3FXDB

Crystal structure of interacting domains of icmr and icmq
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
b'VTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein IcmQ
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Unknown function
total genus 24
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fxdB00
3FXDB 3QK6A 2C5KT 2CA5A 3N5LA 1LRZA 2X9WA 1LVFA 1Z0PA 2XTLA 3CKDA 3L3PA 2K48A 1IJ5A 3CVRA 4B6XA 2IC9A 2G0UA 1IJ6A 4L0RA 4EYYR 2KWHA 3FXEB 4J2CA 1H7CA 2C5JA 3QUJA 2KWIB 2X9XA 1QSDA 2X9YA 2C5IT 3TKLB 2MBGA 4CQIA 3P7IA 2IC6A 4DNDA 3S4UA 4FI5A 1ZKEA 3MXZA
chains in the Genus database with same CATH superfamily
2LOPA 3AE1A 4EV6A 5L3BB 4JYAT 1FJGT 2V6YA 4UF0A 3KV4A 4U33A 4LF9T 2KWHA 2V6XA 5J2TE 3HA4A 5CFBA 2BVMA 2W00A 2EHOA 3E08A 1KEYA 4JUYA 1J5WA 3LBXB 3CQXC 1J1JA 1WLXA 3AE7A 3UQ7A 3B57A 2IC9A 2AXDS 4L0RA 1CHUA 2NW8A 1KNZA 2W63A 3ZMUB 4WNKA 3GMIA 3RYCE 3UU6A 2K9AA 5IYZE 3RQWA 5AQVB 5JDLA 1N33T 2OLTA 3HR0A 4DV3T 3P4PA 3Q5EA 4IREA 1UK5A 3AA7B 3MK7C 3E0ZA 3N2OA 3AE2A 3PTRB 3UQ4A 4HTEA 3ZN1B 4H9SE 4EEDA 4IT4A 3ABVA 2LHRA 4A5XA 2RA1A 3VKHA 5DJQC 4B3ST 4HWHA 4A98A 4BA9A 5FXZA 3VR8A 4AKHA 1QLBA 2Y6XA 4ASKA 4LMJA 1XNQT 2H7VC 1YW0A 5AQIB 2JMKA 4PK6A 2Q9QD 2ODVA 2LKGA 5HXCA 5L4EA 5ABFA 2C5KT 2XASB 3JADA 3P4QA 4P1NA 2CWYA 4YSZA 3M3ZB 3ZJ2A 5LA6E 2JRKA 4HFEA 1Y64B 1IBKT 2V6YB 1MNDA 4UF0B 4QXHB 1BR0A 1MNEA 1LVKA 2XM1A 3OJAA 2WAUA 2C0SA 3N9PA 3PUGA 2M6IA 3EAMA 2EHOB 3J9X1 3RKGA 3FZHB 2X0YA 4CI3B 3A7MA 3FXDB 2XY8B 3SS1A 3Q5WA 4YJ3E 4IDPA 1WYBA 4YTMA 4TV8E 4OYJA 3QOFA 3AVSA 4UVAB 4DR1T 3RLFF 3SOLA 2MBGA 3Q5DA 4CQIA 2P9BA 5L3GB 4CI1B 2H88A 5JDMA 3AAIA 3RIAA 2BKPA 1MMGA 4JI6T 2K3WA 1ZEEA 5LHGB 2JMHA 2WMNA 2BG9A 1IJ6A 2FUPA 4EZHA 2DI4A 2DLRA 5H6QB 3ESLA 1H7CA 3ZMSB 1Y01A 4WBOA 3WAJA 4X20E 2UUCT 4I0UA 2A2FX 5LJNA 5KDMC 1T72A 2IHR1 2MOZA 3ZCIA 4ILCA 2XTLA 4CZZB 2WCAA 2XQ9A 5AQPB 2QGSA 4X1YE 4JLEA 4DO0A 2N9DA 3WI3A 1HFAA 5L4HA 5C2TA 2NW9A 2PBIA 3EI0A 2YEVC 3KBTA 2FJAA 2WWVA 5FL0A 3NZPA 1HX8A 4F6RC 4X62T 4L5GA 2XSBA 5ABFB 1O3XA 2V7JA 3BK9A 3AAEB 5HCJA 2A3DA 3NRYA 2C5IT 1T98A 4PJMA 2X9HA 4HFDA 3UUNA 3TLWA 4K0UA 2NTXA 3T1HT 4NUVA 5FNVE 3QB5K 2LE8A 3ZC0A 4EEBA 2LOSA 1XWMA 2W66A 2V1DB 4ISSA 2YN6A 5F8PA 4JI4T 2N2NA 3L8RA 4DR4T 3OKQA 4QXBB 2JJ9A 3AA0B 3RRCA 2RP4A 1OEDA 2FJBA 1X79A 2LSIA 2EHOC 1DU2A 3ZMZB 2E9XA 3EABA 4I4TE 3A5XA 2WU5A 3HKCE 2V8SV 4EIWA 4LF6T 3UU8A 3KV6A 5JRCA 4DIDB 4DR3T 2QYWA 4PFPA 4PJLA 2HN2A 3U3IA 3ANWA 5LG4A 3Q5XA 2D2SA 2PJQA 4IL4A 2VVSA 4XAXB 3QC9A 3RIFA 5FP3A 2WZHA 4HFCA 5J0ZA 5HEGA 3I1AA 2QA7A 3PUSA 3IA3A 2H7OA 2XHEB 1QSDA 5L47A 3TKLB 2IUBA 3HL6A 3UTKA 1IBMT 4ADZA 4AKIA 3AB3B 3OVUA 3M65A 4H9OC 3RF1A 4B6XA 5L2LA 5F3JA 5KX5E 2MAWA 2YK0A 2WU2A 1BR2A 3HKEE 4UEMA 2WP9A 4AQYT 4IE7A 3UUXB 3NKZA 3PU3A 4ZOLE 1D1CA 2SPCA 2X9WA 5AQQB 4CXXA 2CRBA 4MHCA 4GYSA 4ZI3C 5LYJE 2OV9A 4PNIA 5TAOA 2H89A 1R8IA 1MMAA 2BVLA 4ZI3D 4ZZBA 2LEHA 3EHZA 5JDGA 2LM2A 4DR7T 2YINA 2XQYA 4ZI2D 5BR8T 2XAHB 1XMQT 2DCFA 3TLUA 5JH7E 4KUMB 2YDSA 1NENA 4EGWA 1D0ZA 4TZ4C 1OEDB 4KHPT 2L3LA 5DABA 3K8PC 4U7IA 5L3FB 1J5ET 2E9XB 3KV5A 4IDQA 1FEWA 4EYUA 4QHOA 1FMWA 2AE9A 1W0AA 3AEBA 5AQFB 4QH4A 3DP7A 5J2UE 5IHYA 1MIYA 2V7IA 4O4HE 3RQUA 4YY3T 3AVRA 2CM0A 5F5WA 2PTFA 3I9YA 1N34T 4KHZF 2G0UA 3KINB 2IW5B 4IHJE 1S35A 5GONE 1BR1A 4I43B 3N9OA 3F57A 4TNWA 2BG9C 2BS3A 3U78A 3Q9DA 1D0XA 1CUNA 1FMVA 4B3RT 3AE3A 4C91A 2ZM2A 2V5DA 4H63H 4BJNA 1T8BA 3K1SA 2B1EA 1HS7A 2J47A 4QH1A 3P4RA 2X0HA 1UURA 2LHNA 2CLYC 2XM2A 2XQ8A 5LHIB 3RRWA 2D0TA 3PUXF 2CXLA 3IEEA 4JI3T 1N32T 3AAAB 3VU7H 1JNRA 3H37A 4IE0A 4KP3C 5A1LA 3QUJA 3AE9A 4UV9B 3MXZA 2XQ3A 3OYZA 2W2UA 3OTOT 4MLKA 2A72A 4O8SA 2QRXA 3ZCJA 2VK9A 4Q25A 5AQJB 4HWIB 4ZS2A 2ZM8A 3RKOA 4YSXA 3UT5E 4LFCT 4PK5A 3IBPA 4KMCA 4U72A 4C90A 4HEAA 5JREA 4ZHQE 3OYXA 2LSJA 2NP9A 3UU5A 3LFMA 4CN1A 2C5JA 2MPKA 3PURA 2XAGB 4B3TT 1KNPA 5J1GA 2VWAA 5IUXA 3FZLB 2LLYA 4ZXLA 1OEDC 3GN5A 3AEFA 2XSAA 3BQLA 2WBLA 3OPCA 2E9XC 3O9XA 4O4IE 2E9XD 4LF4T 4PW8A 2MYSA 3AEAA 3N9QA 2N1GA 2W0GA 2CBIA 2OA5A 1X9BA 2BKOA 3RX6A 2UXXB 5AQKB 4YXDA 4BJMA 1UX5A 2VL0A 4EZ4A 5ABHA 3CX8B 4HWFA 3N2GE 4NXMT 3BQKA 2LSYA 3TLSA 5AQGB 3ETVA 3CPZA 5DQVA 3F31A 1EZ3A 4GK5E 3C50A 3RHWA 2VL8A 2BG9E 3IHRA 2J4GA 2D0UA 2HHHT 5HWXA 1HNZT 3V5UA 5EK3A 3I0QA 3L3PA 1KK7A 3ZYLA 5HYAA 4WW0A 1E2AA 2YU2A 2XAJB 2NW7A 4ANJA 2NR4A 2JQ9A 1HTJF 3ZSSA 2CA5A 3RC3A 3WAKA 4JI8T 3H3AA 3LG7A 4AKRB 1UUSA 3C64A 3CVRA 1LKXA 5HXRA 2JQKA 3PDYA 2FJDA 1L0VA 3CWZB 2D9DA 4DV5T 2LSGA 3FZFB 2XQ7A 2ODUA 1LVFA 4DV1T 4O2AE 2YU1A 3DTOA 3EUHA 3GN5B 3FXEB 1QUUA 1GQEA 3UU3A 3GA8A 2CBJA 2X51A 2R6GF 4G2AA 5L3CB 1ZV4X 3O1JA 4DR5T 5ABGA 4JEUB 4U3CA 4LMLA 2UXNB 2V26A 2D5UA 3ZMTB 5L3DB 2VVNA 2DWKA 3L09A 5LB7B 1KFYA 4M1PA 1OEDE 3KVBA 2WMOA 2YKSA 2M67A 2XQ4A 3RIUA 2UUBT 4ILBA 3AECA 1WR6A 5HEUA 4YTNA 2VKDA 1W09A 2LT3A 4DVDA 2WZIA 1OXZA 3I9WA 3VR9A 3NBXX 4HE8A 3AE4A 5HAXA 5LXTE 4UXNB 3ZSTA 4KX6A 3K3NA 3P4WA 1IZNB 3RC8A 5AQNB 3ZT5A 4QH5A 2JPFA 2IAKA 4A56A 1WFDA 3UULA 5FY0A 4UELA 5LNKA 3ETUA 4WYVA 4JV5T 3PUVF 2LKHA 2ZM6T 1D1AA 3ZYKA 2WDRA 3ONJA 4DR2T 4QX8B 4AISA 4DV4T 4CN4A 5AFUL 4PJJA 5JR9A 1YKHB 2EHOD 3K3QC 5FKYA 2F4VT 3N9NA 5DQWA 3ZYMA 2ES0A 5JDHA 5FXVA 1IJ5A 3L39A 4HFHA 2UXBT 2UUAT 4X66T 4OHFA 3O4XE 4ZI7E 2BG9B 3ZMVB 3O1HA 4BAYB 2CWOA 3RPUA 4PJNA 4JI0T 1YD8G 2JQQA 4DV2T 2WS3A 4CXWA 4UR9A 2CHNA 3NWIA 4OFZA 2KMFA 3KVAA 3EVYA 2NWBA 1HG5A 1W9RA 4IDZA 4YSYA 3C4WA 4ILUA 4DV6T 4Z8XA 2E5LT 2CLYB 4YHHT 2XAFB 5AQOB 1SUMB 1MIWA 4QXCB 2Q9QA 3OBVE 1B7TA 1D0YA 3P50A 1SE7A 3FHNA 3LK42 4YJ2E 3ZPOA 4EYYR 3CQCB 3CX7B 4ISTA 5LG3A 5JVDE 4PAGA 5H6RB 3J7Yq 2E5VA 3JC6C 2XQAA 1ZHCA 5KMGP 3CKDA 5CB4E 4XBFB 4H63V 4IDOA 5AQUB 1ZP0A 4XZCA 2VURA 2X0LB 1M7KA 4L9IA 2IC6A 2L8KA 3QK6A 1WCRA 5FXWA 5AQMB 4TX5A 2JQHA 1I6ZA 2CMRA 3MZKB 3B5MA 4FI5A 4MALA 1MMDA 2I6HA 4HGAA 4QX7B 1WYCA 4DMWA 3HKBE 5JRCB 1HF8A 4U31A 2X67A 3EDVA 2KNDA 2X66A 3ANWB 3CIRA 3LSVA 1Z8UA 2J1DG 3EDUA 1SHZC 3C98B 1XNRT 2VKOA 2XAQB 5JDQA 2PFVA 2NTYA 4DMVA 4V1Av 4IGUA 2IDOB 2VASA 4IL9A 3UFEA 5CGMA 2BZBA 2ZM0A 1YQ3A 2WB5A 3AXJA 3AE6A 3H3MA 1VOMA 2LRKA 2Q9QB 3ZT7A 4DV0T 5LOVE 5E0OA 4ILAA 2E8IA 4H9QC 4DR6T 4HKAA 4Z91A 3VHLA 5L3EB 3UFGA 2WY2A 3E22E 4TWDA 5AQSB 2XQ5A 3R84B 4DBRA 1S94A 3CX6B 4QWNB 1D1BA 3RIUC 2CHOA 5KXJA 2QVAA 2VQET 3VRAA 5LGTB 1AJ3A 3KBUA 2HH7A 5JDNA 4AKLA 3PUQA 3KV9A 2A9UA 4YFSA 3PU8A 4WBNE 3AEEA 5C8YE 2KZ7B 3AE5A 4TNVA 4O4JE 2WM9A 4X65T 4E7SA 1IBLT 3PJAJ 3RGLA 1G8XA 5LJMA 3PE0A 2ZMAA 3GWHA 2V5CA 4OYKA 5JR9C 2V7KA 2IIUA 2VB6A 2VKHA 4YT0A 2BBHA 3ZT6A 4P0AA 2HN1A 5FYMA 3ZEFB 5HEJA 1ZKEA 4NIQA 4CN6A 3LJCA 4AI6A 1LRZA 4X5TA 2CE7A 3AXJB 1E1HB 5FMNA 5EZYE 3AEDA 4AIUA 3CQGB 2X68A 4NXNT 4NUUA 1HX1B 2CEAA 5AQTB 2KWIB 4AKGA 3NZQA 4ZS3A 4A97A 2W4XA 5HWYA 3G06A 4HFIA 1Z0PA 5CA0E 2HPJA 5JQGE 5FVLA 2UXDT 5LHHB 1HCIA 2Q9QC 3RYIE 5ETWA 3X1DA 3RYFE 5EK4A 3ZC1A 4U7YA 3N5LA 4UIGA 3N2KE 4LFBT 2XQ6A 4ERRA 5HXSA 4MFRA 4AXPA 2WWUA 3C4XA 4AQGA 2BKNA 2KINB 2XPKA 4O2BE 4N78D 3B13A 4TUYE 1ZOYA 2BDEA 1E7PA 2K24A 4B3MT 3N9MA 3TLVA 2PG8A 2LSKA 3A8YC 4EB6E 3JAFA 3R6NA 5FXXA 3SFEA 1XDOA 3AEGA 4GIWA 2Y8DA 4EOZB 1VCTA 3F2EA 3MA9A 4PK4A 4GKKT 1YXRA 2B76A 5HCMA 2WSSV 2L9QA 3PUYF 3NRXA 3HI2A 3FZKB 4GOUA 2V7MA 1WR0A 4LMKA 1JNZA 3MKDA 3PJAA 4QKNA 5EK2A 3K3OA 2WDQA 1KNRA 2YOEA 2I59A 4P0BA 2DNXA 5LP6E 3ZLIA 3MJXA 3AE8A 4OX9T 5ABEA 3T8OA 3PUZF 2KT9A 2KSRA 5FVKA 2W61A 3UUMA 2YDRA 4TN7B 3AA6B 2DHRA 2BS4A 4AQFA 2ACXA 1KF6A 4IDNA 2RPAA 4JI7T 4J2CA 4DBQA 3VKGA 2M6BA 5JDFA 2IMLA 4IE4A 3FBZA 3ZKRA 4ZZCA 4DV7T 1YQ4A 4HFBA 3PUWF 4FJOA 3SFDA 2Z6EA 3ONXA 5BMVE 5LCYA 2UU9T 4JEHB 2BS2A 3O1IA 5HXHA 1MIVA 1US7B 2ZLYA 4UVCB 5LBMA 4IE5A 2K48A 1BR4A 2UXCT 1XMOT 5HEHA 3I0OA 4U2YA 2ACZA 2BBJA 2KXPB 2MTQA 5M4YA 3W15B 3CMLA 5IWAT 2YDQA 3QB5A 4P09A 5LBQB 4DUZT 5LGNB 4YHJA 5AQRB 4LF5T 4F8HA 2LM9A 1M62A 3CK6A 3IF8B 4U74A 1MMNA 2FBWA 1W0BA 2V7LA 4DNDA 4Z90A 3RH3A 4COFA 4X1KE 5ADXL 4X1IE 2DWGA 5LMNT 1NEKA 4NPPA 4OK0A 4ZEYA 4TV9E 2WDVA 2VQFT 4K0KT 4KI0F 5FY1A 2X9YA 2CXFA 3D0TA 2XUEA 4WZXA 3UU4A 3PUAA 4JBWF 3FB2A 4U2ZA 5CA1E 4LFAT 2HPLA 2JIWA 5C3JA 5JTGA 2WQYA 1IAPA 4HN9A 4CXYA 1HNWT 5LGUB 1U4QA 2NOXA 1I94T 3SWHA 4IIJE 3S4UA 2E2AA 1UCUA 1G73A 4TWFA 1HG2A 2LJLA 4LF7T 1NWMX 2KLQA 3UUBA 3JC6D 2FJEA 1U5PA 3C51A 1XDPA 3T1YT 3P8CD 4E7ZA 3FZMB 4CI2B 2GK9A 3Q2MA 3AA1B 1YKEB 4UVBB 5CJ5A 3JCFA 2K5BB 4DUYT 3ZN0B 1VCSA 4UV8B 4GKJT 2W67A 3KFWX 4JI2T 5AQLB 1UX4A 3TLTA 1NAFA 1T7SA 2X9XA 4ZI2C 2I0MA 4HFVA 4HWDA 4H9RC 4PFOA 3JAEA 1SA0E 3LBXA 3N9LA 5HEOA 4O4LE 3LK3B 4EXTA 3P4SA 4G63A 5JR9B 3QNUA 1HNXT 2H3RA 2XZEA 4H9NC 4I55E 2DL1A 4JI1T 3SRZA 4MBQA 3MACA 1FIOA 1HR0T 3HKDE 3PV0F 3LK2B 4I50E 2W62A 4GYRA 2J62A 1XZYA 4YLHA 3FBLA 2CPTA 3RI5A 3VRBA 4EAHA 4GK0E 3P7IA 4HWCA 3NVOA 2CCQA 3LDQB 3DJBA 2CXDA 1V9DA 4YTPA 5AQHB 1N36T 3ZJ1A 3RYHE 3ONLC 2XJ7A 5HXEA 2Y48B 3KDSE 4JI5T 1VRBA 4X64T 4TWHA 5FY7A 3V5SA 1UGOA 2LRLA 2VKJA 4LF8T 1OWAA 4KBMB 3BQIA 3C4ZA 4AQFC 1WRDA 4IE6A 4H9PC 5FL1A 5LMUT
chains in the Genus database with same CATH topology
3RYFE 4ZOLE 5LXTE 2LOPA 5EK4A 3ZC1A 1D1CA 2SPCA 3N5LA 4UIGA 2X9WA 4UXNB 4CXXA 3N2KE 4MHCA 5L3BB 4ERRA 5HXSA 4GYSA 4ZI3C 3K3NA 5LYJE 4PNIA 5TAOA 4UF0A 3KV4A 4MFRA 1IZNB 3RC8A 1MMAA 4AXPA 2WWUA 2KWHA 2BVLA 4ZI3D 5J2TE 3C4XA 3HA4A 2LEHA 4AQGA 2KINB 5JDGA 4O2BE 2YINA 4N78D 2JPFA 2BVMA 2W00A 2XQYA 4ZI2D 2IAKA 2XAHB 3B13A 4A56A 2DCFA 2EHOA 4TUYE 3E08A 4JUYA 3UULA 5FY0A 5JH7E 4UELA 2BDEA 3ETUA 4KUMB 5LNKA 3LBXB 3CQXC 2K24A 1WLXA 3N9MA 3B57A 2IC9A 2PG8A 1D1AA 2LSKA 4L0RA 3ZYKA 1D0ZA 4EB6E 3R6NA 5FXXA 4QX8B 2NW8A 4TZ4C 4GIWA 5AFUL 2Y8DA 4EOZB 2L3LA 5DABA 3K8PC 4PJJA 1KNZA 5JR9A 2W63A 1YKHB 2EHOD 3F2EA 3ZMUB 3K3QC 3MA9A 5L3FB 4PK4A 2E9XB 3N9NA 4WNKA 5DQWA 3ZYMA 3GMIA 2WSSV 3KV5A 3RYCE 2L9QA 2K9AA 3NRXA 2ES0A 3HI2A 5IYZE 5FXVA 5JDHA 1IJ5A 1FEWA 4EYUA 4GOUA 4QHOA 5JDLA 4OHFA 2V7MA 1FMWA 3O4XE 4ZI7E 3MKDA 5EK2A 4QKNA 3ZMVB 3K3OA 3O1HA 3DP7A 4BAYB 2CWOA 5J2UE 5IHYA 3RPUA 3HR0A 4PJNA 1YD8G 2JQQA 2I59A 1MIYA 4P0BA 3AA7B 2V7IA 4O4HE 2DNXA 4CXWA 5LP6E 3AVRA 3MK7C 3E0ZA 3ZLIA 2CM0A 4OFZA 3I9YA 2KMFA 3KVAA 3MJXA 3EVYA 2NWBA 3N2OA 1HG5A 2G0UA 4IDZA 3KINB 3PTRB 3C4WA 4IHJE 2IW5B 1S35A 4ILUA 5GONE 4HTEA 4Z8XA 3ZN1B 4H9SE 3T8OA 2CLYB 1BR1A 4I43B 2KT9A 3N9OA 2LHRA 2XAFB 1MIWA 4QXCB 3F57A 2W61A 2Q9QA 3UUMA 2RA1A 3VKHA 4TN7B 5DJQC 3OBVE 1B7TA 1D0YA 3AA6B 3Q9DA 2DHRA 3U78A 3FHNA 1D0XA 4AQFA 4BA9A 1CUNA 5FXZA 1FMVA 4AKHA 3LK42 2Y6XA 2ACXA 4C91A 2ZM2A 4ASKA 4YJ2E 3ZPOA 4EYYR 4H63H 2H7VC 3CQCB 3CX7B 1YW0A 4J2CA 4BJNA 4DBQA 2B1EA 2JMKA 3VKGA 4ISTA 1HS7A 4PK6A 5JDFA 2Q9QD 2ODVA 4IE4A 3FBZA 5JVDE 4PAGA 5H6RB 2LHNA 2CLYC 5HXCA 3J7Yq 3JC6C 5LHIB 2C5KT 2XASB 2D0TA 3RRWA 2CXLA 1ZHCA 3IEEA 5KMGP 3CKDA 4FJOA 2CWYA 5CB4E 3AAAB 2Z6EA 4XBFB 3ZJ2A 3VU7H 3H37A 4H63V 4IE0A 5LA6E 4KP3C 2JRKA 5A1LA 1Y64B 3QUJA 4XZCA 3ONXA 1MNDA 5BMVE 4UF0B 4QXHB 2X0LB 1BR0A 5LCYA 4L9IA 2IC6A 1MNEA 4JEHB 1LVKA 2L8KA 4UV9B 3O1IA 3MXZA 5HXHA 3QK6A 3OYZA 1MIVA 3OJAA 2WAUA 1US7B 2C0SA 2ZLYA 3N9PA 4UVCB 3PUGA 5LBMA 4IE5A 2K48A 1BR4A 5FXWA 2EHOB 4MLKA 3J9X1 2A72A 4O8SA 3I0OA 4TX5A 2KXPB 2VK9A 3ZCJA 2MTQA 2CMRA 4ZS2A 3MZKB 5M4YA 3W15B 3CMLA 2ZM8A 4P09A 4CI3B 3RKOA 4FI5A 4MALA 3UT5E 5LBQB 3FXDB 1MMDA 3SS1A 4PK5A 3IBPA 3Q5WA 4HGAA 4KMCA 4U72A 4HEAA 4YJ3E 4C90A 5LGNB 5JREA 4YHJA 4QX7B 1WYBA 4ZHQE 1WYCA 4DMWA 3HKBE 3OYXA 2LM9A 2LSJA 2NP9A 3LFMA 4OYJA 4TV8E 2C5JA 4UVAB 3AVSA 3PURA 2XAGB 3IF8B 3SOLA 4U74A 2MBGA 1MMNA 5J1GA 2VWAA 4CQIA 2P9BA 5L3GB 5JRCB 2V7LA 1HF8A 4DNDA 4CI1B 5JDMA 3RH3A 4X1KE 3AAIA 3GN5A 2X67A 3EDVA 2KNDA 5ADXL 2X66A 3ANWB 4X1IE 1MMGA 2DWGA 2J1DG 3BQLA 1ZEEA 4OK0A 5LHGB 3EDUA 2JMHA 2WBLA 1SHZC 2WMNA 3C98B 4TV9E 2VKOA 1IJ6A 4EZHA 2DI4A 2E9XC 2XAQB 3O9XA 2DLRA 5H6QB 3ESLA 1H7CA 5JDQA 3ZMSB 2PFVA 2NTYA 4WBOA 4O4IE 5FY1A 4DMVA 4V1Av 2X9YA 3WAJA 2E9XD 2CXFA 3D0TA 4X20E 4IGUA 2XUEA 2VASA 2A2FX 3UFEA 4PW8A 3PUAA 2BZBA 2ZM0A 2MYSA 5LJNA 5KDMC 3FB2A 5CA1E 1VOMA 2MOZA 3N9QA 2Q9QB 2N1GA 3ZCIA 2HPLA 2W0GA 2OA5A 2XTLA 4CZZB 1IAPA 4HN9A 4CXYA 3RX6A 2UXXB 2QGSA 4X1YE 4JLEA 4DO0A 5LGUB 5LOVE 2N9DA 3WI3A 1HFAA 1UX5A 4BJMA 1U4QA 5E0OA 4EZ4A 2NOXA 2NW9A 3SWHA 2E8IA 3CX8B 4H9QC 4IIJE 2PBIA 3N2GE 2YEVC 4HKAA 3S4UA 3KBTA 1UCUA 3VHLA 1G73A 3NZPA 1HG2A 2LJLA 1HX8A 4F6RC 1NWMX 5L3EB 3BQKA 2LSYA 4L5GA 2KLQA 3E22E 3ETVA 1O3XA 3JC6D 1U5PA 2V7JA 3C51A 3P8CD 4E7ZA 3CPZA 3R84B 4DBRA 1S94A 3CX6B 5DQVA 3BK9A 3AAEB 3F31A 1EZ3A 2A3DA 4QWNB 1D1BA 4GK5E 3C50A 3NRYA 4CI2B 2VL8A 2C5IT 1T98A 2GK9A 3IHRA 3Q2MA 3AA1B 2D0UA 4PJMA 2X9HA 1YKEB 4UVBB 2K5BB 3UUNA 3ZN0B 5HWXA 4UV8B 4K0UA 2NTXA 3V5UA 5EK3A 3I0QA 3KFWX 4NUVA 5FNVE 5LGTB 3L3PA 1AJ3A 1KK7A 3ZYLA 5HYAA 4WW0A 3KBUA 1UX4A 2LE8A 3ZC0A 2LOSA 2YU2A 1NAFA 2XAJB 2NW7A 2X9XA 4ZI2C 4ANJA 2HH7A 2V1DB 5JDNA 4ISSA 4AKLA 5F8PA 3PUQA 4HFVA 2N2NA 4H9RC 1HTJF 4PFOA 1SA0E 3LBXA 3N9LA 2CA5A 3KV9A 3OKQA 3RC3A 3WAKA 3H3AA 4O4LE 3LK3B 4EXTA 3LG7A 4YFSA 4G63A 3PU8A 4WBNE 4AKRB 5JR9B 4QXBB 5C8YE 2JJ9A 2KZ7B 3AA0B 3C64A 3RRCA 3CVRA 1LKXA 5HXRA 4O4JE 2RP4A 2WM9A 2H3RA 4H9NC 3PDYA 4I55E 1X79A 3SRZA 4MBQA 2LSIA 3MACA 4E7SA 1FIOA 2EHOC 3CWZB 3HKDE 3ZMZB 2E9XA 2LSGA 3LK2B 2W62A 4I50E 4GYRA 4I4TE 2ODUA 3A5XA 1LVFA 3HKCE 4YLHA 1G8XA 5LJMA 4EIWA 4O2AE 3FBLA 2YU1A 3DTOA 3EUHA 3PE0A 3GN5B 2ZMAA 3GWHA 3KV6A 5JRCA 4OYKA 3FXEB 1QUUA 5JR9C 2V7KA 2VB6A 4EAHA 2VKHA 4PFPA 3GA8A 2X51A 4GK0E 4PJLA 4P0AA 5FYMA 3ZEFB 3U3IA 3ANWA 3P7IA 5LG4A 2CCQA 3Q5XA 4G2AA 1ZKEA 3DJBA 2D2SA 2PJQA 5L3CB 1ZV4X 3O1JA 3LJCA 4XAXB 4AI6A 3QC9A 2CXDA 5FP3A 1LRZA 1V9DA 2CE7A 3I1AA 4JEUB 1E1HB 5FMNA 2UXNB 5EZYE 3ZJ1A 3RYHE 2QA7A 3PUSA 2V26A 3CQGB 2H7OA 2X68A 2XHEB 4NUUA 2D5UA 2CEAA 3ZMTB 2KWIB 5L3DB 4AKGA 2DWKA 1QSDA 3L09A 5HXEA 3NZQA 3TKLB 4M1PA 3HL6A 3UTKA 3KVBA 2WMOA 4ZS3A 5HWYA 2Y48B 2M67A 4ADZA 3KDSE 4AKIA 1Z0PA 1VRBA 5CA0E 2HPJA 3AB3B 5JQGE 3M65A 5FY7A 3V5SA 4H9OC 4B6XA 5L2LA 2VKJA 1WR6A 5LHHB 5F3JA 5KX5E 1HCIA 2Q9QC 2YK0A 1OWAA 2VKDA 4KBMB 3BQIA 1BR2A 3RYIE 2LT3A 5ETWA 3HKEE 4UEMA 3C4ZA 4IE7A 4DVDA 3UUXB 4AQFC 1OXZA 1WRDA 3I9WA 4H9PC 4IE6A 3NBXX 4HE8A 5HAXA 3PU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXD B;  3QK6 A;  2C5K T;  2CA5 A;  3N5L A;  1LRZ A;  2X9W A;  1LVF A;  1Z0P A;  2XTL A;  3CKD A;  3L3P A;  2K48 A;  1IJ5 A;  3CVR A;  4B6X A;  2IC9 A;  2G0U A;  1IJ6 A;  4L0R A;  4EYY R;  2KWH A;  3FXE B;  4J2C A;  1H7C A;  2C5J A;  3QUJ A;  2KWI B;  2X9X A;  1QSD A;  2X9Y A;  2C5I T;  3TKL B;  2MBG A;  4CQI A;  3P7I A;  2IC6 A;  4DND A;  3S4U A;  4FI5 A;  1ZKE A;  3MXZ A; 
#chains in the Genus database with same CATH topology
 2LOP A;  3AE1 A;  4EV6 A;  5L3B B;  4JYA T;  1FJG T;  2V6Y A;  4UF0 A;  3KV4 A;  4U33 A;  4LF9 T;  2KWH A;  2V6X A;  5J2T E;  3HA4 A;  5CFB A;  2BVM A;  2W00 A;  2EHO A;  3E08 A;  1KEY A;  4JUY A;  1J5W A;  3LBX B;  3CQX C;  1J1J A;  1WLX A;  3AE7 A;  3UQ7 A;  3B57 A;  2IC9 A;  2AXD S;  4L0R A;  1CHU A;  2NW8 A;  1KNZ A;  2W63 A;  3ZMU B;  4WNK A;  3GMI A;  3RYC E;  3UU6 A;  2K9A A;  5IYZ E;  3RQW A;  5AQV B;  5JDL A;  1N33 T;  2OLT A;  3HR0 A;  4DV3 T;  3P4P A;  3Q5E A;  4IRE A;  1UK5 A;  3AA7 B;  3MK7 C;  3E0Z A;  3N2O A;  3AE2 A;  3PTR B;  3UQ4 A;  4HTE A;  3ZN1 B;  4H9S E;  4EED A;  4IT4 A;  3ABV A;  2LHR A;  4A5X A;  2RA1 A;  3VKH A;  5DJQ C;  4B3S T;  4HWH A;  4A98 A;  4BA9 A;  5FXZ A;  3VR8 A;  4AKH A;  1QLB A;  2Y6X A;  4ASK A;  4LMJ A;  1XNQ T;  2H7V C;  1YW0 A;  5AQI B;  2JMK A;  4PK6 A;  2Q9Q D;  2ODV A;  2LKG A;  5HXC A;  5L4E A;  5ABF A;  2C5K T;  2XAS B;  3JAD A;  3P4Q A;  4P1N A;  2CWY A;  4YSZ A;  3M3Z B;  3ZJ2 A;  5LA6 E;  2JRK A;  4HFE A;  1Y64 B;  1IBK T;  2V6Y B;  1MND A;  4UF0 B;  4QXH B;  1BR0 A;  1MNE A;  1LVK A;  2XM1 A;  3OJA A;  2WAU A;  2C0S A;  3N9P A;  3PUG A;  2M6I A;  3EAM A;  2EHO B;  3J9X 1;  3RKG A;  3FZH B;  2X0Y A;  4CI3 B;  3A7M A;  3FXD B;  2XY8 B;  3SS1 A;  3Q5W A;  4YJ3 E;  4IDP A;  1WYB A;  4YTM A;  4TV8 E;  4OYJ A;  3QOF A;  3AVS A;  4UVA B;  4DR1 T;  3RLF F;  3SOL A;  2MBG A;  3Q5D A;  4CQI A;  2P9B A;  5L3G B;  4CI1 B;  2H88 A;  5JDM A;  3AAI A;  3RIA A;  2BKP A;  1MMG A;  4JI6 T;  2K3W A;  1ZEE A;  5LHG B;  2JMH A;  2WMN A;  2BG9 A;  1IJ6 A;  2FUP A;  4EZH A;  2DI4 A;  2DLR A;  5H6Q B;  3ESL A;  1H7C A;  3ZMS B;  1Y01 A;  4WBO A;  3WAJ A;  4X20 E;  2UUC T;  4I0U A;  2A2F X;  5LJN A;  5KDM C;  1T72 A;  2IHR 1;  2MOZ A;  3ZCI A;  4ILC A;  2XTL A;  4CZZ B;  2WCA A;  2XQ9 A;  5AQP B;  2QGS A;  4X1Y E;  4JLE A;  4DO0 A;  2N9D A;  3WI3 A;  1HFA A;  5L4H A;  5C2T A;  2NW9 A;  2PBI A;  3EI0 A;  2YEV C;  3KBT A;  2FJA A;  2WWV A;  5FL0 A;  3NZP A;  1HX8 A;  4F6R C;  4X62 T;  4L5G A;  2XSB A;  5ABF B;  1O3X A;  2V7J A;  3BK9 A;  3AAE B;  5HCJ A;  2A3D A;  3NRY A;  2C5I T;  1T98 A;  4PJM A;  2X9H A;  4HFD A;  3UUN A;  3TLW A;  4K0U A;  2NTX A;  3T1H T;  4NUV A;  5FNV E;  3QB5 K;  2LE8 A;  3ZC0 A;  4EEB A;  2LOS A;  1XWM A;  2W66 A;  2V1D B;  4ISS A;  2YN6 A;  5F8P A;  4JI4 T;  2N2N A;  3L8R A;  4DR4 T;  3OKQ A;  4QXB B;  2JJ9 A;  3AA0 B;  3RRC A;  2RP4 A;  1OED A;  2FJB A;  1X79 A;  2LSI A;  2EHO C;  1DU2 A;  3ZMZ B;  2E9X A;  3EAB A;  4I4T E;  3A5X A;  2WU5 A;  3HKC E;  2V8S V;  4EIW A;  4LF6 T;  3UU8 A;  3KV6 A;  5JRC A;  4DID B;  4DR3 T;  2QYW A;  4PFP A;  4PJL A;  2HN2 A;  3U3I A;  3ANW A;  5LG4 A;  3Q5X A;  2D2S A;  2PJQ A;  4IL4 A;  2VVS A;  4XAX B;  3QC9 A;  3RIF A;  5FP3 A;  2WZH A;  4HFC A;  5J0Z A;  5HEG A;  3I1A A;  2QA7 A;  3PUS A;  3IA3 A;  2H7O A;  2XHE B;  1QSD A;  5L47 A;  3TKL B;  2IUB A;  3HL6 A;  3UTK A;  1IBM T;  4ADZ A;  4AKI A;  3AB3 B;  3OVU A;  3M65 A;  4H9O C;  3RF1 A;  4B6X A;  5L2L A;  5F3J A;  5KX5 E;  2MAW A;  2YK0 A;  2WU2 A;  1BR2 A;  3HKE E;  4UEM A;  2WP9 A;  4AQY T;  4IE7 A;  3UUX B;  3NKZ A;  3PU3 A;  4ZOL E;  1D1C A;  2SPC A;  2X9W A;  5AQQ B;  4CXX A;  2CRB A;  4MHC A;  4GYS A;  4ZI3 C;  5LYJ E;  2OV9 A;  4PNI A;  5TAO A;  2H89 A;  1R8I A;  1MMA A;  2BVL A;  4ZI3 D;  4ZZB A;  2LEH A;  3EHZ A;  5JDG A;  2LM2 A;  4DR7 T;  2YIN A;  2XQY A;  4ZI2 D;  5BR8 T;  2XAH B;  1XMQ T;  2DCF A;  3TLU A;  5JH7 E;  4KUM B;  2YDS A;  1NEN A;  4EGW A;  1D0Z A;  4TZ4 C;  1OED B;  4KHP T;  2L3L A;  5DAB A;  3K8P C;  4U7I A;  5L3F B;  1J5E T;  2E9X B;  3KV5 A;  4IDQ A;  1FEW A;  4EYU A;  4QHO A;  1FMW A;  2AE9 A;  1W0A A;  3AEB A;  5AQF B;  4QH4 A;  3DP7 A;  5J2U E;  5IHY A;  1MIY A;  2V7I A;  4O4H E;  3RQU A;  4YY3 T;  3AVR A;  2CM0 A;  5F5W A;  2PTF A;  3I9Y A;  1N34 T;  4KHZ F;  2G0U A;  3KIN B;  2IW5 B;  4IHJ E;  1S35 A;  5GON E;  1BR1 A;  4I43 B;  3N9O A;  3F57 A;  4TNW A;  2BG9 C;  2BS3 A;  3U78 A;  3Q9D A;  1D0X A;  1CUN A;  1FMV A;  4B3R T;  3AE3 A;  4C91 A;  2ZM2 A;  2V5D A;  4H63 H;  4BJN A;  1T8B A;  3K1S A;  2B1E A;  1HS7 A;  2J47 A;  4QH1 A;  3P4R A;  2X0H A;  1UUR A;  2LHN A;  2CLY C;  2XM2 A;  2XQ8 A;  5LHI B;  3RRW A;  2D0T A;  3PUX F;  2CXL A;  3IEE A;  4JI3 T;  1N32 T;  3AAA B;  3VU7 H;  1JNR A;  3H37 A;  4IE0 A;  4KP3 C;  5A1L A;  3QUJ A;  3AE9 A;  4UV9 B;  3MXZ A;  2XQ3 A;  3OYZ A;  2W2U A;  3OTO T;  4MLK A;  2A72 A;  4O8S A;  2QRX A;  3ZCJ A;  2VK9 A;  4Q25 A;  5AQJ B;  4HWI B;  4ZS2 A;  2ZM8 A;  3RKO A;  4YSX A;  3UT5 E;  4LFC T;  4PK5 A;  3IBP A;  4KMC A;  4U72 A;  4C90 A;  4HEA A;  5JRE A;  4ZHQ E;  3OYX A;  2LSJ A;  2NP9 A;  3UU5 A;  3LFM A;  4CN1 A;  2C5J A;  2MPK A;  3PUR A;  2XAG B;  4B3T T;  1KNP A;  5J1G A;  2VWA A;  5IUX A;  3FZL B;  2LLY A;  4ZXL A;  1OED C;  3GN5 A;  3AEF A;  2XSA A;  3BQL A;  2WBL A;  3OPC A;  2E9X C;  3O9X A;  4O4I E;  2E9X D;  4LF4 T;  4PW8 A;  2MYS A;  3AEA A;  3N9Q A;  2N1G A;  2W0G A;  2CBI A;  2OA5 A;  1X9B A;  2BKO A;  3RX6 A;  2UXX B;  5AQK B;  4YXD A;  4BJM A;  1UX5 A;  2VL0 A;  4EZ4 A;  5ABH A;  3CX8 B;  4HWF A;  3N2G E;  4NXM T;  3BQK A;  2LSY A;  3TLS A;  5AQG B;  3ETV A;  3CPZ A;  5DQV A;  3F31 A;  1EZ3 A;  4GK5 E;  3C50 A;  3RHW A;  2VL8 A;  2BG9 E;  3IHR A;  2J4G A;  2D0U A;  2HHH T;  5HWX A;  1HNZ T;  3V5U A;  5EK3 A;  3I0Q A;  3L3P A;  1KK7 A;  3ZYL A;  5HYA A;  4WW0 A;  1E2A A;  2YU2 A;  2XAJ B;  2NW7 A;  4ANJ A;  2NR4 A;  2JQ9 A;  1HTJ F;  3ZSS A;  2CA5 A;  3RC3 A;  3WAK A;  4JI8 T;  3H3A A;  3LG7 A;  4AKR B;  1UUS A;  3C64 A;  3CVR A;  1LKX A;  5HXR A;  2JQK A;  3PDY A;  2FJD A;  1L0V A;  3CWZ B;  2D9D A;  4DV5 T;  2LSG A;  3FZF B;  2XQ7 A;  2ODU A;  1LVF A;  4DV1 T;  4O2A E;  2YU1 A;  3DTO A;  3EUH A;  3GN5 B;  3FXE B;  1QUU A;  1GQE A;  3UU3 A;  3GA8 A;  2CBJ A;  2X51 A;  2R6G F;  4G2A A;  5L3C B;  1ZV4 X;  3O1J A;  4DR5 T;  5ABG A;  4JEU B;  4U3C A;  4LML A;  2UXN B;  2V26 A;  2D5U A;  3ZMT B;  5L3D B;  2VVN A;  2DWK A;  3L09 A;  5LB7 B;  1KFY A;  4M1P A;  1OED E;  3KVB A;  2WMO A;  2YKS A;  2M67 A;  2XQ4 A;  3RIU A;  2UUB T;  4ILB A;  3AEC A;  1WR6 A;  5HEU A;  4YTN A;  2VKD A;  1W09 A;  2LT3 A;  4DVD A;  2WZI A;  1OXZ A;  3I9W A;  3VR9 A;  3NBX X;  4HE8 A;  3AE4 A;  5HAX A;  5LXT E;  4UXN B;  3ZST A;  4KX6 A;  3K3N A;  3P4W A;  1IZN B;  3RC8 A;  5AQN B;  3ZT5 A;  4QH5 A;  2JPF A;  2IAK A;  4A56 A;  1WFD A;  3UUL A;  5FY0 A;  4UEL A;  5LNK A;  3ETU A;  4WYV A;  4JV5 T;  3PUV F;  2LKH A;  2ZM6 T;  1D1A A;  3ZYK A;  2WDR A;  3ONJ A;  4DR2 T;  4QX8 B;  4AIS A;  4DV4 T;  4CN4 A;  5AFU L;  4PJJ A;  5JR9 A;  1YKH B;  2EHO D;  3K3Q C;  5FKY A;  2F4V T;  3N9N A;  5DQW A;  3ZYM A;  2ES0 A;  5JDH A;  5FXV A;  1IJ5 A;  3L39 A;  4HFH A;  2UXB T;  2UUA T;  4X66 T;  4OHF A;  3O4X E;  4ZI7 E;  2BG9 B;  3ZMV B;  3O1H A;  4BAY B;  2CWO A;  3RPU A;  4PJN A;  4JI0 T;  1YD8 G;  2JQQ A;  4DV2 T;  2WS3 A;  4CXW A;  4UR9 A;  2CHN A;  3NWI A;  4OFZ A;  2KMF A;  3KVA A;  3EVY A;  2NWB A;  1HG5 A;  1W9R A;  4IDZ A;  4YSY A;  3C4W A;  4ILU A;  4DV6 T;  4Z8X A;  2E5L T;  2CLY B;  4YHH T;  2XAF B;  5AQO B;  1SUM B;  1MIW A;  4QXC B;  2Q9Q A;  3OBV E;  1B7T A;  1D0Y A;  3P50 A;  1SE7 A;  3FHN A;  3LK4 2;  4YJ2 E;  3ZPO A;  4EYY R;  3CQC B;  3CX7 B;  4IST A;  5LG3 A;  5JVD E;  4PAG A;  5H6R B;  3J7Y q;  2E5V A;  3JC6 C;  2XQA A;  1ZHC A;  5KMG P;  3CKD A;  5CB4 E;  4XBF B;  4H63 V;  4IDO A;  5AQU B;  1ZP0 A;  4XZC A;  2VUR A;  2X0L B;  1M7K A;  4L9I A;  2IC6 A;  2L8K A;  3QK6 A;  1WCR A;  5FXW A;  5AQM B;  4TX5 A;  2JQH A;  1I6Z A;  2CMR A;  3MZK B;  3B5M A;  4FI5 A;  4MAL A;  1MMD A;  2I6H A;  4HGA A;  4QX7 B;  1WYC A;  4DMW A;  3HKB E;  5JRC B;  1HF8 A;  4U31 A;  2X67 A;  3EDV A;  2KND A;  2X66 A;  3ANW B;  3CIR A;  3LSV A;  1Z8U A;  2J1D G;  3EDU A;  1SHZ C;  3C98 B;  1XNR T;  2VKO A;  2XAQ B;  5JDQ A;  2PFV A;  2NTY A;  4DMV A;  4V1A v;  4IGU A;  2IDO B;  2VAS A;  4IL9 A;  3UFE A;  5CGM A;  2BZB A;  2ZM0 A;  1YQ3 A;  2WB5 A;  3AXJ A;  3AE6 A;  3H3M A;  1VOM A;  2LRK A;  2Q9Q B;  3ZT7 A;  4DV0 T;  5LOV E;  5E0O A;  4ILA A;  2E8I A;  4H9Q C;  4DR6 T;  4HKA A;  4Z91 A;  3VHL A;  5L3E B;  3UFG A;  2WY2 A;  3E22 E;  4TWD A;  5AQS B;  2XQ5 A;  3R84 B;  4DBR A;  1S94 A;  3CX6 B;  4QWN B;  1D1B A;  3RIU C;  2CHO A;  5KXJ A;  2QVA A;  2VQE T;  3VRA A;  5LGT B;  1AJ3 A;  3KBU A;  2HH7 A;  5JDN A;  4AKL A;  3PUQ A;  3KV9 A;  2A9U A;  4YFS A;  3PU8 A;  4WBN E;  3AEE A;  5C8Y E;  2KZ7 B;  3AE5 A;  4TNV A;  4O4J E;  2WM9 A;  4X65 T;  4E7S A;  1IBL T;  3PJA J;  3RGL A;  1G8X A;  5LJM A;  3PE0 A;  2ZMA A;  3GWH A;  2V5C A;  4OYK A;  5JR9 C;  2V7K A;  2IIU A;  2VB6 A;  2VKH A;  4YT0 A;  2BBH A;  3ZT6 A;  4P0A A;  2HN1 A;  5FYM A;  3ZEF B;  5HEJ A;  1ZKE A;  4NIQ A;  4CN6 A;  3LJC A;  4AI6 A;  1LRZ A;  4X5T A;  2CE7 A;  3AXJ B;  1E1H B;  5FMN A;  5EZY E;  3AED A;  4AIU A;  3CQG B;  2X68 A;  4NXN T;  4NUU A;  1HX1 B;  2CEA A;  5AQT B;  2KWI B;  4AKG A;  3NZQ A;  4ZS3 A;  4A97 A;  2W4X A;  5HWY A;  3G06 A;  4HFI A;  1Z0P A;  5CA0 E;  2HPJ A;  5JQG E;  5FVL A;  2UXD T;  5LHH B;  1HCI A;  2Q9Q C;  3RYI E;  5ETW A;  3X1D A;  3RYF E;  5EK4 A;  3ZC1 A;  4U7Y A;  3N5L A;  4UIG A;  3N2K E;  4LFB T;  2XQ6 A;  4ERR A;  5HXS A;  4MFR A;  4AXP A;  2WWU A;  3C4X A;  4AQG A;  2BKN A;  2KIN B;  2XPK A;  4O2B E;  4N78 D;  3B13 A;  4TUY E;  1ZOY A;  2BDE A;  1E7P A;  2K24 A;  4B3M T;  3N9M A;  3TLV A;  2PG8 A;  2LSK A;  3A8Y C;  4EB6 E;  3JAF A;  3R6N A;  5FXX A;  3SFE A;  1XDO A;  3AEG A;  4GIW A;  2Y8D A;  4EOZ B;  1VCT A;  3F2E A;  3MA9 A;  4PK4 A;  4GKK T;  1YXR A;  2B76 A;  5HCM A;  2WSS V;  2L9Q A;  3PUY F;  3NRX A;  3HI2 A;  3FZK B;  4GOU A;  2V7M A;  1WR0 A;  4LMK A;  1JNZ A;  3MKD A;  3PJA A;  4QKN A;  5EK2 A;  3K3O A;  2WDQ A;  1KNR A;  2YOE A;  2I59 A;  4P0B A;  2DNX A;  5LP6 E;  3ZLI A;  3MJX A;  3AE8 A;  4OX9 T;  5ABE A;  3T8O A;  3PUZ F;  2KT9 A;  2KSR A;  5FVK A;  2W61 A;  3UUM A;  2YDR A;  4TN7 B;  3AA6 B;  2DHR A;  2BS4 A;  4AQF A;  2ACX A;  1KF6 A;  4IDN A;  2RPA A;  4JI7 T;  4J2C A;  4DBQ A;  3VKG A;  2M6B A;  5JDF A;  2IML A;  4IE4 A;  3FBZ A;  3ZKR A;  4ZZC A;  4DV7 T;  1YQ4 A;  4HFB A;  3PUW F;  4FJO A;  3SFD A;  2Z6E A;  3ONX A;  5BMV E;  5LCY A;  2UU9 T;  4JEH B;  2BS2 A;  3O1I A;  5HXH A;  1MIV A;  1US7 B;  2ZLY A;  4UVC B;  5LBM A;  4IE5 A;  2K48 A;  1BR4 A;  2UXC T;  1XMO T;  5HEH A;  3I0O A;  4U2Y A;  2ACZ A;  2BBJ A;  2KXP B;  2MTQ A;  5M4Y A;  3W15 B;  3CML A;  5IWA T;  2YDQ A;  3QB5 A;  4P09 A;  5LBQ B;  4DUZ T;  5LGN B;  4YHJ A;  5AQR B;  4LF5 T;  4F8H A;  2LM9 A;  1M62 A;  3CK6 A;  3IF8 B;  4U74 A;  1MMN A;  2FBW A;  1W0B A;  2V7L A;  4DND A;  4Z90 A;  3RH3 A;  4COF A;  4X1K E;  5ADX L;  4X1I E;  2DWG A;  5LMN T;  1NEK A;  4NPP A;  4OK0 A;  4ZEY A;  4TV9 E;  2WDV A;  2VQF T;  4K0K T;  4KI0 F;  5FY1 A;  2X9Y A;  2CXF A;  3D0T A;  2XUE A;  4WZX A;  3UU4 A;  3PUA A;  4JBW F;  3FB2 A;  4U2Z A;  5CA1 E;  4LFA T;  2HPL A;  2JIW A;  5C3J A;  5JTG A;  2WQY A;  1IAP A;  4HN9 A;  4CXY A;  1HNW T;  5LGU B;  1U4Q A;  2NOX A;  1I94 T;  3SWH A;  4IIJ E;  3S4U A;  2E2A A;  1UCU A;  1G73 A;  4TWF A;  1HG2 A;  2LJL A;  4LF7 T;  1NWM X;  2KLQ A;  3UUB A;  3JC6 D;  2FJE A;  1U5P A;  3C51 A;  1XDP A;  3T1Y T;  3P8C D;  4E7Z A;  3FZM B;  4CI2 B;  2GK9 A;  3Q2M A;  3AA1 B;  1YKE B;  4UVB B;  5CJ5 A;  3JCF A;  2K5B B;  4DUY T;  3ZN0 B;  1VCS A;  4UV8 B;  4GKJ T;  2W67 A;  3KFW X;  4JI2 T;  5AQL B;  1UX4 A;  3TLT A;  1NAF A;  1T7S A;  2X9X A;  4ZI2 C;  2I0M A;  4HFV A;  4HWD A;  4H9R C;  4PFO A;  3JAE A;  1SA0 E;  3LBX A;  3N9L A;  5HEO A;  4O4L E;  3LK3 B;  4EXT A;  3P4S A;  4G63 A;  5JR9 B;  3QNU A;  1HNX T;  2H3R A;  2XZE A;  4H9N C;  4I55 E;  2DL1 A;  4JI1 T;  3SRZ A;  4MBQ A;  3MAC A;  1FIO A;  1HR0 T;  3HKD E;  3PV0 F;  3LK2 B;  4I50 E;  2W62 A;  4GYR A;  2J62 A;  1XZY A;  4YLH A;  3FBL A;  2CPT A;  3RI5 A;  3VRB A;  4EAH A;  4GK0 E;  3P7I A;  4HWC A;  3NVO A;  2CCQ A;  3LDQ B;  3DJB A;  2CXD A;  1V9D A;  4YTP A;  5AQH B;  1N36 T;  3ZJ1 A;  3RYH E;  3ONL C;  2XJ7 A;  5HXE A;  2Y48 B;  3KDS E;  4JI5 T;  1VRB A;  4X64 T;  4TWH A;  5FY7 A;  3V5S A;  1UGO A;  2LRL A;  2VKJ A;  4LF8 T;  1OWA A;  4KBM B;  3BQI A;  3C4Z A;  4AQF C;  1WRD A;  4IE6 A;  4H9P C;  5FL1 A;  5LMU T; 
#chains in the Genus database with same CATH homology
 3RYF E;  4ZOL E;  5LXT E;  2LOP A;  5EK4 A;  3ZC1 A;  1D1C A;  2SPC A;  3N5L A;  4UIG A;  2X9W A;  4UXN B;  4CXX A;  3N2K E;  4MHC A;  5L3B B;  4ERR A;  5HXS A;  4GYS A;  4ZI3 C;  3K3N A;  5LYJ E;  4PNI A;  5TAO A;  4UF0 A;  3KV4 A;  4MFR A;  1IZN B;  3RC8 A;  1MMA A;  4AXP A;  2WWU A;  2KWH A;  2BVL A;  4ZI3 D;  5J2T E;  3C4X A;  3HA4 A;  2LEH A;  4AQG A;  2KIN B;  5JDG A;  4O2B E;  2YIN A;  4N78 D;  2JPF A;  2BVM A;  2W00 A;  2XQY A;  4ZI2 D;  2IAK A;  2XAH B;  3B13 A;  4A56 A;  2DCF A;  2EHO A;  4TUY E;  3E08 A;  4JUY A;  3UUL A;  5FY0 A;  5JH7 E;  4UEL A;  2BDE A;  3ETU A;  4KUM B;  5LNK A;  3LBX B;  3CQX C;  2K24 A;  1WLX A;  3N9M A;  3B57 A;  2IC9 A;  2PG8 A;  1D1A A;  2LSK A;  4L0R A;  3ZYK A;  1D0Z A;  4EB6 E;  3R6N A;  5FXX A;  4QX8 B;  2NW8 A;  4TZ4 C;  4GIW A;  5AFU L;  2Y8D A;  4EOZ B;  2L3L A;  5DAB A;  3K8P C;  4PJJ A;  1KNZ A;  5JR9 A;  2W63 A;  1YKH B;  2EHO D;  3F2E A;  3ZMU B;  3K3Q C;  3MA9 A;  5L3F B;  4PK4 A;  2E9X B;  3N9N A;  4WNK A;  5DQW A;  3ZYM A;  3GMI A;  2WSS V;  3KV5 A;  3RYC E;  2L9Q A;  2K9A A;  3NRX A;  2ES0 A;  3HI2 A;  5IYZ E;  5FXV A;  5JDH A;  1IJ5 A;  1FEW A;  4EYU A;  4GOU A;  4QHO A;  5JDL A;  4OHF A;  2V7M A;  1FMW A;  3O4X E;  4ZI7 E;  3MKD A;  5EK2 A;  4QKN A;  3ZMV B;  3K3O A;  3O1H A;  3DP7 A;  4BAY B;  2CWO A;  5J2U E;  5IHY A;  3RPU A;  3HR0 A;  4PJN A;  1YD8 G;  2JQQ A;  2I59 A;  1MIY A;  4P0B A;  3AA7 B;  2V7I A;  4O4H E;  2DNX A;  4CXW A;  5LP6 E;  3AVR A;  3MK7 C;  3E0Z A;  3ZLI A;  2CM0 A;  4OFZ A;  3I9Y A;  2KMF A;  3KVA A;  3MJX A;  3EVY A;  2NWB A;  3N2O A;  1HG5 A;  2G0U A;  4IDZ A;  3KIN B;  3PTR B;  3C4W A;  4IHJ E;  2IW5 B;  1S35 A;  4ILU A;  5GON E;  4HTE A;  4Z8X A;  3ZN1 B;  4H9S E;  3T8O A;  2CLY B;  1BR1 A;  4I43 B;  2KT9 A;  3N9O A;  2LHR A;  2XAF B;  1MIW A;  4QXC B;  3F57 A;  2W61 A;  2Q9Q A;  3UUM A;  2RA1 A;  3VKH A;  4TN7 B;  5DJQ C;  3OBV E;  1B7T A;  1D0Y A;  3AA6 B;  3Q9D A;  2DHR A;  3U78 A;  3FHN A;  1D0X A;  4AQF A;  4BA9 A;  1CUN A;  5FXZ A;  1FMV A;  4AKH A;  3LK4 2;  2Y6X A;  2ACX A;  4C91 A;  2ZM2 A;  4ASK A;  4YJ2 E;  3ZPO A;  4EYY R;  4H63 H;  2H7V C;  3CQC B;  3CX7 B;  1YW0 A;  4J2C A;  4BJN A;  4DBQ A;  2B1E A;  2JMK A;  3VKG A;  4IST A;  1HS7 A;  4PK6 A;  5JDF A;  2Q9Q D;  2ODV A;  4IE4 A;  3FBZ A;  5JVD E;  4PAG A;  5H6R B;  2LHN A;  2CLY C;  5HXC A;  3J7Y q;  3JC6 C;  5LHI B;  2C5K T;  2XAS B;  2D0T A;  3RRW A;  2CXL A;  1ZHC A;  3IEE A;  5KMG P;  3CKD A;  4FJO A;  2CWY A;  5CB4 E;  3AAA B;  2Z6E A;  4XBF B;  3ZJ2 A;  3VU7 H;  3H37 A;  4H63 V;  4IE0 A;  5LA6 E;  4KP3 C;  2JRK A;  5A1L A;  1Y64 B;  3QUJ A;  4XZC A;  3ONX A;  1MND A;  5BMV E;  4UF0 B;  4QXH B;  2X0L B;  1BR0 A;  5LCY A;  4L9I A;  2IC6 A;  1MNE A;  4JEH B;  1LVK A;  2L8K A;  4UV9 B;  3O1I A;  3MXZ A;  5HXH A;  3QK6 A;  3OYZ A;  1MIV A;  3OJA A;  2WAU A;  1US7 B;  2C0S A;  2ZLY A;  3N9P A;  4UVC B;  3PUG A;  5LBM A;  4IE5 A;  2K48 A;  1BR4 A;  5FXW A;  2EHO B;  4MLK A;  3J9X 1;  2A72 A;  4O8S A;  3I0O A;  4TX5 A;  2KXP B;  2VK9 A;  3ZCJ A;  2MTQ A;  2CMR A;  4ZS2 A;  3MZK B;  5M4Y A;  3W15 B;  3CML A;  2ZM8 A;  4P09 A;  4CI3 B;  3RKO A;  4FI5 A;  4MAL A;  3UT5 E;  5LBQ B;  3FXD B;  1MMD A;  3SS1 A;  4PK5 A;  3IBP A;  3Q5W A;  4HGA A;  4KMC A;  4U72 A;  4HEA A;  4YJ3 E;  4C90 A;  5LGN B;  5JRE A;  4YHJ A;  4QX7 B;  1WYB A;  4ZHQ E;  1WYC A;  4DMW A;  3HKB E;  3OYX A;  2LM9 A;  2LSJ A;  2NP9 A;  3LFM A;  4OYJ A;  4TV8 E;  2C5J A;  4UVA B;  3AVS A;  3PUR A;  2XAG B;  3IF8 B;  3SOL A;  4U74 A;  2MBG A;  1MMN A;  5J1G A;  2VWA A;  4CQI A;  2P9B A;  5L3G B;  5JRC B;  2V7L A;  1HF8 A;  4DND A;  4CI1 B;  5JDM A;  3RH3 A;  4X1K E;  3AAI A;  3GN5 A;  2X67 A;  3EDV A;  2KND A;  5ADX L;  2X66 A;  3ANW B;  4X1I E;  1MMG A;  2DWG A;  2J1D G;  3BQL A;  1ZEE A;  4OK0 A;  5LHG B;  3EDU A;  2JMH A;  2WBL A;  1SHZ C;  2WMN A;  3C98 B;  4TV9 E;  2VKO A;  1IJ6 A;  4EZH A;  2DI4 A;  2E9X C;  2XAQ B;  3O9X A;  2DLR A;  5H6Q B;  3ESL A;  1H7C A;  5JDQ A;  3ZMS B;  2PFV A;  2NTY A;  4WBO A;  4O4I E;  5FY1 A;  4DMV A;  4V1A v;  2X9Y A;  3WAJ A;  2E9X D;  2CXF A;  3D0T A;  4X20 E;  4IGU A;  2XUE A;  2VAS A;  2A2F X;  3UFE A;  4PW8 A;  3PUA A;  2BZB A;  2ZM0 A;  2MYS A;  5LJN A;  5KDM C;  3FB2 A;  5CA1 E;  1VOM A;  2MOZ A;  3N9Q A;  2Q9Q B;  2N1G A;  3ZCI A;  2HPL A;  2W0G A;  2OA5 A;  2XTL A;  4CZZ B;  1IAP A;  4HN9 A;  4CXY A;  3RX6 A;  2UXX B;  2QGS A;  4X1Y E;  4JLE A;  4DO0 A;  5LGU B;  5LOV E;  2N9D A;  3WI3 A;  1HFA A;  1UX5 A;  4BJM A;  1U4Q A;  5E0O A;  4EZ4 A;  2NOX A;  2NW9 A;  3SWH A;  2E8I A;  3CX8 B;  4H9Q C;  4IIJ E;  2PBI A;  3N2G E;  2YEV C;  4HKA A;  3S4U A;  3KBT A;  1UCU A;  3VHL A;  1G73 A;  3NZP A;  1HG2 A;  2LJL A;  1HX8 A;  4F6R C;  1NWM X;  5L3E B;  3BQK A;  2LSY A;  4L5G A;  2KLQ A;  3E22 E;  3ETV A;  1O3X A;  3JC6 D;  1U5P A;  2V7J A;  3C51 A;  3P8C D;  4E7Z A;  3CPZ A;  3R84 B;  4DBR A;  1S94 A;  3CX6 B;  5DQV A;  3BK9 A;  3AAE B;  3F31 A;  1EZ3 A;  2A3D A;  4QWN B;  1D1B A;  4GK5 E;  3C50 A;  3NRY A;  4CI2 B;  2VL8 A;  2C5I T;  1T98 A;  2GK9 A;  3IHR A;  3Q2M A;  3AA1 B;  2D0U A;  4PJM A;  2X9H A;  1YKE B;  4UVB B;  2K5B B;  3UUN A;  3ZN0 B;  5HWX A;  4UV8 B;  4K0U A;  2NTX A;  3V5U A;  5EK3 A;  3I0Q A;  3KFW X;  4NUV A;  5FNV E;  5LGT B;  3L3P A;  1AJ3 A;  1KK7 A;  3ZYL A;  5HYA A;  4WW0 A;  3KBU A;  1UX4 A;  2LE8 A;  3ZC0 A;  2LOS A;  2YU2 A;  1NAF A;  2XAJ B;  2NW7 A;  2X9X A;  4ZI2 C;  4ANJ A;  2HH7 A;  2V1D B;  5JDN A;  4ISS A;  4AKL A;  5F8P A;  3PUQ A;  4HFV A;  2N2N A;  4H9R C;  1HTJ F;  4PFO A;  1SA0 E;  3LBX A;  3N9L A;  2CA5 A;  3KV9 A;  3OKQ A;  3RC3 A;  3WAK A;  3H3A A;  4O4L E;  3LK3 B;  4EXT A;  3LG7 A;  4YFS A;  4G63 A;  3PU8 A;  4WBN E;  4AKR B;  5JR9 B;  4QXB B;  5C8Y E;  2JJ9 A;  2KZ7 B;  3AA0 B;  3C64 A;  3RRC A;  3CVR A;  1LKX A;  5HXR A;  4O4J E;  2RP4 A;  2WM9 A;  2H3R A;  4H9N C;  3PDY A;  4I55 E;  1X79 A;  3SRZ A;  4MBQ A;  2LSI A;  3MAC A;  4E7S A;  1FIO A;  2EHO C;  3CWZ B;  3HKD E;  3ZMZ B;  2E9X A;  2LSG A;  3LK2 B;  2W62 A;  4I50 E;  4GYR A;  4I4T E;  2ODU A;  3A5X A;  1LVF A;  3HKC E;  4YLH A;  1G8X A;  5LJM A;  4EIW A;  4O2A E;  3FBL A;  2YU1 A;  3DTO A;  3EUH A;  3PE0 A;  3GN5 B;  2ZMA A;  3GWH A;  3KV6 A;  5JRC A;  4OYK A;  3FXE B;  1QUU A;  5JR9 C;  2V7K A;  2VB6 A;  4EAH A;  2VKH A;  4PFP A;  3GA8 A;  2X51 A;  4GK0 E;  4PJL A;  4P0A A;  5FYM A;  3ZEF B;  3U3I A;  3ANW A;  3P7I A;  5LG4 A;  2CCQ A;  3Q5X A;  4G2A A;  1ZKE A;  3DJB A;  2D2S A;  2PJQ A;  5L3C B;  1ZV4 X;  3O1J A;  3LJC A;  4XAX B;  4AI6 A;  3QC9 A;  2CXD A;  5FP3 A;  1LRZ A;  1V9D A;  2CE7 A;  3I1A A;  4JEU B;  1E1H B;  5FMN A;  2UXN B;  5EZY E;  3ZJ1 A;  3RYH E;  2QA7 A;  3PUS A;  2V26 A;  3CQG B;  2H7O A;  2X68 A;  2XHE B;  4NUU A;  2D5U A;  2CEA A;  3ZMT B;  2KWI B;  5L3D B;  4AKG A;  2DWK A;  1QSD A;  3L09 A;  5HXE A;  3NZQ A;  3TKL B;  4M1P A;  3HL6 A;  3UTK A;  3KVB A;  2WMO A;  4ZS3 A;  5HWY A;  2Y48 B;  2M67 A;  4ADZ A;  3KDS E;  4AKI A;  1Z0P A;  1VRB A;  5CA0 E;  2HPJ A;  3AB3 B;  5JQG E;  3M65 A;  5FY7 A;  3V5S A;  4H9O C;  4B6X A;  5L2L A;  2VKJ A;  1WR6 A;  5LHH B;  5F3J A;  5KX5 E;  1HCI A;  2Q9Q C;  2YK0 A;  1OWA A;  2VKD A;  4KBM B;  3BQI A;  1BR2 A;  3RYI E;  2LT3 A;  5ETW A;  3HKE E;  4UEM A;  3C4Z A;  4IE7 A;  4DVD A;  3UUX B;  4AQF C;  1OXZ A;  1WRD A;  3I9W A;  4H9P C;  4IE6 A;  3NBX X;  4HE8 A;  5HAX A;  3PU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...