4H9RC

Complex structure 5 of daxx(e225a)/h3.3(sub5,g90a)/h4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
b'RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQAARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 74
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9rC00
5KDMC 4HGAA 4H9RC 4H9SE 4H9NC 4H9PC 4H9QC 4H9OC
chains in the Genus database with same CATH superfamily
4OYJA 5M4YA 2X51A 2I6HA 3AEGA 5HEOA 3Q2MA 2RPAA 1JNRA 3AVSA 3UT5E 1Y01A 2WDQA 2MBGA 2IC6A 2FJAA 3AEAA 2WU2A 3V5UA 2NW9A 3N9LA 5A1LA 1QUUA 2XUEA 4DR1T 4C91A 4QKNA 3AB3B 3ONJA 2MTQA 4HFEA 2MOZA 1VRBA 4G63A 5LG4A 2VKJA 4EEBA 2XQYA 3C4WA 3ZLIA 2WAUA 2JJ9A 4EB6E 2M67A 1D1AA 2VB6A 3FZKB 3H3MA 2JMHA 4ASKA 1T98A 3L3PA 3QNUA 1ZEEA 3ZSSA 4BJMA 4PFOA 2HN2A 2LEHA 1M7KA 4M1PA 2D9DA 2X66A 1J5WA 1YD8G 3CIRA 4ZOLE 5ABHA 2YEVC 2HH7A 2KT9A 5JDGA 4X62T 3A5XA 2VQFT 2DI4A 2XQ9A 4H9OC 1N33T 1L0VA 4AXPA 4EXTA 4O2AE 2E5LT 4YJ3E 2XTLA 1D1CA 5FXVA 5CGMA 4XAXB 3ZC0A 3T1HT 2X9XA 2OV9A 4YTPA 2UXXB 1UCUA 2OLTA 3QC9A 4QH5A 5C2TA 4F6RC 4PNIA 4EYUA 3GN5A 2UUAT 4JI6T 3TLVA 4EOZB 2WS3A 2VL8A 2JQHA 1MIWA 2SPCA 2RP4A 2K48A 1OWAA 3IBPA 5L4EA 4HEAA 2HN1A 3P50A 5AQTB 3DP7A 3O4XE 2V26A 2LRLA 3CK6A 4GK0E 2BG9C 4PFPA 2OA5A 3FZMB 3I9WA 4G2AA 3ZMZB 4OYKA 3LSVA 1MMDA 3RQUA 4DO0A 3ONXA 4X20E 5F5WA 2WQYA 4H9PC 5JRCA 2KWIB 3CVRA 2KNDA 4KBMB 5LB7B 5GONE 4HWDA 2VVNA 3K3NA 2H7VC 3L8RA 3UUBA 4CXWA 2DLRA 2HPLA 4QH1A 3OYZA 3NRYA 5EK2A 5L2LA 1XWMA 2J62A 2CPTA 4IL4A 1SHZC 1MNDA 3CQCB 1S35A 3WAJA 3E08A 2Q9QC 4B3TT 2C0SA 3PUAA 5AQPB 3AA7B 2V6YB 3IA3A 3ZC1A 3VU7H 3ZYLA 3VRAA 4AISA 2JIWA 4X5TA 2E9XB 4HWCA 3Q9DA 3KV6A 1IBKT 4ISTA 3P4QA 2ZMAA 2ES0A 3PUSA 3AXJA 4PAGA 4BJNA 3SFDA 2WZHA 1HTJF 3ZN0B 4U7IA 3MKDA 2BG9E 1YW0A 3RQWA 1T72A 4YSXA 3RGLA 2XSAA 4AKLA 4JUYA 3RKOA 2EHOB 3NVOA 4ZI7E 5HEHA 4IE6A 2QGSA 2J1DG 3L09A 4AQYT 3RYHE 3GA8A 4AI6A 3C4ZA 4PJNA 2UUBT 3AEEA 3AAIA 4YY3T 3R6NA 3AEDA 2W66A 2M6IA 1E2AA 2B1EA 5FY7A 3HI2A 2XAJB 1BR4A 2BS4A 1AJ3A 3RX6A 1UGOA 3VHLA 5HXHA 1O3XA 3UQ7A 2QVAA 4O8SA 5JDMA 3TLSA 5IUXA 2V7LA 3B13A 3DJBA 3P4RA 3ZMVB 2LKGA 5AQLB 1FJGT 4XBFB 2CLYB 1FEWA 2XAHB 4TNVA 2V6XA 2LSGA 1IZNB 5JREA 5DJQC 4I4TE 2BVMA 2WY2A 4UF0B 5F8PA 3ZT6A 4QXHB 2IIUA 3CWZB 2YDQA 4NIQA 4HE8A 3MXZA 1KFYA 4MLKA 3P4PA 3UFEA 3ZMTB 2PBIA 3EI0A 1HX8A 2KSRA 2XAQB 2BBJA 3O9XA 5AQOB 3RRCA 5FVKA 4H9NC 5LG3A 2ODUA 1HCIA 2W2UA 2VKHA 3G06A 3K3OA 4KI0F 4DMVA 5AQJB 2BVLA 1KNZA 2D5UA 4YXDA 5FMNA 4DVDA 5JR9A 3NRXA 2CEAA 3P7IA 2H88A 5FXXA 2XAFB 4IE0A 2L9QA 2AE9A 1HNZT 4JI7T 2D0TA 3LK42 4P0BA 3HKCE 2H3RA 3N9MA 4U74A 4IREA 2V1DB 4B3ST 2E5VA 3E22E 2IUBA 4HTEA 2W4XA 3SWHA 1BR1A 1M62A 3FXDB 4EEDA 2WM9A 2A72A 2ZM0A 5HCJA 3F57A 5EK3A 4ZI3D 4JLEA 2VQET 4LF9T 4YHHT 2ZLYA 4CXYA 4B6XA 3ZT7A 4OX9T 3LG7A 4L9IA 2XQ5A 2XASB 3B5MA 3BQKA 3W15B 2IDOB 3MJXA 4YFSA 3EABA 3AA0B 3KBTA 2X68A 2W0GA 4U33A 3UUNA 3FZHB 1UURA 5BR8T 4X66T 2VASA 4XZCA 3PURA 1FMWA 2HPJA 1YKEB 4AKGA 4WYVA 5LJMA 2VK9A 5LHGB 1OEDC 5FY1A 2UUCT 4KMCA 2ODVA 4PK6A 3GMIA 2K24A 3F2EA 4HKAA 3B57A 2I0MA 1S94A 2W62A 5AFUL 3Q5DA 3P4WA 5AQRB 3UU3A 1SUMB 4GYSA 3MK7C 2V6YA 4ILBA 1WYBA 2IAKA 4UELA 2DHRA 4ZI2D 1D0XA 4UVBB 2CBJA 2NW8A 4JV5T 4CZZB 4JYAT 2L3LA 3Q5XA 4JI2T 5EK4A 3RYCE 3AE7A 4YLHA 4MHCA 3LK2B 5JVDE 4GIWA 3IF8B 2BZBA 2BG9B 2YU1A 3RH3A 3CX8B 3ZEFB 1MMAA 3J9X1 3UUXB 2J47A 4K0UA 5FKYA 1JNZA 3J7Yq 3PUVF 2EHOA 2V7KA 3RIUA 3OTOT 4QX8B 3RYIE 4IE5A 1LKXA 4EZ4A 3A8YC 1N36T 4JI3T 4LFAT 3N9OA 3T1YT 1IJ5A 4U3CA 4JI1T 4HN9A 4JEHB 5LMNT 3KVAA 4JI8T 1OEDE 3PJAJ 3I0OA 5FL0A 3V5SA 3AE6A 3HKEE 4X65T 2CBIA 1W09A 4FJOA 1HG5A 2KLQA 2Q9QB 4DMWA 3JAFA 1R8IA 2I59A 2WSSV 4IDPA 5LHIB 3QB5K 5LGUB 4QXBB 3K1SA 2AXDS 2ZM2A 2CRBA 4IE7A 4MALA 3PUZF 1VOMA 2WDVA 5H6RB 3A7MA 2NP9A 4UF0A 1B7TA 2FUPA 4AQFA 4HFCA 3N9QA 3LBXB 3RI5A 3ZKRA 3OBVE 4Q25A 2BKNA 3VRBA 2HHHT 2X0LB 1XDOA 4QH4A 4COFA 5JDLA 3RKGA 2WWVA 4DV7T 5IWAT 1HX1B 1KF6A 3KVBA 4TUYE 3RYFE 1NENA 5EZYE 4A97A 1GQEA 4QXCB 1W0BA 4KHPT 2XM2A 2VL0A 3EDVA 3RLFF 3U3IA 1ZKEA 5AQGB 4B3MT 1UX5A 4KHZF 4ZXLA 5HEJA 3ABVA 5J1GA 4GK5E 1J1JA 3ZYKA 1FMVA 1DU2A 4PW8A 2BBHA 3PUYF 4DV3T 2LRKA 3SS1A 4ANJA 2MYSA 4H63H 4NUVA 1VCTA 1XDPA 1ZP0A 2WB5A 3Q5WA 3N2KE 2CHNA 1LRZA 2NWBA 4YTMA 4EGWA 2YDRA 2LJLA 5AQUB 1ZHCA 3CQXC 2KINB 4PJMA 2ACXA 2X0HA 1HNWT 3TLTA 2Y6XA 4ZZBA 5JDQA 3RF1A 2XAGB 3NBXX 2DNXA 2E2AA 5LYJE 2H7OA 4I0UA 3HR0A 5L3DB 3VKGA 1I94T 4YJ2E 1MMGA 2CCQA 4IDNA 1SE7A 3SRZA 4X1IE 2WMOA 4HGAA 1ZV4X 3PJAA 5HEGA 3DTOA 5L47A 1YQ3A 2Y8DA 3HA4A 5JR9C 4ILAA 4E7ZA 2WCAA 4MBQA 2E9XD 5HYAA 2JPFA 3ZJ1A 2CXLA 5JDNA 2X9WA 5L3FB 4X1KE 3AAAB 4YSYA 4UEMA 5HWXA 2M6BA 2UXNB 4JI5T 2B76A 4NUUA 4TX5A 3AAEB 1E1HB 3AEBA 3ZN1B 2EHOD 2X9HA 4ZZCA 3KDSE 1WYCA 4U7YA 3VR9A 1T8BA 3ZMUB 5KMGP 3JADA 1E7PA 3AEFA 1HF8A 3PE0A 4TN7B 3C50A 2LSYA 3CKDA 2JQ9A 2DWGA 4LF6T 4L0RA 2YK0A 3NZPA 4TV8E 4HFHA 3AE9A 5KDMC 3RIFA 4ISSA 3JAEA 1XMQT 4DIDB 3EAMA 1IJ6A 3N2GE 5LHHB 3QB5A 2XZEA 2R6GF 4CI1B 4GKJT 4WBOA 2BG9A 4ZEYA 2KXPB 3ZCJA 4UV9B 4H9SE 4TZ4C 3AECA 5AQMB 3H37A 4OK0A 2NW7A 4DV6T 4ILUA 1US7B 3L39A 3OPCA 4WZXA 3MA9A 5KXJA 3PUXF 3K8PC 4QX7B 1OXZA 3EVYA 3GWHA 4V1Av 4PK4A 5ABGA 3UULA 2A3DA 4YTNA 2XPKA 1OEDB 3UFGA 4X64T 4DUYT 1D0YA 3KBUA 3T8OA 1V9DA 5JQGE 1CUNA 3UU5A 1HFAA 3GN5B 4J2CA 4BA9A 4QHOA 3FZFB 3RC8A 2XQ8A 4AIUA 2Q9QA 4OFZA 5L3BB 1CHUA 2W63A 5HAXA 2GK9A 2DL1A 4IT4A 1YKHB 2CXDA 1WR6A 5AQKB 3H3AA 1VCSA 3RC3A 3RHWA 3BQIA 3O1JA 3LBXA 3I0QA 1WRDA 1NWMX 2NOXA 3RIUC 3N9PA 3FBLA 2N9DA 3HKDE 4ZS3A 5JRCB 3PU8A 5FYMA 4IDOA 4JEUB 3NKZA 3NWIA 4CN1A 1W0AA 4ADZA 3CMLA 3EUHA 3MZKB 4IGUA 4JI4T 1X9BA 2W67A 2C5IT 5LP6E 3IHRA 4YT0A 4O4HE 2BKPA 2WU5A 3BQLA 4OHFA 2XQ6A 4HFVA 1MIVA 4I55E 5HXRA 2LSJA 4U72A 4TWFA 3ETVA 1NEKA 1U4QA 3AE3A 2A2FX 4U2YA 1WR0A 3ZMSB 2ACZA 3AA6B 3ZPOA 4Z8XA 4O4JE 4KP3C 3ONLC 5J2UE 4E7SA 5L3GB 1Z8UA 2CWYA 3PUQA 2PFVA 4A98A 2N1GA 2V7IA 4HWIB 5E0OA 1KNPA 4LMKA 5ABFB 4UVCB 2MPKA 4DBRA 5FXWA 3EHZA 4IE4A 2V8SV 1HNXT 3OYXA 2FJEA 4AQGA 3C4XA 4I50E 2LKHA 2VWAA 1LVFA 2E9XA 1MNEA 4DR4T 4CN4A 3M65A 2UXCT 3I1AA 4CQIA 3UU8A 3ANWB 1W9RA 4PJJA 4UR9A 3D0TA 5LMUT 2UXBT 2J4GA 4A5XA 3PU3A 3UUMA 2LM9A 3N2OA 4DUZT 4LF4T 4LFCT 2G0UA 4DR7T 4DR2T 3QUJA 2UXDT 2QYWA 2RA1A 3K3QC 4ZI3C 2WWUA 2K3WA 2QRXA 3CQGB 4IL9A 1WLXA 1YQ4A 1ZOYA 2YINA 4IIJE 5AQNB 3AA1B 2XQ7A 3PUWF 4GOUA 5DQVA 5LXTE 4H9RC 4IHJE 4NXMT 5AQQB 5FY0A 3SFEA 2FJDA 5JH7E 3WAKA 2ZM8A 2V5CA 4LFBT 4C90A 5LJNA 4EZHA 4H63V 5L3EB 5LOVE 3ZT5A 1N34T 3E0ZA 3PV0F 2NR4A 2E8IA 4KX6A 2V7JA 3TKLB 3P4SA 2Q9QD 1UK5A 2PTFA 3ZSTA 1LVKA 3AE5A 1HG2A 5C3JA 1UX4A 3AE8A 5JR9B 2Z6EA 5DQWA 1IBLT 1U5PA 5HCMA 3BK9A 2VKDA 4UXNB 4H9QC 2BDEA 3UU6A 5AQFB 3KV5A 3KINB 2CMRA 3X1DA 3PDYA 4I43B 1OEDA 4ZI2C 4CI3B 1KK7A 4AKRB 3KV9A 3AE2A 2IMLA 4UV8B 2LSIA 2XQ4A 2PJQA 4LMLA 2BS3A 5FXZA 3FXEB 5LNKA 2LOPA 2JQKA 2WMNA 2X67A 5IHYA 2C5KT 4Z90A 2H89A 4A56A 2LHNA 1Z0PA 3Q5EA 4HWFA 3CPZA 5HXEA 3FHNA 3UTKA 2P9BA 1XMOT 2VURA 2WDRA 4ZHQE 3KV4A 4ZS2A 3FBZA 2WZIA 2BS2A 2LE8A 5L4HA 1UUSA 3FB2A 5CJ5A 4EIWA 4U31A 3QOFA 4GKKT 4DV2T 2YKSA 4IDZA 4NPPA 1X79A 4ERRA 3IEEA 4WNKA 4P09A 3AVRA 2FBWA 2XJ7A 2CE7A 1MMNA 3N5LA 3O1HA 1G73A 4ILCA 5ETWA 4CXXA 5LGNB 1KNRA 2JMKA 5LBQB 2FJBA 3WI3A 4DV0T 3CX7B 4PK5A 4CN6A 4TWHA 1XNQT 2K5BB 2ZM6T 4GYRA 1QSDA 4HWHA 5C8YE 4AKIA 2A9UA 3I9YA 4EYYR 2VVSA 4MFRA 2YU2A 4O4LE 3HKBE 5F3JA 2KWHA 5FVLA 4EAHA 3ESLA 2JQQA 3P8CD 2KZ7B 3U78A 2XSBA 4HFDA 3MACA 2DWKA 5ABFA 1HS7A 4P0AA 2IW5B 1T7SA 5CB4E 5TAOA 2X9YA 4DV4T 5BMVE 2WP9A 4TNWA 5AQSB 4LF5T 5AQVB 3R84B 3KFWX 5CA1E 1WFDA 3VKHA 3ANWA 2CWOA 2XM1A 2XQ3A 3PTRB 4O4IE 2LT3A 4F8HA 5AQHB 3S4UA 2UU9T 4TWDA 3N9NA 3F31A 1EZ3A 2W61A 3CX6B 4KUMB 2D0UA 1IBMT 2PG8A 4PJLA 2CHOA 5AQIB 2V7MA 4DBQA 2YN6A 4DR5T 2VKOA 4HFIA 5CFBA 3SOLA 3JC6D 4AKHA 2KMFA 5FNVE 3RPUA 1HR0T 2X0YA 3RIAA 1FIOA 5FL1A 3OKQA 2Y48B 3C98B 1J5ET 4HFBA 2MAWA 4DR6T 1QLBA 2IC9A 2E9XC 2XY8B 2W00A 5LA6E 4JI0T 2LHRA 2C5JA 3QK6A 3OVUA 3UQ4A 4P1NA 4U2ZA 4YSZA 3JCFA 4Z91A 3EDUA 3ZYMA 1IAPA 2LOSA 5LBMA 2IHR1 4DV5T 1H7CA 2CXFA 4DV1T 2DCFA 4CI2B 2K9AA 2BKOA 3UU4A 3O1IA 2EHOC 1MIYA 1WCRA 4O2BE 3VR8A 5KX5E 5JDHA 2WBLA 2N2NA 1BR2A 4NXNT 2YDSA 5ADXL 1NAFA 5CA0E 4EV6A 5IYZE 4JBWF 1Y64B 2YOEA 1BR0A 4WBNE 3AE4A 4YHJA 3ZJ2A 5HWYA 5FP3A 2LM2A 3AE1A 3PUGA 4DR3T 4BAYB 1YXRA 4UVAB 1I6ZA 5J0ZA 1SA0E 2XQAA 5JDFA 4B3RT 4QWNB 4X1YE 2NTXA 3C64A 1D1BA 4WW0A 4L5GA 1G8XA 4DNDA 2LLYA 4IDQA 1KEYA 1D0ZA 2CLYC 5H6QB 5HXCA 3TLUA 3LK3B 5JTGA 2D2SA 1N32T 4K0KT 5HEUA 3TLWA 2LSKA 4AQFC 3ETUA 2NTYA 2V5DA 3M3ZB 3AXJB 3JC6C 3ZCIA 5HXSA 2CA5A 4LF7T 3C51A 2QA7A 5DABA 1XZYA 2XHEB 4TV9E 5LGTB 3OJAA 5L3CB 4N78D 5ABEA 5LCYA 3HL6A 3LJCA 2F4VT 4LF8T 1XNRT 3NZQA 2CM0A 3FZLB 2L8KA 3RRWA 4LMJA 3LFMA 4UIGA 4FI5A 5J2TE 2JRKA 3LDQB
chains in the Genus database with same CATH topology
3KV5A 4OYJA 3KINB 2BVLA 2CMRA 1KNZA 2D5UA 2UXNB 5M4YA 2X51A 3PDYA 4I43B 5FMNA 4DVDA 4ZI2C 4CI3B 1KK7A 5JR9A 3NRXA 3Q2MA 4NUUA 4TX5A 2CEAA 3P7IA 3AAEB 3AVSA 5FXXA 2XAFB 3UT5E 4IE0A 1E1HB 4AKRB 3KV9A 2L9QA 3ZN1B 2MBGA 2EHOD 2X9HA 3KDSE 4UV8B 2LSIA 2D0TA 3LK42 4P0BA 3HKCE 2IC6A 2PJQA 1WYCA 5FXZA 3ZMUB 5KMGP 3FXEB 5LNKA 2LOPA 2WMNA 1HF8A 2X67A 3PE0A 2H3RA 3N9MA 4TN7B 5IHYA 4U74A 3V5UA 2V1DB 2C5KT 3C50A 2NW9A 3E22E 2LSYA 3CKDA 4A56A 3N9LA 2LHNA 1Z0PA 4HTEA 3SWHA 1BR1A 2DWGA 3CPZA 5A1LA 5HXEA 3FHNA 1QUUA 4L0RA 2XUEA 2YK0A 3UTKA 2P9BA 3FXDB 4C91A 3NZPA 2WM9A 4TV8E 2A72A 2ZM0A 4QKNA 4ISSA 5KDMC 3F57A 5EK3A 4ZI3D 3KV4A 4ZHQE 4JLEA 3AB3B 4ZS2A 3FBZA 1IJ6A 2MTQA 3N2GE 2ZLYA 2MOZA 1VRBA 2LE8A 4CXYA 5LHHB 4G63A 4B6XA 5LG4A 3LG7A 4L9IA 3FB2A 2VKJA 4CI1B 4WBOA 2XASB 4EIWA 2KXPB 3BQKA 2XQYA 3W15B 3ZCJA 4UV9B 3C4WA 4H9SE 4TZ4C 3ZLIA 3MJXA 4YFSA 2WAUA 4IDZA 2JJ9A 4EB6E 1X79A 3H37A 3AA0B 4ERRA 4OK0A 2M67A 2NW7A 3KBTA 3IEEA 1D1AA 2VB6A 4WNKA 4P09A 3AVRA 2X68A 2JMHA 4ASKA 2W0GA 4ILUA 1T98A 1US7B 2CE7A 3L3PA 3UUNA 1MMNA 3N5LA 1ZEEA 3MA9A 4BJMA 3O1HA 4PFOA 2LEHA 1G73A 3K8PC 2VASA 4M1PA 4QX7B 1OXZA 3EVYA 4XZCA 2X66A 3GWHA 3PURA 5ETWA 1YD8G 1FMWA 4V1Av 4CXXA 4PK4A 2HPJA 1YKEB 5LGNB 4AKGA 5LJMA 2JMKA 2A3DA 2VK9A 3UULA 5LHGB 5LBQB 3WI3A 4ZOLE 2YEVC 1D0YA 3KBUA 2HH7A 5FY1A 2KT9A 4KMCA 3T8OA 5JDGA 3CX7B 2ODVA 4PK5A 4PK6A 3GMIA 2K24A 1V9DA 5JQGE 3A5XA 2K5BB 1CUNA 3F2EA 4HKAA 4GYRA 2DI4A 3B57A 1HFAA 1QSDA 1S94A 3GN5B 4H9OC 2W62A 5AFUL 5C8YE 4J2CA 4AKIA 4BA9A 4QHOA 4AXPA 4EXTA 3RC8A 3I9YA 4O2AE 4YJ3E 2Q9QA 2XTLA 4GYSA 4EYYR 4OFZA 4MFRA 1D1CA 3MK7C 5L3BB 5FXVA 2W63A 2YU2A 4XAXB 4O4LE 3ZC0A 2X9XA 5HAXA 3HKBE 2GK9A 1WYBA 5F3JA 2UXXB 1UCUA 2IAKA 2KWHA 1YKHB 3QC9A 4EAHA 3ESLA 2JQQA 2CXDA 4PNIA 4UELA 4F6RC 4EYUA 3GN5A 3P8CD 1WR6A 2DHRA 2KZ7B 3U78A 3H3AA 1D0XA 4UVBB 4ZI2D 2NW8A 3RC3A 4EOZB 3MACA 4CZZB 2DWKA 2VL8A 3BQIA 2L3LA 3O1JA 4P0AA 3LBXA 1HS7A 3Q5XA 1MIWA 3I0QA 1WRDA 5EK4A 2SPCA 2IW5B 2RP4A 1NWMX 3RYCE 2NOXA 2K48A 1OWAA 4YLHA 3IBPA 4MHCA 5CB4E 5TAOA 3N9PA 2X9YA 3FBLA 4HEAA 5BMVE 3LK2B 2N9DA 5JVDE 3HKDE 4ZS3A 3DP7A 5JRCB 3O4XE 2V26A 4GIWA 3IF8B 3PU8A 5FYMA 2BZBA 4GK0E 4PFPA 4JEUB 2YU1A 2OA5A 3RH3A 3CX8B 3R84B 3ZEFB 1MMAA 3J9X1 3KFWX 3I9WA 3ZMZB 4G2AA 3UUXB 5CA1E 4OYKA 4K0UA 4ADZA 3CMLA 3EUHA 3VKHA 3MZKB 4IGUA 3ANWA 1MMDA 3J7Yq 2EHOA 2CWOA 2V7KA 4DO0A 3ONXA 4X20E 4H9PC 3PTRB 4O4IE 2C5IT 2LT3A 5LP6E 5JRCA 4QX8B 3S4UA 3IHRA 3RYIE 2KWIB 4IE5A 4O4HE 1LKXA 3CVRA 3N9NA 3BQLA 2KNDA 4KBMB 4EZ4A 4OHFA 5GONE 3F31A 1EZ3A 2W61A 4HFVA 1MIVA 3N9OA 3K3NA 2H7VC 3CX6B 1IJ5A 4I55E 5HXRA 4KUMB 2D0UA 2LSJA 4U72A 4HN9A 4JEHB 2PG8A 4CXWA 2DLRA 4PJLA 3ETVA 2HPLA 3KVAA 3OYZA 1U4QA 3NRYA 5EK2A 2V7MA 4DBQA 5L2LA 3I0OA 2A2FX 2VKOA 3V5SA 1SHZC 3HKEE 3ZMSB 1MNDA 3AA6B 3SOLA 3ZPOA 4FJOA 3CQCB 1S35A 3JC6D 4Z8XA 4O4JE 2KMFA 5FNVE 4AKHA 3RPUA 3WAJA 3E08A 1HG5A 2Q9QC 2KLQA 4KP3C 2Q9QB 4DMWA 1FIOA 2C0SA 3PUAA 5J2UE 3AA7B 3ZC1A 4E7SA 2I59A 2WSSV 5L3GB 5LHIB 3VU7H 3ZYLA 5LGUB 4QXBB 3OKQA 2CWYA 2Y48B 3C98B 3PUQA 2ZM2A 4IE7A 4MALA 2IC9A 1VOMA 2PFVA 5H6RB 2N1GA 2E9XC 2V7IA 2E9XB 3Q9DA 2NP9A 2W00A 3KV6A 5LA6E 5E0OA 4UF0A 2LHRA 1B7TA 4ISTA 4AQFA 2C5JA 2ZMAA 3N9QA 2ES0A 3PUSA 4UVCB 3LBXB 4DBRA 3QK6A 4PAGA 5FXWA 3OBVE 4BJNA 4IE4A 3EDUA 2X0LB 1HTJF 3ZN0B 3ZYMA 1IAPA 3OYXA 2LOSA 3MKDA 5LBMA 4AQGA 1YW0A 3C4XA 4I50E 5JDLA 1H7CA 2CXFA 2VWAA 1LVFA 2E9XA 2DCFA 3KVBA 1MNEA 4TUYE 3RYFE 4CI2B 2K9AA 3M65A 4AKLA 5EZYE 3I1AA 4JUYA 4CQIA 3O1IA 3RKOA 3ANWB 2EHOC 2EHOB 1MIYA 4O2BE 4QXCB 4ZI7E 5KX5E 4PJJA 4IE6A 3D0TA 3EDVA 3U3IA 5JDHA 2WBLA 1ZKEA 2QGSA 2N2NA 1BR2A 1UX5A 2J1DG 3L09A 5ADXL 1NAFA 3RYHE 3GA8A 5CA0E 4AI6A 3C4ZA 4PJNA 5J1GA 3PU3A 3AAIA 4GK5E 2LM9A 5IYZE 3N2OA 3UUMA 3R6NA 3ZYKA 1Y64B 1FMVA 4PW8A 1BR0A 2G0UA 4WBNE 3SS1A 4ANJA 4YHJA 3ZJ2A 5HWYA 5FP3A 2MYSA 3QUJA 2B1EA 2RA1A 3PUGA 4BAYB 3K3QC 5FY7A 4ZI3C 2WWUA 3HI2A 2XAJB 4H63H 4UVAB 4NUVA 1SA0E 1BR4A 3CQGB 3Q5WA 3N2KE 5JDFA 1AJ3A 1LRZA 1WLXA 4QWNB 3RX6A 2NWBA 4X1YE 3VHLA 2NTXA 5HXHA 2YINA 4IIJE 3C64A 3AA1B 1D1BA 1O3XA 4WW0A 4L5GA 4GOUA 2LJLA 1G8XA 4O8SA 4DNDA 5DQVA 1ZHCA 5JDMA 3CQXC 2KINB 2V7LA 4PJMA 2ACXA 3B13A 3DJBA 5LXTE 3ZMVB 1D0ZA 2Y6XA 5JDQA 4H9RC 4IHJE 2CLYC 4XBFB 2CLYB 2XAGB 1FEWA 3NBXX 2DNXA 2XAHB 5H6QB 5HXCA 3LK3B 5FY0A 5JH7E 2LSGA 2D2SA 3WAKA 2H7OA 2ZM8A 5LYJE 3HR0A 1IZNB 5JREA 5L3DB 5DJQC 4C90A 3VKGA 4YJ2E 1MMGA 4I4TE 5LJNA 4EZHA 2BVMA 2CCQA 4H63V 4UF0B 2LSKA 5F8PA 4AQFC 5L3EB 5LOVE 4QXHB 3ETUA 2NTYA 3JC6C 3E0ZA 3ZCIA 3CWZB 5HXSA 2CA5A 2E8IA 3C51A 4HE8A 3SRZA 4X1IE 2QA7A 5DABA 3MXZA 4MLKA 2V7JA 3TKLB 2XHEB 2Q9QD 2WMOA 4HGAA 3UFEA 3ZMTB 2PBIA 4TV9E 1HX8A 1ZV4X 5LGTB 3OJAA 5L3CB 4N78D 1LVKA 3DTOA 1HG2A 2XAQB 3HL6A 2Y8DA 3LJCA 5LCYA 1UX4A 3HA4A 5JR9C 5JR9B 3O9XA 4E7ZA 3NZQA 2CM0A 4MBQA 2E9XD 2Z6EA 5DQWA 3RRCA 1U5PA 2L8KA 5HYAA 3BK9A 2JPFA 2VKDA 4H9NC 3ZJ1A 4UXNB 2CXLA 2ODUA 1HCIA 4H9QC 5JDNA 2BDEA 2VKHA 2X9WA 5L3FB 3RRWA 4X1KE 3AAAB 3K3OA 4UEMA 3LFMA 4UIGA 4FI5A 5HWXA 5J2TE 2JRKA 4DMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM C;  4HGA A;  4H9R C;  4H9S E;  4H9N C;  4H9P C;  4H9Q C;  4H9O C; 
#chains in the Genus database with same CATH topology
 4OYJ A;  5M4Y A;  2X51 A;  2I6H A;  3AEG A;  5HEO A;  3Q2M A;  2RPA A;  1JNR A;  3AVS A;  3UT5 E;  1Y01 A;  2WDQ A;  2MBG A;  2IC6 A;  2FJA A;  3AEA A;  2WU2 A;  3V5U A;  2NW9 A;  3N9L A;  5A1L A;  1QUU A;  2XUE A;  4DR1 T;  4C91 A;  4QKN A;  3AB3 B;  3ONJ A;  2MTQ A;  4HFE A;  2MOZ A;  1VRB A;  4G63 A;  5LG4 A;  2VKJ A;  4EEB A;  2XQY A;  3C4W A;  3ZLI A;  2WAU A;  2JJ9 A;  4EB6 E;  2M67 A;  1D1A A;  2VB6 A;  3FZK B;  3H3M A;  2JMH A;  4ASK A;  1T98 A;  3L3P A;  3QNU A;  1ZEE A;  3ZSS A;  4BJM A;  4PFO A;  2HN2 A;  2LEH A;  1M7K A;  4M1P A;  2D9D A;  2X66 A;  1J5W A;  1YD8 G;  3CIR A;  4ZOL E;  5ABH A;  2YEV C;  2HH7 A;  2KT9 A;  5JDG A;  4X62 T;  3A5X A;  2VQF T;  2DI4 A;  2XQ9 A;  4H9O C;  1N33 T;  1L0V A;  4AXP A;  4EXT A;  4O2A E;  2E5L T;  4YJ3 E;  2XTL A;  1D1C A;  5FXV A;  5CGM A;  4XAX B;  3ZC0 A;  3T1H T;  2X9X A;  2OV9 A;  4YTP A;  2UXX B;  1UCU A;  2OLT A;  3QC9 A;  4QH5 A;  5C2T A;  4F6R C;  4PNI A;  4EYU A;  3GN5 A;  2UUA T;  4JI6 T;  3TLV A;  4EOZ B;  2WS3 A;  2VL8 A;  2JQH A;  1MIW A;  2SPC A;  2RP4 A;  2K48 A;  1OWA A;  3IBP A;  5L4E A;  4HEA A;  2HN1 A;  3P50 A;  5AQT B;  3DP7 A;  3O4X E;  2V26 A;  2LRL A;  3CK6 A;  4GK0 E;  2BG9 C;  4PFP A;  2OA5 A;  3FZM B;  3I9W A;  4G2A A;  3ZMZ B;  4OYK A;  3LSV A;  1MMD A;  3RQU A;  4DO0 A;  3ONX A;  4X20 E;  5F5W A;  2WQY A;  4H9P C;  5JRC A;  2KWI B;  3CVR A;  2KND A;  4KBM B;  5LB7 B;  5GON E;  4HWD A;  2VVN A;  3K3N A;  2H7V C;  3L8R A;  3UUB A;  4CXW A;  2DLR A;  2HPL A;  4QH1 A;  3OYZ A;  3NRY A;  5EK2 A;  5L2L A;  1XWM A;  2J62 A;  2CPT A;  4IL4 A;  1SHZ C;  1MND A;  3CQC B;  1S35 A;  3WAJ A;  3E08 A;  2Q9Q C;  4B3T T;  2C0S A;  3PUA A;  5AQP B;  3AA7 B;  2V6Y B;  3IA3 A;  3ZC1 A;  3VU7 H;  3ZYL A;  3VRA A;  4AIS A;  2JIW A;  4X5T A;  2E9X B;  4HWC A;  3Q9D A;  3KV6 A;  1IBK T;  4IST A;  3P4Q A;  2ZMA A;  2ES0 A;  3PUS A;  3AXJ A;  4PAG A;  4BJN A;  3SFD A;  2WZH A;  1HTJ F;  3ZN0 B;  4U7I A;  3MKD A;  2BG9 E;  1YW0 A;  3RQW A;  1T72 A;  4YSX A;  3RGL A;  2XSA A;  4AKL A;  4JUY A;  3RKO A;  2EHO B;  3NVO A;  4ZI7 E;  5HEH A;  4IE6 A;  2QGS A;  2J1D G;  3L09 A;  4AQY T;  3RYH E;  3GA8 A;  4AI6 A;  3C4Z A;  4PJN A;  2UUB T;  3AEE A;  3AAI A;  4YY3 T;  3R6N A;  3AED A;  2W66 A;  2M6I A;  1E2A A;  2B1E A;  5FY7 A;  3HI2 A;  2XAJ B;  1BR4 A;  2BS4 A;  1AJ3 A;  3RX6 A;  1UGO A;  3VHL A;  5HXH A;  1O3X A;  3UQ7 A;  2QVA A;  4O8S A;  5JDM A;  3TLS A;  5IUX A;  2V7L A;  3B13 A;  3DJB A;  3P4R A;  3ZMV B;  2LKG A;  5AQL B;  1FJG T;  4XBF B;  2CLY B;  1FEW A;  2XAH B;  4TNV A;  2V6X A;  2LSG A;  1IZN B;  5JRE A;  5DJQ C;  4I4T E;  2BVM A;  2WY2 A;  4UF0 B;  5F8P A;  3ZT6 A;  4QXH B;  2IIU A;  3CWZ B;  2YDQ A;  4NIQ A;  4HE8 A;  3MXZ A;  1KFY A;  4MLK A;  3P4P A;  3UFE A;  3ZMT B;  2PBI A;  3EI0 A;  1HX8 A;  2KSR A;  2XAQ B;  2BBJ A;  3O9X A;  5AQO B;  3RRC A;  5FVK A;  4H9N C;  5LG3 A;  2ODU A;  1HCI A;  2W2U A;  2VKH A;  3G06 A;  3K3O A;  4KI0 F;  4DMV A;  5AQJ B;  2BVL A;  1KNZ A;  2D5U A;  4YXD A;  5FMN A;  4DVD A;  5JR9 A;  3NRX A;  2CEA A;  3P7I A;  2H88 A;  5FXX A;  2XAF B;  4IE0 A;  2L9Q A;  2AE9 A;  1HNZ T;  4JI7 T;  2D0T A;  3LK4 2;  4P0B A;  3HKC E;  2H3R A;  3N9M A;  4U74 A;  4IRE A;  2V1D B;  4B3S T;  2E5V A;  3E22 E;  2IUB A;  4HTE A;  2W4X A;  3SWH A;  1BR1 A;  1M62 A;  3FXD B;  4EED A;  2WM9 A;  2A72 A;  2ZM0 A;  5HCJ A;  3F57 A;  5EK3 A;  4ZI3 D;  4JLE A;  2VQE T;  4LF9 T;  4YHH T;  2ZLY A;  4CXY A;  4B6X A;  3ZT7 A;  4OX9 T;  3LG7 A;  4L9I A;  2XQ5 A;  2XAS B;  3B5M A;  3BQK A;  3W15 B;  2IDO B;  3MJX A;  4YFS A;  3EAB A;  3AA0 B;  3KBT A;  2X68 A;  2W0G A;  4U33 A;  3UUN A;  3FZH B;  1UUR A;  5BR8 T;  4X66 T;  2VAS A;  4XZC A;  3PUR A;  1FMW A;  2HPJ A;  1YKE B;  4AKG A;  4WYV A;  5LJM A;  2VK9 A;  5LHG B;  1OED C;  5FY1 A;  2UUC T;  4KMC A;  2ODV A;  4PK6 A;  3GMI A;  2K24 A;  3F2E A;  4HKA A;  3B57 A;  2I0M A;  1S94 A;  2W62 A;  5AFU L;  3Q5D A;  3P4W A;  5AQR B;  3UU3 A;  1SUM B;  4GYS A;  3MK7 C;  2V6Y A;  4ILB A;  1WYB A;  2IAK A;  4UEL A;  2DHR A;  4ZI2 D;  1D0X A;  4UVB B;  2CBJ A;  2NW8 A;  4JV5 T;  4CZZ B;  4JYA T;  2L3L A;  3Q5X A;  4JI2 T;  5EK4 A;  3RYC E;  3AE7 A;  4YLH A;  4MHC A;  3LK2 B;  5JVD E;  4GIW A;  3IF8 B;  2BZB A;  2BG9 B;  2YU1 A;  3RH3 A;  3CX8 B;  3ZEF B;  1MMA A;  3J9X 1;  3UUX B;  2J47 A;  4K0U A;  5FKY A;  1JNZ A;  3J7Y q;  3PUV F;  2EHO A;  2V7K A;  3RIU A;  3OTO T;  4QX8 B;  3RYI E;  4IE5 A;  1LKX A;  4EZ4 A;  3A8Y C;  1N36 T;  4JI3 T;  4LFA T;  3N9O A;  3T1Y T;  1IJ5 A;  4U3C A;  4JI1 T;  4HN9 A;  4JEH B;  5LMN T;  3KVA A;  4JI8 T;  1OED E;  3PJA J;  3I0O A;  5FL0 A;  3V5S A;  3AE6 A;  3HKE E;  4X65 T;  2CBI A;  1W09 A;  4FJO A;  1HG5 A;  2KLQ A;  2Q9Q B;  4DMW A;  3JAF A;  1R8I A;  2I59 A;  2WSS V;  4IDP A;  5LHI B;  3QB5 K;  5LGU B;  4QXB B;  3K1S A;  2AXD S;  2ZM2 A;  2CRB A;  4IE7 A;  4MAL A;  3PUZ F;  1VOM A;  2WDV A;  5H6R B;  3A7M A;  2NP9 A;  4UF0 A;  1B7T A;  2FUP A;  4AQF A;  4HFC A;  3N9Q A;  3LBX B;  3RI5 A;  3ZKR A;  3OBV E;  4Q25 A;  2BKN A;  3VRB A;  2HHH T;  2X0L B;  1XDO A;  4QH4 A;  4COF A;  5JDL A;  3RKG A;  2WWV A;  4DV7 T;  5IWA T;  1HX1 B;  1KF6 A;  3KVB A;  4TUY E;  3RYF E;  1NEN A;  5EZY E;  4A97 A;  1GQE A;  4QXC B;  1W0B A;  4KHP T;  2XM2 A;  2VL0 A;  3EDV A;  3RLF F;  3U3I A;  1ZKE A;  5AQG B;  4B3M T;  1UX5 A;  4KHZ F;  4ZXL A;  5HEJ A;  3ABV A;  5J1G A;  4GK5 E;  1J1J A;  3ZYK A;  1FMV A;  1DU2 A;  4PW8 A;  2BBH A;  3PUY F;  4DV3 T;  2LRK A;  3SS1 A;  4ANJ A;  2MYS A;  4H63 H;  4NUV A;  1VCT A;  1XDP A;  1ZP0 A;  2WB5 A;  3Q5W A;  3N2K E;  2CHN A;  1LRZ A;  2NWB A;  4YTM A;  4EGW A;  2YDR A;  2LJL A;  5AQU B;  1ZHC A;  3CQX C;  2KIN B;  4PJM A;  2ACX A;  2X0H A;  1HNW T;  3TLT A;  2Y6X A;  4ZZB A;  5JDQ A;  3RF1 A;  2XAG B;  3NBX X;  2DNX A;  2E2A A;  5LYJ E;  2H7O A;  4I0U A;  3HR0 A;  5L3D B;  3VKG A;  1I94 T;  4YJ2 E;  1MMG A;  2CCQ A;  4IDN A;  1SE7 A;  3SRZ A;  4X1I E;  2WMO A;  4HGA A;  1ZV4 X;  3PJA A;  5HEG A;  3DTO A;  5L47 A;  1YQ3 A;  2Y8D A;  3HA4 A;  5JR9 C;  4ILA A;  4E7Z A;  2WCA A;  4MBQ A;  2E9X D;  5HYA A;  2JPF A;  3ZJ1 A;  2CXL A;  5JDN A;  2X9W A;  5L3F B;  4X1K E;  3AAA B;  4YSY A;  4UEM A;  5HWX A;  2M6B A;  2UXN B;  4JI5 T;  2B76 A;  4NUU A;  4TX5 A;  3AAE B;  1E1H B;  3AEB A;  3ZN1 B;  2EHO D;  2X9H A;  4ZZC A;  3KDS E;  1WYC A;  4U7Y A;  3VR9 A;  1T8B A;  3ZMU B;  5KMG P;  3JAD A;  1E7P A;  3AEF A;  1HF8 A;  3PE0 A;  4TN7 B;  3C50 A;  2LSY A;  3CKD A;  2JQ9 A;  2DWG A;  4LF6 T;  4L0R A;  2YK0 A;  3NZP A;  4TV8 E;  4HFH A;  3AE9 A;  5KDM C;  3RIF A;  4ISS A;  3JAE A;  1XMQ T;  4DID B;  3EAM A;  1IJ6 A;  3N2G E;  5LHH B;  3QB5 A;  2XZE A;  2R6G F;  4CI1 B;  4GKJ T;  4WBO A;  2BG9 A;  4ZEY A;  2KXP B;  3ZCJ A;  4UV9 B;  4H9S E;  4TZ4 C;  3AEC A;  5AQM B;  3H37 A;  4OK0 A;  2NW7 A;  4DV6 T;  4ILU A;  1US7 B;  3L39 A;  3OPC A;  4WZX A;  3MA9 A;  5KXJ A;  3PUX F;  3K8P C;  4QX7 B;  1OXZ A;  3EVY A;  3GWH A;  4V1A v;  4PK4 A;  5ABG A;  3UUL A;  2A3D A;  4YTN A;  2XPK A;  1OED B;  3UFG A;  4X64 T;  4DUY T;  1D0Y A;  3KBU A;  3T8O A;  1V9D A;  5JQG E;  1CUN A;  3UU5 A;  1HFA A;  3GN5 B;  4J2C A;  4BA9 A;  4QHO A;  3FZF B;  3RC8 A;  2XQ8 A;  4AIU A;  2Q9Q A;  4OFZ A;  5L3B B;  1CHU A;  2W63 A;  5HAX A;  2GK9 A;  2DL1 A;  4IT4 A;  1YKH B;  2CXD A;  1WR6 A;  5AQK B;  3H3A A;  1VCS A;  3RC3 A;  3RHW A;  3BQI A;  3O1J A;  3LBX A;  3I0Q A;  1WRD A;  1NWM X;  2NOX A;  3RIU C;  3N9P A;  3FBL A;  2N9D A;  3HKD E;  4ZS3 A;  5JRC B;  3PU8 A;  5FYM A;  4IDO A;  4JEU B;  3NKZ A;  3NWI A;  4CN1 A;  1W0A A;  4ADZ A;  3CML A;  3EUH A;  3MZK B;  4IGU A;  4JI4 T;  1X9B A;  2W67 A;  2C5I T;  5LP6 E;  3IHR A;  4YT0 A;  4O4H E;  2BKP A;  2WU5 A;  3BQL A;  4OHF A;  2XQ6 A;  4HFV A;  1MIV A;  4I55 E;  5HXR A;  2LSJ A;  4U72 A;  4TWF A;  3ETV A;  1NEK A;  1U4Q A;  3AE3 A;  2A2F X;  4U2Y A;  1WR0 A;  3ZMS B;  2ACZ A;  3AA6 B;  3ZPO A;  4Z8X A;  4O4J E;  4KP3 C;  3ONL C;  5J2U E;  4E7S A;  5L3G B;  1Z8U A;  2CWY A;  3PUQ A;  2PFV A;  4A98 A;  2N1G A;  2V7I A;  4HWI B;  5E0O A;  1KNP A;  4LMK A;  5ABF B;  4UVC B;  2MPK A;  4DBR A;  5FXW A;  3EHZ A;  4IE4 A;  2V8S V;  1HNX T;  3OYX A;  2FJE A;  4AQG A;  3C4X A;  4I50 E;  2LKH A;  2VWA A;  1LVF A;  2E9X A;  1MNE A;  4DR4 T;  4CN4 A;  3M65 A;  2UXC T;  3I1A A;  4CQI A;  3UU8 A;  3ANW B;  1W9R A;  4PJJ A;  4UR9 A;  3D0T A;  5LMU T;  2UXB T;  2J4G A;  4A5X A;  3PU3 A;  3UUM A;  2LM9 A;  3N2O A;  4DUZ T;  4LF4 T;  4LFC T;  2G0U A;  4DR7 T;  4DR2 T;  3QUJ A;  2UXD T;  2QYW A;  2RA1 A;  3K3Q C;  4ZI3 C;  2WWU A;  2K3W A;  2QRX A;  3CQG B;  4IL9 A;  1WLX A;  1YQ4 A;  1ZOY A;  2YIN A;  4IIJ E;  5AQN B;  3AA1 B;  2XQ7 A;  3PUW F;  4GOU A;  5DQV A;  5LXT E;  4H9R C;  4IHJ E;  4NXM T;  5AQQ B;  5FY0 A;  3SFE A;  2FJD A;  5JH7 E;  3WAK A;  2ZM8 A;  2V5C A;  4LFB T;  4C90 A;  5LJN A;  4EZH A;  4H63 V;  5L3E B;  5LOV E;  3ZT5 A;  1N34 T;  3E0Z A;  3PV0 F;  2NR4 A;  2E8I A;  4KX6 A;  2V7J A;  3TKL B;  3P4S A;  2Q9Q D;  1UK5 A;  2PTF A;  3ZST A;  1LVK A;  3AE5 A;  1HG2 A;  5C3J A;  1UX4 A;  3AE8 A;  5JR9 B;  2Z6E A;  5DQW A;  1IBL T;  1U5P A;  5HCM A;  3BK9 A;  2VKD A;  4UXN B;  4H9Q C;  2BDE A;  3UU6 A;  5AQF B;  3KV5 A;  3KIN B;  2CMR A;  3X1D A;  3PDY A;  4I43 B;  1OED A;  4ZI2 C;  4CI3 B;  1KK7 A;  4AKR B;  3KV9 A;  3AE2 A;  2IML A;  4UV8 B;  2LSI A;  2XQ4 A;  2PJQ A;  4LML A;  2BS3 A;  5FXZ A;  3FXE B;  5LNK A;  2LOP A;  2JQK A;  2WMN A;  2X67 A;  5IHY A;  2C5K T;  4Z90 A;  2H89 A;  4A56 A;  2LHN A;  1Z0P A;  3Q5E A;  4HWF A;  3CPZ A;  5HXE A;  3FHN A;  3UTK A;  2P9B A;  1XMO T;  2VUR A;  2WDR A;  4ZHQ E;  3KV4 A;  4ZS2 A;  3FBZ A;  2WZI A;  2BS2 A;  2LE8 A;  5L4H A;  1UUS A;  3FB2 A;  5CJ5 A;  4EIW A;  4U31 A;  3QOF A;  4GKK T;  4DV2 T;  2YKS A;  4IDZ A;  4NPP A;  1X79 A;  4ERR A;  3IEE A;  4WNK A;  4P09 A;  3AVR A;  2FBW A;  2XJ7 A;  2CE7 A;  1MMN A;  3N5L A;  3O1H A;  1G73 A;  4ILC A;  5ETW A;  4CXX A;  5LGN B;  1KNR A;  2JMK A;  5LBQ B;  2FJB A;  3WI3 A;  4DV0 T;  3CX7 B;  4PK5 A;  4CN6 A;  4TWH A;  1XNQ T;  2K5B B;  2ZM6 T;  4GYR A;  1QSD A;  4HWH A;  5C8Y E;  4AKI A;  2A9U A;  3I9Y A;  4EYY R;  2VVS A;  4MFR A;  2YU2 A;  4O4L E;  3HKB E;  5F3J A;  2KWH A;  5FVL A;  4EAH A;  3ESL A;  2JQQ A;  3P8C D;  2KZ7 B;  3U78 A;  2XSB A;  4HFD A;  3MAC A;  2DWK A;  5ABF A;  1HS7 A;  4P0A A;  2IW5 B;  1T7S A;  5CB4 E;  5TAO A;  2X9Y A;  4DV4 T;  5BMV E;  2WP9 A;  4TNW A;  5AQS B;  4LF5 T;  5AQV B;  3R84 B;  3KFW X;  5CA1 E;  1WFD A;  3VKH A;  3ANW A;  2CWO A;  2XM1 A;  2XQ3 A;  3PTR B;  4O4I E;  2LT3 A;  4F8H A;  5AQH B;  3S4U A;  2UU9 T;  4TWD A;  3N9N A;  3F31 A;  1EZ3 A;  2W61 A;  3CX6 B;  4KUM B;  2D0U A;  1IBM T;  2PG8 A;  4PJL A;  2CHO A;  5AQI B;  2V7M A;  4DBQ A;  2YN6 A;  4DR5 T;  2VKO A;  4HFI A;  5CFB A;  3SOL A;  3JC6 D;  4AKH A;  2KMF A;  5FNV E;  3RPU A;  1HR0 T;  2X0Y A;  3RIA A;  1FIO A;  5FL1 A;  3OKQ A;  2Y48 B;  3C98 B;  1J5E T;  4HFB A;  2MAW A;  4DR6 T;  1QLB A;  2IC9 A;  2E9X C;  2XY8 B;  2W00 A;  5LA6 E;  4JI0 T;  2LHR A;  2C5J A;  3QK6 A;  3OVU A;  3UQ4 A;  4P1N A;  4U2Z A;  4YSZ A;  3JCF A;  4Z91 A;  3EDU A;  3ZYM A;  1IAP A;  2LOS A;  5LBM A;  2IHR 1;  4DV5 T;  1H7C A;  2CXF A;  4DV1 T;  2DCF A;  4CI2 B;  2K9A A;  2BKO A;  3UU4 A;  3O1I A;  2EHO C;  1MIY A;  1WCR A;  4O2B E;  3VR8 A;  5KX5 E;  5JDH A;  2WBL A;  2N2N A;  1BR2 A;  4NXN T;  2YDS A;  5ADX L;  1NAF A;  5CA0 E;  4EV6 A;  5IYZ E;  4JBW F;  1Y64 B;  2YOE A;  1BR0 A;  4WBN E;  3AE4 A;  4YHJ A;  3ZJ2 A;  5HWY A;  5FP3 A;  2LM2 A;  3AE1 A;  3PUG A;  4DR3 T;  4BAY B;  1YXR A;  4UVA B;  1I6Z A;  5J0Z A;  1SA0 E;  2XQA A;  5JDF A;  4B3R T;  4QWN B;  4X1Y E;  2NTX A;  3C64 A;  1D1B A;  4WW0 A;  4L5G A;  1G8X A;  4DND A;  2LLY A;  4IDQ A;  1KEY A;  1D0Z A;  2CLY C;  5H6Q B;  5HXC A;  3TLU A;  3LK3 B;  5JTG A;  2D2S A;  1N32 T;  4K0K T;  5HEU A;  3TLW A;  2LSK A;  4AQF C;  3ETU A;  2NTY A;  2V5D A;  3M3Z B;  3AXJ B;  3JC6 C;  3ZCI A;  5HXS A;  2CA5 A;  4LF7 T;  3C51 A;  2QA7 A;  5DAB A;  1XZY A;  2XHE B;  4TV9 E;  5LGT B;  3OJA A;  5L3C B;  4N78 D;  5ABE A;  5LCY A;  3HL6 A;  3LJC A;  2F4V T;  4LF8 T;  1XNR T;  3NZQ A;  2CM0 A;  3FZL B;  2L8K A;  3RRW A;  4LMJ A;  3LFM A;  4UIG A;  4FI5 A;  5J2T E;  2JRK A;  3LDQ B; 
#chains in the Genus database with same CATH homology
 3KV5 A;  4OYJ A;  3KIN B;  2BVL A;  2CMR A;  1KNZ A;  2D5U A;  2UXN B;  5M4Y A;  2X51 A;  3PDY A;  4I43 B;  5FMN A;  4DVD A;  4ZI2 C;  4CI3 B;  1KK7 A;  5JR9 A;  3NRX A;  3Q2M A;  4NUU A;  4TX5 A;  2CEA A;  3P7I A;  3AAE B;  3AVS A;  5FXX A;  2XAF B;  3UT5 E;  4IE0 A;  1E1H B;  4AKR B;  3KV9 A;  2L9Q A;  3ZN1 B;  2MBG A;  2EHO D;  2X9H A;  3KDS E;  4UV8 B;  2LSI A;  2D0T A;  3LK4 2;  4P0B A;  3HKC E;  2IC6 A;  2PJQ A;  1WYC A;  5FXZ A;  3ZMU B;  5KMG P;  3FXE B;  5LNK A;  2LOP A;  2WMN A;  1HF8 A;  2X67 A;  3PE0 A;  2H3R A;  3N9M A;  4TN7 B;  5IHY A;  4U74 A;  3V5U A;  2V1D B;  2C5K T;  3C50 A;  2NW9 A;  3E22 E;  2LSY A;  3CKD A;  4A56 A;  3N9L A;  2LHN A;  1Z0P A;  4HTE A;  3SWH A;  1BR1 A;  2DWG A;  3CPZ A;  5A1L A;  5HXE A;  3FHN A;  1QUU A;  4L0R A;  2XUE A;  2YK0 A;  3UTK A;  2P9B A;  3FXD B;  4C91 A;  3NZP A;  2WM9 A;  4TV8 E;  2A72 A;  2ZM0 A;  4QKN A;  4ISS A;  5KDM C;  3F57 A;  5EK3 A;  4ZI3 D;  3KV4 A;  4ZHQ E;  4JLE A;  3AB3 B;  4ZS2 A;  3FBZ A;  1IJ6 A;  2MTQ A;  3N2G E;  2ZLY A;  2MOZ A;  1VRB A;  2LE8 A;  4CXY A;  5LHH B;  4G63 A;  4B6X A;  5LG4 A;  3LG7 A;  4L9I A;  3FB2 A;  2VKJ A;  4CI1 B;  4WBO A;  2XAS B;  4EIW A;  2KXP B;  3BQK A;  2XQY A;  3W15 B;  3ZCJ A;  4UV9 B;  3C4W A;  4H9S E;  4TZ4 C;  3ZLI A;  3MJX A;  4YFS A;  2WAU A;  4IDZ A;  2JJ9 A;  4EB6 E;  1X79 A;  3H37 A;  3AA0 B;  4ERR A;  4OK0 A;  2M67 A;  2NW7 A;  3KBT A;  3IEE A;  1D1A A;  2VB6 A;  4WNK A;  4P09 A;  3AVR A;  2X68 A;  2JMH A;  4ASK A;  2W0G A;  4ILU A;  1T98 A;  1US7 B;  2CE7 A;  3L3P A;  3UUN A;  1MMN A;  3N5L A;  1ZEE A;  3MA9 A;  4BJM A;  3O1H A;  4PFO A;  2LEH A;  1G73 A;  3K8P C;  2VAS A;  4M1P A;  4QX7 B;  1OXZ A;  3EVY A;  4XZC A;  2X66 A;  3GWH A;  3PUR A;  5ETW A;  1YD8 G;  1FMW A;  4V1A v;  4CXX A;  4PK4 A;  2HPJ A;  1YKE B;  5LGN B;  4AKG A;  5LJM A;  2JMK A;  2A3D A;  2VK9 A;  3UUL A;  5LHG B;  5LBQ B;  3WI3 A;  4ZOL E;  2YEV C;  1D0Y A;  3KBU A;  2HH7 A;  5FY1 A;  2KT9 A;  4KMC A;  3T8O A;  5JDG A;  3CX7 B;  2ODV A;  4PK5 A;  4PK6 A;  3GMI A;  2K24 A;  1V9D A;  5JQG E;  3A5X A;  2K5B B;  1CUN A;  3F2E A;  4HKA A;  4GYR A;  2DI4 A;  3B57 A;  1HFA A;  1QSD A;  1S94 A;  3GN5 B;  4H9O C;  2W62 A;  5AFU L;  5C8Y E;  4J2C A;  4AKI A;  4BA9 A;  4QHO A;  4AXP A;  4EXT A;  3RC8 A;  3I9Y A;  4O2A E;  4YJ3 E;  2Q9Q A;  2XTL A;  4GYS A;  4EYY R;  4OFZ A;  4MFR A;  1D1C A;  3MK7 C;  5L3B B;  5FXV A;  2W63 A;  2YU2 A;  4XAX B;  4O4L E;  3ZC0 A;  2X9X A;  5HAX A;  3HKB E;  2GK9 A;  1WYB A;  5F3J A;  2UXX B;  1UCU A;  2IAK A;  2KWH A;  1YKH B;  3QC9 A;  4EAH A;  3ESL A;  2JQQ A;  2CXD A;  4PNI A;  4UEL A;  4F6R C;  4EYU A;  3GN5 A;  3P8C D;  1WR6 A;  2DHR A;  2KZ7 B;  3U78 A;  3H3A A;  1D0X A;  4UVB B;  4ZI2 D;  2NW8 A;  3RC3 A;  4EOZ B;  3MAC A;  4CZZ B;  2DWK A;  2VL8 A;  3BQI A;  2L3L A;  3O1J A;  4P0A A;  3LBX A;  1HS7 A;  3Q5X A;  1MIW A;  3I0Q A;  1WRD A;  5EK4 A;  2SPC A;  2IW5 B;  2RP4 A;  1NWM X;  3RYC E;  2NOX A;  2K48 A;  1OWA A;  4YLH A;  3IBP A;  4MHC A;  5CB4 E;  5TAO A;  3N9P A;  2X9Y A;  3FBL A;  4HEA A;  5BMV E;  3LK2 B;  2N9D A;  5JVD E;  3HKD E;  4ZS3 A;  3DP7 A;  5JRC B;  3O4X E;  2V26 A;  4GIW A;  3IF8 B;  3PU8 A;  5FYM A;  2BZB A;  4GK0 E;  4PFP A;  4JEU B;  2YU1 A;  2OA5 A;  3RH3 A;  3CX8 B;  3R84 B;  3ZEF B;  1MMA A;  3J9X 1;  3KFW X;  3I9W A;  3ZMZ B;  4G2A A;  3UUX B;  5CA1 E;  4OYK A;  4K0U A;  4ADZ A;  3CML A;  3EUH A;  3VKH A;  3MZK B;  4IGU A;  3ANW A;  1MMD A;  3J7Y q;  2EHO A;  2CWO A;  2V7K A;  4DO0 A;  3ONX A;  4X20 E;  4H9P C;  3PTR B;  4O4I E;  2C5I T;  2LT3 A;  5LP6 E;  5JRC A;  4QX8 B;  3S4U A;  3IHR A;  3RYI E;  2KWI B;  4IE5 A;  4O4H E;  1LKX A;  3CVR A;  3N9N A;  3BQL A;  2KND A;  4KBM B;  4EZ4 A;  4OHF A;  5GON E;  3F31 A;  1EZ3 A;  2W61 A;  4HFV A;  1MIV A;  3N9O A;  3K3N A;  2H7V C;  3CX6 B;  1IJ5 A;  4I55 E;  5HXR A;  4KUM B;  2D0U A;  2LSJ A;  4U72 A;  4HN9 A;  4JEH B;  2PG8 A;  4CXW A;  2DLR A;  4PJL A;  3ETV A;  2HPL A;  3KVA A;  3OYZ A;  1U4Q A;  3NRY A;  5EK2 A;  2V7M A;  4DBQ A;  5L2L A;  3I0O A;  2A2F X;  2VKO A;  3V5S A;  1SHZ C;  3HKE E;  3ZMS B;  1MND A;  3AA6 B;  3SOL A;  3ZPO A;  4FJO A;  3CQC B;  1S35 A;  3JC6 D;  4Z8X A;  4O4J E;  2KMF A;  5FNV E;  4AKH A;  3RPU A;  3WAJ A;  3E08 A;  1HG5 A;  2Q9Q C;  2KLQ A;  4KP3 C;  2Q9Q B;  4DMW A;  1FIO A;  2C0S A;  3PUA A;  5J2U E;  3AA7 B;  3ZC1 A;  4E7S A;  2I59 A;  2WSS V;  5L3G B;  5LHI B;  3VU7 H;  3ZYL A;  5LGU B;  4QXB B;  3OKQ A;  2CWY A;  2Y48 B;  3C98 B;  3PUQ A;  2ZM2 A;  4IE7 A;  4MAL A;  2IC9 A;  1VOM A;  2PFV A;  5H6R B;  2N1G A;  2E9X C;  2V7I A;  2E9X B;  3Q9D A;  2NP9 A;  2W00 A;  3KV6 A;  5LA6 E;  5E0O A;  4UF0 A;  2LHR A;  1B7T A;  4IST A;  4AQF A;  2C5J A;  2ZMA A;  3N9Q A;  2ES0 A;  3PUS A;  4UVC B;  3LBX B;  4DBR A;  3QK6 A;  4PAG A;  5FXW A;  3OBV E;  4BJN A;  4IE4 A;  3EDU A;  2X0L B;  1HTJ F;  3ZN0 B;  3ZYM A;  1IAP A;  3OYX A;  2LOS A;  3MKD A;  5LBM A;  4AQG A;  1YW0 A;  3C4X A;  4I50 E;  5JDL A;  1H7C A;  2CXF A;  2VWA A;  1LVF A;  2E9X A;  2DCF A;  3KVB A;  1MNE A;  4TUY E;  3RYF E;  4CI2 B;  2K9A A;  3M65 A;  4AKL A;  5EZY E;  3I1A A;  4JUY A;  4CQI A;  3O1I A;  3RKO A;  3ANW B;  2EHO C;  2EHO B;  1MIY A;  4O2B E;  4QXC B;  4ZI7 E;  5KX5 E;  4PJJ A;  4IE6 A;  3D0T A;  3EDV A;  3U3I A;  5JDH A;  2WBL A;  1ZKE A;  2QGS A;  2N2N A;  1BR2 A;  1UX5 A;  2J1D G;  3L09 A;  5ADX L;  1NAF A;  3RYH E;  3GA8 A;  5CA0 E;  4AI6 A;  3C4Z A;  4PJN A;  5J1G A;  3PU3 A;  3AAI A;  4GK5 E;  2LM9 A;  5IYZ E;  3N2O A;  3UUM A;  3R6N A;  3ZYK A;  1Y64 B;  1FMV A;  4PW8 A;  1BR0 A;  2G0U A;  4WBN E;  3SS1 A;  4ANJ A;  4YHJ A;  3ZJ2 A;  5HWY A;  5FP3 A;  2MYS A;  3QUJ A;  2B1E A;  2RA1 A;  3PUG A;  4BAY B;  3K3Q C;  5FY7 A;  4ZI3 C;  2WWU A;  3HI2 A;  2XAJ B;  4H63 H;  4UVA B;  4NUV A;  1SA0 E;  1BR4 A;  3CQG B;  3Q5W A;  3N2K E;  5JDF A;  1AJ3 A;  1LRZ A;  1WLX A;  4QWN B;  3RX6 A;  2NWB A;  4X1Y E;  3VHL A;  2NTX A;  5HXH A;  2YIN A;  4IIJ E;  3C64 A;  3AA1 B;  1D1B A;  1O3X A;  4WW0 A;  4L5G A;  4GOU A;  2LJL A;  1G8X A;  4O8S A;  4DND A;  5DQV A;  1ZHC A;  5JDM A;  3CQX C;  2KIN B;  2V7L A;  4PJM A;  2ACX A;  3B13 A;  3DJB A;  5LXT E;  3ZMV B;  1D0Z A;  2Y6X A;  5JDQ A;  4H9R C;  4IHJ E;  2CLY C;  4XBF B;  2CLY B;  2XAG B;  1FEW A;  3NBX X;  2DNX A;  2XAH B;  5H6Q B;  5HXC A;  3LK3 B;  5FY0 A;  5JH7 E;  2LSG A;  2D2S A;  3WAK A;  2H7O A;  2ZM8 A;  5LYJ E;  3HR0 A;  1IZN B;  5JRE A;  5L3D B;  5DJQ C;  4C90 A;  3VKG A;  4YJ2 E;  1MMG A;  4I4T E;  5LJN A;  4EZH A;  2BVM A;  2CCQ A;  4H63 V;  4UF0 B;  2LSK A;  5F8P A;  4AQF C;  5L3E B;  5LOV E;  4QXH B;  3ETU A;  2NTY A;  3JC6 C;  3E0Z A;  3ZCI A;  3CWZ B;  5HXS A;  2CA5 A;  2E8I A;  3C51 A;  4HE8 A;  3SRZ A;  4X1I E;  2QA7 A;  5DAB A;  3MXZ A;  4MLK A;  2V7J A;  3TKL B;  2XHE B;  2Q9Q D;  2WMO A;  4HGA A;  3UFE A;  3ZMT B;  2PBI A;  4TV9 E;  1HX8 A;  1ZV4 X;  5LGT B;  3OJA A;  5L3C B;  4N78 D;  1LVK A;  3DTO A;  1HG2 A;  2XAQ B;  3HL6 A;  2Y8D A;  3LJC A;  5LCY A;  1UX4 A;  3HA4 A;  5JR9 C;  5JR9 B;  3O9X A;  4E7Z A;  3NZQ A;  2CM0 A;  4MBQ A;  2E9X D;  2Z6E A;  5DQW A;  3RRC A;  1U5P A;  2L8K A;  5HYA A;  3BK9 A;  2JPF A;  2VKD A;  4H9N C;  3ZJ1 A;  4UXN B;  2CXL A;  2ODU A;  1HCI A;  4H9Q C;  5JDN A;  2BDE A;  2VKH A;  2X9W A;  5L3F B;  3RRW A;  4X1K E;  3AAA B;  3K3O A;  4UEM A;  3LFM A;  4UIG A;  4FI5 A;  5HWX A;  5J2T E;  2JRK A;  4DMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...