4H9RC

Complex structure 5 of daxx(e225a)/h3.3(sub5,g90a)/h4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQAARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
total genus 74
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9rC00
4HGAA 4H9PC 5KDMC 4H9QC 4H9SE 4H9RC 4H9NC 4H9OC
chains in the Genus database with same CATH superfamily
5AQRB 2Q9QB 4EOZB 2H89A 3M65A 3K3OA 1Z8UA 4Z8XA 4IREA 4QWNB 1HF8A 5ABHA 5FYMA 4GKKT 2XUEA 2MTQA 1SA0E 4LMJA 4AQGA 4GIWA 2XQ9A 5FL0A 1M7KA 4X66T 4AQFA 2RPAA 3ANWA 4OHFA 5J1GA 5L4HA 2V6YB 2LSGA 2WSSV 1T72A 2BS2A 4JEUB 4YSZA 3VRAA 4QXBB 2DWGA 3C64A 3QK6A 3IF8B 1ZOYA 3PU8A 4ILAA 2KT9A 1ZV4X 4JLEA 2E9XA 5TAOA 1T98A 2NW9A 2WM9A 4LFAT 1R8IA 4JBWF 4H9OC 5HWYA 3SFDA 2K9AA 3T1YT 3JADA 3HKDE 4EZHA 3DJBA 4ISSA 4WW0A 3ZMZB 3LBXA 2CA5A 2CXDA 4DMVA 3LG7A 3RRWA 2X66A 4ZHQE 3NKZA 5JDHA 2IW5B 4WBNE 2UXCT 2Z6EA 4IT4A 4E7ZA 3ZCIA 1W0AA 3E0ZA 3CKDA 4XZCA 4Q25A 3I9YA 4DO0A 3LK2B 4ZI7E 1L0VA 2E8IA 3ETUA 4EEBA 3HKBE 3VR9A 4XAXB 3N9MA 3KFWX 3PURA 2XQ4A 2EHOA 1HX8A 1SHZC 1ZEEA 3N5LA 5LJNA 1LVFA 4YHJA 5H6QB 3Q2MA 2IDOB 1OWAA 1E7PA 4DBRA 2HH7A 4P0BA 3AEFA 4PK4A 3CX6B 1UCUA 2YDRA 5IYZE 5AFUL 4F6RC 4QX8B 2J1DG 3UFEA 4GYRA 2E5VA 2IC9A 5LCYA 2W00A 2X9XA 2E2AA 3MZKB 2WZHA 1OEDC 3UQ4A 2M67A 2XTLA 2ACZA 2E9XD 2ZMAA 3RIUC 2LM2A 3AA0B 4NUVA 2ODVA 3U78A 3UTKA 2UXDT 2LKGA 5L3DB 4H9SE 1HNXT 4TX5A 1KF6A 4DR4T 1KNRA 3AEDA 4GYSA 1HS7A 2BBHA 2CM0A 2DI4A 5H6RB 4JI6T 3UUMA 3SOLA 5JR9B 2JIWA 1ZKEA 3CQCB 5KXJA 1FMVA 2JMHA 2YK0A 2XQ5A 4HKAA 2OA5A 2FJDA 2MYSA 4ZI3D 1MIYA 4ILBA 4KHZF 5AQQB 2VQFT 3I1AA 4WZXA 3TLWA 3OJAA 3AE6A 2EHOD 2IAKA 2J4GA 2LE8A 4HFCA 4YTNA 3DP7A 1EZ3A 4DV6T 4JI4T 4X1KE 4IDPA 2L8KA 3ZMUB 4ILCA 4LFCT 5FMNA 4LMLA 4ILUA 2WMNA 3ONLC 4CXXA 2QRXA 4KUMB 4IE5A 3L09A 2BDEA 4U3CA 3D0TA 4TWDA 4AQFC 1M62A 3Q5XA 2NP9A 4IL9A 1JNZA 1N33T 4O4JE 1VCTA 2V6YA 2XQ8A 4Z91A 1MIVA 4IE7A 5FY1A 5IWAT 1ZP0A 2XAHB 4JYAT 3K8PC 2E9XC 4BJNA 3SRZA 3G06A 3PUSA 4TUYE 5AQVB 3T8OA 3FZFB 1SUMB 4ZS2A 3IBPA 2D0TA 1UGOA 3HKEE 2L9QA 3N2GE 4IDNA 1HNWT 4YFSA 3RH3A 5J2UE 4ZZBA 5AQIB 4PFPA 4HN9A 2B1EA 5FXVA 2FJEA 2AE9A 5HEOA 1HG2A 4IDZA 4HWCA 4NPPA 4NIQA 2AXDS 4E7SA 2J47A 4H9RC 2YINA 5AQSB 2CXFA 3PJAJ 3ZYMA 3K3NA 2ACXA 1GQEA 2XPKA 4ZI2D 2W63A 4TV9E 4ZI3C 1ZHCA 3N9OA 3VU7H 1XNQT 4B3TT 2KLQA 5E0OA 3PV0F 5J2TE 2X68A 2EHOC 1HR0T 1KEYA 5LHIB 1D1CA 5LGTB 4LF6T 4DMWA 5L47A 4F8HA 2I59A 1Y64B 5AQFB 1HFAA 4O4LE 3CIRA 4DV7T 3VRBA 1N34T 3IHRA 4DR2T 3EHZA 4DNDA 3UUBA 4EGWA 1KNZA 2WAUA 3O1JA 4V1Av 2XHEB 2WDQA 1H7CA 4BJMA 2P9BA 3N2OA 2C5IT 4H9PC 4M1PA 3FHNA 2K3WA 4ZOLE 5FVKA 4CZZB 4QKNA 2KMFA 2V7LA 3C4WA 5CA1E 4AI6A 4UV8B 4QX7B 1UK5A 5J0ZA 1S94A 3FZHB 3W15B 4YTPA 4CXYA 4CI3B 4H9QC 3ZN1B 2HHHT 2XM2A 3FZMB 1LRZA 2VKHA 2XAQB 3C50A 2VKJA 3UU3A 4HWDA 2CHOA 1IZNB 2DWKA 5AQJB 1MMDA 4EZ4A 5JR9A 1J5WA 3UQ7A 3DTOA 2JMKA 3NRXA 4AISA 4QXCB 1BR4A 1XNRT 2BG9E 1XDPA 4DV4T 4YTMA 5GONE 5JDNA 2N1GA 4HFDA 4ZI2C 5FXWA 2W66A 2X9YA 1WLXA 4ANJA 4O4HE 3KBUA 5AQNB 3TLSA 3AVRA 4TV8E 3U3IA 3L39A 3RC3A 2OV9A 2CWYA 4LMKA 1WR6A 2XASB 4U7YA 4DR7T 4MBQA 2CCQA 2Q9QC 4DV2T 2W67A 2LSYA 5C3JA 4OK0A 1FIOA 3AE8A 3UULA 4LF5T 5L3EB 4EXTA 4UEMA 3O1HA 4U2YA 4K0UA 4EV6A 3N9LA 3I0OA 3I9WA 1BR2A 1AJ3A 4DV0T 3GMIA 1IAPA 2BBJA 2XQ3A 4N78D 4GK5E 3RPUA 1YXRA 5FY7A 3UU8A 2NW8A 3UU6A 5FNVE 1CUNA 2DCFA 5HCJA 5C2TA 3Q5WA 3NRYA 2LHRA 3VR8A 4YSXA 3KV6A 4J2CA 4X64T 1HTJF 1DU2A 2HPJA 2PTFA 3CMLA 4X1IE 5JDLA 3S4UA 2LOSA 3H3AA 1BR1A 2DNXA 1YW0A 1XWMA 3PUQA 4B3ST 2W62A 4TWHA 4G2AA 3P8CD 3MJXA 2BS4A 5AQLB 1MIWA 2BZBA 5L3GB 3NVOA 5DQVA 4MLKA 3N2KE 3SFEA 4JI7T 3Q5EA 4H63V 3ETVA 2LLYA 1WFDA 1SE7A 2CWOA 5ABFB 4TNWA 3P4SA 1V9DA 2JQQA 4QXHB 4MHCA 5KX5E 4PJNA 5IHYA 3VKGA 2NW7A 5HEGA 1KFYA 1IJ5A 3MXZA 4P0AA 5LBQB 1YKEB 1JNRA 1X9BA 2WS3A 5HYAA 3CQGB 2LJLA 2HN1A 4ERRA 3VKHA 3OPCA 3V5SA 2SPCA 2A2FX 1W0BA 2XQAA 3CVRA 3KV5A 2BG9B 2WCAA 4HGAA 3BQKA 3SS1A 4JV5T 4CQIA 3RKGA 3RRCA 3AXJA 4IE6A 3HI2A 3LK3B 3ZMTB 2C5KT 2LSKA 2Y6XA 4YSYA 4WNKA 4HEAA 3PUWF 3TLVA 4A5XA 5HXCA 5JRCA 3R84B 3CWZB 4H9NC 3QB5K 5F8PA 3ONJA 3UUXB 4TZ4C 5JVDE 4ADZA 1OXZA 4U7IA 5JR9C 4UV9B 2V6XA 3KDSE 4A56A 3AE9A 2V8SV 3AE7A 4IDOA 3RQWA 2VVSA 3BQLA 3M3ZB 3UU4A 5JTGA 2PBIA 2W2UA 2YU2A 3ZEFB 5BMVE 2KWIB 4AKIA 5ETWA 4IGUA 3QNUA 4JI8T 4UF0B 3L3PA 4HFBA 3CX8B 4L9IA 4X65T 2WDRA 2CHNA 3TLTA 3P4WA 2LRLA 3ABVA 4WBOA 4DBQA 3ZC0A 3B57A 3N9PA 5HEJA 3RYCE 2DHRA 2ZM6T 4OFZA 5AQKB 1XMQT 2A72A 2V5DA 1D0ZA 3MK7C 3AE3A 3RI5A 4IE0A 2BVMA 2OLTA 4U72A 4PNIA 4YJ2E 3PUVF 2LEHA 1T7SA 2C0SA 4KP3C 4JI1T 1XMOT 1W9RA 4JUYA 3E08A 1MNDA 3TLUA 3RHWA 5F3JA 2YDSA 1D1AA 3QB5A 3RYIE 2CPTA 3AA7B 5ADXL 1US7B 3AEBA 3PJAA 2XSBA 5AQPB 2V7KA 4O2BE 3B13A 1VCSA 4PFOA 5L3CB 1E2AA 4KI0F 4YLHA 5LG4A 2FUPA 3Q5DA 2WU2A 4DV5T 1NAFA 3ZKRA 4P1NA 3ZC1A 3ZPOA 1IBKT 4QH4A 3RQUA 4JI3T 3HL6A 4ZZCA 1E1HB 1QUUA 3ZYKA 3AE4A 2JRKA 3QOFA 3RF1A 4TNVA 3WAJA 3AECA 1YD8G 3FBZA 4LF8T 3FZKB 3CPZA 1MMAA 3QUJA 5ABFA 1FJGT 2YN6A 1LKXA 5JQGE 3NWIA 4ZS3A 4B6XA 2WDVA 4HTEA 4YY3T 2X0LB 3E22E 5L2LA 1CHUA 1U5PA 3F2EA 5HXSA 2A9UA 1VOMA 2CLYB 3PUXF 2K24A 4AIUA 1HCIA 1VRBA 1J5ET 1U4QA 3AAAB 3PUAA 2FJBA 2YKSA 5JDFA 2UXBT 2UUAT 2QYWA 2J62A 1FEWA 3LFMA 2PJQA 1UUSA 3MA9A 3F57A 2GK9A 2W4XA 1X79A 5LHHB 3R6NA 4QHOA 5LOVE 2QA7A 3CK6A 1B7TA 3OBVE 2MAWA 2BG9A 3O9XA 3KVAA 4DIDB 3K3QC 4GOUA 4FJOA 5F5WA 3EDVA 3O4XE 4LF9T 2MBGA 4HWHA 3H3MA 3V5UA 5LG3A 2N9DA 2NR4A 3A8YC 2LHNA 2D5UA 3AXJB 3HKCE 4KX6A 4AKHA 2WWUA 2XSAA 5C8YE 5LXTE 2XQYA 4EAHA 3J9X1 1XDOA 4YHHT 3AEGA 4AQYT 2KNDA 4Z90A 2ZLYA 5EZYE 4OYJA 2PG8A 5JRCB 3T1HT 5FXZA 5JDGA 1D0YA 3AE5A 4DR5T 4DUYT 1WR0A 4I4TE 4U31A 1HNZT 5FP3A 5LHGB 2RP4A 4HFHA 3IA3A 4CN4A 3AA1B 4CI2B 3RIUA 4XBFB 2VURA 4B3RT 3FXEB 2KZ7B 3EUHA 4DR1T 2YOEA 4EB6E 1Z0PA 2IIUA 2X0YA 2Y48B 3EAMA 3TKLB 3N9NA 4JI2T 4JI0T 4UF0A 4X20E 4KHPT 4A97A 2G0UA 4EIWA 4DV1T 1HG5A 5AQHB 4YXDA 4DR3T 5HXEA 4HWFA 3BQIA 3OTOT 5ABEA 4JEHB 3ZJ2A 2KXPB 1OEDE 3EDUA 2CMRA 4ZXLA 3KVBA 1KK7A 2I6HA 3C4XA 3ZJ1A 2WMOA 3ZMSB 3PUGA 4PJLA 2ZM8A 3RX6A 3AEAA 4UIGA 3A7MA 2V1DB 3EI0A 1BR0A 3OYZA 5A1LA 2BKNA 3JAFA 5LYJE 5DQWA 5BR8T 2L3LA 2JQHA 1WYBA 2XAJB 4BAYB 2MPKA 3FXDB 1IJ6A 3ZT5A 5AQUB 2ZM0A 3GWHA 2X9HA 2H7VC 4X5TA 3PTRB 2X0HA 2XJ7A 3P4PA 2MOZA 4LFBT 4NXNT 4CN1A 3MKDA 4YJ3E 1NWMX 4DR6T 4EYUA 2YDQA 4KMCA 1N36T 1IBLT 1N32T 3OKQA 1QSDA 4HFEA 2WZIA 2N2NA 2WP9A 2M6IA 3ZMVB 3RYHE 5CA0E 1IBMT 2CXLA 2R6GF 4EYYR 3LK42 5JDMA 2W0GA 2BVLA 4GK0E 2IMLA 2LOPA 3N9QA 1MMGA 4ZEYA 3C4ZA 5M4YA 5AQTB 3L8RA 2XQ6A 5KMGP 2F4VT 5ABGA 3EABA 5AQOB 5IUXA 3AAEB 3PUZF 3UFGA 4HFIA 1XZYA 2W61A 3OYXA 3P4QA 1S35A 2IC6A 5HAXA 5LJMA 3KV4A 1G8XA 2DL1A 2BG9C 5EK4A 1NEKA 2YEVC 3FBLA 2Y8DA 1QLBA 2V26A 3KBTA 2K48A 4NUUA 4PW8A 4AKLA 2RA1A 2XQ7A 2WB5A 5FKYA 3AAIA 5LMUT 2VKDA 3ZN0B 4IIJE 3AE2A 3WI3A 1Y01A 2NTXA 1FMWA 2CRBA 2VL8A 1O3XA 3P7IA 3RC8A 2JJ9A 3JAEA 4LF7T 2H3RA 3ZLIA 2V7JA 4AXPA 2X51A 3JC6D 1OEDB 4UVBB 4OX9T 2JPFA 2NTYA 4U2ZA 2ZM2A 4U74A 3ZYLA 5L3BB 5JDQA 5HEUA 4A98A 3A5XA 1LVKA 3IEEA 4HWIB 2LM9A 2QGSA 2X9WA 3LSVA 5JH7E 2BS3A 4QH1A 5DJQC 5FY0A 5KDMC 4C91A 3CQXC 4HFVA 3ZT7A 3X1DA 2LSJA 4U33A 4MALA 2FJAA 4HE8A 4I43B 5EK2A 4UVAB 3RIFA 4PK5A 3ONXA 4PK6A 3AA6B 4ISTA 5HXHA 2V7IA 3FB2A 1J1JA 1YQ3A 2CBIA 4CN6A 5LMNT 4O2AE 2X67A 3GN5B 3PE0A 1YKHB 2VQET 4I50E 2XAFB 4GKJT 3HA4A 2ES0A 2VKOA 4G63A 2VVNA 2HN2A 3UUNA 4IDQA 4IE4A 4K0KT 3RYFE 5L3FB 1KNPA 2Q9QA 1I94T 4UELA 3RLFF 2V5CA 1WYCA 3P50A 4COFA 2JQKA 2BKPA 2I0MA 2WU5A 2QVAA 3P4RA 1MNEA 2ODUA 5CGMA 4PAGA 2IUBA 3ANWB 2C5JA 1W09A 3NZQA 1T8BA 2BKOA 3RIAA 5LGNB 3NZPA 3GA8A 2A3DA 3AB3B 2LSIA 3FZLB 4QH5A 4P09A 3JC6C 3C98B 3EVYA 2WQYA 2E9XB 1MMNA 2B76A 3RKOA 3BK9A 3PU3A 2FBWA 3J7Yq 2UU9T 4UR9A 3LBXB 5LGUB 4UVCB 5FVLA 3OVUA 1D1BA 4UXNB 2V7MA 4CXWA 2CLYC 4C90A 4NXMT 5DABA 3H37A 4O4IE 1UURA 3VHLA 2KWHA 5HWXA 1UX4A 2WBLA 4PJJA 4FI5A 4LF4T 2UUCT 5AQMB 5LB7B 3UT5E 3LDQB 5JREA 2EHOB 2Q9QD 3NBXX 2UXXB 3LJCA 4I0UA 4TWFA 5L4EA 2M6BA 3QC9A 3F31A 2CBJA 2XM1A 3MACA 3KV9A 1WCRA 3JCFA 4ASKA 5LP6E 5FL1A 4DV3T 2XY8B 3Q9DA 2VASA 2XAGB 3CX7B 5EK3A 4WYVA 3HR0A 5HEHA 3ESLA 3UU5A 2KSRA 3AVSA 3K1SA 3AEEA 4AKRB 4CI1B 4O8SA 3KINB 2LT3A 2VK9A 3B5MA 4PJMA 4BA9A 2XZEA 1YQ4A 2CE7A 2WY2A 4IHJE 1OEDA 1UX5A 3C51A 2H7OA 2JQ9A 2VWAA 5LBMA 2PFVA 4H63H 1NENA 2CEAA 1WRDA 5AQGB 2LRKA 1D0XA 1HX1B 2NOXA 2LKHA 4IL4A 3ZCJA 2E5LT 4L0RA 5HXRA 4KBMB 3ZSSA 2K5BB 4B3MT 3RGLA 3PDYA 4L5GA 4DUZT 4X62T 2UUBT 3ZSTA 5LNKA 2D9DA 3ZT6A 1I6ZA 5CB4E 5HCMA 4JI5T 3I0QA 5CFBA 4MFRA 2YU1A 5LA6E 4YT0A 3SWHA 4TN7B 2DLRA 4AKGA 2UXNB 3GN5A 2VB6A 2HPLA 3AE1A 2WWVA 4OYKA 4X1YE 4DVDA 5CJ5A 3PUYF 4I55E 4EEDA 3O1IA 2IHR1 2VL0A 2NWBA 1G73A 2D2SA 3WAKA 2H88A 5FXXA 2KINB 2D0UA
chains in the Genus database with same CATH topology
2A72A 3IHRA 1D0ZA 3MK7C 4IE0A 2Q9QB 5EK4A 4DNDA 4EOZB 1KNZA 3M65A 2BVMA 2YEVC 3K3OA 2WAUA 4Z8XA 3O1JA 3FBLA 4U72A 4V1Av 2XHEB 4QWNB 4PNIA 1HF8A 4YJ2E 2Y8DA 1H7CA 2LEHA 2V26A 5FYMA 3KBTA 2K48A 2C0SA 4KP3C 2P9BA 4NUUA 4BJMA 2XUEA 3N2OA 4PW8A 2MTQA 2C5IT 1SA0E 4AQGA 4GIWA 4JUYA 4H9PC 4AKLA 3E08A 4M1PA 2RA1A 1MNDA 3FHNA 4ZOLE 3AAIA 4CZZB 5F3JA 4QKNA 1D1AA 2VKDA 2KMFA 2V7LA 3C4WA 3ZN0B 4AQFA 3RYIE 4UV8B 5CA1E 4AI6A 3ANWA 3AA7B 4OHFA 4QX7B 1US7B 5J1GA 5ADXL 4IIJE 2V7KA 3WI3A 4O2BE 1S94A 2LSGA 2WSSV 3B13A 4PFOA 4JEUB 3W15B 5L3CB 4CXYA 4QXBB 2NTXA 4YLHA 5LG4A 1FMWA 4CI3B 2DWGA 3C64A 4H9QC 3QK6A 3ZN1B 2VL8A 1NAFA 1O3XA 3P7IA 3RC8A 3IF8B 2JJ9A 3ZC1A 3PU8A 1LRZA 2H3RA 3ZLIA 2V7JA 3ZPOA 4AXPA 2X51A 2KT9A 1ZV4X 3JC6D 4JLEA 2VKHA 4UVBB 2E9XA 5TAOA 2XAQB 3C50A 1T98A 2JPFA 2NTYA 3HL6A 2NW9A 2VKJA 2WM9A 1E1HB 1QUUA 3ZYKA 1IZNB 2DWKA 4H9OC 5HWYA 2K9AA 2ZM2A 2JRKA 4U74A 1MMDA 3HKDE 4EZ4A 3ZYLA 5L3BB 4EZHA 5JDQA 3DJBA 4ISSA 4WW0A 5JR9A 3ZMZB 3LBXA 2CA5A 3A5XA 1LVKA 3DTOA 3IEEA 2JMKA 2LM9A 2QGSA 2X9WA 1YD8G 2CXDA 3FBZA 3NRXA 4QXCB 4DMVA 5JH7E 1BR4A 3LG7A 3RRWA 3CPZA 2X66A 4ZHQE 5JDHA 2IW5B 1MMAA 4WBNE 3QUJA 5DJQC 5FY0A 5GONE 5KDMC 2Z6EA 5JDNA 2N1GA 4C91A 3CQXC 4ZI2C 1LKXA 4HFVA 4E7ZA 2LSJA 5FXWA 2X9YA 1WLXA 4ANJA 3ZCIA 5JQGE 3E0ZA 4MALA 4HE8A 4I43B 4O4HE 4ZS3A 4B6XA 3KBUA 3CKDA 4XZCA 3I9YA 4DO0A 4HTEA 5EK2A 4UVAB 3LK2B 3AVRA 2X0LB 3E22E 3ONXA 4PK5A 4TV8E 5L2LA 4PK6A 3AA6B 4ZI7E 4ISTA 1U5PA 5HXHA 3U3IA 3F2EA 2V7IA 3FB2A 5HXSA 3RC3A 1VOMA 2CLYB 2CWYA 1WR6A 2K24A 2E8IA 1HCIA 1VRBA 3ETUA 3HKBE 2XASB 4O2AE 2X67A 4MBQA 3GN5B 1U4QA 1YKHB 2CCQA 3AAAB 3PE0A 3N9MA 3PUAA 2XAFB 3KFWX 4I50E 2Q9QC 4XAXB 3PURA 3HA4A 2EHOA 2ES0A 1HX8A 2LSYA 5JDFA 1SHZC 2VKOA 4OK0A 4G63A 1ZEEA 3N5LA 1FIOA 1FEWA 3UUNA 3LFMA 2PJQA 4IE4A 3MA9A 3F57A 2GK9A 5LJNA 1X79A 3UULA 5LHHB 3R6NA 1LVFA 4YHJA 5L3EB 3RYFE 4QHOA 5LOVE 4EXTA 5H6QB 3Q2MA 1OWAA 5L3FB 2Q9QA 4UEMA 2QA7A 4UELA 4DBRA 3O1HA 2HH7A 4K0UA 1B7TA 3OBVE 1WYCA 4P0BA 4PK4A 3O9XA 3KVAA 3CX6B 3N9LA 1UCUA 3K3QC 3I0OA 4GOUA 4FJOA 5IYZE 3EDVA 3I9WA 3O4XE 1BR2A 1AJ3A 2MBGA 5AFUL 3V5UA 3GMIA 4F6RC 1IAPA 2N9DA 2LHNA 2D5UA 4QX8B 3HKCE 4N78D 4GK5E 2J1DG 3RPUA 3UFEA 4AKHA 4GYRA 2WWUA 5FY7A 1MNEA 2ODUA 2IC9A 5C8YE 5LXTE 3WAJA 2XQYA 4EAHA 4PAGA 3J9X1 2NW8A 5LCYA 2W00A 3ANWB 2C5JA 2X9XA 5FNVE 3NZQA 1CUNA 2DCFA 3MZKB 3Q5WA 2KNDA 5LGNB 3NRYA 2ZLYA 2M67A 2XTLA 3NZPA 3GA8A 5EZYE 2E9XD 4OYJA 2PG8A 2ZMAA 5JRCB 2A3DA 2LHRA 3AB3B 5FXZA 2LSIA 5JDGA 4P09A 3AA0B 1D0YA 4NUVA 2ODVA 3KV6A 3U78A 3UTKA 3JC6C 3C98B 4J2CA 1HTJF 5L3DB 2HPJA 4H9SE 3EVYA 4I4TE 3CMLA 4X1IE 4TX5A 5JDLA 3S4UA 5FP3A 2E9XB 5LHGB 2RP4A 1MMNA 2LOSA 3H3AA 1BR1A 2DNXA 1YW0A 4GYSA 3RKOA 3BK9A 3AA1B 3PU3A 4CI2B 4XBFB 2CM0A 2DI4A 1HS7A 3J7Yq 3FXEB 5H6RB 3UUMA 2KZ7B 3PUQA 3SOLA 3EUHA 4EB6E 5JR9B 2W62A 1ZKEA 3CQCB 3LBXB 3P8CD 4G2AA 3MJXA 5LGUB 4UVCB 1MIWA 1Z0PA 2BZBA 1D1BA 1FMVA 2JMHA 5L3GB 4UXNB 2YK0A 5DQVA 2V7MA 4HKAA 4MLKA 3N2KE 2OA5A 2Y48B 4CXWA 4H63V 3TKLB 3ETVA 3N9NA 2CWOA 2MYSA 4ZI3D 1MIYA 2CLYC 4UF0A 4X20E 4C90A 1V9DA 5DABA 2G0UA 4EIWA 1HG5A 3I1AA 2JQQA 4QXHB 5HXEA 3H37A 4MHCA 5KX5E 3OJAA 3BQIA 4O4IE 4PJNA 5IHYA 3VHLA 3VKGA 2NW7A 2KWHA 2EHOD 5HWXA 1IJ5A 3MXZA 4P0AA 1UX4A 5LBQB 2IAKA 1YKEB 4JEHB 2LE8A 2WBLA 3DP7A 4PJJA 4FI5A 1EZ3A 5HYAA 3CQGB 3ZJ2A 2KXPB 3EDUA 2LJLA 3UT5E 4X1KE 2L8KA 5JREA 3ZMUB 2EHOB 2CMRA 4ERRA 2Q9QD 3NBXX 2UXXB 3VKHA 3LJCA 3V5SA 3KVBA 1KK7A 3QC9A 5FMNA 3F31A 2SPCA 2A2FX 4ILUA 2WMNA 3MACA 3C4XA 4CXXA 3CVRA 4KUMB 3KV9A 4IE5A 3L09A 3ZJ1A 2BDEA 2WMOA 3ZMSB 4ASKA 3KV5A 3PUGA 4PJLA 5LP6E 2ZM8A 3D0TA 3RX6A 4AQFC 4UIGA 2V1DB 3Q9DA 2VASA 3Q5XA 2XAGB 4HGAA 3BQKA 1BR0A 2NP9A 3CX7B 3OYZA 3SS1A 5A1LA 4CQIA 5EK3A 3HR0A 3RRCA 3ESLA 4O4JE 4IE6A 3HI2A 5LYJE 3LK3B 3AVSA 5DQWA 4AKRB 4CI1B 4O8SA 2C5KT 3KINB 2LSKA 2LT3A 2L3LA 3ZMTB 1WYBA 2XAJB 2Y6XA 1MIVA 4IE7A 5FY1A 4BAYB 3FXDB 2VK9A 2XAHB 1IJ6A 4WNKA 2ZM0A 4PJMA 3GWHA 4HEAA 2X9HA 4BA9A 2H7VC 3K8PC 2E9XC 3PTRB 4BJNA 5HXCA 5JRCA 3R84B 3SRZA 2CE7A 3CWZB 3PUSA 4H9NC 4IHJE 5F8PA 4TUYE 3T8OA 1UX5A 3UUXB 4TZ4C 5JVDE 4ZS2A 3C51A 3IBPA 4ADZA 1OXZA 2D0TA 3HKEE 5JR9C 2H7OA 2L9QA 2MOZA 4UV9B 2VWAA 5LBMA 3N2GE 2PFVA 4H63H 3KDSE 2CEAA 4YFSA 1WRDA 3MKDA 4A56A 3RH3A 5J2UE 4YJ3E 1NWMX 4EYUA 4PFPA 4HN9A 1D0XA 2B1EA 5FXVA 4KMCA 2NOXA 3ZCJA 4L0RA 5HXRA 1HG2A 3OKQA 1QSDA 4IDZA 4KBMB 4E7SA 3BQLA 2N2NA 2PBIA 4H9RC 2K5BB 2YINA 2YU2A 3ZMVB 3ZEFB 3RYHE 2CXFA 3PDYA 4L5GA 5CA0E 5BMVE 2KWIB 2CXLA 3ZYMA 4AKIA 3K3NA 4EYYR 2ACXA 4ZI2D 2W63A 5ETWA 3LK42 4TV9E 4ZI3C 4IGUA 5LNKA 5JDMA 1ZHCA 2W0GA 2BVLA 5CB4E 3N9OA 4UF0B 3L3PA 4GK0E 3VU7H 3I0QA 2KLQA 3CX8B 4L9IA 2LOPA 3N9QA 5E0OA 4MFRA 2YU1A 5LA6E 1MMGA 3C4ZA 3SWHA 5M4YA 5J2TE 2X68A 2EHOC 4TN7B 2DLRA 5KMGP 5LHIB 4AKGA 2UXNB 3GN5A 2VB6A 2HPLA 4OYKA 4X1YE 1D1CA 4DVDA 5LGTB 4I55E 4DMWA 2I59A 3AAEB 1Y64B 3O1IA 1HFAA 4WBOA 4DBQA 3ZC0A 4O4LE 3B57A 3N9PA 2W61A 3OYXA 3RYCE 2NWBA 1S35A 2DHRA 1G73A 2D2SA 2IC6A 5HAXA 5LJMA 3WAKA 5FXXA 2KINB 4OFZA 3KV4A 2D0UA 1G8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HGA A;  4H9P C;  5KDM C;  4H9Q C;  4H9S E;  4H9R C;  4H9N C;  4H9O C; 
#chains in the Genus database with same CATH topology
 5AQR B;  2Q9Q B;  4EOZ B;  2H89 A;  3M65 A;  3K3O A;  1Z8U A;  4Z8X A;  4IRE A;  4QWN B;  1HF8 A;  5ABH A;  5FYM A;  4GKK T;  2XUE A;  2MTQ A;  1SA0 E;  4LMJ A;  4AQG A;  4GIW A;  2XQ9 A;  5FL0 A;  1M7K A;  4X66 T;  4AQF A;  2RPA A;  3ANW A;  4OHF A;  5J1G A;  5L4H A;  2V6Y B;  2LSG A;  2WSS V;  1T72 A;  2BS2 A;  4JEU B;  4YSZ A;  3VRA A;  4QXB B;  2DWG A;  3C64 A;  3QK6 A;  3IF8 B;  1ZOY A;  3PU8 A;  4ILA A;  2KT9 A;  1ZV4 X;  4JLE A;  2E9X A;  5TAO A;  1T98 A;  2NW9 A;  2WM9 A;  4LFA T;  1R8I A;  4JBW F;  4H9O C;  5HWY A;  3SFD A;  2K9A A;  3T1Y T;  3JAD A;  3HKD E;  4EZH A;  3DJB A;  4ISS A;  4WW0 A;  3ZMZ B;  3LBX A;  2CA5 A;  2CXD A;  4DMV A;  3LG7 A;  3RRW A;  2X66 A;  4ZHQ E;  3NKZ A;  5JDH A;  2IW5 B;  4WBN E;  2UXC T;  2Z6E A;  4IT4 A;  4E7Z A;  3ZCI A;  1W0A A;  3E0Z A;  3CKD A;  4XZC A;  4Q25 A;  3I9Y A;  4DO0 A;  3LK2 B;  4ZI7 E;  1L0V A;  2E8I A;  3ETU A;  4EEB A;  3HKB E;  3VR9 A;  4XAX B;  3N9M A;  3KFW X;  3PUR A;  2XQ4 A;  2EHO A;  1HX8 A;  1SHZ C;  1ZEE A;  3N5L A;  5LJN A;  1LVF A;  4YHJ A;  5H6Q B;  3Q2M A;  2IDO B;  1OWA A;  1E7P A;  4DBR A;  2HH7 A;  4P0B A;  3AEF A;  4PK4 A;  3CX6 B;  1UCU A;  2YDR A;  5IYZ E;  5AFU L;  4F6R C;  4QX8 B;  2J1D G;  3UFE A;  4GYR A;  2E5V A;  2IC9 A;  5LCY A;  2W00 A;  2X9X A;  2E2A A;  3MZK B;  2WZH A;  1OED C;  3UQ4 A;  2M67 A;  2XTL A;  2ACZ A;  2E9X D;  2ZMA A;  3RIU C;  2LM2 A;  3AA0 B;  4NUV A;  2ODV A;  3U78 A;  3UTK A;  2UXD T;  2LKG A;  5L3D B;  4H9S E;  1HNX T;  4TX5 A;  1KF6 A;  4DR4 T;  1KNR A;  3AED A;  4GYS A;  1HS7 A;  2BBH A;  2CM0 A;  2DI4 A;  5H6R B;  4JI6 T;  3UUM A;  3SOL A;  5JR9 B;  2JIW A;  1ZKE A;  3CQC B;  5KXJ A;  1FMV A;  2JMH A;  2YK0 A;  2XQ5 A;  4HKA A;  2OA5 A;  2FJD A;  2MYS A;  4ZI3 D;  1MIY A;  4ILB A;  4KHZ F;  5AQQ B;  2VQF T;  3I1A A;  4WZX A;  3TLW A;  3OJA A;  3AE6 A;  2EHO D;  2IAK A;  2J4G A;  2LE8 A;  4HFC A;  4YTN A;  3DP7 A;  1EZ3 A;  4DV6 T;  4JI4 T;  4X1K E;  4IDP A;  2L8K A;  3ZMU B;  4ILC A;  4LFC T;  5FMN A;  4LML A;  4ILU A;  2WMN A;  3ONL C;  4CXX A;  2QRX A;  4KUM B;  4IE5 A;  3L09 A;  2BDE A;  4U3C A;  3D0T A;  4TWD A;  4AQF C;  1M62 A;  3Q5X A;  2NP9 A;  4IL9 A;  1JNZ A;  1N33 T;  4O4J E;  1VCT A;  2V6Y A;  2XQ8 A;  4Z91 A;  1MIV A;  4IE7 A;  5FY1 A;  5IWA T;  1ZP0 A;  2XAH B;  4JYA T;  3K8P C;  2E9X C;  4BJN A;  3SRZ A;  3G06 A;  3PUS A;  4TUY E;  5AQV B;  3T8O A;  3FZF B;  1SUM B;  4ZS2 A;  3IBP A;  2D0T A;  1UGO A;  3HKE E;  2L9Q A;  3N2G E;  4IDN A;  1HNW T;  4YFS A;  3RH3 A;  5J2U E;  4ZZB A;  5AQI B;  4PFP A;  4HN9 A;  2B1E A;  5FXV A;  2FJE A;  2AE9 A;  5HEO A;  1HG2 A;  4IDZ A;  4HWC A;  4NPP A;  4NIQ A;  2AXD S;  4E7S A;  2J47 A;  4H9R C;  2YIN A;  5AQS B;  2CXF A;  3PJA J;  3ZYM A;  3K3N A;  2ACX A;  1GQE A;  2XPK A;  4ZI2 D;  2W63 A;  4TV9 E;  4ZI3 C;  1ZHC A;  3N9O A;  3VU7 H;  1XNQ T;  4B3T T;  2KLQ A;  5E0O A;  3PV0 F;  5J2T E;  2X68 A;  2EHO C;  1HR0 T;  1KEY A;  5LHI B;  1D1C A;  5LGT B;  4LF6 T;  4DMW A;  5L47 A;  4F8H A;  2I59 A;  1Y64 B;  5AQF B;  1HFA A;  4O4L E;  3CIR A;  4DV7 T;  3VRB A;  1N34 T;  3IHR A;  4DR2 T;  3EHZ A;  4DND A;  3UUB A;  4EGW A;  1KNZ A;  2WAU A;  3O1J A;  4V1A v;  2XHE B;  2WDQ A;  1H7C A;  4BJM A;  2P9B A;  3N2O A;  2C5I T;  4H9P C;  4M1P A;  3FHN A;  2K3W A;  4ZOL E;  5FVK A;  4CZZ B;  4QKN A;  2KMF A;  2V7L A;  3C4W A;  5CA1 E;  4AI6 A;  4UV8 B;  4QX7 B;  1UK5 A;  5J0Z A;  1S94 A;  3FZH B;  3W15 B;  4YTP A;  4CXY A;  4CI3 B;  4H9Q C;  3ZN1 B;  2HHH T;  2XM2 A;  3FZM B;  1LRZ A;  2VKH A;  2XAQ B;  3C50 A;  2VKJ A;  3UU3 A;  4HWD A;  2CHO A;  1IZN B;  2DWK A;  5AQJ B;  1MMD A;  4EZ4 A;  5JR9 A;  1J5W A;  3UQ7 A;  3DTO A;  2JMK A;  3NRX A;  4AIS A;  4QXC B;  1BR4 A;  1XNR T;  2BG9 E;  1XDP A;  4DV4 T;  4YTM A;  5GON E;  5JDN A;  2N1G A;  4HFD A;  4ZI2 C;  5FXW A;  2W66 A;  2X9Y A;  1WLX A;  4ANJ A;  4O4H E;  3KBU A;  5AQN B;  3TLS A;  3AVR A;  4TV8 E;  3U3I A;  3L39 A;  3RC3 A;  2OV9 A;  2CWY A;  4LMK A;  1WR6 A;  2XAS B;  4U7Y A;  4DR7 T;  4MBQ A;  2CCQ A;  2Q9Q C;  4DV2 T;  2W67 A;  2LSY A;  5C3J A;  4OK0 A;  1FIO A;  3AE8 A;  3UUL A;  4LF5 T;  5L3E B;  4EXT A;  4UEM A;  3O1H A;  4U2Y A;  4K0U A;  4EV6 A;  3N9L A;  3I0O A;  3I9W A;  1BR2 A;  1AJ3 A;  4DV0 T;  3GMI A;  1IAP A;  2BBJ A;  2XQ3 A;  4N78 D;  4GK5 E;  3RPU A;  1YXR A;  5FY7 A;  3UU8 A;  2NW8 A;  3UU6 A;  5FNV E;  1CUN A;  2DCF A;  5HCJ A;  5C2T A;  3Q5W A;  3NRY A;  2LHR A;  3VR8 A;  4YSX A;  3KV6 A;  4J2C A;  4X64 T;  1HTJ F;  1DU2 A;  2HPJ A;  2PTF A;  3CML A;  4X1I E;  5JDL A;  3S4U A;  2LOS A;  3H3A A;  1BR1 A;  2DNX A;  1YW0 A;  1XWM A;  3PUQ A;  4B3S T;  2W62 A;  4TWH A;  4G2A A;  3P8C D;  3MJX A;  2BS4 A;  5AQL B;  1MIW A;  2BZB A;  5L3G B;  3NVO A;  5DQV A;  4MLK A;  3N2K E;  3SFE A;  4JI7 T;  3Q5E A;  4H63 V;  3ETV A;  2LLY A;  1WFD A;  1SE7 A;  2CWO A;  5ABF B;  4TNW A;  3P4S A;  1V9D A;  2JQQ A;  4QXH B;  4MHC A;  5KX5 E;  4PJN A;  5IHY A;  3VKG A;  2NW7 A;  5HEG A;  1KFY A;  1IJ5 A;  3MXZ A;  4P0A A;  5LBQ B;  1YKE B;  1JNR A;  1X9B A;  2WS3 A;  5HYA A;  3CQG B;  2LJL A;  2HN1 A;  4ERR A;  3VKH A;  3OPC A;  3V5S A;  2SPC A;  2A2F X;  1W0B A;  2XQA A;  3CVR A;  3KV5 A;  2BG9 B;  2WCA A;  4HGA A;  3BQK A;  3SS1 A;  4JV5 T;  4CQI A;  3RKG A;  3RRC A;  3AXJ A;  4IE6 A;  3HI2 A;  3LK3 B;  3ZMT B;  2C5K T;  2LSK A;  2Y6X A;  4YSY A;  4WNK A;  4HEA A;  3PUW F;  3TLV A;  4A5X A;  5HXC A;  5JRC A;  3R84 B;  3CWZ B;  4H9N C;  3QB5 K;  5F8P A;  3ONJ A;  3UUX B;  4TZ4 C;  5JVD E;  4ADZ A;  1OXZ A;  4U7I A;  5JR9 C;  4UV9 B;  2V6X A;  3KDS E;  4A56 A;  3AE9 A;  2V8S V;  3AE7 A;  4IDO A;  3RQW A;  2VVS A;  3BQL A;  3M3Z B;  3UU4 A;  5JTG A;  2PBI A;  2W2U A;  2YU2 A;  3ZEF B;  5BMV E;  2KWI B;  4AKI A;  5ETW A;  4IGU A;  3QNU A;  4JI8 T;  4UF0 B;  3L3P A;  4HFB A;  3CX8 B;  4L9I A;  4X65 T;  2WDR A;  2CHN A;  3TLT A;  3P4W A;  2LRL A;  3ABV A;  4WBO A;  4DBQ A;  3ZC0 A;  3B57 A;  3N9P A;  5HEJ A;  3RYC E;  2DHR A;  2ZM6 T;  4OFZ A;  5AQK B;  1XMQ T;  2A72 A;  2V5D A;  1D0Z A;  3MK7 C;  3AE3 A;  3RI5 A;  4IE0 A;  2BVM A;  2OLT A;  4U72 A;  4PNI A;  4YJ2 E;  3PUV F;  2LEH A;  1T7S A;  2C0S A;  4KP3 C;  4JI1 T;  1XMO T;  1W9R A;  4JUY A;  3E08 A;  1MND A;  3TLU A;  3RHW A;  5F3J A;  2YDS A;  1D1A A;  3QB5 A;  3RYI E;  2CPT A;  3AA7 B;  5ADX L;  1US7 B;  3AEB A;  3PJA A;  2XSB A;  5AQP B;  2V7K A;  4O2B E;  3B13 A;  1VCS A;  4PFO A;  5L3C B;  1E2A A;  4KI0 F;  4YLH A;  5LG4 A;  2FUP A;  3Q5D A;  2WU2 A;  4DV5 T;  1NAF A;  3ZKR A;  4P1N A;  3ZC1 A;  3ZPO A;  1IBK T;  4QH4 A;  3RQU A;  4JI3 T;  3HL6 A;  4ZZC A;  1E1H B;  1QUU A;  3ZYK A;  3AE4 A;  2JRK A;  3QOF A;  3RF1 A;  4TNV A;  3WAJ A;  3AEC A;  1YD8 G;  3FBZ A;  4LF8 T;  3FZK B;  3CPZ A;  1MMA A;  3QUJ A;  5ABF A;  1FJG T;  2YN6 A;  1LKX A;  5JQG E;  3NWI A;  4ZS3 A;  4B6X A;  2WDV A;  4HTE A;  4YY3 T;  2X0L B;  3E22 E;  5L2L A;  1CHU A;  1U5P A;  3F2E A;  5HXS A;  2A9U A;  1VOM A;  2CLY B;  3PUX F;  2K24 A;  4AIU A;  1HCI A;  1VRB A;  1J5E T;  1U4Q A;  3AAA B;  3PUA A;  2FJB A;  2YKS A;  5JDF A;  2UXB T;  2UUA T;  2QYW A;  2J62 A;  1FEW A;  3LFM A;  2PJQ A;  1UUS A;  3MA9 A;  3F57 A;  2GK9 A;  2W4X A;  1X79 A;  5LHH B;  3R6N A;  4QHO A;  5LOV E;  2QA7 A;  3CK6 A;  1B7T A;  3OBV E;  2MAW A;  2BG9 A;  3O9X A;  3KVA A;  4DID B;  3K3Q C;  4GOU A;  4FJO A;  5F5W A;  3EDV A;  3O4X E;  4LF9 T;  2MBG A;  4HWH A;  3H3M A;  3V5U A;  5LG3 A;  2N9D A;  2NR4 A;  3A8Y C;  2LHN A;  2D5U A;  3AXJ B;  3HKC E;  4KX6 A;  4AKH A;  2WWU A;  2XSA A;  5C8Y E;  5LXT E;  2XQY A;  4EAH A;  3J9X 1;  1XDO A;  4YHH T;  3AEG A;  4AQY T;  2KND A;  4Z90 A;  2ZLY A;  5EZY E;  4OYJ A;  2PG8 A;  5JRC B;  3T1H T;  5FXZ A;  5JDG A;  1D0Y A;  3AE5 A;  4DR5 T;  4DUY T;  1WR0 A;  4I4T E;  4U31 A;  1HNZ T;  5FP3 A;  5LHG B;  2RP4 A;  4HFH A;  3IA3 A;  4CN4 A;  3AA1 B;  4CI2 B;  3RIU A;  4XBF B;  2VUR A;  4B3R T;  3FXE B;  2KZ7 B;  3EUH A;  4DR1 T;  2YOE A;  4EB6 E;  1Z0P A;  2IIU A;  2X0Y A;  2Y48 B;  3EAM A;  3TKL B;  3N9N A;  4JI2 T;  4JI0 T;  4UF0 A;  4X20 E;  4KHP T;  4A97 A;  2G0U A;  4EIW A;  4DV1 T;  1HG5 A;  5AQH B;  4YXD A;  4DR3 T;  5HXE A;  4HWF A;  3BQI A;  3OTO T;  5ABE A;  4JEH B;  3ZJ2 A;  2KXP B;  1OED E;  3EDU A;  2CMR A;  4ZXL A;  3KVB A;  1KK7 A;  2I6H A;  3C4X A;  3ZJ1 A;  2WMO A;  3ZMS B;  3PUG A;  4PJL A;  2ZM8 A;  3RX6 A;  3AEA A;  4UIG A;  3A7M A;  2V1D B;  3EI0 A;  1BR0 A;  3OYZ A;  5A1L A;  2BKN A;  3JAF A;  5LYJ E;  5DQW A;  5BR8 T;  2L3L A;  2JQH A;  1WYB A;  2XAJ B;  4BAY B;  2MPK A;  3FXD B;  1IJ6 A;  3ZT5 A;  5AQU B;  2ZM0 A;  3GWH A;  2X9H A;  2H7V C;  4X5T A;  3PTR B;  2X0H A;  2XJ7 A;  3P4P A;  2MOZ A;  4LFB T;  4NXN T;  4CN1 A;  3MKD A;  4YJ3 E;  1NWM X;  4DR6 T;  4EYU A;  2YDQ A;  4KMC A;  1N36 T;  1IBL T;  1N32 T;  3OKQ A;  1QSD A;  4HFE A;  2WZI A;  2N2N A;  2WP9 A;  2M6I A;  3ZMV B;  3RYH E;  5CA0 E;  1IBM T;  2CXL A;  2R6G F;  4EYY R;  3LK4 2;  5JDM A;  2W0G A;  2BVL A;  4GK0 E;  2IML A;  2LOP A;  3N9Q A;  1MMG A;  4ZEY A;  3C4Z A;  5M4Y A;  5AQT B;  3L8R A;  2XQ6 A;  5KMG P;  2F4V T;  5ABG A;  3EAB A;  5AQO B;  5IUX A;  3AAE B;  3PUZ F;  3UFG A;  4HFI A;  1XZY A;  2W61 A;  3OYX A;  3P4Q A;  1S35 A;  2IC6 A;  5HAX A;  5LJM A;  3KV4 A;  1G8X A;  2DL1 A;  2BG9 C;  5EK4 A;  1NEK A;  2YEV C;  3FBL A;  2Y8D A;  1QLB A;  2V26 A;  3KBT A;  2K48 A;  4NUU A;  4PW8 A;  4AKL A;  2RA1 A;  2XQ7 A;  2WB5 A;  5FKY A;  3AAI A;  5LMU T;  2VKD A;  3ZN0 B;  4IIJ E;  3AE2 A;  3WI3 A;  1Y01 A;  2NTX A;  1FMW A;  2CRB A;  2VL8 A;  1O3X A;  3P7I A;  3RC8 A;  2JJ9 A;  3JAE A;  4LF7 T;  2H3R A;  3ZLI A;  2V7J A;  4AXP A;  2X51 A;  3JC6 D;  1OED B;  4UVB B;  4OX9 T;  2JPF A;  2NTY A;  4U2Z A;  2ZM2 A;  4U74 A;  3ZYL A;  5L3B B;  5JDQ A;  5HEU A;  4A98 A;  3A5X A;  1LVK A;  3IEE A;  4HWI B;  2LM9 A;  2QGS A;  2X9W A;  3LSV A;  5JH7 E;  2BS3 A;  4QH1 A;  5DJQ C;  5FY0 A;  5KDM C;  4C91 A;  3CQX C;  4HFV A;  3ZT7 A;  3X1D A;  2LSJ A;  4U33 A;  4MAL A;  2FJA A;  4HE8 A;  4I43 B;  5EK2 A;  4UVA B;  3RIF A;  4PK5 A;  3ONX A;  4PK6 A;  3AA6 B;  4IST A;  5HXH A;  2V7I A;  3FB2 A;  1J1J A;  1YQ3 A;  2CBI A;  4CN6 A;  5LMN T;  4O2A E;  2X67 A;  3GN5 B;  3PE0 A;  1YKH B;  2VQE T;  4I50 E;  2XAF B;  4GKJ T;  3HA4 A;  2ES0 A;  2VKO A;  4G63 A;  2VVN A;  2HN2 A;  3UUN A;  4IDQ A;  4IE4 A;  4K0K T;  3RYF E;  5L3F B;  1KNP A;  2Q9Q A;  1I94 T;  4UEL A;  3RLF F;  2V5C A;  1WYC A;  3P50 A;  4COF A;  2JQK A;  2BKP A;  2I0M A;  2WU5 A;  2QVA A;  3P4R A;  1MNE A;  2ODU A;  5CGM A;  4PAG A;  2IUB A;  3ANW B;  2C5J A;  1W09 A;  3NZQ A;  1T8B A;  2BKO A;  3RIA A;  5LGN B;  3NZP A;  3GA8 A;  2A3D A;  3AB3 B;  2LSI A;  3FZL B;  4QH5 A;  4P09 A;  3JC6 C;  3C98 B;  3EVY A;  2WQY A;  2E9X B;  1MMN A;  2B76 A;  3RKO A;  3BK9 A;  3PU3 A;  2FBW A;  3J7Y q;  2UU9 T;  4UR9 A;  3LBX B;  5LGU B;  4UVC B;  5FVL A;  3OVU A;  1D1B A;  4UXN B;  2V7M A;  4CXW A;  2CLY C;  4C90 A;  4NXM T;  5DAB A;  3H37 A;  4O4I E;  1UUR A;  3VHL A;  2KWH A;  5HWX A;  1UX4 A;  2WBL A;  4PJJ A;  4FI5 A;  4LF4 T;  2UUC T;  5AQM B;  5LB7 B;  3UT5 E;  3LDQ B;  5JRE A;  2EHO B;  2Q9Q D;  3NBX X;  2UXX B;  3LJC A;  4I0U A;  4TWF A;  5L4E A;  2M6B A;  3QC9 A;  3F31 A;  2CBJ A;  2XM1 A;  3MAC A;  3KV9 A;  1WCR A;  3JCF A;  4ASK A;  5LP6 E;  5FL1 A;  4DV3 T;  2XY8 B;  3Q9D A;  2VAS A;  2XAG B;  3CX7 B;  5EK3 A;  4WYV A;  3HR0 A;  5HEH A;  3ESL A;  3UU5 A;  2KSR A;  3AVS A;  3K1S A;  3AEE A;  4AKR B;  4CI1 B;  4O8S A;  3KIN B;  2LT3 A;  2VK9 A;  3B5M A;  4PJM A;  4BA9 A;  2XZE A;  1YQ4 A;  2CE7 A;  2WY2 A;  4IHJ E;  1OED A;  1UX5 A;  3C51 A;  2H7O A;  2JQ9 A;  2VWA A;  5LBM A;  2PFV A;  4H63 H;  1NEN A;  2CEA A;  1WRD A;  5AQG B;  2LRK A;  1D0X A;  1HX1 B;  2NOX A;  2LKH A;  4IL4 A;  3ZCJ A;  2E5L T;  4L0R A;  5HXR A;  4KBM B;  3ZSS A;  2K5B B;  4B3M T;  3RGL A;  3PDY A;  4L5G A;  4DUZ T;  4X62 T;  2UUB T;  3ZST A;  5LNK A;  2D9D A;  3ZT6 A;  1I6Z A;  5CB4 E;  5HCM A;  4JI5 T;  3I0Q A;  5CFB A;  4MFR A;  2YU1 A;  5LA6 E;  4YT0 A;  3SWH A;  4TN7 B;  2DLR A;  4AKG A;  2UXN B;  3GN5 A;  2VB6 A;  2HPL A;  3AE1 A;  2WWV A;  4OYK A;  4X1Y E;  4DVD A;  5CJ5 A;  3PUY F;  4I55 E;  4EED A;  3O1I A;  2IHR 1;  2VL0 A;  2NWB A;  1G73 A;  2D2S A;  3WAK A;  2H88 A;  5FXX A;  2KIN B;  2D0U A; 
#chains in the Genus database with same CATH homology
 2A72 A;  3IHR A;  1D0Z A;  3MK7 C;  4IE0 A;  2Q9Q B;  5EK4 A;  4DND A;  4EOZ B;  1KNZ A;  3M65 A;  2BVM A;  2YEV C;  3K3O A;  2WAU A;  4Z8X A;  3O1J A;  3FBL A;  4U72 A;  4V1A v;  2XHE B;  4QWN B;  4PNI A;  1HF8 A;  4YJ2 E;  2Y8D A;  1H7C A;  2LEH A;  2V26 A;  5FYM A;  3KBT A;  2K48 A;  2C0S A;  4KP3 C;  2P9B A;  4NUU A;  4BJM A;  2XUE A;  3N2O A;  4PW8 A;  2MTQ A;  2C5I T;  1SA0 E;  4AQG A;  4GIW A;  4JUY A;  4H9P C;  4AKL A;  3E08 A;  4M1P A;  2RA1 A;  1MND A;  3FHN A;  4ZOL E;  3AAI A;  4CZZ B;  5F3J A;  4QKN A;  1D1A A;  2VKD A;  2KMF A;  2V7L A;  3C4W A;  3ZN0 B;  4AQF A;  3RYI E;  4UV8 B;  5CA1 E;  4AI6 A;  3ANW A;  3AA7 B;  4OHF A;  4QX7 B;  1US7 B;  5J1G A;  5ADX L;  4IIJ E;  2V7K A;  3WI3 A;  4O2B E;  1S94 A;  2LSG A;  2WSS V;  3B13 A;  4PFO A;  4JEU B;  3W15 B;  5L3C B;  4CXY A;  4QXB B;  2NTX A;  4YLH A;  5LG4 A;  1FMW A;  4CI3 B;  2DWG A;  3C64 A;  4H9Q C;  3QK6 A;  3ZN1 B;  2VL8 A;  1NAF A;  1O3X A;  3P7I A;  3RC8 A;  3IF8 B;  2JJ9 A;  3ZC1 A;  3PU8 A;  1LRZ A;  2H3R A;  3ZLI A;  2V7J A;  3ZPO A;  4AXP A;  2X51 A;  2KT9 A;  1ZV4 X;  3JC6 D;  4JLE A;  2VKH A;  4UVB B;  2E9X A;  5TAO A;  2XAQ B;  3C50 A;  1T98 A;  2JPF A;  2NTY A;  3HL6 A;  2NW9 A;  2VKJ A;  2WM9 A;  1E1H B;  1QUU A;  3ZYK A;  1IZN B;  2DWK A;  4H9O C;  5HWY A;  2K9A A;  2ZM2 A;  2JRK A;  4U74 A;  1MMD A;  3HKD E;  4EZ4 A;  3ZYL A;  5L3B B;  4EZH A;  5JDQ A;  3DJB A;  4ISS A;  4WW0 A;  5JR9 A;  3ZMZ B;  3LBX A;  2CA5 A;  3A5X A;  1LVK A;  3DTO A;  3IEE A;  2JMK A;  2LM9 A;  2QGS A;  2X9W A;  1YD8 G;  2CXD A;  3FBZ A;  3NRX A;  4QXC B;  4DMV A;  5JH7 E;  1BR4 A;  3LG7 A;  3RRW A;  3CPZ A;  2X66 A;  4ZHQ E;  5JDH A;  2IW5 B;  1MMA A;  4WBN E;  3QUJ A;  5DJQ C;  5FY0 A;  5GON E;  5KDM C;  2Z6E A;  5JDN A;  2N1G A;  4C91 A;  3CQX C;  4ZI2 C;  1LKX A;  4HFV A;  4E7Z A;  2LSJ A;  5FXW A;  2X9Y A;  1WLX A;  4ANJ A;  3ZCI A;  5JQG E;  3E0Z A;  4MAL A;  4HE8 A;  4I43 B;  4O4H E;  4ZS3 A;  4B6X A;  3KBU A;  3CKD A;  4XZC A;  3I9Y A;  4DO0 A;  4HTE A;  5EK2 A;  4UVA B;  3LK2 B;  3AVR A;  2X0L B;  3E22 E;  3ONX A;  4PK5 A;  4TV8 E;  5L2L A;  4PK6 A;  3AA6 B;  4ZI7 E;  4IST A;  1U5P A;  5HXH A;  3U3I A;  3F2E A;  2V7I A;  3FB2 A;  5HXS A;  3RC3 A;  1VOM A;  2CLY B;  2CWY A;  1WR6 A;  2K24 A;  2E8I A;  1HCI A;  1VRB A;  3ETU A;  3HKB E;  2XAS B;  4O2A E;  2X67 A;  4MBQ A;  3GN5 B;  1U4Q A;  1YKH B;  2CCQ A;  3AAA B;  3PE0 A;  3N9M A;  3PUA A;  2XAF B;  3KFW X;  4I50 E;  2Q9Q C;  4XAX B;  3PUR A;  3HA4 A;  2EHO A;  2ES0 A;  1HX8 A;  2LSY A;  5JDF A;  1SHZ C;  2VKO A;  4OK0 A;  4G63 A;  1ZEE A;  3N5L A;  1FIO A;  1FEW A;  3UUN A;  3LFM A;  2PJQ A;  4IE4 A;  3MA9 A;  3F57 A;  2GK9 A;  5LJN A;  1X79 A;  3UUL A;  5LHH B;  3R6N A;  1LVF A;  4YHJ A;  5L3E B;  3RYF E;  4QHO A;  5LOV E;  4EXT A;  5H6Q B;  3Q2M A;  1OWA A;  5L3F B;  2Q9Q A;  4UEM A;  2QA7 A;  4UEL A;  4DBR A;  3O1H A;  2HH7 A;  4K0U A;  1B7T A;  3OBV E;  1WYC A;  4P0B A;  4PK4 A;  3O9X A;  3KVA A;  3CX6 B;  3N9L A;  1UCU A;  3K3Q C;  3I0O A;  4GOU A;  4FJO A;  5IYZ E;  3EDV A;  3I9W A;  3O4X E;  1BR2 A;  1AJ3 A;  2MBG A;  5AFU L;  3V5U A;  3GMI A;  4F6R C;  1IAP A;  2N9D A;  2LHN A;  2D5U A;  4QX8 B;  3HKC E;  4N78 D;  4GK5 E;  2J1D G;  3RPU A;  3UFE A;  4AKH A;  4GYR A;  2WWU A;  5FY7 A;  1MNE A;  2ODU A;  2IC9 A;  5C8Y E;  5LXT E;  3WAJ A;  2XQY A;  4EAH A;  4PAG A;  3J9X 1;  2NW8 A;  5LCY A;  2W00 A;  3ANW B;  2C5J A;  2X9X A;  5FNV E;  3NZQ A;  1CUN A;  2DCF A;  3MZK B;  3Q5W A;  2KND A;  5LGN B;  3NRY A;  2ZLY A;  2M67 A;  2XTL A;  3NZP A;  3GA8 A;  5EZY E;  2E9X D;  4OYJ A;  2PG8 A;  2ZMA A;  5JRC B;  2A3D A;  2LHR A;  3AB3 B;  5FXZ A;  2LSI A;  5JDG A;  4P09 A;  3AA0 B;  1D0Y A;  4NUV A;  2ODV A;  3KV6 A;  3U78 A;  3UTK A;  3JC6 C;  3C98 B;  4J2C A;  1HTJ F;  5L3D B;  2HPJ A;  4H9S E;  3EVY A;  4I4T E;  3CML A;  4X1I E;  4TX5 A;  5JDL A;  3S4U A;  5FP3 A;  2E9X B;  5LHG B;  2RP4 A;  1MMN A;  2LOS A;  3H3A A;  1BR1 A;  2DNX A;  1YW0 A;  4GYS A;  3RKO A;  3BK9 A;  3AA1 B;  3PU3 A;  4CI2 B;  4XBF B;  2CM0 A;  2DI4 A;  1HS7 A;  3J7Y q;  3FXE B;  5H6R B;  3UUM A;  2KZ7 B;  3PUQ A;  3SOL A;  3EUH A;  4EB6 E;  5JR9 B;  2W62 A;  1ZKE A;  3CQC B;  3LBX B;  3P8C D;  4G2A A;  3MJX A;  5LGU B;  4UVC B;  1MIW A;  1Z0P A;  2BZB A;  1D1B A;  1FMV A;  2JMH A;  5L3G B;  4UXN B;  2YK0 A;  5DQV A;  2V7M A;  4HKA A;  4MLK A;  3N2K E;  2OA5 A;  2Y48 B;  4CXW A;  4H63 V;  3TKL B;  3ETV A;  3N9N A;  2CWO A;  2MYS A;  4ZI3 D;  1MIY A;  2CLY C;  4UF0 A;  4X20 E;  4C90 A;  1V9D A;  5DAB A;  2G0U A;  4EIW A;  1HG5 A;  3I1A A;  2JQQ A;  4QXH B;  5HXE A;  3H37 A;  4MHC A;  5KX5 E;  3OJA A;  3BQI A;  4O4I E;  4PJN A;  5IHY A;  3VHL A;  3VKG A;  2NW7 A;  2KWH A;  2EHO D;  5HWX A;  1IJ5 A;  3MXZ A;  4P0A A;  1UX4 A;  5LBQ B;  2IAK A;  1YKE B;  4JEH B;  2LE8 A;  2WBL A;  3DP7 A;  4PJJ A;  4FI5 A;  1EZ3 A;  5HYA A;  3CQG B;  3ZJ2 A;  2KXP B;  3EDU A;  2LJL A;  3UT5 E;  4X1K E;  2L8K A;  5JRE A;  3ZMU B;  2EHO B;  2CMR A;  4ERR A;  2Q9Q D;  3NBX X;  2UXX B;  3VKH A;  3LJC A;  3V5S A;  3KVB A;  1KK7 A;  3QC9 A;  5FMN A;  3F31 A;  2SPC A;  2A2F X;  4ILU A;  2WMN A;  3MAC A;  3C4X A;  4CXX A;  3CVR A;  4KUM B;  3KV9 A;  4IE5 A;  3L09 A;  3ZJ1 A;  2BDE A;  2WMO A;  3ZMS B;  4ASK A;  3KV5 A;  3PUG A;  4PJL A;  5LP6 E;  2ZM8 A;  3D0T A;  3RX6 A;  4AQF C;  4UIG A;  2V1D B;  3Q9D A;  2VAS A;  3Q5X A;  2XAG B;  4HGA A;  3BQK A;  1BR0 A;  2NP9 A;  3CX7 B;  3OYZ A;  3SS1 A;  5A1L A;  4CQI A;  5EK3 A;  3HR0 A;  3RRC A;  3ESL A;  4O4J E;  4IE6 A;  3HI2 A;  5LYJ E;  3LK3 B;  3AVS A;  5DQW A;  4AKR B;  4CI1 B;  4O8S A;  2C5K T;  3KIN B;  2LSK A;  2LT3 A;  2L3L A;  3ZMT B;  1WYB A;  2XAJ B;  2Y6X A;  1MIV A;  4IE7 A;  5FY1 A;  4BAY B;  3FXD B;  2VK9 A;  2XAH B;  1IJ6 A;  4WNK A;  2ZM0 A;  4PJM A;  3GWH A;  4HEA A;  2X9H A;  4BA9 A;  2H7V C;  3K8P C;  2E9X C;  3PTR B;  4BJN A;  5HXC A;  5JRC A;  3R84 B;  3SRZ A;  2CE7 A;  3CWZ B;  3PUS A;  4H9N C;  4IHJ E;  5F8P A;  4TUY E;  3T8O A;  1UX5 A;  3UUX B;  4TZ4 C;  5JVD E;  4ZS2 A;  3C51 A;  3IBP A;  4ADZ A;  1OXZ A;  2D0T A;  3HKE E;  5JR9 C;  2H7O A;  2L9Q A;  2MOZ A;  4UV9 B;  2VWA A;  5LBM A;  3N2G E;  2PFV A;  4H63 H;  3KDS E;  2CEA A;  4YFS A;  1WRD A;  3MKD A;  4A56 A;  3RH3 A;  5J2U E;  4YJ3 E;  1NWM X;  4EYU A;  4PFP A;  4HN9 A;  1D0X A;  2B1E A;  5FXV A;  4KMC A;  2NOX A;  3ZCJ A;  4L0R A;  5HXR A;  1HG2 A;  3OKQ A;  1QSD A;  4IDZ A;  4KBM B;  4E7S A;  3BQL A;  2N2N A;  2PBI A;  4H9R C;  2K5B B;  2YIN A;  2YU2 A;  3ZMV B;  3ZEF B;  3RYH E;  2CXF A;  3PDY A;  4L5G A;  5CA0 E;  5BMV E;  2KWI B;  2CXL A;  3ZYM A;  4AKI A;  3K3N A;  4EYY R;  2ACX A;  4ZI2 D;  2W63 A;  5ETW A;  3LK4 2;  4TV9 E;  4ZI3 C;  4IGU A;  5LNK A;  5JDM A;  1ZHC A;  2W0G A;  2BVL A;  5CB4 E;  3N9O A;  4UF0 B;  3L3P A;  4GK0 E;  3VU7 H;  3I0Q A;  2KLQ A;  3CX8 B;  4L9I A;  2LOP A;  3N9Q A;  5E0O A;  4MFR A;  2YU1 A;  5LA6 E;  1MMG A;  3C4Z A;  3SWH A;  5M4Y A;  5J2T E;  2X68 A;  2EHO C;  4TN7 B;  2DLR A;  5KMG P;  5LHI B;  4AKG A;  2UXN B;  3GN5 A;  2VB6 A;  2HPL A;  4OYK A;  4X1Y E;  1D1C A;  4DVD A;  5LGT B;  4I55 E;  4DMW A;  2I59 A;  3AAE B;  1Y64 B;  3O1I A;  1HFA A;  4WBO A;  4DBQ A;  3ZC0 A;  4O4L E;  3B57 A;  3N9P A;  2W61 A;  3OYX A;  3RYC E;  2NWB A;  1S35 A;  2DHR A;  1G73 A;  2D2S A;  2IC6 A;  5HAX A;  5LJM A;  3WAK A;  5FXX A;  2KIN B;  4OFZ A;  3KV4 A;  2D0U A;  1G8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...