3FXDB

Crystal structure of interacting domains of icmr and icmq
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
VTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Interacting IcmR-IcmQ Domains from a Type IVb Secretion System in Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Unknown function
molecule keywords Protein IcmQ
total genus 24
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3fxdB00
3QUJA 1IJ5A 1IJ6A 2XTLA 1LVFA 2CA5A 2IC6A 3CVRA 3TKLB 3L3PA 2X9YA 3N5LA 1Z0PA 1LRZA 2IC9A 3MXZA 2K48A 3FXDB 4B6XA 2C5IT 2KWHA 3FXEB 2X9WA 2MBGA 1ZKEA 2KWIB 2X9XA 3S4UA 4DNDA 4FI5A 2G0UA 4EYYR 3QK6A 4CQIA 1QSDA 4J2CA 4L0RA 2C5KT 2C5JA 1H7CA 3P7IA 3CKDA
chains in the Genus database with same CATH superfamily
3P4WA 3ONXA 2WSSV 4IREA 2GK9A 3L8RA 1SA0E 4ZOLE 3ZSTA 2IDOB 3HKCE 1N32T 2KLQA 3KDSE 2WY2A 3T8OA 1UK5A 4Z8XA 5FY0A 3P4QA 5LCYA 2A3DA 2V7MA 4WW0A 3NRYA 2BVMA 4IGUA 4DO0A 5DQWA 4A97A 5LGNB 4P0AA 2Q9QC 4YHJA 3RKOA 2J4GA 5AQQB 2UXNB 2XQYA 2W67A 4LF6T 2FJEA 5CA0E 3ANWA 3AE2A 3ONJA 4HE8A 2JJ9A 1OEDE 4PJNA 5ETWA 4DR5T 4JI1T 3WAJA 4ZS2A 2IMLA 2WS3A 4J2CA 2WWVA 2H7OA 3KV9A 4O8SA 4DR4T 4GYSA 2D5UA 3IF8B 3OYZA 4QX7B 4QWNB 4Z91A 2WZIA 5FP3A 2LT3A 4QH1A 5J2UE 5L3CB 2CEAA 2D0TA 3ANWB 4HFBA 1SUMB 3GA8A 3MACA 1LVFA 4YTMA 3VR9A 3MA9A 1HX1B 1Y01A 4QXCB 2WZHA 1OXZA 2X68A 1WYBA 4U2YA 5AQTB 3RF1A 5HEGA 3AA6B 3C50A 1IBMT 3AE4A 4JBWF 2VKDA 4CI3B 4FJOA 2W2UA 1W9RA 3AA0B 3AXJA 2N2NA 3N2GE 4MBQA 3AE6A 2WWUA 1XDPA 4U72A 4X62T 2LM2A 3TLSA 3TLUA 2KWIB 2X9XA 3CPZA 4FI5A 3PUGA 3AA1B 3K3QC 4HN9A 4N78D 5JDFA 2M6IA 2NW9A 4EYYR 2YU2A 1V9DA 2VKJA 3C4XA 4WBNE 4B3TT 2UUBT 4G2AA 1CHUA 4JI3T 2XSAA 2KNDA 2DHRA 3AE7A 3DP7A 2JMHA 1JNZA 5LBMA 2J47A 2XAGB 3AECA 3FZLB 1IJ6A 2X66A 3EAMA 4OHFA 5HCJA 3RKGA 4GKKT 3ZC1A 1KK7A 3PV0F 4IHJE 2CMRA 1E7PA 2LHRA 2X9YA 4LF5T 2VL0A 4QX8B 4UELA 3V5UA 5EZYE 1HG5A 3PTRB 4GK0E 4AKGA 4AQYT 1HX8A 5CGMA 1MMGA 3LSVA 5KX5E 2W62A 4IE4A 3AE8A 1XZYA 2WDVA 2XUEA 5AQMB 1MNEA 1ZOYA 3N9MA 4O2AE 2MBGA 4DNDA 2MPKA 3E08A 4L5GA 3VRAA 5CJ5A 3NVOA 5JDHA 2X0LB 2BG9C 3QC9A 4PW8A 4CZZB 3J7Yq 1N36T 4HFHA 3B57A 2KXPB 4QXBB 2XQAA 2NW8A 5FXWA 2XHEB 4DV4T 4ZI2C 2HH7A 3P4RA 2CBJA 4OK0A 3CQCB 4I4TE 1HNWT 3M3ZB 2XQ4A 4HWDA 3IBPA 1MMDA 3FBZA 2ODUA 4KX6A 1R8IA 5L3GB 2JIWA 2OA5A 3EDVA 4KBMB 5HEUA 3V5SA 5JDGA 4EEDA 2ODVA 2MAWA 2LKGA 3EABA 3UUBA 2NTXA 3DTOA 4KUMB 3HR0A 4H9RC 3ETUA 4QXHB 4Z90A 2CE7A 4LF8T 1VOMA 3AEAA 4HWCA 4ZZBA 5F3JA 1KF6A 4DR1T 4L9IA 4CQIA 1QSDA 4DV2T 2BG9E 4H9SE 5LOVE 5JDQA 2BS2A 1XMQT 2WU2A 2PBIA 3N9NA 4CN4A 4DR7T 2B1EA 2IIUA 2WCAA 3F31A 3WI3A 5HWXA 1H7CA 5L3DB 3AE5A 1XWMA 1VCSA 1WRDA 5AQVB 5HEHA 2IAKA 4ILCA 5LB7B 1MMNA 2KINB 2IUBA 5AQRB 4ANJA 5BMVE 2XZEA 4IDNA 4JI5T 4X20E 4HKAA 2JMKA 3GWHA 4PFPA 4CI1B 2VKOA 4B3RT 4GK5E 2Y48B 4C90A 4F8HA 3QB5A 5AQSB 4AKHA 3O1IA 3ZJ2A 1WCRA 2CXLA 5IYZE 5LNKA 3SWHA 3L39A 5JQGE 4WBOA 2IC9A 4QHOA 2NR4A 4BA9A 4UV9B 3Q5WA 3RC8A 3HKDE 2CWOA 4WYVA 2L8KA 2XM1A 4TN7B 5HAXA 2Y8DA 5LBQB 2SPCA 3HKBE 4YXDA 4ILUA 2B76A 4TV9E 1I94T 2XQ8A 1UGOA 2UXXB 2D0UA 3ZEFB 4B3MT 3QNUA 3KBTA 3PJAJ 3PUYF 2W4XA 4EOZB 1T72A 2X9HA 1QUUA 2CLYB 2V7LA 2E9XC 3AE9A 4EGWA 5HXSA 5FXXA 3UTKA 5AQHB 3UQ4A 5KMGP 2H7VC 2CRBA 1IAPA 5LMNT 4DV6T 1UX4A 3AEBA 4P0BA 4DUYT 3AAIA 4HEAA 3I0OA 4KP3C 4U33A 4LFBT 5H6RB 3CVRA 3U3IA 1W0AA 1VRBA 1WR0A 4TWFA 3SFEA 5H6QB 1AJ3A 3PUSA 1FMVA 1HNZT 3ZMVB 5AQFB 4IDPA 4NUVA 3VKGA 4JLEA 5FKYA 2WDRA 2K48A 5ADXL 2DI4A 1BR1A 4TZ4C 4PJLA 5HXCA 4PJJA 2QVAA 5AQUB 4UVCB 3T1YT 5HXRA 5FL0A 4CN1A 3EUHA 2LOPA 3JC6D 3KV5A 5LHHB 2WP9A 1NAFA 4HFVA 5FVLA 1IBKT 2Z6EA 3Q9DA 1J1JA 4DV5T 5L47A 4JEHB 4L0RA 1HTJF 1MIYA 2QGSA 2RP4A 1S35A 1US7B 2W0GA 1O3XA 3HKEE 3ZSSA 5BR8T 1N33T 3G06A 4CI2B 1UUSA 1EZ3A 4XBFB 1YKHB 3ZCJA 3B5MA 3BQKA 3NZPA 1XNQT 4NUUA 1WFDA 4F6RC 3VRBA 1N34T 2JQKA 3IHRA 3IA3A 3UQ7A 2CA5A 2HN1A 2LM9A 2CXFA 3FB2A 1G73A 3RYFE 4TX5A 3CWZB 3RQWA 4K0KT 2X51A 2KSRA 3PU3A 3PURA 5JR9C 2RA1A 4HFEA 2LRLA 3GN5B 4I0UA 2D2SA 5FVKA 4DVDA 3ZC0A 3EI0A 3SRZA 2BBJA 2H88A 2C5IT 2K5BB 3H3MA 2JQ9A 3IEEA 2J62A 3PUXF 5TAOA 4IE7A 4YFSA 3ZMUB 5HXEA 5JDNA 5JRCA 2K24A 5DQVA 4O4JE 4COFA 4YT0A 1MMAA 3AE3A 4X1YE 2YN6A 1D0ZA 3LG7A 4A5XA 2E8IA 1J5ET 3ZYMA 3O1HA 4AI6A 3MJXA 3JAEA 1D0YA 2XSBA 1B7TA 1UCUA 3P7IA 4LMLA 3CIRA 4UF0B 5FMNA 4A56A 2CXDA 5L3BB 3QUJA 5LGTB 3AB3B 1MIWA 5L3EB 2ZM8A 3NZQA 3LDQB 4TNWA 3D0TA 3OYXA 4AIUA 5J0ZA 2JRKA 2QA7A 4LF9T 2LHNA 3I1AA 2HPLA 1WLXA 3CX6B 1T7SA 3OJAA 4XZCA 4IE0A 4EXTA 4YTNA 3RIUC 3AVRA 3SS1A 2BKOA 3LBXB 4PK4A 2XAFB 2LEHA 4ZEYA 1HF8A 1LRZA 2CPTA 4P1NA 4XAXB 3RGLA 3SOLA 1WR6A 5ABFB 5LYJE 3PUWF 4ZI2D 2R6GF 3CQGB 3K1SA 4ZXLA 4ERRA 1E2AA 3J9X1 3K3NA 4KHPT 4ISTA 1BR2A 1UURA 1Y64B 3UFGA 2WM9A 3OBVE 3S4UA 3ZMTB 2VWAA 2N9DA 4KMCA 2XAHB 4O4IE 2UXDT 4JI0T 2HHHT 2X0HA 2XQ5A 3BK9A 3N2OA 1ZHCA 1ZP0A 3FBLA 3Q5EA 2DL1A 3QK6A 4QH5A 1UX5A 3RRWA 2XAJB 1GQEA 2CWYA 3CMLA 1ZEEA 2LKHA 4PNIA 3UT5E 4YSZA 5C8YE 2CCQA 1NWMX 5JTGA 1KEYA 4G63A 4DIDB 4LFAT 2DLRA 2VQFT 4H63V 2VVNA 2BDEA 5AQGB 5FXZA 1U5PA 2W66A 4LMKA 3RRCA 3UUMA 4JI7T 3N9LA 2OLTA 4OFZA 4BAYB 4DR6T 4X1IE 3FZMB 5HYAA 4JI6T 3CK6A 2CLYC 3AAEB 4B6XA 4IIJE 4UVAB 3R6NA 2YINA 3PDYA 4HFCA 4I43B 3FXEB 1ZKEA 3I9WA 4M1PA 5LG3A 5JRCB 3PUQA 3EHZA 4GYRA 1KNPA 2JQHA 4H9PC 3ONLC 4IE6A 4DMVA 2UUCT 1U4QA 4OYJA 2D9DA 4EEBA 2XAQB 4EYUA 2UXCT 1WYCA 3C64A 5DJQC 2EHOB 5L4HA 3KVAA 1IZNB 1KNRA 1FIOA 5JVDE 3QB5K 1CUNA 5EK4A 4A98A 4EB6E 4YHHT 4Q25A 2V1DB 2BG9B 2ACXA 2LSYA 3OVUA 3W15B 4BJMA 1YKEB 4HWIB 4UVBB 3ZJ1A 3L3PA 1IBLT 4I55E 3ABVA 3N5LA 4H63H 1S94A 3MXZA 4AKLA 2JQQA 2V7KA 2PG8A 2WU5A 4U7YA 3RC3A 3UUNA 4EV6A 4ILBA 4EZ4A 4PK6A 2BVLA 3L09A 4DR3T 2J1DG 5LGUB 3PUZF 5AQKB 1X79A 2PFVA 2YDSA 3UU6A 4IE5A 3ZN1B 4X64T 2CHOA 3RPUA 1I6ZA 4X65T 2X67A 4TWDA 5JH7E 5J2TE 1W0BA 5AQIB 4BJNA 5LMUT 1MIVA 2V26A 5C3JA 1E1HB 5HWYA 4ZI7E 2UXBT 4DUZT 2VVSA 3P8CD 3NWIA 4YLHA 2W63A 2CBIA 2AE9A 3U78A 2LE8A 2YKSA 5AQNB 1SE7A 5IUXA 4JYAT 3VKHA 5LP6E 1YW0A 4PK5A 4ZS3A 1D1CA 2CHNA 2A9UA 2V5CA 3TKLB 4MFRA 4GKJT 3AXJB 2V6XA 2VURA 3LJCA 3RIAA 2NTYA 2XQ9A 2M67A 3LBXA 4NPPA 1M7KA 4P09A 5AQPB 3ZLIA 4DV7T 4PFOA 3KBUA 3RIUA 5L2LA 3FHNA 1XDOA 4DV3T 2MYSA 5IHYA 3ZCIA 3ZKRA 4LF4T 2NP9A 4AXPA 2X9WA 2XM2A 5LHGB 4DV1T 3FZHB 3OPCA 3NKZA 4HTEA 4IDZA 3RYIE 4ADZA 3ETVA 1HG2A 2H89A 2ZM2A 3MKDA 4CXYA 2C0SA 4AQGA 3MK7C 2I59A 2E5VA 2FBWA 1HS7A 3O4XE 5FYMA 4JV5T 1T98A 2XQ6A 4H9OC 3AE1A 3UULA 1IJ5A 2W61A 2QYWA 2XQ7A 4DR2T 5ABHA 2V8SV 2XTLA 3AAAB 3KV4A 1G8XA 4WNKA 3ZT6A 2ZMAA 2UUAT 2I0MA 2EHOA 3SFDA 4AQFA 5M4YA 3C51A 2H3RA 1LKXA 3JC6C 2WAUA 3ZMSB 2V5DA 4ASKA 4DMWA 4B3ST 2WMNA 1T8BA 2HPJA 2AXDS 2WBLA 3ZMZB 4E7ZA 2FJAA 2NOXA 3A5XA 3HL6A 4HWHA 1HR0T 2ES0A 3JCFA 3N9QA 1YQ4A 3MZKB 2KWHA 3E0ZA 4H9NC 3O1JA 4KI0F 3RQUA 2BS4A 3N2KE 4K0UA 5EK2A 4EAHA 4X5TA 3FZFB 3F57A 3HA4A 4V1Av 2F4VT 5HXHA 2Q9QA 3CQXC 3C4ZA 1ZV4X 3GMIA 4WZXA 3UU8A 4ZI3D 5KDMC 3C4WA 2C5KT 2LJLA 3K3OA 3FZKB 4YTPA 2PJQA 1FEWA 2NW7A 2X0YA 4HFIA 1W09A 2YOEA 3EVYA 2I6HA 4OX9T 5JR9A 3WAKA 5ABGA 3I9YA 2LSKA 3ZPOA 2LSIA 2YEVC 5FXVA 3KV6A 4IL4A 4U3CA 5FY1A 4EIWA 3CX8B 4KHZF 5L4EA 1OEDB 4X66T 1YXRA 3KINB 4UV8B 2VL8A 2VASA 4JI2T 3R84B 1JNRA 5F8PA 3P4SA 3I0QA 3H37A 3ZT7A 2V6YA 1YQ3A 5HCMA 4YSYA 4X1KE 5JDMA 5LG4A 2UU9T 2OV9A 2BKNA 1MNDA 4C91A 1OEDA 4ZHQE 1XNRT 5L3FB 5GONE 3KVBA 4ZZCA 4ZI3C 2V7JA 4E7SA 1KFYA 4TUYE 2NWBA 3AVSA 4UIGA 2E2AA 4U31A 4JI4T 5CA1E 2VQET 4IDOA 3B13A 3ZYLA 5JR9B 3HI2A 2L3LA 4H9QC 2VK9A 2XASB 5CFBA 2MTQA 3LK42 4MALA 2XQ3A 2LSGA 4UR9A 2CM0A 2YK0A 3P50A 3PJAA 2Q9QB 1FMWA 2V7IA 3AEDA 3DJBA 4NIQA 1M62A 5LHIB 4CN6A 5LJNA 4NXMT 1L0VA 4JI8T 4O4HE 3T1HT 3LK2B 2WDQA 2K9AA 2PTFA 3NBXX 3N9PA 4IT4A 3BQLA 3X1DA 4UEMA 1HNXT 4GIWA 3JAFA 1D1BA 2KZ7B 4TNVA 2V6YB 3GN5A 5DABA 3RLFF 3UUXB 4LFCT 3Q2MA 5AQOB 3VHLA 2E9XA 4CXXA 3TLTA 4MHCA 3PE0A 4JUYA 5EK3A 4AISA 3VR8A 5FL1A 5ABFA 3H3AA 2QRXA 4QH4A 4U2ZA 3RYCE 3AEFA 1SHZC 2DWKA 2ACZA 3OKQA 1NENA 4TV8E 1HFAA 2FJDA 4AKRB 3C98B 3RX6A 4O4LE 1HCIA 3ZYKA 4PJMA 2BBHA 2XY8B 2DWGA 5AQLB 4CXWA 3PU8A 4HFDA 5F5WA 3M65A 2IHR1 3CKDA 2ZLYA 3JADA 2MOZA 3K8PC 4I50E 5FY7A 5HEOA 3RIFA 5AFUL 3P4PA 4ILAA 5E0OA 2LRKA 3RI5A 2RPAA 2LSJA 1D1AA 4GOUA 3LFMA 2K3WA 2IC6A 2L9QA 4UF0A 3UFEA 3A7MA 4PAGA 2HN2A 2E5LT 2LLYA 1KNZA 2E9XB 1J5WA 2E9XD 1Z0PA 4OYKA 4YSXA 4DBQA 3F2EA 5JDLA 5IWAT 2P9BA 2DCFA 3FXDB 4DBRA 1FJGT 5J1GA 4YJ2E 2IW5B 2M6BA 4UXNB 1XMOT 3A8YC 2EHOD 2N1GA 1VCTA 4IDQA 4U7IA 5LA6E 3UU5A 5LXTE 4QKNA 4YY3T 1D0XA 3ESLA 3RH3A 1DU2A 3Q5DA 4O2BE 3E22E 1X9BA 3TLVA 3ZN0B 3AEEA 3TLWA 2WMOA 3UU3A 4AKIA 2WQYA 2C5JA 5A1LA 4DV0T 2DNXA 2WB5A 3RHWA 1NEKA 1QLBA 4U74A 2BZBA 3PUVF 2Y6XA 2YDQA 2LOSA 2VKHA 3AEGA 4ISSA 4EZHA 3O9XA 1Z8UA 1BR0A 5AQJB 3RYHE 4HWFA 1OWAA 2FUPA 2VB6A 2YDRA 3KFWX 3BQIA 2EHOC 3CX7B 4AQFC 2KT9A 1YD8G 5HEJA 5ABEA 2KMFA 2ZM0A 2XPKA 4LMJA 1LVKA 5FNVE 3Q5XA 5CB4E 2BG9A 1OEDC 2G0UA 4HGAA 4IL9A 2W00A 4JEUB 3EDUA 3PUAA 3LK3B 1BR4A 2A2FX 3QOFA 3OTOT 5JREA 5LJMA 2FJBA 2BKPA 2YU1A 5C2TA 4YJ3E 5KXJA 3AA7B 2XJ7A 3N9OA 3VU7H 4TWHA 3ZT5A 4MLKA 2BS3A 4NXNT 2ZM6T 2JPFA 2Q9QD 3UU4A 4LF7T 2A72A 3NRXA
chains in the Genus database with same CATH topology
3ONXA 2WSSV 2GK9A 4ZOLE 1SA0E 3HKCE 2KLQA 3KDSE 3T8OA 4Z8XA 5FY0A 5LCYA 2A3DA 2V7MA 4WW0A 3NRYA 2BVMA 4IGUA 4DO0A 5DQWA 5LGNB 4P0AA 2Q9QC 4YHJA 3RKOA 2UXNB 2XQYA 5CA0E 3ANWA 5ETWA 4HE8A 2JJ9A 4PJNA 3WAJA 4ZS2A 4J2CA 2H7OA 3KV9A 4O8SA 4GYSA 2D5UA 3IF8B 3OYZA 4QX7B 4QWNB 5FP3A 2LT3A 5L3CB 5J2UE 2CEAA 2D0TA 3ANWB 3GA8A 3MACA 1LVFA 3MA9A 4QXCB 1OXZA 2X68A 1WYBA 3AA6B 3C50A 2VKDA 4CI3B 4FJOA 3AA0B 2N2NA 3N2GE 4MBQA 2WWUA 4U72A 2KWIB 2X9XA 3CPZA 4FI5A 3PUGA 3AA1B 3K3QC 4HN9A 4N78D 5JDFA 2NW9A 4EYYR 2YU2A 1V9DA 2VKJA 3C4XA 4WBNE 4G2AA 2KNDA 2DHRA 3DP7A 2JMHA 5LBMA 2XAGB 1IJ6A 2X66A 4OHFA 1KK7A 4IHJE 2CMRA 2LHRA 2X9YA 4QX8B 4UELA 3V5UA 5EZYE 1HG5A 3PTRB 4GK0E 4AKGA 1HX8A 1MMGA 5KX5E 2W62A 4IE4A 2XUEA 1MNEA 4O2AE 3N9MA 2MBGA 4DNDA 3E08A 4L5GA 5JDHA 2X0LB 4PW8A 3QC9A 4CZZB 3J7Yq 3B57A 2KXPB 4QXBB 5FXWA 2NW8A 2XHEB 4ZI2C 2HH7A 4OK0A 3CQCB 4I4TE 3IBPA 1MMDA 3FBZA 2ODUA 5L3GB 3EDVA 2OA5A 4KBMB 3V5SA 5JDGA 2ODVA 2NTXA 3DTOA 4KUMB 3HR0A 4H9RC 3ETUA 4QXHB 2CE7A 1VOMA 5F3JA 4L9IA 4CQIA 1QSDA 4H9SE 5LOVE 5JDQA 2PBIA 3N9NA 3F31A 2B1EA 3WI3A 5HWXA 1H7CA 5L3DB 1WRDA 3ZC1A 4ANJA 2IAKA 1MMNA 2KINB 5BMVE 5JDNA 4X20E 4HKAA 2JMKA 3GWHA 4PFPA 4CI1B 2VKOA 4GK5E 2Y48B 4C90A 3O1IA 3ZJ2A 2CXLA 5LNKA 5IYZE 3SWHA 5JQGE 4WBOA 2IC9A 4QHOA 4BA9A 4UV9B 3Q5WA 3RC8A 3HKDE 2CWOA 2L8KA 4TN7B 5HAXA 5LBQB 2Y8DA 2SPCA 3HKBE 4ILUA 4TV9E 2UXXB 2D0UA 3ZEFB 3KBTA 4EOZB 2X9HA 1QUUA 2CLYB 2V7LA 2E9XC 5HXSA 5FXXA 3UTKA 5KMGP 2H7VC 1IAPA 1UX4A 4P0BA 3AAIA 4HEAA 3I0OA 4KP3C 5H6RB 3CVRA 3U3IA 1VRBA 5H6QB 1AJ3A 3PUSA 1FMVA 3ZMVB 4NUVA 3VKGA 4JLEA 2K48A 5ADXL 2DI4A 1BR1A 4TZ4C 4PJLA 5HXCA 4PJJA 4UVCB 5HXRA 3EUHA 2LOPA 3JC6D 3KV5A 5LHHB 1NAFA 4HFVA 2Z6EA 3Q9DA 4JEHB 4L0RA 1HTJF 1MIYA 2QGSA 2RP4A 1S35A 1US7B 2W0GA 1O3XA 3HKEE 4XBFB 4CI2B 1EZ3A 1YKHB 3ZCJA 3NZPA 3BQKA 4NUUA 4F6RC 3IHRA 2CA5A 2LM9A 2CXFA 3FB2A 1G73A 3RYFE 4TX5A 3CWZB 2X51A 3PU3A 3PURA 5JR9C 2RA1A 3GN5B 3ZC0A 2D2SA 4DVDA 3SRZA 2K5BB 2C5IT 4ASKA 3IEEA 5JRCA 5HXEA 3ZMUB 5TAOA 4IE7A 4YFSA 2K24A 5DQVA 4O4JE 1MMAA 4X1YE 1D0ZA 3LG7A 2E8IA 3ZYMA 3O1HA 4AI6A 3MJXA 1D0YA 1B7TA 1UCUA 3P7IA 4UF0B 5FMNA 4A56A 5L3BB 2CXDA 3QUJA 5LGTB 3AB3B 1MIWA 5L3EB 2ZM8A 3NZQA 3D0TA 3OYXA 2JRKA 2QA7A 2LHNA 3I1AA 2HPLA 1WLXA 3CX6B 3OJAA 4XZCA 4EXTA 4IE0A 3AVRA 3SS1A 4PK4A 3LBXB 2XAFB 2LEHA 1HF8A 1LRZA 4XAXB 3SOLA 5LYJE 1WR6A 4ZI2D 3CQGB 4ERRA 3J9X1 3K3NA 4ISTA 1BR2A 1Y64B 2WM9A 3OBVE 3S4UA 3ZMTB 2VWAA 2N9DA 4KMCA 2XAHB 4O4IE 3QK6A 3BK9A 3N2OA 1ZHCA 3FBLA 1UX5A 3RRWA 2XAJB 2CWYA 3CMLA 4PNIA 1ZEEA 3UT5E 2CCQA 1NWMX 4G63A 2DLRA 4H63V 2BDEA 5FXZA 1U5PA 3RRCA 3UUMA 3N9LA 4OFZA 4BAYB 4X1IE 2CLYC 3AAEB 4B6XA 4IIJE 4UVAB 3R6NA 2YINA 3PDYA 4I43B 3FXEB 1ZKEA 3I9WA 4M1PA 3PUQA 4H9PC 4GYRA 4IE6A 4DMVA 1U4QA 4OYJA 2XAQB 4EYUA 1WYCA 3C64A 5DJQC 2EHOB 3KVAA 1IZNB 1FIOA 5JVDE 1CUNA 5EK4A 4EB6E 2V1DB 2ACXA 2LSYA 3W15B 4BJMA 1YKEB 4UVBB 3ZJ1A 3L3PA 4I55E 3N5LA 4H63H 1S94A 3MXZA 4AKLA 2JQQA 2V7KA 2PG8A 3RC3A 4EZ4A 3UUNA 4PK6A 2BVLA 3L09A 2J1DG 5LGUB 3ZN1B 1X79A 2PFVA 4IE5A 3RPUA 2X67A 5JH7E 5J2TE 4BJNA 1MIVA 2V26A 1E1HB 5HWYA 4ZI7E 3P8CD 4YLHA 2W63A 3U78A 2LE8A 3VKHA 5LP6E 1YW0A 4PK5A 4ZS3A 1D1CA 3TKLB 4MFRA 3LJCA 2NTYA 2M67A 3LBXA 4P09A 3ZLIA 1HS7A 4PFOA 3KBUA 5L2LA 3FHNA 2MYSA 5IHYA 3ZCIA 2NP9A 4AXPA 2X9WA 5LHGB 4HTEA 4IDZA 3RYIE 4ADZA 3ETVA 1HG2A 2ZM2A 3MKDA 4CXYA 2C0SA 4AQGA 3MK7C 2I59A 3O4XE 5FYMA 1T98A 4H9OC 3UULA 1IJ5A 2W61A 2XTLA 3AAAB 3KV4A 4WNKA 1G8XA 2ZMAA 2EHOA 4AQFA 5M4YA 3C51A 2H3RA 1LKXA 3JC6C 2WAUA 3ZMSB 4DMWA 2WMNA 2HPJA 2WBLA 3ZMZB 4E7ZA 2NOXA 3A5XA 3HL6A 2ES0A 3N9QA 4H9NC 3MZKB 2KWHA 3E0ZA 5EK2A 3O1JA 3N2KE 4K0UA 4EAHA 3HA4A 3F57A 4V1Av 5HXHA 3GMIA 2Q9QA 3C4ZA 1ZV4X 3CQXC 4ZI3D 5KDMC 3C4WA 2C5KT 2LJLA 3K3OA 2PJQA 1FEWA 2NW7A 3EVYA 5JR9A 3WAKA 3ZPOA 3I9YA 2LSKA 2LSIA 2YEVC 5FXVA 3KV6A 4EIWA 3CX8B 3KINB 4UV8B 2VL8A 2VASA 3R84B 5C8YE 5F8PA 5HYAA 5JRCB 3I0QA 3H37A 4X1KE 5JDMA 5LG4A 1MNDA 4C91A 4ZHQE 5L3FB 5GONE 3KVBA 4ZI3C 2V7JA 4E7SA 4TUYE 2NWBA 3AVSA 4UIGA 5CA1E 3ZYLA 3B13A 5JR9B 3HI2A 2L3LA 4H9QC 2VK9A 2XASB 2MTQA 3LK42 4MALA 2LSGA 2CM0A 2YK0A 2Q9QB 1FMWA 2V7IA 3DJBA 5LHIB 5LJNA 4O4HE 3LK2B 2K9AA 3NBXX 3N9PA 3BQLA 4UEMA 4GIWA 1D1BA 2KZ7B 3UUXB 3GN5A 5DABA 3Q2MA 3VHLA 4CXXA 2E9XA 4MHCA 3PE0A 4JUYA 5EK3A 3H3AA 3RYCE 3OKQA 1SHZC 2DWKA 4TV8E 1HFAA 4AKRB 3C98B 3RX6A 4O4LE 1HCIA 3ZYKA 4PJMA 2DWGA 4CXWA 3PU8A 3M65A 3CKDA 3K8PC 2ZLYA 4I50E 2MOZA 5FY7A 5AFUL 5E0OA 4GOUA 2LSJA 1D1AA 3LFMA 4UF0A 2IC6A 2L9QA 3UFEA 4PAGA 1KNZA 2E9XB 2E9XD 1Z0PA 4OYKA 4DBQA 3F2EA 5JDLA 2P9BA 2DCFA 3FXDB 4DBRA 5J1GA 4YJ2E 2IW5B 4UXNB 2EHOD 2N1GA 5LA6E 5LXTE 4QKNA 1D0XA 3ESLA 3RH3A 4AKHA 4O2BE 3E22E 3ZN0B 2WMOA 4AKIA 2C5JA 5A1LA 2DNXA 4U74A 2BZBA 2Y6XA 2LOSA 2VKHA 4ISSA 4EZHA 3O9XA 1BR0A 3RYHE 1OWAA 2VB6A 3KFWX 3BQIA 2EHOC 3CX7B 4AQFC 2KT9A 1YD8G 2KMFA 2ZM0A 1LVKA 5FNVE 3Q5XA 5CB4E 2G0UA 4HGAA 4JEUB 2W00A 5FY1A 3EDUA 3PUAA 3LK3B 1BR4A 2A2FX 5JREA 5LJMA 2YU1A 4YJ3E 3AA7B 3N9OA 3VU7H 4MLKA 2JPFA 2Q9QD 2A72A 3NRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QUJ A;  1IJ5 A;  1IJ6 A;  2XTL A;  1LVF A;  2CA5 A;  2IC6 A;  3CVR A;  3TKL B;  3L3P A;  2X9Y A;  3N5L A;  1Z0P A;  1LRZ A;  2IC9 A;  3MXZ A;  2K48 A;  3FXD B;  4B6X A;  2C5I T;  2KWH A;  3FXE B;  2X9W A;  2MBG A;  1ZKE A;  2KWI B;  2X9X A;  3S4U A;  4DND A;  4FI5 A;  2G0U A;  4EYY R;  3QK6 A;  4CQI A;  1QSD A;  4J2C A;  4L0R A;  2C5K T;  2C5J A;  1H7C A;  3P7I A;  3CKD A; 
#chains in the Genus database with same CATH topology
 3P4W A;  3ONX A;  2WSS V;  4IRE A;  2GK9 A;  3L8R A;  1SA0 E;  4ZOL E;  3ZST A;  2IDO B;  3HKC E;  1N32 T;  2KLQ A;  3KDS E;  2WY2 A;  3T8O A;  1UK5 A;  4Z8X A;  5FY0 A;  3P4Q A;  5LCY A;  2A3D A;  2V7M A;  4WW0 A;  3NRY A;  2BVM A;  4IGU A;  4DO0 A;  5DQW A;  4A97 A;  5LGN B;  4P0A A;  2Q9Q C;  4YHJ A;  3RKO A;  2J4G A;  5AQQ B;  2UXN B;  2XQY A;  2W67 A;  4LF6 T;  2FJE A;  5CA0 E;  3ANW A;  3AE2 A;  3ONJ A;  4HE8 A;  2JJ9 A;  1OED E;  4PJN A;  5ETW A;  4DR5 T;  4JI1 T;  3WAJ A;  4ZS2 A;  2IML A;  2WS3 A;  4J2C A;  2WWV A;  2H7O A;  3KV9 A;  4O8S A;  4DR4 T;  4GYS A;  2D5U A;  3IF8 B;  3OYZ A;  4QX7 B;  4QWN B;  4Z91 A;  2WZI A;  5FP3 A;  2LT3 A;  4QH1 A;  5J2U E;  5L3C B;  2CEA A;  2D0T A;  3ANW B;  4HFB A;  1SUM B;  3GA8 A;  3MAC A;  1LVF A;  4YTM A;  3VR9 A;  3MA9 A;  1HX1 B;  1Y01 A;  4QXC B;  2WZH A;  1OXZ A;  2X68 A;  1WYB A;  4U2Y A;  5AQT B;  3RF1 A;  5HEG A;  3AA6 B;  3C50 A;  1IBM T;  3AE4 A;  4JBW F;  2VKD A;  4CI3 B;  4FJO A;  2W2U A;  1W9R A;  3AA0 B;  3AXJ A;  2N2N A;  3N2G E;  4MBQ A;  3AE6 A;  2WWU A;  1XDP A;  4U72 A;  4X62 T;  2LM2 A;  3TLS A;  3TLU A;  2KWI B;  2X9X A;  3CPZ A;  4FI5 A;  3PUG A;  3AA1 B;  3K3Q C;  4HN9 A;  4N78 D;  5JDF A;  2M6I A;  2NW9 A;  4EYY R;  2YU2 A;  1V9D A;  2VKJ A;  3C4X A;  4WBN E;  4B3T T;  2UUB T;  4G2A A;  1CHU A;  4JI3 T;  2XSA A;  2KND A;  2DHR A;  3AE7 A;  3DP7 A;  2JMH A;  1JNZ A;  5LBM A;  2J47 A;  2XAG B;  3AEC A;  3FZL B;  1IJ6 A;  2X66 A;  3EAM A;  4OHF A;  5HCJ A;  3RKG A;  4GKK T;  3ZC1 A;  1KK7 A;  3PV0 F;  4IHJ E;  2CMR A;  1E7P A;  2LHR A;  2X9Y A;  4LF5 T;  2VL0 A;  4QX8 B;  4UEL A;  3V5U A;  5EZY E;  1HG5 A;  3PTR B;  4GK0 E;  4AKG A;  4AQY T;  1HX8 A;  5CGM A;  1MMG A;  3LSV A;  5KX5 E;  2W62 A;  4IE4 A;  3AE8 A;  1XZY A;  2WDV A;  2XUE A;  5AQM B;  1MNE A;  1ZOY A;  3N9M A;  4O2A E;  2MBG A;  4DND A;  2MPK A;  3E08 A;  4L5G A;  3VRA A;  5CJ5 A;  3NVO A;  5JDH A;  2X0L B;  2BG9 C;  3QC9 A;  4PW8 A;  4CZZ B;  3J7Y q;  1N36 T;  4HFH A;  3B57 A;  2KXP B;  4QXB B;  2XQA A;  2NW8 A;  5FXW A;  2XHE B;  4DV4 T;  4ZI2 C;  2HH7 A;  3P4R A;  2CBJ A;  4OK0 A;  3CQC B;  4I4T E;  1HNW T;  3M3Z B;  2XQ4 A;  4HWD A;  3IBP A;  1MMD A;  3FBZ A;  2ODU A;  4KX6 A;  1R8I A;  5L3G B;  2JIW A;  2OA5 A;  3EDV A;  4KBM B;  5HEU A;  3V5S A;  5JDG A;  4EED A;  2ODV A;  2MAW A;  2LKG A;  3EAB A;  3UUB A;  2NTX A;  3DTO A;  4KUM B;  3HR0 A;  4H9R C;  3ETU A;  4QXH B;  4Z90 A;  2CE7 A;  4LF8 T;  1VOM A;  3AEA A;  4HWC A;  4ZZB A;  5F3J A;  1KF6 A;  4DR1 T;  4L9I A;  4CQI A;  1QSD A;  4DV2 T;  2BG9 E;  4H9S E;  5LOV E;  5JDQ A;  2BS2 A;  1XMQ T;  2WU2 A;  2PBI A;  3N9N A;  4CN4 A;  4DR7 T;  2B1E A;  2IIU A;  2WCA A;  3F31 A;  3WI3 A;  5HWX A;  1H7C A;  5L3D B;  3AE5 A;  1XWM A;  1VCS A;  1WRD A;  5AQV B;  5HEH A;  2IAK A;  4ILC A;  5LB7 B;  1MMN A;  2KIN B;  2IUB A;  5AQR B;  4ANJ A;  5BMV E;  2XZE A;  4IDN A;  4JI5 T;  4X20 E;  4HKA A;  2JMK A;  3GWH A;  4PFP A;  4CI1 B;  2VKO A;  4B3R T;  4GK5 E;  2Y48 B;  4C90 A;  4F8H A;  3QB5 A;  5AQS B;  4AKH A;  3O1I A;  3ZJ2 A;  1WCR A;  2CXL A;  5IYZ E;  5LNK A;  3SWH A;  3L39 A;  5JQG E;  4WBO A;  2IC9 A;  4QHO A;  2NR4 A;  4BA9 A;  4UV9 B;  3Q5W A;  3RC8 A;  3HKD E;  2CWO A;  4WYV A;  2L8K A;  2XM1 A;  4TN7 B;  5HAX A;  2Y8D A;  5LBQ B;  2SPC A;  3HKB E;  4YXD A;  4ILU A;  2B76 A;  4TV9 E;  1I94 T;  2XQ8 A;  1UGO A;  2UXX B;  2D0U A;  3ZEF B;  4B3M T;  3QNU A;  3KBT A;  3PJA J;  3PUY F;  2W4X A;  4EOZ B;  1T72 A;  2X9H A;  1QUU A;  2CLY B;  2V7L A;  2E9X C;  3AE9 A;  4EGW A;  5HXS A;  5FXX A;  3UTK A;  5AQH B;  3UQ4 A;  5KMG P;  2H7V C;  2CRB A;  1IAP A;  5LMN T;  4DV6 T;  1UX4 A;  3AEB A;  4P0B A;  4DUY T;  3AAI A;  4HEA A;  3I0O A;  4KP3 C;  4U33 A;  4LFB T;  5H6R B;  3CVR A;  3U3I A;  1W0A A;  1VRB A;  1WR0 A;  4TWF A;  3SFE A;  5H6Q B;  1AJ3 A;  3PUS A;  1FMV A;  1HNZ T;  3ZMV B;  5AQF B;  4IDP A;  4NUV A;  3VKG A;  4JLE A;  5FKY A;  2WDR A;  2K48 A;  5ADX L;  2DI4 A;  1BR1 A;  4TZ4 C;  4PJL A;  5HXC A;  4PJJ A;  2QVA A;  5AQU B;  4UVC B;  3T1Y T;  5HXR A;  5FL0 A;  4CN1 A;  3EUH A;  2LOP A;  3JC6 D;  3KV5 A;  5LHH B;  2WP9 A;  1NAF A;  4HFV A;  5FVL A;  1IBK T;  2Z6E A;  3Q9D A;  1J1J A;  4DV5 T;  5L47 A;  4JEH B;  4L0R A;  1HTJ F;  1MIY A;  2QGS A;  2RP4 A;  1S35 A;  1US7 B;  2W0G A;  1O3X A;  3HKE E;  3ZSS A;  5BR8 T;  1N33 T;  3G06 A;  4CI2 B;  1UUS A;  1EZ3 A;  4XBF B;  1YKH B;  3ZCJ A;  3B5M A;  3BQK A;  3NZP A;  1XNQ T;  4NUU A;  1WFD A;  4F6R C;  3VRB A;  1N34 T;  2JQK A;  3IHR A;  3IA3 A;  3UQ7 A;  2CA5 A;  2HN1 A;  2LM9 A;  2CXF A;  3FB2 A;  1G73 A;  3RYF E;  4TX5 A;  3CWZ B;  3RQW A;  4K0K T;  2X51 A;  2KSR A;  3PU3 A;  3PUR A;  5JR9 C;  2RA1 A;  4HFE A;  2LRL A;  3GN5 B;  4I0U A;  2D2S A;  5FVK A;  4DVD A;  3ZC0 A;  3EI0 A;  3SRZ A;  2BBJ A;  2H88 A;  2C5I T;  2K5B B;  3H3M A;  2JQ9 A;  3IEE A;  2J62 A;  3PUX F;  5TAO A;  4IE7 A;  4YFS A;  3ZMU B;  5HXE A;  5JDN A;  5JRC A;  2K24 A;  5DQV A;  4O4J E;  4COF A;  4YT0 A;  1MMA A;  3AE3 A;  4X1Y E;  2YN6 A;  1D0Z A;  3LG7 A;  4A5X A;  2E8I A;  1J5E T;  3ZYM A;  3O1H A;  4AI6 A;  3MJX A;  3JAE A;  1D0Y A;  2XSB A;  1B7T A;  1UCU A;  3P7I A;  4LML A;  3CIR A;  4UF0 B;  5FMN A;  4A56 A;  2CXD A;  5L3B B;  3QUJ A;  5LGT B;  3AB3 B;  1MIW A;  5L3E B;  2ZM8 A;  3NZQ A;  3LDQ B;  4TNW A;  3D0T A;  3OYX A;  4AIU A;  5J0Z A;  2JRK A;  2QA7 A;  4LF9 T;  2LHN A;  3I1A A;  2HPL A;  1WLX A;  3CX6 B;  1T7S A;  3OJA A;  4XZC A;  4IE0 A;  4EXT A;  4YTN A;  3RIU C;  3AVR A;  3SS1 A;  2BKO A;  3LBX B;  4PK4 A;  2XAF B;  2LEH A;  4ZEY A;  1HF8 A;  1LRZ A;  2CPT A;  4P1N A;  4XAX B;  3RGL A;  3SOL A;  1WR6 A;  5ABF B;  5LYJ E;  3PUW F;  4ZI2 D;  2R6G F;  3CQG B;  3K1S A;  4ZXL A;  4ERR A;  1E2A A;  3J9X 1;  3K3N A;  4KHP T;  4IST A;  1BR2 A;  1UUR A;  1Y64 B;  3UFG A;  2WM9 A;  3OBV E;  3S4U A;  3ZMT B;  2VWA A;  2N9D A;  4KMC A;  2XAH B;  4O4I E;  2UXD T;  4JI0 T;  2HHH T;  2X0H A;  2XQ5 A;  3BK9 A;  3N2O A;  1ZHC A;  1ZP0 A;  3FBL A;  3Q5E A;  2DL1 A;  3QK6 A;  4QH5 A;  1UX5 A;  3RRW A;  2XAJ B;  1GQE A;  2CWY A;  3CML A;  1ZEE A;  2LKH A;  4PNI A;  3UT5 E;  4YSZ A;  5C8Y E;  2CCQ A;  1NWM X;  5JTG A;  1KEY A;  4G63 A;  4DID B;  4LFA T;  2DLR A;  2VQF T;  4H63 V;  2VVN A;  2BDE A;  5AQG B;  5FXZ A;  1U5P A;  2W66 A;  4LMK A;  3RRC A;  3UUM A;  4JI7 T;  3N9L A;  2OLT A;  4OFZ A;  4BAY B;  4DR6 T;  4X1I E;  3FZM B;  5HYA A;  4JI6 T;  3CK6 A;  2CLY C;  3AAE B;  4B6X A;  4IIJ E;  4UVA B;  3R6N A;  2YIN A;  3PDY A;  4HFC A;  4I43 B;  3FXE B;  1ZKE A;  3I9W A;  4M1P A;  5LG3 A;  5JRC B;  3PUQ A;  3EHZ A;  4GYR A;  1KNP A;  2JQH A;  4H9P C;  3ONL C;  4IE6 A;  4DMV A;  2UUC T;  1U4Q A;  4OYJ A;  2D9D A;  4EEB A;  2XAQ B;  4EYU A;  2UXC T;  1WYC A;  3C64 A;  5DJQ C;  2EHO B;  5L4H A;  3KVA A;  1IZN B;  1KNR A;  1FIO A;  5JVD E;  3QB5 K;  1CUN A;  5EK4 A;  4A98 A;  4EB6 E;  4YHH T;  4Q25 A;  2V1D B;  2BG9 B;  2ACX A;  2LSY A;  3OVU A;  3W15 B;  4BJM A;  1YKE B;  4HWI B;  4UVB B;  3ZJ1 A;  3L3P A;  1IBL T;  4I55 E;  3ABV A;  3N5L A;  4H63 H;  1S94 A;  3MXZ A;  4AKL A;  2JQQ A;  2V7K A;  2PG8 A;  2WU5 A;  4U7Y A;  3RC3 A;  3UUN A;  4EV6 A;  4ILB A;  4EZ4 A;  4PK6 A;  2BVL A;  3L09 A;  4DR3 T;  2J1D G;  5LGU B;  3PUZ F;  5AQK B;  1X79 A;  2PFV A;  2YDS A;  3UU6 A;  4IE5 A;  3ZN1 B;  4X64 T;  2CHO A;  3RPU A;  1I6Z A;  4X65 T;  2X67 A;  4TWD A;  5JH7 E;  5J2T E;  1W0B A;  5AQI B;  4BJN A;  5LMU T;  1MIV A;  2V26 A;  5C3J A;  1E1H B;  5HWY A;  4ZI7 E;  2UXB T;  4DUZ T;  2VVS A;  3P8C D;  3NWI A;  4YLH A;  2W63 A;  2CBI A;  2AE9 A;  3U78 A;  2LE8 A;  2YKS A;  5AQN B;  1SE7 A;  5IUX A;  4JYA T;  3VKH A;  5LP6 E;  1YW0 A;  4PK5 A;  4ZS3 A;  1D1C A;  2CHN A;  2A9U A;  2V5C A;  3TKL B;  4MFR A;  4GKJ T;  3AXJ B;  2V6X A;  2VUR A;  3LJC A;  3RIA A;  2NTY A;  2XQ9 A;  2M67 A;  3LBX A;  4NPP A;  1M7K A;  4P09 A;  5AQP B;  3ZLI A;  4DV7 T;  4PFO A;  3KBU A;  3RIU A;  5L2L A;  3FHN A;  1XDO A;  4DV3 T;  2MYS A;  5IHY A;  3ZCI A;  3ZKR A;  4LF4 T;  2NP9 A;  4AXP A;  2X9W A;  2XM2 A;  5LHG B;  4DV1 T;  3FZH B;  3OPC A;  3NKZ A;  4HTE A;  4IDZ A;  3RYI E;  4ADZ A;  3ETV A;  1HG2 A;  2H89 A;  2ZM2 A;  3MKD A;  4CXY A;  2C0S A;  4AQG A;  3MK7 C;  2I59 A;  2E5V A;  2FBW A;  1HS7 A;  3O4X E;  5FYM A;  4JV5 T;  1T98 A;  2XQ6 A;  4H9O C;  3AE1 A;  3UUL A;  1IJ5 A;  2W61 A;  2QYW A;  2XQ7 A;  4DR2 T;  5ABH A;  2V8S V;  2XTL A;  3AAA B;  3KV4 A;  1G8X A;  4WNK A;  3ZT6 A;  2ZMA A;  2UUA T;  2I0M A;  2EHO A;  3SFD A;  4AQF A;  5M4Y A;  3C51 A;  2H3R A;  1LKX A;  3JC6 C;  2WAU A;  3ZMS B;  2V5D A;  4ASK A;  4DMW A;  4B3S T;  2WMN A;  1T8B A;  2HPJ A;  2AXD S;  2WBL A;  3ZMZ B;  4E7Z A;  2FJA A;  2NOX A;  3A5X A;  3HL6 A;  4HWH A;  1HR0 T;  2ES0 A;  3JCF A;  3N9Q A;  1YQ4 A;  3MZK B;  2KWH A;  3E0Z A;  4H9N C;  3O1J A;  4KI0 F;  3RQU A;  2BS4 A;  3N2K E;  4K0U A;  5EK2 A;  4EAH A;  4X5T A;  3FZF B;  3F57 A;  3HA4 A;  4V1A v;  2F4V T;  5HXH A;  2Q9Q A;  3CQX C;  3C4Z A;  1ZV4 X;  3GMI A;  4WZX A;  3UU8 A;  4ZI3 D;  5KDM C;  3C4W A;  2C5K T;  2LJL A;  3K3O A;  3FZK B;  4YTP A;  2PJQ A;  1FEW A;  2NW7 A;  2X0Y A;  4HFI A;  1W09 A;  2YOE A;  3EVY A;  2I6H A;  4OX9 T;  5JR9 A;  3WAK A;  5ABG A;  3I9Y A;  2LSK A;  3ZPO A;  2LSI A;  2YEV C;  5FXV A;  3KV6 A;  4IL4 A;  4U3C A;  5FY1 A;  4EIW A;  3CX8 B;  4KHZ F;  5L4E A;  1OED B;  4X66 T;  1YXR A;  3KIN B;  4UV8 B;  2VL8 A;  2VAS A;  4JI2 T;  3R84 B;  1JNR A;  5F8P A;  3P4S A;  3I0Q A;  3H37 A;  3ZT7 A;  2V6Y A;  1YQ3 A;  5HCM A;  4YSY A;  4X1K E;  5JDM A;  5LG4 A;  2UU9 T;  2OV9 A;  2BKN A;  1MND A;  4C91 A;  1OED A;  4ZHQ E;  1XNR T;  5L3F B;  5GON E;  3KVB A;  4ZZC A;  4ZI3 C;  2V7J A;  4E7S A;  1KFY A;  4TUY E;  2NWB A;  3AVS A;  4UIG A;  2E2A A;  4U31 A;  4JI4 T;  5CA1 E;  2VQE T;  4IDO A;  3B13 A;  3ZYL A;  5JR9 B;  3HI2 A;  2L3L A;  4H9Q C;  2VK9 A;  2XAS B;  5CFB A;  2MTQ A;  3LK4 2;  4MAL A;  2XQ3 A;  2LSG A;  4UR9 A;  2CM0 A;  2YK0 A;  3P50 A;  3PJA A;  2Q9Q B;  1FMW A;  2V7I A;  3AED A;  3DJB A;  4NIQ A;  1M62 A;  5LHI B;  4CN6 A;  5LJN A;  4NXM T;  1L0V A;  4JI8 T;  4O4H E;  3T1H T;  3LK2 B;  2WDQ A;  2K9A A;  2PTF A;  3NBX X;  3N9P A;  4IT4 A;  3BQL A;  3X1D A;  4UEM A;  1HNX T;  4GIW A;  3JAF A;  1D1B A;  2KZ7 B;  4TNV A;  2V6Y B;  3GN5 A;  5DAB A;  3RLF F;  3UUX B;  4LFC T;  3Q2M A;  5AQO B;  3VHL A;  2E9X A;  4CXX A;  3TLT A;  4MHC A;  3PE0 A;  4JUY A;  5EK3 A;  4AIS A;  3VR8 A;  5FL1 A;  5ABF A;  3H3A A;  2QRX A;  4QH4 A;  4U2Z A;  3RYC E;  3AEF A;  1SHZ C;  2DWK A;  2ACZ A;  3OKQ A;  1NEN A;  4TV8 E;  1HFA A;  2FJD A;  4AKR B;  3C98 B;  3RX6 A;  4O4L E;  1HCI A;  3ZYK A;  4PJM A;  2BBH A;  2XY8 B;  2DWG A;  5AQL B;  4CXW A;  3PU8 A;  4HFD A;  5F5W A;  3M65 A;  2IHR 1;  3CKD A;  2ZLY A;  3JAD A;  2MOZ A;  3K8P C;  4I50 E;  5FY7 A;  5HEO A;  3RIF A;  5AFU L;  3P4P A;  4ILA A;  5E0O A;  2LRK A;  3RI5 A;  2RPA A;  2LSJ A;  1D1A A;  4GOU A;  3LFM A;  2K3W A;  2IC6 A;  2L9Q A;  4UF0 A;  3UFE A;  3A7M A;  4PAG A;  2HN2 A;  2E5L T;  2LLY A;  1KNZ A;  2E9X B;  1J5W A;  2E9X D;  1Z0P A;  4OYK A;  4YSX A;  4DBQ A;  3F2E A;  5JDL A;  5IWA T;  2P9B A;  2DCF A;  3FXD B;  4DBR A;  1FJG T;  5J1G A;  4YJ2 E;  2IW5 B;  2M6B A;  4UXN B;  1XMO T;  3A8Y C;  2EHO D;  2N1G A;  1VCT A;  4IDQ A;  4U7I A;  5LA6 E;  3UU5 A;  5LXT E;  4QKN A;  4YY3 T;  1D0X A;  3ESL A;  3RH3 A;  1DU2 A;  3Q5D A;  4O2B E;  3E22 E;  1X9B A;  3TLV A;  3ZN0 B;  3AEE A;  3TLW A;  2WMO A;  3UU3 A;  4AKI A;  2WQY A;  2C5J A;  5A1L A;  4DV0 T;  2DNX A;  2WB5 A;  3RHW A;  1NEK A;  1QLB A;  4U74 A;  2BZB A;  3PUV F;  2Y6X A;  2YDQ A;  2LOS A;  2VKH A;  3AEG A;  4ISS A;  4EZH A;  3O9X A;  1Z8U A;  1BR0 A;  5AQJ B;  3RYH E;  4HWF A;  1OWA A;  2FUP A;  2VB6 A;  2YDR A;  3KFW X;  3BQI A;  2EHO C;  3CX7 B;  4AQF C;  2KT9 A;  1YD8 G;  5HEJ A;  5ABE A;  2KMF A;  2ZM0 A;  2XPK A;  4LMJ A;  1LVK A;  5FNV E;  3Q5X A;  5CB4 E;  2BG9 A;  1OED C;  2G0U A;  4HGA A;  4IL9 A;  2W00 A;  4JEU B;  3EDU A;  3PUA A;  3LK3 B;  1BR4 A;  2A2F X;  3QOF A;  3OTO T;  5JRE A;  5LJM A;  2FJB A;  2BKP A;  2YU1 A;  5C2T A;  4YJ3 E;  5KXJ A;  3AA7 B;  2XJ7 A;  3N9O A;  3VU7 H;  4TWH A;  3ZT5 A;  4MLK A;  2BS3 A;  4NXN T;  2ZM6 T;  2JPF A;  2Q9Q D;  3UU4 A;  4LF7 T;  2A72 A;  3NRX A; 
#chains in the Genus database with same CATH homology
 3ONX A;  2WSS V;  2GK9 A;  4ZOL E;  1SA0 E;  3HKC E;  2KLQ A;  3KDS E;  3T8O A;  4Z8X A;  5FY0 A;  5LCY A;  2A3D A;  2V7M A;  4WW0 A;  3NRY A;  2BVM A;  4IGU A;  4DO0 A;  5DQW A;  5LGN B;  4P0A A;  2Q9Q C;  4YHJ A;  3RKO A;  2UXN B;  2XQY A;  5CA0 E;  3ANW A;  5ETW A;  4HE8 A;  2JJ9 A;  4PJN A;  3WAJ A;  4ZS2 A;  4J2C A;  2H7O A;  3KV9 A;  4O8S A;  4GYS A;  2D5U A;  3IF8 B;  3OYZ A;  4QX7 B;  4QWN B;  5FP3 A;  2LT3 A;  5L3C B;  5J2U E;  2CEA A;  2D0T A;  3ANW B;  3GA8 A;  3MAC A;  1LVF A;  3MA9 A;  4QXC B;  1OXZ A;  2X68 A;  1WYB A;  3AA6 B;  3C50 A;  2VKD A;  4CI3 B;  4FJO A;  3AA0 B;  2N2N A;  3N2G E;  4MBQ A;  2WWU A;  4U72 A;  2KWI B;  2X9X A;  3CPZ A;  4FI5 A;  3PUG A;  3AA1 B;  3K3Q C;  4HN9 A;  4N78 D;  5JDF A;  2NW9 A;  4EYY R;  2YU2 A;  1V9D A;  2VKJ A;  3C4X A;  4WBN E;  4G2A A;  2KND A;  2DHR A;  3DP7 A;  2JMH A;  5LBM A;  2XAG B;  1IJ6 A;  2X66 A;  4OHF A;  1KK7 A;  4IHJ E;  2CMR A;  2LHR A;  2X9Y A;  4QX8 B;  4UEL A;  3V5U A;  5EZY E;  1HG5 A;  3PTR B;  4GK0 E;  4AKG A;  1HX8 A;  1MMG A;  5KX5 E;  2W62 A;  4IE4 A;  2XUE A;  1MNE A;  4O2A E;  3N9M A;  2MBG A;  4DND A;  3E08 A;  4L5G A;  5JDH A;  2X0L B;  4PW8 A;  3QC9 A;  4CZZ B;  3J7Y q;  3B57 A;  2KXP B;  4QXB B;  5FXW A;  2NW8 A;  2XHE B;  4ZI2 C;  2HH7 A;  4OK0 A;  3CQC B;  4I4T E;  3IBP A;  1MMD A;  3FBZ A;  2ODU A;  5L3G B;  3EDV A;  2OA5 A;  4KBM B;  3V5S A;  5JDG A;  2ODV A;  2NTX A;  3DTO A;  4KUM B;  3HR0 A;  4H9R C;  3ETU A;  4QXH B;  2CE7 A;  1VOM A;  5F3J A;  4L9I A;  4CQI A;  1QSD A;  4H9S E;  5LOV E;  5JDQ A;  2PBI A;  3N9N A;  3F31 A;  2B1E A;  3WI3 A;  5HWX A;  1H7C A;  5L3D B;  1WRD A;  3ZC1 A;  4ANJ A;  2IAK A;  1MMN A;  2KIN B;  5BMV E;  5JDN A;  4X20 E;  4HKA A;  2JMK A;  3GWH A;  4PFP A;  4CI1 B;  2VKO A;  4GK5 E;  2Y48 B;  4C90 A;  3O1I A;  3ZJ2 A;  2CXL A;  5LNK A;  5IYZ E;  3SWH A;  5JQG E;  4WBO A;  2IC9 A;  4QHO A;  4BA9 A;  4UV9 B;  3Q5W A;  3RC8 A;  3HKD E;  2CWO A;  2L8K A;  4TN7 B;  5HAX A;  5LBQ B;  2Y8D A;  2SPC A;  3HKB E;  4ILU A;  4TV9 E;  2UXX B;  2D0U A;  3ZEF B;  3KBT A;  4EOZ B;  2X9H A;  1QUU A;  2CLY B;  2V7L A;  2E9X C;  5HXS A;  5FXX A;  3UTK A;  5KMG P;  2H7V C;  1IAP A;  1UX4 A;  4P0B A;  3AAI A;  4HEA A;  3I0O A;  4KP3 C;  5H6R B;  3CVR A;  3U3I A;  1VRB A;  5H6Q B;  1AJ3 A;  3PUS A;  1FMV A;  3ZMV B;  4NUV A;  3VKG A;  4JLE A;  2K48 A;  5ADX L;  2DI4 A;  1BR1 A;  4TZ4 C;  4PJL A;  5HXC A;  4PJJ A;  4UVC B;  5HXR A;  3EUH A;  2LOP A;  3JC6 D;  3KV5 A;  5LHH B;  1NAF A;  4HFV A;  2Z6E A;  3Q9D A;  4JEH B;  4L0R A;  1HTJ F;  1MIY A;  2QGS A;  2RP4 A;  1S35 A;  1US7 B;  2W0G A;  1O3X A;  3HKE E;  4XBF B;  4CI2 B;  1EZ3 A;  1YKH B;  3ZCJ A;  3NZP A;  3BQK A;  4NUU A;  4F6R C;  3IHR A;  2CA5 A;  2LM9 A;  2CXF A;  3FB2 A;  1G73 A;  3RYF E;  4TX5 A;  3CWZ B;  2X51 A;  3PU3 A;  3PUR A;  5JR9 C;  2RA1 A;  3GN5 B;  3ZC0 A;  2D2S A;  4DVD A;  3SRZ A;  2K5B B;  2C5I T;  4ASK A;  3IEE A;  5JRC A;  5HXE A;  3ZMU B;  5TAO A;  4IE7 A;  4YFS A;  2K24 A;  5DQV A;  4O4J E;  1MMA A;  4X1Y E;  1D0Z A;  3LG7 A;  2E8I A;  3ZYM A;  3O1H A;  4AI6 A;  3MJX A;  1D0Y A;  1B7T A;  1UCU A;  3P7I A;  4UF0 B;  5FMN A;  4A56 A;  5L3B B;  2CXD A;  3QUJ A;  5LGT B;  3AB3 B;  1MIW A;  5L3E B;  2ZM8 A;  3NZQ A;  3D0T A;  3OYX A;  2JRK A;  2QA7 A;  2LHN A;  3I1A A;  2HPL A;  1WLX A;  3CX6 B;  3OJA A;  4XZC A;  4EXT A;  4IE0 A;  3AVR A;  3SS1 A;  4PK4 A;  3LBX B;  2XAF B;  2LEH A;  1HF8 A;  1LRZ A;  4XAX B;  3SOL A;  5LYJ E;  1WR6 A;  4ZI2 D;  3CQG B;  4ERR A;  3J9X 1;  3K3N A;  4IST A;  1BR2 A;  1Y64 B;  2WM9 A;  3OBV E;  3S4U A;  3ZMT B;  2VWA A;  2N9D A;  4KMC A;  2XAH B;  4O4I E;  3QK6 A;  3BK9 A;  3N2O A;  1ZHC A;  3FBL A;  1UX5 A;  3RRW A;  2XAJ B;  2CWY A;  3CML A;  4PNI A;  1ZEE A;  3UT5 E;  2CCQ A;  1NWM X;  4G63 A;  2DLR A;  4H63 V;  2BDE A;  5FXZ A;  1U5P A;  3RRC A;  3UUM A;  3N9L A;  4OFZ A;  4BAY B;  4X1I E;  2CLY C;  3AAE B;  4B6X A;  4IIJ E;  4UVA B;  3R6N A;  2YIN A;  3PDY A;  4I43 B;  3FXE B;  1ZKE A;  3I9W A;  4M1P A;  3PUQ A;  4H9P C;  4GYR A;  4IE6 A;  4DMV A;  1U4Q A;  4OYJ A;  2XAQ B;  4EYU A;  1WYC A;  3C64 A;  5DJQ C;  2EHO B;  3KVA A;  1IZN B;  1FIO A;  5JVD E;  1CUN A;  5EK4 A;  4EB6 E;  2V1D B;  2ACX A;  2LSY A;  3W15 B;  4BJM A;  1YKE B;  4UVB B;  3ZJ1 A;  3L3P A;  4I55 E;  3N5L A;  4H63 H;  1S94 A;  3MXZ A;  4AKL A;  2JQQ A;  2V7K A;  2PG8 A;  3RC3 A;  4EZ4 A;  3UUN A;  4PK6 A;  2BVL A;  3L09 A;  2J1D G;  5LGU B;  3ZN1 B;  1X79 A;  2PFV A;  4IE5 A;  3RPU A;  2X67 A;  5JH7 E;  5J2T E;  4BJN A;  1MIV A;  2V26 A;  1E1H B;  5HWY A;  4ZI7 E;  3P8C D;  4YLH A;  2W63 A;  3U78 A;  2LE8 A;  3VKH A;  5LP6 E;  1YW0 A;  4PK5 A;  4ZS3 A;  1D1C A;  3TKL B;  4MFR A;  3LJC A;  2NTY A;  2M67 A;  3LBX A;  4P09 A;  3ZLI A;  1HS7 A;  4PFO A;  3KBU A;  5L2L A;  3FHN A;  2MYS A;  5IHY A;  3ZCI A;  2NP9 A;  4AXP A;  2X9W A;  5LHG B;  4HTE A;  4IDZ A;  3RYI E;  4ADZ A;  3ETV A;  1HG2 A;  2ZM2 A;  3MKD A;  4CXY A;  2C0S A;  4AQG A;  3MK7 C;  2I59 A;  3O4X E;  5FYM A;  1T98 A;  4H9O C;  3UUL A;  1IJ5 A;  2W61 A;  2XTL A;  3AAA B;  3KV4 A;  4WNK A;  1G8X A;  2ZMA A;  2EHO A;  4AQF A;  5M4Y A;  3C51 A;  2H3R A;  1LKX A;  3JC6 C;  2WAU A;  3ZMS B;  4DMW A;  2WMN A;  2HPJ A;  2WBL A;  3ZMZ B;  4E7Z A;  2NOX A;  3A5X A;  3HL6 A;  2ES0 A;  3N9Q A;  4H9N C;  3MZK B;  2KWH A;  3E0Z A;  5EK2 A;  3O1J A;  3N2K E;  4K0U A;  4EAH A;  3HA4 A;  3F57 A;  4V1A v;  5HXH A;  3GMI A;  2Q9Q A;  3C4Z A;  1ZV4 X;  3CQX C;  4ZI3 D;  5KDM C;  3C4W A;  2C5K T;  2LJL A;  3K3O A;  2PJQ A;  1FEW A;  2NW7 A;  3EVY A;  5JR9 A;  3WAK A;  3ZPO A;  3I9Y A;  2LSK A;  2LSI A;  2YEV C;  5FXV A;  3KV6 A;  4EIW A;  3CX8 B;  3KIN B;  4UV8 B;  2VL8 A;  2VAS A;  3R84 B;  5C8Y E;  5F8P A;  5HYA A;  5JRC B;  3I0Q A;  3H37 A;  4X1K E;  5JDM A;  5LG4 A;  1MND A;  4C91 A;  4ZHQ E;  5L3F B;  5GON E;  3KVB A;  4ZI3 C;  2V7J A;  4E7S A;  4TUY E;  2NWB A;  3AVS A;  4UIG A;  5CA1 E;  3ZYL A;  3B13 A;  5JR9 B;  3HI2 A;  2L3L A;  4H9Q C;  2VK9 A;  2XAS B;  2MTQ A;  3LK4 2;  4MAL A;  2LSG A;  2CM0 A;  2YK0 A;  2Q9Q B;  1FMW A;  2V7I A;  3DJB A;  5LHI B;  5LJN A;  4O4H E;  3LK2 B;  2K9A A;  3NBX X;  3N9P A;  3BQL A;  4UEM A;  4GIW A;  1D1B A;  2KZ7 B;  3UUX B;  3GN5 A;  5DAB A;  3Q2M A;  3VHL A;  4CXX A;  2E9X A;  4MHC A;  3PE0 A;  4JUY A;  5EK3 A;  3H3A A;  3RYC E;  3OKQ A;  1SHZ C;  2DWK A;  4TV8 E;  1HFA A;  4AKR B;  3C98 B;  3RX6 A;  4O4L E;  1HCI A;  3ZYK A;  4PJM A;  2DWG A;  4CXW A;  3PU8 A;  3M65 A;  3CKD A;  3K8P C;  2ZLY A;  4I50 E;  2MOZ A;  5FY7 A;  5AFU L;  5E0O A;  4GOU A;  2LSJ A;  1D1A A;  3LFM A;  4UF0 A;  2IC6 A;  2L9Q A;  3UFE A;  4PAG A;  1KNZ A;  2E9X B;  2E9X D;  1Z0P A;  4OYK A;  4DBQ A;  3F2E A;  5JDL A;  2P9B A;  2DCF A;  3FXD B;  4DBR A;  5J1G A;  4YJ2 E;  2IW5 B;  4UXN B;  2EHO D;  2N1G A;  5LA6 E;  5LXT E;  4QKN A;  1D0X A;  3ESL A;  3RH3 A;  4AKH A;  4O2B E;  3E22 E;  3ZN0 B;  2WMO A;  4AKI A;  2C5J A;  5A1L A;  2DNX A;  4U74 A;  2BZB A;  2Y6X A;  2LOS A;  2VKH A;  4ISS A;  4EZH A;  3O9X A;  1BR0 A;  3RYH E;  1OWA A;  2VB6 A;  3KFW X;  3BQI A;  2EHO C;  3CX7 B;  4AQF C;  2KT9 A;  1YD8 G;  2KMF A;  2ZM0 A;  1LVK A;  5FNV E;  3Q5X A;  5CB4 E;  2G0U A;  4HGA A;  4JEU B;  2W00 A;  5FY1 A;  3EDU A;  3PUA A;  3LK3 B;  1BR4 A;  2A2F X;  5JRE A;  5LJM A;  2YU1 A;  4YJ3 E;  3AA7 B;  3N9O A;  3VU7 H;  4MLK A;  2JPF A;  2Q9Q D;  2A72 A;  3NRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...