3FXDB

Crystal structure of interacting domains of icmr and icmq
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
VTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein IcmQ
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Unknown function
total genus 24
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fxdB00
2X9WA 1IJ6A 1H7CA 4EYYR 1QSDA 3FXDB 3CVRA 4CQIA 1Z0PA 1LVFA 2MBGA 1LRZA 3L3PA 1IJ5A 1ZKEA 2C5IT 4DNDA 3CKDA 4L0RA 3P7IA 2KWIB 3QK6A 3S4UA 3N5LA 2KWHA 3QUJA 4B6XA 2IC9A 2X9YA 2XTLA 4J2CA 2X9XA 2CA5A 2K48A 2C5KT 4FI5A 2IC6A 2G0UA 3MXZA 2C5JA 3FXEB 3TKLB
chains in the Genus database with same CATH superfamily
2JMKA 5CA1E 4EOZB 1N34T 5KMGP 2DL1A 1FEWA 1FJGT 1U4QA 4ZHQE 2PFVA 4GYRA 3VR8A 3AE5A 4COFA 3MXZA 2D5UA 3PUGA 5ETWA 2E9XD 1CHUA 1I6ZA 3HKCE 3AECA 4JI8T 4ZI3C 5HEUA 3FB2A 5FY7A 2CXDA 4QXBB 4X65T 2CLYB 4YJ2E 4JI1T 2EHOB 4LFBT 3ZT6A 2UXBT 4P1NA 2WB5A 2PBIA 4H9OC 1R8IA 5C8YE 5M4YA 3RIUC 1HNZT 4I55E 4HFDA 3PV0F 3ZMZB 3EABA 5AQRB 5FXZA 2W00A 1ZKEA 3RQUA 3TLTA 2CRBA 3LSVA 2VVSA 5F5WA 2Y6XA 4IE4A 5FNVE 3UTKA 4YJ3E 3RGLA 2D9DA 2X68A 2CWYA 1J1JA 4BJMA 2ES0A 5AQGB 4DR4T 4DV2T 5CGMA 3R84B 4UV9B 5AFUL 3E0ZA 3A5XA 4AKRB 4JI7T 3AE6A 1OWAA 3QB5K 2OV9A 2YDSA 3RYHE 3C4WA 5HXCA 2LHRA 1SUMB 4AISA 3P4PA 5H6QB 2K24A 1ZHCA 4HEAA 3PU3A 4L9IA 2I0MA 1D1CA 3Q5EA 1OXZA 4IL4A 4HE8A 3EDUA 3LBXB 4I43B 4MHCA 2DWGA 3RC3A 4AKIA 5ABFA 2JQHA 3CX6B 5BMVE 5LXTE 2WU5A 1HNWT 3U3IA 4TUYE 4U7YA 4ANJA 3BQIA 4GYSA 2KT9A 4DV3T 4DR3T 4ILUA 2WDRA 3TLVA 5HCMA 2X0YA 5L2LA 4OHFA 4O2AE 3KV4A 2LM2A 4EAHA 4O4JE 5JDHA 2ZM0A 4ZI3D 4OX9T 1D1AA 5JDQA 4GKKT 4EV6A 2W67A 4UR9A 3LK2B 4HN9A 4PNIA 1UX5A 3CK6A 2V5DA 3KV5A 2BVMA 3AEFA 5JDFA 3RH3A 4OFZA 2IHR1 2XHEB 1HR0T 3FHNA 4EYYR 4YTPA 4ZZCA 3C64A 5LGUB 4DMWA 2QGSA 3X1DA 2WSSV 1MIWA 4H9PC 5EK3A 3AA6B 1OEDC 3EI0A 5JDGA 2BDEA 4UXNB 3WAKA 1XNQT 1UUSA 4C91A 2BS3A 4JI3T 3A7MA 1SHZC 3ABVA 3QNUA 3AEEA 3L8RA 2QRXA 2J47A 5CB4E 2NOXA 4TV8E 3I1AA 4MLKA 4QX7B 5L4HA 2G0UA 3ZYMA 3KVBA 3BK9A 4YTNA 2ZM8A 2V7MA 3KINB 4K0UA 3CQXC 3BQLA 2ODUA 5LJMA 3MK7C 2ODVA 3IHRA 3Q9DA 3AE4A 5ABEA 3ZYLA 5C2TA 1UK5A 5AQHB 2A3DA 1N36T 3LG7A 4IDPA 3ETVA 3CMLA 2FBWA 4I4TE 4DVDA 2KWHA 4EB6E 2VWAA 2RPAA 2XPKA 1GQEA 2XQ7A 2I6HA 3DJBA 4DBRA 1MIVA 2EHOA 2BG9E 3PUAA 5AQJB 3OJAA 2XAHB 5AQLB 2JQQA 5AQFB 1HG5A 2ACXA 4KMCA 1MMGA 2LT3A 3AB3B 3RHWA 1HFAA 2WDVA 3Q5WA 3UU4A 5A1LA 2KLQA 5LG3A 5HYAA 4IE0A 3T1YT 4LF4T 4UEMA 3OKQA 3PUZF 1FMWA 3W15B 4TZ4C 3K1SA 4YSYA 2E5LT 5FL0A 3AXJB 2FUPA 1IAPA 1HX1B 2HN2A 2MPKA 2YDRA 5C3JA 4H9NC 5LHIB 3QK6A 2JMHA 3N9PA 5J0ZA 4JI2T 3ZCJA 2WY2A 3SFDA 4EIWA 5ABGA 4ISTA 4KP3C 2CXLA 2K9AA 2WDQA 2XQYA 1UURA 3RPUA 3NZPA 5KXJA 2YU1A 1IBLT 4QWNB 2BKNA 2K5BB 1T72A 2CM0A 2J62A 1KF6A 2P9BA 2CXFA 3ZMUB 1LKXA 2CWOA 3UFEA 2MBGA 2JRKA 5AQPB 5AQNB 3LBXA 3FZLB 3HA4A 3UUMA 3S4UA 3EAMA 1YQ3A 4ISSA 4P09A 2Q9QD 1ZP0A 1Z8UA 2CHOA 4L5GA 4QXCB 1LRZA 3KVAA 4YSZA 1IJ5A 3F2EA 3RI5A 2BBHA 3ZN0B 3GMIA 3B5MA 4JI5T 4WZXA 3FBZA 3EVYA 1YXRA 4ZEYA 3TLUA 4YY3T 2M67A 4DUYT 1FIOA 4CI1B 3FXDB 2N9DA 3ZSSA 4X62T 3QOFA 2IAKA 5AQUB 2LOPA 5AQQB 5LB7B 4EXTA 5LCYA 2GK9A 3ZEFB 3L09A 4WBNE 4B3MT 2XQ3A 3KV9A 2WS3A 4DV7T 2CA5A 4GKJT 1ZEEA 1WLXA 3CX8B 1UX4A 4HFEA 3CQGB 2W63A 3P8CD 2QYWA 5L3DB 3OBVE 1W9RA 3LDQB 2WBLA 5HEHA 4H9RC 3C50A 3CQCB 3PUXF 5FL1A 3J9X1 3HR0A 1T7SA 2W4XA 1YW0A 2J1DG 1XNRT 3IBPA 1JNRA 3ZMSB 1BR1A 3PU8A 4WBOA 2HH7A 2V7IA 2CMRA 4CI2B 4LF5T 5LBQB 2HHHT 4GIWA 4IDZA 1YKHB 3FBLA 1XDPA 5AQOB 4UVAB 3ZPOA 2UXDT 3JAFA 1IJ6A 2VL0A 3PE0A 3E22E 2JIWA 1W09A 4TWDA 1Y01A 1HX8A 4HTEA 2XZEA 1WRDA 2LRLA 4HFCA 3KBTA 3ZC0A 5HEOA 4UIGA 5GONE 2Z6EA 2IC9A 2X9YA 4JI6T 4TWHA 3MZKB 2A72A 2NW9A 5LA6E 3FZFB 1MMAA 2MAWA 3V5UA 4IE7A 2LLYA 4B6XA 2JJ9A 1W0AA 3IA3A 3IEEA 1UGOA 3ONLC 2V1DB 4MALA 3HKBE 5LGNB 2XASB 2KWIB 2YINA 2VQFT 3LFMA 3UT5E 2V5CA 3ZYKA 3J7Yq 2YDQA 2C5JA 3CWZB 4O8SA 4LFAT 5JDMA 2V7KA 5L3EB 3RF1A 3AVRA 3UU3A 5ADXL 2H7VC 3AA0B 1ZV4X 3F31A 3T8OA 2EHOC 3H37A 2NW7A 3UUBA 5IHYA 2CEAA 4AXPA 4HWHA 5LHHB 4DIDB 2X9HA 5JR9A 3RYFE 2NR4A 2HPLA 3MA9A 4ILCA 3AXJA 1HNXT 2CCQA 4IE5A 1XZYA 4X64T 2L9QA 3K3NA 3HI2A 2LEHA 4Z91A 4X66T 2E5VA 2F4VT 4BA9A 5FVLA 4LF9T 4LMLA 3Q5XA 4U74A 3UUXB 3ZMVB 1MNDA 2ZMAA 4ZOLE 5EK4A 4E7SA 1WYBA 3EDVA 4UV8B 3Q2MA 2MTQA 2X0HA 2HN1A 3VRAA 2VASA 3ANWB 3I0QA 4JI4T 4YHJA 2H7OA 1VCSA 2C5KT 1NENA 4LF7T 4OK0A 3N5LA 4U7IA 4NIQA 3RX6A 3AEGA 2QA7A 2BKPA 5IWAT 4YHHT 2YOEA 4KHZF 3BQKA 4A98A 4AI6A 4B3ST 2A9UA 5FMNA 2BG9B 2YU2A 3JADA 2L3LA 4UVBB 3WAJA 1WYCA 2QVAA 4DUZT 4HWIB 3VU7H 4DV6T 2DHRA 5HEGA 4DR6T 4H63V 5LOVE 1T8BA 5LYJE 3AE7A 3CPZA 2CBJA 3L3PA 3K3QC 3CIRA 4YFSA 2VQET 3CX7B 3AE3A 4I50E 1S94A 1SA0E 4FI5A 4JI0T 3B57A 3Q5DA 5HXRA 1E2AA 5DQVA 3AE2A 1E7PA 4DR2T 2WU2A 4B3TT 3VR9A 2CE7A 4E7ZA 4QH5A 4G63A 1MMDA 2WWUA 1YKEB 2CBIA 4YT0A 2AE9A 2Q9QC 4EZ4A 2ZM2A 4A5XA 2XAFB 3RRCA 2EHOD 4ILBA 4DV1T 2BS2A 4JUYA 5HXSA 2UU9T 3AVSA 2KZ7B 4OYKA 4DO0A 3NVOA 2IIUA 4PJLA 2ZM6T 1QUUA 4U3CA 3P4WA 5CA0E 3C98B 4ZS2A 4DMVA 1X79A 5LNKA 4ZZBA 2NTYA 2BBJA 2MOZA 2DI4A 2XSAA 3FZHB 5DQWA 1B7TA 5AQMB 4DV5T 3PJAA 1BR0A 3OTOT 4N78D 2FJAA 3PURA 4CN6A 3OPCA 5AQKB 4AQGA 1XMQT 3SWHA 5HAXA 3I9YA 2BZBA 2E9XB 4LF8T 2YN6A 3UULA 4KHPT 2VL8A 1VRBA 4LFCT 3AEBA 2B76A 5LP6E 2L8KA 2Y48B 4GOUA 3P4QA 4AQYT 4EYUA 2XQ8A 4U31A 5LGTB 4EEBA 4NPPA 3D0TA 4LMKA 2IUBA 5E0OA 1D0XA 4V1Av 5L3CB 5HWYA 5HXEA 4IGUA 3KBUA 4M1PA 5L47A 3I9WA 2IDOB 4AIUA 1DU2A 4I0UA 3ZJ1A 1WR6A 4EZHA 1O3XA 2YKSA 2WQYA 1N32T 5DABA 3RC8A 2H3RA 2C0SA 2VURA 4AKGA 2V7LA 4PK6A 3E08A 4DV4T 3ZT5A 4DBQA 3MACA 5AQVB 2LSGA 2WP9A 4JYAT 1BR4A 4QX8B 2W66A 5JR9C 2WZIA 1NWMX 4U2ZA 1N33T 3ANWA 3AA7B 4KI0F 3HKEE 2UUAT 2X9XA 4O4LE 3C4XA 5ABHA 3AAIA 4AKHA 3GN5B 5JH7E 3AAEB 3WI3A 5TAOA 5LHGB 2ACZA 4XBFB 4CXYA 5FY0A 3R6NA 5LJNA 2UUBT 5JTGA 3UQ4A 2BG9A 4NUUA 3ZC1A 2X9WA 1IZNB 1US7B 1HG2A 5LG4A 3ZJ2A 2XM1A 3RYCE 4ERRA 2XY8B 1E1HB 3O9XA 4TWFA 5FXVA 4NUVA 4YSXA 4PJMA 2CPTA 2LM9A 4XAXB 2W61A 1D0ZA 3CVRA 3ONXA 3VKHA 2OA5A 4H63H 4B3RT 4CXXA 5IUXA 2D0TA 4O4IE 3PUQA 5F3JA 2XQ5A 3AA1B 4BAYB 4PAGA 3LJCA 3T1HT 5CFBA 5JDLA 3RKGA 5AQSB 4IREA 3SRZA 4JEUB 4PK5A 3ZMTB 3NRYA 3UFGA 2XAJB 3M3ZB 4QH1A 3KV6A 3V5SA 2YK0A 1WFDA 1J5ET 5JRCB 3RYIE 4HWDA 2LSKA 2W0GA 3QB5A 4HWFA 2E2AA 3NKZA 4BJNA 3P4SA 4IIJE 4IL9A 3MJXA 3RQWA 3AAAB 4A56A 2XAGB 3QC9A 1T98A 3PUWF 5L3GB 2XQ4A 3IF8B 3LK3B 4HFBA 3NWIA 3FZKB 2JQ9A 3H3MA 5FYMA 4HKAA 5BR8T 4H9QC 2HPJA 5FKYA 3TLWA 2JPFA 3O4XE 4DV0T 1UCUA 4QKNA 4Z8XA 4NXNT 1VOMA 1WCRA 4IDQA 4P0BA 3C4ZA 1NAFA 2WMOA 2NW8A 3AE9A 2NTXA 3O1IA 2BKOA 3O1JA 4IDOA 4CXWA 3ONJA 2RA1A 2E9XA 4U72A 3TKLB 1H7CA 4IT4A 1MNEA 3ZT7A 4CN1A 2XQ6A 4GK0E 2CLYC 3N9LA 3UU6A 4AQFA 3DP7A 3P4RA 4X1KE 2PG8A 4OYJA 3ESLA 4KUMB 3KFWX 4X1YE 2NWBA 5J1GA 4XZCA 3M65A 3AEAA 4DNDA 5J2TE 1G73A 2VKDA 4UVCB 1NEKA 3OYZA 2BVLA 5DJQC 3F57A 5IYZE 3AE8A 4PFOA 4TN7B 4IE6A 3VHLA 4WNKA 1IBKT 4ASKA 2WMNA 4CN4A 4UF0B 5HEJA 3FZMB 1KFYA 4IDNA 1FMVA 4G2AA 5JVDE 4TV9E 2D2SA 4DR5T 2LHNA 5HCJA 1KNRA 2PJQA 3ETUA 3N2GE 4TNWA 4HWCA 5FY1A 4U33A 4H9SE 4X1IE 2X0LB 2XSBA 1U5PA 2LOSA 2X66A 2WM9A 4U2YA 3GN5A 4DR1T 4HFHA 1OEDB 4ZXLA 1AJ3A 1LVFA 2W2UA 4O2BE 2LKGA 3ZLIA 1HF8A 1HTJF 4MBQA 2N2NA 1X9BA 1HS7A 3SS1A 3RIAA 3QUJA 4KBMB 2XQ9A 2DWKA 2MYSA 2K3WA 3SFEA 3O1HA 4Q25A 4TX5A 3SOLA 5AQIB 5FVKA 3N9MA 3CKDA 4L0RA 1I94T 3P50A 2R6GF 2Q9QB 3JC6C 3EHZA 2BS4A 2DNXA 2VKJA 5FXWA 4ZI2C 3MKDA 4LF6T 4YTMA 2D0UA 4PJJA 1EZ3A 3I0OA 2J4GA 4LMJA 4DR7T 3ZSTA 4JV5T 2BG9C 4TNVA 3H3AA 3N9OA 5CJ5A 2VK9A 3AEDA 2ZLYA 2VB6A 2XTLA 2LSIA 2V6YB 5JDNA 1KNZA 3UUNA 2KXPB 2KSRA 4KX6A 2I59A 3PUVF 3N2OA 3OYXA 3PDYA 2V8SV 4HGAA 4JBWF 3RRWA 3U78A 5JRCA 4AKLA 2JQKA 4WW0A 4MFRA 2V6XA 5EZYE 3VRBA 4PW8A 2C5IT 2UUCT 4FJOA 3PTRB 4ZI7E 1W0BA 3PJAJ 4A97A 3ZN1B 4X5TA 3RIUA 5AQTB 1ZOYA 2LRKA 3N9NA 5JREA 1XWMA 1YQ4A 2UXXB 4EEDA 2KMFA 1JNZA 2DLRA 5JQGE 2OLTA 1OEDE 2FJEA 2CHNA 4HFVA 2LKHA 2X51A 1VCTA 3GA8A 1D1BA 4YXDA 5EK2A 1QLBA 3FXEB 2VVNA 2UXNB 1QSDA 2LJLA 2IW5B 3EUHA 4O4HE 2WWVA 2WZHA 4CI3B 2AXDS 2UXCT 5F8PA 3DTOA 3PUYF 2FJDA 4F8HA 2IC6A 2XM2A 2M6BA 2V26A 2WAUA 4PFPA 3L39A 4JLEA 4ZS3A 2N1GA 1BR2A 4QH4A 4X20E 2LSYA 3RKOA 1XDOA 2KINB 4QXHB 3A8YC 1SE7A 4CZZB 4EGWA 2M6IA 3HL6A 2K48A 1IBMT 2XQAA 5JR9B 2E8IA 3OVUA 1XMOT 1M62A 3G06A 3UQ7A 2E9XC 3JAEA 3JC6D 2IMLA 3JCFA 2V7JA 3NBXX 4ZI2D 4AQFC 5FP3A 5LMNT 3B13A 4GK5E 5H6RB 5LMUT 3TLSA 4K0KT 3RIFA 1G8XA 2H88A 4UF0A 5FXXA 2DCFA 4ILAA 2FJBA 2PTFA 1S35A 3ZCIA 2LE8A 4ADZA 2Y8DA 1D0YA 5ABFB 4P0AA 2WCAA 3AE1A 1KNPA 3N2KE 1M7KA 1MIYA 3UU5A 4CQIA 2VKHA 1Y64B 3ZKRA 5HXHA 4JEHB 2W62A 4NXMT 2NP9A 3GWHA 3PUSA 4C90A 5L4EA 4Z90A 1MMNA 5J2UE 3N9QA 4IHJE 1OEDA 1KK7A 1Z0PA 2H89A 2LSJA 5KX5E 2X67A 3HKDE 4HFIA 2XJ7A 2A2FX 3K3OA 1KEYA 2VKOA 2XUEA 3LK42 3P7IA 3UU8A 4WYVA 2XAQB 1YD8G 2Q9QA 2SPCA 5L3FB 1CUNA 1HCIA 2RP4A 5L3BB 4PK4A 5LBMA 1J5WA 4YLHA 2B1EA 1LVKA 4QHOA 5HWXA 3C51A 3KDSE 2KNDA 1V9DA 4UELA 4F6RC 3K8PC 3NRXA 1L0VA 3NZQA 4J2CA 2V6YA 4PJNA 1WR0A 3RLFF 2YEVC 3VKGA 5KDMC
chains in the Genus database with same CATH topology
2ZM2A 4UF0B 2JMKA 5CA1E 2XAFB 4EIWA 4ISTA 4EOZB 4KP3C 3RRCA 2CXLA 2EHOD 2K9AA 1FMVA 2XQYA 4G2AA 3RPUA 5JVDE 3NZPA 4TV9E 5KMGP 2YU1A 2D2SA 1FEWA 4QWNB 2LHNA 4JUYA 5HXSA 1U4QA 3AVSA 4ZHQE 2PFVA 2K5BB 2KZ7B 4GYRA 4OYKA 2CM0A 3MXZA 2P9BA 2D5UA 3PUGA 2PJQA 4DO0A 3ETUA 5ETWA 4PJLA 2CXFA 1QUUA 2E9XD 3N2GE 5CA0E 3ZMUB 3C98B 1LKXA 2CWOA 3UFEA 5FY1A 4ZS2A 2MBGA 4DMVA 2JRKA 1X79A 3HKCE 4H9SE 4ZI3C 3LBXA 4X1IE 5LNKA 2X0LB 3HA4A 3UUMA 3S4UA 3FB2A 5FY7A 1U5PA 2CXDA 2NTYA 2MOZA 4ISSA 2Q9QD 4P09A 2DI4A 4QXBB 2LOSA 2X66A 5DQWA 1B7TA 3VKGA 2CLYB 4YJ2E 2WM9A 3GN5A 4L5GA 1AJ3A 4QXCB 1LVFA 2EHOB 4O2BE 1LRZA 3KVAA 1BR0A 3ZLIA 1IJ5A 3F2EA 1HF8A 4N78D 3PURA 1HTJF 4MBQA 2N2NA 1HS7A 3SS1A 4AQGA 3ZN0B 3QUJA 2PBIA 4KBMB 3SWHA 3GMIA 5HAXA 2DWKA 3FBZA 3EVYA 3I9YA 4H9OC 2MYSA 2BZBA 5C8YE 2E9XB 3O1HA 5M4YA 2M67A 1FIOA 4CI1B 4TX5A 3FXDB 2N9DA 3SOLA 4I55E 3UULA 3ZMZB 5FXZA 2IAKA 2W00A 1ZKEA 3N9MA 2LOPA 3CKDA 2VL8A 4EXTA 1VRBA 4L0RA 5LCYA 2GK9A 3ZEFB 5LP6E 2L8KA 2Y48B 3L09A 4GOUA 4WBNE 2Q9QB 2Y6XA 4IE4A 5FNVE 4EYUA 3JC6C 3KV9A 4YJ3E 3UTKA 2DNXA 2CA5A 2VKJA 5FXWA 4ZI2C 2X68A 1ZEEA 2CWYA 5LGTB 1WLXA 3MKDA 3CX8B 1UX4A 4BJMA 3D0TA 2D0UA 4PJJA 2ES0A 5E0OA 3CQGB 1D0XA 1EZ3A 3I0OA 2W63A 4V1Av 5L3CB 3P8CD 5HWYA 5L3DB 3OBVE 3H3AA 2WBLA 3N9OA 5HXEA 4IGUA 4H9RC 3C50A 3CQCB 3KBUA 4M1PA 2VK9A 3J9X1 3I9WA 3HR0A 2ZLYA 2VB6A 1YW0A 2J1DG 2LSIA 2XTLA 3R84B 4UV9B 5AFUL 3ZJ1A 3E0ZA 1WR6A 4EZHA 1O3XA 3A5XA 4AKRB 5JDNA 1KNZA 5DABA 3RC8A 1OWAA 3UUNA 3IBPA 2KXPB 2H3RA 3ZMSB 2C0SA 1BR1A 2I59A 3PU8A 3N2OA 4WBOA 2HH7A 2V7IA 2CMRA 4CI2B 3OYXA 5L3FB 3RYHE 4AKGA 5LBQB 3PDYA 2V7LA 4GIWA 4PK6A 3E08A 4IDZA 1YKHB 3FBLA 4HGAA 3C4WA 5HXCA 2LHRA 3RRWA 3U78A 5JRCA 4AKLA 5H6QB 2K24A 1ZHCA 4HEAA 4UVAB 3ZPOA 4DBQA 3MACA 3PU3A 4WW0A 1IJ6A 3PE0A 2LSGA 4L9IA 4MFRA 1D1CA 3E22E 1BR4A 4QX8B 5EZYE 4PW8A 2C5IT 1OXZA 4HE8A 1HX8A 3EDUA 4HTEA 5JR9C 3LBXB 4FJOA 1WRDA 3PTRB 4ZI7E 3KBTA 1NWMX 4MHCA 4I43B 3ZC0A 2DWGA 3RC3A 3ANWA 3ZN1B 4UIGA 3AA7B 4AKIA 5GONE 3HKEE 2Z6EA 2IC9A 2X9YA 3N9NA 2X9XA 3MZKB 5JREA 4O4LE 2A72A 3CX6B 3C4XA 2NW9A 2UXXB 3AAIA 5LA6E 5BMVE 4AKHA 3GN5B 1MMAA 5JH7E 2KMFA 5LXTE 3AAEB 3WI3A 3U3IA 4TUYE 2DLRA 3V5UA 5TAOA 4ANJA 5JQGE 3BQIA 4GYSA 5LHGB 2KT9A 4IE7A 5EK3A 4XBFB 4HFVA 4CXYA 2X51A 5FY0A 3R6NA 4ILUA 5LJNA 4B6XA 2JJ9A 3GA8A 1D1BA 5EK2A 5L2LA 4OHFA 4O2AE 3KV4A 3IEEA 3FXEB 4EAHA 4NUUA 3ZC1A 2X9WA 4O4JE 1IZNB 2UXNB 5JDHA 1QSDA 1US7B 1HG2A 2LJLA 2ZM0A 4ZI3D 2IW5B 5LG4A 1D1AA 5JDQA 3EUHA 2V1DB 3LK2B 4O4HE 3ZJ2A 4HN9A 4PNIA 1UX5A 4MALA 4CI3B 3RYCE 3HKBE 5LGNB 2XASB 3KV5A 4ERRA 2BVMA 2KWIB 2YINA 5F8PA 5JDFA 3RH3A 4OFZA 3DTOA 1E1HB 3LFMA 3O9XA 3UT5E 2XHEB 3ZYKA 3J7Yq 2IC6A 5FXVA 4NUVA 2V26A 2C5JA 4PJMA 3CWZB 4O8SA 2WAUA 3FHNA 4EYYR 2LM9A 4XAXB 5JDMA 3C64A 2V7KA 4DMWA 2QGSA 5LGUB 2W61A 1D0ZA 2WSSV 3CVRA 4JLEA 4PFPA 3ONXA 1MIWA 4ZS3A 5L3EB 2N1GA 1BR2A 3AVRA 4X20E 3VKHA 4H9PC 2OA5A 4H63H 5ADXL 4CXXA 2LSYA 3RKOA 2D0TA 2H7VC 3AA6B 1ZV4X 3AA0B 3F31A 2KINB 3PUQA 3AA1B 4O4IE 2EHOC 2BDEA 3H37A 4QXHB 4UXNB 3T8OA 2NW7A 4PAGA 3WAKA 4BAYB 5JDGA 3LJCA 4CZZB 3HL6A 2K48A 5IHYA 5JDLA 2CEAA 4AXPA 4C91A 5LHHB 3SRZA 2X9HA 4JEUB 1SHZC 4PK5A 5JR9B 5JR9A 2E8IA 3RYFE 2HPLA 3MA9A 3ZMTB 3NRYA 2XAJB 2CCQA 4IE5A 2E9XC 2L9QA 3JC6D 3K3NA 3HI2A 5CB4E 2LEHA 2V7JA 3NBXX 2NOXA 3KV6A 4ZI2D 4TV8E 3V5SA 4BA9A 3I1AA 3Q5XA 4MLKA 4AQFC 4QX7B 5FP3A 3B13A 4GK5E 4U74A 2YK0A 5H6RB 5JRCB 2G0UA 3UUXB 3ZYMA 1G8XA 3ZMVB 4UF0A 3KVBA 1MNDA 3BK9A 2ZMAA 5FXXA 4ZOLE 3RYIE 2ZM8A 2DCFA 5EK4A 2V7MA 4E7SA 1WYBA 2LSKA 3KINB 4K0UA 3CQXC 3EDVA 2W0GA 2ODUA 3BQLA 3Q2MA 4UV8B 2MTQA 5LJMA 3MK7C 2ODVA 3IHRA 1S35A 4BJNA 4IIJE 3Q9DA 2VASA 3ANWB 3ZCIA 3I0QA 3MJXA 2LE8A 4ADZA 4YHJA 2H7OA 3ZYLA 2Y8DA 3AAAB 1D0YA 2C5KT 2XAGB 4A56A 3QC9A 1T98A 4P0AA 2A3DA 3N2KE 4OK0A 3N5LA 5L3GB 1MIYA 3IF8B 3LK3B 3LG7A 4CQIA 3RX6A 2VKHA 5FYMA 4HKAA 1Y64B 4H9QC 3ETVA 5HXHA 4JEHB 2W62A 2HPJA 2NP9A 2QA7A 3CMLA 3GWHA 3PUSA 4I4TE 4C90A 4DVDA 2KWHA 4EB6E 2VWAA 2JPFA 1MMNA 3BQKA 3O4XE 4AI6A 5J2UE 1UCUA 3N9QA 4IHJE 4QKNA 5FMNA 3DJBA 2YU2A 4Z8XA 4DBRA 2L3LA 4UVBB 1VOMA 1MIVA 2EHOA 1KK7A 1Z0PA 4P0BA 3WAJA 3PUAA 3C4ZA 3OJAA 1NAFA 1WYCA 2WMOA 2XAHB 2NW8A 2JQQA 2LSJA 5KX5E 2NTXA 2X67A 3O1IA 3VU7H 1HG5A 3HKDE 3O1JA 4CXWA 2ACXA 4KMCA 1MMGA 2DHRA 2RA1A 2E9XA 4U72A 4H63V 2A2FX 2LT3A 3K3OA 3TKLB 2VKOA 1H7CA 3AB3B 2XUEA 5LOVE 1HFAA 5LYJE 1MNEA 3Q5WA 3CPZA 5A1LA 3LK42 3L3PA 3K3QC 2KLQA 4GK0E 2CLYC 3N9LA 4YFSA 4AQFA 3P7IA 3DP7A 5HYAA 2XAQB 4IE0A 1YD8G 2Q9QA 2SPCA 3CX7B 3OKQA 4UEMA 1CUNA 1HCIA 4X1KE 1FMWA 2PG8A 2RP4A 3W15B 5F3JA 4PK4A 4OYJA 4I50E 5L3BB 1S94A 5LBMA 1SA0E 4FI5A 3ESLA 4KUMB 4TZ4C 4YLHA 3B57A 2B1EA 1LVKA 4QHOA 3KFWX 5HXRA 5DQVA 4X1YE 2NWBA 5J1GA 4XZCA 3M65A 5HWXA 1IAPA 3C51A 4DNDA 3KDSE 2KNDA 5J2TE 1V9DA 1G73A 5LHIB 2VKDA 2CE7A 4H9NC 4UELA 4UVCB 3QK6A 4E7ZA 4G63A 1MMDA 4F6RC 3K8PC 2WWUA 2JMHA 3NRXA 3OYZA 3N9PA 1YKEB 2BVLA 5DJQC 3F57A 3NZQA 4J2CA 5IYZE 4PJNA 4PFOA 3ZCJA 4TN7B 4IE6A 3VHLA 4WNKA 2YEVC 2Q9QC 4EZ4A 4ASKA 2WMNA 5KDMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9W A;  1IJ6 A;  1H7C A;  4EYY R;  1QSD A;  3FXD B;  3CVR A;  4CQI A;  1Z0P A;  1LVF A;  2MBG A;  1LRZ A;  3L3P A;  1IJ5 A;  1ZKE A;  2C5I T;  4DND A;  3CKD A;  4L0R A;  3P7I A;  2KWI B;  3QK6 A;  3S4U A;  3N5L A;  2KWH A;  3QUJ A;  4B6X A;  2IC9 A;  2X9Y A;  2XTL A;  4J2C A;  2X9X A;  2CA5 A;  2K48 A;  2C5K T;  4FI5 A;  2IC6 A;  2G0U A;  3MXZ A;  2C5J A;  3FXE B;  3TKL B; 
#chains in the Genus database with same CATH topology
 2JMK A;  5CA1 E;  4EOZ B;  1N34 T;  5KMG P;  2DL1 A;  1FEW A;  1FJG T;  1U4Q A;  4ZHQ E;  2PFV A;  4GYR A;  3VR8 A;  3AE5 A;  4COF A;  3MXZ A;  2D5U A;  3PUG A;  5ETW A;  2E9X D;  1CHU A;  1I6Z A;  3HKC E;  3AEC A;  4JI8 T;  4ZI3 C;  5HEU A;  3FB2 A;  5FY7 A;  2CXD A;  4QXB B;  4X65 T;  2CLY B;  4YJ2 E;  4JI1 T;  2EHO B;  4LFB T;  3ZT6 A;  2UXB T;  4P1N A;  2WB5 A;  2PBI A;  4H9O C;  1R8I A;  5C8Y E;  5M4Y A;  3RIU C;  1HNZ T;  4I55 E;  4HFD A;  3PV0 F;  3ZMZ B;  3EAB A;  5AQR B;  5FXZ A;  2W00 A;  1ZKE A;  3RQU A;  3TLT A;  2CRB A;  3LSV A;  2VVS A;  5F5W A;  2Y6X A;  4IE4 A;  5FNV E;  3UTK A;  4YJ3 E;  3RGL A;  2D9D A;  2X68 A;  2CWY A;  1J1J A;  4BJM A;  2ES0 A;  5AQG B;  4DR4 T;  4DV2 T;  5CGM A;  3R84 B;  4UV9 B;  5AFU L;  3E0Z A;  3A5X A;  4AKR B;  4JI7 T;  3AE6 A;  1OWA A;  3QB5 K;  2OV9 A;  2YDS A;  3RYH E;  3C4W A;  5HXC A;  2LHR A;  1SUM B;  4AIS A;  3P4P A;  5H6Q B;  2K24 A;  1ZHC A;  4HEA A;  3PU3 A;  4L9I A;  2I0M A;  1D1C A;  3Q5E A;  1OXZ A;  4IL4 A;  4HE8 A;  3EDU A;  3LBX B;  4I43 B;  4MHC A;  2DWG A;  3RC3 A;  4AKI A;  5ABF A;  2JQH A;  3CX6 B;  5BMV E;  5LXT E;  2WU5 A;  1HNW T;  3U3I A;  4TUY E;  4U7Y A;  4ANJ A;  3BQI A;  4GYS A;  2KT9 A;  4DV3 T;  4DR3 T;  4ILU A;  2WDR A;  3TLV A;  5HCM A;  2X0Y A;  5L2L A;  4OHF A;  4O2A E;  3KV4 A;  2LM2 A;  4EAH A;  4O4J E;  5JDH A;  2ZM0 A;  4ZI3 D;  4OX9 T;  1D1A A;  5JDQ A;  4GKK T;  4EV6 A;  2W67 A;  4UR9 A;  3LK2 B;  4HN9 A;  4PNI A;  1UX5 A;  3CK6 A;  2V5D A;  3KV5 A;  2BVM A;  3AEF A;  5JDF A;  3RH3 A;  4OFZ A;  2IHR 1;  2XHE B;  1HR0 T;  3FHN A;  4EYY R;  4YTP A;  4ZZC A;  3C64 A;  5LGU B;  4DMW A;  2QGS A;  3X1D A;  2WSS V;  1MIW A;  4H9P C;  5EK3 A;  3AA6 B;  1OED C;  3EI0 A;  5JDG A;  2BDE A;  4UXN B;  3WAK A;  1XNQ T;  1UUS A;  4C91 A;  2BS3 A;  4JI3 T;  3A7M A;  1SHZ C;  3ABV A;  3QNU A;  3AEE A;  3L8R A;  2QRX A;  2J47 A;  5CB4 E;  2NOX A;  4TV8 E;  3I1A A;  4MLK A;  4QX7 B;  5L4H A;  2G0U A;  3ZYM A;  3KVB A;  3BK9 A;  4YTN A;  2ZM8 A;  2V7M A;  3KIN B;  4K0U A;  3CQX C;  3BQL A;  2ODU A;  5LJM A;  3MK7 C;  2ODV A;  3IHR A;  3Q9D A;  3AE4 A;  5ABE A;  3ZYL A;  5C2T A;  1UK5 A;  5AQH B;  2A3D A;  1N36 T;  3LG7 A;  4IDP A;  3ETV A;  3CML A;  2FBW A;  4I4T E;  4DVD A;  2KWH A;  4EB6 E;  2VWA A;  2RPA A;  2XPK A;  1GQE A;  2XQ7 A;  2I6H A;  3DJB A;  4DBR A;  1MIV A;  2EHO A;  2BG9 E;  3PUA A;  5AQJ B;  3OJA A;  2XAH B;  5AQL B;  2JQQ A;  5AQF B;  1HG5 A;  2ACX A;  4KMC A;  1MMG A;  2LT3 A;  3AB3 B;  3RHW A;  1HFA A;  2WDV A;  3Q5W A;  3UU4 A;  5A1L A;  2KLQ A;  5LG3 A;  5HYA A;  4IE0 A;  3T1Y T;  4LF4 T;  4UEM A;  3OKQ A;  3PUZ F;  1FMW A;  3W15 B;  4TZ4 C;  3K1S A;  4YSY A;  2E5L T;  5FL0 A;  3AXJ B;  2FUP A;  1IAP A;  1HX1 B;  2HN2 A;  2MPK A;  2YDR A;  5C3J A;  4H9N C;  5LHI B;  3QK6 A;  2JMH A;  3N9P A;  5J0Z A;  4JI2 T;  3ZCJ A;  2WY2 A;  3SFD A;  4EIW A;  5ABG A;  4IST A;  4KP3 C;  2CXL A;  2K9A A;  2WDQ A;  2XQY A;  1UUR A;  3RPU A;  3NZP A;  5KXJ A;  2YU1 A;  1IBL T;  4QWN B;  2BKN A;  2K5B B;  1T72 A;  2CM0 A;  2J62 A;  1KF6 A;  2P9B A;  2CXF A;  3ZMU B;  1LKX A;  2CWO A;  3UFE A;  2MBG A;  2JRK A;  5AQP B;  5AQN B;  3LBX A;  3FZL B;  3HA4 A;  3UUM A;  3S4U A;  3EAM A;  1YQ3 A;  4ISS A;  4P09 A;  2Q9Q D;  1ZP0 A;  1Z8U A;  2CHO A;  4L5G A;  4QXC B;  1LRZ A;  3KVA A;  4YSZ A;  1IJ5 A;  3F2E A;  3RI5 A;  2BBH A;  3ZN0 B;  3GMI A;  3B5M A;  4JI5 T;  4WZX A;  3FBZ A;  3EVY A;  1YXR A;  4ZEY A;  3TLU A;  4YY3 T;  2M67 A;  4DUY T;  1FIO A;  4CI1 B;  3FXD B;  2N9D A;  3ZSS A;  4X62 T;  3QOF A;  2IAK A;  5AQU B;  2LOP A;  5AQQ B;  5LB7 B;  4EXT A;  5LCY A;  2GK9 A;  3ZEF B;  3L09 A;  4WBN E;  4B3M T;  2XQ3 A;  3KV9 A;  2WS3 A;  4DV7 T;  2CA5 A;  4GKJ T;  1ZEE A;  1WLX A;  3CX8 B;  1UX4 A;  4HFE A;  3CQG B;  2W63 A;  3P8C D;  2QYW A;  5L3D B;  3OBV E;  1W9R A;  3LDQ B;  2WBL A;  5HEH A;  4H9R C;  3C50 A;  3CQC B;  3PUX F;  5FL1 A;  3J9X 1;  3HR0 A;  1T7S A;  2W4X A;  1YW0 A;  2J1D G;  1XNR T;  3IBP A;  1JNR A;  3ZMS B;  1BR1 A;  3PU8 A;  4WBO A;  2HH7 A;  2V7I A;  2CMR A;  4CI2 B;  4LF5 T;  5LBQ B;  2HHH T;  4GIW A;  4IDZ A;  1YKH B;  3FBL A;  1XDP A;  5AQO B;  4UVA B;  3ZPO A;  2UXD T;  3JAF A;  1IJ6 A;  2VL0 A;  3PE0 A;  3E22 E;  2JIW A;  1W09 A;  4TWD A;  1Y01 A;  1HX8 A;  4HTE A;  2XZE A;  1WRD A;  2LRL A;  4HFC A;  3KBT A;  3ZC0 A;  5HEO A;  4UIG A;  5GON E;  2Z6E A;  2IC9 A;  2X9Y A;  4JI6 T;  4TWH A;  3MZK B;  2A72 A;  2NW9 A;  5LA6 E;  3FZF B;  1MMA A;  2MAW A;  3V5U A;  4IE7 A;  2LLY A;  4B6X A;  2JJ9 A;  1W0A A;  3IA3 A;  3IEE A;  1UGO A;  3ONL C;  2V1D B;  4MAL A;  3HKB E;  5LGN B;  2XAS B;  2KWI B;  2YIN A;  2VQF T;  3LFM A;  3UT5 E;  2V5C A;  3ZYK A;  3J7Y q;  2YDQ A;  2C5J A;  3CWZ B;  4O8S A;  4LFA T;  5JDM A;  2V7K A;  5L3E B;  3RF1 A;  3AVR A;  3UU3 A;  5ADX L;  2H7V C;  3AA0 B;  1ZV4 X;  3F31 A;  3T8O A;  2EHO C;  3H37 A;  2NW7 A;  3UUB A;  5IHY A;  2CEA A;  4AXP A;  4HWH A;  5LHH B;  4DID B;  2X9H A;  5JR9 A;  3RYF E;  2NR4 A;  2HPL A;  3MA9 A;  4ILC A;  3AXJ A;  1HNX T;  2CCQ A;  4IE5 A;  1XZY A;  4X64 T;  2L9Q A;  3K3N A;  3HI2 A;  2LEH A;  4Z91 A;  4X66 T;  2E5V A;  2F4V T;  4BA9 A;  5FVL A;  4LF9 T;  4LML A;  3Q5X A;  4U74 A;  3UUX B;  3ZMV B;  1MND A;  2ZMA A;  4ZOL E;  5EK4 A;  4E7S A;  1WYB A;  3EDV A;  4UV8 B;  3Q2M A;  2MTQ A;  2X0H A;  2HN1 A;  3VRA A;  2VAS A;  3ANW B;  3I0Q A;  4JI4 T;  4YHJ A;  2H7O A;  1VCS A;  2C5K T;  1NEN A;  4LF7 T;  4OK0 A;  3N5L A;  4U7I A;  4NIQ A;  3RX6 A;  3AEG A;  2QA7 A;  2BKP A;  5IWA T;  4YHH T;  2YOE A;  4KHZ F;  3BQK A;  4A98 A;  4AI6 A;  4B3S T;  2A9U A;  5FMN A;  2BG9 B;  2YU2 A;  3JAD A;  2L3L A;  4UVB B;  3WAJ A;  1WYC A;  2QVA A;  4DUZ T;  4HWI B;  3VU7 H;  4DV6 T;  2DHR A;  5HEG A;  4DR6 T;  4H63 V;  5LOV E;  1T8B A;  5LYJ E;  3AE7 A;  3CPZ A;  2CBJ A;  3L3P A;  3K3Q C;  3CIR A;  4YFS A;  2VQE T;  3CX7 B;  3AE3 A;  4I50 E;  1S94 A;  1SA0 E;  4FI5 A;  4JI0 T;  3B57 A;  3Q5D A;  5HXR A;  1E2A A;  5DQV A;  3AE2 A;  1E7P A;  4DR2 T;  2WU2 A;  4B3T T;  3VR9 A;  2CE7 A;  4E7Z A;  4QH5 A;  4G63 A;  1MMD A;  2WWU A;  1YKE B;  2CBI A;  4YT0 A;  2AE9 A;  2Q9Q C;  4EZ4 A;  2ZM2 A;  4A5X A;  2XAF B;  3RRC A;  2EHO D;  4ILB A;  4DV1 T;  2BS2 A;  4JUY A;  5HXS A;  2UU9 T;  3AVS A;  2KZ7 B;  4OYK A;  4DO0 A;  3NVO A;  2IIU A;  4PJL A;  2ZM6 T;  1QUU A;  4U3C A;  3P4W A;  5CA0 E;  3C98 B;  4ZS2 A;  4DMV A;  1X79 A;  5LNK A;  4ZZB A;  2NTY A;  2BBJ A;  2MOZ A;  2DI4 A;  2XSA A;  3FZH B;  5DQW A;  1B7T A;  5AQM B;  4DV5 T;  3PJA A;  1BR0 A;  3OTO T;  4N78 D;  2FJA A;  3PUR A;  4CN6 A;  3OPC A;  5AQK B;  4AQG A;  1XMQ T;  3SWH A;  5HAX A;  3I9Y A;  2BZB A;  2E9X B;  4LF8 T;  2YN6 A;  3UUL A;  4KHP T;  2VL8 A;  1VRB A;  4LFC T;  3AEB A;  2B76 A;  5LP6 E;  2L8K A;  2Y48 B;  4GOU A;  3P4Q A;  4AQY T;  4EYU A;  2XQ8 A;  4U31 A;  5LGT B;  4EEB A;  4NPP A;  3D0T A;  4LMK A;  2IUB A;  5E0O A;  1D0X A;  4V1A v;  5L3C B;  5HWY A;  5HXE A;  4IGU A;  3KBU A;  4M1P A;  5L47 A;  3I9W A;  2IDO B;  4AIU A;  1DU2 A;  4I0U A;  3ZJ1 A;  1WR6 A;  4EZH A;  1O3X A;  2YKS A;  2WQY A;  1N32 T;  5DAB A;  3RC8 A;  2H3R A;  2C0S A;  2VUR A;  4AKG A;  2V7L A;  4PK6 A;  3E08 A;  4DV4 T;  3ZT5 A;  4DBQ A;  3MAC A;  5AQV B;  2LSG A;  2WP9 A;  4JYA T;  1BR4 A;  4QX8 B;  2W66 A;  5JR9 C;  2WZI A;  1NWM X;  4U2Z A;  1N33 T;  3ANW A;  3AA7 B;  4KI0 F;  3HKE E;  2UUA T;  2X9X A;  4O4L E;  3C4X A;  5ABH A;  3AAI A;  4AKH A;  3GN5 B;  5JH7 E;  3AAE B;  3WI3 A;  5TAO A;  5LHG B;  2ACZ A;  4XBF B;  4CXY A;  5FY0 A;  3R6N A;  5LJN A;  2UUB T;  5JTG A;  3UQ4 A;  2BG9 A;  4NUU A;  3ZC1 A;  2X9W A;  1IZN B;  1US7 B;  1HG2 A;  5LG4 A;  3ZJ2 A;  2XM1 A;  3RYC E;  4ERR A;  2XY8 B;  1E1H B;  3O9X A;  4TWF A;  5FXV A;  4NUV A;  4YSX A;  4PJM A;  2CPT A;  2LM9 A;  4XAX B;  2W61 A;  1D0Z A;  3CVR A;  3ONX A;  3VKH A;  2OA5 A;  4H63 H;  4B3R T;  4CXX A;  5IUX A;  2D0T A;  4O4I E;  3PUQ A;  5F3J A;  2XQ5 A;  3AA1 B;  4BAY B;  4PAG A;  3LJC A;  3T1H T;  5CFB A;  5JDL A;  3RKG A;  5AQS B;  4IRE A;  3SRZ A;  4JEU B;  4PK5 A;  3ZMT B;  3NRY A;  3UFG A;  2XAJ B;  3M3Z B;  4QH1 A;  3KV6 A;  3V5S A;  2YK0 A;  1WFD A;  1J5E T;  5JRC B;  3RYI E;  4HWD A;  2LSK A;  2W0G A;  3QB5 A;  4HWF A;  2E2A A;  3NKZ A;  4BJN A;  3P4S A;  4IIJ E;  4IL9 A;  3MJX A;  3RQW A;  3AAA B;  4A56 A;  2XAG B;  3QC9 A;  1T98 A;  3PUW F;  5L3G B;  2XQ4 A;  3IF8 B;  3LK3 B;  4HFB A;  3NWI A;  3FZK B;  2JQ9 A;  3H3M A;  5FYM A;  4HKA A;  5BR8 T;  4H9Q C;  2HPJ A;  5FKY A;  3TLW A;  2JPF A;  3O4X E;  4DV0 T;  1UCU A;  4QKN A;  4Z8X A;  4NXN T;  1VOM A;  1WCR A;  4IDQ A;  4P0B A;  3C4Z A;  1NAF A;  2WMO A;  2NW8 A;  3AE9 A;  2NTX A;  3O1I A;  2BKO A;  3O1J A;  4IDO A;  4CXW A;  3ONJ A;  2RA1 A;  2E9X A;  4U72 A;  3TKL B;  1H7C A;  4IT4 A;  1MNE A;  3ZT7 A;  4CN1 A;  2XQ6 A;  4GK0 E;  2CLY C;  3N9L A;  3UU6 A;  4AQF A;  3DP7 A;  3P4R A;  4X1K E;  2PG8 A;  4OYJ A;  3ESL A;  4KUM B;  3KFW X;  4X1Y E;  2NWB A;  5J1G A;  4XZC A;  3M65 A;  3AEA A;  4DND A;  5J2T E;  1G73 A;  2VKD A;  4UVC B;  1NEK A;  3OYZ A;  2BVL A;  5DJQ C;  3F57 A;  5IYZ E;  3AE8 A;  4PFO A;  4TN7 B;  4IE6 A;  3VHL A;  4WNK A;  1IBK T;  4ASK A;  2WMN A;  4CN4 A;  4UF0 B;  5HEJ A;  3FZM B;  1KFY A;  4IDN A;  1FMV A;  4G2A A;  5JVD E;  4TV9 E;  2D2S A;  4DR5 T;  2LHN A;  5HCJ A;  1KNR A;  2PJQ A;  3ETU A;  3N2G E;  4TNW A;  4HWC A;  5FY1 A;  4U33 A;  4H9S E;  4X1I E;  2X0L B;  2XSB A;  1U5P A;  2LOS A;  2X66 A;  2WM9 A;  4U2Y A;  3GN5 A;  4DR1 T;  4HFH A;  1OED B;  4ZXL A;  1AJ3 A;  1LVF A;  2W2U A;  4O2B E;  2LKG A;  3ZLI A;  1HF8 A;  1HTJ F;  4MBQ A;  2N2N A;  1X9B A;  1HS7 A;  3SS1 A;  3RIA A;  3QUJ A;  4KBM B;  2XQ9 A;  2DWK A;  2MYS A;  2K3W A;  3SFE A;  3O1H A;  4Q25 A;  4TX5 A;  3SOL A;  5AQI B;  5FVK A;  3N9M A;  3CKD A;  4L0R A;  1I94 T;  3P50 A;  2R6G F;  2Q9Q B;  3JC6 C;  3EHZ A;  2BS4 A;  2DNX A;  2VKJ A;  5FXW A;  4ZI2 C;  3MKD A;  4LF6 T;  4YTM A;  2D0U A;  4PJJ A;  1EZ3 A;  3I0O A;  2J4G A;  4LMJ A;  4DR7 T;  3ZST A;  4JV5 T;  2BG9 C;  4TNV A;  3H3A A;  3N9O A;  5CJ5 A;  2VK9 A;  3AED A;  2ZLY A;  2VB6 A;  2XTL A;  2LSI A;  2V6Y B;  5JDN A;  1KNZ A;  3UUN A;  2KXP B;  2KSR A;  4KX6 A;  2I59 A;  3PUV F;  3N2O A;  3OYX A;  3PDY A;  2V8S V;  4HGA A;  4JBW F;  3RRW A;  3U78 A;  5JRC A;  4AKL A;  2JQK A;  4WW0 A;  4MFR A;  2V6X A;  5EZY E;  3VRB A;  4PW8 A;  2C5I T;  2UUC T;  4FJO A;  3PTR B;  4ZI7 E;  1W0B A;  3PJA J;  4A97 A;  3ZN1 B;  4X5T A;  3RIU A;  5AQT B;  1ZOY A;  2LRK A;  3N9N A;  5JRE A;  1XWM A;  1YQ4 A;  2UXX B;  4EED A;  2KMF A;  1JNZ A;  2DLR A;  5JQG E;  2OLT A;  1OED E;  2FJE A;  2CHN A;  4HFV A;  2LKH A;  2X51 A;  1VCT A;  3GA8 A;  1D1B A;  4YXD A;  5EK2 A;  1QLB A;  3FXE B;  2VVN A;  2UXN B;  1QSD A;  2LJL A;  2IW5 B;  3EUH A;  4O4H E;  2WWV A;  2WZH A;  4CI3 B;  2AXD S;  2UXC T;  5F8P A;  3DTO A;  3PUY F;  2FJD A;  4F8H A;  2IC6 A;  2XM2 A;  2M6B A;  2V26 A;  2WAU A;  4PFP A;  3L39 A;  4JLE A;  4ZS3 A;  2N1G A;  1BR2 A;  4QH4 A;  4X20 E;  2LSY A;  3RKO A;  1XDO A;  2KIN B;  4QXH B;  3A8Y C;  1SE7 A;  4CZZ B;  4EGW A;  2M6I A;  3HL6 A;  2K48 A;  1IBM T;  2XQA A;  5JR9 B;  2E8I A;  3OVU A;  1XMO T;  1M62 A;  3G06 A;  3UQ7 A;  2E9X C;  3JAE A;  3JC6 D;  2IML A;  3JCF A;  2V7J A;  3NBX X;  4ZI2 D;  4AQF C;  5FP3 A;  5LMN T;  3B13 A;  4GK5 E;  5H6R B;  5LMU T;  3TLS A;  4K0K T;  3RIF A;  1G8X A;  2H88 A;  4UF0 A;  5FXX A;  2DCF A;  4ILA A;  2FJB A;  2PTF A;  1S35 A;  3ZCI A;  2LE8 A;  4ADZ A;  2Y8D A;  1D0Y A;  5ABF B;  4P0A A;  2WCA A;  3AE1 A;  1KNP A;  3N2K E;  1M7K A;  1MIY A;  3UU5 A;  4CQI A;  2VKH A;  1Y64 B;  3ZKR A;  5HXH A;  4JEH B;  2W62 A;  4NXM T;  2NP9 A;  3GWH A;  3PUS A;  4C90 A;  5L4E A;  4Z90 A;  1MMN A;  5J2U E;  3N9Q A;  4IHJ E;  1OED A;  1KK7 A;  1Z0P A;  2H89 A;  2LSJ A;  5KX5 E;  2X67 A;  3HKD E;  4HFI A;  2XJ7 A;  2A2F X;  3K3O A;  1KEY A;  2VKO A;  2XUE A;  3LK4 2;  3P7I A;  3UU8 A;  4WYV A;  2XAQ B;  1YD8 G;  2Q9Q A;  2SPC A;  5L3F B;  1CUN A;  1HCI A;  2RP4 A;  5L3B B;  4PK4 A;  5LBM A;  1J5W A;  4YLH A;  2B1E A;  1LVK A;  4QHO A;  5HWX A;  3C51 A;  3KDS E;  2KND A;  1V9D A;  4UEL A;  4F6R C;  3K8P C;  3NRX A;  1L0V A;  3NZQ A;  4J2C A;  2V6Y A;  4PJN A;  1WR0 A;  3RLF F;  2YEV C;  3VKG A;  5KDM C; 
#chains in the Genus database with same CATH homology
 2ZM2 A;  4UF0 B;  2JMK A;  5CA1 E;  2XAF B;  4EIW A;  4IST A;  4EOZ B;  4KP3 C;  3RRC A;  2CXL A;  2EHO D;  2K9A A;  1FMV A;  2XQY A;  4G2A A;  3RPU A;  5JVD E;  3NZP A;  4TV9 E;  5KMG P;  2YU1 A;  2D2S A;  1FEW A;  4QWN B;  2LHN A;  4JUY A;  5HXS A;  1U4Q A;  3AVS A;  4ZHQ E;  2PFV A;  2K5B B;  2KZ7 B;  4GYR A;  4OYK A;  2CM0 A;  3MXZ A;  2P9B A;  2D5U A;  3PUG A;  2PJQ A;  4DO0 A;  3ETU A;  5ETW A;  4PJL A;  2CXF A;  1QUU A;  2E9X D;  3N2G E;  5CA0 E;  3ZMU B;  3C98 B;  1LKX A;  2CWO A;  3UFE A;  5FY1 A;  4ZS2 A;  2MBG A;  4DMV A;  2JRK A;  1X79 A;  3HKC E;  4H9S E;  4ZI3 C;  3LBX A;  4X1I E;  5LNK A;  2X0L B;  3HA4 A;  3UUM A;  3S4U A;  3FB2 A;  5FY7 A;  1U5P A;  2CXD A;  2NTY A;  2MOZ A;  4ISS A;  2Q9Q D;  4P09 A;  2DI4 A;  4QXB B;  2LOS A;  2X66 A;  5DQW A;  1B7T A;  3VKG A;  2CLY B;  4YJ2 E;  2WM9 A;  3GN5 A;  4L5G A;  1AJ3 A;  4QXC B;  1LVF A;  2EHO B;  4O2B E;  1LRZ A;  3KVA A;  1BR0 A;  3ZLI A;  1IJ5 A;  3F2E A;  1HF8 A;  4N78 D;  3PUR A;  1HTJ F;  4MBQ A;  2N2N A;  1HS7 A;  3SS1 A;  4AQG A;  3ZN0 B;  3QUJ A;  2PBI A;  4KBM B;  3SWH A;  3GMI A;  5HAX A;  2DWK A;  3FBZ A;  3EVY A;  3I9Y A;  4H9O C;  2MYS A;  2BZB A;  5C8Y E;  2E9X B;  3O1H A;  5M4Y A;  2M67 A;  1FIO A;  4CI1 B;  4TX5 A;  3FXD B;  2N9D A;  3SOL A;  4I55 E;  3UUL A;  3ZMZ B;  5FXZ A;  2IAK A;  2W00 A;  1ZKE A;  3N9M A;  2LOP A;  3CKD A;  2VL8 A;  4EXT A;  1VRB A;  4L0R A;  5LCY A;  2GK9 A;  3ZEF B;  5LP6 E;  2L8K A;  2Y48 B;  3L09 A;  4GOU A;  4WBN E;  2Q9Q B;  2Y6X A;  4IE4 A;  5FNV E;  4EYU A;  3JC6 C;  3KV9 A;  4YJ3 E;  3UTK A;  2DNX A;  2CA5 A;  2VKJ A;  5FXW A;  4ZI2 C;  2X68 A;  1ZEE A;  2CWY A;  5LGT B;  1WLX A;  3MKD A;  3CX8 B;  1UX4 A;  4BJM A;  3D0T A;  2D0U A;  4PJJ A;  2ES0 A;  5E0O A;  3CQG B;  1D0X A;  1EZ3 A;  3I0O A;  2W63 A;  4V1A v;  5L3C B;  3P8C D;  5HWY A;  5L3D B;  3OBV E;  3H3A A;  2WBL A;  3N9O A;  5HXE A;  4IGU A;  4H9R C;  3C50 A;  3CQC B;  3KBU A;  4M1P A;  2VK9 A;  3J9X 1;  3I9W A;  3HR0 A;  2ZLY A;  2VB6 A;  1YW0 A;  2J1D G;  2LSI A;  2XTL A;  3R84 B;  4UV9 B;  5AFU L;  3ZJ1 A;  3E0Z A;  1WR6 A;  4EZH A;  1O3X A;  3A5X A;  4AKR B;  5JDN A;  1KNZ A;  5DAB A;  3RC8 A;  1OWA A;  3UUN A;  3IBP A;  2KXP B;  2H3R A;  3ZMS B;  2C0S A;  1BR1 A;  2I59 A;  3PU8 A;  3N2O A;  4WBO A;  2HH7 A;  2V7I A;  2CMR A;  4CI2 B;  3OYX A;  5L3F B;  3RYH E;  4AKG A;  5LBQ B;  3PDY A;  2V7L A;  4GIW A;  4PK6 A;  3E08 A;  4IDZ A;  1YKH B;  3FBL A;  4HGA A;  3C4W A;  5HXC A;  2LHR A;  3RRW A;  3U78 A;  5JRC A;  4AKL A;  5H6Q B;  2K24 A;  1ZHC A;  4HEA A;  4UVA B;  3ZPO A;  4DBQ A;  3MAC A;  3PU3 A;  4WW0 A;  1IJ6 A;  3PE0 A;  2LSG A;  4L9I A;  4MFR A;  1D1C A;  3E22 E;  1BR4 A;  4QX8 B;  5EZY E;  4PW8 A;  2C5I T;  1OXZ A;  4HE8 A;  1HX8 A;  3EDU A;  4HTE A;  5JR9 C;  3LBX B;  4FJO A;  1WRD A;  3PTR B;  4ZI7 E;  3KBT A;  1NWM X;  4MHC A;  4I43 B;  3ZC0 A;  2DWG A;  3RC3 A;  3ANW A;  3ZN1 B;  4UIG A;  3AA7 B;  4AKI A;  5GON E;  3HKE E;  2Z6E A;  2IC9 A;  2X9Y A;  3N9N A;  2X9X A;  3MZK B;  5JRE A;  4O4L E;  2A72 A;  3CX6 B;  3C4X A;  2NW9 A;  2UXX B;  3AAI A;  5LA6 E;  5BMV E;  4AKH A;  3GN5 B;  1MMA A;  5JH7 E;  2KMF A;  5LXT E;  3AAE B;  3WI3 A;  3U3I A;  4TUY E;  2DLR A;  3V5U A;  5TAO A;  4ANJ A;  5JQG E;  3BQI A;  4GYS A;  5LHG B;  2KT9 A;  4IE7 A;  5EK3 A;  4XBF B;  4HFV A;  4CXY A;  2X51 A;  5FY0 A;  3R6N A;  4ILU A;  5LJN A;  4B6X A;  2JJ9 A;  3GA8 A;  1D1B A;  5EK2 A;  5L2L A;  4OHF A;  4O2A E;  3KV4 A;  3IEE A;  3FXE B;  4EAH A;  4NUU A;  3ZC1 A;  2X9W A;  4O4J E;  1IZN B;  2UXN B;  5JDH A;  1QSD A;  1US7 B;  1HG2 A;  2LJL A;  2ZM0 A;  4ZI3 D;  2IW5 B;  5LG4 A;  1D1A A;  5JDQ A;  3EUH A;  2V1D B;  3LK2 B;  4O4H E;  3ZJ2 A;  4HN9 A;  4PNI A;  1UX5 A;  4MAL A;  4CI3 B;  3RYC E;  3HKB E;  5LGN B;  2XAS B;  3KV5 A;  4ERR A;  2BVM A;  2KWI B;  2YIN A;  5F8P A;  5JDF A;  3RH3 A;  4OFZ A;  3DTO A;  1E1H B;  3LFM A;  3O9X A;  3UT5 E;  2XHE B;  3ZYK A;  3J7Y q;  2IC6 A;  5FXV A;  4NUV A;  2V26 A;  2C5J A;  4PJM A;  3CWZ B;  4O8S A;  2WAU A;  3FHN A;  4EYY R;  2LM9 A;  4XAX B;  5JDM A;  3C64 A;  2V7K A;  4DMW A;  2QGS A;  5LGU B;  2W61 A;  1D0Z A;  2WSS V;  3CVR A;  4JLE A;  4PFP A;  3ONX A;  1MIW A;  4ZS3 A;  5L3E B;  2N1G A;  1BR2 A;  3AVR A;  4X20 E;  3VKH A;  4H9P C;  2OA5 A;  4H63 H;  5ADX L;  4CXX A;  2LSY A;  3RKO A;  2D0T A;  2H7V C;  3AA6 B;  1ZV4 X;  3AA0 B;  3F31 A;  2KIN B;  3PUQ A;  3AA1 B;  4O4I E;  2EHO C;  2BDE A;  3H37 A;  4QXH B;  4UXN B;  3T8O A;  2NW7 A;  4PAG A;  3WAK A;  4BAY B;  5JDG A;  3LJC A;  4CZZ B;  3HL6 A;  2K48 A;  5IHY A;  5JDL A;  2CEA A;  4AXP A;  4C91 A;  5LHH B;  3SRZ A;  2X9H A;  4JEU B;  1SHZ C;  4PK5 A;  5JR9 B;  5JR9 A;  2E8I A;  3RYF E;  2HPL A;  3MA9 A;  3ZMT B;  3NRY A;  2XAJ B;  2CCQ A;  4IE5 A;  2E9X C;  2L9Q A;  3JC6 D;  3K3N A;  3HI2 A;  5CB4 E;  2LEH A;  2V7J A;  3NBX X;  2NOX A;  3KV6 A;  4ZI2 D;  4TV8 E;  3V5S A;  4BA9 A;  3I1A A;  3Q5X A;  4MLK A;  4AQF C;  4QX7 B;  5FP3 A;  3B13 A;  4GK5 E;  4U74 A;  2YK0 A;  5H6R B;  5JRC B;  2G0U A;  3UUX B;  3ZYM A;  1G8X A;  3ZMV B;  4UF0 A;  3KVB A;  1MND A;  3BK9 A;  2ZMA A;  5FXX A;  4ZOL E;  3RYI E;  2ZM8 A;  2DCF A;  5EK4 A;  2V7M A;  4E7S A;  1WYB A;  2LSK A;  3KIN B;  4K0U A;  3CQX C;  3EDV A;  2W0G A;  2ODU A;  3BQL A;  3Q2M A;  4UV8 B;  2MTQ A;  5LJM A;  3MK7 C;  2ODV A;  3IHR A;  1S35 A;  4BJN A;  4IIJ E;  3Q9D A;  2VAS A;  3ANW B;  3ZCI A;  3I0Q A;  3MJX A;  2LE8 A;  4ADZ A;  4YHJ A;  2H7O A;  3ZYL A;  2Y8D A;  3AAA B;  1D0Y A;  2C5K T;  2XAG B;  4A56 A;  3QC9 A;  1T98 A;  4P0A A;  2A3D A;  3N2K E;  4OK0 A;  3N5L A;  5L3G B;  1MIY A;  3IF8 B;  3LK3 B;  3LG7 A;  4CQI A;  3RX6 A;  2VKH A;  5FYM A;  4HKA A;  1Y64 B;  4H9Q C;  3ETV A;  5HXH A;  4JEH B;  2W62 A;  2HPJ A;  2NP9 A;  2QA7 A;  3CML A;  3GWH A;  3PUS A;  4I4T E;  4C90 A;  4DVD A;  2KWH A;  4EB6 E;  2VWA A;  2JPF A;  1MMN A;  3BQK A;  3O4X E;  4AI6 A;  5J2U E;  1UCU A;  3N9Q A;  4IHJ E;  4QKN A;  5FMN A;  3DJB A;  2YU2 A;  4Z8X A;  4DBR A;  2L3L A;  4UVB B;  1VOM A;  1MIV A;  2EHO A;  1KK7 A;  1Z0P A;  4P0B A;  3WAJ A;  3PUA A;  3C4Z A;  3OJA A;  1NAF A;  1WYC A;  2WMO A;  2XAH B;  2NW8 A;  2JQQ A;  2LSJ A;  5KX5 E;  2NTX A;  2X67 A;  3O1I A;  3VU7 H;  1HG5 A;  3HKD E;  3O1J A;  4CXW A;  2ACX A;  4KMC A;  1MMG A;  2DHR A;  2RA1 A;  2E9X A;  4U72 A;  4H63 V;  2A2F X;  2LT3 A;  3K3O A;  3TKL B;  2VKO A;  1H7C A;  3AB3 B;  2XUE A;  5LOV E;  1HFA A;  5LYJ E;  1MNE A;  3Q5W A;  3CPZ A;  5A1L A;  3LK4 2;  3L3P A;  3K3Q C;  2KLQ A;  4GK0 E;  2CLY C;  3N9L A;  4YFS A;  4AQF A;  3P7I A;  3DP7 A;  5HYA A;  2XAQ B;  4IE0 A;  1YD8 G;  2Q9Q A;  2SPC A;  3CX7 B;  3OKQ A;  4UEM A;  1CUN A;  1HCI A;  4X1K E;  1FMW A;  2PG8 A;  2RP4 A;  3W15 B;  5F3J A;  4PK4 A;  4OYJ A;  4I50 E;  5L3B B;  1S94 A;  5LBM A;  1SA0 E;  4FI5 A;  3ESL A;  4KUM B;  4TZ4 C;  4YLH A;  3B57 A;  2B1E A;  1LVK A;  4QHO A;  3KFW X;  5HXR A;  5DQV A;  4X1Y E;  2NWB A;  5J1G A;  4XZC A;  3M65 A;  5HWX A;  1IAP A;  3C51 A;  4DND A;  3KDS E;  2KND A;  5J2T E;  1V9D A;  1G73 A;  5LHI B;  2VKD A;  2CE7 A;  4H9N C;  4UEL A;  4UVC B;  3QK6 A;  4E7Z A;  4G63 A;  1MMD A;  4F6R C;  3K8P C;  2WWU A;  2JMH A;  3NRX A;  3OYZ A;  3N9P A;  1YKE B;  2BVL A;  5DJQ C;  3F57 A;  3NZQ A;  4J2C A;  5IYZ E;  4PJN A;  4PFO A;  3ZCJ A;  4TN7 B;  4IE6 A;  3VHL A;  4WNK A;  2YEV C;  2Q9Q C;  4EZ4 A;  4ASK A;  2WMN A;  5KDM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...