1HS7A

Vam3p n-terminal domain solution structure
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
97
structure length
97
Chain Sequence
TNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTAXIN VAM3
publication title Vam3p structure reveals conserved and divergent properties of syntaxins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
total genus 43
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2000-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hs7A00
4JEHB 1FEWA 1FIOA 1BR0A 2XHEB 5LG4A 4JEUB 1HS7A 3LG7A 1G73A 4TX5A 1S94A 2DNXA 3C98B 5M4YA 1EZ3A
chains in the Genus database with same CATH superfamily
2ODVA 2X0LB 4AIUA 2ZM0A 1KF6A 4LMJA 5KDMC 4QH5A 5AQNB 3Q2MA 3RLFF 2LSYA 1MMAA 4UF0B 4B3MT 4JI8T 1CHUA 5ABHA 3OVUA 2Y8DA 4B3TT 1LVKA 3AE4A 3LSVA 3TLVA 1YW0A 4CXXA 2UU9T 3UQ7A 4QKNA 2X9WA 2VWAA 2CE7A 3AE1A 1L0VA 1IBLT 4GKKT 3ETUA 4WYVA 2XTLA 2ACZA 2B76A 4X65T 2BVMA 3FZLB 2DWKA 3IF8B 4CN4A 4TUYE 2NR4A 2XQ6A 2XQ4A 3SFDA 4QXBB 3PUAA 2WDQA 3UQ4A 1HX1B 5JQGE 2LT3A 4ZI2D 2CRBA 3MXZA 4DR3T 2P9BA 4UELA 3RIAA 4ASKA 3TLWA 2Q9QC 4O4LE 4LFBT 3SRZA 3N5LA 5JRCA 2EHOC 4DR2T 2YU1A 3ETVA 5HAXA 2XQ5A 4GYSA 4HFDA 4GIWA 3P50A 5ABFB 3UU6A 4LF8T 3HI2A 4LMLA 2UXNB 2VVSA 3HKCE 3I9YA 4HWFA 4XAXB 2CWOA 2W66A 2XAHB 3IHRA 4ZEYA 4IDOA 3KFWX 2FJBA 2KZ7B 2BS3A 4DUZT 4TNVA 4IGUA 3RX6A 4AKIA 4I0UA 3O9XA 4X1YE 3MZKB 5ABGA 4HFIA 3I1AA 3O1HA 4U2YA 4IT4A 5LBQB 4WZXA 5J2TE 4ZS3A 4YJ2E 4H9QC 4DV5T 3RRWA 2NOXA 4I4TE 5FMNA 1T72A 2DWGA 4TWDA 4PNIA 2W4XA 2V6YB 3K3OA 3TLSA 4DV7T 2VKDA 3LK42 2BG9E 4YHHT 2X66A 2RA1A 3IBPA 3P4PA 5JDLA 2HN2A 4CI1B 3N2OA 3K1SA 3ZJ2A 2L3LA 4JI2T 4CI3B 2QYWA 3QK6A 4X1IE 2MPKA 3T8OA 1GQEA 4LF7T 5JDFA 4OX9T 2H7VC 3L8RA 3NZPA 2XSAA 3ZN1B 4ISSA 1Z0PA 2PG8A 4YT0A 2PJQA 5JDHA 4U7IA 3CQGB 1SUMB 4LF4T 2A2FX 4QXCB 3N9LA 5L3EB 3ZC0A 4G2AA 2WAUA 2JIWA 4LF9T 3CMLA 1G8XA 1NEKA 4KP3C 4IHJE 5JRCB 4YY3T 2KWIB 2JMHA 2LLYA 3Q5XA 4U33A 2E9XA 3V5UA 3ZN0B 2SPCA 4CXWA 3N2GE 4I43B 3ANWA 2K24A 1B7TA 2ZMAA 3RIUC 3E22E 3ESLA 4DMVA 1YD8G 2FUPA 2X9XA 3SOLA 3N9MA 5JR9A 5LJNA 4YTMA 4P09A 4P1NA 3VRAA 2LKGA 3QB5A 4ZZBA 2DLRA 4EGWA 4DVDA 4BJNA 1BR1A 4OYJA 3A7MA 1U5PA 4EEDA 3EI0A 1I6ZA 2GK9A 2CHOA 2M6IA 1WFDA 5JDQA 3ZCIA 2XY8B 2XQYA 3K3QC 2CBJA 1LVFA 3RGLA 2WZIA 2CLYB 3UUBA 4X1KE 3FZKB 2XHEB 5A1LA 5LGNB 5FP3A 4UF0A 4CQIA 1W0AA 5L3GB 4LMKA 3LK3B 2BG9C 4HWDA 3F57A 4TWFA 1YQ3A 2E8IA 1VCSA 2NW7A 4YJ3E 4DR5T 2I0MA 4L0RA 4KUMB 1KNZA 1W9RA 2WS3A 2V7MA 3RHWA 3ZYKA 2UXDT 2DHRA 2V6XA 5CA0E 2VURA 4AKHA 2E9XD 2LRKA 3UUXB 4DV0T 3F2EA 4IDNA 4H9SE 4CZZB 4NPPA 3PJAA 3R6NA 4X64T 3JC6D 3RRCA 3U3IA 4KX6A 2L8KA 1N34T 4IE0A 2QVAA 5AQHB 1MIWA 5AQMB 2JPFA 2K5BB 1WR0A 4PK4A 4H9RC 3HKDE 1OEDC 5AQGB 4X5TA 1XZYA 3ZPOA 1D0XA 4ERRA 5IWAT 1LRZA 5IHYA 2W61A 4HFHA 1IBKT 3OKQA 3PUXF 2W00A 2FJAA 5HYAA 1ZEEA 3M3ZB 2KNDA 3H3AA 5AFUL 5AQLB 1ZP0A 3DTOA 4Z91A 2XSBA 3QOFA 2JMKA 3ANWB 5AQIB 3L09A 3AE3A 1IJ5A 5LJMA 2M6BA 2NP9A 2RP4A 4QH1A 3EUHA 5JR9B 3AE2A 1XDPA 3ONJA 4H63V 4ILUA 5F3JA 3FBZA 3IA3A 3SWHA 2VL8A 3AEGA 3KDSE 2LOPA 4N78D 2LM9A 1G73A 4FI5A 5HCJA 1ZKEA 3FB2A 3AEFA 2JJ9A 4TWHA 4ILCA 3PUQA 4JI0T 4JI3T 3ZMZB 5DABA 2IAKA 3NRYA 2IW5B 5LMNT 5CGMA 3K8PC 3ZYLA 1XMOT 5L3BB 5C3JA 1US7B 3OPCA 3NVOA 3N9OA 3AEBA 4AKGA 3R84B 4ANJA 5L3CB 2XAQB 4COFA 5LHIB 5L4EA 4P0BA 4F6RC 3KBUA 2V6YA 2LKHA 3PUVF 3HKBE 3I0OA 1T7SA 4J2CA 3L3PA 1FJGT 4JYAT 3T1HT 2WSSV 1NAFA 3PU8A 2CBIA 3ZCJA 3U78A 5L47A 4A5XA 2UUAT 2LE8A 4JLEA 5LBMA 1R8IA 4DR4T 1WCRA 2NW9A 5BMVE 2XPKA 1IBMT 4DV3T 2YINA 3RIFA 3UU4A 1J5WA 4JBWF 3E0ZA 2BBJA 4HFBA 2DL1A 4U3CA 5J0ZA 4DIDB 5L3FB 3SFEA 3LJCA 3ZKRA 5JDNA 3QUJA 1Y01A 4U74A 1M62A 2WCAA 2OV9A 4EAHA 5LA6E 1J5ET 3FXEB 3AEDA 4L5GA 4I50E 2DNXA 4HWHA 1JNZA 1X9BA 1NENA 3OYXA 3AEAA 1WYCA 4V1Av 2XAGB 1HNXT 4DO0A 4JV5T 4A97A 5HWXA 1KNPA 2Z6EA 5JDMA 4EZHA 5AQOB 1T8BA 4BAYB 5AQQB 4DBRA 2BDEA 4MFRA 3RKOA 3VKGA 3AA6B 5HXSA 1HF8A 2ES0A 2VKOA 4O2BE 1W09A 5ETWA 5AQSB 4DV6T 2AXDS 3CQXC 2H7OA 2WDRA 3OYZA 5KMGP 3PJAJ 1Z8UA 2I59A 3HA4A 3NKZA 3UFEA 5LYJE 4H9OC 4HE8A 4XZCA 4DR1T 5CFBA 4IREA 2IHR1 2XQ3A 5HEOA 3P8CD 1MNEA 4O2AE 1D0YA 2H88A 1QUUA 5C2TA 1N33T 3JAEA 1JNRA 2BKNA 3RYCE 3LG7A 5EK4A 4ZXLA 4HKAA 4ILBA 1KFYA 1J1JA 1MNDA 4HFCA 2JRKA 4CXYA 3C4WA 2LSJA 3ZMSB 5LGUB 4QH4A 5AQJB 3OBVE 5AQRB 4IE7A 4DUYT 2WZHA 1VOMA 1XNRT 1ZHCA 4PFOA 2BKPA 4EB6E 1BR2A 2E2AA 2XQAA 3J7Yq 5ADXL 4HFEA 3AAIA 3ZEFB 3AAEB 4WBOA 3UU8A 2WU5A 2X0YA 2KSRA 2LOSA 4IE6A 3WAJA 5HWYA 5FXZA 1YKEB 3AEEA 2IDOB 1VRBA 2V1DB 1W0BA 1FMVA 5IUXA 5H6RB 2G0UA 2XASB 3O4XE 2XQ7A 2WWVA 2D9DA 3N2KE 2X9HA 2YN6A 3AA0B 4DV4T 4ZI2C 3G06A 5HEGA 4AKLA 3S4UA 3I0QA 1H7CA 2BZBA 2LM2A 2E5VA 3MACA 5J2UE 3RQWA 2HPJA 3ONXA 1D1CA 4EXTA 4X62T 3N9NA 2LSKA 2N1GA 4OK0A 1YXRA 1X79A 4TZ4C 3LBXA 1MIVA 1UUSA 4PJMA 4A56A 1IJ6A 2HHHT 1XMQT 3N9QA 4U2ZA 2V26A 4PJLA 4EIWA 3PE0A 1Y64B 5HXHA 5JREA 4ISTA 4MALA 4QHOA 2W2UA 4TNWA 4DNDA 1WRDA 2WMOA 4DBQA 2YEVC 2E5LT 1UX4A 3JAFA 1WR6A 1E2AA 3TLUA 3HR0A 3ZMVB 4WW0A 3P4QA 3FBLA 1OEDB 4EYYR 5LXTE 4YFSA 3DP7A 3UUNA 4HEAA 5HCMA 4GKJT 5DQWA 2MAWA 5AQPB 4K0KT 4ZI3D 4A98A 3TLTA 3AA7B 4K0UA 3A5XA 4UVAB 1N32T 4KHPT 1M7KA 2Q9QA 3P4WA 2NW8A 4KBMB 2EHOA 1D1BA 1BR4A 2CXDA 3KV6A 4PFPA 3WI3A 5FL0A 1FIOA 3UULA 5L3DB 4ZI7E 2JQQA 3AE5A 5AQTB 2VQET 2X68A 1HS7A 3RC8A 2YU2A 3PU3A 1MMNA 5LNKA 3CX8B 5DJQC 2I6HA 3OTOT 2V5DA 2YDSA 1V9DA 1N36T 3KV4A 1HG5A 1UURA 4PJNA 2MBGA 2V7LA 1QSDA 5LCYA 2A9UA 3UU3A 2V5CA 5ABEA 1KEYA 2WY2A 4HN9A 3PURA 4EV6A 3CK6A 3BQKA 2VK9A 3NRXA 2IC9A 4Z90A 3C4XA 3SS1A 4NXMT 4PK5A 2IIUA 1U4QA 2X0HA 2C5KT 3AECA 3AE8A 1SE7A 5JH7E 3MK7C 3W15B 3UUMA 4AKRB 2VQFT 3Q5EA 5IYZE 3UT5E 1IAPA 3LBXB 4NUUA 1UX5A 2UUCT 3LDQB 1UCUA 3RYFE 5AQVB 3CX6B 2BS4A 3AE7A 4AXPA 2OLTA 3ZT6A 4NIQA 5KX5E 3C4ZA 2Q9QD 2CM0A 2HPLA 5LB7B 4LFCT 2KXPB 2EHOD 4HWCA 4BA9A 3ZYMA 2XAJB 4P0AA 2CLYC 3CPZA 5HXCA 4TV8E 1UK5A 4QXHB 3WAKA 4AQFA 5KXJA 5HEJA 2ODUA 3BK9A 5H6QB 3VRBA 5LG4A 3Q5DA 3UU5A 3K3NA 2W0GA 4JUYA 2V8SV 2V7IA 4OYKA 1YKHB 1HG2A 4OHFA 3FZMB 2VKJA 4U31A 2MTQA 2Q9QB 2CMRA 5BR8T 4FJOA 2EHOB 4MHCA 2AE9A 3GWHA 3JADA 4UVBB 1FEWA 5F8PA 3ZJ1A 3PUGA 4PJJA 2IUBA 3H37A 3NBXX 4UIGA 3J9X1 4CN6A 3VHLA 1S35A 3D0TA 4HFVA 2HH7A 5FL1A 1EZ3A 3O1IA 2X51A 3B57A 4HTEA 3RIUA 4KHZF 3C50A 5FXVA 3LFMA 2R6GF 4JI6T 1MMDA 2YKSA 4ZZCA 5EK3A 4GOUA 4DMWA 2XM2A 3DJBA 2J1DG 4YXDA 3VR8A 2JQKA 4UEMA 2E9XC 4ZHQE 4KI0F 4JI1T 4JEUB 2MYSA 2LHRA 5EZYE 1O3XA 3GN5A 3JC6C 3MA9A 3AE6A 3VKHA 1T98A 2KINB 4DR6T 4KMCA 2PFVA 3P4RA 4C90A 5AQUB 5J1GA 4X20E 3PUYF 4E7SA 5C8YE 5JR9C 2NTYA 3PUSA 1I94T 4JEHB 4E7ZA 3B5MA 2IMLA 3FZHB 3AB3B 1D0ZA 2H3RA 4AISA 4AQYT 4AQGA 2F4VT 4WBNE 2VVNA 3L39A 1E1HB 3EVYA 5DQVA 4YSZA 3T1YT 2BVLA 3BQIA 4JI4T 2WDVA 2VKHA 2BG9A 4B3ST 4BJMA 3Q5WA 3CX7B 4EZ4A 2C0SA 1E7PA 3ABVA 4PK6A 2A3DA 2DCFA 4MBQA 4WNKA 2MOZA 1DU2A 4EYUA 2CPTA 5CB4E 3EDUA 3E08A 3N9PA 3JCFA 2VASA 3ZC1A 3VR9A 4YHJA 1VCTA 5LOVE 2K9AA 2LSGA 5AQKB 1XNQT 3RF1A 3PTRB 4UR9A 4UV8B 2BBHA 3KVAA 3AAAB 2XUEA 2N2NA 4NUVA 2IC6A 2CEAA 1D1AA 1OEDA 2BS2A 3LK2B 4LF6T 3AXJB 1MIYA 5FXWA 2FJDA 2A72A 5HXEA 1ZV4X 1IZNB 3ZSTA 1UGOA 3ZMUB 3F31A 2NTXA 2NWBA 2UXBT 5CA1E 1OXZA 4U7YA 4LF5T 5FY7A 3RYHE 1BR0A 4Q25A 5EK2A 4YTNA 2W62A 1QLBA 2L9QA 5L2LA 4IL4A 5JVDE 4DR7T 3RKGA 2JQ9A 2B1EA 3KBTA 2CXFA 2HN1A 3B13A 5LP6E 3GN5B 2D0UA 2V7KA 3RH3A 2VB6A 3EABA 4XBFB 4O4IE 3MJXA 2VL0A 3RI5A 4TX5A 3KINB 2CCQA 2WB5A 4ZS2A 4I55E 5LGTB 4TV9E 2CWYA 4H9NC 4ADZA 4CN1A 1OWAA 4L9IA 4YSXA 2D2SA 3UFGA 3PV0F 4IDQA 2D0TA 2RPAA 2PBIA 2KLQA 2CXLA 5FNVE 2WQYA 3M65A 1KK7A 3GMIA 4AQFC 4EOZB 4H63H 1OEDE 1AJ3A 3EDVA 4NXNT 2H89A 3AVSA 2M67A 1XDOA 2KWHA 2WBLA 5E0OA 3PUWF 5FVLA 4IDZA 2X67A 2BG9B 3ZMTB 3CIRA 2XQ8A 1WLXA 2C5IT 2OA5A 3FHNA 1WYBA 3HKEE 3O1JA 4TN7B 3RYIE 5HEHA 4GK5E 3ZLIA 2W67A 2UXCT 4UV9B 2FJEA 3KV5A 2ACXA 2CA5A 3ZT7A 4IE4A 3RC3A 4ILAA 5FKYA 3QB5K 3UTKA 3ONLC 3H3MA 4IDPA 2KT9A 2J62A 4PW8A 4YTPA 2QRXA 5LHHB 4JI7T 2Y6XA 1SHZC 4DV1T 5TAOA 4LFAT 3VU7H 5F5WA 4OFZA 5FY0A 2N9DA 2K3WA 1HNWT 2XAFB 2LRLA 2KMFA 4B3RT 2FBWA 2QA7A 1YQ4A 3FXDB 4F8HA 4U72A 4DV2T 3FZFB 4PAGA 4QX8B 3KVBA 2XM1A 2ZM8A 4YSYA 3P4SA 5CJ5A 2ZM6T 3X1DA 1SA0E 3KV9A 5FXXA 4HWIB 4M1PA 4UVCB 3V5SA 2V7JA 2DI4A 3C51A 5HEUA 2D5UA 2LHNA 2LJLA 2WWUA 2WU2A 2QGSA 3BQLA 5HXRA 5LHGB 5FYMA 4O8SA 2X9YA 4ZOLE 3I9WA 5L4HA 3HL6A 4GYRA 1HCIA 3QNUA 2WMNA 3P7IA 2WP9A 1ZOYA 1LKXA 3PDYA 2J4GA 2XQ9A 3TKLB 4AI6A 2LEHA 3AVRA 1HNZT 3OJAA 4IIJE 3RQUA 2C5JA 2WM9A 4MLKA 3ZT5A 3AA1B 4QX7B 3CQCB 3RPUA 3AE9A 4CI2B 4X66T 5LG3A 3GA8A 4UXNB 2BKOA 1MMGA 5FY1A 5FVKA 2YOEA 4G63A 2E9XB 4QWNB 2ZLYA 3EAMA 5AQFB 3CKDA 2W63A 3QC9A 3C98B 2ZM2A 1XWMA 2Y48B 2UUBT 3NWIA 1HR0T 3EHZA 3NZQA 1CUNA 5ABFA 3PUZF 3Q9DA 3MKDA 4IL9A 4JI5T 3C64A 4Z8XA 2YDQA 3A8YC 3CWZB 5LMUT 1HTJF 2LSIA 4C91A 3CVRA 2YK0A 4ZI3C 4H9PC 5JTGA 2CHNA 3ZSSA 4EEBA 2JQHA 3AXJA 2K48A 1KNRA 1S94A 2J47A 2YDRA 3IEEA 2PTFA 4IE5A 4YLHA 1HFAA 2XJ7A 5GONE 2XZEA 1FMWA 1NWMX 1HX8A 2UXXB 4B6XA 5JDGA 4HGAA 4O4HE 4GK0E 4O4JE 5M4YA
chains in the Genus database with same CATH topology
2E9XD 4UV8B 3KVAA 3UUXB 3AAAB 3N9NA 2ODVA 2X0LB 2XUEA 2ZM0A 2LSKA 2N1GA 4OK0A 1X79A 2N2NA 4TZ4C 3F2EA 4NUVA 2IC6A 3LBXA 4H9SE 2CEAA 1D1AA 5KDMC 4CZZB 4AKHA 3LK2B 3R6NA 1MIVA 3JC6D 3Q2MA 2LSYA 3RRCA 1MIYA 1MMAA 4UF0B 3U3IA 4PJMA 5FXWA 4A56A 2A72A 1IJ6A 3N9QA 2L8KA 2V26A 4IE0A 4PJLA 1MIWA 4EIWA 2JPFA 3PE0A 5HXEA 1Y64B 2K5BB 1ZV4X 2Y8DA 5HXHA 1IZNB 4PK4A 5JREA 4H9RC 3HKDE 1LVKA 4ISTA 4MALA 4QHOA 3ZPOA 1D0XA 1YW0A 4ERRA 3ZMUB 3F31A 4CXXA 1LRZA 2NTXA 2NWBA 4DNDA 1WRDA 2WMOA 5IHYA 4DBQA 5CA1E 4QKNA 2W61A 1OXZA 2YEVC 5FY7A 2X9WA 1UX4A 3OKQA 2VWAA 2CE7A 3RYHE 1WR6A 1BR0A 2W00A 5EK2A 3HR0A 3ETUA 3ZMVB 5HYAA 4WW0A 1ZEEA 2W62A 3FBLA 2XTLA 2L9QA 5L2LA 2KNDA 5JVDE 3H3AA 5AFUL 2BVMA 3DTOA 4EYYR 5LXTE 2DWKA 3IF8B 4YFSA 4TUYE 3DP7A 2JMKA 3ANWB 3UUNA 4HEAA 3L09A 1IJ5A 5DQWA 2B1EA 3KBTA 2CXFA 4ZI3D 5LJMA 4QXBB 2NP9A 3PUAA 2RP4A 3AA7B 4K0UA 5JQGE 3A5XA 3B13A 3EUHA 4UVAB 5LP6E 5JR9B 3GN5B 2Q9QA 2D0UA 2V7KA 3RH3A 2LT3A 2VB6A 4ZI2D 4XBFB 2NW8A 4KBMB 2EHOA 4H63V 4ILUA 1D1BA 4O4IE 5F3JA 3FBZA 1BR4A 2CXDA 3MJXA 2VL8A 3SWHA 3MXZA 4TX5A 2P9BA 3KINB 3KV6A 3KDSE 4PFPA 2CCQA 2LOPA 4N78D 3WI3A 1FIOA 4ZS2A 3UULA 4UELA 4I55E 4ASKA 4TV9E 2LM9A 5L3DB 1G73A 2CWYA 5LGTB 4H9NC 4ADZA 4ZI7E 1OWAA 4FI5A 1ZKEA 2Q9QC 4L9IA 4O4LE 2D2SA 3FB2A 2JQQA 3SRZA 3N5LA 2JJ9A 5JRCA 2EHOC 2D0TA 2PBIA 2KLQA 2YU1A 2X68A 3ETVA 5HAXA 2CXLA 1HS7A 3RC8A 2YU2A 3PUQA 5FNVE 3PU3A 4GYSA 1MMNA 4GIWA 3M65A 5LNKA 3CX8B 1KK7A 3GMIA 5DABA 3ZMZB 4AQFC 4EOZB 5DJQC 4H63H 2IAKA 3NRYA 2IW5B 1AJ3A 1V9DA 3EDVA 3KV4A 3AVSA 3K8PC 2M67A 3ZYLA 5L3BB 1US7B 2KWHA 2WBLA 5E0OA 1HG5A 3HI2A 4PJNA 2MBGA 2UXNB 2V7LA 4IDZA 3HKCE 2X67A 1QSDA 3I9YA 3ZMTB 4XAXB 3N9OA 2CWOA 2XAHB 4AKGA 1WLXA 3R84B 5LCYA 2C5IT 4ANJA 5L3CB 2OA5A 2XAQB 3FHNA 3IHRA 5LHIB 1WYBA 3HKEE 3O1JA 4TN7B 3RYIE 4GK5E 3KFWX 3ZLIA 2KZ7B 4P0BA 4UV9B 4F6RC 4IGUA 3RX6A 4AKIA 3KBUA 3KV5A 2ACXA 2CA5A 3HKBE 3I0OA 4IE4A 4HN9A 3L3PA 4J2CA 3RC3A 3PURA 3UTKA 3O9XA 3BQKA 4X1YE 3MZKB 2WSSV 2VK9A 3NRXA 3I1AA 2IC9A 3O1HA 5LBQB 3C4XA 3SS1A 2KT9A 1NAFA 4PW8A 4PK5A 5J2TE 3PU8A 1U4QA 5LHHB 4ZS3A 4YJ2E 2C5KT 2Y6XA 4H9QC 3ZCJA 5JH7E 1SHZC 3MK7C 3U78A 3W15B 3UUMA 4AKRB 3RRWA 2NOXA 2LE8A 5TAOA 4JLEA 5LBMA 3VU7H 4I4TE 5IYZE 5FMNA 3UT5E 2DWGA 1IAPA 3LBXB 4NUUA 1UX5A 4OFZA 5FY0A 2N9DA 2NW9A 5BMVE 4PNIA 2YINA 1UCUA 3RYFE 3K3OA 3CX6B 2VKDA 3LK42 3E0ZA 4AXPA 2X66A 2RA1A 3IBPA 5L3FB 3LJCA 5JDLA 2XAFB 5KX5E 5JDNA 3QUJA 3C4ZA 2KMFA 4U74A 2Q9QD 2CM0A 2HPLA 4CI1B 2QA7A 3N2OA 2KXPB 3FXDB 4EAHA 2EHOD 4U72A 5LA6E 4BA9A 4PAGA 3ZJ2A 3FXEB 4L5GA 2L3LA 4QX8B 4I50E 3ZYMA 4CI3B 2XAJB 4P0AA 2CLYC 2DNXA 3CPZA 5HXCA 4TV8E 3QK6A 3OYXA 4X1IE 3KVBA 1WYCA 2ZM8A 4V1Av 4QXHB 2XAGB 3T8OA 3WAKA 5JDFA 4DO0A 4AQFA 5HWXA 2ODUA 2H7VC 2Z6EA 3BK9A 3NZPA 5H6QB 5JDMA 1SA0E 3KV9A 3ZN1B 4ISSA 1Z0PA 5LG4A 2PG8A 5FXXA 4M1PA 4EZHA 4UVCB 4BAYB 4DBRA 2BDEA 3K3NA 3V5SA 2V7JA 2PJQA 2W0GA 4JUYA 4MFRA 2DI4A 3C51A 3RKOA 2D5UA 2LHNA 3VKGA 3AA6B 5HXSA 5JDHA 2V7IA 4OYKA 1YKHB 2LJLA 1HF8A 1HG2A 2ES0A 4OHFA 2VKOA 3CQGB 4O2BE 2WWUA 2VKJA 2MTQA 2QGSA 2Q9QB 2CMRA 3BQLA 5ETWA 4FJOA 2EHOB 3CQXC 4MHCA 5HXRA 2A2FX 3GWHA 2H7OA 3OYZA 1FEWA 4QXCB 3N9LA 4UVBB 5F8PA 5L3EB 3ZC0A 5KMGP 4G2AA 5LHGB 3ZJ1A 2WAUA 5FYMA 4O8SA 3PUGA 2X9YA 3I9WA 4ZOLE 4PJJA 2I59A 3H37A 3CMLA 3HA4A 3NBXX 4UIGA 3J9X1 1G8XA 3HL6A 3VHLA 1S35A 3D0TA 4KP3C 3UFEA 5LYJE 4IHJE 4GYRA 1HCIA 5JRCB 4HFVA 2KWIB 2HH7A 1EZ3A 2WMNA 2JMHA 3O1IA 4H9OC 3Q5XA 4HE8A 3P7IA 4XZCA 1LKXA 2X51A 3PDYA 3B57A 2E9XA 4HTEA 3V5UA 3TKLB 3C50A 2SPCA 5FXVA 2LEHA 3ZN0B 3LFMA 4AI6A 3AVRA 1MMDA 3OJAA 4CXWA 3P8CD 3N2GE 4IIJE 2C5JA 2WM9A 5EK3A 4GOUA 1MNEA 4MLKA 3AA1B 4DMWA 4O2AE 1D0YA 3DJBA 2J1DG 4I43B 1QUUA 3ANWA 2K24A 1B7TA 4QX7B 4UEMA 2E9XC 4ZHQE 2ZMAA 3CQCB 3E22E 3RPUA 3RYCE 3ESLA 3LG7A 5EK4A 4DMVA 4CI2B 4HKAA 1MNDA 1YD8G 2MYSA 2LHRA 4JEUB 2JRKA 2X9XA 5EZYE 4CXYA 3SOLA 3N9MA 1O3XA 3C4WA 3GN5A 5JR9A 2LSJA 3GA8A 3JC6C 3MA9A 3ZMSB 5LGUB 5LJNA 4P09A 3VKHA 1T98A 3OBVE 2KINB 4UXNB 4KMCA 1MMGA 4IE7A 5FY1A 2PFVA 2DLRA 4G63A 4C90A 2E9XB 4DVDA 4QWNB 2ZLYA 5J1GA 4BJNA 1BR1A 4OYJA 1VOMA 4X20E 1ZHCA 4PFOA 4EB6E 1BR2A 1U5PA 2W63A 3CKDA 3QC9A 4E7SA 3C98B 5C8YE 5JR9C 2NTYA 5ADXL 3J7Yq 3AAIA 3ZEFB 3PUSA 3AAEB 4WBOA 2ZM2A 4JEHB 4E7ZA 2GK9A 2LOSA 2Y48B 3AB3B 1D0ZA 2H3RA 4AQGA 4IE6A 3WAJA 4WBNE 3NZQA 5HWYA 5FXZA 1E1HB 1CUNA 1YKEB 3EVYA 3Q9DA 3MKDA 5DQVA 5JDQA 3ZCIA 5M4YA 3C64A 2XQYA 4Z8XA 2BVLA 3BQIA 1VRBA 2V1DB 3CWZB 1FMVA 3K3QC 2VKHA 1HTJF 2LSIA 4C91A 3CVRA 5H6RB 1LVFA 2YK0A 4BJMA 2CLYB 3Q5WA 4ZI3C 2G0UA 2XASB 3CX7B 3O4XE 4H9PC 4EZ4A 2C0SA 4X1KE 3N2KE 2X9HA 3AA0B 4PK6A 2A3DA 2XHEB 5A1LA 2K48A 4ZI2C 2DCFA 5LGNB 1S94A 3IEEA 4MBQA 4UF0A 5FP3A 4AKLA 3S4UA 3I0QA 4WNKA 1H7CA 2BZBA 2MOZA 4IE5A 4CQIA 4YLHA 1HFAA 4EYUA 5L3GB 3LK3B 5GONE 3F57A 2E8IA 5CB4E 2NW7A 3E08A 3EDUA 3N9PA 4YJ3E 2VASA 3ZC1A 4L0RA 1FMWA 1NWMX 1HX8A 4YHJA 4KUMB 1KNZA 5LOVE 2UXXB 2K9AA 3MACA 2LSGA 5J2UE 2V7MA 3ZYKA 2HPJA 4B6XA 5JDGA 4HGAA 4O4HE 4GK0E 3PTRB 3ONXA 1D1CA 2DHRA 4EXTA 4O4JE 5CA0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEH B;  1FEW A;  1FIO A;  1BR0 A;  2XHE B;  5LG4 A;  4JEU B;  1HS7 A;  3LG7 A;  1G73 A;  4TX5 A;  1S94 A;  2DNX A;  3C98 B;  5M4Y A;  1EZ3 A; 
#chains in the Genus database with same CATH topology
 2ODV A;  2X0L B;  4AIU A;  2ZM0 A;  1KF6 A;  4LMJ A;  5KDM C;  4QH5 A;  5AQN B;  3Q2M A;  3RLF F;  2LSY A;  1MMA A;  4UF0 B;  4B3M T;  4JI8 T;  1CHU A;  5ABH A;  3OVU A;  2Y8D A;  4B3T T;  1LVK A;  3AE4 A;  3LSV A;  3TLV A;  1YW0 A;  4CXX A;  2UU9 T;  3UQ7 A;  4QKN A;  2X9W A;  2VWA A;  2CE7 A;  3AE1 A;  1L0V A;  1IBL T;  4GKK T;  3ETU A;  4WYV A;  2XTL A;  2ACZ A;  2B76 A;  4X65 T;  2BVM A;  3FZL B;  2DWK A;  3IF8 B;  4CN4 A;  4TUY E;  2NR4 A;  2XQ6 A;  2XQ4 A;  3SFD A;  4QXB B;  3PUA A;  2WDQ A;  3UQ4 A;  1HX1 B;  5JQG E;  2LT3 A;  4ZI2 D;  2CRB A;  3MXZ A;  4DR3 T;  2P9B A;  4UEL A;  3RIA A;  4ASK A;  3TLW A;  2Q9Q C;  4O4L E;  4LFB T;  3SRZ A;  3N5L A;  5JRC A;  2EHO C;  4DR2 T;  2YU1 A;  3ETV A;  5HAX A;  2XQ5 A;  4GYS A;  4HFD A;  4GIW A;  3P50 A;  5ABF B;  3UU6 A;  4LF8 T;  3HI2 A;  4LML A;  2UXN B;  2VVS A;  3HKC E;  3I9Y A;  4HWF A;  4XAX B;  2CWO A;  2W66 A;  2XAH B;  3IHR A;  4ZEY A;  4IDO A;  3KFW X;  2FJB A;  2KZ7 B;  2BS3 A;  4DUZ T;  4TNV A;  4IGU A;  3RX6 A;  4AKI A;  4I0U A;  3O9X A;  4X1Y E;  3MZK B;  5ABG A;  4HFI A;  3I1A A;  3O1H A;  4U2Y A;  4IT4 A;  5LBQ B;  4WZX A;  5J2T E;  4ZS3 A;  4YJ2 E;  4H9Q C;  4DV5 T;  3RRW A;  2NOX A;  4I4T E;  5FMN A;  1T72 A;  2DWG A;  4TWD A;  4PNI A;  2W4X A;  2V6Y B;  3K3O A;  3TLS A;  4DV7 T;  2VKD A;  3LK4 2;  2BG9 E;  4YHH T;  2X66 A;  2RA1 A;  3IBP A;  3P4P A;  5JDL A;  2HN2 A;  4CI1 B;  3N2O A;  3K1S A;  3ZJ2 A;  2L3L A;  4JI2 T;  4CI3 B;  2QYW A;  3QK6 A;  4X1I E;  2MPK A;  3T8O A;  1GQE A;  4LF7 T;  5JDF A;  4OX9 T;  2H7V C;  3L8R A;  3NZP A;  2XSA A;  3ZN1 B;  4ISS A;  1Z0P A;  2PG8 A;  4YT0 A;  2PJQ A;  5JDH A;  4U7I A;  3CQG B;  1SUM B;  4LF4 T;  2A2F X;  4QXC B;  3N9L A;  5L3E B;  3ZC0 A;  4G2A A;  2WAU A;  2JIW A;  4LF9 T;  3CML A;  1G8X A;  1NEK A;  4KP3 C;  4IHJ E;  5JRC B;  4YY3 T;  2KWI B;  2JMH A;  2LLY A;  3Q5X A;  4U33 A;  2E9X A;  3V5U A;  3ZN0 B;  2SPC A;  4CXW A;  3N2G E;  4I43 B;  3ANW A;  2K24 A;  1B7T A;  2ZMA A;  3RIU C;  3E22 E;  3ESL A;  4DMV A;  1YD8 G;  2FUP A;  2X9X A;  3SOL A;  3N9M A;  5JR9 A;  5LJN A;  4YTM A;  4P09 A;  4P1N A;  3VRA A;  2LKG A;  3QB5 A;  4ZZB A;  2DLR A;  4EGW A;  4DVD A;  4BJN A;  1BR1 A;  4OYJ A;  3A7M A;  1U5P A;  4EED A;  3EI0 A;  1I6Z A;  2GK9 A;  2CHO A;  2M6I A;  1WFD A;  5JDQ A;  3ZCI A;  2XY8 B;  2XQY A;  3K3Q C;  2CBJ A;  1LVF A;  3RGL A;  2WZI A;  2CLY B;  3UUB A;  4X1K E;  3FZK B;  2XHE B;  5A1L A;  5LGN B;  5FP3 A;  4UF0 A;  4CQI A;  1W0A A;  5L3G B;  4LMK A;  3LK3 B;  2BG9 C;  4HWD A;  3F57 A;  4TWF A;  1YQ3 A;  2E8I A;  1VCS A;  2NW7 A;  4YJ3 E;  4DR5 T;  2I0M A;  4L0R A;  4KUM B;  1KNZ A;  1W9R A;  2WS3 A;  2V7M A;  3RHW A;  3ZYK A;  2UXD T;  2DHR A;  2V6X A;  5CA0 E;  2VUR A;  4AKH A;  2E9X D;  2LRK A;  3UUX B;  4DV0 T;  3F2E A;  4IDN A;  4H9S E;  4CZZ B;  4NPP A;  3PJA A;  3R6N A;  4X64 T;  3JC6 D;  3RRC A;  3U3I A;  4KX6 A;  2L8K A;  1N34 T;  4IE0 A;  2QVA A;  5AQH B;  1MIW A;  5AQM B;  2JPF A;  2K5B B;  1WR0 A;  4PK4 A;  4H9R C;  3HKD E;  1OED C;  5AQG B;  4X5T A;  1XZY A;  3ZPO A;  1D0X A;  4ERR A;  5IWA T;  1LRZ A;  5IHY A;  2W61 A;  4HFH A;  1IBK T;  3OKQ A;  3PUX F;  2W00 A;  2FJA A;  5HYA A;  1ZEE A;  3M3Z B;  2KND A;  3H3A A;  5AFU L;  5AQL B;  1ZP0 A;  3DTO A;  4Z91 A;  2XSB A;  3QOF A;  2JMK A;  3ANW B;  5AQI B;  3L09 A;  3AE3 A;  1IJ5 A;  5LJM A;  2M6B A;  2NP9 A;  2RP4 A;  4QH1 A;  3EUH A;  5JR9 B;  3AE2 A;  1XDP A;  3ONJ A;  4H63 V;  4ILU A;  5F3J A;  3FBZ A;  3IA3 A;  3SWH A;  2VL8 A;  3AEG A;  3KDS E;  2LOP A;  4N78 D;  2LM9 A;  1G73 A;  4FI5 A;  5HCJ A;  1ZKE A;  3FB2 A;  3AEF A;  2JJ9 A;  4TWH A;  4ILC A;  3PUQ A;  4JI0 T;  4JI3 T;  3ZMZ B;  5DAB A;  2IAK A;  3NRY A;  2IW5 B;  5LMN T;  5CGM A;  3K8P C;  3ZYL A;  1XMO T;  5L3B B;  5C3J A;  1US7 B;  3OPC A;  3NVO A;  3N9O A;  3AEB A;  4AKG A;  3R84 B;  4ANJ A;  5L3C B;  2XAQ B;  4COF A;  5LHI B;  5L4E A;  4P0B A;  4F6R C;  3KBU A;  2V6Y A;  2LKH A;  3PUV F;  3HKB E;  3I0O A;  1T7S A;  4J2C A;  3L3P A;  1FJG T;  4JYA T;  3T1H T;  2WSS V;  1NAF A;  3PU8 A;  2CBI A;  3ZCJ A;  3U78 A;  5L47 A;  4A5X A;  2UUA T;  2LE8 A;  4JLE A;  5LBM A;  1R8I A;  4DR4 T;  1WCR A;  2NW9 A;  5BMV E;  2XPK A;  1IBM T;  4DV3 T;  2YIN A;  3RIF A;  3UU4 A;  1J5W A;  4JBW F;  3E0Z A;  2BBJ A;  4HFB A;  2DL1 A;  4U3C A;  5J0Z A;  4DID B;  5L3F B;  3SFE A;  3LJC A;  3ZKR A;  5JDN A;  3QUJ A;  1Y01 A;  4U74 A;  1M62 A;  2WCA A;  2OV9 A;  4EAH A;  5LA6 E;  1J5E T;  3FXE B;  3AED A;  4L5G A;  4I50 E;  2DNX A;  4HWH A;  1JNZ A;  1X9B A;  1NEN A;  3OYX A;  3AEA A;  1WYC A;  4V1A v;  2XAG B;  1HNX T;  4DO0 A;  4JV5 T;  4A97 A;  5HWX A;  1KNP A;  2Z6E A;  5JDM A;  4EZH A;  5AQO B;  1T8B A;  4BAY B;  5AQQ B;  4DBR A;  2BDE A;  4MFR A;  3RKO A;  3VKG A;  3AA6 B;  5HXS A;  1HF8 A;  2ES0 A;  2VKO A;  4O2B E;  1W09 A;  5ETW A;  5AQS B;  4DV6 T;  2AXD S;  3CQX C;  2H7O A;  2WDR A;  3OYZ A;  5KMG P;  3PJA J;  1Z8U A;  2I59 A;  3HA4 A;  3NKZ A;  3UFE A;  5LYJ E;  4H9O C;  4HE8 A;  4XZC A;  4DR1 T;  5CFB A;  4IRE A;  2IHR 1;  2XQ3 A;  5HEO A;  3P8C D;  1MNE A;  4O2A E;  1D0Y A;  2H88 A;  1QUU A;  5C2T A;  1N33 T;  3JAE A;  1JNR A;  2BKN A;  3RYC E;  3LG7 A;  5EK4 A;  4ZXL A;  4HKA A;  4ILB A;  1KFY A;  1J1J A;  1MND A;  4HFC A;  2JRK A;  4CXY A;  3C4W A;  2LSJ A;  3ZMS B;  5LGU B;  4QH4 A;  5AQJ B;  3OBV E;  5AQR B;  4IE7 A;  4DUY T;  2WZH A;  1VOM A;  1XNR T;  1ZHC A;  4PFO A;  2BKP A;  4EB6 E;  1BR2 A;  2E2A A;  2XQA A;  3J7Y q;  5ADX L;  4HFE A;  3AAI A;  3ZEF B;  3AAE B;  4WBO A;  3UU8 A;  2WU5 A;  2X0Y A;  2KSR A;  2LOS A;  4IE6 A;  3WAJ A;  5HWY A;  5FXZ A;  1YKE B;  3AEE A;  2IDO B;  1VRB A;  2V1D B;  1W0B A;  1FMV A;  5IUX A;  5H6R B;  2G0U A;  2XAS B;  3O4X E;  2XQ7 A;  2WWV A;  2D9D A;  3N2K E;  2X9H A;  2YN6 A;  3AA0 B;  4DV4 T;  4ZI2 C;  3G06 A;  5HEG A;  4AKL A;  3S4U A;  3I0Q A;  1H7C A;  2BZB A;  2LM2 A;  2E5V A;  3MAC A;  5J2U E;  3RQW A;  2HPJ A;  3ONX A;  1D1C A;  4EXT A;  4X62 T;  3N9N A;  2LSK A;  2N1G A;  4OK0 A;  1YXR A;  1X79 A;  4TZ4 C;  3LBX A;  1MIV A;  1UUS A;  4PJM A;  4A56 A;  1IJ6 A;  2HHH T;  1XMQ T;  3N9Q A;  4U2Z A;  2V26 A;  4PJL A;  4EIW A;  3PE0 A;  1Y64 B;  5HXH A;  5JRE A;  4IST A;  4MAL A;  4QHO A;  2W2U A;  4TNW A;  4DND A;  1WRD A;  2WMO A;  4DBQ A;  2YEV C;  2E5L T;  1UX4 A;  3JAF A;  1WR6 A;  1E2A A;  3TLU A;  3HR0 A;  3ZMV B;  4WW0 A;  3P4Q A;  3FBL A;  1OED B;  4EYY R;  5LXT E;  4YFS A;  3DP7 A;  3UUN A;  4HEA A;  5HCM A;  4GKJ T;  5DQW A;  2MAW A;  5AQP B;  4K0K T;  4ZI3 D;  4A98 A;  3TLT A;  3AA7 B;  4K0U A;  3A5X A;  4UVA B;  1N32 T;  4KHP T;  1M7K A;  2Q9Q A;  3P4W A;  2NW8 A;  4KBM B;  2EHO A;  1D1B A;  1BR4 A;  2CXD A;  3KV6 A;  4PFP A;  3WI3 A;  5FL0 A;  1FIO A;  3UUL A;  5L3D B;  4ZI7 E;  2JQQ A;  3AE5 A;  5AQT B;  2VQE T;  2X68 A;  1HS7 A;  3RC8 A;  2YU2 A;  3PU3 A;  1MMN A;  5LNK A;  3CX8 B;  5DJQ C;  2I6H A;  3OTO T;  2V5D A;  2YDS A;  1V9D A;  1N36 T;  3KV4 A;  1HG5 A;  1UUR A;  4PJN A;  2MBG A;  2V7L A;  1QSD A;  5LCY A;  2A9U A;  3UU3 A;  2V5C A;  5ABE A;  1KEY A;  2WY2 A;  4HN9 A;  3PUR A;  4EV6 A;  3CK6 A;  3BQK A;  2VK9 A;  3NRX A;  2IC9 A;  4Z90 A;  3C4X A;  3SS1 A;  4NXM T;  4PK5 A;  2IIU A;  1U4Q A;  2X0H A;  2C5K T;  3AEC A;  3AE8 A;  1SE7 A;  5JH7 E;  3MK7 C;  3W15 B;  3UUM A;  4AKR B;  2VQF T;  3Q5E A;  5IYZ E;  3UT5 E;  1IAP A;  3LBX B;  4NUU A;  1UX5 A;  2UUC T;  3LDQ B;  1UCU A;  3RYF E;  5AQV B;  3CX6 B;  2BS4 A;  3AE7 A;  4AXP A;  2OLT A;  3ZT6 A;  4NIQ A;  5KX5 E;  3C4Z A;  2Q9Q D;  2CM0 A;  2HPL A;  5LB7 B;  4LFC T;  2KXP B;  2EHO D;  4HWC A;  4BA9 A;  3ZYM A;  2XAJ B;  4P0A A;  2CLY C;  3CPZ A;  5HXC A;  4TV8 E;  1UK5 A;  4QXH B;  3WAK A;  4AQF A;  5KXJ A;  5HEJ A;  2ODU A;  3BK9 A;  5H6Q B;  3VRB A;  5LG4 A;  3Q5D A;  3UU5 A;  3K3N A;  2W0G A;  4JUY A;  2V8S V;  2V7I A;  4OYK A;  1YKH B;  1HG2 A;  4OHF A;  3FZM B;  2VKJ A;  4U31 A;  2MTQ A;  2Q9Q B;  2CMR A;  5BR8 T;  4FJO A;  2EHO B;  4MHC A;  2AE9 A;  3GWH A;  3JAD A;  4UVB B;  1FEW A;  5F8P A;  3ZJ1 A;  3PUG A;  4PJJ A;  2IUB A;  3H37 A;  3NBX X;  4UIG A;  3J9X 1;  4CN6 A;  3VHL A;  1S35 A;  3D0T A;  4HFV A;  2HH7 A;  5FL1 A;  1EZ3 A;  3O1I A;  2X51 A;  3B57 A;  4HTE A;  3RIU A;  4KHZ F;  3C50 A;  5FXV A;  3LFM A;  2R6G F;  4JI6 T;  1MMD A;  2YKS A;  4ZZC A;  5EK3 A;  4GOU A;  4DMW A;  2XM2 A;  3DJB A;  2J1D G;  4YXD A;  3VR8 A;  2JQK A;  4UEM A;  2E9X C;  4ZHQ E;  4KI0 F;  4JI1 T;  4JEU B;  2MYS A;  2LHR A;  5EZY E;  1O3X A;  3GN5 A;  3JC6 C;  3MA9 A;  3AE6 A;  3VKH A;  1T98 A;  2KIN B;  4DR6 T;  4KMC A;  2PFV A;  3P4R A;  4C90 A;  5AQU B;  5J1G A;  4X20 E;  3PUY F;  4E7S A;  5C8Y E;  5JR9 C;  2NTY A;  3PUS A;  1I94 T;  4JEH B;  4E7Z A;  3B5M A;  2IML A;  3FZH B;  3AB3 B;  1D0Z A;  2H3R A;  4AIS A;  4AQY T;  4AQG A;  2F4V T;  4WBN E;  2VVN A;  3L39 A;  1E1H B;  3EVY A;  5DQV A;  4YSZ A;  3T1Y T;  2BVL A;  3BQI A;  4JI4 T;  2WDV A;  2VKH A;  2BG9 A;  4B3S T;  4BJM A;  3Q5W A;  3CX7 B;  4EZ4 A;  2C0S A;  1E7P A;  3ABV A;  4PK6 A;  2A3D A;  2DCF A;  4MBQ A;  4WNK A;  2MOZ A;  1DU2 A;  4EYU A;  2CPT A;  5CB4 E;  3EDU A;  3E08 A;  3N9P A;  3JCF A;  2VAS A;  3ZC1 A;  3VR9 A;  4YHJ A;  1VCT A;  5LOV E;  2K9A A;  2LSG A;  5AQK B;  1XNQ T;  3RF1 A;  3PTR B;  4UR9 A;  4UV8 B;  2BBH A;  3KVA A;  3AAA B;  2XUE A;  2N2N A;  4NUV A;  2IC6 A;  2CEA A;  1D1A A;  1OED A;  2BS2 A;  3LK2 B;  4LF6 T;  3AXJ B;  1MIY A;  5FXW A;  2FJD A;  2A72 A;  5HXE A;  1ZV4 X;  1IZN B;  3ZST A;  1UGO A;  3ZMU B;  3F31 A;  2NTX A;  2NWB A;  2UXB T;  5CA1 E;  1OXZ A;  4U7Y A;  4LF5 T;  5FY7 A;  3RYH E;  1BR0 A;  4Q25 A;  5EK2 A;  4YTN A;  2W62 A;  1QLB A;  2L9Q A;  5L2L A;  4IL4 A;  5JVD E;  4DR7 T;  3RKG A;  2JQ9 A;  2B1E A;  3KBT A;  2CXF A;  2HN1 A;  3B13 A;  5LP6 E;  3GN5 B;  2D0U A;  2V7K A;  3RH3 A;  2VB6 A;  3EAB A;  4XBF B;  4O4I E;  3MJX A;  2VL0 A;  3RI5 A;  4TX5 A;  3KIN B;  2CCQ A;  2WB5 A;  4ZS2 A;  4I55 E;  5LGT B;  4TV9 E;  2CWY A;  4H9N C;  4ADZ A;  4CN1 A;  1OWA A;  4L9I A;  4YSX A;  2D2S A;  3UFG A;  3PV0 F;  4IDQ A;  2D0T A;  2RPA A;  2PBI A;  2KLQ A;  2CXL A;  5FNV E;  2WQY A;  3M65 A;  1KK7 A;  3GMI A;  4AQF C;  4EOZ B;  4H63 H;  1OED E;  1AJ3 A;  3EDV A;  4NXN T;  2H89 A;  3AVS A;  2M67 A;  1XDO A;  2KWH A;  2WBL A;  5E0O A;  3PUW F;  5FVL A;  4IDZ A;  2X67 A;  2BG9 B;  3ZMT B;  3CIR A;  2XQ8 A;  1WLX A;  2C5I T;  2OA5 A;  3FHN A;  1WYB A;  3HKE E;  3O1J A;  4TN7 B;  3RYI E;  5HEH A;  4GK5 E;  3ZLI A;  2W67 A;  2UXC T;  4UV9 B;  2FJE A;  3KV5 A;  2ACX A;  2CA5 A;  3ZT7 A;  4IE4 A;  3RC3 A;  4ILA A;  5FKY A;  3QB5 K;  3UTK A;  3ONL C;  3H3M A;  4IDP A;  2KT9 A;  2J62 A;  4PW8 A;  4YTP A;  2QRX A;  5LHH B;  4JI7 T;  2Y6X A;  1SHZ C;  4DV1 T;  5TAO A;  4LFA T;  3VU7 H;  5F5W A;  4OFZ A;  5FY0 A;  2N9D A;  2K3W A;  1HNW T;  2XAF B;  2LRL A;  2KMF A;  4B3R T;  2FBW A;  2QA7 A;  1YQ4 A;  3FXD B;  4F8H A;  4U72 A;  4DV2 T;  3FZF B;  4PAG A;  4QX8 B;  3KVB A;  2XM1 A;  2ZM8 A;  4YSY A;  3P4S A;  5CJ5 A;  2ZM6 T;  3X1D A;  1SA0 E;  3KV9 A;  5FXX A;  4HWI B;  4M1P A;  4UVC B;  3V5S A;  2V7J A;  2DI4 A;  3C51 A;  5HEU A;  2D5U A;  2LHN A;  2LJL A;  2WWU A;  2WU2 A;  2QGS A;  3BQL A;  5HXR A;  5LHG B;  5FYM A;  4O8S A;  2X9Y A;  4ZOL E;  3I9W A;  5L4H A;  3HL6 A;  4GYR A;  1HCI A;  3QNU A;  2WMN A;  3P7I A;  2WP9 A;  1ZOY A;  1LKX A;  3PDY A;  2J4G A;  2XQ9 A;  3TKL B;  4AI6 A;  2LEH A;  3AVR A;  1HNZ T;  3OJA A;  4IIJ E;  3RQU A;  2C5J A;  2WM9 A;  4MLK A;  3ZT5 A;  3AA1 B;  4QX7 B;  3CQC B;  3RPU A;  3AE9 A;  4CI2 B;  4X66 T;  5LG3 A;  3GA8 A;  4UXN B;  2BKO A;  1MMG A;  5FY1 A;  5FVK A;  2YOE A;  4G63 A;  2E9X B;  4QWN B;  2ZLY A;  3EAM A;  5AQF B;  3CKD A;  2W63 A;  3QC9 A;  3C98 B;  2ZM2 A;  1XWM A;  2Y48 B;  2UUB T;  3NWI A;  1HR0 T;  3EHZ A;  3NZQ A;  1CUN A;  5ABF A;  3PUZ F;  3Q9D A;  3MKD A;  4IL9 A;  4JI5 T;  3C64 A;  4Z8X A;  2YDQ A;  3A8Y C;  3CWZ B;  5LMU T;  1HTJ F;  2LSI A;  4C91 A;  3CVR A;  2YK0 A;  4ZI3 C;  4H9P C;  5JTG A;  2CHN A;  3ZSS A;  4EEB A;  2JQH A;  3AXJ A;  2K48 A;  1KNR A;  1S94 A;  2J47 A;  2YDR A;  3IEE A;  2PTF A;  4IE5 A;  4YLH A;  1HFA A;  2XJ7 A;  5GON E;  2XZE A;  1FMW A;  1NWM X;  1HX8 A;  2UXX B;  4B6X A;  5JDG A;  4HGA A;  4O4H E;  4GK0 E;  4O4J E;  5M4Y A; 
#chains in the Genus database with same CATH homology
 2E9X D;  4UV8 B;  3KVA A;  3UUX B;  3AAA B;  3N9N A;  2ODV A;  2X0L B;  2XUE A;  2ZM0 A;  2LSK A;  2N1G A;  4OK0 A;  1X79 A;  2N2N A;  4TZ4 C;  3F2E A;  4NUV A;  2IC6 A;  3LBX A;  4H9S E;  2CEA A;  1D1A A;  5KDM C;  4CZZ B;  4AKH A;  3LK2 B;  3R6N A;  1MIV A;  3JC6 D;  3Q2M A;  2LSY A;  3RRC A;  1MIY A;  1MMA A;  4UF0 B;  3U3I A;  4PJM A;  5FXW A;  4A56 A;  2A72 A;  1IJ6 A;  3N9Q A;  2L8K A;  2V26 A;  4IE0 A;  4PJL A;  1MIW A;  4EIW A;  2JPF A;  3PE0 A;  5HXE A;  1Y64 B;  2K5B B;  1ZV4 X;  2Y8D A;  5HXH A;  1IZN B;  4PK4 A;  5JRE A;  4H9R C;  3HKD E;  1LVK A;  4IST A;  4MAL A;  4QHO A;  3ZPO A;  1D0X A;  1YW0 A;  4ERR A;  3ZMU B;  3F31 A;  4CXX A;  1LRZ A;  2NTX A;  2NWB A;  4DND A;  1WRD A;  2WMO A;  5IHY A;  4DBQ A;  5CA1 E;  4QKN A;  2W61 A;  1OXZ A;  2YEV C;  5FY7 A;  2X9W A;  1UX4 A;  3OKQ A;  2VWA A;  2CE7 A;  3RYH E;  1WR6 A;  1BR0 A;  2W00 A;  5EK2 A;  3HR0 A;  3ETU A;  3ZMV B;  5HYA A;  4WW0 A;  1ZEE A;  2W62 A;  3FBL A;  2XTL A;  2L9Q A;  5L2L A;  2KND A;  5JVD E;  3H3A A;  5AFU L;  2BVM A;  3DTO A;  4EYY R;  5LXT E;  2DWK A;  3IF8 B;  4YFS A;  4TUY E;  3DP7 A;  2JMK A;  3ANW B;  3UUN A;  4HEA A;  3L09 A;  1IJ5 A;  5DQW A;  2B1E A;  3KBT A;  2CXF A;  4ZI3 D;  5LJM A;  4QXB B;  2NP9 A;  3PUA A;  2RP4 A;  3AA7 B;  4K0U A;  5JQG E;  3A5X A;  3B13 A;  3EUH A;  4UVA B;  5LP6 E;  5JR9 B;  3GN5 B;  2Q9Q A;  2D0U A;  2V7K A;  3RH3 A;  2LT3 A;  2VB6 A;  4ZI2 D;  4XBF B;  2NW8 A;  4KBM B;  2EHO A;  4H63 V;  4ILU A;  1D1B A;  4O4I E;  5F3J A;  3FBZ A;  1BR4 A;  2CXD A;  3MJX A;  2VL8 A;  3SWH A;  3MXZ A;  4TX5 A;  2P9B A;  3KIN B;  3KV6 A;  3KDS E;  4PFP A;  2CCQ A;  2LOP A;  4N78 D;  3WI3 A;  1FIO A;  4ZS2 A;  3UUL A;  4UEL A;  4I55 E;  4ASK A;  4TV9 E;  2LM9 A;  5L3D B;  1G73 A;  2CWY A;  5LGT B;  4H9N C;  4ADZ A;  4ZI7 E;  1OWA A;  4FI5 A;  1ZKE A;  2Q9Q C;  4L9I A;  4O4L E;  2D2S A;  3FB2 A;  2JQQ A;  3SRZ A;  3N5L A;  2JJ9 A;  5JRC A;  2EHO C;  2D0T A;  2PBI A;  2KLQ A;  2YU1 A;  2X68 A;  3ETV A;  5HAX A;  2CXL A;  1HS7 A;  3RC8 A;  2YU2 A;  3PUQ A;  5FNV E;  3PU3 A;  4GYS A;  1MMN A;  4GIW A;  3M65 A;  5LNK A;  3CX8 B;  1KK7 A;  3GMI A;  5DAB A;  3ZMZ B;  4AQF C;  4EOZ B;  5DJQ C;  4H63 H;  2IAK A;  3NRY A;  2IW5 B;  1AJ3 A;  1V9D A;  3EDV A;  3KV4 A;  3AVS A;  3K8P C;  2M67 A;  3ZYL A;  5L3B B;  1US7 B;  2KWH A;  2WBL A;  5E0O A;  1HG5 A;  3HI2 A;  4PJN A;  2MBG A;  2UXN B;  2V7L A;  4IDZ A;  3HKC E;  2X67 A;  1QSD A;  3I9Y A;  3ZMT B;  4XAX B;  3N9O A;  2CWO A;  2XAH B;  4AKG A;  1WLX A;  3R84 B;  5LCY A;  2C5I T;  4ANJ A;  5L3C B;  2OA5 A;  2XAQ B;  3FHN A;  3IHR A;  5LHI B;  1WYB A;  3HKE E;  3O1J A;  4TN7 B;  3RYI E;  4GK5 E;  3KFW X;  3ZLI A;  2KZ7 B;  4P0B A;  4UV9 B;  4F6R C;  4IGU A;  3RX6 A;  4AKI A;  3KBU A;  3KV5 A;  2ACX A;  2CA5 A;  3HKB E;  3I0O A;  4IE4 A;  4HN9 A;  3L3P A;  4J2C A;  3RC3 A;  3PUR A;  3UTK A;  3O9X A;  3BQK A;  4X1Y E;  3MZK B;  2WSS V;  2VK9 A;  3NRX A;  3I1A A;  2IC9 A;  3O1H A;  5LBQ B;  3C4X A;  3SS1 A;  2KT9 A;  1NAF A;  4PW8 A;  4PK5 A;  5J2T E;  3PU8 A;  1U4Q A;  5LHH B;  4ZS3 A;  4YJ2 E;  2C5K T;  2Y6X A;  4H9Q C;  3ZCJ A;  5JH7 E;  1SHZ C;  3MK7 C;  3U78 A;  3W15 B;  3UUM A;  4AKR B;  3RRW A;  2NOX A;  2LE8 A;  5TAO A;  4JLE A;  5LBM A;  3VU7 H;  4I4T E;  5IYZ E;  5FMN A;  3UT5 E;  2DWG A;  1IAP A;  3LBX B;  4NUU A;  1UX5 A;  4OFZ A;  5FY0 A;  2N9D A;  2NW9 A;  5BMV E;  4PNI A;  2YIN A;  1UCU A;  3RYF E;  3K3O A;  3CX6 B;  2VKD A;  3LK4 2;  3E0Z A;  4AXP A;  2X66 A;  2RA1 A;  3IBP A;  5L3F B;  3LJC A;  5JDL A;  2XAF B;  5KX5 E;  5JDN A;  3QUJ A;  3C4Z A;  2KMF A;  4U74 A;  2Q9Q D;  2CM0 A;  2HPL A;  4CI1 B;  2QA7 A;  3N2O A;  2KXP B;  3FXD B;  4EAH A;  2EHO D;  4U72 A;  5LA6 E;  4BA9 A;  4PAG A;  3ZJ2 A;  3FXE B;  4L5G A;  2L3L A;  4QX8 B;  4I50 E;  3ZYM A;  4CI3 B;  2XAJ B;  4P0A A;  2CLY C;  2DNX A;  3CPZ A;  5HXC A;  4TV8 E;  3QK6 A;  3OYX A;  4X1I E;  3KVB A;  1WYC A;  2ZM8 A;  4V1A v;  4QXH B;  2XAG B;  3T8O A;  3WAK A;  5JDF A;  4DO0 A;  4AQF A;  5HWX A;  2ODU A;  2H7V C;  2Z6E A;  3BK9 A;  3NZP A;  5H6Q B;  5JDM A;  1SA0 E;  3KV9 A;  3ZN1 B;  4ISS A;  1Z0P A;  5LG4 A;  2PG8 A;  5FXX A;  4M1P A;  4EZH A;  4UVC B;  4BAY B;  4DBR A;  2BDE A;  3K3N A;  3V5S A;  2V7J A;  2PJQ A;  2W0G A;  4JUY A;  4MFR A;  2DI4 A;  3C51 A;  3RKO A;  2D5U A;  2LHN A;  3VKG A;  3AA6 B;  5HXS A;  5JDH A;  2V7I A;  4OYK A;  1YKH B;  2LJL A;  1HF8 A;  1HG2 A;  2ES0 A;  4OHF A;  2VKO A;  3CQG B;  4O2B E;  2WWU A;  2VKJ A;  2MTQ A;  2QGS A;  2Q9Q B;  2CMR A;  3BQL A;  5ETW A;  4FJO A;  2EHO B;  3CQX C;  4MHC A;  5HXR A;  2A2F X;  3GWH A;  2H7O A;  3OYZ A;  1FEW A;  4QXC B;  3N9L A;  4UVB B;  5F8P A;  5L3E B;  3ZC0 A;  5KMG P;  4G2A A;  5LHG B;  3ZJ1 A;  2WAU A;  5FYM A;  4O8S A;  3PUG A;  2X9Y A;  3I9W A;  4ZOL E;  4PJJ A;  2I59 A;  3H37 A;  3CML A;  3HA4 A;  3NBX X;  4UIG A;  3J9X 1;  1G8X A;  3HL6 A;  3VHL A;  1S35 A;  3D0T A;  4KP3 C;  3UFE A;  5LYJ E;  4IHJ E;  4GYR A;  1HCI A;  5JRC B;  4HFV A;  2KWI B;  2HH7 A;  1EZ3 A;  2WMN A;  2JMH A;  3O1I A;  4H9O C;  3Q5X A;  4HE8 A;  3P7I A;  4XZC A;  1LKX A;  2X51 A;  3PDY A;  3B57 A;  2E9X A;  4HTE A;  3V5U A;  3TKL B;  3C50 A;  2SPC A;  5FXV A;  2LEH A;  3ZN0 B;  3LFM A;  4AI6 A;  3AVR A;  1MMD A;  3OJA A;  4CXW A;  3P8C D;  3N2G E;  4IIJ E;  2C5J A;  2WM9 A;  5EK3 A;  4GOU A;  1MNE A;  4MLK A;  3AA1 B;  4DMW A;  4O2A E;  1D0Y A;  3DJB A;  2J1D G;  4I43 B;  1QUU A;  3ANW A;  2K24 A;  1B7T A;  4QX7 B;  4UEM A;  2E9X C;  4ZHQ E;  2ZMA A;  3CQC B;  3E22 E;  3RPU A;  3RYC E;  3ESL A;  3LG7 A;  5EK4 A;  4DMV A;  4CI2 B;  4HKA A;  1MND A;  1YD8 G;  2MYS A;  2LHR A;  4JEU B;  2JRK A;  2X9X A;  5EZY E;  4CXY A;  3SOL A;  3N9M A;  1O3X A;  3C4W A;  3GN5 A;  5JR9 A;  2LSJ A;  3GA8 A;  3JC6 C;  3MA9 A;  3ZMS B;  5LGU B;  5LJN A;  4P09 A;  3VKH A;  1T98 A;  3OBV E;  2KIN B;  4UXN B;  4KMC A;  1MMG A;  4IE7 A;  5FY1 A;  2PFV A;  2DLR A;  4G63 A;  4C90 A;  2E9X B;  4DVD A;  4QWN B;  2ZLY A;  5J1G A;  4BJN A;  1BR1 A;  4OYJ A;  1VOM A;  4X20 E;  1ZHC A;  4PFO A;  4EB6 E;  1BR2 A;  1U5P A;  2W63 A;  3CKD A;  3QC9 A;  4E7S A;  3C98 B;  5C8Y E;  5JR9 C;  2NTY A;  5ADX L;  3J7Y q;  3AAI A;  3ZEF B;  3PUS A;  3AAE B;  4WBO A;  2ZM2 A;  4JEH B;  4E7Z A;  2GK9 A;  2LOS A;  2Y48 B;  3AB3 B;  1D0Z A;  2H3R A;  4AQG A;  4IE6 A;  3WAJ A;  4WBN E;  3NZQ A;  5HWY A;  5FXZ A;  1E1H B;  1CUN A;  1YKE B;  3EVY A;  3Q9D A;  3MKD A;  5DQV A;  5JDQ A;  3ZCI A;  5M4Y A;  3C64 A;  2XQY A;  4Z8X A;  2BVL A;  3BQI A;  1VRB A;  2V1D B;  3CWZ B;  1FMV A;  3K3Q C;  2VKH A;  1HTJ F;  2LSI A;  4C91 A;  3CVR A;  5H6R B;  1LVF A;  2YK0 A;  4BJM A;  2CLY B;  3Q5W A;  4ZI3 C;  2G0U A;  2XAS B;  3CX7 B;  3O4X E;  4H9P C;  4EZ4 A;  2C0S A;  4X1K E;  3N2K E;  2X9H A;  3AA0 B;  4PK6 A;  2A3D A;  2XHE B;  5A1L A;  2K48 A;  4ZI2 C;  2DCF A;  5LGN B;  1S94 A;  3IEE A;  4MBQ A;  4UF0 A;  5FP3 A;  4AKL A;  3S4U A;  3I0Q A;  4WNK A;  1H7C A;  2BZB A;  2MOZ A;  4IE5 A;  4CQI A;  4YLH A;  1HFA A;  4EYU A;  5L3G B;  3LK3 B;  5GON E;  3F57 A;  2E8I A;  5CB4 E;  2NW7 A;  3E08 A;  3EDU A;  3N9P A;  4YJ3 E;  2VAS A;  3ZC1 A;  4L0R A;  1FMW A;  1NWM X;  1HX8 A;  4YHJ A;  4KUM B;  1KNZ A;  5LOV E;  2UXX B;  2K9A A;  3MAC A;  2LSG A;  5J2U E;  2V7M A;  3ZYK A;  2HPJ A;  4B6X A;  5JDG A;  4HGA A;  4O4H E;  4GK0 E;  3PTR B;  3ONX A;  1D1C A;  2DHR A;  4EXT A;  4O4J E;  5CA0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...