y q;  2I59 A;  1US7 B;  2K9A A;  3EDU A;  3ZT5 A;  1BR4 A;  3AEE A;  2IUB A;  5LG3 A;  1O3X A;  4UXN B;  5DAB A;  4HKA A;  1OWA A;  2CLY C;  4FJO A;  1IZN B;  1D1A A;  4EB6 E;  3ANW B;  2R6G F;  1H7C A;  3LFM A;  2IC9 A;  2V26 A;  4PJL A;  4X20 E;  3NKZ A;  2Q9Q A;  3T1H T;  4BJN A;  3CML A;  5ABF B;  4JYA T;  3EAM A;  2CXD A;  1FMV A;  3BQI A;  3RC3 A;  1W9R A;  2DLR A;  2A72 A;  2VL8 A;  3SS1 A;  3VKH A;  2IDO B;  3PJA J;  4AI6 A;  3JAD A;  2E9X B;  3NBX X;  3X1D A;  3JC6 C;  3S4U A;  3R84 B;  1W0A A;  2LM9 A;  4UF0 B;  2H89 A;  3RHW A;  4F6R C;  4Q25 A;  2Z6E A;  5L3C B;  2C5I T;  4YTP A;  3ABV A;  3IEE A;  4TUY E;  2W00 A;  5HEU A;  5LJM A;  2YKS A;  4I43 B;  2D9D A;  1VOM A;  5J2U E;  2E9X D;  2NP9 A;  2WSS V;  2DI4 A;  1KNR A;  1J1J A;  3GMI A;  2M67 A;  4QX7 B;  4BA9 A;  5LB7 B;  3NRX A;  2LSI A;  4H9S E;  1KF6 A;  2J1D G;  2IC6 A;  4JI5 T;  2XQ8 A;  2BS4 A;  4HWC A;  4U33 A;  1ZEE A;  3AVS A;  4U2Z A;  2HH7 A;  4DMV A;  1E7P A;  5H6Q B;  2BVL A;  2LE8 A;  2X0L B;  3SWH A;  2NOX A;  1Z0P A;  1WRD A;  1BR2 A;  3ZCI A;  1HFA A;  1BR0 A;  4YTM A;  2FJB A;  4H9R C;  1OED C;  3AVR A;  2VVN A;  4IDQ A;  2ZLY A;  3AAE B;  5M4Y A;  2LRL A;  3KVB A;  3FZF B;  1XNR T;  4H9N C;  2X68 A;  4IE5 A;  3CWZ B;  2VQF T;  1FMW A;  3AEA A;  1LRZ A;  5JTG A;  2LKH A;  5JDL A;  4LF8 T;  4HE8 A;  1M7K A;  1M62 A;  3PUS A;  4GYR A;  4O8S A;  3UUB A;  3I1A A;  1CHU A;  2CA5 A;  5L3E B;  3G06 A;  4IDP A;  2XQ5 A;  3VR8 A;  4TWD A;  3KBU A;  5LOV E;  2XQ4 A;  4TV9 E;  2W0G A;  3V5S A;  4IDO A;  2XQ3 A;  2NW7 A;  5HYA A;  1CUN A;  2PJQ A;  2LEH A;  5DQW A;  3KIN B;  2XQ6 A;  3Q5D A;  3ZMT B;  4H9O C;  1XZY A;  2NWB A;  1B7T A;  4HFC A;  3RKO A;  3DJB A;  4JI6 T;  2MTQ A;  4DBQ A;  3AB3 B;  4IL4 A;  1V9D A;  3QB5 A;  2KZ7 B;  2X66 A;  3OVU A;  1JNZ A;  1S35 A;  5DQV A;  3LK3 B;  4DBR A;  2MBG A;  2IHR 1;  2V7K A;  3AEC A;  4UEM A;  1FIO A;  3AEF A;  5JR9 A;  2QA7 A;  2CHO A;  4WW0 A;  2PTF A;  3E0Z A;  3CX6 B;  3UUM A;  4LF9 T;  1UUR A;  3H3A A;  3N9P A;  1MMG A;  2BG9 E;  3HR0 A;  5KDM C;  3OYZ A;  4UV9 B;  4IL9 A;  3IA3 A;  4UV8 B;  3K1S A;  3MK7 C;  4WYV A;  3N9N A;  4QXC B;  5IUX A;  2LKG A;  5JDN A;  3RYH E;  2KWH A;  3R6N A;  2RP4 A;  2FJA A;  2BG9 C;  5HCJ A;  4AQG A;  2KXP B;  1KFY A;  3MA9 A;  2X0H A;  4UF0 A;  3PU8 A;  2Q9Q B;  3P4S A;  2Q9Q C;  3O1J A;  2H7V C;  1UX4 A;  3Q9D A;  4YHJ A;  5FVL A;  4YJ3 E;  2HN1 A;  3UUX B;  3P7I A;  4OK0 A;  3EAB A;  4TNV A;  4WZX A;  2UUB T;  4MAL A;  3RPU A;  3Q5E A;  2RPA A;  4H63 H;  2Q9Q D;  4XAX B;  2ZM2 A;  4JI2 T;  2XUE A;  2ZM8 A;  3TKL B;  2CEA A;  4PJN A;  4J2C A;  4DID B;  1XDP A;  4DR5 T;  5EK3 A;  5IWA T;  2WDQ A;  5DJQ C;  2WZI A;  2SPC A;  3BQK A;  1OED A;  4I55 E;  1UK5 A;  1NEK A;  3AE5 A;  4PK6 A;  4GKK T;  4ILB A;  4Z91 A;  2L9Q A;  5AQF B;  2BKO A;  1KK7 A;  3KV6 A;  3AAI A;  4GYS A;  3C50 A;  2MPK A;  2PBI A;  1D1C A;  5LGU B;  2XAG B;  1XMO T;  3ZT6 A;  5AQS B;  3PUY F;  4ERR A;  5F5W A;  4ZEY A;  1SE7 A;  5KXJ A;  2DCF A;  4HFB A;  2C0S A;  3NWI A;  4OYK A;  2IML A;  1VCS A;  3N9M A;  4UR9 A;  5KMG P;  5FMN A;  5LNK A;  4KHP T;  4GKJ T;  5IHY A;  5AQM B;  2KWI B;  5AQQ B;  4PFO A;  4LFC T;  4EV6 A;  4E7S A;  2WMO A;  4NXM T;  2LLY A;  3L09 A;  3P4W A;  3A5X A;  4NPP A;  5LJN A;  3BK9 A;  3ZJ2 A;  4DND A;  3PUW F;  4A98 A;  5LG4 A;  3KVA A;  2GK9 A;  3P4Q A;  2IIU A;  2ODU A;  4HFI A;  4AQF C;  1D1B A;  2CBI A;  2D0U A;  3ZCJ A;  1SHZ C;  4ZS3 A;  3RQW A;  3M65 A;  1ZOY A;  5JQG E;  2A9U A;  1I6Z A;  4LF5 T;  2V8S V;  1DU2 A;  3RYC E;  2OV9 A;  3VU7 H;  2KLQ A;  3AEB A;  4XZC A;  4HFE A;  3W15 B;  3I0O A;  3NZP A;  3ZLI A;  4AKG A;  2D2S A;  4ZI2 D;  2A2F X;  1NAF A;  2YU2 A;  3O9X A;  2XQ9 A;  2JQQ A;  2XQ7 A;  3WI3 A;  3H37 A;  5CGM A;  3VKG A;  4IGU A;  3AA7 B;  2ACX A;  2X67 A;  5CA1 E;  4DR4 T;  4PJJ A;  2F4V T;  4X65 T;  4PFP A;  5AQR B;  5ABG A;  5JDM A;  5JR9 B;  4LFA T;  4HGA A;  3FXD B;  2WS3 A;  4N78 D;  5AQT B;  3QK6 A;  2ACZ A;  3C98 B;  2I0M A;  2CLY B;  2BG9 A;  5L47 A;  4PW8 A;  5AQO B;  2Y48 B;  4IE6 A;  2XM2 A;  5JRC A;  2CRB A;  5FXW A;  3SRZ A;  4DVD A;  3CKD A;  1MIV A;  1HX1 B;  1SUM B;  4XBF B;  4JI8 T;  4LMJ A;  3ZC1 A;  2N2N A;  4ZHQ E;  3FZL B;  5L3G B;  2WCA A;  2WAU A;  1MMA A;  2MYS A;  2AE9 A;  2W63 A;  2W66 A;  2ZMA A;  5F3J A;  1LVF A;  2E5L T;  3ONL C;  3QOF A;  2LM2 A;  3M3Z B;  4NUV A;  2V7J A;  2CXF A;  1MND A;  2LHR A;  4EGW A;  2VKH A;  4IDZ A;  4K0K T;  4EOZ B;  2MOZ A;  1WYB A;  3FXE B;  5FY1 A;  1YQ4 A;  5AQV B;  3JC6 D;  3VR9 A;  4TWH A;  2OLT A;  1ZP0 A;  4U7Y A;  2CMR A;  5L3D B;  4GK5 E;  4I4T E;  4ANJ A;  1IBM T;  3TLT A;  4HFD A;  5ETW A;  2YOE A;  2HPJ A;  5EK2 A;  2YIN A;  2ODV A;  3GN5 A;  3H3M A;  1XNQ T;  4IRE A;  3AA0 B;  3UT5 E;  4YSX A;  3EUH A;  2WBL A;  2WDV A;  4X64 T;  4B3S T;  2V6X A;  1IBL T;  5LHI B;  3SFE A;  3CQX C;  4C90 A;  2CE7 A;  4ZS2 A;  2H3R A;  4JLE A;  3OJA A;  4HWD A;  1OED B;  4AKI A;  2YEV C;  2QGS A;  1L0V A;  5HXE A;  2CBJ A;  1IBK T;  4EAH A;  4U7I A;  2NW9 A;  3CIR A;  3ZYM A;  4KX6 A;  5CA0 E;  2KSR A;  3QC9 A;  5FY0 A;  3N9O A;  4CQI A;  2UXD T;  4OHF A; 
#chains in the Genus database with same CATH homology
 2LJL A;  2WM9 A;  4IHJ E;  3R6N A;  4AQF A;  2RP4 A;  4P0B A;  4X1Y E;  4M1P A;  2VKO A;  4V1A v;  3E08 A;  2LSK A;  2LSY A;  5F8P A;  4PNI A;  3CVR A;  1IJ5 A;  3ETU A;  2XAS B;  2VAS A;  4AQG A;  3AA6 B;  1HX8 A;  2KXP B;  5JH7 E;  5L3F B;  3DTO A;  3MA9 A;  2D0T A;  3UUL A;  3PDY A;  4PJM A;  1HG5 A;  4UF0 A;  2BVM A;  4TV8 E;  4IST A;  3PU8 A;  5HXS A;  2W61 A;  4IE0 A;  4AXP A;  2Q9Q B;  2K48 A;  2Q9Q C;  2XAJ B;  1ZHC A;  2N9D A;  3O1J A;  5IYZ E;  5LA6 E;  2H7V C;  4A56 A;  2LSJ A;  2X51 A;  1UX4 A;  3KV9 A;  3MJX A;  1D0Z A;  4U74 A;  2L8K A;  5AFU L;  3C51 A;  3Q9D A;  4YFS A;  3HKC E;  4IE4 A;  4L9I A;  4YHJ A;  3ZMZ B;  4QXB B;  3ZMS B;  4YJ3 E;  4C91 A;  3Q2M A;  3UUX B;  2XAQ B;  3P7I A;  3V5U A;  3ZYK A;  3T8O A;  4OK0 A;  4ZI7 E;  4UVB B;  4WBN E;  2XHE B;  5EZY E;  3EVY A;  4KMC A;  2E9X C;  2V7I A;  4MBQ A;  4K0U A;  5HAX A;  1WLX A;  4MAL A;  3RPU A;  2EHO B;  2BZB A;  4CXX A;  4O4I E;  4ZI2 C;  3GWH A;  5BMV E;  4HTE A;  4H63 H;  2Q9Q D;  2NW8 A;  2C5K T;  1WYC A;  1X79 A;  3EDV A;  4XAX B;  2ZM2 A;  4WNK A;  3KDS E;  3WAK A;  5L2L A;  1MIY A;  2RA1 A;  1G8X A;  3F57 A;  3KFW X;  5HWX A;  3HKD E;  3N9L A;  4IIJ E;  2KMF A;  3O1H A;  4NUU A;  2XUE A;  2VKJ A;  2ZM8 A;  1IAP A;  4ILU A;  3ZJ1 A;  4O4L E;  3TKL B;  2CEA A;  1YKE B;  2B1E A;  4PJN A;  2DHR A;  3B13 A;  4J2C A;  3RX6 A;  3PUA A;  3UUN A;  5HXH A;  2X9W A;  2BDE A;  4QXH B;  1AJ3 A;  4I50 E;  4QWN B;  4Z8X A;  5FNV E;  2HPL A;  1E1H B;  3HKE E;  4EYY R;  3KBT A;  2XQY A;  4EZ4 A;  2DWK A;  3RRW A;  1ZKE A;  2EHO D;  5EK3 A;  3NZQ A;  5DJQ C;  3ZEF B;  3K3N A;  5L3B B;  3ESL A;  1WR6 A;  2SPC A;  3BQK A;  3BQL A;  2Y8D A;  1YD8 G;  4I55 E;  2K5B B;  5JVD E;  4G2A A;  3HA4 A;  3I9W A;  3PTR B;  4H63 V;  4PK6 A;  2JMK A;  2DNX A;  2L9Q A;  1KK7 A;  3KV6 A;  4O4H E;  3F2E A;  1MNE A;  4MLK A;  2UXN B;  3AAI A;  4GYS A;  3C50 A;  2PBI A;  3K8P C;  4ZI3 C;  1FEW A;  1D1C A;  3IBP A;  5LGU B;  4QHO A;  2XAG B;  4L5G A;  2VWA A;  5LYJ E;  5CB4 E;  3LG7 A;  2JRK A;  3ZN1 B;  1ZV4 X;  2CM0 A;  3N9Q A;  1VRB A;  3Q5X A;  4B6X A;  5LP6 E;  3N2O A;  3LBX B;  4ERR A;  3FBZ A;  3L3P A;  3RYF E;  5JDG A;  2DCF A;  5JR9 C;  2C0S A;  5J2T E;  3J7Y q;  2I59 A;  1US7 B;  3P8C D;  2K9A A;  5LCY A;  3EDU A;  3U3I A;  3N2G E;  4OYK A;  1BR4 A;  3OBV E;  1SA0 E;  3N9M A;  4TN7 B;  3E22 E;  1O3X A;  2E8I A;  4UXN B;  5DAB A;  1UX5 A;  5KMG P;  5FMN A;  3KV5 A;  5LNK A;  1HCI A;  1OWA A;  2CLY C;  1T98 A;  4HKA A;  4GK0 E;  4FJO A;  1IZN B;  1D1A A;  1NWM X;  3ANW B;  3FB2 A;  3N5L A;  4WBO A;  1H7C A;  4EB6 E;  5IHY A;  3ZMU B;  2PFV A;  3LFM A;  3LJC A;  2IC9 A;  1QSD A;  2V26 A;  2KWI B;  4PJL A;  4PFO A;  4AKR B;  4X20 E;  2NTY A;  2Q9Q A;  3K3Q C;  2CWY A;  4BJN A;  3CML A;  1IJ6 A;  4E7S A;  2WMO A;  3L09 A;  3A5X A;  5LJN A;  2CXD A;  5A1L A;  1FMV A;  3BK9 A;  2D5U A;  3ZJ2 A;  5JRC B;  3BQI A;  3MAC A;  3DP7 A;  4DND A;  3RC3 A;  2V7M A;  2DLR A;  5LG4 A;  3KVA A;  2A72 A;  2VL8 A;  2GK9 A;  4P09 A;  3MXZ A;  3C4X A;  2ODU A;  3SS1 A;  4AQF C;  2EHO A;  3VKH A;  3K3O A;  1D1B A;  2D0U A;  4EZH A;  5ADX L;  4AI6 A;  4H9Q C;  1BR1 A;  2E9X B;  3NBX X;  1MIW A;  3UTK A;  3JC6 C;  3S4U A;  5JDQ A;  5E0O A;  3ZCJ A;  1SHZ C;  3R84 B;  2XAH B;  4HFV A;  2LM9 A;  4DO0 A;  4ZS3 A;  4UF0 B;  2LOP A;  3ZYL A;  5LBM A;  3M65 A;  4F6R C;  2Z6E A;  5JQG E;  5L3C B;  2C5I T;  3IEE A;  3RYC E;  5LGN B;  3VU7 H;  4TUY E;  3HI2 A;  2W00 A;  3AAA B;  2KLQ A;  3B57 A;  4XZC A;  5LJM A;  2X9H A;  2WWU A;  4I43 B;  4PK4 A;  2ZM0 A;  1VOM A;  3W15 B;  5J2U E;  3I0O A;  3NZP A;  2E9X D;  2NP9 A;  2WSS V;  2XAF B;  3ZLI A;  4AKG A;  2DI4 A;  2D2S A;  3ZPO A;  4O2B E;  4ZI2 D;  2A2F X;  1NAF A;  2YU2 A;  3AA1 B;  3O9X A;  2KND A;  2M67 A;  3GMI A;  2L3L A;  4QX7 B;  2H7O A;  4BA9 A;  1MMN A;  3NRX A;  2JQQ A;  4H9P C;  5HXR A;  3WI3 A;  2LSI A;  3H37 A;  4FI5 A;  3VKG A;  4P0A A;  4YLH A;  5LHG B;  2V7L A;  4H9S E;  2J1D G;  2XTL A;  3KV4 A;  2IC6 A;  4CI1 B;  1HF8 A;  2JJ9 A;  2A3D A;  4IGU A;  3PE0 A;  1HG2 A;  3AA7 B;  2UXX B;  3LBX A;  2DWG A;  4GIW A;  2ACX A;  2X67 A;  5CA1 E;  1ZEE A;  3AVS A;  4PJJ A;  2V1D B;  2CWO A;  2CXL A;  3GN5 B;  2HH7 A;  4UEL A;  3ZMV B;  5KX5 E;  4DMV A;  4PFP A;  5H6Q B;  2BVL A;  2LE8 A;  2X0L B;  3OKQ A;  3SWH A;  5FXX A;  5JDM A;  1Y64 B;  2NOX A;  5JR9 B;  3J9X 1;  1Z0P A;  1WRD A;  1BR2 A;  4HGA A;  4GOU A;  2LT3 A;  3FXD B;  3O4X E;  4PK5 A;  3ZCI A;  1HFA A;  2P9B A;  4CI2 B;  3ANW A;  4N78 D;  1BR0 A;  3QK6 A;  3ZN0 B;  1G73 A;  5JDH A;  1D0Y A;  2ES0 A;  4H9R C;  3CQG B;  3PUG A;  3C98 B;  4O4J E;  2CLY B;  3AVR A;  3AAE B;  2ZLY A;  3FBL A;  4G63 A;  4CI3 B;  5M4Y A;  3F31 A;  3KVB A;  4PW8 A;  1QUU A;  5FY7 A;  4ZI3 D;  4CZZ B;  2Y48 B;  4H9N C;  2X68 A;  3PUQ A;  4HEA A;  4IE6 A;  4IE5 A;  3VHL A;  5JRE A;  3CWZ B;  3GA8 A;  1FMW A;  1LRZ A;  5JDL A;  5JRC A;  4ADZ A;  5FXW A;  5FXZ A;  3SRZ A;  4DVD A;  2IAK A;  4HE8 A;  4X1K E;  5EK4 A;  4EYU A;  3PUS A;  4GYR A;  2VK9 A;  3CKD A;  5LHH B;  4O8S A;  1MIV A;  2N1G A;  4OYJ A;  4UVC B;  5LGT B;  5TAO A;  2CCQ A;  3CPZ A;  2JPF A;  4XBF B;  3I1A A;  5FYM A;  2CA5 A;  4EXT A;  5L3E B;  1U4Q A;  3ZC1 A;  3RRC A;  2N2N A;  2VKD A;  2X9X A;  3HKB E;  2E9X A;  3KBU A;  4TZ4 C;  3RH3 A;  4ZHQ E;  5LOV E;  5L3G B;  3LK4 2;  3UFE A;  2WAU A;  2Y6X A;  1MMA A;  4TV9 E;  2W0G A;  3V5S A;  2KIN B;  2OA5 A;  1EZ3 A;  2NW7 A;  2MYS A;  5HYA A;  2W63 A;  2ZMA A;  1CUN A;  5F3J A;  2PJQ A;  1LVF A;  2LSG A;  4AKH A;  5J1G A;  2LEH A;  3MZK B;  5GON E;  3SOL A;  5DQW A;  3C4W A;  3KIN B;  4YJ2 E;  4PAG A;  1LVK A;  4HN9 A;  3I9Y A;  3ZMT B;  4L0R A;  4NUV A;  2X9Y A;  2V7J A;  2CXF A;  4H9O C;  4IE7 A;  2PG8 A;  2NWB A;  1MND A;  2LHR A;  1LKX A;  1B7T A;  3IHR A;  4EIW A;  4MFR A;  5C8Y E;  3O1I A;  2VKH A;  3MKD A;  5H6R B;  4IDZ A;  3PU3 A;  4JEH B;  2MOZ A;  4EOZ B;  1WYB A;  3RKO A;  4JEU B;  5FP3 A;  2KT9 A;  2EHO C;  4ISS A;  3FXE B;  5FY1 A;  3DJB A;  2NTX A;  4AKL A;  2C5J A;  4E7Z A;  2MTQ A;  3JC6 D;  4DBQ A;  3AB3 B;  4ASK A;  2CMR A;  5L3D B;  1V9D A;  5JDF A;  2KZ7 B;  4GK5 E;  2W62 A;  2X66 A;  2VB6 A;  4I4T E;  4ANJ A;  3CX7 B;  3OYX A;  4U72 A;  5ETW A;  2HPJ A;  3D0T A;  1S35 A;  4QKN A;  3CX8 B;  4OFZ A;  5DQV A;  5LXT E;  5EK2 A;  3FHN A;  2YIN A;  3LK3 B;  5LBQ B;  3RYI E;  4DBR A;  2MBG A;  2ODV A;  2V7K A;  3GN5 A;  4UEM A;  3PUR A;  4TX5 A;  4DMW A;  1UCU A;  3AA0 B;  1HTJ F;  1FIO A;  3NRY A;  3UT5 E;  4BAY B;  1S94 A;  3EUH A;  5JR9 A;  1YKH B;  5HWY A;  2WBL A;  4JUY A;  2QA7 A;  4CXY A;  3IF8 B;  3C4Z A;  3QUJ A;  2YK0 A;  3CQC B;  3I0Q A;  3Q5W A;  4QX8 B;  1MMD A;  4WW0 A;  3HL6 A;  3ETV A;  4ZOL E;  3E0Z A;  5LHI B;  3CX6 B;  3UUM A;  4MHC A;  3C64 A;  3H3A A;  3CQX C;  4C90 A;  2CE7 A;  2JMH A;  3N9P A;  2H3R A;  4JLE A;  1MMG A;  4ZS2 A;  3OJA A;  4KP3 C;  4O2A E;  2K24 A;  3ONX A;  3WAJ A;  4KBM B;  1KNZ A;  3LK2 B;  4AKI A;  2YEV C;  4KUM B;  5FXV A;  2G0U A;  3HR0 A;  3N2K E;  2YU1 A;  2QGS A;  5KDM C;  3OYZ A;  2WMN A;  5HXE A;  2LOS A;  4UV9 B;  4UVA B;  2IW5 B;  4EAH A;  2NW9 A;  4CXW A;  1D0X A;  4UV8 B;  5HXC A;  3ZYM A;  5CA0 E;  2LHN A;  3QC9 A;  3RC8 A;  1OXZ A;  4X1I E;  3ZC0 A;  5FY0 A;  4UIG A;  3MK7 C;  3N9N A;  3N9O A;  4CQI A;  4QXC B;  4BJM A;  5JDN A;  1U5P A;  1YW0 A;  1HS7 A;  4OHF A;  3U78 A;  3RYH E;  2KWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...