3FXDB

Crystal structure of interacting domains of icmr and icmq
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
VTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein IcmQ
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 24
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fxdB00
1IJ5A 2KWHA 3FXEB 4L0RA 3S4UA 1H7CA 3QUJA 3MXZA 3FXDB 1LVFA 3N5LA 4EYYR 3P7IA 2K48A 2X9XA 2IC6A 1Z0PA 2X9YA 2C5JA 4J2CA 3CVRA 3QK6A 4FI5A 1IJ6A 2CA5A 3L3PA 4DNDA 4B6XA 3TKLB 4CQIA 2IC9A 2C5KT 2X9WA 2C5IT 2KWIB 1LRZA 2G0UA 2MBGA 2XTLA 1ZKEA 1QSDA 3CKDA
chains in the Genus database with same CATH superfamily
4IE4A 1T98A 4JV5T 3QB5K 1D0XA 3JAFA 2B76A 2E9XC 2JMHA 4Z8XA 3QB5A 4IGUA 2Q9QC 4FI5A 5H6RB 1IBMT 2VASA 4GOUA 3OBVE 2XQ4A 2FJEA 5AQVB 4JYAT 4DUZT 4MALA 3FZFB 2LSJA 4WW0A 4EXTA 2K3WA 2L8KA 3N2KE 2A9UA 3I9WA 1BR2A 4KUMB 3N9PA 1ZEEA 3QC9A 4H9RC 4HN9A 1HF8A 1FIOA 5JDLA 3PUVF 2E5VA 1LVFA 3PE0A 4ILBA 1XMOT 3RIFA 5LHGB 2LKHA 4LFAT 4YTMA 4CZZB 2YK0A 1FMWA 5HXCA 5ABFA 2V8SV 1ZKEA 3JAEA 3GN5A 2LSYA 3ZCJA 2CHNA 4LMJA 4I50E 1MMDA 2W66A 4QWNB 4O4LE 3ETUA 4H63V 4DR7T 3MJXA 4IIJE 2HHHT 2AXDS 3EDVA 4OX9T 3Q9DA 4HFVA 1O3XA 1XMQT 3N9MA 1W0AA 5FYMA 4FJOA 5FP3A 1KNZA 2KZ7B 2BBJA 2CLYC 2X9HA 3AE7A 3C4ZA 2WWVA 2K24A 4UVCB 2VL8A 1EZ3A 4JI8T 2CRBA 4U33A 4IDOA 3ZJ2A 4DR3T 1HG5A 1BR0A 1WYCA 5CFBA 1QLBA 3LJCA 5EZYE 1UGOA 1J1JA 2VKOA 4HFBA 3ZMZB 3ZSSA 2VQET 1IBLT 3TKLB 5J2TE 2I6HA 4OYKA 4NUUA 3H3AA 3ONJA 4JI5T 2EHOA 3EUHA 2YN6A 4LF7T 4E7SA 5HEOA 4JBWF 1UK5A 1KFYA 1HS7A 2BS4A 3PJAA 4B6XA 4QXHB 1OEDE 3EVYA 2KMFA 1MIVA 4DV6T 2F4VT 3FB2A 3MKDA 4HWDA 5JR9B 2RA1A 3CX7B 4C90A 3ZYMA 4L5GA 2NW9A 2X9YA 5FL1A 3KVBA 2W67A 4GK5E 5FMNA 4DBQA 2C5KT 2A3DA 1VCSA 4DR6T 3U78A 1WR6A 3RF1A 4JLEA 5AQTB 2LT3A 2ZM0A 3QUJA 2WY2A 5LBMA 2V7MA 3J9X1 3R84B 2V6YA 3MZKB 4EZ4A 1FEWA 2KXPB 4AIUA 4AKGA 2VKDA 4X20E 4UXNB 3IA3A 1SUMB 1D0ZA 1NENA 4ZHQE 4WZXA 2FJDA 3CX8B 4EEDA 2BZBA 2CHOA 5L47A 5FXVA 2LOSA 3P8CD 3OKQA 5DABA 3TLVA 1WLXA 3PUAA 4KHZF 5ABGA 3AXJB 3VR8A 3K1SA 3O1IA 2E8IA 3K8PC 5FL0A 3WAKA 4HE8A 4EEBA 2WM9A 2UXBT 3QK6A 5AQOB 3ZPOA 1LRZA 5M4YA 3Q5EA 2WB5A 4NIQA 1N32T 2FUPA 2CBIA 4IL4A 3RYHE 2XQ8A 3P4WA 3OYXA 4X1KE 2BVMA 2BG9A 2JMKA 4P0BA 1SHZC 4UR9A 4J2CA 2PJQA 4U2YA 3NKZA 1HFAA 2CCQA 3AE3A 4QHOA 4HFDA 2CE7A 5LXTE 3DP7A 5TAOA 4OFZA 3HKCE 1UUSA 3RQWA 1HNZT 4OYJA 2UXCT 1S94A 2XQYA 5AQRB 1IAPA 2NR4A 3FBZA 2LOPA 3M3ZB 4HWIB 4UEMA 3B5MA 4DR4T 5LGNB 2WAUA 4QXCB 4NPPA 5HEGA 1YKEB 2VL0A 4TV8E 2B1EA 3ZCIA 2XASB 2M6IA 4YJ2E 2CM0A 4ADZA 2L9QA 2MTQA 4AQYT 4UIGA 3UFGA 1NEKA 3RYCE 5LJNA 4DV7T 3H37A 4K0UA 1J5WA 4WBNE 2X0LB 2YINA 4ASKA 2AE9A 3AE8A 3LDQB 2CWOA 4KI0F 4I55E 2IMLA 3UU5A 3ZT6A 4ILCA 1DU2A 1D1CA 2LRLA 4NXMT 3P4PA 3SRZA 3RIAA 4GKKT 2KT9A 3RIUA 4ISSA 4M1PA 1KNRA 2XZEA 3HKDE 2WMNA 2W00A 1E1HB 3NWIA 5HCJA 5BR8T 2EHOD 3RHWA 4LMKA 2XAJB 3N9OA 5AQLB 2LM9A 3PJAJ 3I0OA 2JIWA 3C50A 1X79A 3F2EA 1ZP0A 3EABA 4Q25A 2YDRA 3ZEFB 4IL9A 5HXRA 4V1Av 4ZZBA 2Q9QB 2C0SA 4JI3T 1R8IA 2KLQA 3LG7A 3N9NA 1D0YA 2WP9A 3UQ4A 3FZHB 2XM1A 5JQGE 4DNDA 4O2BE 2J62A 4CQIA 4YFSA 3RX6A 3ZLIA 4PK4A 3CQXC 3AEGA 4PK5A 1MMGA 3F31A 4HWFA 1HG2A 2PFVA 4AKRB 4ZS2A 3GWHA 4LF6T 4EV6A 2IIUA 1YKHB 1KEYA 4AKLA 3AAIA 4QX8B 3E08A 5JR9A 3VKGA 4NUVA 3SWHA 4X1YE 3T1HT 1MMNA 5LYJE 5LMNT 2V5CA 2LSKA 3KV9A 3TLUA 3V5UA 4EIWA 2NTXA 2A72A 2R6GF 2X66A 4A56A 3C64A 2NTYA 4ZXLA 5H6QB 2WQYA 3P4RA 3P7IA 3HA4A 2D0TA 4PK6A 3OTOT 3QNUA 1B7TA 4YSXA 2EHOC 1HCIA 4DMWA 2WDQA 4JI6T 5LB7B 3UTKA 3FHNA 1S35A 1Y01A 3NBXX 3AVRA 3N2GE 2XQ9A 5CJ5A 3CVRA 4PJNA 2D2SA 4I0UA 2KNDA 5FY1A 4U3CA 4IHJE 5JVDE 4CXWA 2DCFA 1V9DA 2LSGA 2IDOB 4EYYR 3RH3A 3ZSTA 3VRAA 5AQGB 2WWUA 4YY3T 3VRBA 2QYWA 4EB6E 3AECA 2WDRA 3AE1A 5IYZE 1YXRA 2JQ9A 2BDEA 3KINB 4TZ4C 3RLFF 4B3TT 3TLSA 2VVNA 4ANJA 5LBQB 3ESLA 1HNXT 5F8PA 3VHLA 3V5SA 2G0UA 3ANWA 4WNKA 1WCRA 3IBPA 3EAMA 5L2LA 3AEEA 3AVSA 5C8YE 3HI2A 5HCMA 5LOVE 2FJBA 2IC6A 4UF0B 4O8SA 5L3CB 3ZT7A 1T72A 3UUMA 1LKXA 4ZI2D 4HFIA 4JI4T 2V1DB 3KVAA 2ZM8A 4EYUA 2NW8A 5LP6E 2DWKA 5AQUB 3M65A 4A97A 4DV3T 3CX6B 5C3JA 4XAXB 3C4WA 3AA6B 4CXYA 3SFDA 2JQKA 1US7B 2WCAA 4DO0A 3JADA 1G73A 3PU3A 3K3OA 3HL6A 3UULA 1CHUA 1E2AA 2BG9C 2LJLA 3L09A 2PTFA 3PTRB 2RP4A 4PJJA 4EZHA 2YOEA 1U4QA 4MHCA 2WS3A 3ZMTB 3KV4A 2J47A 3NZQA 3L8RA 1FJGT 2YKSA 4CN6A 1YQ3A 5AQQB 3UU6A 3UUBA 3PUYF 2WZHA 1XNQT 5J2UE 5CA1E 2XJ7A 2XQAA 1J5ET 2XM2A 3PV0F 4KHPT 3B13A 5LHIB 3KFWX 1Y64B 4HEAA 1YW0A 2N1GA 5AQHB 4F6RC 5ABEA 2ODUA 2LE8A 3FXEB 5ABHA 2BKOA 1OWAA 2VKJA 3ZKRA 5L3DB 4O4JE 2SPCA 3RKGA 3MA9A 3RQUA 2XAFB 2CWYA 3PURA 3TLTA 4K0KT 2V7JA 3Q5WA 1JNZA 4ISTA 4TWDA 1MNDA 5FKYA 4ZI2C 1IBKT 4DR1T 4MBQA 5C2TA 5DJQC 4PJMA 3L3PA 4LF5T 5AQJB 3AEDA 4QH1A 2GK9A 2P9BA 2KWHA 2CXFA 5JRCB 2X68A 1D1BA 2NWBA 3RIUC 3UFEA 5J1GA 3K3NA 2X0YA 5LGUB 3ONLC 2W4XA 5AQPB 3ONXA 3UU4A 1NWMX 2J1DG 5LJMA 2XQ5A 1N34T 2LKGA 1G8XA 2PBIA 2IAKA 4C91A 5JREA 3N5LA 1YQ4A 2V5DA 4PW8A 4YXDA 4TX5A 2ZM6T 3UUXB 2IC9A 2LSIA 1MIWA 4H9NC 4U2ZA 5FXZA 3JC6D 3FZLB 2MBGA 3LBXA 3CKDA 4X66T 2ZM2A 1KK7A 3ZMSB 4U31A 2ACXA 3E0ZA 3VKHA 5JTGA 4I43B 1T7SA 2JJ9A 1N33T 2LM2A 4HFHA 3C4XA 4AISA 3JCFA 3BK9A 2CXDA 4UVBB 3ZT5A 5JR9C 4IE6A 5HEUA 2ES0A 2X9WA 2C5IT 4GK0E 2BG9E 2IW5B 3R6NA 2XTLA 1VCTA 5IHYA 2NOXA 3P4QA 5ABFB 5ADXL 4DV4T 2Y48B 3B57A 3AA0B 4CI2B 3IF8B 3ABVA 4JI2T 3K3QC 2I0MA 5KX5E 1X9BA 2OA5A 4KBMB 4E7ZA 2BS3A 2NW7A 3G06A 4HGAA 3PUWF 5HWYA 5KDMC 3SFEA 4CI3B 4HFCA 4TWFA 3CK6A 2XPKA 4YTPA 4YLHA 4DBRA 3FZKB 3RYIE 2LEHA 3W15B 2A2FX 4LF8T 4HTEA 4Z90A 4MFRA 3O9XA 2D5UA 1WRDA 3JC6C 1OEDB 2KWIB 4ZZCA 5L3FB 2DL1A 3GMIA 3AE5A 3WI3A 3VR9A 2EHOB 2LRKA 3DTOA 3BQLA 4XZCA 2VVSA 2X51A 2YDQA 3ZMUB 3KBUA 2E9XB 2N9DA 2OLTA 2W62A 4L0RA 3ZN0B 2LLYA 2FJAA 4IE0A 4QH4A 4YHJA 2X9XA 5AQNB 3IHRA 4H63H 1M7KA 2UXDT 4EOZB 4UV9B 4B3RT 5L3GB 2ACZA 2KSRA 3T1YT 2BKPA 4IREA 1IZNB 4CN1A 2BBHA 2DLRA 2K48A 3ZC1A 4AQGA 2DHRA 2X0HA 3QOFA 2W61A 4DIDB 5HAXA 5HXEA 5L3BB 4YHHT 2DNXA 3RRCA 2LHNA 4TN7B 3C51A 3IEEA 4JEHB 4PFPA 4AXPA 4BJNA 2Z6EA 2HPJA 2V7KA 4H9QC 4O4IE 2WU5A 4B3MT 2XSBA 3RC3A 3OPCA 4COFA 5AQSB 1NAFA 4AI6A 2V7LA 5DQVA 5CGMA 3RGLA 5AQKB 2XQ3A 4ZS3A 5DQWA 2QVAA 5JH7E 2NP9A 4HWHA 5CA0E 4JEUB 2CLYB 2UU9T 3CQCB 2H3RA 3PUXF 2XQ6A 1HX8A 4G63A 5KXJA 5CB4E 1T8BA 2BG9B 1HX1B 4X64T 2VKHA 3KV6A 4ZI3C 3AXJA 3HKEE 4U7YA 4ZI7E 1UURA 3ETVA 3HKBE 4CN4A 4IDPA 4WYVA 4X1IE 3Q5XA 4QX7B 4H9PC 5L4HA 5LA6E 4JI1T 3TLWA 5LG3A 2X67A 2OV9A 5EK2A 2M67A 3LFMA 2WZIA 1W9RA 3BQKA 5HXHA 3UQ7A 4AKIA 5JDHA 2H7VC 3BQIA 4PJLA 4PAGA 2MAWA 3CPZA 2XSAA 4G2AA 4H9OC 3U3IA 4BAYB 5HXSA 4B3ST 1XNRT 4P09A 4LF9T 2H89A 3LK42 4UV8B 4GIWA 4O4HE 5BMVE 2CPTA 3NZPA 1BR4A 2VQFT 3LK2B 4IDZA 2HPLA 1I94T 2V7IA 1MIYA 4JUYA 2CMRA 4BJMA 4EAHA 1SA0E 2VURA 2W0GA 2WDVA 4UVAB 4TNVA 4GKJT 4CI1B 2BS2A 2YU2A 3GA8A 2ZLYA 1MNEA 2MYSA 4CXXA 3NRYA 2DWGA 4EGWA 3UU3A 5FXXA 4AQFC 4PNIA 4AKHA 1IJ5A 3H3MA 4OK0A 4TNWA 5LNKA 2UXNB 3S4UA 2HN1A 4U72A 4DUYT 2UUAT 1UX4A 1HNWT 1WR0A 5LG4A 3Q5DA 3PUZF 2D0UA 2UUBT 3MACA 2H88A 3F57A 1OEDA 3AEFA 2QA7A 2XAGB 4KP3C 4BA9A 2C5JA 3MK7C 4H9SE 2XAQB 1VRBA 3NVOA 4UELA 4DR2T 3ZN1B 2XHEB 3AE6A 3I0QA 3A5XA 3CQGB 3MXZA 5ETWA 1MMAA 1FMVA 4TWHA 4IE7A 2E9XA 4A98A 3AB3B 2Q9QA 3O4XE 4XBFB 5JDQA 2L3LA 1QUUA 1CUNA 3I1AA 4A5XA 1KNPA 4HFEA 2VB6A 1WYBA 4WBOA 2XUEA 3HR0A 3P50A 4IT4A 4DV5T 2WU2A 4DMVA 1I6ZA 3ZYKA 3VU7H 4DR5T 5AQMB 4ERRA 1N36T 4X65T 5L3EB 5GONE 4JI0T 2V6XA 4QKNA 3PDYA 4GYSA 2E2AA 4IDQA 3KBTA 2D9DA 2IHR1 4Z91A 5L4EA 2MOZA 2JPFA 2WBLA 3PUQA 4DV1T 3DJBA 2JQHA 3OVUA 3J7Yq 1XZYA 2YU1A 4AQFA 3O1JA 3EDUA 3RI5A 4KX6A 2LHRA 5JDGA 3AAAB 5HYAA 1LVKA 4O2AE 2VWAA 5F5WA 4IDNA 1AJ3A 2UXXB 1KF6A 3FXDB 3A8YC 4ILUA 2VK9A 4ILAA 2W2UA 5IUXA 4MLKA 1HTJF 3A7MA 5FY0A 3OJAA 3RC8A 4P1NA 2JQQA 2RPAA 4U7IA 2W63A 3Q2MA 3CIRA 1M62A 2DI4A 3ANWB 5HEHA 3ZMVB 3AAEB 4LFCT 3GN5B 2H7OA 3RYFE 2QRXA 4YT0A 4OHFA 2CA5A 5JDFA 4TUYE 2ODVA 1XDPA 5LGTB 4YTNA 5J0ZA 3NRXA 4HKAA 4JI7T 3RRWA 3I9YA 5IWAT 3KDSE 5AQIB 1YD8G 1HR0T 1IJ6A 2BKNA 2IUBA 3X1DA 5AFUL 2XAHB 3KV5A 2KINB 5JDNA 3ZYLA 3SS1A 3PUSA 3SOLA 1UCUA 4UF0A 4GYRA 2YDSA 3WAJA 4HWCA 4U74A 3UT5E 3C98B 5LHHB 2K9AA 5FY7A 5EK3A 5AQFB 5JDMA 1QSDA 1GQEA 2WMOA 3EI0A 2QGSA 1UX5A 1H7CA 3T8OA 4LMLA 1Z0PA 3N9QA 4YSZA 1W09A 4DV0T 5LCYA 1W0BA 3ZJ1A 3UU8A 1JNRA 4N78D 4YJ3E 2Y8DA 2K5BB 2PG8A 4QXBB 3RPUA 4ZI3D 3N2OA 3L39A 5KMGP 3AE4A 3O1HA 1XDOA 3AE9A 2E9XD 3PUGA 1VOMA 2WSSV 1XWMA 5HWXA 3FBLA 2Q9QD 2E5LT 3ZC0A 4YSYA 3AE2A 5HEJA 1ZOYA 4F8HA 5FVLA 3UUNA 4I4TE 1ZHCA 4P0AA 4DV2T 2CBJA 3LK3B 2V6YB 2MPKA 4NXNT 1Z8UA 1E7PA 2FBWA 2I59A 1ZV4X 5E0OA 2HH7A 2YEVC 3CMLA 5FVKA 3AA1B 5FNVE 4X62T 4KMCA 2ZMAA 5F3JA 3AA7B 1OXZA 3AEAA 5FXWA 2J4GA 3CWZB 4IE5A 3E22E 3N9LA 2CXLA 2JRKA 3LSVA 2HN2A 4ZEYA 4LFBT 1D1AA 2CEAA 4DVDA 1BR1A 2XQ7A 3PU8A 4QH5A 2XY8B 3P4SA 3RKOA 4PFOA 4ZOLE 5JRCA 2N2NA 5EK4A 4LF4T 1OEDC 1U5PA 4X5TA 5A1LA 5LMUT 2M6BA 1SE7A 3LBXB 3FZMB 2Y6XA 2UUCT 3OYZA 2BVLA 3D0TA 4L9IA 3AEBA 1WFDA 3EHZA 1L0VA 2V26A 4TV9E
chains in the Genus database with same CATH topology
2EHOD 3MACA 4IE4A 1T98A 2ZM2A 1KK7A 3F57A 2XAJB 1D0XA 3N9OA 3ZMSB 2E9XC 2JMHA 2LM9A 4Z8XA 3I0OA 2QA7A 2XAGB 4KP3C 4BA9A 3C50A 2ACXA 3E0ZA 1X79A 3F2EA 3VKHA 2C5JA 4IGUA 2Q9QC 3MK7C 4FI5A 4H9SE 2XAQB 5H6RB 1VRBA 2VASA 4I43B 2JJ9A 4GOUA 3OBVE 3ZEFB 5HXRA 4UELA 3ZN1B 4V1Av 2XHEB 4MALA 2Q9QB 3C4XA 3I0QA 2C0SA 3A5XA 3CQGB 2LSJA 3MXZA 5ETWA 1MMAA 4WW0A 1FMVA 2KLQA 3BK9A 3LG7A 2CXDA 3N9NA 4EXTA 4UVBB 1D0YA 4IE7A 5JR9C 2L8KA 2E9XA 3I9WA 3N2KE 4IE6A 1BR2A 5JQGE 4KUMB 4DNDA 3N9PA 1ZEEA 3QC9A 2ES0A 4O2BE 4CQIA 4YFSA 2X9WA 2C5IT 4GK0E 3AB3B 4H9RC 2IW5B 3R6NA 3RX6A 2Q9QA 3ZLIA 4PK4A 4HN9A 3CQXC 3O4XE 2XTLA 1HF8A 1FIOA 5IHYA 5JDLA 4XBFB 2NOXA 5JDQA 2L3LA 1QUUA 1CUNA 4PK5A 1MMGA 3I1AA 1LVFA 3F31A 3PE0A 5ADXL 1HG2A 2PFVA 5LHGB 4AKRB 4ZS2A 3GWHA 2VB6A 1WYBA 4CZZB 1YKHB 2Y48B 4AKLA 3AAIA 2YK0A 3E08A 1FMWA 3B57A 4QX8B 5JR9A 4NUVA 4WBOA 3SWHA 3VKGA 2XUEA 3HR0A 5HXCA 3AA0B 4X1YE 4CI2B 1ZKEA 1MMNA 4DMVA 3GN5A 3IF8B 2LSYA 3ZCJA 3ZYKA 3VU7H 4I50E 3K3QC 5LYJE 1MMDA 4QWNB 4O4LE 5KX5E 2OA5A 4KBMB 4ERRA 4E7ZA 2LSKA 3KV9A 2NW7A 4HGAA 3ETUA 3V5UA 4H63V 3MJXA 4EIWA 4IIJE 5HWYA 2NTXA 5L3EB 5KDMC 4CI3B 3EDVA 2A72A 5GONE 2X66A 4A56A 3C64A 3Q9DA 4HFVA 1O3XA 4YLHA 3N9MA 5FYMA 4DBRA 4QKNA 2NTYA 4FJOA 5FP3A 3RYIE 1KNZA 3PDYA 5H6QB 2LEHA 4GYSA 2KZ7B 3W15B 3KBTA 2A2FX 2CLYC 2X9HA 3P7IA 3HA4A 3C4ZA 4HTEA 2K24A 4UVCB 2D0TA 4PK6A 2VL8A 4MFRA 1EZ3A 3O9XA 2D5UA 1B7TA 1WRDA 3JC6C 3ZJ2A 2EHOC 2MOZA 1HCIA 2KWIB 4DMWA 1HG5A 5L3FB 1BR0A 1WYCA 2JPFA 3UTKA 2WBLA 3GMIA 3PUQA 3DJBA 3WI3A 3FHNA 1S35A 3J7Yq 2EHOB 2YU1A 3AVRA 3LJCA 3NBXX 5EZYE 4AQFA 3O1JA 3DTOA 3EDUA 2VKOA 3N2GE 3BQLA 3ZMZB 3CVRA 4PJNA 4XZCA 2D2SA 2LHRA 2KNDA 2X51A 3TKLB 5FY1A 5J2TE 3ZMUB 5JDGA 3AAAB 5HYAA 4IHJE 3KBUA 1LVKA 2E9XB 5JVDE 4OYKA 4NUUA 3H3AA 4CXWA 2EHOA 2N9DA 4O2AE 2DCFA 1V9DA 3EUHA 2VWAA 1AJ3A 2W62A 2LSGA 2UXXB 4L0RA 3ZN0B 3FXDB 4E7SA 4ILUA 4EYYR 3RH3A 4IE0A 2VK9A 4YHJA 2X9XA 2WWUA 4MLKA 1HTJF 3IHRA 1HS7A 4H63H 5FY0A 3OJAA 4B6XA 3RC8A 4QXHB 4EB6E 2JQQA 4EOZB 4UV9B 3EVYA 2KMFA 1MIVA 5L3GB 3FB2A 2W63A 3MKDA 3Q2MA 5JR9B 5IYZE 2DI4A 1IZNB 2RA1A 3CX7B 3ANWB 4C90A 3ZYMA 4L5GA 3ZMVB 2BDEA 2DLRA 3KINB 4TZ4C 3AAEB 2NW9A 3GN5B 2K48A 2H7OA 2X9YA 3RYFE 3ZC1A 3KVBA 4OHFA 4AQGA 4GK5E 4ANJA 5FMNA 4DBQA 2CA5A 5LBQB 5JDFA 2DHRA 3ESLA 2C5KT 2A3DA 5F8PA 4TUYE 3VHLA 2ODVA 2W61A 3V5SA 5HAXA 5HXEA 5L3BB 2G0UA 3ANWA 2DNXA 3RRCA 3U78A 4WNKA 1WR6A 3IBPA 5LGTB 2LHNA 4TN7B 3C51A 4JLEA 3IEEA 4JEHB 4PFPA 4AXPA 5L2LA 4BJNA 3NRXA 2LT3A 2ZM0A 3AVSA 3QUJA 2Z6EA 5LBMA 4HKAA 5C8YE 3HI2A 5LOVE 2V7MA 2HPJA 2IC6A 2V7KA 4H9QC 4O4IE 3J9X1 4UF0B 4O8SA 3R84B 3RRWA 5L3CB 3I9YA 3UUMA 3KDSE 1LKXA 1YD8G 3MZKB 4ZI2D 4EZ4A 1IJ6A 1FEWA 5AFUL 2V1DB 2XAHB 3KVAA 2ZM8A 2KXPB 3RC3A 3KV5A 2KINB 4AKGA 4EYUA 2NW8A 2VKDA 5LP6E 4X20E 5JDNA 4UXNB 3ZYLA 2DWKA 3SS1A 3PUSA 4BJMA 1D0ZA 3M65A 3CX6B 4ZHQE 3SOLA 1UCUA 1NAFA 4UF0A 3CX8B 4XAXB 4AI6A 2V7LA 3C4WA 4GYRA 5DQVA 2BZBA 3WAJA 3AA6B 4U74A 4CXYA 4ZS3A 5DQWA 3UT5E 5FXVA 1US7B 2LOSA 5JH7E 4DO0A 2NP9A 3P8CD 3OKQA 3C98B 1G73A 3PU3A 5CA0E 5DABA 5LHHB 3K3OA 4JEUB 2K9AA 3HL6A 1WLXA 5FY7A 2CLYB 3PUAA 5EK3A 3CQCB 3UULA 2H3RA 5JDMA 1QSDA 2LJLA 2WMOA 3L09A 3PTRB 1HX8A 2QGSA 3O1IA 1UX5A 2E8IA 2RP4A 4G63A 1H7CA 3K8PC 3T8OA 3WAKA 4HE8A 4PJJA 4EZHA 5CB4E 1Z0PA 3N9QA 1U4QA 2WM9A 4MHCA 3ZMTB 3QK6A 3KV4A 5LCYA 3ZJ1A 2VKHA 3KV6A 3NZQA 4N78D 4ZI3C 3ZPOA 1LRZA 2Y8DA 4YJ3E 3HKEE 5M4YA 2K5BB 2PG8A 4QXBB 3RPUA 4ZI3D 4ZI7E 3RYHE 3OYXA 4X1KE 3N2OA 3ETVA 3HKBE 2BVMA 5KMGP 5J2UE 2JMKA 5CA1E 4P0BA 1SHZC 3O1HA 4X1IE 3Q5XA 4J2CA 2PJQA 4QX7B 2E9XD 4H9PC 3PUGA 1HFAA 2CCQA 1VOMA 3B13A 2WSSV 5LHIB 3KFWX 4QHOA 1Y64B 2CE7A 3DP7A 4HEAA 1YW0A 5LA6E 5TAOA 5LXTE 5HWXA 2N1GA 3FBLA 3HKCE 4OFZA 2Q9QD 3ZC0A 4F6RC 4OYJA 2ODUA 2LE8A 2X67A 3FXEB 5EK2A 2M67A 3LFMA 1OWAA 2VKJA 3BQKA 5HXHA 3UUNA 5L3DB 1S94A 4I4TE 1ZHCA 4AKIA 4O4JE 2SPCA 4P0AA 3MA9A 2XAFB 2XQYA 3LK3B 2CWYA 1IAPA 3PURA 5JDHA 2H7VC 3BQIA 3FBZA 2LOPA 4PJLA 2V7JA 3Q5WA 4PAGA 3CPZA 4JUYA 4ISTA 4UEMA 4G2AA 4H9OC 3U3IA 4BAYB 5HXSA 5LGNB 1MNDA 4ZI2C 2I59A 2WAUA 4QXCB 4P09A 4MBQA 1ZV4X 5E0OA 3LK42 4UV8B 1YKEB 5DJQC 4GIWA 2HH7A 2YEVC 4O4HE 3CMLA 5BMVE 3NZPA 3AA1B 1BR4A 4PJMA 4TV8E 5FNVE 3L3PA 3LK2B 4IDZA 4KMCA 2B1EA 2ZMAA 3ZCIA 5F3JA 2HPLA 3AA7B 2XASB 1OXZA 5FXWA 2V7IA 1MIYA 4YJ2E 3CWZB 4IE5A 2CM0A 2CMRA 2P9BA 2GK9A 2CXLA 2L9QA 2MTQA 3E22E 3N9LA 1SA0E 4UIGA 2JRKA 4ADZA 4EAHA 3RYCE 2KWHA 2W0GA 4UVAB 2CXFA 5JRCB 5LJNA 2X68A 3H37A 4K0UA 1D1BA 2NWBA 4WBNE 2X0LB 3UFEA 5J1GA 4CI1B 3K3NA 2YINA 1D1AA 4ASKA 2CEAA 5LGUB 3ONXA 4DVDA 2CWOA 1NWMX 2YU2A 1BR1A 3GA8A 2ZLYA 3PU8A 2J1DG 1MNEA 4I55E 2MYSA 4CXXA 5LJMA 3NRYA 3RKOA 4PFOA 4ZOLE 5JRCA 2N2NA 2DWGA 5FXXA 1D1CA 1G8XA 5EK4A 4AQFC 4PNIA 2PBIA 4AKHA 1IJ5A 4OK0A 3SRZA 1U5PA 2IAKA 5A1LA 4C91A 5LNKA 2UXNB 5JREA 3S4UA 3LBXB 3N5LA 2Y6XA 2KT9A 4U72A 3OYZA 2BVLA 4ISSA 3D0TA 4M1PA 4PW8A 4TX5A 1UX4A 4L9IA 3HKDE 2WMNA 3UUXB 5LG4A 2IC9A 2W00A 2LSIA 1E1HB 2D0UA 1MIWA 4H9NC 4TV9E 5FXZA 3JC6D 2MBGA 2V26A 3LBXA 3CKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  2KWH A;  3FXE B;  4L0R A;  3S4U A;  1H7C A;  3QUJ A;  3MXZ A;  3FXD B;  1LVF A;  3N5L A;  4EYY R;  3P7I A;  2K48 A;  2X9X A;  2IC6 A;  1Z0P A;  2X9Y A;  2C5J A;  4J2C A;  3CVR A;  3QK6 A;  4FI5 A;  1IJ6 A;  2CA5 A;  3L3P A;  4DND A;  4B6X A;  3TKL B;  4CQI A;  2IC9 A;  2C5K T;  2X9W A;  2C5I T;  2KWI B;  1LRZ A;  2G0U A;  2MBG A;  2XTL A;  1ZKE A;  1QSD A;  3CKD A; 
#chains in the Genus database with same CATH topology
 4IE4 A;  1T98 A;  4JV5 T;  3QB5 K;  1D0X A;  3JAF A;  2B76 A;  2E9X C;  2JMH A;  4Z8X A;  3QB5 A;  4IGU A;  2Q9Q C;  4FI5 A;  5H6R B;  1IBM T;  2VAS A;  4GOU A;  3OBV E;  2XQ4 A;  2FJE A;  5AQV B;  4JYA T;  4DUZ T;  4MAL A;  3FZF B;  2LSJ A;  4WW0 A;  4EXT A;  2K3W A;  2L8K A;  3N2K E;  2A9U A;  3I9W A;  1BR2 A;  4KUM B;  3N9P A;  1ZEE A;  3QC9 A;  4H9R C;  4HN9 A;  1HF8 A;  1FIO A;  5JDL A;  3PUV F;  2E5V A;  1LVF A;  3PE0 A;  4ILB A;  1XMO T;  3RIF A;  5LHG B;  2LKH A;  4LFA T;  4YTM A;  4CZZ B;  2YK0 A;  1FMW A;  5HXC A;  5ABF A;  2V8S V;  1ZKE A;  3JAE A;  3GN5 A;  2LSY A;  3ZCJ A;  2CHN A;  4LMJ A;  4I50 E;  1MMD A;  2W66 A;  4QWN B;  4O4L E;  3ETU A;  4H63 V;  4DR7 T;  3MJX A;  4IIJ E;  2HHH T;  2AXD S;  3EDV A;  4OX9 T;  3Q9D A;  4HFV A;  1O3X A;  1XMQ T;  3N9M A;  1W0A A;  5FYM A;  4FJO A;  5FP3 A;  1KNZ A;  2KZ7 B;  2BBJ A;  2CLY C;  2X9H A;  3AE7 A;  3C4Z A;  2WWV A;  2K24 A;  4UVC B;  2VL8 A;  1EZ3 A;  4JI8 T;  2CRB A;  4U33 A;  4IDO A;  3ZJ2 A;  4DR3 T;  1HG5 A;  1BR0 A;  1WYC A;  5CFB A;  1QLB A;  3LJC A;  5EZY E;  1UGO A;  1J1J A;  2VKO A;  4HFB A;  3ZMZ B;  3ZSS A;  2VQE T;  1IBL T;  3TKL B;  5J2T E;  2I6H A;  4OYK A;  4NUU A;  3H3A A;  3ONJ A;  4JI5 T;  2EHO A;  3EUH A;  2YN6 A;  4LF7 T;  4E7S A;  5HEO A;  4JBW F;  1UK5 A;  1KFY A;  1HS7 A;  2BS4 A;  3PJA A;  4B6X A;  4QXH B;  1OED E;  3EVY A;  2KMF A;  1MIV A;  4DV6 T;  2F4V T;  3FB2 A;  3MKD A;  4HWD A;  5JR9 B;  2RA1 A;  3CX7 B;  4C90 A;  3ZYM A;  4L5G A;  2NW9 A;  2X9Y A;  5FL1 A;  3KVB A;  2W67 A;  4GK5 E;  5FMN A;  4DBQ A;  2C5K T;  2A3D A;  1VCS A;  4DR6 T;  3U78 A;  1WR6 A;  3RF1 A;  4JLE A;  5AQT B;  2LT3 A;  2ZM0 A;  3QUJ A;  2WY2 A;  5LBM A;  2V7M A;  3J9X 1;  3R84 B;  2V6Y A;  3MZK B;  4EZ4 A;  1FEW A;  2KXP B;  4AIU A;  4AKG A;  2VKD A;  4X20 E;  4UXN B;  3IA3 A;  1SUM B;  1D0Z A;  1NEN A;  4ZHQ E;  4WZX A;  2FJD A;  3CX8 B;  4EED A;  2BZB A;  2CHO A;  5L47 A;  5FXV A;  2LOS A;  3P8C D;  3OKQ A;  5DAB A;  3TLV A;  1WLX A;  3PUA A;  4KHZ F;  5ABG A;  3AXJ B;  3VR8 A;  3K1S A;  3O1I A;  2E8I A;  3K8P C;  5FL0 A;  3WAK A;  4HE8 A;  4EEB A;  2WM9 A;  2UXB T;  3QK6 A;  5AQO B;  3ZPO A;  1LRZ A;  5M4Y A;  3Q5E A;  2WB5 A;  4NIQ A;  1N32 T;  2FUP A;  2CBI A;  4IL4 A;  3RYH E;  2XQ8 A;  3P4W A;  3OYX A;  4X1K E;  2BVM A;  2BG9 A;  2JMK A;  4P0B A;  1SHZ C;  4UR9 A;  4J2C A;  2PJQ A;  4U2Y A;  3NKZ A;  1HFA A;  2CCQ A;  3AE3 A;  4QHO A;  4HFD A;  2CE7 A;  5LXT E;  3DP7 A;  5TAO A;  4OFZ A;  3HKC E;  1UUS A;  3RQW A;  1HNZ T;  4OYJ A;  2UXC T;  1S94 A;  2XQY A;  5AQR B;  1IAP A;  2NR4 A;  3FBZ A;  2LOP A;  3M3Z B;  4HWI B;  4UEM A;  3B5M A;  4DR4 T;  5LGN B;  2WAU A;  4QXC B;  4NPP A;  5HEG A;  1YKE B;  2VL0 A;  4TV8 E;  2B1E A;  3ZCI A;  2XAS B;  2M6I A;  4YJ2 E;  2CM0 A;  4ADZ A;  2L9Q A;  2MTQ A;  4AQY T;  4UIG A;  3UFG A;  1NEK A;  3RYC E;  5LJN A;  4DV7 T;  3H37 A;  4K0U A;  1J5W A;  4WBN E;  2X0L B;  2YIN A;  4ASK A;  2AE9 A;  3AE8 A;  3LDQ B;  2CWO A;  4KI0 F;  4I55 E;  2IML A;  3UU5 A;  3ZT6 A;  4ILC A;  1DU2 A;  1D1C A;  2LRL A;  4NXM T;  3P4P A;  3SRZ A;  3RIA A;  4GKK T;  2KT9 A;  3RIU A;  4ISS A;  4M1P A;  1KNR A;  2XZE A;  3HKD E;  2WMN A;  2W00 A;  1E1H B;  3NWI A;  5HCJ A;  5BR8 T;  2EHO D;  3RHW A;  4LMK A;  2XAJ B;  3N9O A;  5AQL B;  2LM9 A;  3PJA J;  3I0O A;  2JIW A;  3C50 A;  1X79 A;  3F2E A;  1ZP0 A;  3EAB A;  4Q25 A;  2YDR A;  3ZEF B;  4IL9 A;  5HXR A;  4V1A v;  4ZZB A;  2Q9Q B;  2C0S A;  4JI3 T;  1R8I A;  2KLQ A;  3LG7 A;  3N9N A;  1D0Y A;  2WP9 A;  3UQ4 A;  3FZH B;  2XM1 A;  5JQG E;  4DND A;  4O2B E;  2J62 A;  4CQI A;  4YFS A;  3RX6 A;  3ZLI A;  4PK4 A;  3CQX C;  3AEG A;  4PK5 A;  1MMG A;  3F31 A;  4HWF A;  1HG2 A;  2PFV A;  4AKR B;  4ZS2 A;  3GWH A;  4LF6 T;  4EV6 A;  2IIU A;  1YKH B;  1KEY A;  4AKL A;  3AAI A;  4QX8 B;  3E08 A;  5JR9 A;  3VKG A;  4NUV A;  3SWH A;  4X1Y E;  3T1H T;  1MMN A;  5LYJ E;  5LMN T;  2V5C A;  2LSK A;  3KV9 A;  3TLU A;  3V5U A;  4EIW A;  2NTX A;  2A72 A;  2R6G F;  2X66 A;  4A56 A;  3C64 A;  2NTY A;  4ZXL A;  5H6Q B;  2WQY A;  3P4R A;  3P7I A;  3HA4 A;  2D0T A;  4PK6 A;  3OTO T;  3QNU A;  1B7T A;  4YSX A;  2EHO C;  1HCI A;  4DMW A;  2WDQ A;  4JI6 T;  5LB7 B;  3UTK A;  3FHN A;  1S35 A;  1Y01 A;  3NBX X;  3AVR A;  3N2G E;  2XQ9 A;  5CJ5 A;  3CVR A;  4PJN A;  2D2S A;  4I0U A;  2KND A;  5FY1 A;  4U3C A;  4IHJ E;  5JVD E;  4CXW A;  2DCF A;  1V9D A;  2LSG A;  2IDO B;  4EYY R;  3RH3 A;  3ZST A;  3VRA A;  5AQG B;  2WWU A;  4YY3 T;  3VRB A;  2QYW A;  4EB6 E;  3AEC A;  2WDR A;  3AE1 A;  5IYZ E;  1YXR A;  2JQ9 A;  2BDE A;  3KIN B;  4TZ4 C;  3RLF F;  4B3T T;  3TLS A;  2VVN A;  4ANJ A;  5LBQ B;  3ESL A;  1HNX T;  5F8P A;  3VHL A;  3V5S A;  2G0U A;  3ANW A;  4WNK A;  1WCR A;  3IBP A;  3EAM A;  5L2L A;  3AEE A;  3AVS A;  5C8Y E;  3HI2 A;  5HCM A;  5LOV E;  2FJB A;  2IC6 A;  4UF0 B;  4O8S A;  5L3C B;  3ZT7 A;  1T72 A;  3UUM A;  1LKX A;  4ZI2 D;  4HFI A;  4JI4 T;  2V1D B;  3KVA A;  2ZM8 A;  4EYU A;  2NW8 A;  5LP6 E;  2DWK A;  5AQU B;  3M65 A;  4A97 A;  4DV3 T;  3CX6 B;  5C3J A;  4XAX B;  3C4W A;  3AA6 B;  4CXY A;  3SFD A;  2JQK A;  1US7 B;  2WCA A;  4DO0 A;  3JAD A;  1G73 A;  3PU3 A;  3K3O A;  3HL6 A;  3UUL A;  1CHU A;  1E2A A;  2BG9 C;  2LJL A;  3L09 A;  2PTF A;  3PTR B;  2RP4 A;  4PJJ A;  4EZH A;  2YOE A;  1U4Q A;  4MHC A;  2WS3 A;  3ZMT B;  3KV4 A;  2J47 A;  3NZQ A;  3L8R A;  1FJG T;  2YKS A;  4CN6 A;  1YQ3 A;  5AQQ B;  3UU6 A;  3UUB A;  3PUY F;  2WZH A;  1XNQ T;  5J2U E;  5CA1 E;  2XJ7 A;  2XQA A;  1J5E T;  2XM2 A;  3PV0 F;  4KHP T;  3B13 A;  5LHI B;  3KFW X;  1Y64 B;  4HEA A;  1YW0 A;  2N1G A;  5AQH B;  4F6R C;  5ABE A;  2ODU A;  2LE8 A;  3FXE B;  5ABH A;  2BKO A;  1OWA A;  2VKJ A;  3ZKR A;  5L3D B;  4O4J E;  2SPC A;  3RKG A;  3MA9 A;  3RQU A;  2XAF B;  2CWY A;  3PUR A;  3TLT A;  4K0K T;  2V7J A;  3Q5W A;  1JNZ A;  4IST A;  4TWD A;  1MND A;  5FKY A;  4ZI2 C;  1IBK T;  4DR1 T;  4MBQ A;  5C2T A;  5DJQ C;  4PJM A;  3L3P A;  4LF5 T;  5AQJ B;  3AED A;  4QH1 A;  2GK9 A;  2P9B A;  2KWH A;  2CXF A;  5JRC B;  2X68 A;  1D1B A;  2NWB A;  3RIU C;  3UFE A;  5J1G A;  3K3N A;  2X0Y A;  5LGU B;  3ONL C;  2W4X A;  5AQP B;  3ONX A;  3UU4 A;  1NWM X;  2J1D G;  5LJM A;  2XQ5 A;  1N34 T;  2LKG A;  1G8X A;  2PBI A;  2IAK A;  4C91 A;  5JRE A;  3N5L A;  1YQ4 A;  2V5D A;  4PW8 A;  4YXD A;  4TX5 A;  2ZM6 T;  3UUX B;  2IC9 A;  2LSI A;  1MIW A;  4H9N C;  4U2Z A;  5FXZ A;  3JC6 D;  3FZL B;  2MBG A;  3LBX A;  3CKD A;  4X66 T;  2ZM2 A;  1KK7 A;  3ZMS B;  4U31 A;  2ACX A;  3E0Z A;  3VKH A;  5JTG A;  4I43 B;  1T7S A;  2JJ9 A;  1N33 T;  2LM2 A;  4HFH A;  3C4X A;  4AIS A;  3JCF A;  3BK9 A;  2CXD A;  4UVB B;  3ZT5 A;  5JR9 C;  4IE6 A;  5HEU A;  2ES0 A;  2X9W A;  2C5I T;  4GK0 E;  2BG9 E;  2IW5 B;  3R6N A;  2XTL A;  1VCT A;  5IHY A;  2NOX A;  3P4Q A;  5ABF B;  5ADX L;  4DV4 T;  2Y48 B;  3B57 A;  3AA0 B;  4CI2 B;  3IF8 B;  3ABV A;  4JI2 T;  3K3Q C;  2I0M A;  5KX5 E;  1X9B A;  2OA5 A;  4KBM B;  4E7Z A;  2BS3 A;  2NW7 A;  3G06 A;  4HGA A;  3PUW F;  5HWY A;  5KDM C;  3SFE A;  4CI3 B;  4HFC A;  4TWF A;  3CK6 A;  2XPK A;  4YTP A;  4YLH A;  4DBR A;  3FZK B;  3RYI E;  2LEH A;  3W15 B;  2A2F X;  4LF8 T;  4HTE A;  4Z90 A;  4MFR A;  3O9X A;  2D5U A;  1WRD A;  3JC6 C;  1OED B;  2KWI B;  4ZZC A;  5L3F B;  2DL1 A;  3GMI A;  3AE5 A;  3WI3 A;  3VR9 A;  2EHO B;  2LRK A;  3DTO A;  3BQL A;  4XZC A;  2VVS A;  2X51 A;  2YDQ A;  3ZMU B;  3KBU A;  2E9X B;  2N9D A;  2OLT A;  2W62 A;  4L0R A;  3ZN0 B;  2LLY A;  2FJA A;  4IE0 A;  4QH4 A;  4YHJ A;  2X9X A;  5AQN B;  3IHR A;  4H63 H;  1M7K A;  2UXD T;  4EOZ B;  4UV9 B;  4B3R T;  5L3G B;  2ACZ A;  2KSR A;  3T1Y T;  2BKP A;  4IRE A;  1IZN B;  4CN1 A;  2BBH A;  2DLR A;  2K48 A;  3ZC1 A;  4AQG A;  2DHR A;  2X0H A;  3QOF A;  2W61 A;  4DID B;  5HAX A;  5HXE A;  5L3B B;  4YHH T;  2DNX A;  3RRC A;  2LHN A;  4TN7 B;  3C51 A;  3IEE A;  4JEH B;  4PFP A;  4AXP A;  4BJN A;  2Z6E A;  2HPJ A;  2V7K A;  4H9Q C;  4O4I E;  2WU5 A;  4B3M T;  2XSB A;  3RC3 A;  3OPC A;  4COF A;  5AQS B;  1NAF A;  4AI6 A;  2V7L A;  5DQV A;  5CGM A;  3RGL A;  5AQK B;  2XQ3 A;  4ZS3 A;  5DQW A;  2QVA A;  5JH7 E;  2NP9 A;  4HWH A;  5CA0 E;  4JEU B;  2CLY B;  2UU9 T;  3CQC B;  2H3R A;  3PUX F;  2XQ6 A;  1HX8 A;  4G63 A;  5KXJ A;  5CB4 E;  1T8B A;  2BG9 B;  1HX1 B;  4X64 T;  2VKH A;  3KV6 A;  4ZI3 C;  3AXJ A;  3HKE E;  4U7Y A;  4ZI7 E;  1UUR A;  3ETV A;  3HKB E;  4CN4 A;  4IDP A;  4WYV A;  4X1I E;  3Q5X A;  4QX7 B;  4H9P C;  5L4H A;  5LA6 E;  4JI1 T;  3TLW A;  5LG3 A;  2X67 A;  2OV9 A;  5EK2 A;  2M67 A;  3LFM A;  2WZI A;  1W9R A;  3BQK A;  5HXH A;  3UQ7 A;  4AKI A;  5JDH A;  2H7V C;  3BQI A;  4PJL A;  4PAG A;  2MAW A;  3CPZ A;  2XSA A;  4G2A A;  4H9O C;  3U3I A;  4BAY B;  5HXS A;  4B3S T;  1XNR T;  4P09 A;  4LF9 T;  2H89 A;  3LK4 2;  4UV8 B;  4GIW A;  4O4H E;  5BMV E;  2CPT A;  3NZP A;  1BR4 A;  2VQF T;  3LK2 B;  4IDZ A;  2HPL A;  1I94 T;  2V7I A;  1MIY A;  4JUY A;  2CMR A;  4BJM A;  4EAH A;  1SA0 E;  2VUR A;  2W0G A;  2WDV A;  4UVA B;  4TNV A;  4GKJ T;  4CI1 B;  2BS2 A;  2YU2 A;  3GA8 A;  2ZLY A;  1MNE A;  2MYS A;  4CXX A;  3NRY A;  2DWG A;  4EGW A;  3UU3 A;  5FXX A;  4AQF C;  4PNI A;  4AKH A;  1IJ5 A;  3H3M A;  4OK0 A;  4TNW A;  5LNK A;  2UXN B;  3S4U A;  2HN1 A;  4U72 A;  4DUY T;  2UUA T;  1UX4 A;  1HNW T;  1WR0 A;  5LG4 A;  3Q5D A;  3PUZ F;  2D0U A;  2UUB T;  3MAC A;  2H88 A;  3F57 A;  1OED A;  3AEF A;  2QA7 A;  2XAG B;  4KP3 C;  4BA9 A;  2C5J A;  3MK7 C;  4H9S E;  2XAQ B;  1VRB A;  3NVO A;  4UEL A;  4DR2 T;  3ZN1 B;  2XHE B;  3AE6 A;  3I0Q A;  3A5X A;  3CQG B;  3MXZ A;  5ETW A;  1MMA A;  1FMV A;  4TWH A;  4IE7 A;  2E9X A;  4A98 A;  3AB3 B;  2Q9Q A;  3O4X E;  4XBF B;  5JDQ A;  2L3L A;  1QUU A;  1CUN A;  3I1A A;  4A5X A;  1KNP A;  4HFE A;  2VB6 A;  1WYB A;  4WBO A;  2XUE A;  3HR0 A;  3P50 A;  4IT4 A;  4DV5 T;  2WU2 A;  4DMV A;  1I6Z A;  3ZYK A;  3VU7 H;  4DR5 T;  5AQM B;  4ERR A;  1N36 T;  4X65 T;  5L3E B;  5GON E;  4JI0 T;  2V6X A;  4QKN A;  3PDY A;  4GYS A;  2E2A A;  4IDQ A;  3KBT A;  2D9D A;  2IHR 1;  4Z91 A;  5L4E A;  2MOZ A;  2JPF A;  2WBL A;  3PUQ A;  4DV1 T;  3DJB A;  2JQH A;  3OVU A;  3J7Y q;  1XZY A;  2YU1 A;  4AQF A;  3O1J A;  3EDU A;  3RI5 A;  4KX6 A;  2LHR A;  5JDG A;  3AAA B;  5HYA A;  1LVK A;  4O2A E;  2VWA A;  5F5W A;  4IDN A;  1AJ3 A;  2UXX B;  1KF6 A;  3FXD B;  3A8Y C;  4ILU A;  2VK9 A;  4ILA A;  2W2U A;  5IUX A;  4MLK A;  1HTJ F;  3A7M A;  5FY0 A;  3OJA A;  3RC8 A;  4P1N A;  2JQQ A;  2RPA A;  4U7I A;  2W63 A;  3Q2M A;  3CIR A;  1M62 A;  2DI4 A;  3ANW B;  5HEH A;  3ZMV B;  3AAE B;  4LFC T;  3GN5 B;  2H7O A;  3RYF E;  2QRX A;  4YT0 A;  4OHF A;  2CA5 A;  5JDF A;  4TUY E;  2ODV A;  1XDP A;  5LGT B;  4YTN A;  5J0Z A;  3NRX A;  4HKA A;  4JI7 T;  3RRW A;  3I9Y A;  5IWA T;  3KDS E;  5AQI B;  1YD8 G;  1HR0 T;  1IJ6 A;  2BKN A;  2IUB A;  3X1D A;  5AFU L;  2XAH B;  3KV5 A;  2KIN B;  5JDN A;  3ZYL A;  3SS1 A;  3PUS A;  3SOL A;  1UCU A;  4UF0 A;  4GYR A;  2YDS A;  3WAJ A;  4HWC A;  4U74 A;  3UT5 E;  3C98 B;  5LHH B;  2K9A A;  5FY7 A;  5EK3 A;  5AQF B;  5JDM A;  1QSD A;  1GQE A;  2WMO A;  3EI0 A;  2QGS A;  1UX5 A;  1H7C A;  3T8O A;  4LML A;  1Z0P A;  3N9Q A;  4YSZ A;  1W09 A;  4DV0 T;  5LCY A;  1W0B A;  3ZJ1 A;  3UU8 A;  1JNR A;  4N78 D;  4YJ3 E;  2Y8D A;  2K5B B;  2PG8 A;  4QXB B;  3RPU A;  4ZI3 D;  3N2O A;  3L39 A;  5KMG P;  3AE4 A;  3O1H A;  1XDO A;  3AE9 A;  2E9X D;  3PUG A;  1VOM A;  2WSS V;  1XWM A;  5HWX A;  3FBL A;  2Q9Q D;  2E5L T;  3ZC0 A;  4YSY A;  3AE2 A;  5HEJ A;  1ZOY A;  4F8H A;  5FVL A;  3UUN A;  4I4T E;  1ZHC A;  4P0A A;  4DV2 T;  2CBJ A;  3LK3 B;  2V6Y B;  2MPK A;  4NXN T;  1Z8U A;  1E7P A;  2FBW A;  2I59 A;  1ZV4 X;  5E0O A;  2HH7 A;  2YEV C;  3CML A;  5FVK A;  3AA1 B;  5FNV E;  4X62 T;  4KMC A;  2ZMA A;  5F3J A;  3AA7 B;  1OXZ A;  3AEA A;  5FXW A;  2J4G A;  3CWZ B;  4IE5 A;  3E22 E;  3N9L A;  2CXL A;  2JRK A;  3LSV A;  2HN2 A;  4ZEY A;  4LFB T;  1D1A A;  2CEA A;  4DVD A;  1BR1 A;  2XQ7 A;  3PU8 A;  4QH5 A;  2XY8 B;  3P4S A;  3RKO A;  4PFO A;  4ZOL E;  5JRC A;  2N2N A;  5EK4 A;  4LF4 T;  1OED C;  1U5P A;  4X5T A;  5A1L A;  5LMU T;  2M6B A;  1SE7 A;  3LBX B;  3FZM B;  2Y6X A;  2UUC T;  3OYZ A;  2BVL A;  3D0T A;  4L9I A;  3AEB A;  1WFD A;  3EHZ A;  1L0V A;  2V26 A;  4TV9 E; 
#chains in the Genus database with same CATH homology
 2EHO D;  3MAC A;  4IE4 A;  1T98 A;  2ZM2 A;  1KK7 A;  3F57 A;  2XAJ B;  1D0X A;  3N9O A;  3ZMS B;  2E9X C;  2JMH A;  2LM9 A;  4Z8X A;  3I0O A;  2QA7 A;  2XAG B;  4KP3 C;  4BA9 A;  3C50 A;  2ACX A;  3E0Z A;  1X79 A;  3F2E A;  3VKH A;  2C5J A;  4IGU A;  2Q9Q C;  3MK7 C;  4FI5 A;  4H9S E;  2XAQ B;  5H6R B;  1VRB A;  2VAS A;  4I43 B;  2JJ9 A;  4GOU A;  3OBV E;  3ZEF B;  5HXR A;  4UEL A;  3ZN1 B;  4V1A v;  2XHE B;  4MAL A;  2Q9Q B;  3C4X A;  3I0Q A;  2C0S A;  3A5X A;  3CQG B;  2LSJ A;  3MXZ A;  5ETW A;  1MMA A;  4WW0 A;  1FMV A;  2KLQ A;  3BK9 A;  3LG7 A;  2CXD A;  3N9N A;  4EXT A;  4UVB B;  1D0Y A;  4IE7 A;  5JR9 C;  2L8K A;  2E9X A;  3I9W A;  3N2K E;  4IE6 A;  1BR2 A;  5JQG E;  4KUM B;  4DND A;  3N9P A;  1ZEE A;  3QC9 A;  2ES0 A;  4O2B E;  4CQI A;  4YFS A;  2X9W A;  2C5I T;  4GK0 E;  3AB3 B;  4H9R C;  2IW5 B;  3R6N A;  3RX6 A;  2Q9Q A;  3ZLI A;  4PK4 A;  4HN9 A;  3CQX C;  3O4X E;  2XTL A;  1HF8 A;  1FIO A;  5IHY A;  5JDL A;  4XBF B;  2NOX A;  5JDQ A;  2L3L A;  1QUU A;  1CUN A;  4PK5 A;  1MMG A;  3I1A A;  1LVF A;  3F31 A;  3PE0 A;  5ADX L;  1HG2 A;  2PFV A;  5LHG B;  4AKR B;  4ZS2 A;  3GWH A;  2VB6 A;  1WYB A;  4CZZ B;  1YKH B;  2Y48 B;  4AKL A;  3AAI A;  2YK0 A;  3E08 A;  1FMW A;  3B57 A;  4QX8 B;  5JR9 A;  4NUV A;  4WBO A;  3SWH A;  3VKG A;  2XUE A;  3HR0 A;  5HXC A;  3AA0 B;  4X1Y E;  4CI2 B;  1ZKE A;  1MMN A;  4DMV A;  3GN5 A;  3IF8 B;  2LSY A;  3ZCJ A;  3ZYK A;  3VU7 H;  4I50 E;  3K3Q C;  5LYJ E;  1MMD A;  4QWN B;  4O4L E;  5KX5 E;  2OA5 A;  4KBM B;  4ERR A;  4E7Z A;  2LSK A;  3KV9 A;  2NW7 A;  4HGA A;  3ETU A;  3V5U A;  4H63 V;  3MJX A;  4EIW A;  4IIJ E;  5HWY A;  2NTX A;  5L3E B;  5KDM C;  4CI3 B;  3EDV A;  2A72 A;  5GON E;  2X66 A;  4A56 A;  3C64 A;  3Q9D A;  4HFV A;  1O3X A;  4YLH A;  3N9M A;  5FYM A;  4DBR A;  4QKN A;  2NTY A;  4FJO A;  5FP3 A;  3RYI E;  1KNZ A;  3PDY A;  5H6Q B;  2LEH A;  4GYS A;  2KZ7 B;  3W15 B;  3KBT A;  2A2F X;  2CLY C;  2X9H A;  3P7I A;  3HA4 A;  3C4Z A;  4HTE A;  2K24 A;  4UVC B;  2D0T A;  4PK6 A;  2VL8 A;  4MFR A;  1EZ3 A;  3O9X A;  2D5U A;  1B7T A;  1WRD A;  3JC6 C;  3ZJ2 A;  2EHO C;  2MOZ A;  1HCI A;  2KWI B;  4DMW A;  1HG5 A;  5L3F B;  1BR0 A;  1WYC A;  2JPF A;  3UTK A;  2WBL A;  3GMI A;  3PUQ A;  3DJB A;  3WI3 A;  3FHN A;  1S35 A;  3J7Y q;  2EHO B;  2YU1 A;  3AVR A;  3LJC A;  3NBX X;  5EZY E;  4AQF A;  3O1J A;  3DTO A;  3EDU A;  2VKO A;  3N2G E;  3BQL A;  3ZMZ B;  3CVR A;  4PJN A;  4XZC A;  2D2S A;  2LHR A;  2KND A;  2X51 A;  3TKL B;  5FY1 A;  5J2T E;  3ZMU B;  5JDG A;  3AAA B;  5HYA A;  4IHJ E;  3KBU A;  1LVK A;  2E9X B;  5JVD E;  4OYK A;  4NUU A;  3H3A A;  4CXW A;  2EHO A;  2N9D A;  4O2A E;  2DCF A;  1V9D A;  3EUH A;  2VWA A;  1AJ3 A;  2W62 A;  2LSG A;  2UXX B;  4L0R A;  3ZN0 B;  3FXD B;  4E7S A;  4ILU A;  4EYY R;  3RH3 A;  4IE0 A;  2VK9 A;  4YHJ A;  2X9X A;  2WWU A;  4MLK A;  1HTJ F;  3IHR A;  1HS7 A;  4H63 H;  5FY0 A;  3OJA A;  4B6X A;  3RC8 A;  4QXH B;  4EB6 E;  2JQQ A;  4EOZ B;  4UV9 B;  3EVY A;  2KMF A;  1MIV A;  5L3G B;  3FB2 A;  2W63 A;  3MKD A;  3Q2M A;  5JR9 B;  5IYZ E;  2DI4 A;  1IZN B;  2RA1 A;  3CX7 B;  3ANW B;  4C90 A;  3ZYM A;  4L5G A;  3ZMV B;  2BDE A;  2DLR A;  3KIN B;  4TZ4 C;  3AAE B;  2NW9 A;  3GN5 B;  2K48 A;  2H7O A;  2X9Y A;  3RYF E;  3ZC1 A;  3KVB A;  4OHF A;  4AQG A;  4GK5 E;  4ANJ A;  5FMN A;  4DBQ A;  2CA5 A;  5LBQ B;  5JDF A;  2DHR A;  3ESL A;  2C5K T;  2A3D A;  5F8P A;  4TUY E;  3VHL A;  2ODV A;  2W61 A;  3V5S A;  5HAX A;  5HXE A;  5L3B B;  2G0U A;  3ANW A;  2DNX A;  3RRC A;  3U78 A;  4WNK A;  1WR6 A;  3IBP A;  5LGT B;  2LHN A;  4TN7 B;  3C51 A;  4JLE A;  3IEE A;  4JEH B;  4PFP A;  4AXP A;  5L2L A;  4BJN A;  3NRX A;  2LT3 A;  2ZM0 A;  3AVS A;  3QUJ A;  2Z6E A;  5LBM A;  4HKA A;  5C8Y E;  3HI2 A;  5LOV E;  2V7M A;  2HPJ A;  2IC6 A;  2V7K A;  4H9Q C;  4O4I E;  3J9X 1;  4UF0 B;  4O8S A;  3R84 B;  3RRW A;  5L3C B;  3I9Y A;  3UUM A;  3KDS E;  1LKX A;  1YD8 G;  3MZK B;  4ZI2 D;  4EZ4 A;  1IJ6 A;  1FEW A;  5AFU L;  2V1D B;  2XAH B;  3KVA A;  2ZM8 A;  2KXP B;  3RC3 A;  3KV5 A;  2KIN B;  4AKG A;  4EYU A;  2NW8 A;  2VKD A;  5LP6 E;  4X20 E;  5JDN A;  4UXN B;  3ZYL A;  2DWK A;  3SS1 A;  3PUS A;  4BJM A;  1D0Z A;  3M65 A;  3CX6 B;  4ZHQ E;  3SOL A;  1UCU A;  1NAF A;  4UF0 A;  3CX8 B;  4XAX B;  4AI6 A;  2V7L A;  3C4W A;  4GYR A;  5DQV A;  2BZB A;  3WAJ A;  3AA6 B;  4U74 A;  4CXY A;  4ZS3 A;  5DQW A;  3UT5 E;  5FXV A;  1US7 B;  2LOS A;  5JH7 E;  4DO0 A;  2NP9 A;  3P8C D;  3OKQ A;  3C98 B;  1G73 A;  3PU3 A;  5CA0 E;  5DAB A;  5LHH B;  3K3O A;  4JEU B;  2K9A A;  3HL6 A;  1WLX A;  5FY7 A;  2CLY B;  3PUA A;  5EK3 A;  3CQC B;  3UUL A;  2H3R A;  5JDM A;  1QSD A;  2LJL A;  2WMO A;  3L09 A;  3PTR B;  1HX8 A;  2QGS A;  3O1I A;  1UX5 A;  2E8I A;  2RP4 A;  4G63 A;  1H7C A;  3K8P C;  3T8O A;  3WAK A;  4HE8 A;  4PJJ A;  4EZH A;  5CB4 E;  1Z0P A;  3N9Q A;  1U4Q A;  2WM9 A;  4MHC A;  3ZMT B;  3QK6 A;  3KV4 A;  5LCY A;  3ZJ1 A;  2VKH A;  3KV6 A;  3NZQ A;  4N78 D;  4ZI3 C;  3ZPO A;  1LRZ A;  2Y8D A;  4YJ3 E;  3HKE E;  5M4Y A;  2K5B B;  2PG8 A;  4QXB B;  3RPU A;  4ZI3 D;  4ZI7 E;  3RYH E;  3OYX A;  4X1K E;  3N2O A;  3ETV A;  3HKB E;  2BVM A;  5KMG P;  5J2U E;  2JMK A;  5CA1 E;  4P0B A;  1SHZ C;  3O1H A;  4X1I E;  3Q5X A;  4J2C A;  2PJQ A;  4QX7 B;  2E9X D;  4H9P C;  3PUG A;  1HFA A;  2CCQ A;  1VOM A;  3B13 A;  2WSS V;  5LHI B;  3KFW X;  4QHO A;  1Y64 B;  2CE7 A;  3DP7 A;  4HEA A;  1YW0 A;  5LA6 E;  5TAO A;  5LXT E;  5HWX A;  2N1G A;  3FBL A;  3HKC E;  4OFZ A;  2Q9Q D;  3ZC0 A;  4F6R C;  4OYJ A;  2ODU A;  2LE8 A;  2X67 A;  3FXE B;  5EK2 A;  2M67 A;  3LFM A;  1OWA A;  2VKJ A;  3BQK A;  5HXH A;  3UUN A;  5L3D B;  1S94 A;  4I4T E;  1ZHC A;  4AKI A;  4O4J E;  2SPC A;  4P0A A;  3MA9 A;  2XAF B;  2XQY A;  3LK3 B;  2CWY A;  1IAP A;  3PUR A;  5JDH A;  2H7V C;  3BQI A;  3FBZ A;  2LOP A;  4PJL A;  2V7J A;  3Q5W A;  4PAG A;  3CPZ A;  4JUY A;  4IST A;  4UEM A;  4G2A A;  4H9O C;  3U3I A;  4BAY B;  5HXS A;  5LGN B;  1MND A;  4ZI2 C;  2I59 A;  2WAU A;  4QXC B;  4P09 A;  4MBQ A;  1ZV4 X;  5E0O A;  3LK4 2;  4UV8 B;  1YKE B;  5DJQ C;  4GIW A;  2HH7 A;  2YEV C;  4O4H E;  3CML A;  5BMV E;  3NZP A;  3AA1 B;  1BR4 A;  4PJM A;  4TV8 E;  5FNV E;  3L3P A;  3LK2 B;  4IDZ A;  4KMC A;  2B1E A;  2ZMA A;  3ZCI A;  5F3J A;  2HPL A;  3AA7 B;  2XAS B;  1OXZ A;  5FXW A;  2V7I A;  1MIY A;  4YJ2 E;  3CWZ B;  4IE5 A;  2CM0 A;  2CMR A;  2P9B A;  2GK9 A;  2CXL A;  2L9Q A;  2MTQ A;  3E22 E;  3N9L A;  1SA0 E;  4UIG A;  2JRK A;  4ADZ A;  4EAH A;  3RYC E;  2KWH A;  2W0G A;  4UVA B;  2CXF A;  5JRC B;  5LJN A;  2X68 A;  3H37 A;  4K0U A;  1D1B A;  2NWB A;  4WBN E;  2X0L B;  3UFE A;  5J1G A;  4CI1 B;  3K3N A;  2YIN A;  1D1A A;  4ASK A;  2CEA A;  5LGU B;  3ONX A;  4DVD A;  2CWO A;  1NWM X;  2YU2 A;  1BR1 A;  3GA8 A;  2ZLY A;  3PU8 A;  2J1D G;  1MNE A;  4I55 E;  2MYS A;  4CXX A;  5LJM A;  3NRY A;  3RKO A;  4PFO A;  4ZOL E;  5JRC A;  2N2N A;  2DWG A;  5FXX A;  1D1C A;  1G8X A;  5EK4 A;  4AQF C;  4PNI A;  2PBI A;  4AKH A;  1IJ5 A;  4OK0 A;  3SRZ A;  1U5P A;  2IAK A;  5A1L A;  4C91 A;  5LNK A;  2UXN B;  5JRE A;  3S4U A;  3LBX B;  3N5L A;  2Y6X A;  2KT9 A;  4U72 A;  3OYZ A;  2BVL A;  4ISS A;  3D0T A;  4M1P A;  4PW8 A;  4TX5 A;  1UX4 A;  4L9I A;  3HKD E;  2WMN A;  3UUX B;  5LG4 A;  2IC9 A;  2W00 A;  2LSI A;  1E1H B;  2D0U A;  1MIW A;  4H9N C;  4TV9 E;  5FXZ A;  3JC6 D;  2MBG A;  2V26 A;  3LBX A;  3CKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...