3FXDB

Crystal structure of interacting domains of icmr and icmq
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
VTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Unknown function
molecule keywords Protein IcmQ
total genus 24
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fxdB00
1LRZA 3N5LA 2C5KT 2X9WA 3CKDA 4L0RA 2XTLA 2MBGA 1IJ5A 2C5IT 1H7CA 3S4UA 2C5JA 3FXEB 2X9XA 4EYYR 2KWHA 2G0UA 4DNDA 3MXZA 1QSDA 3QUJA 3TKLB 3FXDB 4CQIA 1Z0PA 1ZKEA 3P7IA 4B6XA 3CVRA 2CA5A 2KWIB 2IC6A 3L3PA 2K48A 3QK6A 1LVFA 2X9YA 4FI5A 4J2CA 2IC9A 1IJ6A
chains in the Genus database with same CATH superfamily
4ZI3D 4CXYA 2KXPB 1HG2A 2XQ4A 3RKGA 2CLYB 5HXSA 5HEJA 1IJ5A 2K3WA 4NUVA 3UUBA 2NW8A 4ILUA 4JI6T 1MMDA 3RRWA 3ZJ2A 1KF6A 1UCUA 5HCMA 5L3GB 3HI2A 2YINA 5KX5E 5J1GA 1KNRA 4P0BA 2V5CA 3AEEA 1EZ3A 3HKBE 3N9QA 4DR7T 4U31A 2WSSV 4K0UA 1ZOYA 1XNQT 3BQIA 4DO0A 2CA5A 3I1AA 1B7TA 4IIJE 2VVNA 4A56A 1HF8A 3KFWX 4LMLA 3RIUA 4JV5T 4JI3T 4KMCA 4UIGA 2V1DB 2SPCA 3AE1A 2DHRA 3ZMZB 4EIWA 2H7OA 2DWKA 3LJCA 3OYXA 5FYMA 5L3DB 4JBWF 3AEDA 4OHFA 1FIOA 4U74A 2NTYA 1LRZA 3AEFA 4AKLA 5KMGP 2NWBA 4A97A 3L39A 4I4TE 4JI1T 4LF7T 3VRAA 2C0SA 1WCRA 4PJNA 3CX7B 2LSKA 3BK9A 2FUPA 3C4WA 1D0ZA 2WS3A 3FZMB 2W67A 3CK6A 4HTEA 5FXXA 1HNXT 1E1HB 3I9YA 3JC6D 4BAYB 4JI8T 1CUNA 4WBOA 2H88A 2Q9QA 5JDHA 1GQEA 2BS4A 4ZS2A 2D9DA 5AQMB 4LF5T 4UF0A 5JDQA 4DR5T 3EI0A 4QX7B 2K24A 1OEDB 2CE7A 1G73A 2N9DA 3JC6C 2BDEA 3LK3B 3I9WA 2JMKA 5HEHA 1I94T 5LG4A 3PURA 1FMVA 2W2UA 4JEHB 3VHLA 3RX6A 1XMQT 3RPUA 4AKRB 3N9NA 3Q5XA 4I55E 3L8RA 3SOLA 4YT0A 5JREA 2UXDT 1E7PA 2L8KA 2QA7A 4TWHA 5F8PA 3FZLB 1S35A 2XZEA 4DV2T 5FY7A 2WZIA 3Q5WA 3TLWA 3PTRB 4I50E 2LLYA 2AXDS 4PJMA 5L3FB 1IZNB 2E9XB 2V7JA 2XPKA 3S4UA 2YU1A 2IAKA 3NVOA 4QXHB 2LT3A 5AQLB 2R6GF 5HXEA 2DI4A 3AAAB 3P4SA 4H63H 5FL1A 2Q9QD 4DVDA 2E9XD 2PTFA 2BG9E 5AQJB 3Q9DA 2EHOD 2VASA 4HFHA 2CBJA 2M67A 2BBHA 2MOZA 3AE6A 3UFEA 1HX1B 3ZYKA 4HKAA 3LK42 5HWYA 1MMAA 5H6RB 4COFA 1J5ET 2CBIA 2MAWA 5LMNT 5JR9C 2WMOA 4TX5A 4EYUA 1W09A 3IF8B 3ZPOA 3N9OA 2BVLA 2NTXA 2IMLA 2LEHA 2LSIA 3VR9A 5ABEA 4PNIA 1KK7A 3AEGA 1BR1A 3ESLA 3DP7A 3N5LA 1WRDA 2C5KT 3UUNA 5L4EA 4DR1T 1AJ3A 4KHZF 2MBGA 2NP9A 2GK9A 1XDPA 3UQ7A 2PG8A 3U3IA 3GA8A 3Q5EA 5LG3A 1IBMT 2W66A 5AQVB 4QH1A 1Z8UA 2L3LA 3OYZA 5JRCB 4DNDA 2BS2A 3K3NA 4HGAA 3E08A 5LGUB 3JCFA 3FXDB 2RP4A 4HE8A 4TNWA 5HWXA 3H3AA 2BG9B 1NENA 3V5SA 3C64A 4OYJA 3VKHA 3QC9A 2VVSA 4HN9A 3AVSA 2CCQA 3KINB 5AQFB 2Y6XA 2YOEA 2CWYA 2E9XC 2ES0A 4IDQA 4QXCB 4BJMA 3MJXA 3FZFB 3ONXA 2VQFT 4KBMB 1XDOA 2QGSA 3EDUA 3AAEB 3GN5B 3LK2B 2BG9A 4HFEA 4Z8XA 4FI5A 2LM9A 2WU5A 3UUXB 3UU8A 5JH7E 3FZHB 2LSYA 3PDYA 5C2TA 1HNWT 4AXPA 2WU2A 3M65A 3MA9A 4ZI2C 5JRCA 3PUYF 3PJAJ 4PK5A 3WI3A 5LJNA 4GYSA 3TLTA 2ACXA 3PUWF 2H89A 4DBQA 3PUZF 4KX6A 4UVCB 5LXTE 2G0UA 2CXLA 4MFRA 1OEDE 3A5XA 4G2AA 4JI2T 1WYBA 5ABHA 4KI0F 5AFUL 1E2AA 3RYCE 1N33T 3VKGA 3U78A 3ZT7A 1QUUA 2W63A 4JYAT 3T1YT 1WR6A 2CMRA 2XUEA 4JEUB 4ZS3A 1YQ4A 2UU9T 4B6XA 2CXDA 4HFBA 5FXVA 3ZCIA 2VKDA 3AE5A 3F2EA 2A3DA 5HYAA 2VKOA 4ISSA 5AQTB 3GWHA 2M6IA 5CGMA 1Y01A 4AQYT 4JI0T 5FL0A 4YY3T 2DL1A 3P8CD 4G63A 4AISA 2IC9A 3CQXC 2HHHT 5LOVE 2BKOA 2CXFA 5KDMC 4AKGA 2XQ5A 4L0RA 2LSGA 3CKDA 4UR9A 3RC3A 2MTQA 3OPCA 5C8YE 3SWHA 3W15B 3TLUA 4B3ST 4O8SA 4OX9T 3RC8A 3ZN0B 3UQ4A 3AA1B 5HEGA 1U4QA 2V5DA 3ETUA 4JI7T 2FBWA 2WWUA 4GK0E 4XBFB 4OFZA 4HFVA 3RH3A 3P50A 4X64T 3V5UA 4EXTA 4YSZA 4DV4T 5M4YA 4QH5A 1I6ZA 3AA6B 2LOPA 3AVRA 3I0OA 2QYWA 4HEAA 2VURA 4I43B 1Z0PA 5JTGA 2XQAA 3RQWA 4X65T 1G8XA 1WR0A 4MHCA 4QKNA 4LMJA 4DUYT 1LVKA 4UEMA 5L3EB 4IE6A 2CHOA 2IC6A 2XAGB 5CB4E 3N2GE 3NRYA 3EABA 4H9PC 5JDNA 1XZYA 3ZC1A 4O4HE 1IAPA 4CN6A 1OEDA 3T1HT 4AKIA 3ZLIA 3ZSTA 2BG9C 1O3XA 5AQNB 4O2AE 4ADZA 2WMNA 3UU6A 4WBNE 2FJAA 1ZHCA 2YKSA 2WQYA 2CHNA 3FBLA 3NKZA 1JNRA 1OWAA 2OA5A 2XY8B 3NWIA 1X79A 3ONLC 4EAHA 4H9RC 3AE3A 4DV1T 5IHYA 4YJ3E 2DLRA 3EHZA 4EEDA 2UUAT 1JNZA 5EK3A 5IWAT 1W9RA 3AA0B 1HX8A 3F57A 4X1KE 4DV6T 2WY2A 3ZKRA 1MIYA 4ZZBA 5ABFA 1J5WA 4IE4A 4QWNB 2A2FX 1UX4A 2ZLYA 3GN5A 5HEOA 5LNKA 2UUCT 2WZHA 3CVRA 4U33A 1D1CA 3AE7A 1CHUA 2LJLA 5DQWA 4U72A 5BR8T 4EEBA 4LF9T 3WAJA 2DCFA 2IIUA 3G06A 1OXZA 3CQCB 1HS7A 2JQKA 1XWMA 3C50A 5J0ZA 2WBLA 3AB3B 4DUZT 2OV9A 2QRXA 3UTKA 4DV3T 2VL8A 2W0GA 4GIWA 4MALA 2V26A 3ZC0A 3UUMA 2X9WA 3L09A 3AE4A 3KV4A 3LDQB 2XTLA 4GK5E 1SHZC 2ZM8A 2NW9A 4CXWA 3BQLA 5L3BB 3VR8A 5HXRA 3ZMVB 2XM1A 4H63V 4N78D 2EHOA 4CN4A 2X68A 1N34T 1N32T 4DR4T 3MXZA 3KV5A 4IE0A 4TV9E 2YN6A 4ZZCA 4ZI3C 1YD8G 4U2ZA 3A8YC 1VOMA 3FHNA 3MKDA 2YDSA 1FJGT 3O4XE 3ZYLA 5FY0A 3M3ZB 4PFOA 4EGWA 4YSXA 1MIWA 1UGOA 2XQYA 2UXBT 3RHWA 2Z6EA 2KLQA 3FZKB 3K3QC 4PFPA 4HWCA 2XASB 3R6NA 1UUSA 3UU3A 4C90A 5JDMA 1OEDC 1W0AA 5FKYA 2JQ9A 3J7Yq 1YXRA 4GOUA 3ETVA 2JJ9A 2W00A 2BKNA 2CLYC 2I6HA 3PE0A 3TLVA 4YXDA 4IDOA 5ABFB 5LHHB 3F31A 5LGTB 2KWHA 1XNRT 4MBQA 5LB7B 3QOFA 4X66T 3PUXF 1KFYA 2VKHA 4HFIA 1DU2A 2WWVA 1LKXA 2KSRA 1T7SA 1X9BA 2N2NA 3CPZA 4WYVA 5DQVA 2P9BA 2X0HA 2XAQB 2MYSA 3RLFF 4PW8A 2WDRA 4A98A 2Q9QB 2XQ8A 3P4QA 3UU5A 5C3JA 3ANWA 5AQRB 5AQQB 1HFAA 1SUMB 1WFDA 4AQGA 5LGNB 4KHPT 3E0ZA 3Q2MA 2V6YB 3ZCJA 1HCIA 2W4XA 4LFCT 1N36T 1WLXA 2X9YA 2X66A 3NRXA 4L9IA 3RKOA 3SRZA 4YSYA 2UUBT 4B3MT 4LFBT 1IJ6A 3HKEE 2XAJB 2X51A 4EV6A 2ZM6T 2J4GA 2E5LT 4GKJT 4WZXA 2WDVA 4ZXLA 2PBIA 2BKPA 5JR9B 4YHHT 5L4HA 2YEVC 4YLHA 3RGLA 4TWDA 1NAFA 4HFDA 3RI5A 5ADXL 4PK4A 2JQHA 4E7ZA 4QXBB 3ZMSB 5FVLA 3KV6A 4ASKA 4NPPA 5AQOB 1V9DA 5BMVE 5J2TE 1KEYA 3K3OA 3AEAA 4UV9B 5AQKB 2XM2A 3LBXB 2QVAA 4EZHA 4P0AA 2FJEA 3P7IA 4ILCA 2JPFA 2JQQA 2VL0A 4LF8T 1S94A 1BR2A 3EDVA 5FMNA 5HEUA 4EZ4A 2FJBA 4FJOA 1QLBA 3J9X1 3O9XA 4UELA 5CFBA 3KBUA 3B57A 3I0QA 2X0LB 2WCAA 2YDQA 3ANWB 4HWIB 4LFAT 3IEEA 3ZYMA 2LHNA 4HWHA 3RIUC 2LKHA 5JDFA 3X1DA 2H7VC 3OTOT 2WP9A 2E8IA 2Y8DA 3HKCE 3OKQA 4TNVA 3PV0F 1HR0T 4JI5T 4ISTA 3N9PA 5IUXA 4K0KT 2JIWA 2X67A 3HKDE 1ZV4X 2WB5A 3QB5K 2D2SA 3ONJA 5AQPB 4ZI7E 2KZ7B 1U5PA 2CPTA 3KV9A 4CI1B 4BA9A 1QSDA 2YU2A 3H3MA 3QNUA 5FP3A 4YTPA 2CEAA 2YK0A 3TKLB 5L2LA 4B3TT 4AI6A 1YW0A 2A72A 3Q5DA 4F8HA 1MMGA 3LSVA 3CWZB 4HWDA 4DBRA 1YKHB 3OBVE 4C91A 2BZBA 3DJBA 5LA6E 5DJQC 5AQGB 5DABA 2XQ3A 3B5MA 2D5UA 2B1EA 1KNZA 4X1IE 4X5TA 4Z91A 3UULA 4BJNA 2NOXA 3QK6A 4TV8E 5EK2A 5FY1A 3RQUA 2XSAA 4IDPA 4ILAA 2EHOB 2LM2A 2KINB 2XAHB 5AQHB 5AQIB 5F5WA 1VRBA 2V6XA 2HH7A 2XQ7A 3CQGB 3OJAA 3P4WA 4UXNB 2BBJA 3RIAA 3KVBA 3N9MA 2H3RA 4V1Av 3ZN1B 3HA4A 4QH4A 3IBPA 4TZ4C 3RRCA 4JI4T 1UK5A 4H9OC 4DV5T 4U7IA 1US7B 3SFDA 4HFCA 4YTNA 2LRKA 4EYYR 1HNZT 1WYCA 1HTJF 5IYZE 1D1BA 3ZSSA 1SE7A 4OYKA 4Q25A 2XHEB 3NBXX 2RPAA 2IW5B 4UV8B 3IA3A 3N2KE 3UT5E 2KMFA 2PFVA 4IE7A 1ZKEA 2J62A 2V7IA 3EUHA 1ZEEA 2LRLA 2ZMAA 4AIUA 5LHGB 3HR0A 2UXCT 3RYHE 4H9SE 3ZMTB 2HPLA 2ZM2A 5E0OA 3L3PA 5LBMA 2LSJA 4X62T 2E9XA 4DMWA 5J2UE 5JQGE 2XAFB 3UFGA 2WDQA 5LCYA 5L3CB 1BR4A 1FEWA 5FNVE 3LG7A 4DV7T 2M6BA 2LE8A 1IBLT 4CN1A 4IREA 4TWFA 4GKKT 3AAIA 4DV0T 5LP6E 4DR6T 5KXJA 3SS1A 2AE9A 3RYIE 2N1GA 2I59A 4IGUA 3A7MA 2ACZA 2A9UA 4PK6A 1HG5A 4IDZA 1NEKA 3QUJA 3R84B 5JR9A 5LJMA 3NZPA 2V7LA 2L9QA 1FMWA 4L5GA 2XQ9A 4UVBB 2VKJA 3AA7B 2FJDA 3JAFA 5FVKA 5LYJE 4Z90A 4ZEYA 2D0TA 4PJLA 3ZEFB 3AECA 3C98B 2BVMA 3QB5A 4QHOA 1VCTA 2PJQA 3CMLA 3AEBA 3JAEA 3MACA 5HXCA 1L0VA 2BS3A 4ANJA 3P4RA 4H9NC 3O1JA 3PU8A 4X1YE 5H6QB 2XQ6A 4PJJA 2KNDA 4I0UA 4P09A 4AQFA 2NR4A 3RF1A 4YHJA 5CJ5A 4J2CA 4F6RC 1D0XA 1MNDA 2WAUA 4LF6T 3C4ZA 2VWAA 4OK0A 3FBZA 4M1PA 1UURA 4U7YA 3PUAA 4O4JE 4U3CA 4XAXB 3GMIA 4IT4A 1YQ3A 1H7CA 2B76A 2KT9A 1T98A 2CRBA 2CM0A 3CIRA 4U2YA 3JADA 5FXWA 2IDOB 2Q9QC 2V7MA 5LHIB 4X20E 3EAMA 5ETWA 5LMUT 2VK9A 2MPKA 3DTOA 3VU7H 4CI2B 3T8OA 4LF4T 4TN7B 1SA0E 3ZT6A 3RIFA 2JMHA 2LOSA 2K9AA 1MNEA 3C4XA 3O1HA 4O2BE 4CI3B 1NWMX 2CWOA 2E2AA 2HPJA 2D0UA 1J1JA 2DNXA 3ABVA 4O4LE 2X0YA 3PUQA 4EOZB 4ERRA 4ZI2D 4GYRA 1IBKT 3C51A 4WNKA 1D0YA 3B13A 4IE5A 5TAOA 3PUGA 4TUYE 2UXNB 4P1NA 2ODVA 2LKGA 4YFSA 3LBXA 3PJAA 1T8BA 2WM9A 3MZKB 3AE2A 4JLEA 5AQUB 5HAXA 4HWFA 2ZM0A 5EK4A 5FXZA 2XJ7A 4A5XA 3OVUA 5JVDE 3CX6B 3WAKA 2C5IT 3NZQA 5A1LA 2OLTA 2X9XA 2J47A 2NW7A 4ZHQE 3AXJA 4IL4A 2LHRA 2VQET 2I0MA 4EB6E 4NXMT 3D0TA 2K5BB 1VCSA 2W61A 3PU3A 3ZJ1A 2V8SV 1M62A 4CQIA 3PUVF 3N9LA 2JRKA 4IL9A 2EHOC 3P4PA 4UVAB 4DMVA 5JDLA 3MK7C 5JDGA 2VB6A 3AXJB 5CA1E 3CX8B 2KWIB 4PAGA 4AQFC 4UF0B 5AQSB 3K8PC 3HL6A 5EZYE 3ZT5A 1YKEB 2K48A 2IHR1 3AE8A 3EVYA 2X9HA 4ZOLE 3TLSA 1LVFA 1Y64B 4QX8B 3ZMUB 2E5VA 5HXHA 1XMOT 4NXNT 4LMKA 1ZP0A 5ABGA 4XZCA 4YTMA 3FB2A 1R8IA 2J1DG 5F3JA 3AE9A 3K1SA 2Y48B 5CA0E 4NUUA 1D1AA 4NIQA 4H9QC 5GONE 4JUYA 4CZZB 3RYFE 2C5JA 2HN1A 4E7SA 3KBTA 4CXXA 3FXEB 2IUBA 3LFMA 2W62A 3SFEA 3KVAA 3UU4A 4YJ2E 4IHJE 1W0BA 3IHRA 4KUMB 2YDRA 3KDSE 4B3RT 1UX5A 5L47A 2V7KA 1KNPA 4IDNA 4KP3C 2RA1A 4DR3T 2V6YA 2ODUA 2XSBA 2UXXB 1MIVA 4AKHA 3E22E 4DIDB 3O1IA 4WW0A 5LBQB 2HN2A 4MLKA 1T72A 3PUSA 1M7KA 4ILBA 3H37A 2DWGA 2F4VT 4O4IE 1BR0A 4DR2T 3VRBA 1MMNA 5HCJA 3N2OA 3BQKA
chains in the Genus database with same CATH topology
4ZI3D 4CXYA 2KXPB 1HG2A 2CLYB 5HXSA 1IJ5A 4NUVA 2NW8A 4ILUA 1MMDA 3RRWA 3ZJ2A 1UCUA 5L3GB 3HI2A 2YINA 5KX5E 5J1GA 4P0BA 3N9QA 1EZ3A 3HKBE 2WSSV 4K0UA 3BQIA 4DO0A 2CA5A 3I1AA 1B7TA 4IIJE 4A56A 1HF8A 3KFWX 4KMCA 4UIGA 2V1DB 2SPCA 3ZMZB 2DHRA 4EIWA 5L3DB 2H7OA 2DWKA 3LJCA 3OYXA 5FYMA 4OHFA 1FIOA 4U74A 2NTYA 1LRZA 4AKLA 5KMGP 2NWBA 4I4TE 2C0SA 4PJNA 3CX7B 2LSKA 3BK9A 3C4WA 1D0ZA 4HTEA 5FXXA 1E1HB 3I9YA 3JC6D 4BAYB 1CUNA 4WBOA 5JDHA 2Q9QA 4ZS2A 4UF0A 5JDQA 4QX7B 2K24A 3LK3B 2CE7A 1G73A 2N9DA 3JC6C 2BDEA 3I9WA 2JMKA 5LG4A 3PURA 1FMVA 4JEHB 3VHLA 3RX6A 3RPUA 4AKRB 3N9NA 3Q5XA 4I55E 3SOLA 5JREA 2L8KA 2QA7A 5F8PA 1S35A 5FY7A 3Q5WA 3PTRB 4I50E 4PJMA 5L3FB 1IZNB 2E9XB 2V7JA 3S4UA 2YU1A 2IAKA 4QXHB 2LT3A 5HXEA 2DI4A 3AAAB 4H63H 2Q9QD 4DVDA 2E9XD 3Q9DA 2EHOD 2VASA 3UFEA 2M67A 3ZYKA 1AJ3A 2MOZA 4HKAA 3LK42 5HWYA 1MMAA 5H6RB 5JR9C 2WMOA 4TX5A 4EYUA 3IF8B 3ZPOA 3N9OA 2BVLA 2NTXA 2LSIA 2LEHA 4PNIA 1KK7A 1BR1A 3ESLA 3DP7A 3N5LA 1WRDA 2C5KT 3UUNA 2MBGA 2NP9A 2GK9A 2PG8A 3U3IA 3GA8A 2L3LA 3OYZA 5JRCB 4DNDA 3K3NA 4HGAA 3E08A 5LGUB 4HE8A 3FXDB 2RP4A 5HWXA 3H3AA 3V5SA 3C64A 4OYJA 3VKHA 3QC9A 4HN9A 3AVSA 2CCQA 3KINB 2Y6XA 4ANJA 2CWYA 2E9XC 2ES0A 4QXCB 4BJMA 3MJXA 3ONXA 4KBMB 3GN5B 2QGSA 3EDUA 3AAEB 3LK2B 4Z8XA 5JR9A 4FI5A 2LM9A 3UUXB 5JH7E 3PDYA 2LSYA 4AXPA 3M65A 3MA9A 4ZI2C 5JRCA 4PK5A 3WI3A 5LJNA 4GYSA 2ACXA 4DBQA 4UVCB 5LXTE 2G0UA 2CXLA 4MFRA 5AFUL 3A5XA 4G2AA 5LGNB 1WYBA 3RYCE 3VKGA 1QUUA 2W63A 1WR6A 2CMRA 2XUEA 4JEUB 4ZS3A 4B6XA 2CXDA 5FXVA 3ZCIA 2VKDA 3F2EA 2A3DA 5HYAA 2VKOA 4ISSA 3GWHA 3P8CD 4G63A 2IC9A 3CQXC 5LOVE 5KDMC 2CXFA 4AKGA 3RC3A 4L0RA 2LSGA 3CKDA 2MTQA 5C8YE 3SWHA 3W15B 3RC8A 4O8SA 3ZN0B 3AA1B 1U4QA 3ETUA 2WWUA 4GK0E 4XBFB 4OFZA 4HFVA 3RH3A 4EXTA 3AA6B 2LOPA 3AVRA 3I0OA 4HEAA 4I43B 1Z0PA 1G8XA 4MHCA 4QKNA 1LVKA 4UEMA 5L3EB 4IE6A 2IC6A 5CB4E 2XAGB 3N2GE 3NRYA 4H9PC 5JDNA 3ZC1A 4O4HE 1IAPA 4AKIA 3ZLIA 1O3XA 4O2AE 4ADZA 2WMNA 4WBNE 4TN7B 1ZHCA 3OJAA 3FBLA 3U78A 5M4YA 1OWAA 2OA5A 4EAHA 1X79A 4H9RC 5IHYA 4YJ3E 2DLRA 5EK3A 3AA0B 1HX8A 3F57A 4X1KE 1MIYA 4IE4A 4QWNB 2A2FX 1UX4A 2ZLYA 3GN5A 5LNKA 3CVRA 1D1CA 2LJLA 5DQWA 4U72A 3WAJA 2DCFA 1OXZA 3CQCB 3C50A 2WBLA 3AB3B 3UTKA 2VL8A 2W0GA 4GIWA 4MALA 2V26A 3ZC0A 3UUMA 2X9WA 3L09A 4GK5E 3KV4A 4CXWA 2XTLA 1SHZC 2ZM8A 2NW9A 3BQLA 5L3BB 5HXRA 3ZMVB 4N78D 4H63V 2EHOA 2X68A 3MXZA 3KV5A 4IE0A 4TV9E 4ZI3C 1YD8G 1VOMA 3FHNA 3MKDA 3O4XE 3ZYLA 5FY0A 4PFOA 1MIWA 2XQYA 2Z6EA 2KLQA 3K3QC 4PFPA 2XASB 3R6NA 5JDMA 3J7Yq 4GOUA 3ETVA 2JJ9A 2W00A 2CLYC 3PE0A 5LHHB 5LGTB 3F31A 2KWHA 4MBQA 2VKHA 1LKXA 2N2NA 5DQVA 3CPZA 2P9BA 2XAQB 2MYSA 4PW8A 2Q9QB 3ANWA 1HFAA 4AQGA 3E0ZA 3Q2MA 3ZCJA 1HCIA 1WLXA 2X9YA 2X66A 3NRXA 4L9IA 3RKOA 3SRZA 1IJ6A 3HKEE 2XAJB 2X51A 5JR9B 2PBIA 2YEVC 4YLHA 1NAFA 5ADXL 4PK4A 4E7ZA 4QXBB 3ZMSB 3KV6A 4ASKA 5BMVE 1V9DA 5J2TE 3K3OA 4UV9B 3LBXB 4EZHA 4P0AA 3P7IA 2JPFA 2JQQA 1S94A 1BR2A 3EDVA 5FMNA 4EZ4A 3J9X1 4FJOA 3O9XA 4UELA 3KBUA 3B57A 3I0QA 2X0LB 3ANWB 3IEEA 3ZYMA 2LHNA 5JDFA 2H7VC 2Y8DA 2E8IA 3HKCE 3OKQA 4ISTA 3N9PA 2X67A 3HKDE 1ZV4X 4ZI7E 2D2SA 4CI1B 2KZ7B 1U5PA 3KV9A 4BA9A 1QSDA 2YU2A 5L2LA 5FP3A 2CEAA 2YK0A 3TKLB 4AI6A 2A72A 1YW0A 1MMGA 3CWZB 4DBRA 1YKHB 3OBVE 4C91A 2BZBA 3DJBA 5LA6E 5DJQC 5DABA 2D5UA 2B1EA 1KNZA 4X1IE 4BJNA 3UULA 5EK2A 2NOXA 3QK6A 4TV8E 5FY1A 2EHOB 2KINB 2XAHB 3CQGB 1VRBA 2HH7A 4UXNB 3KVBA 3N9MA 2H3RA 4V1Av 3ZN1B 3HA4A 4TZ4C 3IBPA 3RRCA 4H9OC 1US7B 4EYYR 1WYCA 1HTJF 5IYZE 1D1BA 4OYKA 2XHEB 3NBXX 2IW5B 4UV8B 3N2KE 3UT5E 2KMFA 2PFVA 4IE7A 1ZKEA 2V7IA 3EUHA 1ZEEA 2ZMAA 5LHGB 3HR0A 3RYHE 4H9SE 3ZMTB 2HPLA 2ZM2A 5E0OA 3L3PA 5LBMA 2LSJA 2E9XA 4DMWA 5J2UE 5JQGE 2XAFB 5LCYA 5L3CB 1BR4A 1FEWA 5FNVE 3LG7A 2LE8A 3AAIA 5LP6E 3SS1A 3RYIE 2N1GA 2I59A 4IGUA 4PK6A 1HG5A 4IDZA 3QUJA 3R84B 5LJMA 3NZPA 2V7LA 2L9QA 1FMWA 4L5GA 4UVBB 2VKJA 3AA7B 5LYJE 2D0TA 4PJLA 3ZEFB 3C98B 2BVMA 4QHOA 5HXCA 2PJQA 3MACA 3CMLA 4ZI2D 4H9NC 3O1JA 3PU8A 4X1YE 5H6QB 4PJJA 4AQFA 2KNDA 4C90A 4P09A 4YHJA 4J2CA 4F6RC 1D0XA 1MNDA 2WAUA 3C4ZA 2VWAA 4OK0A 3FBZA 4M1PA 1HS7A 3PUAA 4O4JE 4XAXB 3GMIA 1H7CA 2KT9A 1T98A 2CM0A 5FXWA 2Q9QC 2V7MA 5LHIB 4X20E 5ETWA 2VK9A 3VU7H 3DTOA 4CI2B 3T8OA 1SA0E 2JMHA 2LOSA 2K9AA 1MNEA 3C4XA 3O1HA 4O2BE 4CI3B 1NWMX 2CWOA 2HPJA 4O4LE 2D0UA 2DNXA 3V5UA 3PUQA 4EOZB 4ERRA 4GYRA 3C51A 4WNKA 1D0YA 3B13A 4IE5A 5TAOA 3PUGA 4TUYE 2UXNB 2ODVA 4YFSA 3LBXA 2WM9A 3MZKB 4JLEA 5HAXA 2ZM0A 5EK4A 5FXZA 3WAKA 5JVDE 3CX6B 2C5IT 3NZQA 5A1LA 2X9XA 2NW7A 4ZHQE 2LHRA 4EB6E 3D0TA 2K5BB 2W61A 3PU3A 3ZJ1A 4CQIA 3N9LA 2JRKA 2EHOC 4UVAB 4DMVA 5JDLA 5JDGA 3MK7C 2VB6A 5CA1E 3CX8B 2KWIB 4PAGA 4AQFC 4UF0B 3K8PC 3HL6A 5EZYE 1YKEB 2K48A 3EVYA 2X9HA 4ZOLE 3ZMUB 1LVFA 1Y64B 4QX8B 5HXHA 4XZCA 3FB2A 2J1DG 5F3JA 5CA0E 2Y48B 4NUUA 1D1AA 4H9QC 5GONE 4JUYA 4CZZB 3RYFE 2C5JA 4E7SA 3KBTA 4CXXA 3FXEB 3LFMA 2W62A 3KVAA 4YJ2E 4IHJE 4KUMB 3IHRA 3KDSE 1UX5A 2V7KA 4KP3C 2RA1A 2ODUA 2UXXB 1MIVA 4AKHA 3E22E 3O1IA 4WW0A 5LBQB 4MLKA 3PUSA 3H37A 2DWGA 4O4IE 1BR0A 1MMNA 3N2OA 3BQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LRZ A;  3N5L A;  2C5K T;  2X9W A;  3CKD A;  4L0R A;  2XTL A;  2MBG A;  1IJ5 A;  2C5I T;  1H7C A;  3S4U A;  2C5J A;  3FXE B;  2X9X A;  4EYY R;  2KWH A;  2G0U A;  4DND A;  3MXZ A;  1QSD A;  3QUJ A;  3TKL B;  3FXD B;  4CQI A;  1Z0P A;  1ZKE A;  3P7I A;  4B6X A;  3CVR A;  2CA5 A;  2KWI B;  2IC6 A;  3L3P A;  2K48 A;  3QK6 A;  1LVF A;  2X9Y A;  4FI5 A;  4J2C A;  2IC9 A;  1IJ6 A; 
#chains in the Genus database with same CATH topology
 4ZI3 D;  4CXY A;  2KXP B;  1HG2 A;  2XQ4 A;  3RKG A;  2CLY B;  5HXS A;  5HEJ A;  1IJ5 A;  2K3W A;  4NUV A;  3UUB A;  2NW8 A;  4ILU A;  4JI6 T;  1MMD A;  3RRW A;  3ZJ2 A;  1KF6 A;  1UCU A;  5HCM A;  5L3G B;  3HI2 A;  2YIN A;  5KX5 E;  5J1G A;  1KNR A;  4P0B A;  2V5C A;  3AEE A;  1EZ3 A;  3HKB E;  3N9Q A;  4DR7 T;  4U31 A;  2WSS V;  4K0U A;  1ZOY A;  1XNQ T;  3BQI A;  4DO0 A;  2CA5 A;  3I1A A;  1B7T A;  4IIJ E;  2VVN A;  4A56 A;  1HF8 A;  3KFW X;  4LML A;  3RIU A;  4JV5 T;  4JI3 T;  4KMC A;  4UIG A;  2V1D B;  2SPC A;  3AE1 A;  2DHR A;  3ZMZ B;  4EIW A;  2H7O A;  2DWK A;  3LJC A;  3OYX A;  5FYM A;  5L3D B;  4JBW F;  3AED A;  4OHF A;  1FIO A;  4U74 A;  2NTY A;  1LRZ A;  3AEF A;  4AKL A;  5KMG P;  2NWB A;  4A97 A;  3L39 A;  4I4T E;  4JI1 T;  4LF7 T;  3VRA A;  2C0S A;  1WCR A;  4PJN A;  3CX7 B;  2LSK A;  3BK9 A;  2FUP A;  3C4W A;  1D0Z A;  2WS3 A;  3FZM B;  2W67 A;  3CK6 A;  4HTE A;  5FXX A;  1HNX T;  1E1H B;  3I9Y A;  3JC6 D;  4BAY B;  4JI8 T;  1CUN A;  4WBO A;  2H88 A;  2Q9Q A;  5JDH A;  1GQE A;  2BS4 A;  4ZS2 A;  2D9D A;  5AQM B;  4LF5 T;  4UF0 A;  5JDQ A;  4DR5 T;  3EI0 A;  4QX7 B;  2K24 A;  1OED B;  2CE7 A;  1G73 A;  2N9D A;  3JC6 C;  2BDE A;  3LK3 B;  3I9W A;  2JMK A;  5HEH A;  1I94 T;  5LG4 A;  3PUR A;  1FMV A;  2W2U A;  4JEH B;  3VHL A;  3RX6 A;  1XMQ T;  3RPU A;  4AKR B;  3N9N A;  3Q5X A;  4I55 E;  3L8R A;  3SOL A;  4YT0 A;  5JRE A;  2UXD T;  1E7P A;  2L8K A;  2QA7 A;  4TWH A;  5F8P A;  3FZL B;  1S35 A;  2XZE A;  4DV2 T;  5FY7 A;  2WZI A;  3Q5W A;  3TLW A;  3PTR B;  4I50 E;  2LLY A;  2AXD S;  4PJM A;  5L3F B;  1IZN B;  2E9X B;  2V7J A;  2XPK A;  3S4U A;  2YU1 A;  2IAK A;  3NVO A;  4QXH B;  2LT3 A;  5AQL B;  2R6G F;  5HXE A;  2DI4 A;  3AAA B;  3P4S A;  4H63 H;  5FL1 A;  2Q9Q D;  4DVD A;  2E9X D;  2PTF A;  2BG9 E;  5AQJ B;  3Q9D A;  2EHO D;  2VAS A;  4HFH A;  2CBJ A;  2M67 A;  2BBH A;  2MOZ A;  3AE6 A;  3UFE A;  1HX1 B;  3ZYK A;  4HKA A;  3LK4 2;  5HWY A;  1MMA A;  5H6R B;  4COF A;  1J5E T;  2CBI A;  2MAW A;  5LMN T;  5JR9 C;  2WMO A;  4TX5 A;  4EYU A;  1W09 A;  3IF8 B;  3ZPO A;  3N9O A;  2BVL A;  2NTX A;  2IML A;  2LEH A;  2LSI A;  3VR9 A;  5ABE A;  4PNI A;  1KK7 A;  3AEG A;  1BR1 A;  3ESL A;  3DP7 A;  3N5L A;  1WRD A;  2C5K T;  3UUN A;  5L4E A;  4DR1 T;  1AJ3 A;  4KHZ F;  2MBG A;  2NP9 A;  2GK9 A;  1XDP A;  3UQ7 A;  2PG8 A;  3U3I A;  3GA8 A;  3Q5E A;  5LG3 A;  1IBM T;  2W66 A;  5AQV B;  4QH1 A;  1Z8U A;  2L3L A;  3OYZ A;  5JRC B;  4DND A;  2BS2 A;  3K3N A;  4HGA A;  3E08 A;  5LGU B;  3JCF A;  3FXD B;  2RP4 A;  4HE8 A;  4TNW A;  5HWX A;  3H3A A;  2BG9 B;  1NEN A;  3V5S A;  3C64 A;  4OYJ A;  3VKH A;  3QC9 A;  2VVS A;  4HN9 A;  3AVS A;  2CCQ A;  3KIN B;  5AQF B;  2Y6X A;  2YOE A;  2CWY A;  2E9X C;  2ES0 A;  4IDQ A;  4QXC B;  4BJM A;  3MJX A;  3FZF B;  3ONX A;  2VQF T;  4KBM B;  1XDO A;  2QGS A;  3EDU A;  3AAE B;  3GN5 B;  3LK2 B;  2BG9 A;  4HFE A;  4Z8X A;  4FI5 A;  2LM9 A;  2WU5 A;  3UUX B;  3UU8 A;  5JH7 E;  3FZH B;  2LSY A;  3PDY A;  5C2T A;  1HNW T;  4AXP A;  2WU2 A;  3M65 A;  3MA9 A;  4ZI2 C;  5JRC A;  3PUY F;  3PJA J;  4PK5 A;  3WI3 A;  5LJN A;  4GYS A;  3TLT A;  2ACX A;  3PUW F;  2H89 A;  4DBQ A;  3PUZ F;  4KX6 A;  4UVC B;  5LXT E;  2G0U A;  2CXL A;  4MFR A;  1OED E;  3A5X A;  4G2A A;  4JI2 T;  1WYB A;  5ABH A;  4KI0 F;  5AFU L;  1E2A A;  3RYC E;  1N33 T;  3VKG A;  3U78 A;  3ZT7 A;  1QUU A;  2W63 A;  4JYA T;  3T1Y T;  1WR6 A;  2CMR A;  2XUE A;  4JEU B;  4ZS3 A;  1YQ4 A;  2UU9 T;  4B6X A;  2CXD A;  4HFB A;  5FXV A;  3ZCI A;  2VKD A;  3AE5 A;  3F2E A;  2A3D A;  5HYA A;  2VKO A;  4ISS A;  5AQT B;  3GWH A;  2M6I A;  5CGM A;  1Y01 A;  4AQY T;  4JI0 T;  5FL0 A;  4YY3 T;  2DL1 A;  3P8C D;  4G63 A;  4AIS A;  2IC9 A;  3CQX C;  2HHH T;  5LOV E;  2BKO A;  2CXF A;  5KDM C;  4AKG A;  2XQ5 A;  4L0R A;  2LSG A;  3CKD A;  4UR9 A;  3RC3 A;  2MTQ A;  3OPC A;  5C8Y E;  3SWH A;  3W15 B;  3TLU A;  4B3S T;  4O8S A;  4OX9 T;  3RC8 A;  3ZN0 B;  3UQ4 A;  3AA1 B;  5HEG A;  1U4Q A;  2V5D A;  3ETU A;  4JI7 T;  2FBW A;  2WWU A;  4GK0 E;  4XBF B;  4OFZ A;  4HFV A;  3RH3 A;  3P50 A;  4X64 T;  3V5U A;  4EXT A;  4YSZ A;  4DV4 T;  5M4Y A;  4QH5 A;  1I6Z A;  3AA6 B;  2LOP A;  3AVR A;  3I0O A;  2QYW A;  4HEA A;  2VUR A;  4I43 B;  1Z0P A;  5JTG A;  2XQA A;  3RQW A;  4X65 T;  1G8X A;  1WR0 A;  4MHC A;  4QKN A;  4LMJ A;  4DUY T;  1LVK A;  4UEM A;  5L3E B;  4IE6 A;  2CHO A;  2IC6 A;  2XAG B;  5CB4 E;  3N2G E;  3NRY A;  3EAB A;  4H9P C;  5JDN A;  1XZY A;  3ZC1 A;  4O4H E;  1IAP A;  4CN6 A;  1OED A;  3T1H T;  4AKI A;  3ZLI A;  3ZST A;  2BG9 C;  1O3X A;  5AQN B;  4O2A E;  4ADZ A;  2WMN A;  3UU6 A;  4WBN E;  2FJA A;  1ZHC A;  2YKS A;  2WQY A;  2CHN A;  3FBL A;  3NKZ A;  1JNR A;  1OWA A;  2OA5 A;  2XY8 B;  3NWI A;  1X79 A;  3ONL C;  4EAH A;  4H9R C;  3AE3 A;  4DV1 T;  5IHY A;  4YJ3 E;  2DLR A;  3EHZ A;  4EED A;  2UUA T;  1JNZ A;  5EK3 A;  5IWA T;  1W9R A;  3AA0 B;  1HX8 A;  3F57 A;  4X1K E;  4DV6 T;  2WY2 A;  3ZKR A;  1MIY A;  4ZZB A;  5ABF A;  1J5W A;  4IE4 A;  4QWN B;  2A2F X;  1UX4 A;  2ZLY A;  3GN5 A;  5HEO A;  5LNK A;  2UUC T;  2WZH A;  3CVR A;  4U33 A;  1D1C A;  3AE7 A;  1CHU A;  2LJL A;  5DQW A;  4U72 A;  5BR8 T;  4EEB A;  4LF9 T;  3WAJ A;  2DCF A;  2IIU A;  3G06 A;  1OXZ A;  3CQC B;  1HS7 A;  2JQK A;  1XWM A;  3C50 A;  5J0Z A;  2WBL A;  3AB3 B;  4DUZ T;  2OV9 A;  2QRX A;  3UTK A;  4DV3 T;  2VL8 A;  2W0G A;  4GIW A;  4MAL A;  2V26 A;  3ZC0 A;  3UUM A;  2X9W A;  3L09 A;  3AE4 A;  3KV4 A;  3LDQ B;  2XTL A;  4GK5 E;  1SHZ C;  2ZM8 A;  2NW9 A;  4CXW A;  3BQL A;  5L3B B;  3VR8 A;  5HXR A;  3ZMV B;  2XM1 A;  4H63 V;  4N78 D;  2EHO A;  4CN4 A;  2X68 A;  1N34 T;  1N32 T;  4DR4 T;  3MXZ A;  3KV5 A;  4IE0 A;  4TV9 E;  2YN6 A;  4ZZC A;  4ZI3 C;  1YD8 G;  4U2Z A;  3A8Y C;  1VOM A;  3FHN A;  3MKD A;  2YDS A;  1FJG T;  3O4X E;  3ZYL A;  5FY0 A;  3M3Z B;  4PFO A;  4EGW A;  4YSX A;  1MIW A;  1UGO A;  2XQY A;  2UXB T;  3RHW A;  2Z6E A;  2KLQ A;  3FZK B;  3K3Q C;  4PFP A;  4HWC A;  2XAS B;  3R6N A;  1UUS A;  3UU3 A;  4C90 A;  5JDM A;  1OED C;  1W0A A;  5FKY A;  2JQ9 A;  3J7Y q;  1YXR A;  4GOU A;  3ETV A;  2JJ9 A;  2W00 A;  2BKN A;  2CLY C;  2I6H A;  3PE0 A;  3TLV A;  4YXD A;  4IDO A;  5ABF B;  5LHH B;  3F31 A;  5LGT B;  2KWH A;  1XNR T;  4MBQ A;  5LB7 B;  3QOF A;  4X66 T;  3PUX F;  1KFY A;  2VKH A;  4HFI A;  1DU2 A;  2WWV A;  1LKX A;  2KSR A;  1T7S A;  1X9B A;  2N2N A;  3CPZ A;  4WYV A;  5DQV A;  2P9B A;  2X0H A;  2XAQ B;  2MYS A;  3RLF F;  4PW8 A;  2WDR A;  4A98 A;  2Q9Q B;  2XQ8 A;  3P4Q A;  3UU5 A;  5C3J A;  3ANW A;  5AQR B;  5AQQ B;  1HFA A;  1SUM B;  1WFD A;  4AQG A;  5LGN B;  4KHP T;  3E0Z A;  3Q2M A;  2V6Y B;  3ZCJ A;  1HCI A;  2W4X A;  4LFC T;  1N36 T;  1WLX A;  2X9Y A;  2X66 A;  3NRX A;  4L9I A;  3RKO A;  3SRZ A;  4YSY A;  2UUB T;  4B3M T;  4LFB T;  1IJ6 A;  3HKE E;  2XAJ B;  2X51 A;  4EV6 A;  2ZM6 T;  2J4G A;  2E5L T;  4GKJ T;  4WZX A;  2WDV A;  4ZXL A;  2PBI A;  2BKP A;  5JR9 B;  4YHH T;  5L4H A;  2YEV C;  4YLH A;  3RGL A;  4TWD A;  1NAF A;  4HFD A;  3RI5 A;  5ADX L;  4PK4 A;  2JQH A;  4E7Z A;  4QXB B;  3ZMS B;  5FVL A;  3KV6 A;  4ASK A;  4NPP A;  5AQO B;  1V9D A;  5BMV E;  5J2T E;  1KEY A;  3K3O A;  3AEA A;  4UV9 B;  5AQK B;  2XM2 A;  3LBX B;  2QVA A;  4EZH A;  4P0A A;  2FJE A;  3P7I A;  4ILC A;  2JPF A;  2JQQ A;  2VL0 A;  4LF8 T;  1S94 A;  1BR2 A;  3EDV A;  5FMN A;  5HEU A;  4EZ4 A;  2FJB A;  4FJO A;  1QLB A;  3J9X 1;  3O9X A;  4UEL A;  5CFB A;  3KBU A;  3B57 A;  3I0Q A;  2X0L B;  2WCA A;  2YDQ A;  3ANW B;  4HWI B;  4LFA T;  3IEE A;  3ZYM A;  2LHN A;  4HWH A;  3RIU C;  2LKH A;  5JDF A;  3X1D A;  2H7V C;  3OTO T;  2WP9 A;  2E8I A;  2Y8D A;  3HKC E;  3OKQ A;  4TNV A;  3PV0 F;  1HR0 T;  4JI5 T;  4IST A;  3N9P A;  5IUX A;  4K0K T;  2JIW A;  2X67 A;  3HKD E;  1ZV4 X;  2WB5 A;  3QB5 K;  2D2S A;  3ONJ A;  5AQP B;  4ZI7 E;  2KZ7 B;  1U5P A;  2CPT A;  3KV9 A;  4CI1 B;  4BA9 A;  1QSD A;  2YU2 A;  3H3M A;  3QNU A;  5FP3 A;  4YTP A;  2CEA A;  2YK0 A;  3TKL B;  5L2L A;  4B3T T;  4AI6 A;  1YW0 A;  2A72 A;  3Q5D A;  4F8H A;  1MMG A;  3LSV A;  3CWZ B;  4HWD A;  4DBR A;  1YKH B;  3OBV E;  4C91 A;  2BZB A;  3DJB A;  5LA6 E;  5DJQ C;  5AQG B;  5DAB A;  2XQ3 A;  3B5M A;  2D5U A;  2B1E A;  1KNZ A;  4X1I E;  4X5T A;  4Z91 A;  3UUL A;  4BJN A;  2NOX A;  3QK6 A;  4TV8 E;  5EK2 A;  5FY1 A;  3RQU A;  2XSA A;  4IDP A;  4ILA A;  2EHO B;  2LM2 A;  2KIN B;  2XAH B;  5AQH B;  5AQI B;  5F5W A;  1VRB A;  2V6X A;  2HH7 A;  2XQ7 A;  3CQG B;  3OJA A;  3P4W A;  4UXN B;  2BBJ A;  3RIA A;  3KVB A;  3N9M A;  2H3R A;  4V1A v;  3ZN1 B;  3HA4 A;  4QH4 A;  3IBP A;  4TZ4 C;  3RRC A;  4JI4 T;  1UK5 A;  4H9O C;  4DV5 T;  4U7I A;  1US7 B;  3SFD A;  4HFC A;  4YTN A;  2LRK A;  4EYY R;  1HNZ T;  1WYC A;  1HTJ F;  5IYZ E;  1D1B A;  3ZSS A;  1SE7 A;  4OYK A;  4Q25 A;  2XHE B;  3NBX X;  2RPA A;  2IW5 B;  4UV8 B;  3IA3 A;  3N2K E;  3UT5 E;  2KMF A;  2PFV A;  4IE7 A;  1ZKE A;  2J62 A;  2V7I A;  3EUH A;  1ZEE A;  2LRL A;  2ZMA A;  4AIU A;  5LHG B;  3HR0 A;  2UXC T;  3RYH E;  4H9S E;  3ZMT B;  2HPL A;  2ZM2 A;  5E0O A;  3L3P A;  5LBM A;  2LSJ A;  4X62 T;  2E9X A;  4DMW A;  5J2U E;  5JQG E;  2XAF B;  3UFG A;  2WDQ A;  5LCY A;  5L3C B;  1BR4 A;  1FEW A;  5FNV E;  3LG7 A;  4DV7 T;  2M6B A;  2LE8 A;  1IBL T;  4CN1 A;  4IRE A;  4TWF A;  4GKK T;  3AAI A;  4DV0 T;  5LP6 E;  4DR6 T;  5KXJ A;  3SS1 A;  2AE9 A;  3RYI E;  2N1G A;  2I59 A;  4IGU A;  3A7M A;  2ACZ A;  2A9U A;  4PK6 A;  1HG5 A;  4IDZ A;  1NEK A;  3QUJ A;  3R84 B;  5JR9 A;  5LJM A;  3NZP A;  2V7L A;  2L9Q A;  1FMW A;  4L5G A;  2XQ9 A;  4UVB B;  2VKJ A;  3AA7 B;  2FJD A;  3JAF A;  5FVK A;  5LYJ E;  4Z90 A;  4ZEY A;  2D0T A;  4PJL A;  3ZEF B;  3AEC A;  3C98 B;  2BVM A;  3QB5 A;  4QHO A;  1VCT A;  2PJQ A;  3CML A;  3AEB A;  3JAE A;  3MAC A;  5HXC A;  1L0V A;  2BS3 A;  4ANJ A;  3P4R A;  4H9N C;  3O1J A;  3PU8 A;  4X1Y E;  5H6Q B;  2XQ6 A;  4PJJ A;  2KND A;  4I0U A;  4P09 A;  4AQF A;  2NR4 A;  3RF1 A;  4YHJ A;  5CJ5 A;  4J2C A;  4F6R C;  1D0X A;  1MND A;  2WAU A;  4LF6 T;  3C4Z A;  2VWA A;  4OK0 A;  3FBZ A;  4M1P A;  1UUR A;  4U7Y A;  3PUA A;  4O4J E;  4U3C A;  4XAX B;  3GMI A;  4IT4 A;  1YQ3 A;  1H7C A;  2B76 A;  2KT9 A;  1T98 A;  2CRB A;  2CM0 A;  3CIR A;  4U2Y A;  3JAD A;  5FXW A;  2IDO B;  2Q9Q C;  2V7M A;  5LHI B;  4X20 E;  3EAM A;  5ETW A;  5LMU T;  2VK9 A;  2MPK A;  3DTO A;  3VU7 H;  4CI2 B;  3T8O A;  4LF4 T;  4TN7 B;  1SA0 E;  3ZT6 A;  3RIF A;  2JMH A;  2LOS A;  2K9A A;  1MNE A;  3C4X A;  3O1H A;  4O2B E;  4CI3 B;  1NWM X;  2CWO A;  2E2A A;  2HPJ A;  2D0U A;  1J1J A;  2DNX A;  3ABV A;  4O4L E;  2X0Y A;  3PUQ A;  4EOZ B;  4ERR A;  4ZI2 D;  4GYR A;  1IBK T;  3C51 A;  4WNK A;  1D0Y A;  3B13 A;  4IE5 A;  5TAO A;  3PUG A;  4TUY E;  2UXN B;  4P1N A;  2ODV A;  2LKG A;  4YFS A;  3LBX A;  3PJA A;  1T8B A;  2WM9 A;  3MZK B;  3AE2 A;  4JLE A;  5AQU B;  5HAX A;  4HWF A;  2ZM0 A;  5EK4 A;  5FXZ A;  2XJ7 A;  4A5X A;  3OVU A;  5JVD E;  3CX6 B;  3WAK A;  2C5I T;  3NZQ A;  5A1L A;  2OLT A;  2X9X A;  2J47 A;  2NW7 A;  4ZHQ E;  3AXJ A;  4IL4 A;  2LHR A;  2VQE T;  2I0M A;  4EB6 E;  4NXM T;  3D0T A;  2K5B B;  1VCS A;  2W61 A;  3PU3 A;  3ZJ1 A;  2V8S V;  1M62 A;  4CQI A;  3PUV F;  3N9L A;  2JRK A;  4IL9 A;  2EHO C;  3P4P A;  4UVA B;  4DMV A;  5JDL A;  3MK7 C;  5JDG A;  2VB6 A;  3AXJ B;  5CA1 E;  3CX8 B;  2KWI B;  4PAG A;  4AQF C;  4UF0 B;  5AQS B;  3K8P C;  3HL6 A;  5EZY E;  3ZT5 A;  1YKE B;  2K48 A;  2IHR 1;  3AE8 A;  3EVY A;  2X9H A;  4ZOL E;  3TLS A;  1LVF A;  1Y64 B;  4QX8 B;  3ZMU B;  2E5V A;  5HXH A;  1XMO T;  4NXN T;  4LMK A;  1ZP0 A;  5ABG A;  4XZC A;  4YTM A;  3FB2 A;  1R8I A;  2J1D G;  5F3J A;  3AE9 A;  3K1S A;  2Y48 B;  5CA0 E;  4NUU A;  1D1A A;  4NIQ A;  4H9Q C;  5GON E;  4JUY A;  4CZZ B;  3RYF E;  2C5J A;  2HN1 A;  4E7S A;  3KBT A;  4CXX A;  3FXE B;  2IUB A;  3LFM A;  2W62 A;  3SFE A;  3KVA A;  3UU4 A;  4YJ2 E;  4IHJ E;  1W0B A;  3IHR A;  4KUM B;  2YDR A;  3KDS E;  4B3R T;  1UX5 A;  5L47 A;  2V7K A;  1KNP A;  4IDN A;  4KP3 C;  2RA1 A;  4DR3 T;  2V6Y A;  2ODU A;  2XSB A;  2UXX B;  1MIV A;  4AKH A;  3E22 E;  4DID B;  3O1I A;  4WW0 A;  5LBQ B;  2HN2 A;  4MLK A;  1T72 A;  3PUS A;  1M7K A;  4ILB A;  3H37 A;  2DWG A;  2F4V T;  4O4I E;  1BR0 A;  4DR2 T;  3VRB A;  1MMN A;  5HCJ A;  3N2O A;  3BQK A; 
#chains in the Genus database with same CATH homology
 4ZI3 D;  4CXY A;  2KXP B;  1HG2 A;  2CLY B;  5HXS A;  1IJ5 A;  4NUV A;  2NW8 A;  4ILU A;  1MMD A;  3RRW A;  3ZJ2 A;  1UCU A;  5L3G B;  3HI2 A;  2YIN A;  5KX5 E;  5J1G A;  4P0B A;  3N9Q A;  1EZ3 A;  3HKB E;  2WSS V;  4K0U A;  3BQI A;  4DO0 A;  2CA5 A;  3I1A A;  1B7T A;  4IIJ E;  4A56 A;  1HF8 A;  3KFW X;  4KMC A;  4UIG A;  2V1D B;  2SPC A;  3ZMZ B;  2DHR A;  4EIW A;  5L3D B;  2H7O A;  2DWK A;  3LJC A;  3OYX A;  5FYM A;  4OHF A;  1FIO A;  4U74 A;  2NTY A;  1LRZ A;  4AKL A;  5KMG P;  2NWB A;  4I4T E;  2C0S A;  4PJN A;  3CX7 B;  2LSK A;  3BK9 A;  3C4W A;  1D0Z A;  4HTE A;  5FXX A;  1E1H B;  3I9Y A;  3JC6 D;  4BAY B;  1CUN A;  4WBO A;  5JDH A;  2Q9Q A;  4ZS2 A;  4UF0 A;  5JDQ A;  4QX7 B;  2K24 A;  3LK3 B;  2CE7 A;  1G73 A;  2N9D A;  3JC6 C;  2BDE A;  3I9W A;  2JMK A;  5LG4 A;  3PUR A;  1FMV A;  4JEH B;  3VHL A;  3RX6 A;  3RPU A;  4AKR B;  3N9N A;  3Q5X A;  4I55 E;  3SOL A;  5JRE A;  2L8K A;  2QA7 A;  5F8P A;  1S35 A;  5FY7 A;  3Q5W A;  3PTR B;  4I50 E;  4PJM A;  5L3F B;  1IZN B;  2E9X B;  2V7J A;  3S4U A;  2YU1 A;  2IAK A;  4QXH B;  2LT3 A;  5HXE A;  2DI4 A;  3AAA B;  4H63 H;  2Q9Q D;  4DVD A;  2E9X D;  3Q9D A;  2EHO D;  2VAS A;  3UFE A;  2M67 A;  3ZYK A;  1AJ3 A;  2MOZ A;  4HKA A;  3LK4 2;  5HWY A;  1MMA A;  5H6R B;  5JR9 C;  2WMO A;  4TX5 A;  4EYU A;  3IF8 B;  3ZPO A;  3N9O A;  2BVL A;  2NTX A;  2LSI A;  2LEH A;  4PNI A;  1KK7 A;  1BR1 A;  3ESL A;  3DP7 A;  3N5L A;  1WRD A;  2C5K T;  3UUN A;  2MBG A;  2NP9 A;  2GK9 A;  2PG8 A;  3U3I A;  3GA8 A;  2L3L A;  3OYZ A;  5JRC B;  4DND A;  3K3N A;  4HGA A;  3E08 A;  5LGU B;  4HE8 A;  3FXD B;  2RP4 A;  5HWX A;  3H3A A;  3V5S A;  3C64 A;  4OYJ A;  3VKH A;  3QC9 A;  4HN9 A;  3AVS A;  2CCQ A;  3KIN B;  2Y6X A;  4ANJ A;  2CWY A;  2E9X C;  2ES0 A;  4QXC B;  4BJM A;  3MJX A;  3ONX A;  4KBM B;  3GN5 B;  2QGS A;  3EDU A;  3AAE B;  3LK2 B;  4Z8X A;  5JR9 A;  4FI5 A;  2LM9 A;  3UUX B;  5JH7 E;  3PDY A;  2LSY A;  4AXP A;  3M65 A;  3MA9 A;  4ZI2 C;  5JRC A;  4PK5 A;  3WI3 A;  5LJN A;  4GYS A;  2ACX A;  4DBQ A;  4UVC B;  5LXT E;  2G0U A;  2CXL A;  4MFR A;  5AFU L;  3A5X A;  4G2A A;  5LGN B;  1WYB A;  3RYC E;  3VKG A;  1QUU A;  2W63 A;  1WR6 A;  2CMR A;  2XUE A;  4JEU B;  4ZS3 A;  4B6X A;  2CXD A;  5FXV A;  3ZCI A;  2VKD A;  3F2E A;  2A3D A;  5HYA A;  2VKO A;  4ISS A;  3GWH A;  3P8C D;  4G63 A;  2IC9 A;  3CQX C;  5LOV E;  5KDM C;  2CXF A;  4AKG A;  3RC3 A;  4L0R A;  2LSG A;  3CKD A;  2MTQ A;  5C8Y E;  3SWH A;  3W15 B;  3RC8 A;  4O8S A;  3ZN0 B;  3AA1 B;  1U4Q A;  3ETU A;  2WWU A;  4GK0 E;  4XBF B;  4OFZ A;  4HFV A;  3RH3 A;  4EXT A;  3AA6 B;  2LOP A;  3AVR A;  3I0O A;  4HEA A;  4I43 B;  1Z0P A;  1G8X A;  4MHC A;  4QKN A;  1LVK A;  4UEM A;  5L3E B;  4IE6 A;  2IC6 A;  5CB4 E;  2XAG B;  3N2G E;  3NRY A;  4H9P C;  5JDN A;  3ZC1 A;  4O4H E;  1IAP A;  4AKI A;  3ZLI A;  1O3X A;  4O2A E;  4ADZ A;  2WMN A;  4WBN E;  4TN7 B;  1ZHC A;  3OJA A;  3FBL A;  3U78 A;  5M4Y A;  1OWA A;  2OA5 A;  4EAH A;  1X79 A;  4H9R C;  5IHY A;  4YJ3 E;  2DLR A;  5EK3 A;  3AA0 B;  1HX8 A;  3F57 A;  4X1K E;  1MIY A;  4IE4 A;  4QWN B;  2A2F X;  1UX4 A;  2ZLY A;  3GN5 A;  5LNK A;  3CVR A;  1D1C A;  2LJL A;  5DQW A;  4U72 A;  3WAJ A;  2DCF A;  1OXZ A;  3CQC B;  3C50 A;  2WBL A;  3AB3 B;  3UTK A;  2VL8 A;  2W0G A;  4GIW A;  4MAL A;  2V26 A;  3ZC0 A;  3UUM A;  2X9W A;  3L09 A;  4GK5 E;  3KV4 A;  4CXW A;  2XTL A;  1SHZ C;  2ZM8 A;  2NW9 A;  3BQL A;  5L3B B;  5HXR A;  3ZMV B;  4N78 D;  4H63 V;  2EHO A;  2X68 A;  3MXZ A;  3KV5 A;  4IE0 A;  4TV9 E;  4ZI3 C;  1YD8 G;  1VOM A;  3FHN A;  3MKD A;  3O4X E;  3ZYL A;  5FY0 A;  4PFO A;  1MIW A;  2XQY A;  2Z6E A;  2KLQ A;  3K3Q C;  4PFP A;  2XAS B;  3R6N A;  5JDM A;  3J7Y q;  4GOU A;  3ETV A;  2JJ9 A;  2W00 A;  2CLY C;  3PE0 A;  5LHH B;  5LGT B;  3F31 A;  2KWH A;  4MBQ A;  2VKH A;  1LKX A;  2N2N A;  5DQV A;  3CPZ A;  2P9B A;  2XAQ B;  2MYS A;  4PW8 A;  2Q9Q B;  3ANW A;  1HFA A;  4AQG A;  3E0Z A;  3Q2M A;  3ZCJ A;  1HCI A;  1WLX A;  2X9Y A;  2X66 A;  3NRX A;  4L9I A;  3RKO A;  3SRZ A;  1IJ6 A;  3HKE E;  2XAJ B;  2X51 A;  5JR9 B;  2PBI A;  2YEV C;  4YLH A;  1NAF A;  5ADX L;  4PK4 A;  4E7Z A;  4QXB B;  3ZMS B;  3KV6 A;  4ASK A;  5BMV E;  1V9D A;  5J2T E;  3K3O A;  4UV9 B;  3LBX B;  4EZH A;  4P0A A;  3P7I A;  2JPF A;  2JQQ A;  1S94 A;  1BR2 A;  3EDV A;  5FMN A;  4EZ4 A;  3J9X 1;  4FJO A;  3O9X A;  4UEL A;  3KBU A;  3B57 A;  3I0Q A;  2X0L B;  3ANW B;  3IEE A;  3ZYM A;  2LHN A;  5JDF A;  2H7V C;  2Y8D A;  2E8I A;  3HKC E;  3OKQ A;  4IST A;  3N9P A;  2X67 A;  3HKD E;  1ZV4 X;  4ZI7 E;  2D2S A;  4CI1 B;  2KZ7 B;  1U5P A;  3KV9 A;  4BA9 A;  1QSD A;  2YU2 A;  5L2L A;  5FP3 A;  2CEA A;  2YK0 A;  3TKL B;  4AI6 A;  2A72 A;  1YW0 A;  1MMG A;  3CWZ B;  4DBR A;  1YKH B;  3OBV E;  4C91 A;  2BZB A;  3DJB A;  5LA6 E;  5DJQ C;  5DAB A;  2D5U A;  2B1E A;  1KNZ A;  4X1I E;  4BJN A;  3UUL A;  5EK2 A;  2NOX A;  3QK6 A;  4TV8 E;  5FY1 A;  2EHO B;  2KIN B;  2XAH B;  3CQG B;  1VRB A;  2HH7 A;  4UXN B;  3KVB A;  3N9M A;  2H3R A;  4V1A v;  3ZN1 B;  3HA4 A;  4TZ4 C;  3IBP A;  3RRC A;  4H9O C;  1US7 B;  4EYY R;  1WYC A;  1HTJ F;  5IYZ E;  1D1B A;  4OYK A;  2XHE B;  3NBX X;  2IW5 B;  4UV8 B;  3N2K E;  3UT5 E;  2KMF A;  2PFV A;  4IE7 A;  1ZKE A;  2V7I A;  3EUH A;  1ZEE A;  2ZMA A;  5LHG B;  3HR0 A;  3RYH E;  4H9S E;  3ZMT B;  2HPL A;  2ZM2 A;  5E0O A;  3L3P A;  5LBM A;  2LSJ A;  2E9X A;  4DMW A;  5J2U E;  5JQG E;  2XAF B;  5LCY A;  5L3C B;  1BR4 A;  1FEW A;  5FNV E;  3LG7 A;  2LE8 A;  3AAI A;  5LP6 E;  3SS1 A;  3RYI E;  2N1G A;  2I59 A;  4IGU A;  4PK6 A;  1HG5 A;  4IDZ A;  3QUJ A;  3R84 B;  5LJM A;  3NZP A;  2V7L A;  2L9Q A;  1FMW A;  4L5G A;  4UVB B;  2VKJ A;  3AA7 B;  5LYJ E;  2D0T A;  4PJL A;  3ZEF B;  3C98 B;  2BVM A;  4QHO A;  5HXC A;  2PJQ A;  3MAC A;  3CML A;  4ZI2 D;  4H9N C;  3O1J A;  3PU8 A;  4X1Y E;  5H6Q B;  4PJJ A;  4AQF A;  2KND A;  4C90 A;  4P09 A;  4YHJ A;  4J2C A;  4F6R C;  1D0X A;  1MND A;  2WAU A;  3C4Z A;  2VWA A;  4OK0 A;  3FBZ A;  4M1P A;  1HS7 A;  3PUA A;  4O4J E;  4XAX B;  3GMI A;  1H7C A;  2KT9 A;  1T98 A;  2CM0 A;  5FXW A;  2Q9Q C;  2V7M A;  5LHI B;  4X20 E;  5ETW A;  2VK9 A;  3VU7 H;  3DTO A;  4CI2 B;  3T8O A;  1SA0 E;  2JMH A;  2LOS A;  2K9A A;  1MNE A;  3C4X A;  3O1H A;  4O2B E;  4CI3 B;  1NWM X;  2CWO A;  2HPJ A;  4O4L E;  2D0U A;  2DNX A;  3V5U A;  3PUQ A;  4EOZ B;  4ERR A;  4GYR A;  3C51 A;  4WNK A;  1D0Y A;  3B13 A;  4IE5 A;  5TAO A;  3PUG A;  4TUY E;  2UXN B;  2ODV A;  4YFS A;  3LBX A;  2WM9 A;  3MZK B;  4JLE A;  5HAX A;  2ZM0 A;  5EK4 A;  5FXZ A;  3WAK A;  5JVD E;  3CX6 B;  2C5I T;  3NZQ A;  5A1L A;  2X9X A;  2NW7 A;  4ZHQ E;  2LHR A;  4EB6 E;  3D0T A;  2K5B B;  2W61 A;  3PU3 A;  3ZJ1 A;  4CQI A;  3N9L A;  2JRK A;  2EHO C;  4UVA B;  4DMV A;  5JDL A;  5JDG A;  3MK7 C;  2VB6 A;  5CA1 E;  3CX8 B;  2KWI B;  4PAG A;  4AQF C;  4UF0 B;  3K8P C;  3HL6 A;  5EZY E;  1YKE B;  2K48 A;  3EVY A;  2X9H A;  4ZOL E;  3ZMU B;  1LVF A;  1Y64 B;  4QX8 B;  5HXH A;  4XZC A;  3FB2 A;  2J1D G;  5F3J A;  5CA0 E;  2Y48 B;  4NUU A;  1D1A A;  4H9Q C;  5GON E;  4JUY A;  4CZZ B;  3RYF E;  2C5J A;  4E7S A;  3KBT A;  4CXX A;  3FXE B;  3LFM A;  2W62 A;  3KVA A;  4YJ2 E;  4IHJ E;  4KUM B;  3IHR A;  3KDS E;  1UX5 A;  2V7K A;  4KP3 C;  2RA1 A;  2ODU A;  2UXX B;  1MIV A;  4AKH A;  3E22 E;  3O1I A;  4WW0 A;  5LBQ B;  4MLK A;  3PUS A;  3H37 A;  2DWG A;  4O4I E;  1BR0 A;  1MMN A;  3N2O A;  3BQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...