1OEDC

Structure of acetylcholine receptor pore from electron images
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
260
structure length
127
Chain Sequence
PLFYVINFITPCVLISFLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVIVNCGIVLNFHFRTGQTIDRLSMFIITPVMVLGTIFIFVMGNFNHPPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ion channel/receptor
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
total genus 46
structure length 127
sequence length 260
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedC00
4HFEA 3UU4A 4HFDA 5IUXA 2KSRA 2YKSA 2MAWA 2M6BA 2LKGA 3JAFA 3UU3A 4LMLA 2YOEA 5HEHA 5LG3A 4NPPA 3TLTA 4COFA 2XQ5A 3UU5A 5CFBA 4ILAA 2XQ9A 2BG9E 3RHWA 3TLVA 4ZZCA 3RIFA 1OEDA 4Z90A 3ZKRA 1OEDE 4F8HA 3EAMA 4IL4A 4A97A 4HFCA 3TLWA 2BG9B 5HCMA 2BG9C 4IREA 4TWFA 3EI0A 4TWDA 4TNWA 3TLSA 3LSVA 5HEOA 2XQ3A 4Z91A 3P50A 5HEUA 2XQ8A 3P4WA 3RI5A 4X5TA 2YN6A 4HFIA 2XQ7A 4QH4A 5L4HA 2XQ6A 2M6IA 4TNVA 5HEGA 5J0ZA 2LLYA 2XQ4A 4IL9A 4TWHA 4QH5A 4HFHA 1OEDB 4QH1A 3JAEA 3RIAA 1OEDC 4LMJA 3UUBA 4HFBA 3UU8A 3TLUA 4LMKA 5L4EA 5HEJA 2LM2A 2XQAA 4A98A 2LKHA 3EHZA 2VL0A 4ILBA 5L47A 4ILCA 5HCJA 3UQ4A 2BG9A 3UU6A 4ZZBA 3UQ7A 3JADA 3RQUA 3RQWA
chains in the Genus database with same CATH superfamily
2J47A 4HEAA 3UU4A 2PJQA 3OBVE 2NP9A 1MMGA 2WB5A 4AIUA 1KEYA 2SPCA 3VRAA 2KLQA 2FJEA 2LKGA 4LMLA 4JBWF 2AXDS 3QOFA 4HWIB 4JYAT 4AKIA 1MMNA 3TLTA 2QYWA 4MLKA 2PTFA 1J1JA 3PV0F 4EOZB 3FXDB 4NUVA 3HL6A 5JDMA 2D2SA 3I1AA 5CJ5A 1V9DA 3GWHA 3AECA 4HFCA 2KWHA 2QGSA 2J1DG 5JQGE 3AE5A 4AQFA 3HKDE 5L3FB 2CRBA 3ZYKA 4OX9T 2WDVA 3E0ZA 4A56A 3CX8B 2PG8A 3C4ZA 3N9MA 2E9XD 4YXDA 3J9X1 1YKEB 3IHRA 4QH1A 3RIAA 2IUBA 4UVCB 3PUVF 1FMWA 4AKGA 3ZC0A 2E5LT 2LSJA 2GK9A 2LKHA 1US7B 5F3JA 5AQGB 2Y6XA 4AKRB 2XAFB 4AISA 1HFAA 1HNWT 3L3PA 4ZZBA 2XY8B 3RQWA 4JI5T 2J4GA 3AEDA 1WR6A 2BKPA 2M67A 1UX5A 4B6XA 4AI6A 2KZ7B 1FEWA 2V6YA 3JAFA 3FHNA 3ZT7A 1AJ3A 3NRXA 1IJ5A 1MNEA 3CVRA 2K3WA 4IDOA 3ONJA 5H6QB 2E9XC 3SS1A 3I9YA 5JRCB 4CXXA 4MFRA 3EABA 3FXEB 3NRYA 4DV6T 4Q25A 4YTNA 5HYAA 3A5XA 4GK0E 4IE4A 2BG9B 3V5SA 3BQLA 5LXTE 4HFVA 4DMVA 3FB2A 2CA5A 4X64T 2XQ7A 3FBZA 1JNZA 3KDSE 4E7ZA 1J5ET 4KHPT 4DR1T 3KV6A 3P8CD 1XDOA 4ISSA 4HFHA 2NOXA 2LE8A 2WZIA 2ZM8A 3RPUA 3ONLC 4HFBA 1VCTA 4JI7T 5FY0A 2JMKA 2E5VA 3KVAA 2BKNA 4JV5T 5EK4A 4U3CA 3EHZA 4O2AE 4DR2T 2VB6A 3K3OA 5HCJA 3ANWB 2VKDA 3RQUA 5EK2A 3LDQB 3MJXA 5J2UE 2DL1A 4BJNA 1KNZA 1IZNB 1IAPA 4HWFA 4IT4A 2V26A 3ESLA 5GONE 4PJLA 2CHNA 1NEKA 3ZJ1A 5CA0E 3C64A 4KUMB 4EXTA 5FXWA 2H3RA 2W4XA 3FBLA 1HNXT 1Z8UA 4IL4A 3VU7H 5AQJB 1UUSA 3JC6D 1M7KA 3RLFF 5AQVB 3P4SA 3NZQA 3ZPOA 3LSVA 4O4JE 4UVBB 3PU8A 3ETVA 3F57A 4V1Av 1E1HB 3ZYLA 2UUAT 1XMOT 1WFDA 4P09A 1OXZA 5AQHB 1NWMX 5AQPB 4YY3T 2CWOA 2D5UA 3ZN0B 2Q9QB 1KK7A 2LEHA 2A9UA 3FZLB 4UR9A 4PFOA 5BMVE 2UXNB 1EZ3A 4IDZA 4JI8T 5AQKB 5JR9C 2KWIB 3MZKB 2W63A 2VURA 4PFPA 1E7PA 2R6GF 3JADA 2WDQA 2XSBA 2YDSA 3MA9A 3JC6C 3ZSTA 3ZYMA 2MAWA 3AEEA 4JI1T 4EEBA 4DV5T 3V5UA 2LOSA 4NPPA 2YDRA 4COFA 2XQ5A 1XMQT 3PE0A 4ILAA 4U72A 2WAUA 1ZOYA 3R84B 3RIFA 5LBMA 4G2AA 1O3XA 4PJMA 5CB4E 3ZT6A 4DR7T 4DO0A 2LSKA 2IMLA 4TWFA 4UF0B 3L39A 2CXFA 3P50A 5HEUA 2XM2A 3P4WA 3SWHA 1NAFA 4DV1T 3C4WA 3RRCA 5EZYE 1BR0A 2D0TA 5HWYA 4QWNB 4X1YE 5L3EB 4HE8A 3CX7B 3P4PA 1N34T 4GKKT 2DLRA 4IE5A 3M65A 4KI0F 2MPKA 3ZMUB 4U7IA 4ILBA 5L47A 4ILCA 1M62A 5KX5E 2XZEA 3UU6A 2C5JA 3N9QA 3AVSA 4DV0T 2C5KT 1MMDA 1Z0PA 1SUMB 2IDOB 1R8IA 3P4RA 4I50E 2CBIA 1U4QA 3QNUA 4PW8A 3UU5A 4JLEA 5AQRB 2BS2A 4HGAA 4JI3T 4ADZA 4AKLA 4WW0A 2P9BA 4EZHA 2V1DB 2XAHB 5FXVA 2WU2A 4X65T 3SRZA 4WYVA 3N2KE 4O4IE 4CN4A 2VKJA 3EI0A 3E22E 5FVLA 2VQFT 5FP3A 3OPCA 2CHOA 4X5TA 2YN6A 4K0KT 3PDYA 4KX6A 4EAHA 5HAXA 3RYHE 4JI0T 4IL9A 1WLXA 1X79A 4ZS2A 2I59A 1XDPA 5AQQB 5AQTB 2CWYA 3HKEE 3W15B 4JUYA 2ZM2A 2PBIA 4A98A 5JRCA 4ASKA 3AEBA 2XPKA 3OTOT 4AQFC 3UQ4A 2BG9A 4FJOA 1IBKT 3VKHA 2KINB 2WWVA 2LSGA 2BVMA 1KNRA 2EHOB 4QHOA 3O1HA 2JIWA 5JTGA 3I0OA 4H63H 1H7CA 2ACXA 4K0UA 5CFBA 3PTRB 4ZHQE 3RYFE 4X1KE 3T8OA 1D1CA 1Y64B 2X9HA 4DUZT 3TLWA 4HWDA 2XAQB 4TN7B 4TV8E 2V7IA 5L3GB 5J2TE 2C0SA 4IIJE 2L8KA 4ZI2C 3UTKA 2ES0A 2XQ8A 5AQIB 5FXZA 2NW7A 3ANWA 2CEAA 1LKXA 1LVKA 2RA1A 2AE9A 3K3NA 2L9QA 4O4HE 4AKHA 1W0BA 1N36T 4DNDA 3Q5WA 2WMOA 4ZI7E 5FVKA 4AXPA 3K8PC 2XM1A 4IE7A 5FKYA 5FY7A 3U78A 2NTYA 2K24A 1CUNA 4HWHA 1FIOA 5JDFA 1BR1A 5FMNA 3TKLB 3BQKA 3PUGA 2XTLA 3ZMSB 3WAJA 4ANJA 2NTXA 1WCRA 1D0XA 3ZMVB 3L8RA 2JQKA 4DR3T 3BK9A 3CQXC 4NXNT 2V5DA 4YSZA 1SHZC 1YXRA 2XQ9A 5LYJE 2VVSA 3SFEA 2LRLA 3AE4A 4HWCA 4CQIA 2UXBT 4H63V 4PK5A 2Q9QA 4I4TE 2WMNA 3AE3A 4GKJT 1KNPA 1XNRT 5C8YE 4IREA 2XJ7A 3RH3A 3ZN1B 1T72A 5FY1A 3RIUA 1BR4A 2CXLA 2RPAA 4PAGA 3RC8A 3H3AA 1OEDB 2H7OA 2RP4A 4ZEYA 4N78D 2X0HA 2K9AA 3N9NA 3KV4A 3OKQA 3ZSSA 4YTMA 5HEJA 2WSSV 4AQYT 2LM2A 3N9LA 4G63A 5DQVA 2X66A 2IC6A 4NIQA 3AAIA 2IC9A 1HF8A 5FL0A 2FJBA 4CI2B 3RF1A 2KSRA 4UF0A 2QRXA 2W0GA 3PUXF 2D0UA 4IDQA 3LK3B 4KMCA 4CXWA 4LF6T 5IWAT 2XASB 2A3DA 4LF4T 1T98A 5LG3A 1UGOA 5C3JA 3HR0A 3HKCE 2F4VT 2JRKA 2CPTA 3F31A 2DI4A 3WAKA 2VWAA 2W61A 2BZBA 4EIWA 4LFCT 2WM9A 4F8HA 2JPFA 2FJDA 2V8SV 3AB3B 5HCMA 3S4UA 4UELA 4GIWA 1MMAA 4DV2T 1MIYA 5HEOA 4J2CA 5HXRA 4PK6A 3KBTA 1YW0A 4HFIA 3ETUA 2LHNA 5L4HA 3H37A 3AE9A 3HKBE 2C5IT 4TNVA 5JDGA 4KBMB 4DR5T 4QX7B 2UXCT 3KV5A 4PK4A 3TLUA 4NUUA 2NW9A 3ZMTB 2Y48B 4KP3C 3ZCIA 2IHR1 4TV9E 1I94T 2HPJA 2W62A 3UUNA 3FZFB 3QUJA 4U74A 1ZP0A 2XSAA 2X67A 4H9NC 2MOZA 3NWIA 1HCIA 5TAOA 1D0YA 2VKHA 4ISTA 5AQLB 1S94A 2UU9T 5DQWA 3QK6A 1D1AA 2BDEA 5LMUT 4E7SA 3EDVA 4M1PA 1FMVA 3AEAA 2UXXB 3SFDA 5HXHA 3ZKRA 1QSDA 5ABGA 4DVDA 5A1LA 4A97A 5DABA 2K48A 5IHYA 3RYIE 2Y8DA 2MTQA 1QUUA 2CLYB 3OVUA 2WBLA 3EUHA 1HTJF 4X1IE 2NW8A 2V7LA 2W67A 5AQFB 4QH4A 2ZM6T 2MYSA 2DHRA 3C51A 2FUPA 2M6IA 3VR9A 4TWHA 3K1SA 4ZOLE 4KHZF 2EHOA 3AXJB 4WNKA 2XUEA 2ODVA 5L3BB 5LP6E 2OLTA 2V7MA 4B3TT 3EDUA 2WS3A 4IDPA 3C98B 3AEFA 4TZ4C 3AE8A 3D0TA 5ABEA 2YU1A 4H9QC 4X62T 1IBMT 1D1BA 2W00A 1SE7A 2UUCT 3CKDA 2BS3A 3UULA 5LCYA 5L3DB 5F8PA 5AQSB 4P1NA 3AA6B 4MALA 3UU3A 5HEHA 2ZLYA 3IA3A 3AA1B 3L09A 4DMWA 2IW5B 2WY2A 2J62A 3QB5K 1HR0T 1W09A 2ODUA 3X1DA 2E9XB 3LG7A 2XQYA 1IBLT 3PUQA 4ZZCA 5LG4A 4Z90A 1HS7A 3N2OA 4FI5A 3CMLA 5JDQA 2BG9C 2G0UA 2BKOA 3O1JA 3N2GE 2JQHA 3ZCJA 5FXXA 3PUAA 4EGWA 2XQ3A 4U33A 1W0AA 4BJMA 1ZHCA 4X66T 4ILUA 2B76A 4EYUA 5KDMC 3OJAA 2NR4A 1YQ3A 2LJLA 4EB6E 2ZMAA 2W2UA 2E2AA 3LJCA 5L3CB 2IIUA 3LBXB 4DV3T 5H6RB 2B1EA 4U2ZA 3UT5E 4I0UA 4JEHB 4LMKA 5L4EA 2CXDA 1HX1B 3B13A 3AEGA 3Q5XA 3PUWF 2X68A 3ABVA 3UQ7A 4PJJA 3KBUA 5HXSA 2PFVA 4YSYA 2VKOA 1W9RA 3E08A 4C90A 1WRDA 4WBOA 2D9DA 4XAXB 5LJMA 2E8IA 4ZI2D 4YLHA 2Q9QD 4PJNA 3AAAB 3PUZF 2KT9A 4CZZB 1HNZT 3PURA 1OEDA 5HXEA 3ONXA 4HN9A 2VQET 3ZEFB 2CCQA 4EYYR 2N2NA 3T1YT 2MBGA 3CPZA 2LSIA 3B57A 2JJ9A 4XBFB 4YHJA 3KFWX 3VHLA 5F5WA 2HN1A 1XNQT 4LF7T 4JI6T 4DBQA 5HWXA 4B3ST 5LMNT 1HG5A 3RC3A 2N1GA 4QH5A 4OYKA 2Z6EA 4YT0A 2Q9QC 3K3QC 2LSYA 2I6HA 2X9WA 5JR9B 3OYXA 4JI2T 2I0MA 2WU5A 3MKDA 5LOVE 5HXCA 4GOUA 1WYBA 5LB7B 3RIUC 4HFEA 4ZI3D 3RGLA 3RKOA 3J7Yq 1GQEA 2WCAA 4YJ2E 1MIVA 4OFZA 4C91A 2YOEA 4GK5E 4F6RC 4CN1A 2DCFA 2X51A 1VOMA 2CLYC 3PUYF 3GN5B 5JDNA 1N32T 4PNIA 5CGMA 3RHWA 5FNVE 3Q5DA 3AA7B 4IHJE 4GYRA 3LK42 2VL8A 3M3ZB 2WQYA 4HTEA 4X20E 3ZC1A 4B3RT 4A5XA 2H88A 3U3IA 5LHIB 5FYMA 1L0VA 4DV7T 5LA6E 5ADXL 5BR8T 4O2BE 3MK7C 4TUYE 2KXPB 5JVDE 3JCFA 1IJ6A 3G06A 4QXBB 4OK0A 3OYZA 3AA0B 4ZI3C 2UUBT 2XAGB 3T1HT 3QC9A 4ZXLA 5KMGP 2UXDT 3FZHB 5CA1E 1T8BA 5M4YA 1D0ZA 2V6XA 3IF8B 3BQIA 5IYZE 3I0QA 3PJAJ 4UVAB 3RKGA 4QXCB 1WYCA 2A2FX 2XQAA 2VL0A 2WP9A 4YHHT 3PJAA 3C50A 3Q2MA 2YK0A 2LT3A 3CQCB 5IUXA 4EV6A 1OWAA 4LF8T 2FBWA 1LVFA 2WZHA 4ZS3A 2BBHA 5JDHA 5JREA 2BG9E 3AVRA 1G73A 3TLVA 1XWMA 2BBJA 1Y01A 2HPLA 3AXJA 1OEDE 5ABFB 4UXNB 4GYSA 1U5PA 3LFMA 3PU3A 4I43B 2YEVC 2DWGA 3ZT5A 2JQ9A 4BA9A 4DR6T 1ZEEA 2V5CA 1I6ZA 5AQOB 5KXJA 5AQUB 2EHOD 2ACZA 2OA5A 3FZMB 2IAKA 3WI3A 1B7TA 4BAYB 1UK5A 4TX5A 1HG2A 5HEGA 4I55E 5ETWA 4DV4T 3JAEA 4O4LE 3UUXB 3UUBA 3UU8A 2NWBA 2ZM0A 3MXZA 3I9WA 4UIGA 1BR2A 3PUSA 2E9XA 2QVAA 5EK3A 2BVLA 4IE6A 3RYCE 3O4XE 3CWZB 1J5WA 1SA0E 4U7YA 3F2EA 2XAJB 4ERRA 2KNDA 1ZV4X 1LRZA 4NXMT 5JH7E 3AE2A 2HN2A 4LF5T 4L0RA 2N9DA 4HFDA 4YSXA 2BS4A 3HA4A 4XZCA 3DJBA 2W66A 4YJ3E 2M6BA 4P0BA 5LGTB 2EHOC 5E0OA 5LGUB 3N9PA 4EEDA 4OYJA 3VRBA 4CXYA 4DBRA 3UUMA 4WZXA 3UFEA 2FJAA 4YTPA 2JQQA 3LBXA 4H9PC 2HHHT 3EAMA 1MIWA 4JEUB 2OV9A 4U31A 3IEEA 4QX8B 3B5MA 3SOLA 5LNKA 1CHUA 2V6YB 3DTOA 5LJNA 1KFYA 4L9IA 1T7SA 2XQ6A 5LHGB 2DWKA 5LHHB 2QA7A 4UEMA 5ABHA 2X0LB 3N5LA 3EVYA 3MACA 2V7JA 4L5GA 4B3MT 2WDRA 4O8SA 3A8YC 2X9XA 2H89A 1ZKEA 3O1IA 4DR4T 5JDLA 3AE6A 3Q5EA 1XZYA 2LOPA 4LFAT 1NENA 3KINB 2CM0A 1E2AA 3CK6A 3LK2B 3AAEB 3VR8A 4DIDB 3AE7A 4IDNA 4Z8XA 3C4XA 1DU2A 2YINA 1G8XA 3ZLIA 2YDQA 4DUYT 4WBNE 3ZJ2A 4JI4T 1FJGT 2LRKA 1YQ4A 2VASA 3GMIA 4H9SE 3RX6A 3Q9DA 5JR9A 1YKHB 1QLBA 3HI2A 3NVOA 2L3LA 1UCUA 4Z91A 3CQGB 4LF9T 1S35A 5LGNB 5L2LA 3P7IA 1X9BA 2LLYA 3H3MA 2V7KA 4P0AA 1OEDC 3R6NA 1VCSA 4LMJA 2A72A 3GN5A 1YD8G 5AQNB 2LHRA 1VRBA 1MNDA 3N9OA 5J1GA 3A7MA 4MHCA 5AFUL 1UX4A 3CIRA 3NZPA 5C2TA 3AE1A 5FL1A 3O9XA 3IBPA 2CBJA 2YKSA 3P4QA 4QKNA 2K5BB 3NBXX 2XHEB 1WR0A 2WWUA 3GA8A 4AQGA 5AQMB 2YU2A 4CI1B 1KF6A 4UV8B 1N33T 3RRWA 2KMFA 4H9RC 2HH7A 4IE0A 4YFSA 2X9YA 1HX8A 4H9OC 3UFGA 2VK9A 5LBQB 4TWDA 4TNWA 3TLSA 1UURA 3ZMZB 3KV9A 5DJQC 3RI5A 3FZKB 2H7VC 4HKAA 3NKZA 2X0YA 4QXHB 4MBQA 5J0ZA 2XQ4A 2CE7A 4LFBT 1JNRA 3QB5A 4EZ4A 4OHFA 3VKGA 2CMRA 3DP7A 3KVBA 4UV9B 2LM9A 2JMHA 2VVNA 4IGUA 3CX6B 2DNXA 4U2YA 5ABFA 4CI3B 4CN6A
chains in the Genus database with same CATH topology
4HFEA 3UU4A 4HFDA 5IUXA 2KSRA 2YKSA 2MAWA 2M6BA 2LKGA 3JAFA 3UU3A 4LMLA 2YOEA 5HEHA 5LG3A 4NPPA 3TLTA 4COFA 2XQ5A 3UU5A 5CFBA 4ILAA 2XQ9A 2BG9E 3RHWA 3TLVA 4ZZCA 3RIFA 1OEDA 4Z90A 3ZKRA 1OEDE 4F8HA 3EAMA 4IL4A 4A97A 4HFCA 3TLWA 2BG9B 5HCMA 2BG9C 4IREA 4TWFA 3EI0A 4TWDA 4TNWA 3TLSA 3LSVA 5HEOA 2XQ3A 4Z91A 3P50A 5HEUA 2XQ8A 3P4WA 3RI5A 4X5TA 2YN6A 4HFIA 2XQ7A 4QH4A 5L4HA 2XQ6A 2M6IA 4TNVA 5HEGA 5J0ZA 2LLYA 2XQ4A 4IL9A 4TWHA 4QH5A 4HFHA 1OEDB 4QH1A 3JAEA 3RIAA 1OEDC 4LMJA 3UUBA 4HFBA 3UU8A 3TLUA 4LMKA 5L4EA 5HEJA 2LM2A 2XQAA 4A98A 2LKHA 3EHZA 2VL0A 4ILBA 5L47A 4ILCA 5HCJA 3UQ4A 2BG9A 3UU6A 4ZZBA 3UQ7A 3JADA 3RQUA 3RQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFE A;  3UU4 A;  4HFD A;  5IUX A;  2KSR A;  2YKS A;  2MAW A;  2M6B A;  2LKG A;  3JAF A;  3UU3 A;  4LML A;  2YOE A;  5HEH A;  5LG3 A;  4NPP A;  3TLT A;  4COF A;  2XQ5 A;  3UU5 A;  5CFB A;  4ILA A;  2XQ9 A;  2BG9 E;  3RHW A;  3TLV A;  4ZZC A;  3RIF A;  1OED A;  4Z90 A;  3ZKR A;  1OED E;  4F8H A;  3EAM A;  4IL4 A;  4A97 A;  4HFC A;  3TLW A;  2BG9 B;  5HCM A;  2BG9 C;  4IRE A;  4TWF A;  3EI0 A;  4TWD A;  4TNW A;  3TLS A;  3LSV A;  5HEO A;  2XQ3 A;  4Z91 A;  3P50 A;  5HEU A;  2XQ8 A;  3P4W A;  3RI5 A;  4X5T A;  2YN6 A;  4HFI A;  2XQ7 A;  4QH4 A;  5L4H A;  2XQ6 A;  2M6I A;  4TNV A;  5HEG A;  5J0Z A;  2LLY A;  2XQ4 A;  4IL9 A;  4TWH A;  4QH5 A;  4HFH A;  1OED B;  4QH1 A;  3JAE A;  3RIA A;  1OED C;  4LMJ A;  3UUB A;  4HFB A;  3UU8 A;  3TLU A;  4LMK A;  5L4E A;  5HEJ A;  2LM2 A;  2XQA A;  4A98 A;  2LKH A;  3EHZ A;  2VL0 A;  4ILB A;  5L47 A;  4ILC A;  5HCJ A;  3UQ4 A;  2BG9 A;  3UU6 A;  4ZZB A;  3UQ7 A;  3JAD A;  3RQU A;  3RQW A; 
#chains in the Genus database with same CATH topology
 2J47 A;  4HEA A;  3UU4 A;  2PJQ A;  3OBV E;  2NP9 A;  1MMG A;  2WB5 A;  4AIU A;  1KEY A;  2SPC A;  3VRA A;  2KLQ A;  2FJE A;  2LKG A;  4LML A;  4JBW F;  2AXD S;  3QOF A;  4HWI B;  4JYA T;  4AKI A;  1MMN A;  3TLT A;  2QYW A;  4MLK A;  2PTF A;  1J1J A;  3PV0 F;  4EOZ B;  3FXD B;  4NUV A;  3HL6 A;  5JDM A;  2D2S A;  3I1A A;  5CJ5 A;  1V9D A;  3GWH A;  3AEC A;  4HFC A;  2KWH A;  2QGS A;  2J1D G;  5JQG E;  3AE5 A;  4AQF A;  3HKD E;  5L3F B;  2CRB A;  3ZYK A;  4OX9 T;  2WDV A;  3E0Z A;  4A56 A;  3CX8 B;  2PG8 A;  3C4Z A;  3N9M A;  2E9X D;  4YXD A;  3J9X 1;  1YKE B;  3IHR A;  4QH1 A;  3RIA A;  2IUB A;  4UVC B;  3PUV F;  1FMW A;  4AKG A;  3ZC0 A;  2E5L T;  2LSJ A;  2GK9 A;  2LKH A;  1US7 B;  5F3J A;  5AQG B;  2Y6X A;  4AKR B;  2XAF B;  4AIS A;  1HFA A;  1HNW T;  3L3P A;  4ZZB A;  2XY8 B;  3RQW A;  4JI5 T;  2J4G A;  3AED A;  1WR6 A;  2BKP A;  2M67 A;  1UX5 A;  4B6X A;  4AI6 A;  2KZ7 B;  1FEW A;  2V6Y A;  3JAF A;  3FHN A;  3ZT7 A;  1AJ3 A;  3NRX A;  1IJ5 A;  1MNE A;  3CVR A;  2K3W A;  4IDO A;  3ONJ A;  5H6Q B;  2E9X C;  3SS1 A;  3I9Y A;  5JRC B;  4CXX A;  4MFR A;  3EAB A;  3FXE B;  3NRY A;  4DV6 T;  4Q25 A;  4YTN A;  5HYA A;  3A5X A;  4GK0 E;  4IE4 A;  2BG9 B;  3V5S A;  3BQL A;  5LXT E;  4HFV A;  4DMV A;  3FB2 A;  2CA5 A;  4X64 T;  2XQ7 A;  3FBZ A;  1JNZ A;  3KDS E;  4E7Z A;  1J5E T;  4KHP T;  4DR1 T;  3KV6 A;  3P8C D;  1XDO A;  4ISS A;  4HFH A;  2NOX A;  2LE8 A;  2WZI A;  2ZM8 A;  3RPU A;  3ONL C;  4HFB A;  1VCT A;  4JI7 T;  5FY0 A;  2JMK A;  2E5V A;  3KVA A;  2BKN A;  4JV5 T;  5EK4 A;  4U3C A;  3EHZ A;  4O2A E;  4DR2 T;  2VB6 A;  3K3O A;  5HCJ A;  3ANW B;  2VKD A;  3RQU A;  5EK2 A;  3LDQ B;  3MJX A;  5J2U E;  2DL1 A;  4BJN A;  1KNZ A;  1IZN B;  1IAP A;  4HWF A;  4IT4 A;  2V26 A;  3ESL A;  5GON E;  4PJL A;  2CHN A;  1NEK A;  3ZJ1 A;  5CA0 E;  3C64 A;  4KUM B;  4EXT A;  5FXW A;  2H3R A;  2W4X A;  3FBL A;  1HNX T;  1Z8U A;  4IL4 A;  3VU7 H;  5AQJ B;  1UUS A;  3JC6 D;  1M7K A;  3RLF F;  5AQV B;  3P4S A;  3NZQ A;  3ZPO A;  3LSV A;  4O4J E;  4UVB B;  3PU8 A;  3ETV A;  3F57 A;  4V1A v;  1E1H B;  3ZYL A;  2UUA T;  1XMO T;  1WFD A;  4P09 A;  1OXZ A;  5AQH B;  1NWM X;  5AQP B;  4YY3 T;  2CWO A;  2D5U A;  3ZN0 B;  2Q9Q B;  1KK7 A;  2LEH A;  2A9U A;  3FZL B;  4UR9 A;  4PFO A;  5BMV E;  2UXN B;  1EZ3 A;  4IDZ A;  4JI8 T;  5AQK B;  5JR9 C;  2KWI B;  3MZK B;  2W63 A;  2VUR A;  4PFP A;  1E7P A;  2R6G F;  3JAD A;  2WDQ A;  2XSB A;  2YDS A;  3MA9 A;  3JC6 C;  3ZST A;  3ZYM A;  2MAW A;  3AEE A;  4JI1 T;  4EEB A;  4DV5 T;  3V5U A;  2LOS A;  4NPP A;  2YDR A;  4COF A;  2XQ5 A;  1XMQ T;  3PE0 A;  4ILA A;  4U72 A;  2WAU A;  1ZOY A;  3R84 B;  3RIF A;  5LBM A;  4G2A A;  1O3X A;  4PJM A;  5CB4 E;  3ZT6 A;  4DR7 T;  4DO0 A;  2LSK A;  2IML A;  4TWF A;  4UF0 B;  3L39 A;  2CXF A;  3P50 A;  5HEU A;  2XM2 A;  3P4W A;  3SWH A;  1NAF A;  4DV1 T;  3C4W A;  3RRC A;  5EZY E;  1BR0 A;  2D0T A;  5HWY A;  4QWN B;  4X1Y E;  5L3E B;  4HE8 A;  3CX7 B;  3P4P A;  1N34 T;  4GKK T;  2DLR A;  4IE5 A;  3M65 A;  4KI0 F;  2MPK A;  3ZMU B;  4U7I A;  4ILB A;  5L47 A;  4ILC A;  1M62 A;  5KX5 E;  2XZE A;  3UU6 A;  2C5J A;  3N9Q A;  3AVS A;  4DV0 T;  2C5K T;  1MMD A;  1Z0P A;  1SUM B;  2IDO B;  1R8I A;  3P4R A;  4I50 E;  2CBI A;  1U4Q A;  3QNU A;  4PW8 A;  3UU5 A;  4JLE A;  5AQR B;  2BS2 A;  4HGA A;  4JI3 T;  4ADZ A;  4AKL A;  4WW0 A;  2P9B A;  4EZH A;  2V1D B;  2XAH B;  5FXV A;  2WU2 A;  4X65 T;  3SRZ A;  4WYV A;  3N2K E;  4O4I E;  4CN4 A;  2VKJ A;  3EI0 A;  3E22 E;  5FVL A;  2VQF T;  5FP3 A;  3OPC A;  2CHO A;  4X5T A;  2YN6 A;  4K0K T;  3PDY A;  4KX6 A;  4EAH A;  5HAX A;  3RYH E;  4JI0 T;  4IL9 A;  1WLX A;  1X79 A;  4ZS2 A;  2I59 A;  1XDP A;  5AQQ B;  5AQT B;  2CWY A;  3HKE E;  3W15 B;  4JUY A;  2ZM2 A;  2PBI A;  4A98 A;  5JRC A;  4ASK A;  3AEB A;  2XPK A;  3OTO T;  4AQF C;  3UQ4 A;  2BG9 A;  4FJO A;  1IBK T;  3VKH A;  2KIN B;  2WWV A;  2LSG A;  2BVM A;  1KNR A;  2EHO B;  4QHO A;  3O1H A;  2JIW A;  5JTG A;  3I0O A;  4H63 H;  1H7C A;  2ACX A;  4K0U A;  5CFB A;  3PTR B;  4ZHQ E;  3RYF E;  4X1K E;  3T8O A;  1D1C A;  1Y64 B;  2X9H A;  4DUZ T;  3TLW A;  4HWD A;  2XAQ B;  4TN7 B;  4TV8 E;  2V7I A;  5L3G B;  5J2T E;  2C0S A;  4IIJ E;  2L8K A;  4ZI2 C;  3UTK A;  2ES0 A;  2XQ8 A;  5AQI B;  5FXZ A;  2NW7 A;  3ANW A;  2CEA A;  1LKX A;  1LVK A;  2RA1 A;  2AE9 A;  3K3N A;  2L9Q A;  4O4H E;  4AKH A;  1W0B A;  1N36 T;  4DND A;  3Q5W A;  2WMO A;  4ZI7 E;  5FVK A;  4AXP A;  3K8P C;  2XM1 A;  4IE7 A;  5FKY A;  5FY7 A;  3U78 A;  2NTY A;  2K24 A;  1CUN A;  4HWH A;  1FIO A;  5JDF A;  1BR1 A;  5FMN A;  3TKL B;  3BQK A;  3PUG A;  2XTL A;  3ZMS B;  3WAJ A;  4ANJ A;  2NTX A;  1WCR A;  1D0X A;  3ZMV B;  3L8R A;  2JQK A;  4DR3 T;  3BK9 A;  3CQX C;  4NXN T;  2V5D A;  4YSZ A;  1SHZ C;  1YXR A;  2XQ9 A;  5LYJ E;  2VVS A;  3SFE A;  2LRL A;  3AE4 A;  4HWC A;  4CQI A;  2UXB T;  4H63 V;  4PK5 A;  2Q9Q A;  4I4T E;  2WMN A;  3AE3 A;  4GKJ T;  1KNP A;  1XNR T;  5C8Y E;  4IRE A;  2XJ7 A;  3RH3 A;  3ZN1 B;  1T72 A;  5FY1 A;  3RIU A;  1BR4 A;  2CXL A;  2RPA A;  4PAG A;  3RC8 A;  3H3A A;  1OED B;  2H7O A;  2RP4 A;  4ZEY A;  4N78 D;  2X0H A;  2K9A A;  3N9N A;  3KV4 A;  3OKQ A;  3ZSS A;  4YTM A;  5HEJ A;  2WSS V;  4AQY T;  2LM2 A;  3N9L A;  4G63 A;  5DQV A;  2X66 A;  2IC6 A;  4NIQ A;  3AAI A;  2IC9 A;  1HF8 A;  5FL0 A;  2FJB A;  4CI2 B;  3RF1 A;  2KSR A;  4UF0 A;  2QRX A;  2W0G A;  3PUX F;  2D0U A;  4IDQ A;  3LK3 B;  4KMC A;  4CXW A;  4LF6 T;  5IWA T;  2XAS B;  2A3D A;  4LF4 T;  1T98 A;  5LG3 A;  1UGO A;  5C3J A;  3HR0 A;  3HKC E;  2F4V T;  2JRK A;  2CPT A;  3F31 A;  2DI4 A;  3WAK A;  2VWA A;  2W61 A;  2BZB A;  4EIW A;  4LFC T;  2WM9 A;  4F8H A;  2JPF A;  2FJD A;  2V8S V;  3AB3 B;  5HCM A;  3S4U A;  4UEL A;  4GIW A;  1MMA A;  4DV2 T;  1MIY A;  5HEO A;  4J2C A;  5HXR A;  4PK6 A;  3KBT A;  1YW0 A;  4HFI A;  3ETU A;  2LHN A;  5L4H A;  3H37 A;  3AE9 A;  3HKB E;  2C5I T;  4TNV A;  5JDG A;  4KBM B;  4DR5 T;  4QX7 B;  2UXC T;  3KV5 A;  4PK4 A;  3TLU A;  4NUU A;  2NW9 A;  3ZMT B;  2Y48 B;  4KP3 C;  3ZCI A;  2IHR 1;  4TV9 E;  1I94 T;  2HPJ A;  2W62 A;  3UUN A;  3FZF B;  3QUJ A;  4U74 A;  1ZP0 A;  2XSA A;  2X67 A;  4H9N C;  2MOZ A;  3NWI A;  1HCI A;  5TAO A;  1D0Y A;  2VKH A;  4IST A;  5AQL B;  1S94 A;  2UU9 T;  5DQW A;  3QK6 A;  1D1A A;  2BDE A;  5LMU T;  4E7S A;  3EDV A;  4M1P A;  1FMV A;  3AEA A;  2UXX B;  3SFD A;  5HXH A;  3ZKR A;  1QSD A;  5ABG A;  4DVD A;  5A1L A;  4A97 A;  5DAB A;  2K48 A;  5IHY A;  3RYI E;  2Y8D A;  2MTQ A;  1QUU A;  2CLY B;  3OVU A;  2WBL A;  3EUH A;  1HTJ F;  4X1I E;  2NW8 A;  2V7L A;  2W67 A;  5AQF B;  4QH4 A;  2ZM6 T;  2MYS A;  2DHR A;  3C51 A;  2FUP A;  2M6I A;  3VR9 A;  4TWH A;  3K1S A;  4ZOL E;  4KHZ F;  2EHO A;  3AXJ B;  4WNK A;  2XUE A;  2ODV A;  5L3B B;  5LP6 E;  2OLT A;  2V7M A;  4B3T T;  3EDU A;  2WS3 A;  4IDP A;  3C98 B;  3AEF A;  4TZ4 C;  3AE8 A;  3D0T A;  5ABE A;  2YU1 A;  4H9Q C;  4X62 T;  1IBM T;  1D1B A;  2W00 A;  1SE7 A;  2UUC T;  3CKD A;  2BS3 A;  3UUL A;  5LCY A;  5L3D B;  5F8P A;  5AQS B;  4P1N A;  3AA6 B;  4MAL A;  3UU3 A;  5HEH A;  2ZLY A;  3IA3 A;  3AA1 B;  3L09 A;  4DMW A;  2IW5 B;  2WY2 A;  2J62 A;  3QB5 K;  1HR0 T;  1W09 A;  2ODU A;  3X1D A;  2E9X B;  3LG7 A;  2XQY A;  1IBL T;  3PUQ A;  4ZZC A;  5LG4 A;  4Z90 A;  1HS7 A;  3N2O A;  4FI5 A;  3CML A;  5JDQ A;  2BG9 C;  2G0U A;  2BKO A;  3O1J A;  3N2G E;  2JQH A;  3ZCJ A;  5FXX A;  3PUA A;  4EGW A;  2XQ3 A;  4U33 A;  1W0A A;  4BJM A;  1ZHC A;  4X66 T;  4ILU A;  2B76 A;  4EYU A;  5KDM C;  3OJA A;  2NR4 A;  1YQ3 A;  2LJL A;  4EB6 E;  2ZMA A;  2W2U A;  2E2A A;  3LJC A;  5L3C B;  2IIU A;  3LBX B;  4DV3 T;  5H6R B;  2B1E A;  4U2Z A;  3UT5 E;  4I0U A;  4JEH B;  4LMK A;  5L4E A;  2CXD A;  1HX1 B;  3B13 A;  3AEG A;  3Q5X A;  3PUW F;  2X68 A;  3ABV A;  3UQ7 A;  4PJJ A;  3KBU A;  5HXS A;  2PFV A;  4YSY A;  2VKO A;  1W9R A;  3E08 A;  4C90 A;  1WRD A;  4WBO A;  2D9D A;  4XAX B;  5LJM A;  2E8I A;  4ZI2 D;  4YLH A;  2Q9Q D;  4PJN A;  3AAA B;  3PUZ F;  2KT9 A;  4CZZ B;  1HNZ T;  3PUR A;  1OED A;  5HXE A;  3ONX A;  4HN9 A;  2VQE T;  3ZEF B;  2CCQ A;  4EYY R;  2N2N A;  3T1Y T;  2MBG A;  3CPZ A;  2LSI A;  3B57 A;  2JJ9 A;  4XBF B;  4YHJ A;  3KFW X;  3VHL A;  5F5W A;  2HN1 A;  1XNQ T;  4LF7 T;  4JI6 T;  4DBQ A;  5HWX A;  4B3S T;  5LMN T;  1HG5 A;  3RC3 A;  2N1G A;  4QH5 A;  4OYK A;  2Z6E A;  4YT0 A;  2Q9Q C;  3K3Q C;  2LSY A;  2I6H A;  2X9W A;  5JR9 B;  3OYX A;  4JI2 T;  2I0M A;  2WU5 A;  3MKD A;  5LOV E;  5HXC A;  4GOU A;  1WYB A;  5LB7 B;  3RIU C;  4HFE A;  4ZI3 D;  3RGL A;  3RKO A;  3J7Y q;  1GQE A;  2WCA A;  4YJ2 E;  1MIV A;  4OFZ A;  4C91 A;  2YOE A;  4GK5 E;  4F6R C;  4CN1 A;  2DCF A;  2X51 A;  1VOM A;  2CLY C;  3PUY F;  3GN5 B;  5JDN A;  1N32 T;  4PNI A;  5CGM A;  3RHW A;  5FNV E;  3Q5D A;  3AA7 B;  4IHJ E;  4GYR A;  3LK4 2;  2VL8 A;  3M3Z B;  2WQY A;  4HTE A;  4X20 E;  3ZC1 A;  4B3R T;  4A5X A;  2H88 A;  3U3I A;  5LHI B;  5FYM A;  1L0V A;  4DV7 T;  5LA6 E;  5ADX L;  5BR8 T;  4O2B E;  3MK7 C;  4TUY E;  2KXP B;  5JVD E;  3JCF A;  1IJ6 A;  3G06 A;  4QXB B;  4OK0 A;  3OYZ A;  3AA0 B;  4ZI3 C;  2UUB T;  2XAG B;  3T1H T;  3QC9 A;  4ZXL A;  5KMG P;  2UXD T;  3FZH B;  5CA1 E;  1T8B A;  5M4Y A;  1D0Z A;  2V6X A;  3IF8 B;  3BQI A;  5IYZ E;  3I0Q A;  3PJA J;  4UVA B;  3RKG A;  4QXC B;  1WYC A;  2A2F X;  2XQA A;  2VL0 A;  2WP9 A;  4YHH T;  3PJA A;  3C50 A;  3Q2M A;  2YK0 A;  2LT3 A;  3CQC B;  5IUX A;  4EV6 A;  1OWA A;  4LF8 T;  2FBW A;  1LVF A;  2WZH A;  4ZS3 A;  2BBH A;  5JDH A;  5JRE A;  2BG9 E;  3AVR A;  1G73 A;  3TLV A;  1XWM A;  2BBJ A;  1Y01 A;  2HPL A;  3AXJ A;  1OED E;  5ABF B;  4UXN B;  4GYS A;  1U5P A;  3LFM A;  3PU3 A;  4I43 B;  2YEV C;  2DWG A;  3ZT5 A;  2JQ9 A;  4BA9 A;  4DR6 T;  1ZEE A;  2V5C A;  1I6Z A;  5AQO B;  5KXJ A;  5AQU B;  2EHO D;  2ACZ A;  2OA5 A;  3FZM B;  2IAK A;  3WI3 A;  1B7T A;  4BAY B;  1UK5 A;  4TX5 A;  1HG2 A;  5HEG A;  4I55 E;  5ETW A;  4DV4 T;  3JAE A;  4O4L E;  3UUX B;  3UUB A;  3UU8 A;  2NWB A;  2ZM0 A;  3MXZ A;  3I9W A;  4UIG A;  1BR2 A;  3PUS A;  2E9X A;  2QVA A;  5EK3 A;  2BVL A;  4IE6 A;  3RYC E;  3O4X E;  3CWZ B;  1J5W A;  1SA0 E;  4U7Y A;  3F2E A;  2XAJ B;  4ERR A;  2KND A;  1ZV4 X;  1LRZ A;  4NXM T;  5JH7 E;  3AE2 A;  2HN2 A;  4LF5 T;  4L0R A;  2N9D A;  4HFD A;  4YSX A;  2BS4 A;  3HA4 A;  4XZC A;  3DJB A;  2W66 A;  4YJ3 E;  2M6B A;  4P0B A;  5LGT B;  2EHO C;  5E0O A;  5LGU B;  3N9P A;  4EED A;  4OYJ A;  3VRB A;  4CXY A;  4DBR A;  3UUM A;  4WZX A;  3UFE A;  2FJA A;  4YTP A;  2JQQ A;  3LBX A;  4H9P C;  2HHH T;  3EAM A;  1MIW A;  4JEU B;  2OV9 A;  4U31 A;  3IEE A;  4QX8 B;  3B5M A;  3SOL A;  5LNK A;  1CHU A;  2V6Y B;  3DTO A;  5LJN A;  1KFY A;  4L9I A;  1T7S A;  2XQ6 A;  5LHG B;  2DWK A;  5LHH B;  2QA7 A;  4UEM A;  5ABH A;  2X0L B;  3N5L A;  3EVY A;  3MAC A;  2V7J A;  4L5G A;  4B3M T;  2WDR A;  4O8S A;  3A8Y C;  2X9X A;  2H89 A;  1ZKE A;  3O1I A;  4DR4 T;  5JDL A;  3AE6 A;  3Q5E A;  1XZY A;  2LOP A;  4LFA T;  1NEN A;  3KIN B;  2CM0 A;  1E2A A;  3CK6 A;  3LK2 B;  3AAE B;  3VR8 A;  4DID B;  3AE7 A;  4IDN A;  4Z8X A;  3C4X A;  1DU2 A;  2YIN A;  1G8X A;  3ZLI A;  2YDQ A;  4DUY T;  4WBN E;  3ZJ2 A;  4JI4 T;  1FJG T;  2LRK A;  1YQ4 A;  2VAS A;  3GMI A;  4H9S E;  3RX6 A;  3Q9D A;  5JR9 A;  1YKH B;  1QLB A;  3HI2 A;  3NVO A;  2L3L A;  1UCU A;  4Z91 A;  3CQG B;  4LF9 T;  1S35 A;  5LGN B;  5L2L A;  3P7I A;  1X9B A;  2LLY A;  3H3M A;  2V7K A;  4P0A A;  1OED C;  3R6N A;  1VCS A;  4LMJ A;  2A72 A;  3GN5 A;  1YD8 G;  5AQN B;  2LHR A;  1VRB A;  1MND A;  3N9O A;  5J1G A;  3A7M A;  4MHC A;  5AFU L;  1UX4 A;  3CIR A;  3NZP A;  5C2T A;  3AE1 A;  5FL1 A;  3O9X A;  3IBP A;  2CBJ A;  2YKS A;  3P4Q A;  4QKN A;  2K5B B;  3NBX X;  2XHE B;  1WR0 A;  2WWU A;  3GA8 A;  4AQG A;  5AQM B;  2YU2 A;  4CI1 B;  1KF6 A;  4UV8 B;  1N33 T;  3RRW A;  2KMF A;  4H9R C;  2HH7 A;  4IE0 A;  4YFS A;  2X9Y A;  1HX8 A;  4H9O C;  3UFG A;  2VK9 A;  5LBQ B;  4TWD A;  4TNW A;  3TLS A;  1UUR A;  3ZMZ B;  3KV9 A;  5DJQ C;  3RI5 A;  3FZK B;  2H7V C;  4HKA A;  3NKZ A;  2X0Y A;  4QXH B;  4MBQ A;  5J0Z A;  2XQ4 A;  2CE7 A;  4LFB T;  1JNR A;  3QB5 A;  4EZ4 A;  4OHF A;  3VKG A;  2CMR A;  3DP7 A;  3KVB A;  4UV9 B;  2LM9 A;  2JMH A;  2VVN A;  4IGU A;  3CX6 B;  2DNX A;  4U2Y A;  5ABF A;  4CI3 B;  4CN6 A; 
#chains in the Genus database with same CATH homology
 4HFE A;  3UU4 A;  4HFD A;  5IUX A;  2KSR A;  2YKS A;  2MAW A;  2M6B A;  2LKG A;  3JAF A;  3UU3 A;  4LML A;  2YOE A;  5HEH A;  5LG3 A;  4NPP A;  3TLT A;  4COF A;  2XQ5 A;  3UU5 A;  5CFB A;  4ILA A;  2XQ9 A;  2BG9 E;  3RHW A;  3TLV A;  4ZZC A;  3RIF A;  1OED A;  4Z90 A;  3ZKR A;  1OED E;  4F8H A;  3EAM A;  4IL4 A;  4A97 A;  4HFC A;  3TLW A;  2BG9 B;  5HCM A;  2BG9 C;  4IRE A;  4TWF A;  3EI0 A;  4TWD A;  4TNW A;  3TLS A;  3LSV A;  5HEO A;  2XQ3 A;  4Z91 A;  3P50 A;  5HEU A;  2XQ8 A;  3P4W A;  3RI5 A;  4X5T A;  2YN6 A;  4HFI A;  2XQ7 A;  4QH4 A;  5L4H A;  2XQ6 A;  2M6I A;  4TNV A;  5HEG A;  5J0Z A;  2LLY A;  2XQ4 A;  4IL9 A;  4TWH A;  4QH5 A;  4HFH A;  1OED B;  4QH1 A;  3JAE A;  3RIA A;  1OED C;  4LMJ A;  3UUB A;  4HFB A;  3UU8 A;  3TLU A;  4LMK A;  5L4E A;  5HEJ A;  2LM2 A;  2XQA A;  4A98 A;  2LKH A;  3EHZ A;  2VL0 A;  4ILB A;  5L47 A;  4ILC A;  5HCJ A;  3UQ4 A;  2BG9 A;  3UU6 A;  4ZZB A;  3UQ7 A;  3JAD A;  3RQU A;  3RQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...