5AQMB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
112
structure length
112
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 44
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqmB00
1M7KA 5AQVB 3FZKB 5AQTB 5AQLB 3M3ZB 3A8YC 5AQPB 5AQQB 2D9DA 5AQMB 5AQHB 3FZMB 4HWFA 1UGOA 1UK5A 5AQGB 1M62A 5AQSB 3FZFB 5AQOB 4HWIB 1I6ZA 4HWCA 5AQNB 3FZLB 5AQRB 5AQFB 4HWDA 4HWHA 5AQKB 1T7SA 1HX1B 5AQIB 3FZHB 5AQJB 3LDQB 5AQUB
chains in the Genus database with same CATH superfamily
3W15B 1M7KA 3AEBA 3RYFE 3UTKA 2WAUA 4ERRA 4LF9T 2FJDA 3QNUA 1VRBA 4AKLA 3TLVA 2LM9A 3ZT5A 1UX4A 1XDOA 3O1JA 4IDOA 2CCQA 3AECA 4QH1A 2VVNA 2QYWA 3I9YA 4IGUA 4O4IE 2W62A 3L39A 4ZS3A 1BR1A 5BMVE 4TNVA 1FMWA 3CVRA 1D1BA 5FXWA 3VRAA 4ANJA 3AEAA 2LM2A 2CXDA 2NTXA 3AE2A 3C4ZA 3R6NA 5LYJE 2FJBA 1HS7A 3KINB 4KHZF 3ZMZB 3OKQA 3UUXB 5IWAT 3LJCA 1S35A 3CMLA 3C50A 3PE0A 4X1IE 2BG9E 3RYIE 1XMOT 4HEAA 1WYBA 1DU2A 2JIWA 2H89A 1W9RA 2UXXB 2V1DB 4NIQA 4IT4A 3J9X1 3ANWB 3RH3A 3JCFA 1MIYA 3ESLA 3LBXB 3NZPA 2X9YA 3A7MA 3RIFA 3S4UA 1ZOYA 4IE6A 4F8HA 4TZ4C 4EYUA 5ABFB 5L4EA 2CLYC 4WZXA 4CZZB 3UT5E 2JQ9A 2CWYA 2VURA 2XAQB 2JQKA 5LMUT 4LFBT 1D0XA 2X9XA 3O9XA 4PAGA 2E5LT 4DR4T 2NW7A 3AVSA 4DV3T 1FIOA 2CE7A 1WYCA 2HPJA 2NP9A 2J47A 2LOSA 3EABA 3KVAA 3K3NA 4IHJE 3LSVA 2B76A 3MZKB 3PV0F 5FY0A 4DV1T 2X0HA 4DV2T 3ZCIA 4HE8A 5AFUL 4DMVA 4GYRA 2GK9A 1Y01A 3AE4A 1OEDE 5HEUA 4UV9B 4AI6A 4P0AA 1YKEB 2LJLA 4ZOLE 5JVDE 3GWHA 3PU8A 4X62T 2LOPA 5LGUB 3I1AA 4ZI7E 4U72A 4DVDA 3BK9A 2H7VC 3AB3B 4N78D 4BAYB 2HHHT 2WP9A 5A1LA 1UURA 2BS3A 2OA5A 4QWNB 4PJJA 2JQHA 2BBJA 4EXTA 2XQYA 3ZMVB 5ABHA 5F8PA 2XQ9A 1QUUA 2XSBA 2CXFA 5LG3A 4DBRA 5FKYA 4DNDA 2KSRA 2BKOA 3WAKA 2CWOA 2V6YB 5AQQB 3AA1B 1N36T 2KXPB 3V5UA 2YDQA 2JQQA 4H9NC 3KV5A 2D2SA 3UUMA 2XASB 5JDGA 1D0ZA 5KXJA 1HF8A 3AA0B 4ZI3D 4QH4A 3QUJA 5F3JA 2JRKA 2VQET 3HR0A 3T1YT 2CM0A 3EAMA 5IUXA 2YU1A 4UV8B 1FMVA 2CA5A 3FZLB 2PFVA 3HA4A 4KX6A 5LCYA 4K0UA 1U5PA 1T8BA 3TLUA 3ZYLA 5HXHA 5L47A 4EAHA 3RLFF 1E1HB 3FXDB 1J1JA 2VWAA 2NTYA 4M1PA 3ZCJA 3ZYKA 3QB5A 4BA9A 2WM9A 3AE7A 3D0TA 4YJ2E 4GK0E 2RP4A 4HFIA 4OYJA 2ZM8A 2A9UA 3J7Yq 3SFDA 1Z0PA 4MHCA 2PTFA 2UU9T 3CX6B 4LFAT 3PDYA 4EB6E 5E0OA 3AAAB 2IW5B 1ZHCA 4GOUA 4DUYT 2IC6A 1L0VA 4AKIA 4U31A 1KNPA 2KLQA 3AAEB 4HFDA 3ZMTB 4B3MT 4LMJA 4IE5A 2UXDT 1QLBA 2LSGA 2LKHA 1H7CA 2JMHA 2KT9A 1M62A 1MMAA 3A5XA 3O1HA 2L3LA 2VKOA 4NPPA 2I6HA 2LRLA 2XY8B 4X5TA 5HXSA 4JEHB 3EUHA 1BR0A 4TWDA 4H63H 3RC8A 4EEDA 3GN5A 4KHPT 2Z6EA 2C0SA 2LHNA 1D0YA 2A3DA 3KVBA 4I50E 3UQ4A 5AQFB 2W2UA 1MIWA 5AQKB 2OLTA 3FB2A 3ZSTA 4O4HE 3HKBE 2ZM0A 2P9BA 4UIGA 1J5ET 3P4QA 2C5JA 1NEKA 4LF6T 3QC9A 4TN7B 3AE1A 3IHRA 1E7PA 1U4QA 2E2AA 1CHUA 4HFEA 4YTNA 4JI6T 5FXVA 2VVSA 3N2OA 1WFDA 4LF5T 3CQCB 1S94A 4H9OC 4X66T 2BG9C 2X66A 3E22E 4ZHQE 5LGTB 3ZT6A 3RRWA 2BS4A 5KMGP 4YT0A 2X68A 5J2TE 1W0AA 1OWAA 2EHOB 3C98B 1KNRA 2WU2A 3LBXA 1SA0E 4ISSA 4P1NA 3OBVE 3AVRA 2DWGA 5HXRA 4KBMB 2Q9QD 4X1YE 4ZZBA 1E2AA 2IIUA 3H3MA 2KINB 2CLYB 5EZYE 4DV0T 4DR1T 4LMKA 3PUYF 1JNRA 4A56A 3P4SA 4CI1B 3N9OA 4IE4A 3AXJA 5JDQA 5LHHB 3PUVF 3RGLA 1OEDB 4I4TE 1IJ6A 4MLKA 4CXWA 5LP6E 5FYMA 1EZ3A 1N34T 3N2KE 4O8SA 3U78A 1WR0A 5DJQC 3I0QA 4AISA 2FJAA 5IYZE 3UULA 2XM1A 3RYCE 1NAFA 5CGMA 1W0BA 2MPKA 2SPCA 4PK6A 3RIUA 2XQ3A 3SRZA 5C2TA 1MMDA 3RPUA 1XNQT 3DJBA 4PJLA 4FJOA 3PUAA 5C3JA 3PTRB 4JV5T 5JR9B 5HXEA 5HYAA 1SE7A 4AKRB 4DV5T 2KZ7B 3Q5EA 4GYSA 4H9PC 4H9SE 2V6YA 5J1GA 4AQFA 2RA1A 3PUXF 4J2CA 5LOVE 3PU3A 4CXXA 4DV4T 1HR0T 3PUSA 4HFVA 3UU8A 4HFBA 3OJAA 3C4WA 3IA3A 3B57A 4P0BA 3VR8A 2FBWA 3QB5K 4TX5A 5CA1E 5ABEA 5JH7E 5HEOA 4WBOA 3CK6A 3LK2B 2M6IA 3CWZB 2Q9QA 2X9WA 3Q9DA 2BZBA 5J2UE 4AQFC 3T1HT 2V7MA 4ILAA 5BR8T 2V26A 2XQ5A 2CPTA 3KBUA 2XAHB 2J1DG 3ZYMA 1W09A 5JTGA 5H6QB 4KI0F 1WCRA 2N9DA 3AXJB 4Z8XA 2V5CA 3SS1A 2CRBA 5AQHB 4UVAB 3N9PA 4GKKT 4O4LE 4UF0B 4X65T 3HI2A 4U74A 3C64A 2LSYA 4U33A 1IJ5A 3GN5B 3ZMSB 3B13A 4HWIB 3HKDE 4YJ3E 2CXLA 3DP7A 3CQXC 4HWCA 4OHFA 3RQWA 5AQRB 3PUWF 3ZEFB 3PUQA 3VKHA 1XWMA 2VB6A 2A2FX 2Y6XA 3KV9A 4QX8B 2WMNA 2XJ7A 2V7LA 1B7TA 4L0RA 4H63V 4JYAT 3ZC1A 2IHR1 1N33T 4XBFB 1KNZA 2LSJA 4H9RC 2W00A 3AA6B 2LRKA 2XQ7A 3FBZA 3LK42 3NRXA 5AQLB 4YSYA 1D1AA 3AAIA 3BQIA 5KDMC 4UEMA 5L3EB 4O2BE 3IBPA 4ZI3C 3FBLA 2XUEA 5L4HA 4JI2T 3JADA 1UK5A 4HFCA 5JDLA 1G8XA 2XAGB 4HN9A 4B3TT 2J62A 3Q2MA 4YHJA 3AEDA 2LSKA 2V7KA 3N9LA 2XHEB 4DR2T 2Q9QC 3EDUA 4IDQA 5LBQB 3AEGA 3CPZA 4JI3T 4B3ST 4NUUA 4EGWA 1MNEA 4JI1T 2ZLYA 2JJ9A 2NR4A 3MJXA 3MACA 1OEDA 2HPLA 3CX8B 4U2YA 3U3IA 1HX1B 1T7SA 4ADZA 4EIWA 3N5LA 3FZHB 1ZP0A 1LRZA 2IMLA 3E0ZA 1KEYA 4IDPA 4TWFA 3P50A 3UQ7A 4LF4T 2X67A 4PJNA 4PFOA 3RI5A 4EEBA 4EZHA 2IDOB 4TV8E 3AE5A 5L3BB 1HNWT 2BG9A 3AE9A 1HFAA 2YDRA 5FMNA 3SFEA 4ASKA 3JAEA 2V5DA 3B5MA 4IL4A 4B3RT 2D9DA 2AE9A 5HEGA 3L3PA 4UR9A 5LBMA 1KFYA 1VCSA 4E7ZA 2DWKA 2YINA 2YKSA 3RX6A 4QXCB 2JMKA 2NW8A 4EYYR 2VKDA 3FHNA 3Q5XA 1D1CA 2HH7A 4V1Av 5AQOB 2FJEA 3TLTA 2E9XB 4U3CA 4JI4T 2A72A 2XQ4A 3ONJA 1X9BA 2BKPA 2W4XA 2W63A 3DTOA 5HXCA 3ZMUB 3CX7B 5KX5E 1MNDA 2CHOA 2E9XA 2WQYA 2NWBA 5JREA 1HG2A 1Z8UA 4GIWA 3L8RA 2F4VT 4UVCB 1UUSA 2ES0A 3ZT7A 2PG8A 1NWMX 2IUBA 3QOFA 3QK6A 4ISTA 5AQVB 1R8IA 2ACZA 4DR3T 3N9NA 4IL9A 2BKNA 5JRCB 2DI4A 2NW9A 4TWHA 2YEVC 3M3ZB 4HGAA 5M4YA 2V6XA 2W66A 3MXZA 4KMCA 5FVKA 5FVLA 3VKGA 1SHZC 4HWFA 5ABFA 5HWYA 3FXEB 4DO0A 5HCMA 2MOZA 4MALA 4YSXA 1YD8G 3MA9A 3F57A 1YQ3A 2E9XD 3KDSE 3PJAA 3T8OA 3ZN0B 2V8SV 5CJ5A 4EOZB 3AEFA 4C91A 5DQWA 1XNRT 3K3OA 4IE7A 3VR9A 5L3GB 3NVOA 4AXPA 1J5WA 2BBHA 4I43B 3ZC0A 1OXZA 4HWHA 5DQVA 2WU5A 5CA0E 4DUZT 2C5IT 1VCTA 4AKGA 2CMRA 4YY3T 3EVYA 3HKCE 3P8CD 4OK0A 3PURA 4UXNB 4AIUA 5L3DB 4K0KT 2KWIB 3KBTA 1YW0A 1X79A 2K48A 3IF8B 2C5KT 1G73A 2DL1A 4L9IA 3I9WA 2XZEA 3KV6A 4FI5A 5LJNA 1FJGT 2UUBT 2IC9A 4BJMA 1WR6A 2LEHA 4IDNA 5EK2A 2D5UA 1XMQT 3KFWX 4ZEYA 1UX5A 4DIDB 5TAOA 5JDNA 3I0OA 4QXBB 5HEHA 4F6RC 1UGOA 1XZYA 4WNKA 2DCFA 3RHWA 3R84B 2QVAA 4DV6T 5ABGA 2WWUA 1IBKT 3FZFB 2E8IA 1NENA 3C51A 4JI7T 1MMGA 3UU3A 3EHZA 2H3RA 3N9MA 3PUGA 4MBQA 4DR6T 2EHOC 2UXCT 5LA6E 1HG5A 3K3QC 3ZKRA 5IHYA 1HNZT 4DBQA 4NXMT 2DNXA 2NOXA 3C4XA 1ZKEA 2KWHA 2MAWA 2WWVA 2VKJA 2WZIA 1UCUA 2L9QA 4EZ4A 4Q25A 2WSSV 2X51A 2WY2A 4YLHA 3VU7H 4ZS2A 4Z90A 2CHNA 3E08A 2UXNB 4G2AA 4ZZCA 4CI3B 4ZXLA 5C8YE 5L2LA 3RIUC 2UUAT 2XM2A 1MMNA 1ZEEA 2K5BB 4YTMA 1WRDA 2Q9QB 4DR5T 2M6BA 3RQUA 4IDZA 4U7IA 3UFEA 2X0YA 3VHLA 5AQSB 3V5SA 1BR4A 2UXBT 1O3XA 2BVLA 3BQLA 3Q5WA 3G06A 3H3AA 4QHOA 4JI8T 1LKXA 3KV4A 2R6GF 2IAKA 2N2NA 3L09A 4OFZA 5FNVE 2LE8A 1BR2A 2WDRA 2VKHA 4HWDA 3CIRA 2BS2A 3IEEA 4ZI2C 3N9QA 5LNKA 3SWHA 5FXXA 4PFPA 1T98A 3F31A 5AQJB 3K8PC 2H88A 2WDQA 2AXDS 4QXHB 1IZNB 2K24A 3P7IA 5AQUB 2L8KA 2H7OA 2WZHA 3OYZA 4I0UA 5FXZA 3TLWA 4A5XA 4PW8A 3O4XE 3RYHE 5LHGB 5JQGE 2YK0A 4QH5A 3FZKB 4QKNA 4TUYE 4AQYT 1N32T 3A8YC 2LKGA 4JBWF 3UU6A 1VOMA 4LMLA 1XDPA 1YXRA 2KNDA 4KP3C 2FUPA 3UUBA 4YTPA 3CKDA 3PJAJ 2WCAA 5FY1A 2VK9A 3OPCA 2MBGA 4CXYA 4G63A 4KUMB 5AQGB 4DMWA 5L3FB 5JDFA 2J4GA 4ILUA 5J0ZA 4DR7T 2CBJA 4COFA 1LVFA 2DLRA 5ETWA 3ABVA 3OYXA 2N1GA 1AJ3A 1I6ZA 5FL0A 4XZCA 4IE0A 3HL6A 3JAFA 3NZQA 4CI2B 2D0UA 4O4JE 5AQIB 2PJQA 3ZJ1A 1SUMB 3AE3A 4I55E 4B6XA 1LVKA 1FEWA 2DHRA 2EHOA 2JPFA 2VL0A 3N2GE 4P09A 1WLXA 4WW0A 5LB7B 4LF7T 4UELA 4YSZA 4EV6A 5ADXL 5DABA 3Q5DA 3ZLIA 5H6RB 2HN1A 3ZJ2A 5JDHA 2K3WA 2LLYA 2X9HA 3AA7B 4HKAA 5HCJA 3RC3A 4ZI2D 5AQPB 3RF1A 2MYSA 4Z91A 3ETVA 5GONE 2I59A 3NKZA 4U7YA 1MIVA 4O2AE 3ONLC 3RIAA 4BJNA 2CEAA 2YU2A 3RKGA 3AE8A 2WMOA 2CBIA 2ZM2A 1I94T 1YQ4A 3TKLB 2G0UA 3UUNA 2VQFT 4AQGA 4XAXB 3EDVA 3OTOT 3JC6C 2W0GA 4JEUB 3TLSA 5HEJA 2XTLA 4CN6A 1CUNA 3CQGB 1V9DA 2QRXA 2EHOD 3AE6A 5LMNT 2ZMAA 4CN4A 4PK5A 4PK4A 4A98A 5CFBA 4GKJT 5FY7A 4X1KE 2HN2A 3P4RA 2ACXA 2BVMA 4JUYA 2YN6A 3ZPOA 2E5VA 2D0TA 1IBMT 3ONXA 3LG7A 2LSIA 4JLEA 5JDMA 3PUZF 2XAJB 5LHIB 1HX8A 2BG9B 2Y48B 3OVUA 5CB4E 4L5GA 4ILCA 4QX7B 3X1DA 5L3CB 1IBLT 4U2ZA 2W67A 4GK5E 3LK3B 2XAFB 4E7SA 3GMIA 1HCIA 2LT3A 3VRBA 2QGSA 2YOEA 3BQKA 3P4PA 2XSAA 3AEEA 2I0MA 2LHRA 2OV9A 3NWIA 5JR9A 3M65A 3UU4A 4WBNE 2VASA 4DV7T 2Y8DA 2BDEA 2WS3A 5FL1A 4NUVA 1OEDC 4HTEA 3ZN1B 2QA7A 3JC6D 4UVBB 4C90A 4LFCT 4OX9T 4X20E 3P4WA 3ETUA 2ODVA 3MK7C 3O1IA 4IREA 4AKHA 1YKHB 2KMFA 5EK3A 2E9XC 2W61A 3LDQB 4HFHA 2XQ6A 5EK4A 4CN1A 4JI0T 4TNWA 4LF8T 3WI3A 3LFMA 2WB5A 2ODUA 1IAPA 5LGNB 3RKOA 5LXTE 3HKEE 3ANWA 5AQTB 5F5WA 3EI0A 3UFGA 4YHHT 2X0LB 4IIJE 3NBXX 1QSDA 2YDSA 5JR9C 5AQMB 4YFSA 1HTJF 1GQEA 3UU5A 2PBIA 3FZMB 4YXDA 2VL8A 1JNZA 3NRYA 1T72A 3WAJA 4X64T 5HWXA 5LJMA 3ZSSA 1HNXT 3F2EA 4MFRA 2V7IA 4PNIA 4TV9E 4CQIA 2K9AA 4NXNT 1Y64B 2WDVA 3RRCA 3K1SA 5FP3A 3SOLA 5JRCA 4WYVA 4OYKA 2B1EA 2RPAA 3GA8A 5HAXA 2WBLA 5LG4A 2ZM6T 3H37A 4ILBA 5AQNB 2MTQA 2XPKA 3MKDA 4PJMA 1KK7A 1ZV4X 2M67A 4H9QC 1US7B 2V7JA 4JI5T 4UF0A 1KF6A 2UUCT 2XQ8A 4A97A 2XQAA
chains in the Genus database with same CATH topology
1M7KA 5AQVB 3FZKB 5AQTB 5AQLB 3M3ZB 3A8YC 5AQPB 5AQQB 2D9DA 5AQMB 5AQHB 3FZMB 4HWFA 1UGOA 1UK5A 5AQGB 1M62A 5AQSB 3FZFB 5AQOB 4HWIB 1I6ZA 4HWCA 5AQNB 3FZLB 5AQRB 5AQFB 4HWDA 4HWHA 5AQKB 1T7SA 1HX1B 5AQIB 3FZHB 5AQJB 3LDQB 5AQUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7K A;  5AQV B;  3FZK B;  5AQT B;  5AQL B;  3M3Z B;  3A8Y C;  5AQP B;  5AQQ B;  2D9D A;  5AQM B;  5AQH B;  3FZM B;  4HWF A;  1UGO A;  1UK5 A;  5AQG B;  1M62 A;  5AQS B;  3FZF B;  5AQO B;  4HWI B;  1I6Z A;  4HWC A;  5AQN B;  3FZL B;  5AQR B;  5AQF B;  4HWD A;  4HWH A;  5AQK B;  1T7S A;  1HX1 B;  5AQI B;  3FZH B;  5AQJ B;  3LDQ B;  5AQU B; 
#chains in the Genus database with same CATH topology
 3W15 B;  1M7K A;  3AEB A;  3RYF E;  3UTK A;  2WAU A;  4ERR A;  4LF9 T;  2FJD A;  3QNU A;  1VRB A;  4AKL A;  3TLV A;  2LM9 A;  3ZT5 A;  1UX4 A;  1XDO A;  3O1J A;  4IDO A;  2CCQ A;  3AEC A;  4QH1 A;  2VVN A;  2QYW A;  3I9Y A;  4IGU A;  4O4I E;  2W62 A;  3L39 A;  4ZS3 A;  1BR1 A;  5BMV E;  4TNV A;  1FMW A;  3CVR A;  1D1B A;  5FXW A;  3VRA A;  4ANJ A;  3AEA A;  2LM2 A;  2CXD A;  2NTX A;  3AE2 A;  3C4Z A;  3R6N A;  5LYJ E;  2FJB A;  1HS7 A;  3KIN B;  4KHZ F;  3ZMZ B;  3OKQ A;  3UUX B;  5IWA T;  3LJC A;  1S35 A;  3CML A;  3C50 A;  3PE0 A;  4X1I E;  2BG9 E;  3RYI E;  1XMO T;  4HEA A;  1WYB A;  1DU2 A;  2JIW A;  2H89 A;  1W9R A;  2UXX B;  2V1D B;  4NIQ A;  4IT4 A;  3J9X 1;  3ANW B;  3RH3 A;  3JCF A;  1MIY A;  3ESL A;  3LBX B;  3NZP A;  2X9Y A;  3A7M A;  3RIF A;  3S4U A;  1ZOY A;  4IE6 A;  4F8H A;  4TZ4 C;  4EYU A;  5ABF B;  5L4E A;  2CLY C;  4WZX A;  4CZZ B;  3UT5 E;  2JQ9 A;  2CWY A;  2VUR A;  2XAQ B;  2JQK A;  5LMU T;  4LFB T;  1D0X A;  2X9X A;  3O9X A;  4PAG A;  2E5L T;  4DR4 T;  2NW7 A;  3AVS A;  4DV3 T;  1FIO A;  2CE7 A;  1WYC A;  2HPJ A;  2NP9 A;  2J47 A;  2LOS A;  3EAB A;  3KVA A;  3K3N A;  4IHJ E;  3LSV A;  2B76 A;  3MZK B;  3PV0 F;  5FY0 A;  4DV1 T;  2X0H A;  4DV2 T;  3ZCI A;  4HE8 A;  5AFU L;  4DMV A;  4GYR A;  2GK9 A;  1Y01 A;  3AE4 A;  1OED E;  5HEU A;  4UV9 B;  4AI6 A;  4P0A A;  1YKE B;  2LJL A;  4ZOL E;  5JVD E;  3GWH A;  3PU8 A;  4X62 T;  2LOP A;  5LGU B;  3I1A A;  4ZI7 E;  4U72 A;  4DVD A;  3BK9 A;  2H7V C;  3AB3 B;  4N78 D;  4BAY B;  2HHH T;  2WP9 A;  5A1L A;  1UUR A;  2BS3 A;  2OA5 A;  4QWN B;  4PJJ A;  2JQH A;  2BBJ A;  4EXT A;  2XQY A;  3ZMV B;  5ABH A;  5F8P A;  2XQ9 A;  1QUU A;  2XSB A;  2CXF A;  5LG3 A;  4DBR A;  5FKY A;  4DND A;  2KSR A;  2BKO A;  3WAK A;  2CWO A;  2V6Y B;  5AQQ B;  3AA1 B;  1N36 T;  2KXP B;  3V5U A;  2YDQ A;  2JQQ A;  4H9N C;  3KV5 A;  2D2S A;  3UUM A;  2XAS B;  5JDG A;  1D0Z A;  5KXJ A;  1HF8 A;  3AA0 B;  4ZI3 D;  4QH4 A;  3QUJ A;  5F3J A;  2JRK A;  2VQE T;  3HR0 A;  3T1Y T;  2CM0 A;  3EAM A;  5IUX A;  2YU1 A;  4UV8 B;  1FMV A;  2CA5 A;  3FZL B;  2PFV A;  3HA4 A;  4KX6 A;  5LCY A;  4K0U A;  1U5P A;  1T8B A;  3TLU A;  3ZYL A;  5HXH A;  5L47 A;  4EAH A;  3RLF F;  1E1H B;  3FXD B;  1J1J A;  2VWA A;  2NTY A;  4M1P A;  3ZCJ A;  3ZYK A;  3QB5 A;  4BA9 A;  2WM9 A;  3AE7 A;  3D0T A;  4YJ2 E;  4GK0 E;  2RP4 A;  4HFI A;  4OYJ A;  2ZM8 A;  2A9U A;  3J7Y q;  3SFD A;  1Z0P A;  4MHC A;  2PTF A;  2UU9 T;  3CX6 B;  4LFA T;  3PDY A;  4EB6 E;  5E0O A;  3AAA B;  2IW5 B;  1ZHC A;  4GOU A;  4DUY T;  2IC6 A;  1L0V A;  4AKI A;  4U31 A;  1KNP A;  2KLQ A;  3AAE B;  4HFD A;  3ZMT B;  4B3M T;  4LMJ A;  4IE5 A;  2UXD T;  1QLB A;  2LSG A;  2LKH A;  1H7C A;  2JMH A;  2KT9 A;  1M62 A;  1MMA A;  3A5X A;  3O1H A;  2L3L A;  2VKO A;  4NPP A;  2I6H A;  2LRL A;  2XY8 B;  4X5T A;  5HXS A;  4JEH B;  3EUH A;  1BR0 A;  4TWD A;  4H63 H;  3RC8 A;  4EED A;  3GN5 A;  4KHP T;  2Z6E A;  2C0S A;  2LHN A;  1D0Y A;  2A3D A;  3KVB A;  4I50 E;  3UQ4 A;  5AQF B;  2W2U A;  1MIW A;  5AQK B;  2OLT A;  3FB2 A;  3ZST A;  4O4H E;  3HKB E;  2ZM0 A;  2P9B A;  4UIG A;  1J5E T;  3P4Q A;  2C5J A;  1NEK A;  4LF6 T;  3QC9 A;  4TN7 B;  3AE1 A;  3IHR A;  1E7P A;  1U4Q A;  2E2A A;  1CHU A;  4HFE A;  4YTN A;  4JI6 T;  5FXV A;  2VVS A;  3N2O A;  1WFD A;  4LF5 T;  3CQC B;  1S94 A;  4H9O C;  4X66 T;  2BG9 C;  2X66 A;  3E22 E;  4ZHQ E;  5LGT B;  3ZT6 A;  3RRW A;  2BS4 A;  5KMG P;  4YT0 A;  2X68 A;  5J2T E;  1W0A A;  1OWA A;  2EHO B;  3C98 B;  1KNR A;  2WU2 A;  3LBX A;  1SA0 E;  4ISS A;  4P1N A;  3OBV E;  3AVR A;  2DWG A;  5HXR A;  4KBM B;  2Q9Q D;  4X1Y E;  4ZZB A;  1E2A A;  2IIU A;  3H3M A;  2KIN B;  2CLY B;  5EZY E;  4DV0 T;  4DR1 T;  4LMK A;  3PUY F;  1JNR A;  4A56 A;  3P4S A;  4CI1 B;  3N9O A;  4IE4 A;  3AXJ A;  5JDQ A;  5LHH B;  3PUV F;  3RGL A;  1OED B;  4I4T E;  1IJ6 A;  4MLK A;  4CXW A;  5LP6 E;  5FYM A;  1EZ3 A;  1N34 T;  3N2K E;  4O8S A;  3U78 A;  1WR0 A;  5DJQ C;  3I0Q A;  4AIS A;  2FJA A;  5IYZ E;  3UUL A;  2XM1 A;  3RYC E;  1NAF A;  5CGM A;  1W0B A;  2MPK A;  2SPC A;  4PK6 A;  3RIU A;  2XQ3 A;  3SRZ A;  5C2T A;  1MMD A;  3RPU A;  1XNQ T;  3DJB A;  4PJL A;  4FJO A;  3PUA A;  5C3J A;  3PTR B;  4JV5 T;  5JR9 B;  5HXE A;  5HYA A;  1SE7 A;  4AKR B;  4DV5 T;  2KZ7 B;  3Q5E A;  4GYS A;  4H9P C;  4H9S E;  2V6Y A;  5J1G A;  4AQF A;  2RA1 A;  3PUX F;  4J2C A;  5LOV E;  3PU3 A;  4CXX A;  4DV4 T;  1HR0 T;  3PUS A;  4HFV A;  3UU8 A;  4HFB A;  3OJA A;  3C4W A;  3IA3 A;  3B57 A;  4P0B A;  3VR8 A;  2FBW A;  3QB5 K;  4TX5 A;  5CA1 E;  5ABE A;  5JH7 E;  5HEO A;  4WBO A;  3CK6 A;  3LK2 B;  2M6I A;  3CWZ B;  2Q9Q A;  2X9W A;  3Q9D A;  2BZB A;  5J2U E;  4AQF C;  3T1H T;  2V7M A;  4ILA A;  5BR8 T;  2V26 A;  2XQ5 A;  2CPT A;  3KBU A;  2XAH B;  2J1D G;  3ZYM A;  1W09 A;  5JTG A;  5H6Q B;  4KI0 F;  1WCR A;  2N9D A;  3AXJ B;  4Z8X A;  2V5C A;  3SS1 A;  2CRB A;  5AQH B;  4UVA B;  3N9P A;  4GKK T;  4O4L E;  4UF0 B;  4X65 T;  3HI2 A;  4U74 A;  3C64 A;  2LSY A;  4U33 A;  1IJ5 A;  3GN5 B;  3ZMS B;  3B13 A;  4HWI B;  3HKD E;  4YJ3 E;  2CXL A;  3DP7 A;  3CQX C;  4HWC A;  4OHF A;  3RQW A;  5AQR B;  3PUW F;  3ZEF B;  3PUQ A;  3VKH A;  1XWM A;  2VB6 A;  2A2F X;  2Y6X A;  3KV9 A;  4QX8 B;  2WMN A;  2XJ7 A;  2V7L A;  1B7T A;  4L0R A;  4H63 V;  4JYA T;  3ZC1 A;  2IHR 1;  1N33 T;  4XBF B;  1KNZ A;  2LSJ A;  4H9R C;  2W00 A;  3AA6 B;  2LRK A;  2XQ7 A;  3FBZ A;  3LK4 2;  3NRX A;  5AQL B;  4YSY A;  1D1A A;  3AAI A;  3BQI A;  5KDM C;  4UEM A;  5L3E B;  4O2B E;  3IBP A;  4ZI3 C;  3FBL A;  2XUE A;  5L4H A;  4JI2 T;  3JAD A;  1UK5 A;  4HFC A;  5JDL A;  1G8X A;  2XAG B;  4HN9 A;  4B3T T;  2J62 A;  3Q2M A;  4YHJ A;  3AED A;  2LSK A;  2V7K A;  3N9L A;  2XHE B;  4DR2 T;  2Q9Q C;  3EDU A;  4IDQ A;  5LBQ B;  3AEG A;  3CPZ A;  4JI3 T;  4B3S T;  4NUU A;  4EGW A;  1MNE A;  4JI1 T;  2ZLY A;  2JJ9 A;  2NR4 A;  3MJX A;  3MAC A;  1OED A;  2HPL A;  3CX8 B;  4U2Y A;  3U3I A;  1HX1 B;  1T7S A;  4ADZ A;  4EIW A;  3N5L A;  3FZH B;  1ZP0 A;  1LRZ A;  2IML A;  3E0Z A;  1KEY A;  4IDP A;  4TWF A;  3P50 A;  3UQ7 A;  4LF4 T;  2X67 A;  4PJN A;  4PFO A;  3RI5 A;  4EEB A;  4EZH A;  2IDO B;  4TV8 E;  3AE5 A;  5L3B B;  1HNW T;  2BG9 A;  3AE9 A;  1HFA A;  2YDR A;  5FMN A;  3SFE A;  4ASK A;  3JAE A;  2V5D A;  3B5M A;  4IL4 A;  4B3R T;  2D9D A;  2AE9 A;  5HEG A;  3L3P A;  4UR9 A;  5LBM A;  1KFY A;  1VCS A;  4E7Z A;  2DWK A;  2YIN A;  2YKS A;  3RX6 A;  4QXC B;  2JMK A;  2NW8 A;  4EYY R;  2VKD A;  3FHN A;  3Q5X A;  1D1C A;  2HH7 A;  4V1A v;  5AQO B;  2FJE A;  3TLT A;  2E9X B;  4U3C A;  4JI4 T;  2A72 A;  2XQ4 A;  3ONJ A;  1X9B A;  2BKP A;  2W4X A;  2W63 A;  3DTO A;  5HXC A;  3ZMU B;  3CX7 B;  5KX5 E;  1MND A;  2CHO A;  2E9X A;  2WQY A;  2NWB A;  5JRE A;  1HG2 A;  1Z8U A;  4GIW A;  3L8R A;  2F4V T;  4UVC B;  1UUS A;  2ES0 A;  3ZT7 A;  2PG8 A;  1NWM X;  2IUB A;  3QOF A;  3QK6 A;  4IST A;  5AQV B;  1R8I A;  2ACZ A;  4DR3 T;  3N9N A;  4IL9 A;  2BKN A;  5JRC B;  2DI4 A;  2NW9 A;  4TWH A;  2YEV C;  3M3Z B;  4HGA A;  5M4Y A;  2V6X A;  2W66 A;  3MXZ A;  4KMC A;  5FVK A;  5FVL A;  3VKG A;  1SHZ C;  4HWF A;  5ABF A;  5HWY A;  3FXE B;  4DO0 A;  5HCM A;  2MOZ A;  4MAL A;  4YSX A;  1YD8 G;  3MA9 A;  3F57 A;  1YQ3 A;  2E9X D;  3KDS E;  3PJA A;  3T8O A;  3ZN0 B;  2V8S V;  5CJ5 A;  4EOZ B;  3AEF A;  4C91 A;  5DQW A;  1XNR T;  3K3O A;  4IE7 A;  3VR9 A;  5L3G B;  3NVO A;  4AXP A;  1J5W A;  2BBH A;  4I43 B;  3ZC0 A;  1OXZ A;  4HWH A;  5DQV A;  2WU5 A;  5CA0 E;  4DUZ T;  2C5I T;  1VCT A;  4AKG A;  2CMR A;  4YY3 T;  3EVY A;  3HKC E;  3P8C D;  4OK0 A;  3PUR A;  4UXN B;  4AIU A;  5L3D B;  4K0K T;  2KWI B;  3KBT A;  1YW0 A;  1X79 A;  2K48 A;  3IF8 B;  2C5K T;  1G73 A;  2DL1 A;  4L9I A;  3I9W A;  2XZE A;  3KV6 A;  4FI5 A;  5LJN A;  1FJG T;  2UUB T;  2IC9 A;  4BJM A;  1WR6 A;  2LEH A;  4IDN A;  5EK2 A;  2D5U A;  1XMQ T;  3KFW X;  4ZEY A;  1UX5 A;  4DID B;  5TAO A;  5JDN A;  3I0O A;  4QXB B;  5HEH A;  4F6R C;  1UGO A;  1XZY A;  4WNK A;  2DCF A;  3RHW A;  3R84 B;  2QVA A;  4DV6 T;  5ABG A;  2WWU A;  1IBK T;  3FZF B;  2E8I A;  1NEN A;  3C51 A;  4JI7 T;  1MMG A;  3UU3 A;  3EHZ A;  2H3R A;  3N9M A;  3PUG A;  4MBQ A;  4DR6 T;  2EHO C;  2UXC T;  5LA6 E;  1HG5 A;  3K3Q C;  3ZKR A;  5IHY A;  1HNZ T;  4DBQ A;  4NXM T;  2DNX A;  2NOX A;  3C4X A;  1ZKE A;  2KWH A;  2MAW A;  2WWV A;  2VKJ A;  2WZI A;  1UCU A;  2L9Q A;  4EZ4 A;  4Q25 A;  2WSS V;  2X51 A;  2WY2 A;  4YLH A;  3VU7 H;  4ZS2 A;  4Z90 A;  2CHN A;  3E08 A;  2UXN B;  4G2A A;  4ZZC A;  4CI3 B;  4ZXL A;  5C8Y E;  5L2L A;  3RIU C;  2UUA T;  2XM2 A;  1MMN A;  1ZEE A;  2K5B B;  4YTM A;  1WRD A;  2Q9Q B;  4DR5 T;  2M6B A;  3RQU A;  4IDZ A;  4U7I A;  3UFE A;  2X0Y A;  3VHL A;  5AQS B;  3V5S A;  1BR4 A;  2UXB T;  1O3X A;  2BVL A;  3BQL A;  3Q5W A;  3G06 A;  3H3A A;  4QHO A;  4JI8 T;  1LKX A;  3KV4 A;  2R6G F;  2IAK A;  2N2N A;  3L09 A;  4OFZ A;  5FNV E;  2LE8 A;  1BR2 A;  2WDR A;  2VKH A;  4HWD A;  3CIR A;  2BS2 A;  3IEE A;  4ZI2 C;  3N9Q A;  5LNK A;  3SWH A;  5FXX A;  4PFP A;  1T98 A;  3F31 A;  5AQJ B;  3K8P C;  2H88 A;  2WDQ A;  2AXD S;  4QXH B;  1IZN B;  2K24 A;  3P7I A;  5AQU B;  2L8K A;  2H7O A;  2WZH A;  3OYZ A;  4I0U A;  5FXZ A;  3TLW A;  4A5X A;  4PW8 A;  3O4X E;  3RYH E;  5LHG B;  5JQG E;  2YK0 A;  4QH5 A;  3FZK B;  4QKN A;  4TUY E;  4AQY T;  1N32 T;  3A8Y C;  2LKG A;  4JBW F;  3UU6 A;  1VOM A;  4LML A;  1XDP A;  1YXR A;  2KND A;  4KP3 C;  2FUP A;  3UUB A;  4YTP A;  3CKD A;  3PJA J;  2WCA A;  5FY1 A;  2VK9 A;  3OPC A;  2MBG A;  4CXY A;  4G63 A;  4KUM B;  5AQG B;  4DMW A;  5L3F B;  5JDF A;  2J4G A;  4ILU A;  5J0Z A;  4DR7 T;  2CBJ A;  4COF A;  1LVF A;  2DLR A;  5ETW A;  3ABV A;  3OYX A;  2N1G A;  1AJ3 A;  1I6Z A;  5FL0 A;  4XZC A;  4IE0 A;  3HL6 A;  3JAF A;  3NZQ A;  4CI2 B;  2D0U A;  4O4J E;  5AQI B;  2PJQ A;  3ZJ1 A;  1SUM B;  3AE3 A;  4I55 E;  4B6X A;  1LVK A;  1FEW A;  2DHR A;  2EHO A;  2JPF A;  2VL0 A;  3N2G E;  4P09 A;  1WLX A;  4WW0 A;  5LB7 B;  4LF7 T;  4UEL A;  4YSZ A;  4EV6 A;  5ADX L;  5DAB A;  3Q5D A;  3ZLI A;  5H6R B;  2HN1 A;  3ZJ2 A;  5JDH A;  2K3W A;  2LLY A;  2X9H A;  3AA7 B;  4HKA A;  5HCJ A;  3RC3 A;  4ZI2 D;  5AQP B;  3RF1 A;  2MYS A;  4Z91 A;  3ETV A;  5GON E;  2I59 A;  3NKZ A;  4U7Y A;  1MIV A;  4O2A E;  3ONL C;  3RIA A;  4BJN A;  2CEA A;  2YU2 A;  3RKG A;  3AE8 A;  2WMO A;  2CBI A;  2ZM2 A;  1I94 T;  1YQ4 A;  3TKL B;  2G0U A;  3UUN A;  2VQF T;  4AQG A;  4XAX B;  3EDV A;  3OTO T;  3JC6 C;  2W0G A;  4JEU B;  3TLS A;  5HEJ A;  2XTL A;  4CN6 A;  1CUN A;  3CQG B;  1V9D A;  2QRX A;  2EHO D;  3AE6 A;  5LMN T;  2ZMA A;  4CN4 A;  4PK5 A;  4PK4 A;  4A98 A;  5CFB A;  4GKJ T;  5FY7 A;  4X1K E;  2HN2 A;  3P4R A;  2ACX A;  2BVM A;  4JUY A;  2YN6 A;  3ZPO A;  2E5V A;  2D0T A;  1IBM T;  3ONX A;  3LG7 A;  2LSI A;  4JLE A;  5JDM A;  3PUZ F;  2XAJ B;  5LHI B;  1HX8 A;  2BG9 B;  2Y48 B;  3OVU A;  5CB4 E;  4L5G A;  4ILC A;  4QX7 B;  3X1D A;  5L3C B;  1IBL T;  4U2Z A;  2W67 A;  4GK5 E;  3LK3 B;  2XAF B;  4E7S A;  3GMI A;  1HCI A;  2LT3 A;  3VRB A;  2QGS A;  2YOE A;  3BQK A;  3P4P A;  2XSA A;  3AEE A;  2I0M A;  2LHR A;  2OV9 A;  3NWI A;  5JR9 A;  3M65 A;  3UU4 A;  4WBN E;  2VAS A;  4DV7 T;  2Y8D A;  2BDE A;  2WS3 A;  5FL1 A;  4NUV A;  1OED C;  4HTE A;  3ZN1 B;  2QA7 A;  3JC6 D;  4UVB B;  4C90 A;  4LFC T;  4OX9 T;  4X20 E;  3P4W A;  3ETU A;  2ODV A;  3MK7 C;  3O1I A;  4IRE A;  4AKH A;  1YKH B;  2KMF A;  5EK3 A;  2E9X C;  2W61 A;  3LDQ B;  4HFH A;  2XQ6 A;  5EK4 A;  4CN1 A;  4JI0 T;  4TNW A;  4LF8 T;  3WI3 A;  3LFM A;  2WB5 A;  2ODU A;  1IAP A;  5LGN B;  3RKO A;  5LXT E;  3HKE E;  3ANW A;  5AQT B;  5F5W A;  3EI0 A;  3UFG A;  4YHH T;  2X0L B;  4IIJ E;  3NBX X;  1QSD A;  2YDS A;  5JR9 C;  5AQM B;  4YFS A;  1HTJ F;  1GQE A;  3UU5 A;  2PBI A;  3FZM B;  4YXD A;  2VL8 A;  1JNZ A;  3NRY A;  1T72 A;  3WAJ A;  4X64 T;  5HWX A;  5LJM A;  3ZSS A;  1HNX T;  3F2E A;  4MFR A;  2V7I A;  4PNI A;  4TV9 E;  4CQI A;  2K9A A;  4NXN T;  1Y64 B;  2WDV A;  3RRC A;  3K1S A;  5FP3 A;  3SOL A;  5JRC A;  4WYV A;  4OYK A;  2B1E A;  2RPA A;  3GA8 A;  5HAX A;  2WBL A;  5LG4 A;  2ZM6 T;  3H37 A;  4ILB A;  5AQN B;  2MTQ A;  2XPK A;  3MKD A;  4PJM A;  1KK7 A;  1ZV4 X;  2M67 A;  4H9Q C;  1US7 B;  2V7J A;  4JI5 T;  4UF0 A;  1KF6 A;  2UUC T;  2XQ8 A;  4A97 A;  2XQA A; 
#chains in the Genus database with same CATH homology
 1M7K A;  5AQV B;  3FZK B;  5AQT B;  5AQL B;  3M3Z B;  3A8Y C;  5AQP B;  5AQQ B;  2D9D A;  5AQM B;  5AQH B;  3FZM B;  4HWF A;  1UGO A;  1UK5 A;  5AQG B;  1M62 A;  5AQS B;  3FZF B;  5AQO B;  4HWI B;  1I6Z A;  4HWC A;  5AQN B;  3FZL B;  5AQR B;  5AQF B;  4HWD A;  4HWH A;  5AQK B;  1T7S A;  1HX1 B;  5AQI B;  3FZH B;  5AQJ B;  3LDQ B;  5AQU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...