1HS7A

Vam3p n-terminal domain solution structure
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
97
structure length
97
Chain Sequence
TNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords SYNTAXIN VAM3
publication title Vam3p structure reveals conserved and divergent properties of syntaxins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 43
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2000-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hs7A00
3C98B 5LG4A 1BR0A 4TX5A 4JEHB 1EZ3A 2XHEB 1FIOA 1FEWA 2DNXA 3LG7A 4JEUB 5M4YA 1S94A 1G73A 1HS7A
chains in the Genus database with same CATH superfamily
2M67A 1L0VA 3AA0B 3EI0A 2WQYA 3AEEA 4TV8E 3C4WA 2KWIB 2DCFA 3OKQA 2CEAA 2QRXA 2MAWA 1O3XA 2XM1A 3VHLA 3H3AA 4X66T 3P50A 5FVKA 3H3MA 1R8IA 4YHJA 1MIWA 5HAXA 2D2SA 4HWIB 3FZKB 4AKLA 2IMLA 2V7LA 2M6BA 1HFAA 4A97A 3BQIA 3ETVA 4K0UA 3HKCE 3ZPOA 2LHRA 2XPKA 5CA0E 2UXDT 1WR6A 1ZHCA 3E22E 2GK9A 2YOEA 4TUYE 2I59A 2C0SA 2BVMA 1US7B 3OPCA 5JR9A 4JEHB 1HG2A 1HTJF 2V7IA 5FYMA 3ZMSB 1MNEA 1YXRA 4GKJT 4IE7A 4IT4A 5A1LA 2CM0A 2IW5B 2HN2A 3JCFA 4QKNA 2CA5A 5LGUB 3AAAB 3Q2MA 4GYSA 4NXMT 5JR9B 3JC6C 3BQLA 5HXRA 3PUYF 2BBHA 1U4QA 3T1HT 1HNXT 2N9DA 1CUNA 3K3NA 4ILUA 2LRKA 2I0MA 3A7MA 4P0BA 4EEDA 3ZT6A 4DR1T 3IA3A 3PV0F 3RRWA 2I6HA 4PFOA 4KX6A 2LRLA 3AE3A 5IUXA 5DQWA 3NZQA 2KMFA 4CN6A 5L3EB 4B3MT 1LRZA 5FXXA 3MKDA 2W61A 1B7TA 1ZOYA 2XQ5A 2K5BB 5KDMC 4F8HA 2CBIA 5LOVE 4JI1T 3N9PA 4DNDA 4IIJE 1AJ3A 4DR4T 2JIWA 1OWAA 3CQCB 4HE8A 3ZMVB 2X0LB 3AA1B 1I6ZA 4YFSA 1QSDA 1T8BA 3N5LA 4JI6T 2WDVA 4FJOA 4Q25A 3ZYLA 5AQVB 1M62A 3KV5A 4ILAA 3NBXX 2V5CA 1N34T 2UXXB 1DU2A 2DNXA 3E08A 2IIUA 4EYYR 4A56A 5LCYA 5HEJA 2JMHA 3GWHA 2V1DB 2WP9A 1HS7A 2H88A 2X0YA 4ZS3A 1SHZC 4H9QC 3P4QA 4JI5T 1WFDA 4MALA 5JDHA 2NTXA 5IHYA 2JMKA 3JC6D 4OYJA 4UIGA 2YEVC 3PUWF 3QOFA 1Z8UA 4BAYB 5CJ5A 1SUMB 1J1JA 5JDFA 2ZM8A 2W2UA 2MYSA 5LB7B 4BJNA 1IJ6A 3AAEB 1D0YA 2YK0A 4BJMA 2IUBA 4EGWA 3RPUA 4LMJA 5JDLA 1HCIA 1W9RA 4P0AA 3N2KE 2V6XA 4H9RC 5FXVA 3AE9A 1FMWA 4E7ZA 1XWMA 2A72A 5L3CB 5LA6E 4ZXLA 4HWCA 2VKOA 3RX6A 3LG7A 2XQ8A 5AQKB 3FXDB 4C91A 2NW9A 3V5SA 1U5PA 3K1SA 4HN9A 2WM9A 3KV4A 2D0UA 3WAKA 3ZMTB 5JRCB 2CHNA 3B57A 4FI5A 4B3ST 5JDGA 3EDVA 3R84B 4X65T 1W09A 3PTRB 4CXWA 2AE9A 4CI1B 3GA8A 4U2ZA 3Q9DA 3OJAA 5HCMA 1M7KA 2IDOB 3LBXA 5EZYE 4QXHB 2K24A 4YY3T 2BVLA 2WY2A 2ES0A 4O8SA 2CLYB 3X1DA 4HWHA 2Y48B 4PK6A 3MA9A 5CFBA 3AE7A 2BS3A 3LBXB 3AE5A 2XQ4A 4AKIA 4V1Av 2C5JA 4ZI7E 4PJJA 3QB5A 2BG9A 3KVAA 1SA0E 4IDZA 3N9OA 4DR6T 2PFVA 3ONLC 2KT9A 4DIDB 4JI4T 4EIWA 1UURA 5C8YE 3RF1A 4U74A 3EABA 4DV6T 3D0TA 1X79A 5IWAT 5IYZE 2LSIA 5J2UE 5JDNA 2V26A 2Z6EA 4HWFA 3L8RA 1W0AA 2XSAA 5L3BB 2BKPA 2XUEA 2IHR1 5H6RB 4HFHA 5HYAA 2CWYA 1YKEB 2E2AA 3CX7B 2LSGA 2ZM0A 3PUGA 2BBJA 1YW0A 3SWHA 4LF9T 1G73A 3ZT7A 3AA6B 3AE6A 1HNZT 5L3GB 4H9OC 1D1CA 2LOSA 2IAKA 4H9PC 4QH4A 1ZKEA 4AQFC 3OTOT 5FMNA 4GIWA 4OFZA 3Q5XA 4IGUA 2RPAA 5ADXL 3CQXC 1T72A 3SOLA 3TLSA 2VVSA 4H63H 3PUVF 2WMNA 2L3LA 4HFCA 3RH3A 3OVUA 3P4WA 2B1EA 4H9SE 5LG4A 2VL8A 1CHUA 1W0BA 2DL1A 3PU3A 1XNRT 1WLXA 4UV8B 3KVBA 4Z8XA 3UU5A 4H63V 4HGAA 3RRCA 1XDPA 3MJXA 5CB4E 5LJNA 3AE4A 2KZ7B 2W62A 3N9MA 4WBOA 4UEMA 4EYUA 2WMOA 3VR8A 2WDQA 4AXPA 5JQGE 4M1PA 3VRAA 1FIOA 4GOUA 4COFA 1YQ3A 2X66A 4ZHQE 1XMQT 5F5WA 2X9HA 3F2EA 1MIYA 5AQSB 5JDMA 3LSVA 2CE7A 1NAFA 4O4LE 3RIUC 3K3QC 3VR9A 2UUCT 2ZMAA 4I50E 2UU9T 4EXTA 3RQWA 4DUYT 1HX1B 1UGOA 4YLHA 3RKGA 5AQOB 1N32T 4EAHA 4Z91A 3U78A 2XAHB 2XY8B 3HL6A 4AIUA 1KFYA 2XQAA 4GYRA 2JQHA 2QGSA 2FJAA 4LF5T 2WWVA 2E9XC 3O9XA 4JI8T 3F31A 2VB6A 2X67A 2E5LT 1Y01A 3TLUA 3QC9A 3B13A 2CHOA 4MLKA 3ZSSA 1XMOT 4NPPA 4TNWA 4AQFA 3GMIA 3IF8B 2VKJA 4HEAA 2DI4A 3FXEB 3GN5B 4YTMA 1BR4A 1IBKT 1MMNA 3U3IA 4OYKA 3ESLA 2UXNB 4I43B 2XAQB 5JH7E 5FL0A 3CPZA 4TNVA 4LFAT 3KV6A 5L3DB 4U2YA 2SPCA 2G0UA 4L0RA 4O4HE 4LMLA 5AQJB 3FZMB 3L39A 4KUMB 2K9AA 4PK4A 4CN4A 2FJDA 3DJBA 2UXBT 3I0OA 4YSZA 2LM2A 3DTOA 3SS1A 3NRXA 5F8PA 2KINB 3JADA 2N1GA 3FBZA 5LGNB 2LHNA 3R6NA 2MPKA 5F3JA 1J5ET 4O2AE 2NTYA 2BKNA 3N9LA 1KNRA 2W00A 2VASA 1ZV4X 4X1KE 2XQ9A 2CLYC 3IBPA 1I94T 3ETUA 3CX6B 5J1GA 3AE2A 3WAJA 3EDUA 5LG3A 4U31A 4JI2T 1MMDA 1QUUA 3PJAJ 2LKGA 5L2LA 1UCUA 4Z90A 4PJLA 4B6XA 2VKHA 3ZC1A 2E9XD 2DLRA 2NOXA 1LVFA 4A5XA 2HN1A 2VURA 2E9XA 2PJQA 2OV9A 1J5WA 3PURA 4DUZT 4LF6T 2WDRA 4HFVA 4PJNA 4QX7B 4ZS2A 2Q9QC 3UUNA 4TWHA 2FJEA 3C4ZA 3NRYA 5KMGP 4DVDA 4YXDA 5HXHA 1YQ4A 2WB5A 5FY0A 2LT3A 1BR1A 3CX8B 5AQGB 2E9XB 3ZSTA 2FUPA 2HPLA 1JNRA 5JREA 3LDQB 5ABEA 5ABFB 1S35A 2KWHA 4YT0A 3NZPA 1WYCA 1XNQT 2A2FX 1IAPA 2A3DA 3W15B 2XQYA 4DV2T 3L3PA 5JTGA 4ILBA 3NKZA 3TLTA 5C2TA 1FEWA 2R6GF 4HWDA 4KBMB 4UXNB 4DO0A 4GKKT 5LGTB 2CMRA 4UR9A 5C3JA 4CI2B 3RIFA 3RC3A 3J7Yq 4JUYA 4I4TE 4U72A 3P8CD 2VL0A 3F57A 5AQMB 2WBLA 4LF8T 3AVRA 5AQPB 4ZEYA 1Z0PA 2ZM2A 5JRCA 2OA5A 4P1NA 4ISSA 1NWMX 5LBQB 2FBWA 3FHNA 3QB5K 2BDEA 3NVOA 4IHJE 5EK3A 4OHFA 2WS3A 3HI2A 2ZLYA 2JQQA 1WR0A 5HWYA 2E8IA 3BK9A 2B76A 1UX4A 3SFEA 3DP7A 4G63A 4JV5T 4JEUB 5FL1A 5AQUB 4JYAT 3LK42 3C51A 4DV7T 3P4RA 2J62A 3OYZA 1D0XA 3O4XE 5JVDE 5LHGB 2N2NA 5HCJA 3V5UA 1N36T 3RYCE 2Q9QD 4X5TA 4YHHT 5AQFB 3CK6A 2ODUA 2DWGA 2LM9A 3KBTA 4NUUA 4EZHA 4TWDA 5LYJE 4GK0E 4IREA 2W63A 4DBQA 4AI6A 2K48A 2BZBA 3A8YC 5HEHA 1OEDE 3N2OA 3Q5WA 2Q9QB 1VCSA 3HR0A 4YSXA 4H9NC 3RIAA 3RQUA 3UULA 3PU8A 3AAIA 2X9WA 4YJ2E 3ZC0A 3CQGB 1H7CA 2KLQA 3VU7H 3UU6A 4WZXA 3TLVA 2D5UA 5EK4A 5EK2A 3EAMA 2MBGA 4F6RC 4ZI2C 1EZ3A 2XZEA 3UU3A 1HR0T 4K0KT 3K8PC 1ZEEA 4X20E 3N9QA 4WNKA 1VOMA 3EUHA 5FXZA 3M3ZB 5GONE 4A98A 2D0TA 2ODVA 4DV4T 3L09A 5LMNT 4IDQA 4E7SA 3ZLIA 3RC8A 1HX8A 4CXXA 5LNKA 2D9DA 4EB6E 3AEDA 3M65A 1E7PA 1QLBA 2ACXA 3T8OA 4ZZBA 2KSRA 3UUXB 4KMCA 1BR0A 3O1HA 2HH7A 4IDOA 4NXNT 2WU5A 3FZLB 3HKBE 4IE4A 2LKHA 4CZZB 4IL9A 5CGMA 1FJGT 3ZMZB 2BS4A 3H37A 4XBFB 3PUSA 4LMKA 5ABHA 4CN1A 4UVCB 4JI7T 2CRBA 2XHEB 4LFCT 1HF8A 2LSJA 4G2AA 3PUXF 4QH5A 1XDOA 3I1AA 3PE0A 5L4EA 1KK7A 2KXPB 2VWAA 3RLFF 1V9DA 3AA7B 3ONXA 3QNUA 3LK2B 4JLEA 5CA1E 3SFDA 5BR8T 3UUMA 2XJ7A 2LJLA 5LBMA 5AQIB 2NW8A 3C64A 3P7IA 3ZKRA 4ZI3C 3CWZB 4TV9E 4J2CA 3I9YA 2MOZA 4PJMA 2VKDA 2X68A 4UVBB 5TAOA 2DHRA 3IEEA 3AE1A 4PFPA 4CI3B 5LP6E 4QWNB 2LSKA 4X1YE 2NP9A 4IE5A 5LXTE 3ONJA 4UF0A 2E5VA 3RYIE 2XASB 2CWOA 1WYBA 4X62T 2JJ9A 2J1DG 3CMLA 4CQIA 3ANWA 3J9X1 3PDYA 2H3RA 1IZNB 3ZT5A 4QX8B 2VQET 2YDSA 4ZI2D 1UUSA 4UF0B 5KX5E 4HFBA 3BQKA 5M4YA 3ZMUB 4HFEA 2CCQA 3O1IA 3GN5A 4ANJA 3ANWB 5AQRB 3N9NA 4HFIA 1WRDA 2JQKA 4HTEA 4KHPT 3KINB 4MFRA 4GK5E 4DV3T 1VCTA 3JAFA 4CXYA 1MMGA 2Y8DA 1MNDA 4MBQA 3UUBA 5HEOA 4QHOA 2YU1A 3PUZF 2MTQA 2F4VT 5HXSA 2H89A 4I55E 2UUBT 4YTPA 1XZYA 5ABGA 5LHHB 2WWUA 1YD8G 3EHZA 2V7MA 2W67A 3ZYMA 4DR3T 4U3CA 3OYXA 2YKSA 1BR2A 3O1JA 1KF6A 3AVSA 5HEGA 2V7JA 3UU4A 4TWFA 2V5DA 1Y64B 5JDQA 4MHCA 4O4IE 2XAJB 5E0OA 3UFEA 3T1YT 2AXDS 2BS2A 3RI5A 3OBVE 2X0HA 2LEHA 4BA9A 2EHOC 4ZI3D 4AQYT 2KNDA 2VVNA 4HKAA 3KBUA 4C90A 3PUAA 3A5XA 3UTKA 4DR7T 3C50A 1HNWT 1ZP0A 5FNVE 4DBRA 4JI3T 4PNIA 3ZCIA 3RIUA 4DV0T 1IBMT 2H7VC 2HHHT 4QXBB 4KHZF 5FVLA 2UUAT 3RHWA 2L9QA 3I9WA 4X1IE 3CVRA 3VKGA 3MXZA 1OEDC 2VK9A 2LOPA 4EOZB 4YSYA 1WCRA 3KFWX 4DV5T 4TN7B 4UVAB 4X64T 2XTLA 5ABFA 4IL4A 2NWBA 1KNPA 3MZKB 2JRKA 2W4XA 2CXLA 2XQ3A 1T7SA 1D1BA 2BG9C 3QK6A 3AEFA 4B3RT 5AQLB 2RA1A 1G8XA 5BMVE 4NUVA 5J2TE 1VRBA 4PK5A 4YJ3E 4IDPA 4ISTA 4LFBT 3S4UA 1T98A 4PW8A 4JI0T 2YN6A 3ZN0B 3HKDE 5AQTB 4AKGA 1MIVA 2YDRA 4WW0A 3K3OA 4HFDA 3RYFE 5HXEA 2V6YA 3FZHB 4EV6A 3P4SA 2CXDA 3EVYA 2LE8A 3FZFB 2WZIA 3C98B 4PAGA 4P09A 4UV9B 3B5MA 1S94A 5AQQB 5H6QB 5L47A 2CBJA 2WZHA 2V6YB 4OK0A 2EHOD 4B3TT 4AKRB 3FBLA 2W0GA 2L8KA 2EHOA 3VRBA 4TX5A 5AQHB 3VKHA 3AECA 2YU2A 3KDSE 3SRZA 3CIRA 3LJCA 1JNZA 4UELA 2X51A 4IE0A 5DJQC 2P9BA 5AFUL 2LLYA 1D0ZA 2X9XA 3UFGA 2EHOB 4LF4T 2W66A 4OX9T 5HXCA 3ZCJA 4WYVA 2ACZA 3UU8A 3G06A 1X9BA 4IE6A 2QA7A 1KEYA 2IC9A 2XAGB 1D1AA 2WAUA 4ADZA 5DQVA 2RP4A 2WU2A 5ETWA 1OEDA 1IBLT 3AE8A 4O2BE 3Q5EA 2JQ9A 2C5KT 5L4HA 3FB2A 4U33A 4ASKA 5FKYA 4QXCB 4WBNE 5L3FB 2J47A 2Q9QA 3AB3B 2UXCT 3MACA 2J4GA 5J0ZA 3QUJA 2PBIA 4DR5T 2OLTA 3AEAA 1OEDB 2X9YA 3E0ZA 2WCAA 3ZJ2A 2XSBA 2XM2A 2M6IA 3C4XA 3NWIA 1MMAA 2JPFA 2BKOA 3AEGA 4U7IA 3LK3B 4IDNA 2YINA 3AEBA 4DV1T 5HWXA 2HPJA 5LJMA 3UQ4A 2V7KA 4ZOLE 2CXFA 3LFMA 4ILCA 4L5GA 2FJBA 4EEBA 2LSYA 2VQFT 1KNZA 3JAEA 2A9UA 3ZN1B 1LKXA 2BG9B 4QH1A 4NIQA 1HG5A 3UQ7A 2NW7A 3MK7C 3P4PA 5FY1A 4I0UA 3KV9A 3ZEFB 2C5IT 5HEUA 2BG9E 1E2AA 2NR4A 4LF7T 3PJAA 4DMVA 4AQGA 4DMWA 4DR2T 1YKHB 3ZYKA 1UX5A 4O4JE 3I0QA 5JR9C 4ERRA 4N78D 2ZM6T 2PG8A 4YTNA 1UK5A 4XAXB 4AISA 3TLWA 3HA4A 2IC6A 5FP3A 2H7OA 2V8SV 1NENA 4KP3C 4TZ4C 1NEKA 5FXWA 2QYWA 5LHIB 3AXJA 4JBWF 1IJ5A 2QVAA 1N33T 3RKOA 2PTFA 1FMVA 5FY7A 4KI0F 2XQ7A 2YDQA 3ZJ1A 3ABVA 3UT5E 2CPTA 3CKDA 3AXJB 5KXJA 4AKHA 3RYHE 4EZ4A 3N2GE 3PUQA 2K3WA 4ZZCA 3WI3A 5AQNB 4U7YA 3Q5DA 2XAFB 5LMUT 1OXZA 3TKLB 3RGLA 4XZCA 3IHRA 2DWKA 1LVKA 2WSSV 4L9IA 1SE7A 1GQEA 2XQ6A 2Y6XA 5DABA 1E1HB 3HKEE
chains in the Genus database with same CATH topology
2CMRA 1X79A 2M67A 2LEHA 5IYZE 2LSIA 4CI2B 3AA0B 3RC3A 5J2UE 4BA9A 5JDNA 3J7Yq 4TV8E 2EHOC 3C4WA 4JUYA 4I4TE 4ZI3D 4U72A 2KWIB 2DCFA 3OKQA 2V26A 3P8CD 2KNDA 3F57A 2CEAA 2Z6EA 2WBLA 1O3XA 5L3BB 3VHLA 3H3AA 4HKAA 2XUEA 3KBUA 4C90A 5H6RB 3PUAA 3AVRA 3A5XA 3UTKA 1Z0PA 2ZM2A 5HYAA 4YHJA 2OA5A 5JRCA 2CWYA 1MIWA 1YKEB 5HAXA 3CX7B 2LSGA 2D2SA 3C50A 4ISSA 5FNVE 1NWMX 5LBQB 4DBRA 3FHNA 2ZM0A 4PNIA 3PUGA 3ZCIA 2BDEA 1YW0A 2H7VC 3SWHA 4AKLA 2V7LA 1HFAA 3BQIA 3ETVA 4K0UA 1G73A 4QXBB 4IHJE 5EK3A 3AA6B 4OHFA 3HI2A 3HKCE 3ZPOA 2ZLYA 5L3GB 4H9OC 1D1CA 2JQQA 5HWYA 2LHRA 2L9QA 5CA0E 2E8IA 3I9WA 2LOSA 4X1IE 3CVRA 2IAKA 3VKGA 4H9PC 3BK9A 3MXZA 1ZKEA 1WR6A 1ZHCA 2VK9A 3E22E 4AQFC 1UX4A 2LOPA 2GK9A 4TUYE 2I59A 4GIWA 5FMNA 2C0SA 4OFZA 2BVMA 4EOZB 3Q5XA 3KFWX 3DP7A 1US7B 4IGUA 4G63A 5JR9A 4JEHB 1HG2A 4JEUB 4TN7B 4UVAB 1HTJF 5ADXL 3CQXC 2V7IA 5FYMA 3SOLA 3ZMSB 1MNEA 2XTLA 2NWBA 4H63H 4IE7A 2WMNA 3LK42 3MZKB 3C51A 2JRKA 5A1LA 2CM0A 2IW5B 2L3LA 3OYZA 3RH3A 1D0XA 4QKNA 2CA5A 2CXLA 5LGUB 3AAAB 3O4XE 1D1BA 3Q2MA 4GYSA 5JVDE 5LHGB 2B1EA 4H9SE 2N2NA 3QK6A 5LG4A 3V5UA 5JR9B 2VL8A 3RYCE 2Q9QD 3JC6C 3BQLA 2RA1A 5HXRA 1G8XA 3PU3A 2ODUA 5BMVE 1WLXA 4NUVA 4UV8B 3KVBA 5J2TE 2DWGA 4Z8XA 1VRBA 2LM9A 4PK5A 4YJ3E 4H63V 4HGAA 3KBTA 3RRCA 1U4QA 4ISTA 3MJXA 4NUUA 5CB4E 4EZHA 3S4UA 2N9DA 4GK0E 5LJNA 5LYJE 1T98A 4PW8A 1CUNA 2KZ7B 2W62A 3K3NA 3N9MA 4ILUA 4WBOA 4P0BA 3ZN0B 4UEMA 2W63A 4EYUA 3HKDE 2WMOA 4DBQA 4AXPA 4AKGA 5JQGE 4AI6A 1MIVA 3RRWA 4WW0A 2K48A 3K3OA 2BZBA 4PFOA 4M1PA 3N2OA 3Q5WA 2Q9QB 3RYFE 3HR0A 4H9NC 5HXEA 1FIOA 4GOUA 3UULA 2X66A 3PU8A 3AAIA 4ZHQE 2CXDA 3EVYA 5DQWA 2X9WA 2X9HA 3NZQA 4YJ2E 2LE8A 1MIYA 2KMFA 3CQGB 3F2EA 3ZC0A 1H7CA 5L3EB 2KLQA 5JDMA 3VU7H 2CE7A 1NAFA 3C98B 4O4LE 4PAGA 4P09A 1LRZA 4UV9B 5FXXA 3MKDA 3K3QC 2W61A 1B7TA 1S94A 2ZMAA 4I50E 2D5UA 4EXTA 5H6QB 2K5BB 5KDMC 4OK0A 2EHOD 5EK4A 5EK2A 2MBGA 5LOVE 4YLHA 3N9PA 4DNDA 4F6RC 4ZI2C 1EZ3A 4AKRB 3FBLA 2W0GA 4IIJE 1AJ3A 2L8KA 3K8PC 2EHOA 4EAHA 1ZEEA 4TX5A 3U78A 2XAHB 3VKHA 3HL6A 1OWAA 3CQCB 4X20E 3N9QA 4WNKA 2YU2A 4HE8A 3ZMVB 3KDSE 3SRZA 1VOMA 2X0LB 3EUHA 4GYRA 3LJCA 3AA1B 5FXZA 4UELA 5GONE 2X51A 2QGSA 4YFSA 2D0TA 4IE0A 2P9BA 5DJQC 1QSDA 2ODVA 3L09A 2E9XC 3N5LA 5AFUL 3O9XA 4FJOA 4E7SA 3F31A 3ZLIA 3RC8A 1D0ZA 1HX8A 2VB6A 4CXXA 5LNKA 2X67A 2X9XA 3ZYLA 4EB6E 2EHOB 5HXCA 3KV5A 3M65A 2ACXA 3QC9A 3ZCJA 3T8OA 3NBXX 3B13A 4MLKA 2UXXB 4IE6A 2QA7A 3UUXB 4KMCA 1BR0A 3O1HA 2HH7A 2IC9A 2XAGB 2DNXA 3E08A 3HKBE 4IE4A 4EYYR 1D1AA 4A56A 2WAUA 5LCYA 4ADZA 4CZZB 5DQVA 2RP4A 2JMHA 5ETWA 4AQFA 3GWHA 3GMIA 2V1DB 4O2BE 3IF8B 2VKJA 3ZMZB 2C5KT 4HEAA 3H37A 4XBFB 2DI4A 1HS7A 3PUSA 3FB2A 3FXEB 3GN5B 4ZS3A 1SHZC 4ASKA 1BR4A 4H9QC 4QXCB 4WBNE 5L3FB 4UVCB 1MMNA 3U3IA 4OYKA 2Q9QA 3AB3B 3ESLA 2UXNB 2XHEB 1HF8A 2LSJA 3MACA 4G2AA 4MALA 4I43B 3QUJA 5JDHA 2PBIA 2NTXA 2XAQB 5JH7E 3I1AA 3PE0A 3CPZA 1KK7A 2KXPB 5IHYA 2X9YA 2VWAA 3E0ZA 2JMKA 3JC6D 3KV6A 1V9DA 4OYJA 4UIGA 3ZJ2A 2YEVC 5L3DB 3C4XA 1MMAA 3AA7B 3ONXA 3LK2B 4JLEA 2JPFA 2SPCA 5CA1E 4BAYB 2G0UA 3LK3B 4L0RA 3UUMA 2YINA 2LJLA 4O4HE 5LBMA 5JDFA 5HWXA 2HPJA 2NW8A 2ZM8A 5LJMA 2V7KA 4ZOLE 2CXFA 3C64A 3LFMA 3P7IA 2MYSA 4ZI3C 4KUMB 2K9AA 4BJNA 1IJ6A 3AAEB 3CWZB 1D0YA 4L5GA 4TV9E 4PK4A 2YK0A 4BJMA 2LSYA 1KNZA 4J2CA 3DJBA 3I0OA 3ZN1B 1LKXA 2MOZA 3I9YA 4PJMA 2VKDA 2X68A 3DTOA 3SS1A 3RPUA 5JDLA 4UVBB 5TAOA 3NRXA 1HCIA 5F8PA 2DHRA 2KINB 3IEEA 4P0AA 3N2KE 4CI3B 4PFPA 1HG5A 5LP6E 2NW7A 4QWNB 2LSKA 4H9RC 4X1YE 3MK7C 2N1GA 5FXVA 2NP9A 3FBZA 5FY1A 2LHNA 5LGNB 4IE5A 3KV9A 3R6NA 3ZEFB 2C5IT 5LXTE 5F3JA 4O2AE 1FMWA 4UF0A 2NTYA 4E7ZA 3RYIE 3N9LA 2W00A 2VASA 2XASB 2A72A 2CWOA 4DMVA 1ZV4X 1WYBA 4AQGA 5L3CB 5LA6E 2JJ9A 4X1KE 4DMWA 2J1DG 2VKOA 1YKHB 3CMLA 3LG7A 3RX6A 4CQIA 3ANWA 3J9X1 3PDYA 2CLYC 3ZYKA 2H3RA 1UX5A 1IZNB 3FXDB 4C91A 4O4JE 3IBPA 2NW9A 3I0QA 4QX8B 3ETUA 3V5SA 3CX6B 5J1GA 4ZI2D 5JR9C 1U5PA 3WAJA 4UF0B 3EDUA 5KX5E 4ERRA 4N78D 4HN9A 2PG8A 2WM9A 3KV4A 2D0UA 3WAKA 1MMDA 1QUUA 4XAXB 3BQKA 5M4YA 5L2LA 3ZMUB 3HA4A 2IC6A 3ZMTB 5JRCB 2CCQA 5FP3A 1UCUA 3B57A 3O1IA 3GN5A 4FI5A 2H7OA 4TZ4C 4KP3C 4PJLA 4ANJA 3ANWB 4B6XA 2VKHA 5JDGA 3EDVA 3R84B 3ZC1A 2E9XD 3N9NA 2DLRA 2NOXA 1WRDA 1LVFA 3PTRB 5FXWA 4CXWA 4HTEA 4CI1B 3GA8A 3KINB 5LHIB 3Q9DA 3OJAA 4MFRA 2E9XA 2PJQA 4GK5E 3PURA 1IJ5A 3LBXA 5EZYE 4HFVA 4CXYA 4PJNA 4QX7B 4ZS2A 4QXHB 2Q9QC 3UUNA 1MMGA 2K24A 2Y8DA 1MNDA 4MBQA 3RKOA 2BVLA 3C4ZA 1FMVA 5FY7A 3NRYA 5KMGP 4DVDA 4QHOA 2ES0A 4O8SA 2YU1A 5HXHA 3ZJ1A 2MTQA 5FY0A 2LT3A 3D0TA 5HXSA 2CLYB 4I55E 3UT5E 1BR1A 3CX8B 2Y48B 2E9XB 3CKDA 4PK6A 3MA9A 3LBXB 4AKIA 5LHHB 4AKHA 3RYHE 4V1Av 4EZ4A 2WWUA 2C5JA 2HPLA 1YD8G 3N2GE 4ZI7E 4PJJA 5JREA 3PUQA 2V7MA 3ZYMA 3KVAA 3OYXA 1S35A 1SA0E 2KWHA 3WI3A 4IDZA 1BR2A 3NZPA 1WYCA 2XAFB 3O1JA 1OXZA 3TKLB 3N9OA 2A2FX 3AVSA 2PFVA 2V7JA 1IAPA 4XZCA 2A3DA 2DWKA 3IHRA 3W15B 2XQYA 3L3PA 1Y64B 2KT9A 1LVKA 2WSSV 4L9IA 5JDQA 4MHCA 4EIWA 5C8YE 4O4IE 4U74A 1FEWA 2XAJB 5E0OA 3UFEA 2Y6XA 4KBMB 4UXNB 3OBVE 4DO0A 5DABA 1E1HB 3HKEE 5LGTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C98 B;  5LG4 A;  1BR0 A;  4TX5 A;  4JEH B;  1EZ3 A;  2XHE B;  1FIO A;  1FEW A;  2DNX A;  3LG7 A;  4JEU B;  5M4Y A;  1S94 A;  1G73 A;  1HS7 A; 
#chains in the Genus database with same CATH topology
 2M67 A;  1L0V A;  3AA0 B;  3EI0 A;  2WQY A;  3AEE A;  4TV8 E;  3C4W A;  2KWI B;  2DCF A;  3OKQ A;  2CEA A;  2QRX A;  2MAW A;  1O3X A;  2XM1 A;  3VHL A;  3H3A A;  4X66 T;  3P50 A;  5FVK A;  3H3M A;  1R8I A;  4YHJ A;  1MIW A;  5HAX A;  2D2S A;  4HWI B;  3FZK B;  4AKL A;  2IML A;  2V7L A;  2M6B A;  1HFA A;  4A97 A;  3BQI A;  3ETV A;  4K0U A;  3HKC E;  3ZPO A;  2LHR A;  2XPK A;  5CA0 E;  2UXD T;  1WR6 A;  1ZHC A;  3E22 E;  2GK9 A;  2YOE A;  4TUY E;  2I59 A;  2C0S A;  2BVM A;  1US7 B;  3OPC A;  5JR9 A;  4JEH B;  1HG2 A;  1HTJ F;  2V7I A;  5FYM A;  3ZMS B;  1MNE A;  1YXR A;  4GKJ T;  4IE7 A;  4IT4 A;  5A1L A;  2CM0 A;  2IW5 B;  2HN2 A;  3JCF A;  4QKN A;  2CA5 A;  5LGU B;  3AAA B;  3Q2M A;  4GYS A;  4NXM T;  5JR9 B;  3JC6 C;  3BQL A;  5HXR A;  3PUY F;  2BBH A;  1U4Q A;  3T1H T;  1HNX T;  2N9D A;  1CUN A;  3K3N A;  4ILU A;  2LRK A;  2I0M A;  3A7M A;  4P0B A;  4EED A;  3ZT6 A;  4DR1 T;  3IA3 A;  3PV0 F;  3RRW A;  2I6H A;  4PFO A;  4KX6 A;  2LRL A;  3AE3 A;  5IUX A;  5DQW A;  3NZQ A;  2KMF A;  4CN6 A;  5L3E B;  4B3M T;  1LRZ A;  5FXX A;  3MKD A;  2W61 A;  1B7T A;  1ZOY A;  2XQ5 A;  2K5B B;  5KDM C;  4F8H A;  2CBI A;  5LOV E;  4JI1 T;  3N9P A;  4DND A;  4IIJ E;  1AJ3 A;  4DR4 T;  2JIW A;  1OWA A;  3CQC B;  4HE8 A;  3ZMV B;  2X0L B;  3AA1 B;  1I6Z A;  4YFS A;  1QSD A;  1T8B A;  3N5L A;  4JI6 T;  2WDV A;  4FJO A;  4Q25 A;  3ZYL A;  5AQV B;  1M62 A;  3KV5 A;  4ILA A;  3NBX X;  2V5C A;  1N34 T;  2UXX B;  1DU2 A;  2DNX A;  3E08 A;  2IIU A;  4EYY R;  4A56 A;  5LCY A;  5HEJ A;  2JMH A;  3GWH A;  2V1D B;  2WP9 A;  1HS7 A;  2H88 A;  2X0Y A;  4ZS3 A;  1SHZ C;  4H9Q C;  3P4Q A;  4JI5 T;  1WFD A;  4MAL A;  5JDH A;  2NTX A;  5IHY A;  2JMK A;  3JC6 D;  4OYJ A;  4UIG A;  2YEV C;  3PUW F;  3QOF A;  1Z8U A;  4BAY B;  5CJ5 A;  1SUM B;  1J1J A;  5JDF A;  2ZM8 A;  2W2U A;  2MYS A;  5LB7 B;  4BJN A;  1IJ6 A;  3AAE B;  1D0Y A;  2YK0 A;  4BJM A;  2IUB A;  4EGW A;  3RPU A;  4LMJ A;  5JDL A;  1HCI A;  1W9R A;  4P0A A;  3N2K E;  2V6X A;  4H9R C;  5FXV A;  3AE9 A;  1FMW A;  4E7Z A;  1XWM A;  2A72 A;  5L3C B;  5LA6 E;  4ZXL A;  4HWC A;  2VKO A;  3RX6 A;  3LG7 A;  2XQ8 A;  5AQK B;  3FXD B;  4C91 A;  2NW9 A;  3V5S A;  1U5P A;  3K1S A;  4HN9 A;  2WM9 A;  3KV4 A;  2D0U A;  3WAK A;  3ZMT B;  5JRC B;  2CHN A;  3B57 A;  4FI5 A;  4B3S T;  5JDG A;  3EDV A;  3R84 B;  4X65 T;  1W09 A;  3PTR B;  4CXW A;  2AE9 A;  4CI1 B;  3GA8 A;  4U2Z A;  3Q9D A;  3OJA A;  5HCM A;  1M7K A;  2IDO B;  3LBX A;  5EZY E;  4QXH B;  2K24 A;  4YY3 T;  2BVL A;  2WY2 A;  2ES0 A;  4O8S A;  2CLY B;  3X1D A;  4HWH A;  2Y48 B;  4PK6 A;  3MA9 A;  5CFB A;  3AE7 A;  2BS3 A;  3LBX B;  3AE5 A;  2XQ4 A;  4AKI A;  4V1A v;  2C5J A;  4ZI7 E;  4PJJ A;  3QB5 A;  2BG9 A;  3KVA A;  1SA0 E;  4IDZ A;  3N9O A;  4DR6 T;  2PFV A;  3ONL C;  2KT9 A;  4DID B;  4JI4 T;  4EIW A;  1UUR A;  5C8Y E;  3RF1 A;  4U74 A;  3EAB A;  4DV6 T;  3D0T A;  1X79 A;  5IWA T;  5IYZ E;  2LSI A;  5J2U E;  5JDN A;  2V26 A;  2Z6E A;  4HWF A;  3L8R A;  1W0A A;  2XSA A;  5L3B B;  2BKP A;  2XUE A;  2IHR 1;  5H6R B;  4HFH A;  5HYA A;  2CWY A;  1YKE B;  2E2A A;  3CX7 B;  2LSG A;  2ZM0 A;  3PUG A;  2BBJ A;  1YW0 A;  3SWH A;  4LF9 T;  1G73 A;  3ZT7 A;  3AA6 B;  3AE6 A;  1HNZ T;  5L3G B;  4H9O C;  1D1C A;  2LOS A;  2IAK A;  4H9P C;  4QH4 A;  1ZKE A;  4AQF C;  3OTO T;  5FMN A;  4GIW A;  4OFZ A;  3Q5X A;  4IGU A;  2RPA A;  5ADX L;  3CQX C;  1T72 A;  3SOL A;  3TLS A;  2VVS A;  4H63 H;  3PUV F;  2WMN A;  2L3L A;  4HFC A;  3RH3 A;  3OVU A;  3P4W A;  2B1E A;  4H9S E;  5LG4 A;  2VL8 A;  1CHU A;  1W0B A;  2DL1 A;  3PU3 A;  1XNR T;  1WLX A;  4UV8 B;  3KVB A;  4Z8X A;  3UU5 A;  4H63 V;  4HGA A;  3RRC A;  1XDP A;  3MJX A;  5CB4 E;  5LJN A;  3AE4 A;  2KZ7 B;  2W62 A;  3N9M A;  4WBO A;  4UEM A;  4EYU A;  2WMO A;  3VR8 A;  2WDQ A;  4AXP A;  5JQG E;  4M1P A;  3VRA A;  1FIO A;  4GOU A;  4COF A;  1YQ3 A;  2X66 A;  4ZHQ E;  1XMQ T;  5F5W A;  2X9H A;  3F2E A;  1MIY A;  5AQS B;  5JDM A;  3LSV A;  2CE7 A;  1NAF A;  4O4L E;  3RIU C;  3K3Q C;  3VR9 A;  2UUC T;  2ZMA A;  4I50 E;  2UU9 T;  4EXT A;  3RQW A;  4DUY T;  1HX1 B;  1UGO A;  4YLH A;  3RKG A;  5AQO B;  1N32 T;  4EAH A;  4Z91 A;  3U78 A;  2XAH B;  2XY8 B;  3HL6 A;  4AIU A;  1KFY A;  2XQA A;  4GYR A;  2JQH A;  2QGS A;  2FJA A;  4LF5 T;  2WWV A;  2E9X C;  3O9X A;  4JI8 T;  3F31 A;  2VB6 A;  2X67 A;  2E5L T;  1Y01 A;  3TLU A;  3QC9 A;  3B13 A;  2CHO A;  4MLK A;  3ZSS A;  1XMO T;  4NPP A;  4TNW A;  4AQF A;  3GMI A;  3IF8 B;  2VKJ A;  4HEA A;  2DI4 A;  3FXE B;  3GN5 B;  4YTM A;  1BR4 A;  1IBK T;  1MMN A;  3U3I A;  4OYK A;  3ESL A;  2UXN B;  4I43 B;  2XAQ B;  5JH7 E;  5FL0 A;  3CPZ A;  4TNV A;  4LFA T;  3KV6 A;  5L3D B;  4U2Y A;  2SPC A;  2G0U A;  4L0R A;  4O4H E;  4LML A;  5AQJ B;  3FZM B;  3L39 A;  4KUM B;  2K9A A;  4PK4 A;  4CN4 A;  2FJD A;  3DJB A;  2UXB T;  3I0O A;  4YSZ A;  2LM2 A;  3DTO A;  3SS1 A;  3NRX A;  5F8P A;  2KIN B;  3JAD A;  2N1G A;  3FBZ A;  5LGN B;  2LHN A;  3R6N A;  2MPK A;  5F3J A;  1J5E T;  4O2A E;  2NTY A;  2BKN A;  3N9L A;  1KNR A;  2W00 A;  2VAS A;  1ZV4 X;  4X1K E;  2XQ9 A;  2CLY C;  3IBP A;  1I94 T;  3ETU A;  3CX6 B;  5J1G A;  3AE2 A;  3WAJ A;  3EDU A;  5LG3 A;  4U31 A;  4JI2 T;  1MMD A;  1QUU A;  3PJA J;  2LKG A;  5L2L A;  1UCU A;  4Z90 A;  4PJL A;  4B6X A;  2VKH A;  3ZC1 A;  2E9X D;  2DLR A;  2NOX A;  1LVF A;  4A5X A;  2HN1 A;  2VUR A;  2E9X A;  2PJQ A;  2OV9 A;  1J5W A;  3PUR A;  4DUZ T;  4LF6 T;  2WDR A;  4HFV A;  4PJN A;  4QX7 B;  4ZS2 A;  2Q9Q C;  3UUN A;  4TWH A;  2FJE A;  3C4Z A;  3NRY A;  5KMG P;  4DVD A;  4YXD A;  5HXH A;  1YQ4 A;  2WB5 A;  5FY0 A;  2LT3 A;  1BR1 A;  3CX8 B;  5AQG B;  2E9X B;  3ZST A;  2FUP A;  2HPL A;  1JNR A;  5JRE A;  3LDQ B;  5ABE A;  5ABF B;  1S35 A;  2KWH A;  4YT0 A;  3NZP A;  1WYC A;  1XNQ T;  2A2F X;  1IAP A;  2A3D A;  3W15 B;  2XQY A;  4DV2 T;  3L3P A;  5JTG A;  4ILB A;  3NKZ A;  3TLT A;  5C2T A;  1FEW A;  2R6G F;  4HWD A;  4KBM B;  4UXN B;  4DO0 A;  4GKK T;  5LGT B;  2CMR A;  4UR9 A;  5C3J A;  4CI2 B;  3RIF A;  3RC3 A;  3J7Y q;  4JUY A;  4I4T E;  4U72 A;  3P8C D;  2VL0 A;  3F57 A;  5AQM B;  2WBL A;  4LF8 T;  3AVR A;  5AQP B;  4ZEY A;  1Z0P A;  2ZM2 A;  5JRC A;  2OA5 A;  4P1N A;  4ISS A;  1NWM X;  5LBQ B;  2FBW A;  3FHN A;  3QB5 K;  2BDE A;  3NVO A;  4IHJ E;  5EK3 A;  4OHF A;  2WS3 A;  3HI2 A;  2ZLY A;  2JQQ A;  1WR0 A;  5HWY A;  2E8I A;  3BK9 A;  2B76 A;  1UX4 A;  3SFE A;  3DP7 A;  4G63 A;  4JV5 T;  4JEU B;  5FL1 A;  5AQU B;  4JYA T;  3LK4 2;  3C51 A;  4DV7 T;  3P4R A;  2J62 A;  3OYZ A;  1D0X A;  3O4X E;  5JVD E;  5LHG B;  2N2N A;  5HCJ A;  3V5U A;  1N36 T;  3RYC E;  2Q9Q D;  4X5T A;  4YHH T;  5AQF B;  3CK6 A;  2ODU A;  2DWG A;  2LM9 A;  3KBT A;  4NUU A;  4EZH A;  4TWD A;  5LYJ E;  4GK0 E;  4IRE A;  2W63 A;  4DBQ A;  4AI6 A;  2K48 A;  2BZB A;  3A8Y C;  5HEH A;  1OED E;  3N2O A;  3Q5W A;  2Q9Q B;  1VCS A;  3HR0 A;  4YSX A;  4H9N C;  3RIA A;  3RQU A;  3UUL A;  3PU8 A;  3AAI A;  2X9W A;  4YJ2 E;  3ZC0 A;  3CQG B;  1H7C A;  2KLQ A;  3VU7 H;  3UU6 A;  4WZX A;  3TLV A;  2D5U A;  5EK4 A;  5EK2 A;  3EAM A;  2MBG A;  4F6R C;  4ZI2 C;  1EZ3 A;  2XZE A;  3UU3 A;  1HR0 T;  4K0K T;  3K8P C;  1ZEE A;  4X20 E;  3N9Q A;  4WNK A;  1VOM A;  3EUH A;  5FXZ A;  3M3Z B;  5GON E;  4A98 A;  2D0T A;  2ODV A;  4DV4 T;  3L09 A;  5LMN T;  4IDQ A;  4E7S A;  3ZLI A;  3RC8 A;  1HX8 A;  4CXX A;  5LNK A;  2D9D A;  4EB6 E;  3AED A;  3M65 A;  1E7P A;  1QLB A;  2ACX A;  3T8O A;  4ZZB A;  2KSR A;  3UUX B;  4KMC A;  1BR0 A;  3O1H A;  2HH7 A;  4IDO A;  4NXN T;  2WU5 A;  3FZL B;  3HKB E;  4IE4 A;  2LKH A;  4CZZ B;  4IL9 A;  5CGM A;  1FJG T;  3ZMZ B;  2BS4 A;  3H37 A;  4XBF B;  3PUS A;  4LMK A;  5ABH A;  4CN1 A;  4UVC B;  4JI7 T;  2CRB A;  2XHE B;  4LFC T;  1HF8 A;  2LSJ A;  4G2A A;  3PUX F;  4QH5 A;  1XDO A;  3I1A A;  3PE0 A;  5L4E A;  1KK7 A;  2KXP B;  2VWA A;  3RLF F;  1V9D A;  3AA7 B;  3ONX A;  3QNU A;  3LK2 B;  4JLE A;  5CA1 E;  3SFD A;  5BR8 T;  3UUM A;  2XJ7 A;  2LJL A;  5LBM A;  5AQI B;  2NW8 A;  3C64 A;  3P7I A;  3ZKR A;  4ZI3 C;  3CWZ B;  4TV9 E;  4J2C A;  3I9Y A;  2MOZ A;  4PJM A;  2VKD A;  2X68 A;  4UVB B;  5TAO A;  2DHR A;  3IEE A;  3AE1 A;  4PFP A;  4CI3 B;  5LP6 E;  4QWN B;  2LSK A;  4X1Y E;  2NP9 A;  4IE5 A;  5LXT E;  3ONJ A;  4UF0 A;  2E5V A;  3RYI E;  2XAS B;  2CWO A;  1WYB A;  4X62 T;  2JJ9 A;  2J1D G;  3CML A;  4CQI A;  3ANW A;  3J9X 1;  3PDY A;  2H3R A;  1IZN B;  3ZT5 A;  4QX8 B;  2VQE T;  2YDS A;  4ZI2 D;  1UUS A;  4UF0 B;  5KX5 E;  4HFB A;  3BQK A;  5M4Y A;  3ZMU B;  4HFE A;  2CCQ A;  3O1I A;  3GN5 A;  4ANJ A;  3ANW B;  5AQR B;  3N9N A;  4HFI A;  1WRD A;  2JQK A;  4HTE A;  4KHP T;  3KIN B;  4MFR A;  4GK5 E;  4DV3 T;  1VCT A;  3JAF A;  4CXY A;  1MMG A;  2Y8D A;  1MND A;  4MBQ A;  3UUB A;  5HEO A;  4QHO A;  2YU1 A;  3PUZ F;  2MTQ A;  2F4V T;  5HXS A;  2H89 A;  4I55 E;  2UUB T;  4YTP A;  1XZY A;  5ABG A;  5LHH B;  2WWU A;  1YD8 G;  3EHZ A;  2V7M A;  2W67 A;  3ZYM A;  4DR3 T;  4U3C A;  3OYX A;  2YKS A;  1BR2 A;  3O1J A;  1KF6 A;  3AVS A;  5HEG A;  2V7J A;  3UU4 A;  4TWF A;  2V5D A;  1Y64 B;  5JDQ A;  4MHC A;  4O4I E;  2XAJ B;  5E0O A;  3UFE A;  3T1Y T;  2AXD S;  2BS2 A;  3RI5 A;  3OBV E;  2X0H A;  2LEH A;  4BA9 A;  2EHO C;  4ZI3 D;  4AQY T;  2KND A;  2VVN A;  4HKA A;  3KBU A;  4C90 A;  3PUA A;  3A5X A;  3UTK A;  4DR7 T;  3C50 A;  1HNW T;  1ZP0 A;  5FNV E;  4DBR A;  4JI3 T;  4PNI A;  3ZCI A;  3RIU A;  4DV0 T;  1IBM T;  2H7V C;  2HHH T;  4QXB B;  4KHZ F;  5FVL A;  2UUA T;  3RHW A;  2L9Q A;  3I9W A;  4X1I E;  3CVR A;  3VKG A;  3MXZ A;  1OED C;  2VK9 A;  2LOP A;  4EOZ B;  4YSY A;  1WCR A;  3KFW X;  4DV5 T;  4TN7 B;  4UVA B;  4X64 T;  2XTL A;  5ABF A;  4IL4 A;  2NWB A;  1KNP A;  3MZK B;  2JRK A;  2W4X A;  2CXL A;  2XQ3 A;  1T7S A;  1D1B A;  2BG9 C;  3QK6 A;  3AEF A;  4B3R T;  5AQL B;  2RA1 A;  1G8X A;  5BMV E;  4NUV A;  5J2T E;  1VRB A;  4PK5 A;  4YJ3 E;  4IDP A;  4IST A;  4LFB T;  3S4U A;  1T98 A;  4PW8 A;  4JI0 T;  2YN6 A;  3ZN0 B;  3HKD E;  5AQT B;  4AKG A;  1MIV A;  2YDR A;  4WW0 A;  3K3O A;  4HFD A;  3RYF E;  5HXE A;  2V6Y A;  3FZH B;  4EV6 A;  3P4S A;  2CXD A;  3EVY A;  2LE8 A;  3FZF B;  2WZI A;  3C98 B;  4PAG A;  4P09 A;  4UV9 B;  3B5M A;  1S94 A;  5AQQ B;  5H6Q B;  5L47 A;  2CBJ A;  2WZH A;  2V6Y B;  4OK0 A;  2EHO D;  4B3T T;  4AKR B;  3FBL A;  2W0G A;  2L8K A;  2EHO A;  3VRB A;  4TX5 A;  5AQH B;  3VKH A;  3AEC A;  2YU2 A;  3KDS E;  3SRZ A;  3CIR A;  3LJC A;  1JNZ A;  4UEL A;  2X51 A;  4IE0 A;  5DJQ C;  2P9B A;  5AFU L;  2LLY A;  1D0Z A;  2X9X A;  3UFG A;  2EHO B;  4LF4 T;  2W66 A;  4OX9 T;  5HXC A;  3ZCJ A;  4WYV A;  2ACZ A;  3UU8 A;  3G06 A;  1X9B A;  4IE6 A;  2QA7 A;  1KEY A;  2IC9 A;  2XAG B;  1D1A A;  2WAU A;  4ADZ A;  5DQV A;  2RP4 A;  2WU2 A;  5ETW A;  1OED A;  1IBL T;  3AE8 A;  4O2B E;  3Q5E A;  2JQ9 A;  2C5K T;  5L4H A;  3FB2 A;  4U33 A;  4ASK A;  5FKY A;  4QXC B;  4WBN E;  5L3F B;  2J47 A;  2Q9Q A;  3AB3 B;  2UXC T;  3MAC A;  2J4G A;  5J0Z A;  3QUJ A;  2PBI A;  4DR5 T;  2OLT A;  3AEA A;  1OED B;  2X9Y A;  3E0Z A;  2WCA A;  3ZJ2 A;  2XSB A;  2XM2 A;  2M6I A;  3C4X A;  3NWI A;  1MMA A;  2JPF A;  2BKO A;  3AEG A;  4U7I A;  3LK3 B;  4IDN A;  2YIN A;  3AEB A;  4DV1 T;  5HWX A;  2HPJ A;  5LJM A;  3UQ4 A;  2V7K A;  4ZOL E;  2CXF A;  3LFM A;  4ILC A;  4L5G A;  2FJB A;  4EEB A;  2LSY A;  2VQF T;  1KNZ A;  3JAE A;  2A9U A;  3ZN1 B;  1LKX A;  2BG9 B;  4QH1 A;  4NIQ A;  1HG5 A;  3UQ7 A;  2NW7 A;  3MK7 C;  3P4P A;  5FY1 A;  4I0U A;  3KV9 A;  3ZEF B;  2C5I T;  5HEU A;  2BG9 E;  1E2A A;  2NR4 A;  4LF7 T;  3PJA A;  4DMV A;  4AQG A;  4DMW A;  4DR2 T;  1YKH B;  3ZYK A;  1UX5 A;  4O4J E;  3I0Q A;  5JR9 C;  4ERR A;  4N78 D;  2ZM6 T;  2PG8 A;  4YTN A;  1UK5 A;  4XAX B;  4AIS A;  3TLW A;  3HA4 A;  2IC6 A;  5FP3 A;  2H7O A;  2V8S V;  1NEN A;  4KP3 C;  4TZ4 C;  1NEK A;  5FXW A;  2QYW A;  5LHI B;  3AXJ A;  4JBW F;  1IJ5 A;  2QVA A;  1N33 T;  3RKO A;  2PTF A;  1FMV A;  5FY7 A;  4KI0 F;  2XQ7 A;  2YDQ A;  3ZJ1 A;  3ABV A;  3UT5 E;  2CPT A;  3CKD A;  3AXJ B;  5KXJ A;  4AKH A;  3RYH E;  4EZ4 A;  3N2G E;  3PUQ A;  2K3W A;  4ZZC A;  3WI3 A;  5AQN B;  4U7Y A;  3Q5D A;  2XAF B;  5LMU T;  1OXZ A;  3TKL B;  3RGL A;  4XZC A;  3IHR A;  2DWK A;  1LVK A;  2WSS V;  4L9I A;  1SE7 A;  1GQE A;  2XQ6 A;  2Y6X A;  5DAB A;  1E1H B;  3HKE E; 
#chains in the Genus database with same CATH homology
 2CMR A;  1X79 A;  2M67 A;  2LEH A;  5IYZ E;  2LSI A;  4CI2 B;  3AA0 B;  3RC3 A;  5J2U E;  4BA9 A;  5JDN A;  3J7Y q;  4TV8 E;  2EHO C;  3C4W A;  4JUY A;  4I4T E;  4ZI3 D;  4U72 A;  2KWI B;  2DCF A;  3OKQ A;  2V26 A;  3P8C D;  2KND A;  3F57 A;  2CEA A;  2Z6E A;  2WBL A;  1O3X A;  5L3B B;  3VHL A;  3H3A A;  4HKA A;  2XUE A;  3KBU A;  4C90 A;  5H6R B;  3PUA A;  3AVR A;  3A5X A;  3UTK A;  1Z0P A;  2ZM2 A;  5HYA A;  4YHJ A;  2OA5 A;  5JRC A;  2CWY A;  1MIW A;  1YKE B;  5HAX A;  3CX7 B;  2LSG A;  2D2S A;  3C50 A;  4ISS A;  5FNV E;  1NWM X;  5LBQ B;  4DBR A;  3FHN A;  2ZM0 A;  4PNI A;  3PUG A;  3ZCI A;  2BDE A;  1YW0 A;  2H7V C;  3SWH A;  4AKL A;  2V7L A;  1HFA A;  3BQI A;  3ETV A;  4K0U A;  1G73 A;  4QXB B;  4IHJ E;  5EK3 A;  3AA6 B;  4OHF A;  3HI2 A;  3HKC E;  3ZPO A;  2ZLY A;  5L3G B;  4H9O C;  1D1C A;  2JQQ A;  5HWY A;  2LHR A;  2L9Q A;  5CA0 E;  2E8I A;  3I9W A;  2LOS A;  4X1I E;  3CVR A;  2IAK A;  3VKG A;  4H9P C;  3BK9 A;  3MXZ A;  1ZKE A;  1WR6 A;  1ZHC A;  2VK9 A;  3E22 E;  4AQF C;  1UX4 A;  2LOP A;  2GK9 A;  4TUY E;  2I59 A;  4GIW A;  5FMN A;  2C0S A;  4OFZ A;  2BVM A;  4EOZ B;  3Q5X A;  3KFW X;  3DP7 A;  1US7 B;  4IGU A;  4G63 A;  5JR9 A;  4JEH B;  1HG2 A;  4JEU B;  4TN7 B;  4UVA B;  1HTJ F;  5ADX L;  3CQX C;  2V7I A;  5FYM A;  3SOL A;  3ZMS B;  1MNE A;  2XTL A;  2NWB A;  4H63 H;  4IE7 A;  2WMN A;  3LK4 2;  3MZK B;  3C51 A;  2JRK A;  5A1L A;  2CM0 A;  2IW5 B;  2L3L A;  3OYZ A;  3RH3 A;  1D0X A;  4QKN A;  2CA5 A;  2CXL A;  5LGU B;  3AAA B;  3O4X E;  1D1B A;  3Q2M A;  4GYS A;  5JVD E;  5LHG B;  2B1E A;  4H9S E;  2N2N A;  3QK6 A;  5LG4 A;  3V5U A;  5JR9 B;  2VL8 A;  3RYC E;  2Q9Q D;  3JC6 C;  3BQL A;  2RA1 A;  5HXR A;  1G8X A;  3PU3 A;  2ODU A;  5BMV E;  1WLX A;  4NUV A;  4UV8 B;  3KVB A;  5J2T E;  2DWG A;  4Z8X A;  1VRB A;  2LM9 A;  4PK5 A;  4YJ3 E;  4H63 V;  4HGA A;  3KBT A;  3RRC A;  1U4Q A;  4IST A;  3MJX A;  4NUU A;  5CB4 E;  4EZH A;  3S4U A;  2N9D A;  4GK0 E;  5LJN A;  5LYJ E;  1T98 A;  4PW8 A;  1CUN A;  2KZ7 B;  2W62 A;  3K3N A;  3N9M A;  4ILU A;  4WBO A;  4P0B A;  3ZN0 B;  4UEM A;  2W63 A;  4EYU A;  3HKD E;  2WMO A;  4DBQ A;  4AXP A;  4AKG A;  5JQG E;  4AI6 A;  1MIV A;  3RRW A;  4WW0 A;  2K48 A;  3K3O A;  2BZB A;  4PFO A;  4M1P A;  3N2O A;  3Q5W A;  2Q9Q B;  3RYF E;  3HR0 A;  4H9N C;  5HXE A;  1FIO A;  4GOU A;  3UUL A;  2X66 A;  3PU8 A;  3AAI A;  4ZHQ E;  2CXD A;  3EVY A;  5DQW A;  2X9W A;  2X9H A;  3NZQ A;  4YJ2 E;  2LE8 A;  1MIY A;  2KMF A;  3CQG B;  3F2E A;  3ZC0 A;  1H7C A;  5L3E B;  2KLQ A;  5JDM A;  3VU7 H;  2CE7 A;  1NAF A;  3C98 B;  4O4L E;  4PAG A;  4P09 A;  1LRZ A;  4UV9 B;  5FXX A;  3MKD A;  3K3Q C;  2W61 A;  1B7T A;  1S94 A;  2ZMA A;  4I50 E;  2D5U A;  4EXT A;  5H6Q B;  2K5B B;  5KDM C;  4OK0 A;  2EHO D;  5EK4 A;  5EK2 A;  2MBG A;  5LOV E;  4YLH A;  3N9P A;  4DND A;  4F6R C;  4ZI2 C;  1EZ3 A;  4AKR B;  3FBL A;  2W0G A;  4IIJ E;  1AJ3 A;  2L8K A;  3K8P C;  2EHO A;  4EAH A;  1ZEE A;  4TX5 A;  3U78 A;  2XAH B;  3VKH A;  3HL6 A;  1OWA A;  3CQC B;  4X20 E;  3N9Q A;  4WNK A;  2YU2 A;  4HE8 A;  3ZMV B;  3KDS E;  3SRZ A;  1VOM A;  2X0L B;  3EUH A;  4GYR A;  3LJC A;  3AA1 B;  5FXZ A;  4UEL A;  5GON E;  2X51 A;  2QGS A;  4YFS A;  2D0T A;  4IE0 A;  2P9B A;  5DJQ C;  1QSD A;  2ODV A;  3L09 A;  2E9X C;  3N5L A;  5AFU L;  3O9X A;  4FJO A;  4E7S A;  3F31 A;  3ZLI A;  3RC8 A;  1D0Z A;  1HX8 A;  2VB6 A;  4CXX A;  5LNK A;  2X67 A;  2X9X A;  3ZYL A;  4EB6 E;  2EHO B;  5HXC A;  3KV5 A;  3M65 A;  2ACX A;  3QC9 A;  3ZCJ A;  3T8O A;  3NBX X;  3B13 A;  4MLK A;  2UXX B;  4IE6 A;  2QA7 A;  3UUX B;  4KMC A;  1BR0 A;  3O1H A;  2HH7 A;  2IC9 A;  2XAG B;  2DNX A;  3E08 A;  3HKB E;  4IE4 A;  4EYY R;  1D1A A;  4A56 A;  2WAU A;  5LCY A;  4ADZ A;  4CZZ B;  5DQV A;  2RP4 A;  2JMH A;  5ETW A;  4AQF A;  3GWH A;  3GMI A;  2V1D B;  4O2B E;  3IF8 B;  2VKJ A;  3ZMZ B;  2C5K T;  4HEA A;  3H37 A;  4XBF B;  2DI4 A;  1HS7 A;  3PUS A;  3FB2 A;  3FXE B;  3GN5 B;  4ZS3 A;  1SHZ C;  4ASK A;  1BR4 A;  4H9Q C;  4QXC B;  4WBN E;  5L3F B;  4UVC B;  1MMN A;  3U3I A;  4OYK A;  2Q9Q A;  3AB3 B;  3ESL A;  2UXN B;  2XHE B;  1HF8 A;  2LSJ A;  3MAC A;  4G2A A;  4MAL A;  4I43 B;  3QUJ A;  5JDH A;  2PBI A;  2NTX A;  2XAQ B;  5JH7 E;  3I1A A;  3PE0 A;  3CPZ A;  1KK7 A;  2KXP B;  5IHY A;  2X9Y A;  2VWA A;  3E0Z A;  2JMK A;  3JC6 D;  3KV6 A;  1V9D A;  4OYJ A;  4UIG A;  3ZJ2 A;  2YEV C;  5L3D B;  3C4X A;  1MMA A;  3AA7 B;  3ONX A;  3LK2 B;  4JLE A;  2JPF A;  2SPC A;  5CA1 E;  4BAY B;  2G0U A;  3LK3 B;  4L0R A;  3UUM A;  2YIN A;  2LJL A;  4O4H E;  5LBM A;  5JDF A;  5HWX A;  2HPJ A;  2NW8 A;  2ZM8 A;  5LJM A;  2V7K A;  4ZOL E;  2CXF A;  3C64 A;  3LFM A;  3P7I A;  2MYS A;  4ZI3 C;  4KUM B;  2K9A A;  4BJN A;  1IJ6 A;  3AAE B;  3CWZ B;  1D0Y A;  4L5G A;  4TV9 E;  4PK4 A;  2YK0 A;  4BJM A;  2LSY A;  1KNZ A;  4J2C A;  3DJB A;  3I0O A;  3ZN1 B;  1LKX A;  2MOZ A;  3I9Y A;  4PJM A;  2VKD A;  2X68 A;  3DTO A;  3SS1 A;  3RPU A;  5JDL A;  4UVB B;  5TAO A;  3NRX A;  1HCI A;  5F8P A;  2DHR A;  2KIN B;  3IEE A;  4P0A A;  3N2K E;  4CI3 B;  4PFP A;  1HG5 A;  5LP6 E;  2NW7 A;  4QWN B;  2LSK A;  4H9R C;  4X1Y E;  3MK7 C;  2N1G A;  5FXV A;  2NP9 A;  3FBZ A;  5FY1 A;  2LHN A;  5LGN B;  4IE5 A;  3KV9 A;  3R6N A;  3ZEF B;  2C5I T;  5LXT E;  5F3J A;  4O2A E;  1FMW A;  4UF0 A;  2NTY A;  4E7Z A;  3RYI E;  3N9L A;  2W00 A;  2VAS A;  2XAS B;  2A72 A;  2CWO A;  4DMV A;  1ZV4 X;  1WYB A;  4AQG A;  5L3C B;  5LA6 E;  2JJ9 A;  4X1K E;  4DMW A;  2J1D G;  2VKO A;  1YKH B;  3CML A;  3LG7 A;  3RX6 A;  4CQI A;  3ANW A;  3J9X 1;  3PDY A;  2CLY C;  3ZYK A;  2H3R A;  1UX5 A;  1IZN B;  3FXD B;  4C91 A;  4O4J E;  3IBP A;  2NW9 A;  3I0Q A;  4QX8 B;  3ETU A;  3V5S A;  3CX6 B;  5J1G A;  4ZI2 D;  5JR9 C;  1U5P A;  3WAJ A;  4UF0 B;  3EDU A;  5KX5 E;  4ERR A;  4N78 D;  4HN9 A;  2PG8 A;  2WM9 A;  3KV4 A;  2D0U A;  3WAK A;  1MMD A;  1QUU A;  4XAX B;  3BQK A;  5M4Y A;  5L2L A;  3ZMU B;  3HA4 A;  2IC6 A;  3ZMT B;  5JRC B;  2CCQ A;  5FP3 A;  1UCU A;  3B57 A;  3O1I A;  3GN5 A;  4FI5 A;  2H7O A;  4TZ4 C;  4KP3 C;  4PJL A;  4ANJ A;  3ANW B;  4B6X A;  2VKH A;  5JDG A;  3EDV A;  3R84 B;  3ZC1 A;  2E9X D;  3N9N A;  2DLR A;  2NOX A;  1WRD A;  1LVF A;  3PTR B;  5FXW A;  4CXW A;  4HTE A;  4CI1 B;  3GA8 A;  3KIN B;  5LHI B;  3Q9D A;  3OJA A;  4MFR A;  2E9X A;  2PJQ A;  4GK5 E;  3PUR A;  1IJ5 A;  3LBX A;  5EZY E;  4HFV A;  4CXY A;  4PJN A;  4QX7 B;  4ZS2 A;  4QXH B;  2Q9Q C;  3UUN A;  1MMG A;  2K24 A;  2Y8D A;  1MND A;  4MBQ A;  3RKO A;  2BVL A;  3C4Z A;  1FMV A;  5FY7 A;  3NRY A;  5KMG P;  4DVD A;  4QHO A;  2ES0 A;  4O8S A;  2YU1 A;  5HXH A;  3ZJ1 A;  2MTQ A;  5FY0 A;  2LT3 A;  3D0T A;  5HXS A;  2CLY B;  4I55 E;  3UT5 E;  1BR1 A;  3CX8 B;  2Y48 B;  2E9X B;  3CKD A;  4PK6 A;  3MA9 A;  3LBX B;  4AKI A;  5LHH B;  4AKH A;  3RYH E;  4V1A v;  4EZ4 A;  2WWU A;  2C5J A;  2HPL A;  1YD8 G;  3N2G E;  4ZI7 E;  4PJJ A;  5JRE A;  3PUQ A;  2V7M A;  3ZYM A;  3KVA A;  3OYX A;  1S35 A;  1SA0 E;  2KWH A;  3WI3 A;  4IDZ A;  1BR2 A;  3NZP A;  1WYC A;  2XAF B;  3O1J A;  1OXZ A;  3TKL B;  3N9O A;  2A2F X;  3AVS A;  2PFV A;  2V7J A;  1IAP A;  4XZC A;  2A3D A;  2DWK A;  3IHR A;  3W15 B;  2XQY A;  3L3P A;  1Y64 B;  2KT9 A;  1LVK A;  2WSS V;  4L9I A;  5JDQ A;  4MHC A;  4EIW A;  5C8Y E;  4O4I E;  4U74 A;  1FEW A;  2XAJ B;  5E0O A;  3UFE A;  2Y6X A;  4KBM B;  4UXN B;  3OBV E;  4DO0 A;  5DAB A;  1E1H B;  3HKE E;  5LGT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...