5AQMB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
112
structure length
112
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 44
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqmB00
1HX1B 4HWIB 3FZHB 3FZLB 1T7SA 4HWFA 3LDQB 5AQSB 2D9DA 1M62A 5AQKB 1UGOA 3FZMB 5AQGB 5AQMB 1I6ZA 4HWHA 1M7KA 5AQHB 5AQUB 4HWCA 5AQQB 1UK5A 5AQJB 5AQLB 5AQOB 3M3ZB 5AQPB 5AQFB 4HWDA 5AQNB 3FZKB 5AQRB 5AQTB 5AQVB 3A8YC 5AQIB 3FZFB
chains in the Genus database with same CATH superfamily
1NAFA 1HX1B 2NR4A 3QUJA 1HR0T 2WB5A 2ZM0A 2YDSA 4JLEA 4GOUA 1D1CA 1KK7A 3ZJ1A 3GN5A 2DLRA 4UXNB 4HKAA 3CPZA 2MAWA 3CX8B 3EUHA 2E9XA 4IL4A 1HTJF 2PG8A 4KP3C 4N78D 5HXSA 5HCJA 4HFCA 2BVMA 4HFEA 2XQAA 2X66A 4HTEA 5AQMB 1XNRT 3RRWA 1M7KA 4DR4T 2JMHA 3CWZB 3VHLA 4GYSA 4XBFB 3JAFA 3RC8A 3RQWA 2W62A 4NXMT 4HE8A 5JDLA 3OYZA 1MNEA 3K3QC 3E0ZA 3N9NA 3AB3B 4NPPA 4CN4A 2DWKA 4MLKA 4ERRA 2UXBT 3AE3A 3FHNA 3PUWF 5DQWA 4A56A 1X9BA 5HWXA 3ZMTB 4E7SA 3I0OA 3UUNA 4ZXLA 4UF0B 3UU4A 1U4QA 5HWYA 5EZYE 1IJ6A 5L3CB 2VASA 4KHZF 2DNXA 4B3RT 4GKKT 2AE9A 2BKPA 4U3CA 2JQQA 2RP4A 4LMJA 4COFA 5ADXL 3LBXB 1CHUA 4GIWA 4I0UA 3LK2B 5HEJA 2ZM6T 2HPJA 3CX6B 4YSZA 4YHJA 4O2BE 5DJQC 1OWAA 3EDUA 1SUMB 2YDQA 2NTXA 2VKHA 3MACA 4WYVA 5FYMA 1S94A 1HNXT 2Q9QB 3ZCJA 2A3DA 2XASB 1OXZA 2XM2A 4HEAA 3J7Yq 1IJ5A 2W67A 2LEHA 3L8RA 5LBQB 2YN6A 1OEDB 2GK9A 3QOFA 5CFBA 1XMOT 1BR2A 3P7IA 4TNVA 4Z8XA 5LA6E 1UK5A 1UUSA 4IREA 4PFPA 5AQOB 2K5BB 4JUYA 4QH4A 4AISA 2IMLA 2WQYA 3P4SA 5L3EB 2LLYA 2VWAA 3WAJA 4P09A 3ZCIA 3DP7A 4O4JE 1YKHB 4TZ4C 4IE5A 3ZEFB 4P0AA 4JI3T 3A8YC 5IYZE 5LMUT 4F8HA 4H9OC 1SA0E 4KX6A 4IDPA 4H63H 4UIGA 2NP9A 4X1KE 2A2FX 4ZI7E 2IUBA 2I59A 2LE8A 5ABEA 2XPKA 3AA1B 4AKRB 4DR1T 1UX4A 4LFBT 2DWGA 3UU8A 3ZJ2A 5IUXA 1E1HB 1WRDA 3FZLB 4FJOA 3HKCE 3ONLC 4JI7T 2D9DA 2WS3A 2WZHA 4CZZB 4NXNT 1R8IA 2BVLA 4KMCA 4PJLA 5L4EA 3UTKA 4HFDA 1MIVA 1T98A 1MMAA 2CBIA 3GMIA 4V1Av 2NW8A 2HHHT 3UUXB 1N33T 1X79A 2L3LA 3AA6B 3PUGA 5EK2A 4DO0A 4DV2T 4X20E 2BG9E 1HNWT 3BQIA 1KF6A 1WCRA 2H3RA 3EVYA 3PE0A 3TLSA 4PJJA 3Q2MA 3PUYF 1QSDA 4EYYR 1KNZA 2CWOA 3A5XA 3F2EA 3MXZA 5L3FB 3HI2A 5JR9A 3T1YT 2JPFA 1LVKA 3DJBA 4L0RA 3CQXC 3BQLA 4QX8B 3QK6A 5GONE 2LKHA 2NOXA 3UUBA 3LFMA 4DR7T 3RYIE 3B13A 4AIUA 3I9WA 3EI0A 4LF8T 5LOVE 4HWFA 4LF7T 4K0KT 4DV3T 5TAOA 3C4WA 5EK4A 3P4WA 1IBLT 3MKDA 2XSBA 4JI0T 2KNDA 3CX7B 4EAHA 4IE6A 4DR6T 1YW0A 5ABFA 2ZLYA 1VOMA 2C5JA 2X9HA 5FNVE 4WNKA 2M6IA 4PJNA 3WI3A 1KFYA 3T1HT 2ODUA 3L39A 4ZI3C 1KNPA 3ZMUB 2J4GA 2JQHA 4OK0A 3AE9A 1Y01A 1SE7A 3UQ4A 4E7ZA 3PUZF 3MZKB 2VKJA 1VCSA 5LG4A 2VQET 3HR0A 4EB6E 4OX9T 2XQ5A 1XZYA 2BS3A 2N2NA 3ETUA 4LF9T 4NUVA 4YJ2E 2XZEA 3N9MA 3ZT7A 5BR8T 3C50A 4HFHA 2PBIA 5HEHA 3TLWA 2VL0A 2Q9QC 4X5TA 5HYAA 2WDQA 2CXDA 5C2TA 4IT4A 1YQ4A 1LVFA 4H9NC 5JDHA 4O4HE 5L3DB 3ZN0B 2MOZA 5KXJA 3UU3A 1W0AA 4UF0A 3T8OA 4PNIA 2M67A 2V5CA 3AA7B 5E0OA 5JRCB 4H9SE 3U78A 2HN1A 2HN2A 2W2UA 3KBUA 4WW0A 4DV1T 2CE7A 3GN5B 3LJCA 5AQLB 2VURA 4C91A 1DU2A 3RIUC 2KT9A 2L8KA 3MA9A 5JR9C 2YINA 2FBWA 2V8SV 3L3PA 2KMFA 3NVOA 3RX6A 4YY3T 2X9WA 3I9YA 2XAQB 3N5LA 4TWFA 2JQ9A 4IDNA 5A1LA 1H7CA 5AQIB 1BR1A 2CPTA 4NUUA 1T8BA 2Q9QA 2LSKA 5HEGA 5FVKA 4JI2T 5L2LA 4IGUA 3VKHA 2CXLA 4PK4A 4GK5E 3ZMZB 2X9XA 3FZHB 5LNKA 2IC9A 3IA3A 2YEVC 1UCUA 3RRCA 1XNQT 2YU2A 4LF4T 3P50A 2LOSA 4IE0A 2OV9A 3RGLA 4PK5A 5JDMA 2D0TA 4CI1B 3PJAA 1D0XA 2CCQA 2X0HA 3RH3A 4DV5T 4JEUB 4IDZA 1W09A 4U7IA 3FZMB 4PAGA 2WP9A 5HXHA 1IZNB 1US7B 4DMWA 4HWCA 2BZBA 3ONJA 4ASKA 2XUEA 2BG9A 3RF1A 2E8IA 2JJ9A 2VKDA 3ANWA 2FJAA 3N9OA 3AE2A 4TWHA 3RYHE 4HWDA 3ZN1B 4K0UA 4QH5A 1D1AA 3RIAA 2Y48B 4I50E 3C64A 2KSRA 2X67A 4PK6A 3ZMVB 1ZHCA 2A72A 1J5ET 3CKDA 4ILBA 2ACXA 5JREA 5IWAT 5HCMA 5JDQA 4O4LE 3ABVA 3RHWA 3AEFA 4PW8A 4IDQA 3VU7H 3UU6A 1LKXA 1HG5A 3O1IA 4HFIA 4O8SA 4OYKA 5HXRA 4DUZT 5LB7B 2BBHA 2LT3A 2LM2A 3D0TA 4H9PC 4FI5A 2WAUA 2PTFA 5FVLA 3MJXA 2V5DA 2V26A 2WMOA 4JEHB 5EK3A 3TLVA 4DR5T 1XDPA 2DCFA 4WBOA 5HEUA 4DVDA 4ZHQE 1IAPA 3C51A 2IW5B 2ZM8A 3UFEA 4EEBA 1XDOA 3AAIA 4CN6A 5JQGE 2UXXB 3CIRA 3VR9A 4BA9A 2YOEA 3K3OA 4KI0F 4QWNB 4CXWA 2LSYA 4OFZA 4I4TE 4QH1A 2WCAA 3O4XE 3RYFE 4IHJE 4B6XA 5J1GA 1MIWA 2KINB 3RYCE 3IF8B 5FY0A 2LSJA 3UFGA 5FY1A 2XQ4A 2ZM2A 4G63A 2E5LT 2KWIB 2WWUA 2W61A 2CXFA 1FEWA 4YTMA 4AQGA 4EEDA 3PDYA 5M4YA 2WZIA 3N2KE 5F8PA 5J0ZA 2VVNA 5JH7E 5DABA 4QKNA 4ZEYA 4DV6T 5F3JA 3OJAA 3AECA 4MFRA 4WZXA 4UR9A 2G0UA 1WYBA 2JIWA 1KEYA 1WR0A 5FL0A 5L47A 2VL8A 3OBVE 1IBKT 4DV0T 2UXCT 2W66A 2HH7A 5FP3A 3H37A 4ZOLE 2UXDT 5CA1E 5AQJB 5L4HA 3PUAA 4AKHA 5AFUL 2XM1A 1G8XA 4QHOA 4YJ3E 3K8PC 1HF8A 2XQ3A 4HGAA 2XQ8A 3FBZA 4UELA 1S35A 5ABGA 3TLTA 3KV9A 1QLBA 3JCFA 2Y8DA 3EDVA 4ZS2A 4CXYA 3ZC0A 4TN7B 5FXXA 2L9QA 2IC6A 3DTOA 4M1PA 3AVSA 4DR2T 5IHYA 2BG9C 4YTNA 4TX5A 3ESLA 4BAYB 3IEEA 2NW9A 5LGUB 2JRKA 5LJMA 1E2AA 4AQYT 2C5IT 3H3AA 1VRBA 2FUPA 2XJ7A 3HKEE 3HKDE 3PTRB 4KBMB 2OLTA 4TUYE 4X1YE 5H6QB 3TKLB 4IE7A 5CB4E 1UGOA 1MMGA 3AE6A 2PJQA 2KLQA 5AQUB 5AQQB 4GYRA 3ZLIA 2CBJA 4ZI2C 4XZCA 3V5SA 4QXCB 3QB5A 4UVBB 5FXWA 4B3MT 2YDRA 4WBNE 4GK0E 3GWHA 1LRZA 2D0UA 1J5WA 2J62A 2X0LB 4KHPT 3SRZA 3PV0F 5LG3A 1SHZC 2WDRA 5BMVE 1MMDA 3PU3A 4L5GA 3OVUA 4LF5T 1ZV4X 2JQKA 2JMKA 2E9XC 2H88A 3MK7C 5LMNT 2XY8B 2W00A 2V1DB 4TWDA 4J2CA 3LSVA 3PJAJ 3FBLA 4LFCT 5FKYA 3M65A 2E2AA 1ZOYA 3NBXX 3AEAA 4OYJA 4TNWA 3R84B 2RA1A 3QNUA 4BJMA 2XTLA 4MHCA 2LKGA 2RPAA 3ZC1A 2UU9T 4JI6T 2W4XA 5KMGP 4LF6T 2XAJB 3NZQA 3R6NA 3G06A 4DBRA 4B3ST 3FB2A 2MTQA 4GKJT 3AXJA 2V7IA 3KINB 3V5UA 5J2UE 1Z8UA 3JAEA 5L3GB 4AKIA 3ETVA 4BJNA 1FMWA 4ZI3D 1WYCA 2VK9A 3FZKB 3OPCA 4DMVA 2J47A 5LGTB 1YD8G 3PUXF 4DNDA 1IBMT 1HS7A 3K1SA 5HAXA 2NWBA 4JI4T 3FZFB 3EABA 4HN9A 1I6ZA 1BR0A 5LGNB 2V7KA 2VB6A 2UUAT 4YHHT 4ILUA 2QA7A 2WY2A 3EAMA 3P8CD 4ILAA 5L3BB 5FXZA 3P4PA 2IAKA 5J2TE 2IDOB 4EV6A 2LSGA 5HXCA 4JYAT 2VKOA 5HXEA 3I0QA 3IBPA 3AE8A 2YK0A 2E9XB 2N1GA 2DL1A 2V7JA 2WWVA 1FJGT 2Z6EA 2FJDA 1MNDA 2I0MA 3H3MA 2C0SA 4MBQA 4AKLA 4X62T 4KUMB 1XMQT 2V6YA 5LCYA 2I6HA 4YT0A 2MPKA 4O2AE 5LHGB 4ANJA 5HEOA 2UUBT 1O3XA 1Z0PA 4EIWA 3F57A 3LK3B 3RLFF 3SS1A 3Q5XA 1CUNA 2XQYA 3KVBA 3KFWX 4NIQA 2X51A 4U72A 5DQVA 3RKOA 1VCTA 5LHHB 5LBMA 4A5XA 2V6XA 3AE7A 2XHEB 3ZT5A 4CI3B 2LRLA 3KBTA 4UVCB 2AXDS 2BG9B 3HL6A 1ZKEA 4G2AA 4ZS3A 3KV6A 1YKEB 5LP6E 4JI1T 3NRXA 2WMNA 2HPLA 3JADA 1WFDA 4DV4T 2EHOB 2B76A 3BK9A 3FXEB 2WDVA 4ZI2D 3B57A 4IE4A 5AQKB 1HX8A 3AE4A 4U33A 2BS4A 3N9QA 5C8YE 5LYJE 4U2YA 2XAHB 5JRCA 3E08A 3O9XA 4PJMA 5ABHA 2ODVA 3CVRA 1OEDC 4UVAB 1L0VA 5JDFA 4JI5T 4EGWA 4AQFA 4EZ4A 3OTOT 2N9DA 4YSXA 2M6BA 2CWYA 2K3WA 4JI8T 3UU5A 5AQRB 3AA0B 1I94T 2OA5A 2CEAA 4ISTA 2NTYA 4LMLA 5ETWA 3C98B 4JBWF 1HFAA 4AXPA 4IDOA 3AEDA 4U2ZA 1V9DA 2H7OA 2MYSA 3N9PA 3PU8A 5LJNA 5JTGA 2LOPA 4HFVA 1OEDA 3HKBE 3N2GE 1B7TA 3O1JA 3ONXA 3ZMSB 4JV5T 1OEDE 3F31A 2CA5A 4P1NA 3KV5A 2MBGA 4Q25A 3RPUA 1N32T 4TV8E 4P0BA 3C4ZA 2H7VC 3AAAB 4HFBA 2LM9A 2K9AA 3A7MA 1BR4A 5KX5E 2K48A 3Q5EA 3WAKA 3RI5A 4ZZCA 1EZ3A 2D5UA 2EHOC 3UT5E 4TV9E 4Z90A 2LHRA 3ZT6A 4EXTA 1U5PA 3J9X1 2WU5A 3ANWB 2KZ7B 4UV8B 4IIJE 1JNZA 4Z91A 3NWIA 3UQ7A 4QXBB 2Y6XA 3VRAA 3VRBA 4YXDA 3QB5K 4H63V 3CMLA 5AQVB 2X0YA 1ZEEA 2WM9A 5FXVA 2YKSA 5FL1A 4DV7T 1NWMX 2SPCA 3N9LA 4ADZA 5JDGA 3P4QA 4EOZB 1WR6A 2C5KT 2E5VA 2LHNA 3KVAA 3CQCB 3EHZA 2QRXA 3N2OA 3NZPA 1YXRA 2KWHA 4AI6A 3AXJB 2D2SA 1E7PA 3PUVF 2X9YA 1QUUA 3SWHA 5CGMA 3OYXA 4L9IA 2Q9QD 3NKZA 2QGSA 3LDQB 1FMVA 3Q9DA 3S4UA 4DR3T 2V7MA 4UEMA 1JNRA 3IHRA 2ACZA 2BS2A 3X1DA 4H9QC 2ZMAA 5JVDE 2CMRA 4HWHA 3K3NA 5AQHB 3RC3A 4U7YA 1MIYA 2DHRA 2A9UA 2P9BA 3RKGA 1HCIA 2KXPB 3AEGA 5C3JA 2QVAA 2XSAA 2LSIA 4X66T 2LJLA 4DBQA 5AQFB 2H89A 2CRBA 3AVRA 5AQTB 5LXTE 2ES0A 3RQUA 3ZSTA 5CJ5A 4X64T 1W9RA 4LMKA 2F4VT 2CLYC 4OHFA 2UUCT 2XAFB 3UULA 4CXXA 3AAEB 2UXNB 3FXDB 3LK42 3BQKA 3Q5WA 4IL9A 4AQFC 4HWIB 1NEKA 2BDEA 1UX5A 1NENA 2BKNA 2FJBA 2W0GA 4H9RC 4XAXB 2BBJA 3QC9A 2VVSA 4CN1A 3ZYLA 1YQ3A 1T7SA 4DUYT 4B3TT 4I43B 5AQSB 2NW7A 1J1JA 1GQEA 3B5MA 3VKGA 3U3IA 1G73A 2WSSV 2V7LA 2W63A 1W0BA 2LRKA 2QYWA 3AE5A 3SOLA 5JDNA 2VQFT 3LBXA 5KDMC 3L09A 1ZP0A 5CA0E 2FJEA 4I55E 1HG2A 4A97A 3AEEA 3M3ZB 1AJ3A 2CHOA 4ILCA 4MALA 4QX7B 5FMNA 1UURA 2V6YB 4C90A 4ZZBA 3PUQA 4X1IE 3CQGB 3PURA 3ZKRA 4AKGA 3W15B 3OKQA 5JR9B 2IIUA 4UV9B 4YTPA 3GA8A 3KDSE 3SFEA 3Q5DA 2X68A 1D0ZA 4CI2B 3SFDA 2K24A 2XQ6A 2XQ9A 3HA4A 3C4XA 2PFVA 2XAGB 3AEBA 4YLHA 4QXHB 3RIUA 2YU1A 4F6RC 5F5WA 3NRYA 3ZSSA 4EZHA 1HNZT 4U31A 5LHIB 2R6GF 1Y64B 3I1AA 2DI4A 1D0YA 1FIOA 2XQ7A 4YFSA 3VR8A 3ZYKA 4EYUA 2CLYB 2WBLA 3PUSA 3UUMA 4ISSA 1M62A 2EHOD 5H6RB 3RIFA 1T72A 1N36T 1WLXA 5AQGB 5FY7A 2CHNA 3CK6A 3TLUA 3ZPOA 2IHR1 3O1HA 1N34T 2WU2A 4CQIA 3JC6C 4X65T 2EHOA 4O4IE 1MMNA 5AQPB 1KNRA 5ABFB 2B1EA 5AQNB 4A98A 3P4RA 1XWMA 2J1DG 2BKOA 3E22E 3JC6D 3LG7A 3KV4A 4DIDB 2CM0A 4PFOA 1D1BA 3AE1A 4U74A 4LFAT 4YSYA 3ZYMA 2E9XD
chains in the Genus database with same CATH topology
1HX1B 4HWIB 3FZHB 3FZLB 1T7SA 4HWFA 3LDQB 5AQSB 2D9DA 1M62A 5AQKB 1UGOA 3FZMB 5AQGB 5AQMB 1I6ZA 4HWHA 1M7KA 5AQHB 5AQUB 4HWCA 5AQQB 1UK5A 5AQJB 5AQLB 5AQOB 3M3ZB 5AQPB 5AQFB 4HWDA 5AQNB 3FZKB 5AQRB 5AQTB 5AQVB 3A8YC 5AQIB 3FZFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 B;  4HWI B;  3FZH B;  3FZL B;  1T7S A;  4HWF A;  3LDQ B;  5AQS B;  2D9D A;  1M62 A;  5AQK B;  1UGO A;  3FZM B;  5AQG B;  5AQM B;  1I6Z A;  4HWH A;  1M7K A;  5AQH B;  5AQU B;  4HWC A;  5AQQ B;  1UK5 A;  5AQJ B;  5AQL B;  5AQO B;  3M3Z B;  5AQP B;  5AQF B;  4HWD A;  5AQN B;  3FZK B;  5AQR B;  5AQT B;  5AQV B;  3A8Y C;  5AQI B;  3FZF B; 
#chains in the Genus database with same CATH topology
 1NAF A;  1HX1 B;  2NR4 A;  3QUJ A;  1HR0 T;  2WB5 A;  2ZM0 A;  2YDS A;  4JLE A;  4GOU A;  1D1C A;  1KK7 A;  3ZJ1 A;  3GN5 A;  2DLR A;  4UXN B;  4HKA A;  3CPZ A;  2MAW A;  3CX8 B;  3EUH A;  2E9X A;  4IL4 A;  1HTJ F;  2PG8 A;  4KP3 C;  4N78 D;  5HXS A;  5HCJ A;  4HFC A;  2BVM A;  4HFE A;  2XQA A;  2X66 A;  4HTE A;  5AQM B;  1XNR T;  3RRW A;  1M7K A;  4DR4 T;  2JMH A;  3CWZ B;  3VHL A;  4GYS A;  4XBF B;  3JAF A;  3RC8 A;  3RQW A;  2W62 A;  4NXM T;  4HE8 A;  5JDL A;  3OYZ A;  1MNE A;  3K3Q C;  3E0Z A;  3N9N A;  3AB3 B;  4NPP A;  4CN4 A;  2DWK A;  4MLK A;  4ERR A;  2UXB T;  3AE3 A;  3FHN A;  3PUW F;  5DQW A;  4A56 A;  1X9B A;  5HWX A;  3ZMT B;  4E7S A;  3I0O A;  3UUN A;  4ZXL A;  4UF0 B;  3UU4 A;  1U4Q A;  5HWY A;  5EZY E;  1IJ6 A;  5L3C B;  2VAS A;  4KHZ F;  2DNX A;  4B3R T;  4GKK T;  2AE9 A;  2BKP A;  4U3C A;  2JQQ A;  2RP4 A;  4LMJ A;  4COF A;  5ADX L;  3LBX B;  1CHU A;  4GIW A;  4I0U A;  3LK2 B;  5HEJ A;  2ZM6 T;  2HPJ A;  3CX6 B;  4YSZ A;  4YHJ A;  4O2B E;  5DJQ C;  1OWA A;  3EDU A;  1SUM B;  2YDQ A;  2NTX A;  2VKH A;  3MAC A;  4WYV A;  5FYM A;  1S94 A;  1HNX T;  2Q9Q B;  3ZCJ A;  2A3D A;  2XAS B;  1OXZ A;  2XM2 A;  4HEA A;  3J7Y q;  1IJ5 A;  2W67 A;  2LEH A;  3L8R A;  5LBQ B;  2YN6 A;  1OED B;  2GK9 A;  3QOF A;  5CFB A;  1XMO T;  1BR2 A;  3P7I A;  4TNV A;  4Z8X A;  5LA6 E;  1UK5 A;  1UUS A;  4IRE A;  4PFP A;  5AQO B;  2K5B B;  4JUY A;  4QH4 A;  4AIS A;  2IML A;  2WQY A;  3P4S A;  5L3E B;  2LLY A;  2VWA A;  3WAJ A;  4P09 A;  3ZCI A;  3DP7 A;  4O4J E;  1YKH B;  4TZ4 C;  4IE5 A;  3ZEF B;  4P0A A;  4JI3 T;  3A8Y C;  5IYZ E;  5LMU T;  4F8H A;  4H9O C;  1SA0 E;  4KX6 A;  4IDP A;  4H63 H;  4UIG A;  2NP9 A;  4X1K E;  2A2F X;  4ZI7 E;  2IUB A;  2I59 A;  2LE8 A;  5ABE A;  2XPK A;  3AA1 B;  4AKR B;  4DR1 T;  1UX4 A;  4LFB T;  2DWG A;  3UU8 A;  3ZJ2 A;  5IUX A;  1E1H B;  1WRD A;  3FZL B;  4FJO A;  3HKC E;  3ONL C;  4JI7 T;  2D9D A;  2WS3 A;  2WZH A;  4CZZ B;  4NXN T;  1R8I A;  2BVL A;  4KMC A;  4PJL A;  5L4E A;  3UTK A;  4HFD A;  1MIV A;  1T98 A;  1MMA A;  2CBI A;  3GMI A;  4V1A v;  2NW8 A;  2HHH T;  3UUX B;  1N33 T;  1X79 A;  2L3L A;  3AA6 B;  3PUG A;  5EK2 A;  4DO0 A;  4DV2 T;  4X20 E;  2BG9 E;  1HNW T;  3BQI A;  1KF6 A;  1WCR A;  2H3R A;  3EVY A;  3PE0 A;  3TLS A;  4PJJ A;  3Q2M A;  3PUY F;  1QSD A;  4EYY R;  1KNZ A;  2CWO A;  3A5X A;  3F2E A;  3MXZ A;  5L3F B;  3HI2 A;  5JR9 A;  3T1Y T;  2JPF A;  1LVK A;  3DJB A;  4L0R A;  3CQX C;  3BQL A;  4QX8 B;  3QK6 A;  5GON E;  2LKH A;  2NOX A;  3UUB A;  3LFM A;  4DR7 T;  3RYI E;  3B13 A;  4AIU A;  3I9W A;  3EI0 A;  4LF8 T;  5LOV E;  4HWF A;  4LF7 T;  4K0K T;  4DV3 T;  5TAO A;  3C4W A;  5EK4 A;  3P4W A;  1IBL T;  3MKD A;  2XSB A;  4JI0 T;  2KND A;  3CX7 B;  4EAH A;  4IE6 A;  4DR6 T;  1YW0 A;  5ABF A;  2ZLY A;  1VOM A;  2C5J A;  2X9H A;  5FNV E;  4WNK A;  2M6I A;  4PJN A;  3WI3 A;  1KFY A;  3T1H T;  2ODU A;  3L39 A;  4ZI3 C;  1KNP A;  3ZMU B;  2J4G A;  2JQH A;  4OK0 A;  3AE9 A;  1Y01 A;  1SE7 A;  3UQ4 A;  4E7Z A;  3PUZ F;  3MZK B;  2VKJ A;  1VCS A;  5LG4 A;  2VQE T;  3HR0 A;  4EB6 E;  4OX9 T;  2XQ5 A;  1XZY A;  2BS3 A;  2N2N A;  3ETU A;  4LF9 T;  4NUV A;  4YJ2 E;  2XZE A;  3N9M A;  3ZT7 A;  5BR8 T;  3C50 A;  4HFH A;  2PBI A;  5HEH A;  3TLW A;  2VL0 A;  2Q9Q C;  4X5T A;  5HYA A;  2WDQ A;  2CXD A;  5C2T A;  4IT4 A;  1YQ4 A;  1LVF A;  4H9N C;  5JDH A;  4O4H E;  5L3D B;  3ZN0 B;  2MOZ A;  5KXJ A;  3UU3 A;  1W0A A;  4UF0 A;  3T8O A;  4PNI A;  2M67 A;  2V5C A;  3AA7 B;  5E0O A;  5JRC B;  4H9S E;  3U78 A;  2HN1 A;  2HN2 A;  2W2U A;  3KBU A;  4WW0 A;  4DV1 T;  2CE7 A;  3GN5 B;  3LJC A;  5AQL B;  2VUR A;  4C91 A;  1DU2 A;  3RIU C;  2KT9 A;  2L8K A;  3MA9 A;  5JR9 C;  2YIN A;  2FBW A;  2V8S V;  3L3P A;  2KMF A;  3NVO A;  3RX6 A;  4YY3 T;  2X9W A;  3I9Y A;  2XAQ B;  3N5L A;  4TWF A;  2JQ9 A;  4IDN A;  5A1L A;  1H7C A;  5AQI B;  1BR1 A;  2CPT A;  4NUU A;  1T8B A;  2Q9Q A;  2LSK A;  5HEG A;  5FVK A;  4JI2 T;  5L2L A;  4IGU A;  3VKH A;  2CXL A;  4PK4 A;  4GK5 E;  3ZMZ B;  2X9X A;  3FZH B;  5LNK A;  2IC9 A;  3IA3 A;  2YEV C;  1UCU A;  3RRC A;  1XNQ T;  2YU2 A;  4LF4 T;  3P50 A;  2LOS A;  4IE0 A;  2OV9 A;  3RGL A;  4PK5 A;  5JDM A;  2D0T A;  4CI1 B;  3PJA A;  1D0X A;  2CCQ A;  2X0H A;  3RH3 A;  4DV5 T;  4JEU B;  4IDZ A;  1W09 A;  4U7I A;  3FZM B;  4PAG A;  2WP9 A;  5HXH A;  1IZN B;  1US7 B;  4DMW A;  4HWC A;  2BZB A;  3ONJ A;  4ASK A;  2XUE A;  2BG9 A;  3RF1 A;  2E8I A;  2JJ9 A;  2VKD A;  3ANW A;  2FJA A;  3N9O A;  3AE2 A;  4TWH A;  3RYH E;  4HWD A;  3ZN1 B;  4K0U A;  4QH5 A;  1D1A A;  3RIA A;  2Y48 B;  4I50 E;  3C64 A;  2KSR A;  2X67 A;  4PK6 A;  3ZMV B;  1ZHC A;  2A72 A;  1J5E T;  3CKD A;  4ILB A;  2ACX A;  5JRE A;  5IWA T;  5HCM A;  5JDQ A;  4O4L E;  3ABV A;  3RHW A;  3AEF A;  4PW8 A;  4IDQ A;  3VU7 H;  3UU6 A;  1LKX A;  1HG5 A;  3O1I A;  4HFI A;  4O8S A;  4OYK A;  5HXR A;  4DUZ T;  5LB7 B;  2BBH A;  2LT3 A;  2LM2 A;  3D0T A;  4H9P C;  4FI5 A;  2WAU A;  2PTF A;  5FVL A;  3MJX A;  2V5D A;  2V26 A;  2WMO A;  4JEH B;  5EK3 A;  3TLV A;  4DR5 T;  1XDP A;  2DCF A;  4WBO A;  5HEU A;  4DVD A;  4ZHQ E;  1IAP A;  3C51 A;  2IW5 B;  2ZM8 A;  3UFE A;  4EEB A;  1XDO A;  3AAI A;  4CN6 A;  5JQG E;  2UXX B;  3CIR A;  3VR9 A;  4BA9 A;  2YOE A;  3K3O A;  4KI0 F;  4QWN B;  4CXW A;  2LSY A;  4OFZ A;  4I4T E;  4QH1 A;  2WCA A;  3O4X E;  3RYF E;  4IHJ E;  4B6X A;  5J1G A;  1MIW A;  2KIN B;  3RYC E;  3IF8 B;  5FY0 A;  2LSJ A;  3UFG A;  5FY1 A;  2XQ4 A;  2ZM2 A;  4G63 A;  2E5L T;  2KWI B;  2WWU A;  2W61 A;  2CXF A;  1FEW A;  4YTM A;  4AQG A;  4EED A;  3PDY A;  5M4Y A;  2WZI A;  3N2K E;  5F8P A;  5J0Z A;  2VVN A;  5JH7 E;  5DAB A;  4QKN A;  4ZEY A;  4DV6 T;  5F3J A;  3OJA A;  3AEC A;  4MFR A;  4WZX A;  4UR9 A;  2G0U A;  1WYB A;  2JIW A;  1KEY A;  1WR0 A;  5FL0 A;  5L47 A;  2VL8 A;  3OBV E;  1IBK T;  4DV0 T;  2UXC T;  2W66 A;  2HH7 A;  5FP3 A;  3H37 A;  4ZOL E;  2UXD T;  5CA1 E;  5AQJ B;  5L4H A;  3PUA A;  4AKH A;  5AFU L;  2XM1 A;  1G8X A;  4QHO A;  4YJ3 E;  3K8P C;  1HF8 A;  2XQ3 A;  4HGA A;  2XQ8 A;  3FBZ A;  4UEL A;  1S35 A;  5ABG A;  3TLT A;  3KV9 A;  1QLB A;  3JCF A;  2Y8D A;  3EDV A;  4ZS2 A;  4CXY A;  3ZC0 A;  4TN7 B;  5FXX A;  2L9Q A;  2IC6 A;  3DTO A;  4M1P A;  3AVS A;  4DR2 T;  5IHY A;  2BG9 C;  4YTN A;  4TX5 A;  3ESL A;  4BAY B;  3IEE A;  2NW9 A;  5LGU B;  2JRK A;  5LJM A;  1E2A A;  4AQY T;  2C5I T;  3H3A A;  1VRB A;  2FUP A;  2XJ7 A;  3HKE E;  3HKD E;  3PTR B;  4KBM B;  2OLT A;  4TUY E;  4X1Y E;  5H6Q B;  3TKL B;  4IE7 A;  5CB4 E;  1UGO A;  1MMG A;  3AE6 A;  2PJQ A;  2KLQ A;  5AQU B;  5AQQ B;  4GYR A;  3ZLI A;  2CBJ A;  4ZI2 C;  4XZC A;  3V5S A;  4QXC B;  3QB5 A;  4UVB B;  5FXW A;  4B3M T;  2YDR A;  4WBN E;  4GK0 E;  3GWH A;  1LRZ A;  2D0U A;  1J5W A;  2J62 A;  2X0L B;  4KHP T;  3SRZ A;  3PV0 F;  5LG3 A;  1SHZ C;  2WDR A;  5BMV E;  1MMD A;  3PU3 A;  4L5G A;  3OVU A;  4LF5 T;  1ZV4 X;  2JQK A;  2JMK A;  2E9X C;  2H88 A;  3MK7 C;  5LMN T;  2XY8 B;  2W00 A;  2V1D B;  4TWD A;  4J2C A;  3LSV A;  3PJA J;  3FBL A;  4LFC T;  5FKY A;  3M65 A;  2E2A A;  1ZOY A;  3NBX X;  3AEA A;  4OYJ A;  4TNW A;  3R84 B;  2RA1 A;  3QNU A;  4BJM A;  2XTL A;  4MHC A;  2LKG A;  2RPA A;  3ZC1 A;  2UU9 T;  4JI6 T;  2W4X A;  5KMG P;  4LF6 T;  2XAJ B;  3NZQ A;  3R6N A;  3G06 A;  4DBR A;  4B3S T;  3FB2 A;  2MTQ A;  4GKJ T;  3AXJ A;  2V7I A;  3KIN B;  3V5U A;  5J2U E;  1Z8U A;  3JAE A;  5L3G B;  4AKI A;  3ETV A;  4BJN A;  1FMW A;  4ZI3 D;  1WYC A;  2VK9 A;  3FZK B;  3OPC A;  4DMV A;  2J47 A;  5LGT B;  1YD8 G;  3PUX F;  4DND A;  1IBM T;  1HS7 A;  3K1S A;  5HAX A;  2NWB A;  4JI4 T;  3FZF B;  3EAB A;  4HN9 A;  1I6Z A;  1BR0 A;  5LGN B;  2V7K A;  2VB6 A;  2UUA T;  4YHH T;  4ILU A;  2QA7 A;  2WY2 A;  3EAM A;  3P8C D;  4ILA A;  5L3B B;  5FXZ A;  3P4P A;  2IAK A;  5J2T E;  2IDO B;  4EV6 A;  2LSG A;  5HXC A;  4JYA T;  2VKO A;  5HXE A;  3I0Q A;  3IBP A;  3AE8 A;  2YK0 A;  2E9X B;  2N1G A;  2DL1 A;  2V7J A;  2WWV A;  1FJG T;  2Z6E A;  2FJD A;  1MND A;  2I0M A;  3H3M A;  2C0S A;  4MBQ A;  4AKL A;  4X62 T;  4KUM B;  1XMQ T;  2V6Y A;  5LCY A;  2I6H A;  4YT0 A;  2MPK A;  4O2A E;  5LHG B;  4ANJ A;  5HEO A;  2UUB T;  1O3X A;  1Z0P A;  4EIW A;  3F57 A;  3LK3 B;  3RLF F;  3SS1 A;  3Q5X A;  1CUN A;  2XQY A;  3KVB A;  3KFW X;  4NIQ A;  2X51 A;  4U72 A;  5DQV A;  3RKO A;  1VCT A;  5LHH B;  5LBM A;  4A5X A;  2V6X A;  3AE7 A;  2XHE B;  3ZT5 A;  4CI3 B;  2LRL A;  3KBT A;  4UVC B;  2AXD S;  2BG9 B;  3HL6 A;  1ZKE A;  4G2A A;  4ZS3 A;  3KV6 A;  1YKE B;  5LP6 E;  4JI1 T;  3NRX A;  2WMN A;  2HPL A;  3JAD A;  1WFD A;  4DV4 T;  2EHO B;  2B76 A;  3BK9 A;  3FXE B;  2WDV A;  4ZI2 D;  3B57 A;  4IE4 A;  5AQK B;  1HX8 A;  3AE4 A;  4U33 A;  2BS4 A;  3N9Q A;  5C8Y E;  5LYJ E;  4U2Y A;  2XAH B;  5JRC A;  3E08 A;  3O9X A;  4PJM A;  5ABH A;  2ODV A;  3CVR A;  1OED C;  4UVA B;  1L0V A;  5JDF A;  4JI5 T;  4EGW A;  4AQF A;  4EZ4 A;  3OTO T;  2N9D A;  4YSX A;  2M6B A;  2CWY A;  2K3W A;  4JI8 T;  3UU5 A;  5AQR B;  3AA0 B;  1I94 T;  2OA5 A;  2CEA A;  4IST A;  2NTY A;  4LML A;  5ETW A;  3C98 B;  4JBW F;  1HFA A;  4AXP A;  4IDO A;  3AED A;  4U2Z A;  1V9D A;  2H7O A;  2MYS A;  3N9P A;  3PU8 A;  5LJN A;  5JTG A;  2LOP A;  4HFV A;  1OED A;  3HKB E;  3N2G E;  1B7T A;  3O1J A;  3ONX A;  3ZMS B;  4JV5 T;  1OED E;  3F31 A;  2CA5 A;  4P1N A;  3KV5 A;  2MBG A;  4Q25 A;  3RPU A;  1N32 T;  4TV8 E;  4P0B A;  3C4Z A;  2H7V C;  3AAA B;  4HFB A;  2LM9 A;  2K9A A;  3A7M A;  1BR4 A;  5KX5 E;  2K48 A;  3Q5E A;  3WAK A;  3RI5 A;  4ZZC A;  1EZ3 A;  2D5U A;  2EHO C;  3UT5 E;  4TV9 E;  4Z90 A;  2LHR A;  3ZT6 A;  4EXT A;  1U5P A;  3J9X 1;  2WU5 A;  3ANW B;  2KZ7 B;  4UV8 B;  4IIJ E;  1JNZ A;  4Z91 A;  3NWI A;  3UQ7 A;  4QXB B;  2Y6X A;  3VRA A;  3VRB A;  4YXD A;  3QB5 K;  4H63 V;  3CML A;  5AQV B;  2X0Y A;  1ZEE A;  2WM9 A;  5FXV A;  2YKS A;  5FL1 A;  4DV7 T;  1NWM X;  2SPC A;  3N9L A;  4ADZ A;  5JDG A;  3P4Q A;  4EOZ B;  1WR6 A;  2C5K T;  2E5V A;  2LHN A;  3KVA A;  3CQC B;  3EHZ A;  2QRX A;  3N2O A;  3NZP A;  1YXR A;  2KWH A;  4AI6 A;  3AXJ B;  2D2S A;  1E7P A;  3PUV F;  2X9Y A;  1QUU A;  3SWH A;  5CGM A;  3OYX A;  4L9I A;  2Q9Q D;  3NKZ A;  2QGS A;  3LDQ B;  1FMV A;  3Q9D A;  3S4U A;  4DR3 T;  2V7M A;  4UEM A;  1JNR A;  3IHR A;  2ACZ A;  2BS2 A;  3X1D A;  4H9Q C;  2ZMA A;  5JVD E;  2CMR A;  4HWH A;  3K3N A;  5AQH B;  3RC3 A;  4U7Y A;  1MIY A;  2DHR A;  2A9U A;  2P9B A;  3RKG A;  1HCI A;  2KXP B;  3AEG A;  5C3J A;  2QVA A;  2XSA A;  2LSI A;  4X66 T;  2LJL A;  4DBQ A;  5AQF B;  2H89 A;  2CRB A;  3AVR A;  5AQT B;  5LXT E;  2ES0 A;  3RQU A;  3ZST A;  5CJ5 A;  4X64 T;  1W9R A;  4LMK A;  2F4V T;  2CLY C;  4OHF A;  2UUC T;  2XAF B;  3UUL A;  4CXX A;  3AAE B;  2UXN B;  3FXD B;  3LK4 2;  3BQK A;  3Q5W A;  4IL9 A;  4AQF C;  4HWI B;  1NEK A;  2BDE A;  1UX5 A;  1NEN A;  2BKN A;  2FJB A;  2W0G A;  4H9R C;  4XAX B;  2BBJ A;  3QC9 A;  2VVS A;  4CN1 A;  3ZYL A;  1YQ3 A;  1T7S A;  4DUY T;  4B3T T;  4I43 B;  5AQS B;  2NW7 A;  1J1J A;  1GQE A;  3B5M A;  3VKG A;  3U3I A;  1G73 A;  2WSS V;  2V7L A;  2W63 A;  1W0B A;  2LRK A;  2QYW A;  3AE5 A;  3SOL A;  5JDN A;  2VQF T;  3LBX A;  5KDM C;  3L09 A;  1ZP0 A;  5CA0 E;  2FJE A;  4I55 E;  1HG2 A;  4A97 A;  3AEE A;  3M3Z B;  1AJ3 A;  2CHO A;  4ILC A;  4MAL A;  4QX7 B;  5FMN A;  1UUR A;  2V6Y B;  4C90 A;  4ZZB A;  3PUQ A;  4X1I E;  3CQG B;  3PUR A;  3ZKR A;  4AKG A;  3W15 B;  3OKQ A;  5JR9 B;  2IIU A;  4UV9 B;  4YTP A;  3GA8 A;  3KDS E;  3SFE A;  3Q5D A;  2X68 A;  1D0Z A;  4CI2 B;  3SFD A;  2K24 A;  2XQ6 A;  2XQ9 A;  3HA4 A;  3C4X A;  2PFV A;  2XAG B;  3AEB A;  4YLH A;  4QXH B;  3RIU A;  2YU1 A;  4F6R C;  5F5W A;  3NRY A;  3ZSS A;  4EZH A;  1HNZ T;  4U31 A;  5LHI B;  2R6G F;  1Y64 B;  3I1A A;  2DI4 A;  1D0Y A;  1FIO A;  2XQ7 A;  4YFS A;  3VR8 A;  3ZYK A;  4EYU A;  2CLY B;  2WBL A;  3PUS A;  3UUM A;  4ISS A;  1M62 A;  2EHO D;  5H6R B;  3RIF A;  1T72 A;  1N36 T;  1WLX A;  5AQG B;  5FY7 A;  2CHN A;  3CK6 A;  3TLU A;  3ZPO A;  2IHR 1;  3O1H A;  1N34 T;  2WU2 A;  4CQI A;  3JC6 C;  4X65 T;  2EHO A;  4O4I E;  1MMN A;  5AQP B;  1KNR A;  5ABF B;  2B1E A;  5AQN B;  4A98 A;  3P4R A;  1XWM A;  2J1D G;  2BKO A;  3E22 E;  3JC6 D;  3LG7 A;  3KV4 A;  4DID B;  2CM0 A;  4PFO A;  1D1B A;  3AE1 A;  4U74 A;  4LFA T;  4YSY A;  3ZYM A;  2E9X D; 
#chains in the Genus database with same CATH homology
 1HX1 B;  4HWI B;  3FZH B;  3FZL B;  1T7S A;  4HWF A;  3LDQ B;  5AQS B;  2D9D A;  1M62 A;  5AQK B;  1UGO A;  3FZM B;  5AQG B;  5AQM B;  1I6Z A;  4HWH A;  1M7K A;  5AQH B;  5AQU B;  4HWC A;  5AQQ B;  1UK5 A;  5AQJ B;  5AQL B;  5AQO B;  3M3Z B;  5AQP B;  5AQF B;  4HWD A;  5AQN B;  3FZK B;  5AQR B;  5AQT B;  5AQV B;  3A8Y C;  5AQI B;  3FZF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...