1HS7A

Vam3p n-terminal domain solution structure
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
97
structure length
97
Chain Sequence
TNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vam3p structure reveals conserved and divergent properties of syntaxins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
molecule keywords SYNTAXIN VAM3
total genus 43
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2000-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hs7A00
5M4YA 1EZ3A 1FIOA 3LG7A 1HS7A 1G73A 4TX5A 4JEHB 5LG4A 2XHEB 3C98B 4JEUB 2DNXA 1BR0A 1FEWA 1S94A
chains in the Genus database with same CATH superfamily
5CFBA 3C4WA 2BDEA 5J0ZA 1UURA 3UU5A 4Z90A 4AQGA 2UXDT 3T1HT 3TKLB 3FBLA 4IE4A 4IDNA 4PAGA 2WU2A 3N5LA 4X1IE 4TX5A 4JI7T 5AQNB 2XAJB 4PNIA 3MXZA 3IF8B 2WBLA 1MNEA 3CQCB 3F57A 4V1Av 2JMKA 2CLYB 3I1AA 2DHRA 5J2TE 1HS7A 2EHOA 3AE2A 4DR3T 5FMNA 4AQYT 2BG9A 4H9SE 3T8OA 4IIJE 2QA7A 1UCUA 2X51A 3CMLA 4NIQA 4IL9A 3BQLA 1OEDB 4CN6A 1U4QA 3LBXA 2LJLA 4JEHB 3VKGA 3OTOT 2W0GA 4JI5T 2CXFA 3TLSA 2LM9A 4QWNB 3N2GE 2LEHA 2XTLA 3Q2MA 5FY0A 3ZKRA 2H88A 3J7Yq 1BR2A 1R8IA 2C5KT 2WAUA 2Q9QD 3HKEE 4IE7A 4KX6A 3TLUA 4DR6T 4TWDA 2C5IT 2A9UA 3GMIA 3QC9A 2WWVA 4IE0A 1Z8UA 4ADZA 4AKLA 4LF5T 1HX1B 1WCRA 2XQ3A 3AE4A 4H9OC 4TWHA 4AKRB 4EIWA 4ZEYA 5M4YA 2V8SV 3OKQA 5LBQB 4ILBA 4DV7T 2JMHA 5FVLA 4A97A 5HEJA 4H9NC 3EDVA 4ILUA 2IW5B 2Z6EA 3ZT5A 4GIWA 2YOEA 2LHNA 3GA8A 4EV6A 4ZI7E 4JI6T 2XQ7A 2EHOC 2VASA 5LNKA 2LT3A 2J4GA 3VHLA 2VKDA 5IWAT 1XDPA 4DIDB 4ASKA 1IBKT 3SFEA 2Y8DA 3ZCJA 1FMWA 4UF0B 3KV9A 5HYAA 3I0OA 5F8PA 3AXJA 5CJ5A 4TN7B 1X9BA 3ONJA 3FXDB 4GK5E 3ANWA 2YDRA 4ILCA 1HNWT 4DO0A 4XBFB 1XDOA 3D0TA 3E22E 3LG7A 2V6XA 1WLXA 2WWUA 4ZS2A 2IC6A 2KINB 1VRBA 4HWDA 2NOXA 2W00A 1J5ET 4DR7T 4CI2B 3RIFA 3ZC1A 4TWFA 4JI1T 2QVAA 2D0UA 2MBGA 5LXTE 4JI0T 4NXMT 5AQGB 5FL1A 4GKJT 1US7B 3BQKA 1MNDA 4AKIA 1QLBA 2XAFB 2H3RA 2WCAA 4MLKA 3FZMB 3LJCA 3KV6A 3Q5DA 2VB6A 1FMVA 1V9DA 2WP9A 4TV8E 4F8HA 1G8XA 2CE7A 1KFYA 2V7MA 2WM9A 3UU6A 3ZN1B 4WBNE 5LGUB 5A1LA 4HEAA 4BAYB 5AQTB 1XWMA 3MK7C 1FJGT 5J1GA 3PE0A 2NR4A 3RYFE 3HKDE 2CPTA 2CMRA 3KV5A 4FI5A 2X9YA 3HA4A 3NRXA 4JEUB 5LHHB 3RYIE 1OEDC 1D1CA 2CEAA 4P09A 4DMWA 1YW0A 1HFAA 2N2NA 5ABGA 2XQAA 3RI5A 3RRWA 3O9XA 3K3OA 5JRCA 4Z8XA 3NZQA 1D1AA 3PU8A 4I4TE 5CGMA 1HNZT 1ZHCA 4B3MT 3ETUA 4HWIB 1QUUA 5AQVB 2BVMA 4LF4T 2VKHA 5FY7A 3AEEA 3IEEA 3Q5XA 2D0TA 3JC6C 4A5XA 4HE8A 2J47A 2LKGA 4PJLA 2ZM8A 4O4HE 2XM2A 1W0BA 1HNXT 2BG9E 1W9RA 4CQIA 3C64A 5FYMA 3AAEB 3FB2A 5AQJB 2CCQA 3M65A 4EXTA 4F6RC 2X0LB 3RYHE 3EVYA 2W61A 5FKYA 4KMCA 4ZXLA 5LGNB 4Z91A 1W09A 4JV5T 1KNPA 3RYCE 2CLYC 2WDVA 3N9QA 4PJJA 1MMDA 2YDQA 2M6IA 4IT4A 3JCFA 4PK5A 3C51A 3AECA 2X67A 3RHWA 3N9LA 1I94T 2IIUA 3K3NA 4QH1A 2JQHA 2XAGB 4O2BE 4IE6A 4H9QC 3O1HA 2BKOA 2Q9QA 4ZI3D 2CRBA 4IDQA 2VL0A 4CI3B 4X65T 3T1YT 4UV9B 3FHNA 4IDZA 2N9DA 4HFCA 2CHOA 2E9XB 2XZEA 3P4SA 4ZS3A 3ZSSA 2WDRA 2UXBT 4BJMA 3N9MA 3FZFB 3CX6B 3RPUA 3SWHA 1T8BA 2B76A 4ISSA 2YU2A 5ETWA 3JADA 4E7SA 4LFBT 2CBIA 2P9BA 3GWHA 4X1YE 4EYYR 3L39A 4HGAA 3AE8A 5H6RB 5JDLA 3KVBA 2KWHA 2NW7A 2LE8A 3BK9A 5LCYA 3ZJ1A 2R6GF 2N1GA 1XMOT 3NZPA 5EK3A 4EZHA 4KUMB 4HKAA 2VK9A 1MMAA 2BVLA 4ISTA 2D9DA 2JPFA 3J9X1 3VKHA 3ZMUB 5JDMA 4XZCA 3ESLA 4KBMB 2K3WA 5BMVE 3P8CD 4X5TA 1KEYA 3HKBE 4EAHA 1IAPA 3PUZF 4ERRA 3CQGB 4HN9A 4A56A 2IC9A 3RF1A 5L3GB 2VVSA 3PJAA 2I59A 3QB5A 5HCMA 2JRKA 2H89A 3ABVA 1MMNA 2PJQA 2X0HA 4GOUA 2NW8A 4L9IA 3H37A 1WR0A 5LA6E 2LSKA 3L8RA 5LBMA 3UUMA 4BA9A 2NTXA 4KHZF 3NVOA 5H6QB 2CM0A 1OXZA 2Y48B 4UIGA 5AQSB 2BG9B 2UXNB 2W4XA 2BG9C 1W0AA 2XM1A 4GYSA 4X1KE 4JI8T 2BKPA 2K48A 2V6YB 3CK6A 3C4ZA 2BBHA 2LSYA 2H7OA 3IHRA 3P4PA 3ZYMA 4OFZA 5AQFB 2M6BA 4ZI3C 2UUAT 2SPCA 3FXEB 2V1DB 4LF6T 2LLYA 5L4HA 2NWBA 4HFVA 2HHHT 3BQIA 1Y01A 4MALA 4X64T 4QKNA 3PUVF 4KHPT 3B57A 4UV8B 3FZKB 2HH7A 3UUXB 4EEBA 4X62T 3K3QC 1BR4A 1SA0E 3E08A 3ZT6A 4OK0A 4A98A 4HFDA 4IL4A 3E0ZA 1T7SA 4CI1B 5L3EB 4E7ZA 1QSDA 2ODUA 1I6ZA 2IAKA 4ZHQE 2BKNA 2XY8B 2WQYA 4C91A 4LMLA 1JNRA 4UVCB 5LJNA 3WAJA 1XNQT 2UUCT 3OYXA 3TLWA 1OWAA 3ANWB 5IUXA 4LF8T 2I0MA 3TLVA 5HWXA 4P1NA 2YINA 5HCJA 5AQUB 4OYJA 5EZYE 3CIRA 5JDQA 4OX9T 2ZMAA 3ZT7A 1X79A 4U7YA 3C4XA 3ZC0A 3VRBA 3I0QA 3QNUA 1LRZA 3M3ZB 4U33A 4PJMA 2LHRA 5JDGA 5FNVE 4U7IA 1Y64B 4QHOA 3RQWA 4UVAB 5CB4E 5HXRA 3PUYF 4U74A 1NWMX 3UTKA 2ES0A 3OVUA 5FXZA 2YN6A 3QB5K 5AQOB 3N2KE 4DV3T 4DR1T 5FP3A 1N33T 2LKHA 1VCSA 2MAWA 5IYZE 3W15B 2YEVC 1UX4A 1IBLT 5HWYA 3DTOA 2XHEB 2D2SA 2QGSA 3O1IA 3QK6A 3UU4A 2E5LT 2V7IA 2XJ7A 1SE7A 4JUYA 4ZI2D 2CWYA 4TNWA 3AE1A 4WNKA 3P4WA 4YT0A 5L4EA 4YY3T 1YQ3A 2PG8A 2V7JA 5HXHA 3Q9DA 3ZMZB 4OHFA 3AA7B 3GN5A 4HTEA 3ONLC 4YSXA 2CA5A 1OEDA 3AEAA 3JAFA 1IZNB 2AE9A 2K5BB 1O3XA 4PK4A 5FY1A 3VU7H 4DBRA 3HL6A 2Y6XA 3LK42 3VR9A 3AE3A 2FJAA 2LRLA 2L8KA 3AE5A 3O1JA 3A5XA 1CUNA 2EHOB 5F5WA 5ABHA 3K8PC 4J2CA 5HXCA 5JDNA 3C50A 5JRCB 1ZOYA 2E5VA 3B5MA 1BR0A 4O8SA 4ZOLE 1EZ3A 5LHGB 5C2TA 2BS4A 2K24A 5GONE 2NW9A 3KVAA 1G73A 4EGWA 3ZMVB 1YKEB 1KF6A 1N34T 3F2EA 2UUBT 3VR8A 5AQHB 3DP7A 2ACZA 3P4RA 3ZJ2A 4AXPA 2IDOB 3LK2B 4NUUA 4NXNT 2FUPA 3PTRB 1IJ6A 5CA0E 3EDUA 2X0YA 2IMLA 1IBMT 3UFEA 3EAMA 1YXRA 1YKHB 3R84B 3HI2A 2XQYA 2VVNA 3I9YA 3MKDA 4PW8A 1J5WA 5ADXL 4YSYA 4DV6T 5KXJA 4I43B 5DJQC 3TLTA 3X1DA 5L3BB 1IJ5A 2C0SA 3RC3A 4B3RT 2IHR1 4JI3T 2XQ6A 1HG5A 2ACXA 2MYSA 5HXEA 4WW0A 3AEGA 3PV0F 3F31A 3H3AA 3PDYA 5JQGE 2H7VC 4KI0F 5AFUL 4YHHT 2UXCT 1S35A 3CWZB 2B1EA 4DMVA 3RH3A 3PURA 2LM2A 3A8YC 4LFAT 2X9WA 1XNRT 2PBIA 3UQ7A 4H9PC 4LFCT 5DQWA 4JBWF 1M62A 4AQFC 5HAXA 4LF7T 1NENA 2XQ8A 5ABFA 4TNVA 2D5UA 4U31A 3L3PA 3ZMSB 1UX5A 1KNRA 4G63A 2CBJA 2X9XA 1D1BA 3OPCA 4KP3C 5AQQB 5HEGA 4AISA 2W66A 2V26A 4YJ2E 5HEUA 2L9QA 4AIUA 2GK9A 1FEWA 2X66A 4B3TT 4QXCB 2JIWA 1XZYA 4GYRA 4K0UA 4L0RA 3UU3A 4DR2T 2X68A 2XSBA 3FZHB 4P0AA 4EZ4A 2J62A 2WMNA 2VURA 2DWGA 3UULA 2HPJA 5FXVA 1ZV4X 2BS3A 2W2UA 3P7IA 5LHIB 1H7CA 2MPKA 4HFBA 2KZ7B 2XPKA 4FJOA 4MBQA 3EABA 3WI3A 2XSAA 2UXXB 4CXWA 3RGLA 3KBTA 1M7KA 3K1SA 4G2AA 3RC8A 3UU8A 4L5GA 2DCFA 3FZLB 2KLQA 2WB5A 1WRDA 1ZKEA 2CXDA 4QXHB 4U2YA 3ZN0B 3ZEFB 3ZYLA 4O4JE 4X66T 1HTJF 5AQRB 3RIAA 5JTGA 3UT5E 5EK2A 2HN2A 5JR9A 1MMGA 2E9XD 2V7KA 1J1JA 3LDQB 4LF9T 3Q5EA 3AE7A 3C98B 1B7TA 2JQKA 4UXNB 4CXXA 5JREA 1KNZA 3MJXA 4MHCA 3AA1B 5DABA 1T72A 3DJBA 4YXDA 2NP9A 2JQQA 4ZI2C 4IREA 4YTMA 4O4IE 4DBQA 5LMNT 4X20E 5J2UE 5FXWA 3AE9A 3EHZA 2V7LA 4DR5T 3R6NA 4QH5A 3CQXC 3AA0B 3U3IA 5HXSA 1MIVA 4K0KT 5F3JA 4B6XA 2HN1A 3RQUA 1DU2A 5KX5E 5L47A 1HX8A 4YFSA 3RLFF 5HEHA 2OLTA 3JAEA 2QYWA 3RX6A 4DNDA 1FIOA 2JJ9A 3MZKB 4QXBB 1SHZC 2MOZA 2WU5A 2RP4A 3NKZA 5AQLB 1D0YA 4YTNA 5LG3A 2MTQA 2Q9QC 3CX7B 3HR0A 1BR1A 2KSRA 3UQ4A 3AE6A 2WZHA 3AVRA 4PK6A 1D0XA 1VCTA 4IDOA 1HF8A 5EK4A 3AXJB 2VKJA 2XAHB 2VKOA 4I0UA 4Q25A 4ANJA 4GKKT 3LSVA 2PFVA 2LSIA 3H3MA 3V5UA 4DV2T 3PJAJ 1UUSA 3A7MA 2QRXA 4CXYA 3LK3B 4YHJA 3RIUA 1NEKA 2KT9A 4DV0T 2LOPA 3HKCE 4IE5A 4IDPA 5FL0A 2E8IA 2WMOA 5LYJE 1AJ3A 5JDHA 3P4QA 5JR9C 1MIWA 1UK5A 4ZZBA 3AEBA 3ZSTA 3MACA 2XQ9A 1WYCA 5FVKA 3SOLA 1YQ4A 1YD8G 3PUWF 4AQFA 2K9AA 3ZYKA 4ILAA 4I55E 4IHJE 2JQ9A 3CPZA 3RKGA 3IA3A 4CN1A 4BJNA 4P0BA 5JH7E 3UUBA 3EUHA 3SRZA 4YTPA 4DV1T 1KK7A 3P50A 3QOFA 2FJEA 3PUAA 2XQ4A 4GK0E 4EYUA 4H63H 3UUNA 1JNZA 5HEOA 5AQPB 3AVSA 1MIYA 5AQMB 5FXXA 5LMUT 2FJDA 3ZCIA 1LVFA 3AEFA 3NWIA 4TZ4C 2M67A 4U72A 4CN4A 4HWCA 2DI4A 3PUXF 5JDFA 3CX8B 1N32T 3AEDA 1WFDA 2W62A 3KFWX 1T98A 3NRYA 4JLEA 3N2OA 3VRAA 4HWFA 2I6HA 5L3DB 5ABFB 1WR6A 5LGTB 3NBXX 3KDSE 4QX7B 2KNDA 5AQKB 3LBXB 4H9RC 3Q5WA 1L0VA 4C90A 2ZLYA 3N9OA 2V5CA 4JI2T 4IGUA 2EHOD 3ETVA 3QUJA 1HG2A 1GQEA 2ZM6T 4QX8B 4H63V 3RKOA 4DV4T 4ZZCA 2NTYA 2YKSA 3AA6B 2RPAA 3ZLIA 4TUYE 5LP6E 5KMGP 4EEDA 3ZMTB 4UVBB 2CWOA 2YDSA 2WS3A 3MA9A 4YLHA 2BS2A 3AB3B 4HFIA 5LB7B 2E9XA 1NAFA 2HPLA 2LRKA 3AAAB 3KBUA 3N9PA 3PUGA 3B13A 4MFRA 5AQIB 5LOVE 5E0OA 5TAOA 3S4UA 4AI6A 3O4XE 5ABEA 2KWIB 4YJ3E 2PTFA 4EB6E 2DLRA 2Q9QB 3KINB 3OBVE 2LOSA 2KMFA 1ZP0A 2FBWA 4U3CA 4UEMA 4WBOA 5C8YE 4UF0A 4B3ST 2ODVA 2E2AA 2X9HA 5IHYA 5DQVA 3KV4A 4CZZB 1LKXA 3PUSA 2G0UA 2F4VT 3WAKA 2W63A 2XAQB 2WY2A 3CKDA 2YU1A 2C5JA 2CXLA 2DNXA 1N36T 4PFPA 2A3DA 1CHUA 3ZPOA 5JVDE 4LMKA 2CHNA 2J1DG 4JYAT 4LMJA 3U78A 4DUZT 1E7PA 2W67A 4XAXB 4M1PA 5JR9B 2V5DA 2VQFT 5BR8T 3EI0A 4DR4T 4OYKA 1E2AA 1U5PA 3UFGA 1E1HB 2UU9T 2FJBA 4PFOA 4U2ZA 4UELA 4WYVA 4PJNA 3RIUC 2WSSV 2VL8A 2ZM2A 4AKGA 3CVRA 4UR9A 3FBZA 4I50E 3GN5B 1SUMB 2VWAA 3PUQA 1VOMA 3AAIA 1LVKA 3ONXA 4TV9E 1OEDE 2LSGA 4NUVA 4JI4T 3LFMA 4HWHA 2A2FX 2BZBA 2DWKA 2A72A 5L3CB 5L3FB 2VQET 4AKHA 2XASB 2AXDS 1HR0T 2WDQA 4O4LE 4YSZA 4N78D 2XQ5A 3OYZA 2E9XC 2IUBA 3JC6D 4QH4A 3RRCA 3SFDA 2YK0A 3V5SA 2V6YA 5CA1E 3N9NA 5C3JA 4DUYT 1WYBA 1ZEEA 2DL1A 5LG4A 4DV5T 3SS1A 2XUEA 3L09A 1XMQT 2LSJA 4COFA 5L2LA 4DVDA 5KDMC 1S94A 4EOZB 1UGOA 3IBPA 4NPPA 4O2AE 2RA1A 2ZM0A 2KXPB 1Z0PA 2WZIA 3PU3A 1D0ZA 2OV9A 1HCIA 4HFHA 2BBJA 2L3LA 4WZXA 5LJMA 3G06A 4HFEA 3I9WA 2OA5A 3OJAA
chains in the Genus database with same CATH topology
3C4WA 2BDEA 4AQGA 3TKLB 3FBLA 4IE4A 4PAGA 3N5LA 4X1IE 4TX5A 2XAJB 4PNIA 3MXZA 3IF8B 2WBLA 1MNEA 3CQCB 3F57A 4V1Av 2JMKA 2CLYB 3I1AA 2DHRA 5J2TE 1HS7A 2EHOA 5FMNA 4H9SE 3T8OA 4IIJE 2QA7A 1UCUA 2X51A 3CMLA 3BQLA 1U4QA 3LBXA 2LJLA 4JEHB 3VKGA 2W0GA 2CXFA 2LM9A 4QWNB 3N2GE 2LEHA 2XTLA 3Q2MA 5FY0A 3J7Yq 1BR2A 2C5KT 2WAUA 3HKEE 2Q9QD 4IE7A 2C5IT 3GMIA 3QC9A 4IE0A 4ADZA 4AKLA 4H9OC 5M4YA 4EIWA 3OKQA 5LBQB 2JMHA 4H9NC 3EDVA 4ILUA 2IW5B 2Z6EA 4GIWA 4ZI7E 2LHNA 3GA8A 2EHOC 2VASA 5LNKA 2LT3A 3VHLA 2VKDA 4ASKA 2Y8DA 3ZCJA 1FMWA 4UF0B 3KV9A 5HYAA 3I0OA 5F8PA 4TN7B 4GK5E 3FXDB 3ANWA 4DO0A 4XBFB 3E22E 3D0TA 3LG7A 2WWUA 1WLXA 4ZS2A 2IC6A 2KINB 1VRBA 2NOXA 2W00A 4CI2B 3ZC1A 2MBGA 2D0UA 5LXTE 4AKIA 1US7B 3BQKA 1MNDA 2XAFB 2H3RA 4MLKA 3LJCA 3KV6A 2VB6A 1FMVA 1V9DA 4TV8E 1G8XA 2CE7A 2V7MA 5LGUB 2WM9A 4WBNE 3ZN1B 5A1LA 4HEAA 4BAYB 3MK7C 5J1GA 3PE0A 3RYFE 3HKDE 2CMRA 3KV5A 4FI5A 2X9YA 3HA4A 3NRXA 4JEUB 5LHHB 3RYIE 1D1CA 4P09A 2CEAA 4DMWA 1YW0A 1HFAA 2N2NA 5JRCA 3RRWA 3O9XA 3K3OA 4Z8XA 3NZQA 1D1AA 3PU8A 4I4TE 1ZHCA 3ETUA 1QUUA 2BVMA 2VKHA 5FY7A 3IEEA 3Q5XA 2D0TA 3JC6C 4HE8A 4PJLA 2ZM8A 4O4HE 4CQIA 3C64A 5FYMA 3FB2A 3AAEB 2CCQA 3M65A 4EXTA 4F6RC 2X0LB 3RYHE 3EVYA 2W61A 5LGNB 4KMCA 3RYCE 2CLYC 3N9QA 4PJJA 1MMDA 4PK5A 3C51A 2X67A 3N9LA 3K3NA 4O2BE 2XAGB 4IE6A 4H9QC 3O1HA 2Q9QA 4ZI3D 4CI3B 4UV9B 3FHNA 4IDZA 2N9DA 2E9XB 4ZS3A 4BJMA 3N9MA 3RPUA 3CX6B 3SWHA 5ETWA 4ISSA 4E7SA 2YU2A 2P9BA 4X1YE 3GWHA 4EYYR 4HGAA 5H6RB 5JDLA 3KVBA 2KWHA 2NW7A 2LE8A 3BK9A 5LCYA 3ZJ1A 2N1GA 3NZPA 5EK3A 4EZHA 4KUMB 4HKAA 2VK9A 1MMAA 2BVLA 4ISTA 2JPFA 3J9X1 3VKHA 3ZMUB 5JDMA 4XZCA 3ESLA 4KBMB 5BMVE 3P8CD 3HKBE 4EAHA 1IAPA 4ERRA 3CQGB 4HN9A 4A56A 2IC9A 5L3GB 2I59A 2JRKA 1MMNA 2PJQA 4GOUA 2NW8A 4L9IA 3H37A 5LA6E 2LSKA 5LBMA 3UUMA 4BA9A 2NTXA 2CM0A 1OXZA 2Y48B 4UIGA 2UXNB 4GYSA 4X1KE 2K48A 3IHRA 3C4ZA 2LSYA 2H7OA 3ZYMA 4OFZA 4ZI3C 2SPCA 3FXEB 2V1DB 2NWBA 4HFVA 3BQIA 4MALA 4QKNA 3B57A 4UV8B 2HH7A 3UUXB 3K3QC 1BR4A 1SA0E 3E08A 4OK0A 3E0ZA 5L3EB 4CI1B 4E7ZA 1QSDA 2ODUA 2IAKA 4ZHQE 4C91A 4UVCB 5LJNA 3WAJA 3OYXA 1OWAA 3ANWB 5HWXA 2YINA 4OYJA 5EZYE 5JDQA 2ZMAA 1X79A 3C4XA 3ZC0A 3I0QA 1LRZA 4PJMA 2LHRA 5JDGA 5FNVE 1Y64B 4QHOA 4UVAB 5CB4E 5HXRA 4U74A 3UTKA 1NWMX 2ES0A 5FXZA 3N2KE 5FP3A 5IYZE 3W15B 2YEVC 1UX4A 5HWYA 3DTOA 2XHEB 2D2SA 2QGSA 3O1IA 3QK6A 2V7IA 4JUYA 4ZI2D 2CWYA 4WNKA 2PG8A 2V7JA 5HXHA 3Q9DA 3ZMZB 4OHFA 3AA7B 3GN5A 4HTEA 2CA5A 4PK4A 5FY1A 3VU7H 1IZNB 2K5BB 1O3XA 4DBRA 3HL6A 2Y6XA 3LK42 2L8KA 3O1JA 3A5XA 1CUNA 2EHOB 3K8PC 4J2CA 5HXCA 5JDNA 3C50A 5JRCB 1BR0A 4O8SA 4ZOLE 1EZ3A 5LHGB 2K24A 5GONE 2NW9A 3KVAA 1G73A 3ZMVB 1YKEB 3F2EA 3DP7A 3ZJ2A 4AXPA 3LK2B 4NUUA 3PTRB 1IJ6A 5CA0E 3EDUA 3UFEA 1YKHB 3R84B 3HI2A 2XQYA 3MKDA 3I9YA 4PW8A 5ADXL 4I43B 5DJQC 5L3BB 1IJ5A 2C0SA 3RC3A 1HG5A 2ACXA 2MYSA 5HXEA 4WW0A 5JQGE 3F31A 3H3AA 3PDYA 2H7VC 5AFUL 1S35A 3CWZB 2B1EA 4DMVA 3RH3A 3PURA 2X9WA 2PBIA 4H9PC 5DQWA 4AQFC 5HAXA 2D5UA 3ZMSB 3L3PA 1UX5A 4G63A 2X9XA 1D1BA 4KP3C 2V26A 4YJ2E 2L9QA 2GK9A 1FEWA 2X66A 4QXCB 4K0UA 4GYRA 4L0RA 2X68A 4P0AA 4EZ4A 2WMNA 5L2LA 2DWGA 3UULA 2HPJA 5FXVA 1ZV4X 5LHIB 3P7IA 1H7CA 2KZ7B 4FJOA 4MBQA 3WI3A 2UXXB 4CXWA 3KBTA 4G2AA 3RC8A 4L5GA 2DCFA 2KLQA 1WRDA 1ZKEA 2CXDA 4QXHB 3ZN0B 3ZEFB 3ZYLA 4O4JE 1HTJF 3UT5E 5EK2A 5JR9A 1MMGA 2E9XD 2V7KA 3C98B 1B7TA 5JREA 4UXNB 4CXXA 1KNZA 3MJXA 4MHCA 3AA1B 5DABA 3DJBA 2NP9A 2JQQA 4ZI2C 4DBQA 4O4IE 4X20E 5J2UE 5FXWA 2V7LA 3R6NA 3CQXC 3AA0B 3U3IA 5HXSA 1MIVA 5F3JA 4B6XA 5KX5E 1HX8A 4YFSA 3RX6A 4DNDA 1FIOA 2JJ9A 3MZKB 4QXBB 1SHZC 2MOZA 2RP4A 1D0YA 2MTQA 2Q9QC 3CX7B 3HR0A 1BR1A 3AVRA 4PK6A 1D0XA 1HF8A 5EK4A 2VKJA 2XAHB 2VKOA 4ANJA 2PFVA 2LSIA 3V5UA 4CXYA 3LK3B 4YHJA 2KT9A 2LOPA 3HKCE 4IE5A 2E8IA 2WMOA 5LYJE 1AJ3A 5JDHA 5JR9C 1MIWA 3MACA 1WYCA 3SOLA 1YD8G 4AQFA 2K9AA 3ZYKA 4I55E 4IHJE 3CPZA 4BJNA 4P0BA 5JH7E 3EUHA 3SRZA 1KK7A 3PUAA 4GK0E 4EYUA 4H63H 3UUNA 3AVSA 1MIYA 5FXXA 3ZCIA 1LVFA 4TZ4C 2M67A 4U72A 2DI4A 5JDFA 3CX8B 2W62A 3KFWX 3NRYA 1T98A 4JLEA 5L3DB 3N2OA 1WR6A 5LGTB 3NBXX 3KDSE 4QX7B 2KNDA 3LBXB 4H9RC 3Q5WA 4C90A 2ZLYA 3N9OA 4IGUA 2EHOD 3ETVA 3QUJA 1HG2A 4QX8B 4H63V 3RKOA 2NTYA 3AA6B 3ZLIA 4TUYE 5LP6E 5KMGP 3ZMTB 4UVBB 2CWOA 3MA9A 4YLHA 3AB3B 2E9XA 1NAFA 2HPLA 3AAAB 3KBUA 3N9PA 3PUGA 4MFRA 3B13A 5LOVE 5TAOA 3S4UA 5E0OA 4AI6A 3O4XE 2KWIB 4YJ3E 4EB6E 2DLRA 2Q9QB 3KINB 3OBVE 2LOSA 2KMFA 4UEMA 4WBOA 5C8YE 4UF0A 2ODVA 2X9HA 5IHYA 5DQVA 3KV4A 4CZZB 1LKXA 3PUSA 2G0UA 3WAKA 2W63A 2XAQB 3CKDA 2YU1A 2C5JA 2CXLA 2DNXA 4PFPA 2A3DA 3ZPOA 5JVDE 2J1DG 3U78A 4XAXB 4M1PA 5JR9B 4OYKA 1U5PA 1E1HB 4PFOA 4UELA 4PJNA 2WSSV 2VL8A 2ZM2A 4AKGA 3CVRA 3FBZA 4I50E 3GN5B 2VWAA 3PUQA 1VOMA 3AAIA 1LVKA 3ONXA 4TV9E 2LSGA 4NUVA 3LFMA 2A2FX 2BZBA 2DWKA 2A72A 5L3CB 5L3FB 4AKHA 2XASB 4O4LE 4N78D 3OYZA 2E9XC 3JC6D 3RRCA 3V5SA 5CA1E 2YK0A 3N9NA 1WYBA 1ZEEA 5LG4A 3SS1A 2XUEA 3L09A 2LSJA 4DVDA 5KDMC 1S94A 4EOZB 3IBPA 4O2AE 2RA1A 2ZM0A 2KXPB 1Z0PA 5H6QB 3PU3A 1D0ZA 1HCIA 5LJMA 2L3LA 4AKRB 3I9WA 2OA5A 3OJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4Y A;  1EZ3 A;  1FIO A;  3LG7 A;  1HS7 A;  1G73 A;  4TX5 A;  4JEH B;  5LG4 A;  2XHE B;  3C98 B;  4JEU B;  2DNX A;  1BR0 A;  1FEW A;  1S94 A; 
#chains in the Genus database with same CATH topology
 5CFB A;  3C4W A;  2BDE A;  5J0Z A;  1UUR A;  3UU5 A;  4Z90 A;  4AQG A;  2UXD T;  3T1H T;  3TKL B;  3FBL A;  4IE4 A;  4IDN A;  4PAG A;  2WU2 A;  3N5L A;  4X1I E;  4TX5 A;  4JI7 T;  5AQN B;  2XAJ B;  4PNI A;  3MXZ A;  3IF8 B;  2WBL A;  1MNE A;  3CQC B;  3F57 A;  4V1A v;  2JMK A;  2CLY B;  3I1A A;  2DHR A;  5J2T E;  1HS7 A;  2EHO A;  3AE2 A;  4DR3 T;  5FMN A;  4AQY T;  2BG9 A;  4H9S E;  3T8O A;  4IIJ E;  2QA7 A;  1UCU A;  2X51 A;  3CML A;  4NIQ A;  4IL9 A;  3BQL A;  1OED B;  4CN6 A;  1U4Q A;  3LBX A;  2LJL A;  4JEH B;  3VKG A;  3OTO T;  2W0G A;  4JI5 T;  2CXF A;  3TLS A;  2LM9 A;  4QWN B;  3N2G E;  2LEH A;  2XTL A;  3Q2M A;  5FY0 A;  3ZKR A;  2H88 A;  3J7Y q;  1BR2 A;  1R8I A;  2C5K T;  2WAU A;  2Q9Q D;  3HKE E;  4IE7 A;  4KX6 A;  3TLU A;  4DR6 T;  4TWD A;  2C5I T;  2A9U A;  3GMI A;  3QC9 A;  2WWV A;  4IE0 A;  1Z8U A;  4ADZ A;  4AKL A;  4LF5 T;  1HX1 B;  1WCR A;  2XQ3 A;  3AE4 A;  4H9O C;  4TWH A;  4AKR B;  4EIW A;  4ZEY A;  5M4Y A;  2V8S V;  3OKQ A;  5LBQ B;  4ILB A;  4DV7 T;  2JMH A;  5FVL A;  4A97 A;  5HEJ A;  4H9N C;  3EDV A;  4ILU A;  2IW5 B;  2Z6E A;  3ZT5 A;  4GIW A;  2YOE A;  2LHN A;  3GA8 A;  4EV6 A;  4ZI7 E;  4JI6 T;  2XQ7 A;  2EHO C;  2VAS A;  5LNK A;  2LT3 A;  2J4G A;  3VHL A;  2VKD A;  5IWA T;  1XDP A;  4DID B;  4ASK A;  1IBK T;  3SFE A;  2Y8D A;  3ZCJ A;  1FMW A;  4UF0 B;  3KV9 A;  5HYA A;  3I0O A;  5F8P A;  3AXJ A;  5CJ5 A;  4TN7 B;  1X9B A;  3ONJ A;  3FXD B;  4GK5 E;  3ANW A;  2YDR A;  4ILC A;  1HNW T;  4DO0 A;  4XBF B;  1XDO A;  3D0T A;  3E22 E;  3LG7 A;  2V6X A;  1WLX A;  2WWU A;  4ZS2 A;  2IC6 A;  2KIN B;  1VRB A;  4HWD A;  2NOX A;  2W00 A;  1J5E T;  4DR7 T;  4CI2 B;  3RIF A;  3ZC1 A;  4TWF A;  4JI1 T;  2QVA A;  2D0U A;  2MBG A;  5LXT E;  4JI0 T;  4NXM T;  5AQG B;  5FL1 A;  4GKJ T;  1US7 B;  3BQK A;  1MND A;  4AKI A;  1QLB A;  2XAF B;  2H3R A;  2WCA A;  4MLK A;  3FZM B;  3LJC A;  3KV6 A;  3Q5D A;  2VB6 A;  1FMV A;  1V9D A;  2WP9 A;  4TV8 E;  4F8H A;  1G8X A;  2CE7 A;  1KFY A;  2V7M A;  2WM9 A;  3UU6 A;  3ZN1 B;  4WBN E;  5LGU B;  5A1L A;  4HEA A;  4BAY B;  5AQT B;  1XWM A;  3MK7 C;  1FJG T;  5J1G A;  3PE0 A;  2NR4 A;  3RYF E;  3HKD E;  2CPT A;  2CMR A;  3KV5 A;  4FI5 A;  2X9Y A;  3HA4 A;  3NRX A;  4JEU B;  5LHH B;  3RYI E;  1OED C;  1D1C A;  2CEA A;  4P09 A;  4DMW A;  1YW0 A;  1HFA A;  2N2N A;  5ABG A;  2XQA A;  3RI5 A;  3RRW A;  3O9X A;  3K3O A;  5JRC A;  4Z8X A;  3NZQ A;  1D1A A;  3PU8 A;  4I4T E;  5CGM A;  1HNZ T;  1ZHC A;  4B3M T;  3ETU A;  4HWI B;  1QUU A;  5AQV B;  2BVM A;  4LF4 T;  2VKH A;  5FY7 A;  3AEE A;  3IEE A;  3Q5X A;  2D0T A;  3JC6 C;  4A5X A;  4HE8 A;  2J47 A;  2LKG A;  4PJL A;  2ZM8 A;  4O4H E;  2XM2 A;  1W0B A;  1HNX T;  2BG9 E;  1W9R A;  4CQI A;  3C64 A;  5FYM A;  3AAE B;  3FB2 A;  5AQJ B;  2CCQ A;  3M65 A;  4EXT A;  4F6R C;  2X0L B;  3RYH E;  3EVY A;  2W61 A;  5FKY A;  4KMC A;  4ZXL A;  5LGN B;  4Z91 A;  1W09 A;  4JV5 T;  1KNP A;  3RYC E;  2CLY C;  2WDV A;  3N9Q A;  4PJJ A;  1MMD A;  2YDQ A;  2M6I A;  4IT4 A;  3JCF A;  4PK5 A;  3C51 A;  3AEC A;  2X67 A;  3RHW A;  3N9L A;  1I94 T;  2IIU A;  3K3N A;  4QH1 A;  2JQH A;  2XAG B;  4O2B E;  4IE6 A;  4H9Q C;  3O1H A;  2BKO A;  2Q9Q A;  4ZI3 D;  2CRB A;  4IDQ A;  2VL0 A;  4CI3 B;  4X65 T;  3T1Y T;  4UV9 B;  3FHN A;  4IDZ A;  2N9D A;  4HFC A;  2CHO A;  2E9X B;  2XZE A;  3P4S A;  4ZS3 A;  3ZSS A;  2WDR A;  2UXB T;  4BJM A;  3N9M A;  3FZF B;  3CX6 B;  3RPU A;  3SWH A;  1T8B A;  2B76 A;  4ISS A;  2YU2 A;  5ETW A;  3JAD A;  4E7S A;  4LFB T;  2CBI A;  2P9B A;  3GWH A;  4X1Y E;  4EYY R;  3L39 A;  4HGA A;  3AE8 A;  5H6R B;  5JDL A;  3KVB A;  2KWH A;  2NW7 A;  2LE8 A;  3BK9 A;  5LCY A;  3ZJ1 A;  2R6G F;  2N1G A;  1XMO T;  3NZP A;  5EK3 A;  4EZH A;  4KUM B;  4HKA A;  2VK9 A;  1MMA A;  2BVL A;  4IST A;  2D9D A;  2JPF A;  3J9X 1;  3VKH A;  3ZMU B;  5JDM A;  4XZC A;  3ESL A;  4KBM B;  2K3W A;  5BMV E;  3P8C D;  4X5T A;  1KEY A;  3HKB E;  4EAH A;  1IAP A;  3PUZ F;  4ERR A;  3CQG B;  4HN9 A;  4A56 A;  2IC9 A;  3RF1 A;  5L3G B;  2VVS A;  3PJA A;  2I59 A;  3QB5 A;  5HCM A;  2JRK A;  2H89 A;  3ABV A;  1MMN A;  2PJQ A;  2X0H A;  4GOU A;  2NW8 A;  4L9I A;  3H37 A;  1WR0 A;  5LA6 E;  2LSK A;  3L8R A;  5LBM A;  3UUM A;  4BA9 A;  2NTX A;  4KHZ F;  3NVO A;  5H6Q B;  2CM0 A;  1OXZ A;  2Y48 B;  4UIG A;  5AQS B;  2BG9 B;  2UXN B;  2W4X A;  2BG9 C;  1W0A A;  2XM1 A;  4GYS A;  4X1K E;  4JI8 T;  2BKP A;  2K48 A;  2V6Y B;  3CK6 A;  3C4Z A;  2BBH A;  2LSY A;  2H7O A;  3IHR A;  3P4P A;  3ZYM A;  4OFZ A;  5AQF B;  2M6B A;  4ZI3 C;  2UUA T;  2SPC A;  3FXE B;  2V1D B;  4LF6 T;  2LLY A;  5L4H A;  2NWB A;  4HFV A;  2HHH T;  3BQI A;  1Y01 A;  4MAL A;  4X64 T;  4QKN A;  3PUV F;  4KHP T;  3B57 A;  4UV8 B;  3FZK B;  2HH7 A;  3UUX B;  4EEB A;  4X62 T;  3K3Q C;  1BR4 A;  1SA0 E;  3E08 A;  3ZT6 A;  4OK0 A;  4A98 A;  4HFD A;  4IL4 A;  3E0Z A;  1T7S A;  4CI1 B;  5L3E B;  4E7Z A;  1QSD A;  2ODU A;  1I6Z A;  2IAK A;  4ZHQ E;  2BKN A;  2XY8 B;  2WQY A;  4C91 A;  4LML A;  1JNR A;  4UVC B;  5LJN A;  3WAJ A;  1XNQ T;  2UUC T;  3OYX A;  3TLW A;  1OWA A;  3ANW B;  5IUX A;  4LF8 T;  2I0M A;  3TLV A;  5HWX A;  4P1N A;  2YIN A;  5HCJ A;  5AQU B;  4OYJ A;  5EZY E;  3CIR A;  5JDQ A;  4OX9 T;  2ZMA A;  3ZT7 A;  1X79 A;  4U7Y A;  3C4X A;  3ZC0 A;  3VRB A;  3I0Q A;  3QNU A;  1LRZ A;  3M3Z B;  4U33 A;  4PJM A;  2LHR A;  5JDG A;  5FNV E;  4U7I A;  1Y64 B;  4QHO A;  3RQW A;  4UVA B;  5CB4 E;  5HXR A;  3PUY F;  4U74 A;  1NWM X;  3UTK A;  2ES0 A;  3OVU A;  5FXZ A;  2YN6 A;  3QB5 K;  5AQO B;  3N2K E;  4DV3 T;  4DR1 T;  5FP3 A;  1N33 T;  2LKH A;  1VCS A;  2MAW A;  5IYZ E;  3W15 B;  2YEV C;  1UX4 A;  1IBL T;  5HWY A;  3DTO A;  2XHE B;  2D2S A;  2QGS A;  3O1I A;  3QK6 A;  3UU4 A;  2E5L T;  2V7I A;  2XJ7 A;  1SE7 A;  4JUY A;  4ZI2 D;  2CWY A;  4TNW A;  3AE1 A;  4WNK A;  3P4W A;  4YT0 A;  5L4E A;  4YY3 T;  1YQ3 A;  2PG8 A;  2V7J A;  5HXH A;  3Q9D A;  3ZMZ B;  4OHF A;  3AA7 B;  3GN5 A;  4HTE A;  3ONL C;  4YSX A;  2CA5 A;  1OED A;  3AEA A;  3JAF A;  1IZN B;  2AE9 A;  2K5B B;  1O3X A;  4PK4 A;  5FY1 A;  3VU7 H;  4DBR A;  3HL6 A;  2Y6X A;  3LK4 2;  3VR9 A;  3AE3 A;  2FJA A;  2LRL A;  2L8K A;  3AE5 A;  3O1J A;  3A5X A;  1CUN A;  2EHO B;  5F5W A;  5ABH A;  3K8P C;  4J2C A;  5HXC A;  5JDN A;  3C50 A;  5JRC B;  1ZOY A;  2E5V A;  3B5M A;  1BR0 A;  4O8S A;  4ZOL E;  1EZ3 A;  5LHG B;  5C2T A;  2BS4 A;  2K24 A;  5GON E;  2NW9 A;  3KVA A;  1G73 A;  4EGW A;  3ZMV B;  1YKE B;  1KF6 A;  1N34 T;  3F2E A;  2UUB T;  3VR8 A;  5AQH B;  3DP7 A;  2ACZ A;  3P4R A;  3ZJ2 A;  4AXP A;  2IDO B;  3LK2 B;  4NUU A;  4NXN T;  2FUP A;  3PTR B;  1IJ6 A;  5CA0 E;  3EDU A;  2X0Y A;  2IML A;  1IBM T;  3UFE A;  3EAM A;  1YXR A;  1YKH B;  3R84 B;  3HI2 A;  2XQY A;  2VVN A;  3I9Y A;  3MKD A;  4PW8 A;  1J5W A;  5ADX L;  4YSY A;  4DV6 T;  5KXJ A;  4I43 B;  5DJQ C;  3TLT A;  3X1D A;  5L3B B;  1IJ5 A;  2C0S A;  3RC3 A;  4B3R T;  2IHR 1;  4JI3 T;  2XQ6 A;  1HG5 A;  2ACX A;  2MYS A;  5HXE A;  4WW0 A;  3AEG A;  3PV0 F;  3F31 A;  3H3A A;  3PDY A;  5JQG E;  2H7V C;  4KI0 F;  5AFU L;  4YHH T;  2UXC T;  1S35 A;  3CWZ B;  2B1E A;  4DMV A;  3RH3 A;  3PUR A;  2LM2 A;  3A8Y C;  4LFA T;  2X9W A;  1XNR T;  2PBI A;  3UQ7 A;  4H9P C;  4LFC T;  5DQW A;  4JBW F;  1M62 A;  4AQF C;  5HAX A;  4LF7 T;  1NEN A;  2XQ8 A;  5ABF A;  4TNV A;  2D5U A;  4U31 A;  3L3P A;  3ZMS B;  1UX5 A;  1KNR A;  4G63 A;  2CBJ A;  2X9X A;  1D1B A;  3OPC A;  4KP3 C;  5AQQ B;  5HEG A;  4AIS A;  2W66 A;  2V26 A;  4YJ2 E;  5HEU A;  2L9Q A;  4AIU A;  2GK9 A;  1FEW A;  2X66 A;  4B3T T;  4QXC B;  2JIW A;  1XZY A;  4GYR A;  4K0U A;  4L0R A;  3UU3 A;  4DR2 T;  2X68 A;  2XSB A;  3FZH B;  4P0A A;  4EZ4 A;  2J62 A;  2WMN A;  2VUR A;  2DWG A;  3UUL A;  2HPJ A;  5FXV A;  1ZV4 X;  2BS3 A;  2W2U A;  3P7I A;  5LHI B;  1H7C A;  2MPK A;  4HFB A;  2KZ7 B;  2XPK A;  4FJO A;  4MBQ A;  3EAB A;  3WI3 A;  2XSA A;  2UXX B;  4CXW A;  3RGL A;  3KBT A;  1M7K A;  3K1S A;  4G2A A;  3RC8 A;  3UU8 A;  4L5G A;  2DCF A;  3FZL B;  2KLQ A;  2WB5 A;  1WRD A;  1ZKE A;  2CXD A;  4QXH B;  4U2Y A;  3ZN0 B;  3ZEF B;  3ZYL A;  4O4J E;  4X66 T;  1HTJ F;  5AQR B;  3RIA A;  5JTG A;  3UT5 E;  5EK2 A;  2HN2 A;  5JR9 A;  1MMG A;  2E9X D;  2V7K A;  1J1J A;  3LDQ B;  4LF9 T;  3Q5E A;  3AE7 A;  3C98 B;  1B7T A;  2JQK A;  4UXN B;  4CXX A;  5JRE A;  1KNZ A;  3MJX A;  4MHC A;  3AA1 B;  5DAB A;  1T72 A;  3DJB A;  4YXD A;  2NP9 A;  2JQQ A;  4ZI2 C;  4IRE A;  4YTM A;  4O4I E;  4DBQ A;  5LMN T;  4X20 E;  5J2U E;  5FXW A;  3AE9 A;  3EHZ A;  2V7L A;  4DR5 T;  3R6N A;  4QH5 A;  3CQX C;  3AA0 B;  3U3I A;  5HXS A;  1MIV A;  4K0K T;  5F3J A;  4B6X A;  2HN1 A;  3RQU A;  1DU2 A;  5KX5 E;  5L47 A;  1HX8 A;  4YFS A;  3RLF F;  5HEH A;  2OLT A;  3JAE A;  2QYW A;  3RX6 A;  4DND A;  1FIO A;  2JJ9 A;  3MZK B;  4QXB B;  1SHZ C;  2MOZ A;  2WU5 A;  2RP4 A;  3NKZ A;  5AQL B;  1D0Y A;  4YTN A;  5LG3 A;  2MTQ A;  2Q9Q C;  3CX7 B;  3HR0 A;  1BR1 A;  2KSR A;  3UQ4 A;  3AE6 A;  2WZH A;  3AVR A;  4PK6 A;  1D0X A;  1VCT A;  4IDO A;  1HF8 A;  5EK4 A;  3AXJ B;  2VKJ A;  2XAH B;  2VKO A;  4I0U A;  4Q25 A;  4ANJ A;  4GKK T;  3LSV A;  2PFV A;  2LSI A;  3H3M A;  3V5U A;  4DV2 T;  3PJA J;  1UUS A;  3A7M A;  2QRX A;  4CXY A;  3LK3 B;  4YHJ A;  3RIU A;  1NEK A;  2KT9 A;  4DV0 T;  2LOP A;  3HKC E;  4IE5 A;  4IDP A;  5FL0 A;  2E8I A;  2WMO A;  5LYJ E;  1AJ3 A;  5JDH A;  3P4Q A;  5JR9 C;  1MIW A;  1UK5 A;  4ZZB A;  3AEB A;  3ZST A;  3MAC A;  2XQ9 A;  1WYC A;  5FVK A;  3SOL A;  1YQ4 A;  1YD8 G;  3PUW F;  4AQF A;  2K9A A;  3ZYK A;  4ILA A;  4I55 E;  4IHJ E;  2JQ9 A;  3CPZ A;  3RKG A;  3IA3 A;  4CN1 A;  4BJN A;  4P0B A;  5JH7 E;  3UUB A;  3EUH A;  3SRZ A;  4YTP A;  4DV1 T;  1KK7 A;  3P50 A;  3QOF A;  2FJE A;  3PUA A;  2XQ4 A;  4GK0 E;  4EYU A;  4H63 H;  3UUN A;  1JNZ A;  5HEO A;  5AQP B;  3AVS A;  1MIY A;  5AQM B;  5FXX A;  5LMU T;  2FJD A;  3ZCI A;  1LVF A;  3AEF A;  3NWI A;  4TZ4 C;  2M67 A;  4U72 A;  4CN4 A;  4HWC A;  2DI4 A;  3PUX F;  5JDF A;  3CX8 B;  1N32 T;  3AED A;  1WFD A;  2W62 A;  3KFW X;  1T98 A;  3NRY A;  4JLE A;  3N2O A;  3VRA A;  4HWF A;  2I6H A;  5L3D B;  5ABF B;  1WR6 A;  5LGT B;  3NBX X;  3KDS E;  4QX7 B;  2KND A;  5AQK B;  3LBX B;  4H9R C;  3Q5W A;  1L0V A;  4C90 A;  2ZLY A;  3N9O A;  2V5C A;  4JI2 T;  4IGU A;  2EHO D;  3ETV A;  3QUJ A;  1HG2 A;  1GQE A;  2ZM6 T;  4QX8 B;  4H63 V;  3RKO A;  4DV4 T;  4ZZC A;  2NTY A;  2YKS A;  3AA6 B;  2RPA A;  3ZLI A;  4TUY E;  5LP6 E;  5KMG P;  4EED A;  3ZMT B;  4UVB B;  2CWO A;  2YDS A;  2WS3 A;  3MA9 A;  4YLH A;  2BS2 A;  3AB3 B;  4HFI A;  5LB7 B;  2E9X A;  1NAF A;  2HPL A;  2LRK A;  3AAA B;  3KBU A;  3N9P A;  3PUG A;  3B13 A;  4MFR A;  5AQI B;  5LOV E;  5E0O A;  5TAO A;  3S4U A;  4AI6 A;  3O4X E;  5ABE A;  2KWI B;  4YJ3 E;  2PTF A;  4EB6 E;  2DLR A;  2Q9Q B;  3KIN B;  3OBV E;  2LOS A;  2KMF A;  1ZP0 A;  2FBW A;  4U3C A;  4UEM A;  4WBO A;  5C8Y E;  4UF0 A;  4B3S T;  2ODV A;  2E2A A;  2X9H A;  5IHY A;  5DQV A;  3KV4 A;  4CZZ B;  1LKX A;  3PUS A;  2G0U A;  2F4V T;  3WAK A;  2W63 A;  2XAQ B;  2WY2 A;  3CKD A;  2YU1 A;  2C5J A;  2CXL A;  2DNX A;  1N36 T;  4PFP A;  2A3D A;  1CHU A;  3ZPO A;  5JVD E;  4LMK A;  2CHN A;  2J1D G;  4JYA T;  4LMJ A;  3U78 A;  4DUZ T;  1E7P A;  2W67 A;  4XAX B;  4M1P A;  5JR9 B;  2V5D A;  2VQF T;  5BR8 T;  3EI0 A;  4DR4 T;  4OYK A;  1E2A A;  1U5P A;  3UFG A;  1E1H B;  2UU9 T;  2FJB A;  4PFO A;  4U2Z A;  4UEL A;  4WYV A;  4PJN A;  3RIU C;  2WSS V;  2VL8 A;  2ZM2 A;  4AKG A;  3CVR A;  4UR9 A;  3FBZ A;  4I50 E;  3GN5 B;  1SUM B;  2VWA A;  3PUQ A;  1VOM A;  3AAI A;  1LVK A;  3ONX A;  4TV9 E;  1OED E;  2LSG A;  4NUV A;  4JI4 T;  3LFM A;  4HWH A;  2A2F X;  2BZB A;  2DWK A;  2A72 A;  5L3C B;  5L3F B;  2VQE T;  4AKH A;  2XAS B;  2AXD S;  1HR0 T;  2WDQ A;  4O4L E;  4YSZ A;  4N78 D;  2XQ5 A;  3OYZ A;  2E9X C;  2IUB A;  3JC6 D;  4QH4 A;  3RRC A;  3SFD A;  2YK0 A;  3V5S A;  2V6Y A;  5CA1 E;  3N9N A;  5C3J A;  4DUY T;  1WYB A;  1ZEE A;  2DL1 A;  5LG4 A;  4DV5 T;  3SS1 A;  2XUE A;  3L09 A;  1XMQ T;  2LSJ A;  4COF A;  5L2L A;  4DVD A;  5KDM C;  1S94 A;  4EOZ B;  1UGO A;  3IBP A;  4NPP A;  4O2A E;  2RA1 A;  2ZM0 A;  2KXP B;  1Z0P A;  2WZI A;  3PU3 A;  1D0Z A;  2OV9 A;  1HCI A;  4HFH A;  2BBJ A;  2L3L A;  4WZX A;  5LJM A;  3G06 A;  4HFE A;  3I9W A;  2OA5 A;  3OJA A; 
#chains in the Genus database with same CATH homology
 3C4W A;  2BDE A;  4AQG A;  3TKL B;  3FBL A;  4IE4 A;  4PAG A;  3N5L A;  4X1I E;  4TX5 A;  2XAJ B;  4PNI A;  3MXZ A;  3IF8 B;  2WBL A;  1MNE A;  3CQC B;  3F57 A;  4V1A v;  2JMK A;  2CLY B;  3I1A A;  2DHR A;  5J2T E;  1HS7 A;  2EHO A;  5FMN A;  4H9S E;  3T8O A;  4IIJ E;  2QA7 A;  1UCU A;  2X51 A;  3CML A;  3BQL A;  1U4Q A;  3LBX A;  2LJL A;  4JEH B;  3VKG A;  2W0G A;  2CXF A;  2LM9 A;  4QWN B;  3N2G E;  2LEH A;  2XTL A;  3Q2M A;  5FY0 A;  3J7Y q;  1BR2 A;  2C5K T;  2WAU A;  3HKE E;  2Q9Q D;  4IE7 A;  2C5I T;  3GMI A;  3QC9 A;  4IE0 A;  4ADZ A;  4AKL A;  4H9O C;  5M4Y A;  4EIW A;  3OKQ A;  5LBQ B;  2JMH A;  4H9N C;  3EDV A;  4ILU A;  2IW5 B;  2Z6E A;  4GIW A;  4ZI7 E;  2LHN A;  3GA8 A;  2EHO C;  2VAS A;  5LNK A;  2LT3 A;  3VHL A;  2VKD A;  4ASK A;  2Y8D A;  3ZCJ A;  1FMW A;  4UF0 B;  3KV9 A;  5HYA A;  3I0O A;  5F8P A;  4TN7 B;  4GK5 E;  3FXD B;  3ANW A;  4DO0 A;  4XBF B;  3E22 E;  3D0T A;  3LG7 A;  2WWU A;  1WLX A;  4ZS2 A;  2IC6 A;  2KIN B;  1VRB A;  2NOX A;  2W00 A;  4CI2 B;  3ZC1 A;  2MBG A;  2D0U A;  5LXT E;  4AKI A;  1US7 B;  3BQK A;  1MND A;  2XAF B;  2H3R A;  4MLK A;  3LJC A;  3KV6 A;  2VB6 A;  1FMV A;  1V9D A;  4TV8 E;  1G8X A;  2CE7 A;  2V7M A;  5LGU B;  2WM9 A;  4WBN E;  3ZN1 B;  5A1L A;  4HEA A;  4BAY B;  3MK7 C;  5J1G A;  3PE0 A;  3RYF E;  3HKD E;  2CMR A;  3KV5 A;  4FI5 A;  2X9Y A;  3HA4 A;  3NRX A;  4JEU B;  5LHH B;  3RYI E;  1D1C A;  4P09 A;  2CEA A;  4DMW A;  1YW0 A;  1HFA A;  2N2N A;  5JRC A;  3RRW A;  3O9X A;  3K3O A;  4Z8X A;  3NZQ A;  1D1A A;  3PU8 A;  4I4T E;  1ZHC A;  3ETU A;  1QUU A;  2BVM A;  2VKH A;  5FY7 A;  3IEE A;  3Q5X A;  2D0T A;  3JC6 C;  4HE8 A;  4PJL A;  2ZM8 A;  4O4H E;  4CQI A;  3C64 A;  5FYM A;  3FB2 A;  3AAE B;  2CCQ A;  3M65 A;  4EXT A;  4F6R C;  2X0L B;  3RYH E;  3EVY A;  2W61 A;  5LGN B;  4KMC A;  3RYC E;  2CLY C;  3N9Q A;  4PJJ A;  1MMD A;  4PK5 A;  3C51 A;  2X67 A;  3N9L A;  3K3N A;  4O2B E;  2XAG B;  4IE6 A;  4H9Q C;  3O1H A;  2Q9Q A;  4ZI3 D;  4CI3 B;  4UV9 B;  3FHN A;  4IDZ A;  2N9D A;  2E9X B;  4ZS3 A;  4BJM A;  3N9M A;  3RPU A;  3CX6 B;  3SWH A;  5ETW A;  4ISS A;  4E7S A;  2YU2 A;  2P9B A;  4X1Y E;  3GWH A;  4EYY R;  4HGA A;  5H6R B;  5JDL A;  3KVB A;  2KWH A;  2NW7 A;  2LE8 A;  3BK9 A;  5LCY A;  3ZJ1 A;  2N1G A;  3NZP A;  5EK3 A;  4EZH A;  4KUM B;  4HKA A;  2VK9 A;  1MMA A;  2BVL A;  4IST A;  2JPF A;  3J9X 1;  3VKH A;  3ZMU B;  5JDM A;  4XZC A;  3ESL A;  4KBM B;  5BMV E;  3P8C D;  3HKB E;  4EAH A;  1IAP A;  4ERR A;  3CQG B;  4HN9 A;  4A56 A;  2IC9 A;  5L3G B;  2I59 A;  2JRK A;  1MMN A;  2PJQ A;  4GOU A;  2NW8 A;  4L9I A;  3H37 A;  5LA6 E;  2LSK A;  5LBM A;  3UUM A;  4BA9 A;  2NTX A;  2CM0 A;  1OXZ A;  2Y48 B;  4UIG A;  2UXN B;  4GYS A;  4X1K E;  2K48 A;  3IHR A;  3C4Z A;  2LSY A;  2H7O A;  3ZYM A;  4OFZ A;  4ZI3 C;  2SPC A;  3FXE B;  2V1D B;  2NWB A;  4HFV A;  3BQI A;  4MAL A;  4QKN A;  3B57 A;  4UV8 B;  2HH7 A;  3UUX B;  3K3Q C;  1BR4 A;  1SA0 E;  3E08 A;  4OK0 A;  3E0Z A;  5L3E B;  4CI1 B;  4E7Z A;  1QSD A;  2ODU A;  2IAK A;  4ZHQ E;  4C91 A;  4UVC B;  5LJN A;  3WAJ A;  3OYX A;  1OWA A;  3ANW B;  5HWX A;  2YIN A;  4OYJ A;  5EZY E;  5JDQ A;  2ZMA A;  1X79 A;  3C4X A;  3ZC0 A;  3I0Q A;  1LRZ A;  4PJM A;  2LHR A;  5JDG A;  5FNV E;  1Y64 B;  4QHO A;  4UVA B;  5CB4 E;  5HXR A;  4U74 A;  3UTK A;  1NWM X;  2ES0 A;  5FXZ A;  3N2K E;  5FP3 A;  5IYZ E;  3W15 B;  2YEV C;  1UX4 A;  5HWY A;  3DTO A;  2XHE B;  2D2S A;  2QGS A;  3O1I A;  3QK6 A;  2V7I A;  4JUY A;  4ZI2 D;  2CWY A;  4WNK A;  2PG8 A;  2V7J A;  5HXH A;  3Q9D A;  3ZMZ B;  4OHF A;  3AA7 B;  3GN5 A;  4HTE A;  2CA5 A;  4PK4 A;  5FY1 A;  3VU7 H;  1IZN B;  2K5B B;  1O3X A;  4DBR A;  3HL6 A;  2Y6X A;  3LK4 2;  2L8K A;  3O1J A;  3A5X A;  1CUN A;  2EHO B;  3K8P C;  4J2C A;  5HXC A;  5JDN A;  3C50 A;  5JRC B;  1BR0 A;  4O8S A;  4ZOL E;  1EZ3 A;  5LHG B;  2K24 A;  5GON E;  2NW9 A;  3KVA A;  1G73 A;  3ZMV B;  1YKE B;  3F2E A;  3DP7 A;  3ZJ2 A;  4AXP A;  3LK2 B;  4NUU A;  3PTR B;  1IJ6 A;  5CA0 E;  3EDU A;  3UFE A;  1YKH B;  3R84 B;  3HI2 A;  2XQY A;  3MKD A;  3I9Y A;  4PW8 A;  5ADX L;  4I43 B;  5DJQ C;  5L3B B;  1IJ5 A;  2C0S A;  3RC3 A;  1HG5 A;  2ACX A;  2MYS A;  5HXE A;  4WW0 A;  5JQG E;  3F31 A;  3H3A A;  3PDY A;  2H7V C;  5AFU L;  1S35 A;  3CWZ B;  2B1E A;  4DMV A;  3RH3 A;  3PUR A;  2X9W A;  2PBI A;  4H9P C;  5DQW A;  4AQF C;  5HAX A;  2D5U A;  3ZMS B;  3L3P A;  1UX5 A;  4G63 A;  2X9X A;  1D1B A;  4KP3 C;  2V26 A;  4YJ2 E;  2L9Q A;  2GK9 A;  1FEW A;  2X66 A;  4QXC B;  4K0U A;  4GYR A;  4L0R A;  2X68 A;  4P0A A;  4EZ4 A;  2WMN A;  5L2L A;  2DWG A;  3UUL A;  2HPJ A;  5FXV A;  1ZV4 X;  5LHI B;  3P7I A;  1H7C A;  2KZ7 B;  4FJO A;  4MBQ A;  3WI3 A;  2UXX B;  4CXW A;  3KBT A;  4G2A A;  3RC8 A;  4L5G A;  2DCF A;  2KLQ A;  1WRD A;  1ZKE A;  2CXD A;  4QXH B;  3ZN0 B;  3ZEF B;  3ZYL A;  4O4J E;  1HTJ F;  3UT5 E;  5EK2 A;  5JR9 A;  1MMG A;  2E9X D;  2V7K A;  3C98 B;  1B7T A;  5JRE A;  4UXN B;  4CXX A;  1KNZ A;  3MJX A;  4MHC A;  3AA1 B;  5DAB A;  3DJB A;  2NP9 A;  2JQQ A;  4ZI2 C;  4DBQ A;  4O4I E;  4X20 E;  5J2U E;  5FXW A;  2V7L A;  3R6N A;  3CQX C;  3AA0 B;  3U3I A;  5HXS A;  1MIV A;  5F3J A;  4B6X A;  5KX5 E;  1HX8 A;  4YFS A;  3RX6 A;  4DND A;  1FIO A;  2JJ9 A;  3MZK B;  4QXB B;  1SHZ C;  2MOZ A;  2RP4 A;  1D0Y A;  2MTQ A;  2Q9Q C;  3CX7 B;  3HR0 A;  1BR1 A;  3AVR A;  4PK6 A;  1D0X A;  1HF8 A;  5EK4 A;  2VKJ A;  2XAH B;  2VKO A;  4ANJ A;  2PFV A;  2LSI A;  3V5U A;  4CXY A;  3LK3 B;  4YHJ A;  2KT9 A;  2LOP A;  3HKC E;  4IE5 A;  2E8I A;  2WMO A;  5LYJ E;  1AJ3 A;  5JDH A;  5JR9 C;  1MIW A;  3MAC A;  1WYC A;  3SOL A;  1YD8 G;  4AQF A;  2K9A A;  3ZYK A;  4I55 E;  4IHJ E;  3CPZ A;  4BJN A;  4P0B A;  5JH7 E;  3EUH A;  3SRZ A;  1KK7 A;  3PUA A;  4GK0 E;  4EYU A;  4H63 H;  3UUN A;  3AVS A;  1MIY A;  5FXX A;  3ZCI A;  1LVF A;  4TZ4 C;  2M67 A;  4U72 A;  2DI4 A;  5JDF A;  3CX8 B;  2W62 A;  3KFW X;  3NRY A;  1T98 A;  4JLE A;  5L3D B;  3N2O A;  1WR6 A;  5LGT B;  3NBX X;  3KDS E;  4QX7 B;  2KND A;  3LBX B;  4H9R C;  3Q5W A;  4C90 A;  2ZLY A;  3N9O A;  4IGU A;  2EHO D;  3ETV A;  3QUJ A;  1HG2 A;  4QX8 B;  4H63 V;  3RKO A;  2NTY A;  3AA6 B;  3ZLI A;  4TUY E;  5LP6 E;  5KMG P;  3ZMT B;  4UVB B;  2CWO A;  3MA9 A;  4YLH A;  3AB3 B;  2E9X A;  1NAF A;  2HPL A;  3AAA B;  3KBU A;  3N9P A;  3PUG A;  4MFR A;  3B13 A;  5LOV E;  5TAO A;  3S4U A;  5E0O A;  4AI6 A;  3O4X E;  2KWI B;  4YJ3 E;  4EB6 E;  2DLR A;  2Q9Q B;  3KIN B;  3OBV E;  2LOS A;  2KMF A;  4UEM A;  4WBO A;  5C8Y E;  4UF0 A;  2ODV A;  2X9H A;  5IHY A;  5DQV A;  3KV4 A;  4CZZ B;  1LKX A;  3PUS A;  2G0U A;  3WAK A;  2W63 A;  2XAQ B;  3CKD A;  2YU1 A;  2C5J A;  2CXL A;  2DNX A;  4PFP A;  2A3D A;  3ZPO A;  5JVD E;  2J1D G;  3U78 A;  4XAX B;  4M1P A;  5JR9 B;  4OYK A;  1U5P A;  1E1H B;  4PFO A;  4UEL A;  4PJN A;  2WSS V;  2VL8 A;  2ZM2 A;  4AKG A;  3CVR A;  3FBZ A;  4I50 E;  3GN5 B;  2VWA A;  3PUQ A;  1VOM A;  3AAI A;  1LVK A;  3ONX A;  4TV9 E;  2LSG A;  4NUV A;  3LFM A;  2A2F X;  2BZB A;  2DWK A;  2A72 A;  5L3C B;  5L3F B;  4AKH A;  2XAS B;  4O4L E;  4N78 D;  3OYZ A;  2E9X C;  3JC6 D;  3RRC A;  3V5S A;  5CA1 E;  2YK0 A;  3N9N A;  1WYB A;  1ZEE A;  5LG4 A;  3SS1 A;  2XUE A;  3L09 A;  2LSJ A;  4DVD A;  5KDM C;  1S94 A;  4EOZ B;  3IBP A;  4O2A E;  2RA1 A;  2ZM0 A;  2KXP B;  1Z0P A;  5H6Q B;  3PU3 A;  1D0Z A;  1HCI A;  5LJM A;  2L3L A;  4AKR B;  3I9W A;  2OA5 A;  3OJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...