1OEDC

Structure of acetylcholine receptor pore from electron images
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
260
structure length
127
Chain Sequence
PLFYVINFITPCVLISFLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVIVNCGIVLNFHFRTGQTIDRLSMFIITPVMVLGTIFIFVMGNFNHPPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 46
structure length 127
sequence length 260
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedC00
4QH4A 3UU4A 3RI5A 3ZKRA 5HCJA 5L47A 4TNVA 4A98A 4Z91A 5HEJA 2XQ7A 3JAEA 3EAMA 3LSVA 3EI0A 4TWHA 3UUBA 2VL0A 4ILBA 4LMLA 3UU5A 4HFDA 4ILCA 2XQAA 4X5TA 3JAFA 5L4EA 2BG9E 4ILAA 3RIFA 3UQ4A 2M6BA 4QH1A 5J0ZA 2LKGA 5HEOA 4QH5A 4HFHA 1OEDB 4NPPA 2KSRA 5IUXA 3RIAA 3TLTA 1OEDE 3UU6A 3RHWA 2LLYA 3TLSA 4F8HA 3TLVA 5HCMA 4TNWA 4HFIA 2BG9B 4IL9A 2MAWA 5HEUA 2XQ3A 4A97A 1OEDC 5LG3A 5HEGA 3EHZA 3RQUA 2YKSA 3TLWA 3RQWA 2M6IA 3P50A 2XQ5A 2XQ6A 4HFCA 4TWFA 3UU3A 2BG9C 3JADA 4HFEA 2XQ4A 3P4WA 2YN6A 3UU8A 3TLUA 4HFBA 1OEDA 2LKHA 4IREA 2XQ9A 4ZZBA 2LM2A 4TWDA 5CFBA 4LMJA 4ZZCA 4COFA 2YOEA 4IL4A 5L4HA 4Z90A 2XQ8A 5HEHA 2BG9A 3UQ7A 4LMKA
chains in the Genus database with same CATH superfamily
3G06A 4BA9A 1XNRT 3RI5A 4EGWA 4FI5A 3LJCA 1I6ZA 4H9SE 3SOLA 4UVCB 3HKDE 2M67A 4DV2T 2D9DA 4TZ4C 4IDPA 2WWUA 5H6RB 1UK5A 3RRWA 2UXDT 3E08A 5AQGB 2MPKA 4JUYA 1BR1A 2JQQA 3UQ4A 1HNZT 4ADZA 4TX5A 2DWGA 3SS1A 3FXDB 3FB2A 4JBWF 2PJQA 2WDVA 3RC3A 5LJMA 1AJ3A 5EK3A 3RYHE 2H88A 1ZEEA 5HCMA 3ZSSA 2LRKA 4N78D 4UXNB 1UGOA 5L3GB 2W00A 3BQKA 2X9HA 4MBQA 4UVBB 3IEEA 2PG8A 3P50A 2LT3A 4HFEA 2W66A 3KVAA 2ODUA 5JRCA 2CCQA 4U2ZA 2YN6A 5AQLB 1WYBA 2ZM6T 3ONLC 3QB5K 5LA6E 5CFBA 5FMNA 1QLBA 4PJLA 5L3CB 2ACZA 3QOFA 4O4IE 3GWHA 2BG9A 2I59A 4H63V 3P7IA 2KXPB 3HKCE 3AA0B 4LMKA 2BS2A 2H7OA 2MBGA 2Q9QA 4TNVA 5LMNT 4DV6T 4ZS3A 4WBNE 4AKLA 3AEDA 3Q2MA 4LF8T 4EOZB 5HXHA 3JC6C 3Q5XA 3P4RA 3KVBA 2UUBT 1ZHCA 4HWCA 4QX8B 5C3JA 3QC9A 4AKRB 4JI4T 5AQHB 5F8PA 2ES0A 2IAKA 2K48A 4LF5T 4NXMT 4DV3T 2E9XC 2LLYA 2OLTA 2WMNA 4P0BA 3B5MA 4J2CA 4DV4T 3DTOA 2LSIA 2VKOA 5M4YA 2EHOD 5JR9A 3RQWA 4V1Av 1XNQT 2OV9A 5KMGP 3O4XE 3P8CD 4L5GA 2E5LT 4C90A 2DI4A 2LJLA 2PTFA 4G63A 2UXBT 1MNEA 3E0ZA 3ZC0A 2HHHT 4IE4A 2W61A 5AQJB 2V7IA 4TV8E 4EB6E 3CPZA 2A9UA 4I55E 2W67A 4GYSA 4PFOA 3ZYMA 5AQSB 3F57A 2NOXA 2VVNA 3ONXA 3C98B 5CB4E 4DVDA 5AQIB 2XQ7A 3LSVA 1FMWA 3HA4A 4YLHA 4IE7A 2J1DG 2OA5A 1FMVA 2C5JA 1YXRA 1KEYA 3K8PC 2WDQA 1W0AA 5AQPB 4HKAA 1OEDB 4H9NC 5LB7B 3RIAA 2GK9A 5J2UE 1E1HB 1J1JA 3TLSA 2BVMA 1UURA 3RYIE 5LP6E 2FJBA 3GN5A 3AE9A 3PDYA 2XQ3A 2SPCA 4B3RT 3AVSA 2VQFT 4OX9T 1EZ3A 3N9OA 3H37A 2M6IA 1E7PA 2XQ6A 3AEBA 3AAAB 3V5SA 1KNPA 4OHFA 3C50A 3EDUA 3UU8A 2HPLA 2WM9A 5CJ5A 4UVAB 1OWAA 5LBMA 1R8IA 2UXCT 3K3NA 3NZQA 3HKBE 4JI1T 3AA6B 1IJ6A 4AIUA 1HR0T 3PUWF 3Q5DA 3NRXA 2X0LB 2JRKA 4PJNA 2BBJA 2LM9A 4I50E 4HFVA 2KINB 4U74A 3C4ZA 4B3TT 3ESLA 1T7SA 4EAHA 4KHZF 2LSJA 3KV4A 2FUPA 4UF0A 4B3ST 2ZMAA 4X66T 2L9QA 2D0TA 3O1HA 4DUZT 3UUNA 2WZIA 3KINB 4GIWA 4PNIA 2PBIA 1US7B 4C91A 4WZXA 2V6XA 2N1GA 3AECA 5FXVA 1YW0A 2K5BB 1WLXA 3CQCB 3RKGA 3EABA 2LOPA 4BJMA 2E9XB 4HN9A 2WU2A 2XJ7A 1O3XA 1IAPA 1YQ4A 4O2BE 2BKNA 3ONJA 3UU3A 5LG4A 3PUYF 4U7IA 4EYUA 1LVKA 1D0XA 3VKGA 3KBTA 4YXDA 1BR4A 4KHPT 2Q9QD 1YD8G 2RPAA 2K9AA 1T98A 4DMWA 4EV6A 1ZKEA 5FY0A 3PUGA 3Q5EA 4EIWA 3DJBA 1X79A 4Z90A 3AE8A 5J1GA 1YKEB 3ETUA 3KBUA 3K3OA 3FZMB 3T1YT 4B6XA 2CEAA 3F31A 5HEJA 4MALA 2FJAA 2WU5A 5EK2A 5FP3A 3T1HT 4JI6T 4NUUA 4HWDA 4JI7T 2KNDA 3MACA 3EVYA 4YTMA 1HG5A 2E2AA 4QWNB 3AE6A 5H6QB 4BAYB 4ZI3C 3NBXX 1NENA 4YT0A 3L39A 4IDQA 1Z8UA 2MTQA 3ZEFB 5TAOA 4DMVA 2IUBA 2E5VA 3IF8B 3MA9A 3N2GE 4U3CA 4UEMA 1WYCA 3AA7B 3V5UA 2XQ5A 4QXHB 2E9XA 3MKDA 4A56A 4DR4T 1MNDA 4QXCB 4G2AA 3VHLA 2B76A 2YU1A 5FNVE 5LJNA 1MMGA 3L09A 4O4HE 2V6YB 4ZZBA 2CBIA 3PUAA 3RIUA 5AQVB 3ANWB 2XAGB 3I1AA 3I9WA 3P4PA 2L3LA 3OKQA 4MHCA 1MMDA 3A5XA 2KWHA 2UXXB 4IDZA 2RP4A 2KMFA 2Y48B 4I0UA 5FXXA 3AE4A 3UFEA 1QUUA 5LHGB 2QVAA 1L0VA 4YFSA 4ISTA 3ZJ1A 2IW5B 4QX7B 1SHZC 1MIYA 1WFDA 2FBWA 4P09A 3UT5E 5ABGA 3C4WA 4U72A 4DR1T 2WMOA 1VRBA 3CQXC 3SFEA 3VR9A 5FL1A 2FJEA 4A97A 1OEDC 2DL1A 3J7Yq 1X9BA 3ZN1B 3TLWA 4HFCA 4TWFA 3N2OA 4CZZB 3DP7A 4NUVA 2CMRA 4JI8T 3MJXA 2LKHA 3LG7A 4NXNT 4GKKT 4LMJA 4ZZCA 3M3ZB 3MZKB 2VQET 4CQIA 4DIDB 2N9DA 3AB3B 3LK42 2HPJA 4IT4A 3I9YA 3ZKRA 3IA3A 1OXZA 3QNUA 5FXWA 2C0SA 2AXDS 5FVLA 4A98A 2CXLA 5AQKB 4ZOLE 5ADXL 3FZLB 5LGUB 2XAFB 2WY2A 3ZYKA 1SE7A 3ZT5A 1WR6A 5LOVE 2BDEA 4EEDA 5L4EA 5J0ZA 3NRYA 3PUZF 3F2EA 5EK4A 4NPPA 1Z0PA 5GONE 4QXBB 3CKDA 3CK6A 2LRLA 4X1KE 4KBMB 4YSZA 3ZMVB 3UUXB 4X64T 4DBRA 3AA1B 5ABHA 2ZM0A 1NAFA 2UXNB 3BQIA 4HE8A 5AQOB 1S94A 4TUYE 2C5KT 2BKPA 4CN6A 2X51A 1Y01A 2CBJA 4IREA 1I94T 3CQGB 2KZ7B 1D0YA 4HWIB 2BS4A 4IL4A 4I4TE 5HEHA 5BR8T 5LYJE 2WBLA 3CMLA 3ETVA 1IBMT 2G0UA 3AE2A 3RC8A 4FJOA 4JI2T 5L47A 2VASA 2ACXA 3M65A 1FJGT 4Z91A 3PURA 4EZ4A 2D5UA 3JC6D 3EI0A 1M7KA 5AQQB 3RH3A 3I0QA 2XQAA 2XHEB 5FL0A 4PK5A 3BK9A 3HR0A 1BR0A 5AQTB 3FXEB 2E9XD 4AKHA 3UU6A 4Z8XA 2WZHA 4ZI2C 1KFYA 3A8YC 2WWVA 2CE7A 3HI2A 4E7SA 1LVFA 3R6NA 3CX6B 3WAJA 2NR4A 3EHZA 3ZT6A 3O1JA 3I0OA 4H9QC 3RLFF 1SA0E 3ZMZB 4TV9E 2XTLA 3FBLA 3LK3B 5IWAT 2VK9A 3P4WA 1N36T 1N34T 2X9YA 1LRZA 2CXDA 2QA7A 1H7CA 3ZMTB 2FJDA 5JDLA 2ODVA 1GQEA 5AFUL 1LKXA 2K24A 3AXJB 4KP3C 4F6RC 2HN1A 4L0RA 1G73A 3AAEB 4X62T 2H89A 3N9QA 4ANJA 2CPTA 2W63A 4IE6A 5BMVE 2B1EA 4IDNA 3ZMUB 1FEWA 3AAIA 3ZPOA 4AQFA 3C64A 3OVUA 2VL8A 4DR5T 4NIQA 4H9OC 2LSYA 3MK7C 5LGTB 4IE0A 1HTJF 2CHOA 5IUXA 3TLTA 4BJNA 3X1DA 3AEGA 4CI3B 2VKJA 4UV8B 2EHOB 4QKNA 4EZHA 5DABA 4HWHA 3GA8A 2YK0A 5FXZA 4UIGA 3HKEE 5HEGA 2X67A 3H3MA 4IIJE 1U4QA 2WB5A 4XBFB 4AKGA 4PJMA 4IE5A 5JDNA 3PJAJ 4X1YE 1DU2A 1MMNA 2LHNA 5ABFB 5HAXA 5JDFA 1HF8A 4HFBA 1OEDA 1JNZA 3ZN0B 5AQUB 5C8YE 1IBLT 2CXFA 4COFA 2V7MA 1HX8A 1HNXT 1J5WA 5FVKA 3N9MA 2X66A 2W62A 2F4VT 3OYXA 4YSYA 5JR9C 3J9X1 3KV6A 4LFBT 2L8KA 2JJ9A 2VURA 2CWOA 4ILBA 4LF4T 1D0ZA 3NVOA 1HS7A 4IDOA 4YTPA 1UUSA 2IHR1 2CA5A 2YDRA 4X1IE 4ZI7E 3AEAA 2I6HA 5E0OA 4JI0T 4HFHA 4DV7T 3BQLA 2IMLA 1OEDE 2XAQB 3S4UA 2YEVC 3ZCIA 4U7YA 1IZNB 4X20E 5FKYA 1M62A 5HEUA 2YINA 5KDMC 2LSKA 3LBXB 5LG3A 5HXCA 1KK7A 4E7ZA 4X65T 4WW0A 4ZS2A 3VU7H 3L3PA 5FYMA 2XSBA 3AE5A 4OYKA 2XZEA 3JADA 2BZBA 1ZP0A 2CM0A 3WI3A 5ABEA 2KT9A 4O2AE 1XMQT 5FY7A 3QB5A 4K0KT 4OFZA 1KNZA 5KX5E 3VRAA 4DR2T 5AQFB 1ZV4X 3MXZA 3ZLIA 5JDQA 3CX8B 2NTYA 3QK6A 1ZOYA 2BBHA 1S35A 5C2TA 3ZMSB 2D2SA 5HWXA 3N9LA 5LBQB 2XUEA 4P1NA 3PU8A 4B3MT 2H7VC 3K3QC 3QUJA 3EDVA 3UUMA 4HFDA 2BKOA 1NWMX 3PV0F 3GMIA 5JRCB 3RIFA 2WP9A 3ZC1A 5HEOA 5LXTE 4GKJT 2ZLYA 2VVSA 3NWIA 3VKHA 1VCSA 4ZI3D 3C51A 5L3EB 2JPFA 4LF7T 1YKHB 2BG9B 3KV9A 4UELA 5DQVA 3PE0A 4AKIA 5FY1A 2Q9QB 4GYRA 4H63H 2YU2A 3ZT7A 4CI2B 1W9RA 1CHUA 3UTKA 1WCRA 3CWZB 2NTXA 3RPUA 2XAHB 2CRBA 2VKDA 2XQ9A 5A1LA 2NW7A 3RYCE 4MFRA 5JH7E 2YOEA 5F5WA 4ISSA 3PU3A 1N32T 5J2TE 4AI6A 4Q25A 1E2AA 5JDGA 3O1IA 2DNXA 4AQYT 4CI1B 4KMCA 4O4JE 2PFVA 2CHNA 3JAEA 1BR2A 3UUBA 5JDHA 5JR9B 5HXRA 4LMLA 2CLYB 3FZHB 1HG2A 2V6YA 3B57A 3P4QA 3RX6A 4QH1A 5HXEA 3JCFA 3PUVF 2X0HA 3ANWA 4YY3T 5IHYA 2UU9T 4U33A 2QYWA 4XAXB 2V1DB 5JVDE 4HWFA 2JQHA 3T8OA 4YTNA 2WSSV 4DR6T 2V7KA 4WYVA 4IL9A 5JQGE 4OYJA 3N9NA 3RKOA 3AE1A 2Z6EA 1FIOA 2LSGA 4EXTA 3AE3A 3K1SA 1CUNA 2EHOC 2JQ9A 2YKSA 4JI5T 4PK6A 4DUYT 5HWYA 2XPKA 1MIVA 4PJJA 5EZYE 1V9DA 1HNWT 2V7LA 5LCYA 2NWBA 3TLUA 1SUMB 4YJ3E 2JIWA 4XZCA 2LM2A 5LNKA 5JDMA 2NW8A 4HEAA 4DBQA 2RA1A 1UX4A 5AQMB 4P0AA 2W0GA 2JQKA 5LHIB 4AXPA 4QH4A 3UU4A 3GN5B 5L3FB 2WQYA 5JTGA 2WS3A 4TN7B 4DR7T 2NP9A 4PK4A 2E8IA 3WAKA 5CA1E 4LF6T 1HX1B 3LDQB 2VKHA 4DV1T 3P4SA 2V5DA 4ILCA 4GK5E 4CXYA 2BG9E 3Q5WA 3ZSTA 1XMOT 3RIUC 4QH5A 4I43B 3NZPA 3SFDA 1W0BA 2A2FX 1VOMA 3TLVA 4TNWA 3SWHA 3CVRA 4HFIA 4QHOA 5LMUT 3ZYLA 1VCTA 4M1PA 3VRBA 5IYZE 5LGNB 1HFAA 2HN2A 3UFGA 4HTEA 3U3IA 1XWMA 1N33T 4UF0B 2XSAA 4PW8A 2X0YA 3AEEA 1T72A 2DCFA 2YDSA 2XQ8A 4ASKA 3D0TA 2X9XA 2MYSA 1IJ5A 3RYFE 2BS3A 2DWKA 1QSDA 3OJAA 5HCJA 4CN1A 3PUXF 1D1AA 2V8SV 3PUSA 3VR8A 4KUMB 4CXWA 4TWHA 3EUHA 2AE9A 5L3DB 2JMHA 3UU5A 4JLEA 3PJAA 3OYZA 3JAFA 4JEUB 2LE8A 2KLQA 2C5IT 4A5XA 1T8BA 4ERRA 2LKGA 5F3JA 3A7MA 2WAUA 1WRDA 1G8XA 1D1CA 1UCUA 3UULA 3C4XA 4ZI2D 4OK0A 3LFMA 4WNKA 3CIRA 4PFPA 2Y8DA 3U78A 4DR3T 4EYYR 2VWAA 3B13A 3Q9DA 3RQUA 3ZJ2A 3HL6A 4H9PC 2XM1A 2MOZA 2NW9A 2BG9C 4LFCT 5DJQC 2XAJB 4L9IA 2BVLA 2Q9QC 2N2NA 5KXJA 2HH7A 5HYAA 4O8SA 1HCIA 5L4HA 3IHRA 1UX5A 2V26A 1WR0A 4IGUA 3UQ7A 4H9RC 5HXSA 2YDQA 4MLKA 1W09A 2X68A 2VL0A 5ETWA 2WDRA 4KI0F 4AISA 4YJ2E 2P9BA 4AQGA 4YHJA 2IC6A 4X5TA 1KF6A 4JYAT 1YQ3A 3H3AA 3RRCA 3KFWX 3AXJA 1MIWA 5L3BB 1J5ET 2KSRA 3SRZA 2IDOB 2CLYC 2V5CA 2A3DA 4WBOA 5LHHB 4LFAT 5L2LA 4UV9B 4ZHQE 2QRXA 2VB6A 2X9WA 2A72A 1KNRA 2J62A 2MAWA 3CX7B 4JI3T 2K3WA 4GOUA 2XQYA 4GK0E 3FHNA 3OPCA 5CA0E 4CN4A 1MMAA 3KV5A 4CXXA 3N9PA 3ABVA 5AQRB 4JV5T 2JMKA 3RF1A 4TWDA 4DO0A 3N2KE 1B7TA 3N5LA 4K0UA 2EHOA 2I0MA 4LF9T 4YHHT 3PTRB 2KWIB 5AQNB 3LK2B 2LOSA 2IC9A 4U31A 2QGSA 2Y6XA 5CGMA 2XY8B 1IBKT 3PUQA 3EAMA 1U5PA 2UUCT 3OBVE 2ZM8A 5ABFA 4DV5T 2D0UA 1XDOA 1NEKA 2IIUA 4IHJE 4ZEYA 2H3RA 4DV0T 2WCAA 2J4GA 3L8RA 1XDPA 3AE7A 4ILAA 2M6BA 2XM2A 3FBZA 4O4LE 3O9XA 4JEHB 3R84B 3RHWA 2W4XA 4F8HA 3FZKB 2ZM2A 3E22E 4EEBA 2V7JA 4ILUA 3RGLA 2LHRA 2W2UA 4UR9A 4YSXA 3W15B 5DQWA 2J47A 2LEHA 3OTOT 2XASB 3TKLB 3ZCJA 3NKZA 4U2YA 2CWYA 4HGAA 5JREA 1JNRA 2XQ4A 4DNDA 4AQFC 3IBPA 2UUAT 2DHRA 2R6GF 4KX6A 3FZFB 3KDSE 3AEFA 4ZXLA 2DLRA 4PAGA 1D1BA 3AVRA 1Y64B 3LBXA 1XZYA
chains in the Genus database with same CATH topology
4QH4A 3UU4A 3RI5A 3ZKRA 5HCJA 5L47A 4TNVA 4A98A 4Z91A 5HEJA 2XQ7A 3JAEA 3EAMA 3LSVA 3EI0A 4TWHA 3UUBA 2VL0A 4ILBA 4LMLA 3UU5A 4HFDA 4ILCA 2XQAA 4X5TA 3JAFA 5L4EA 2BG9E 4ILAA 3RIFA 3UQ4A 2M6BA 4QH1A 5J0ZA 2LKGA 5HEOA 4QH5A 4HFHA 1OEDB 4NPPA 2KSRA 5IUXA 3RIAA 3TLTA 1OEDE 3UU6A 3RHWA 2LLYA 3TLSA 4F8HA 3TLVA 5HCMA 4TNWA 4HFIA 2BG9B 4IL9A 2MAWA 5HEUA 2XQ3A 4A97A 1OEDC 5LG3A 5HEGA 3EHZA 3RQUA 2YKSA 3TLWA 3RQWA 2M6IA 3P50A 2XQ5A 2XQ6A 4HFCA 4TWFA 3UU3A 2BG9C 3JADA 4HFEA 2XQ4A 3P4WA 2YN6A 3UU8A 3TLUA 4HFBA 1OEDA 2LKHA 4IREA 2XQ9A 4ZZBA 2LM2A 4TWDA 5CFBA 4LMJA 4ZZCA 4COFA 2YOEA 4IL4A 5L4HA 4Z90A 2XQ8A 5HEHA 2BG9A 3UQ7A 4LMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH4 A;  3UU4 A;  3RI5 A;  3ZKR A;  5HCJ A;  5L47 A;  4TNV A;  4A98 A;  4Z91 A;  5HEJ A;  2XQ7 A;  3JAE A;  3EAM A;  3LSV A;  3EI0 A;  4TWH A;  3UUB A;  2VL0 A;  4ILB A;  4LML A;  3UU5 A;  4HFD A;  4ILC A;  2XQA A;  4X5T A;  3JAF A;  5L4E A;  2BG9 E;  4ILA A;  3RIF A;  3UQ4 A;  2M6B A;  4QH1 A;  5J0Z A;  2LKG A;  5HEO A;  4QH5 A;  4HFH A;  1OED B;  4NPP A;  2KSR A;  5IUX A;  3RIA A;  3TLT A;  1OED E;  3UU6 A;  3RHW A;  2LLY A;  3TLS A;  4F8H A;  3TLV A;  5HCM A;  4TNW A;  4HFI A;  2BG9 B;  4IL9 A;  2MAW A;  5HEU A;  2XQ3 A;  4A97 A;  1OED C;  5LG3 A;  5HEG A;  3EHZ A;  3RQU A;  2YKS A;  3TLW A;  3RQW A;  2M6I A;  3P50 A;  2XQ5 A;  2XQ6 A;  4HFC A;  4TWF A;  3UU3 A;  2BG9 C;  3JAD A;  4HFE A;  2XQ4 A;  3P4W A;  2YN6 A;  3UU8 A;  3TLU A;  4HFB A;  1OED A;  2LKH A;  4IRE A;  2XQ9 A;  4ZZB A;  2LM2 A;  4TWD A;  5CFB A;  4LMJ A;  4ZZC A;  4COF A;  2YOE A;  4IL4 A;  5L4H A;  4Z90 A;  2XQ8 A;  5HEH A;  2BG9 A;  3UQ7 A;  4LMK A; 
#chains in the Genus database with same CATH topology
 3G06 A;  4BA9 A;  1XNR T;  3RI5 A;  4EGW A;  4FI5 A;  3LJC A;  1I6Z A;  4H9S E;  3SOL A;  4UVC B;  3HKD E;  2M67 A;  4DV2 T;  2D9D A;  4TZ4 C;  4IDP A;  2WWU A;  5H6R B;  1UK5 A;  3RRW A;  2UXD T;  3E08 A;  5AQG B;  2MPK A;  4JUY A;  1BR1 A;  2JQQ A;  3UQ4 A;  1HNZ T;  4ADZ A;  4TX5 A;  2DWG A;  3SS1 A;  3FXD B;  3FB2 A;  4JBW F;  2PJQ A;  2WDV A;  3RC3 A;  5LJM A;  1AJ3 A;  5EK3 A;  3RYH E;  2H88 A;  1ZEE A;  5HCM A;  3ZSS A;  2LRK A;  4N78 D;  4UXN B;  1UGO A;  5L3G B;  2W00 A;  3BQK A;  2X9H A;  4MBQ A;  4UVB B;  3IEE A;  2PG8 A;  3P50 A;  2LT3 A;  4HFE A;  2W66 A;  3KVA A;  2ODU A;  5JRC A;  2CCQ A;  4U2Z A;  2YN6 A;  5AQL B;  1WYB A;  2ZM6 T;  3ONL C;  3QB5 K;  5LA6 E;  5CFB A;  5FMN A;  1QLB A;  4PJL A;  5L3C B;  2ACZ A;  3QOF A;  4O4I E;  3GWH A;  2BG9 A;  2I59 A;  4H63 V;  3P7I A;  2KXP B;  3HKC E;  3AA0 B;  4LMK A;  2BS2 A;  2H7O A;  2MBG A;  2Q9Q A;  4TNV A;  5LMN T;  4DV6 T;  4ZS3 A;  4WBN E;  4AKL A;  3AED A;  3Q2M A;  4LF8 T;  4EOZ B;  5HXH A;  3JC6 C;  3Q5X A;  3P4R A;  3KVB A;  2UUB T;  1ZHC A;  4HWC A;  4QX8 B;  5C3J A;  3QC9 A;  4AKR B;  4JI4 T;  5AQH B;  5F8P A;  2ES0 A;  2IAK A;  2K48 A;  4LF5 T;  4NXM T;  4DV3 T;  2E9X C;  2LLY A;  2OLT A;  2WMN A;  4P0B A;  3B5M A;  4J2C A;  4DV4 T;  3DTO A;  2LSI A;  2VKO A;  5M4Y A;  2EHO D;  5JR9 A;  3RQW A;  4V1A v;  1XNQ T;  2OV9 A;  5KMG P;  3O4X E;  3P8C D;  4L5G A;  2E5L T;  4C90 A;  2DI4 A;  2LJL A;  2PTF A;  4G63 A;  2UXB T;  1MNE A;  3E0Z A;  3ZC0 A;  2HHH T;  4IE4 A;  2W61 A;  5AQJ B;  2V7I A;  4TV8 E;  4EB6 E;  3CPZ A;  2A9U A;  4I55 E;  2W67 A;  4GYS A;  4PFO A;  3ZYM A;  5AQS B;  3F57 A;  2NOX A;  2VVN A;  3ONX A;  3C98 B;  5CB4 E;  4DVD A;  5AQI B;  2XQ7 A;  3LSV A;  1FMW A;  3HA4 A;  4YLH A;  4IE7 A;  2J1D G;  2OA5 A;  1FMV A;  2C5J A;  1YXR A;  1KEY A;  3K8P C;  2WDQ A;  1W0A A;  5AQP B;  4HKA A;  1OED B;  4H9N C;  5LB7 B;  3RIA A;  2GK9 A;  5J2U E;  1E1H B;  1J1J A;  3TLS A;  2BVM A;  1UUR A;  3RYI E;  5LP6 E;  2FJB A;  3GN5 A;  3AE9 A;  3PDY A;  2XQ3 A;  2SPC A;  4B3R T;  3AVS A;  2VQF T;  4OX9 T;  1EZ3 A;  3N9O A;  3H37 A;  2M6I A;  1E7P A;  2XQ6 A;  3AEB A;  3AAA B;  3V5S A;  1KNP A;  4OHF A;  3C50 A;  3EDU A;  3UU8 A;  2HPL A;  2WM9 A;  5CJ5 A;  4UVA B;  1OWA A;  5LBM A;  1R8I A;  2UXC T;  3K3N A;  3NZQ A;  3HKB E;  4JI1 T;  3AA6 B;  1IJ6 A;  4AIU A;  1HR0 T;  3PUW F;  3Q5D A;  3NRX A;  2X0L B;  2JRK A;  4PJN A;  2BBJ A;  2LM9 A;  4I50 E;  4HFV A;  2KIN B;  4U74 A;  3C4Z A;  4B3T T;  3ESL A;  1T7S A;  4EAH A;  4KHZ F;  2LSJ A;  3KV4 A;  2FUP A;  4UF0 A;  4B3S T;  2ZMA A;  4X66 T;  2L9Q A;  2D0T A;  3O1H A;  4DUZ T;  3UUN A;  2WZI A;  3KIN B;  4GIW A;  4PNI A;  2PBI A;  1US7 B;  4C91 A;  4WZX A;  2V6X A;  2N1G A;  3AEC A;  5FXV A;  1YW0 A;  2K5B B;  1WLX A;  3CQC B;  3RKG A;  3EAB A;  2LOP A;  4BJM A;  2E9X B;  4HN9 A;  2WU2 A;  2XJ7 A;  1O3X A;  1IAP A;  1YQ4 A;  4O2B E;  2BKN A;  3ONJ A;  3UU3 A;  5LG4 A;  3PUY F;  4U7I A;  4EYU A;  1LVK A;  1D0X A;  3VKG A;  3KBT A;  4YXD A;  1BR4 A;  4KHP T;  2Q9Q D;  1YD8 G;  2RPA A;  2K9A A;  1T98 A;  4DMW A;  4EV6 A;  1ZKE A;  5FY0 A;  3PUG A;  3Q5E A;  4EIW A;  3DJB A;  1X79 A;  4Z90 A;  3AE8 A;  5J1G A;  1YKE B;  3ETU A;  3KBU A;  3K3O A;  3FZM B;  3T1Y T;  4B6X A;  2CEA A;  3F31 A;  5HEJ A;  4MAL A;  2FJA A;  2WU5 A;  5EK2 A;  5FP3 A;  3T1H T;  4JI6 T;  4NUU A;  4HWD A;  4JI7 T;  2KND A;  3MAC A;  3EVY A;  4YTM A;  1HG5 A;  2E2A A;  4QWN B;  3AE6 A;  5H6Q B;  4BAY B;  4ZI3 C;  3NBX X;  1NEN A;  4YT0 A;  3L39 A;  4IDQ A;  1Z8U A;  2MTQ A;  3ZEF B;  5TAO A;  4DMV A;  2IUB A;  2E5V A;  3IF8 B;  3MA9 A;  3N2G E;  4U3C A;  4UEM A;  1WYC A;  3AA7 B;  3V5U A;  2XQ5 A;  4QXH B;  2E9X A;  3MKD A;  4A56 A;  4DR4 T;  1MND A;  4QXC B;  4G2A A;  3VHL A;  2B76 A;  2YU1 A;  5FNV E;  5LJN A;  1MMG A;  3L09 A;  4O4H E;  2V6Y B;  4ZZB A;  2CBI A;  3PUA A;  3RIU A;  5AQV B;  3ANW B;  2XAG B;  3I1A A;  3I9W A;  3P4P A;  2L3L A;  3OKQ A;  4MHC A;  1MMD A;  3A5X A;  2KWH A;  2UXX B;  4IDZ A;  2RP4 A;  2KMF A;  2Y48 B;  4I0U A;  5FXX A;  3AE4 A;  3UFE A;  1QUU A;  5LHG B;  2QVA A;  1L0V A;  4YFS A;  4IST A;  3ZJ1 A;  2IW5 B;  4QX7 B;  1SHZ C;  1MIY A;  1WFD A;  2FBW A;  4P09 A;  3UT5 E;  5ABG A;  3C4W A;  4U72 A;  4DR1 T;  2WMO A;  1VRB A;  3CQX C;  3SFE A;  3VR9 A;  5FL1 A;  2FJE A;  4A97 A;  1OED C;  2DL1 A;  3J7Y q;  1X9B A;  3ZN1 B;  3TLW A;  4HFC A;  4TWF A;  3N2O A;  4CZZ B;  3DP7 A;  4NUV A;  2CMR A;  4JI8 T;  3MJX A;  2LKH A;  3LG7 A;  4NXN T;  4GKK T;  4LMJ A;  4ZZC A;  3M3Z B;  3MZK B;  2VQE T;  4CQI A;  4DID B;  2N9D A;  3AB3 B;  3LK4 2;  2HPJ A;  4IT4 A;  3I9Y A;  3ZKR A;  3IA3 A;  1OXZ A;  3QNU A;  5FXW A;  2C0S A;  2AXD S;  5FVL A;  4A98 A;  2CXL A;  5AQK B;  4ZOL E;  5ADX L;  3FZL B;  5LGU B;  2XAF B;  2WY2 A;  3ZYK A;  1SE7 A;  3ZT5 A;  1WR6 A;  5LOV E;  2BDE A;  4EED A;  5L4E A;  5J0Z A;  3NRY A;  3PUZ F;  3F2E A;  5EK4 A;  4NPP A;  1Z0P A;  5GON E;  4QXB B;  3CKD A;  3CK6 A;  2LRL A;  4X1K E;  4KBM B;  4YSZ A;  3ZMV B;  3UUX B;  4X64 T;  4DBR A;  3AA1 B;  5ABH A;  2ZM0 A;  1NAF A;  2UXN B;  3BQI A;  4HE8 A;  5AQO B;  1S94 A;  4TUY E;  2C5K T;  2BKP A;  4CN6 A;  2X51 A;  1Y01 A;  2CBJ A;  4IRE A;  1I94 T;  3CQG B;  2KZ7 B;  1D0Y A;  4HWI B;  2BS4 A;  4IL4 A;  4I4T E;  5HEH A;  5BR8 T;  5LYJ E;  2WBL A;  3CML A;  3ETV A;  1IBM T;  2G0U A;  3AE2 A;  3RC8 A;  4FJO A;  4JI2 T;  5L47 A;  2VAS A;  2ACX A;  3M65 A;  1FJG T;  4Z91 A;  3PUR A;  4EZ4 A;  2D5U A;  3JC6 D;  3EI0 A;  1M7K A;  5AQQ B;  3RH3 A;  3I0Q A;  2XQA A;  2XHE B;  5FL0 A;  4PK5 A;  3BK9 A;  3HR0 A;  1BR0 A;  5AQT B;  3FXE B;  2E9X D;  4AKH A;  3UU6 A;  4Z8X A;  2WZH A;  4ZI2 C;  1KFY A;  3A8Y C;  2WWV A;  2CE7 A;  3HI2 A;  4E7S A;  1LVF A;  3R6N A;  3CX6 B;  3WAJ A;  2NR4 A;  3EHZ A;  3ZT6 A;  3O1J A;  3I0O A;  4H9Q C;  3RLF F;  1SA0 E;  3ZMZ B;  4TV9 E;  2XTL A;  3FBL A;  3LK3 B;  5IWA T;  2VK9 A;  3P4W A;  1N36 T;  1N34 T;  2X9Y A;  1LRZ A;  2CXD A;  2QA7 A;  1H7C A;  3ZMT B;  2FJD A;  5JDL A;  2ODV A;  1GQE A;  5AFU L;  1LKX A;  2K24 A;  3AXJ B;  4KP3 C;  4F6R C;  2HN1 A;  4L0R A;  1G73 A;  3AAE B;  4X62 T;  2H89 A;  3N9Q A;  4ANJ A;  2CPT A;  2W63 A;  4IE6 A;  5BMV E;  2B1E A;  4IDN A;  3ZMU B;  1FEW A;  3AAI A;  3ZPO A;  4AQF A;  3C64 A;  3OVU A;  2VL8 A;  4DR5 T;  4NIQ A;  4H9O C;  2LSY A;  3MK7 C;  5LGT B;  4IE0 A;  1HTJ F;  2CHO A;  5IUX A;  3TLT A;  4BJN A;  3X1D A;  3AEG A;  4CI3 B;  2VKJ A;  4UV8 B;  2EHO B;  4QKN A;  4EZH A;  5DAB A;  4HWH A;  3GA8 A;  2YK0 A;  5FXZ A;  4UIG A;  3HKE E;  5HEG A;  2X67 A;  3H3M A;  4IIJ E;  1U4Q A;  2WB5 A;  4XBF B;  4AKG A;  4PJM A;  4IE5 A;  5JDN A;  3PJA J;  4X1Y E;  1DU2 A;  1MMN A;  2LHN A;  5ABF B;  5HAX A;  5JDF A;  1HF8 A;  4HFB A;  1OED A;  1JNZ A;  3ZN0 B;  5AQU B;  5C8Y E;  1IBL T;  2CXF A;  4COF A;  2V7M A;  1HX8 A;  1HNX T;  1J5W A;  5FVK A;  3N9M A;  2X66 A;  2W62 A;  2F4V T;  3OYX A;  4YSY A;  5JR9 C;  3J9X 1;  3KV6 A;  4LFB T;  2L8K A;  2JJ9 A;  2VUR A;  2CWO A;  4ILB A;  4LF4 T;  1D0Z A;  3NVO A;  1HS7 A;  4IDO A;  4YTP A;  1UUS A;  2IHR 1;  2CA5 A;  2YDR A;  4X1I E;  4ZI7 E;  3AEA A;  2I6H A;  5E0O A;  4JI0 T;  4HFH A;  4DV7 T;  3BQL A;  2IML A;  1OED E;  2XAQ B;  3S4U A;  2YEV C;  3ZCI A;  4U7Y A;  1IZN B;  4X20 E;  5FKY A;  1M62 A;  5HEU A;  2YIN A;  5KDM C;  2LSK A;  3LBX B;  5LG3 A;  5HXC A;  1KK7 A;  4E7Z A;  4X65 T;  4WW0 A;  4ZS2 A;  3VU7 H;  3L3P A;  5FYM A;  2XSB A;  3AE5 A;  4OYK A;  2XZE A;  3JAD A;  2BZB A;  1ZP0 A;  2CM0 A;  3WI3 A;  5ABE A;  2KT9 A;  4O2A E;  1XMQ T;  5FY7 A;  3QB5 A;  4K0K T;  4OFZ A;  1KNZ A;  5KX5 E;  3VRA A;  4DR2 T;  5AQF B;  1ZV4 X;  3MXZ A;  3ZLI A;  5JDQ A;  3CX8 B;  2NTY A;  3QK6 A;  1ZOY A;  2BBH A;  1S35 A;  5C2T A;  3ZMS B;  2D2S A;  5HWX A;  3N9L A;  5LBQ B;  2XUE A;  4P1N A;  3PU8 A;  4B3M T;  2H7V C;  3K3Q C;  3QUJ A;  3EDV A;  3UUM A;  4HFD A;  2BKO A;  1NWM X;  3PV0 F;  3GMI A;  5JRC B;  3RIF A;  2WP9 A;  3ZC1 A;  5HEO A;  5LXT E;  4GKJ T;  2ZLY A;  2VVS A;  3NWI A;  3VKH A;  1VCS A;  4ZI3 D;  3C51 A;  5L3E B;  2JPF A;  4LF7 T;  1YKH B;  2BG9 B;  3KV9 A;  4UEL A;  5DQV A;  3PE0 A;  4AKI A;  5FY1 A;  2Q9Q B;  4GYR A;  4H63 H;  2YU2 A;  3ZT7 A;  4CI2 B;  1W9R A;  1CHU A;  3UTK A;  1WCR A;  3CWZ B;  2NTX A;  3RPU A;  2XAH B;  2CRB A;  2VKD A;  2XQ9 A;  5A1L A;  2NW7 A;  3RYC E;  4MFR A;  5JH7 E;  2YOE A;  5F5W A;  4ISS A;  3PU3 A;  1N32 T;  5J2T E;  4AI6 A;  4Q25 A;  1E2A A;  5JDG A;  3O1I A;  2DNX A;  4AQY T;  4CI1 B;  4KMC A;  4O4J E;  2PFV A;  2CHN A;  3JAE A;  1BR2 A;  3UUB A;  5JDH A;  5JR9 B;  5HXR A;  4LML A;  2CLY B;  3FZH B;  1HG2 A;  2V6Y A;  3B57 A;  3P4Q A;  3RX6 A;  4QH1 A;  5HXE A;  3JCF A;  3PUV F;  2X0H A;  3ANW A;  4YY3 T;  5IHY A;  2UU9 T;  4U33 A;  2QYW A;  4XAX B;  2V1D B;  5JVD E;  4HWF A;  2JQH A;  3T8O A;  4YTN A;  2WSS V;  4DR6 T;  2V7K A;  4WYV A;  4IL9 A;  5JQG E;  4OYJ A;  3N9N A;  3RKO A;  3AE1 A;  2Z6E A;  1FIO A;  2LSG A;  4EXT A;  3AE3 A;  3K1S A;  1CUN A;  2EHO C;  2JQ9 A;  2YKS A;  4JI5 T;  4PK6 A;  4DUY T;  5HWY A;  2XPK A;  1MIV A;  4PJJ A;  5EZY E;  1V9D A;  1HNW T;  2V7L A;  5LCY A;  2NWB A;  3TLU A;  1SUM B;  4YJ3 E;  2JIW A;  4XZC A;  2LM2 A;  5LNK A;  5JDM A;  2NW8 A;  4HEA A;  4DBQ A;  2RA1 A;  1UX4 A;  5AQM B;  4P0A A;  2W0G A;  2JQK A;  5LHI B;  4AXP A;  4QH4 A;  3UU4 A;  3GN5 B;  5L3F B;  2WQY A;  5JTG A;  2WS3 A;  4TN7 B;  4DR7 T;  2NP9 A;  4PK4 A;  2E8I A;  3WAK A;  5CA1 E;  4LF6 T;  1HX1 B;  3LDQ B;  2VKH A;  4DV1 T;  3P4S A;  2V5D A;  4ILC A;  4GK5 E;  4CXY A;  2BG9 E;  3Q5W A;  3ZST A;  1XMO T;  3RIU C;  4QH5 A;  4I43 B;  3NZP A;  3SFD A;  1W0B A;  2A2F X;  1VOM A;  3TLV A;  4TNW A;  3SWH A;  3CVR A;  4HFI A;  4QHO A;  5LMU T;  3ZYL A;  1VCT A;  4M1P A;  3VRB A;  5IYZ E;  5LGN B;  1HFA A;  2HN2 A;  3UFG A;  4HTE A;  3U3I A;  1XWM A;  1N33 T;  4UF0 B;  2XSA A;  4PW8 A;  2X0Y A;  3AEE A;  1T72 A;  2DCF A;  2YDS A;  2XQ8 A;  4ASK A;  3D0T A;  2X9X A;  2MYS A;  1IJ5 A;  3RYF E;  2BS3 A;  2DWK A;  1QSD A;  3OJA A;  5HCJ A;  4CN1 A;  3PUX F;  1D1A A;  2V8S V;  3PUS A;  3VR8 A;  4KUM B;  4CXW A;  4TWH A;  3EUH A;  2AE9 A;  5L3D B;  2JMH A;  3UU5 A;  4JLE A;  3PJA A;  3OYZ A;  3JAF A;  4JEU B;  2LE8 A;  2KLQ A;  2C5I T;  4A5X A;  1T8B A;  4ERR A;  2LKG A;  5F3J A;  3A7M A;  2WAU A;  1WRD A;  1G8X A;  1D1C A;  1UCU A;  3UUL A;  3C4X A;  4ZI2 D;  4OK0 A;  3LFM A;  4WNK A;  3CIR A;  4PFP A;  2Y8D A;  3U78 A;  4DR3 T;  4EYY R;  2VWA A;  3B13 A;  3Q9D A;  3RQU A;  3ZJ2 A;  3HL6 A;  4H9P C;  2XM1 A;  2MOZ A;  2NW9 A;  2BG9 C;  4LFC T;  5DJQ C;  2XAJ B;  4L9I A;  2BVL A;  2Q9Q C;  2N2N A;  5KXJ A;  2HH7 A;  5HYA A;  4O8S A;  1HCI A;  5L4H A;  3IHR A;  1UX5 A;  2V26 A;  1WR0 A;  4IGU A;  3UQ7 A;  4H9R C;  5HXS A;  2YDQ A;  4MLK A;  1W09 A;  2X68 A;  2VL0 A;  5ETW A;  2WDR A;  4KI0 F;  4AIS A;  4YJ2 E;  2P9B A;  4AQG A;  4YHJ A;  2IC6 A;  4X5T A;  1KF6 A;  4JYA T;  1YQ3 A;  3H3A A;  3RRC A;  3KFW X;  3AXJ A;  1MIW A;  5L3B B;  1J5E T;  2KSR A;  3SRZ A;  2IDO B;  2CLY C;  2V5C A;  2A3D A;  4WBO A;  5LHH B;  4LFA T;  5L2L A;  4UV9 B;  4ZHQ E;  2QRX A;  2VB6 A;  2X9W A;  2A72 A;  1KNR A;  2J62 A;  2MAW A;  3CX7 B;  4JI3 T;  2K3W A;  4GOU A;  2XQY A;  4GK0 E;  3FHN A;  3OPC A;  5CA0 E;  4CN4 A;  1MMA A;  3KV5 A;  4CXX A;  3N9P A;  3ABV A;  5AQR B;  4JV5 T;  2JMK A;  3RF1 A;  4TWD A;  4DO0 A;  3N2K E;  1B7T A;  3N5L A;  4K0U A;  2EHO A;  2I0M A;  4LF9 T;  4YHH T;  3PTR B;  2KWI B;  5AQN B;  3LK2 B;  2LOS A;  2IC9 A;  4U31 A;  2QGS A;  2Y6X A;  5CGM A;  2XY8 B;  1IBK T;  3PUQ A;  3EAM A;  1U5P A;  2UUC T;  3OBV E;  2ZM8 A;  5ABF A;  4DV5 T;  2D0U A;  1XDO A;  1NEK A;  2IIU A;  4IHJ E;  4ZEY A;  2H3R A;  4DV0 T;  2WCA A;  2J4G A;  3L8R A;  1XDP A;  3AE7 A;  4ILA A;  2M6B A;  2XM2 A;  3FBZ A;  4O4L E;  3O9X A;  4JEH B;  3R84 B;  3RHW A;  2W4X A;  4F8H A;  3FZK B;  2ZM2 A;  3E22 E;  4EEB A;  2V7J A;  4ILU A;  3RGL A;  2LHR A;  2W2U A;  4UR9 A;  4YSX A;  3W15 B;  5DQW A;  2J47 A;  2LEH A;  3OTO T;  2XAS B;  3TKL B;  3ZCJ A;  3NKZ A;  4U2Y A;  2CWY A;  4HGA A;  5JRE A;  1JNR A;  2XQ4 A;  4DND A;  4AQF C;  3IBP A;  2UUA T;  2DHR A;  2R6G F;  4KX6 A;  3FZF B;  3KDS E;  3AEF A;  4ZXL A;  2DLR A;  4PAG A;  1D1B A;  3AVR A;  1Y64 B;  3LBX A;  1XZY A; 
#chains in the Genus database with same CATH homology
 4QH4 A;  3UU4 A;  3RI5 A;  3ZKR A;  5HCJ A;  5L47 A;  4TNV A;  4A98 A;  4Z91 A;  5HEJ A;  2XQ7 A;  3JAE A;  3EAM A;  3LSV A;  3EI0 A;  4TWH A;  3UUB A;  2VL0 A;  4ILB A;  4LML A;  3UU5 A;  4HFD A;  4ILC A;  2XQA A;  4X5T A;  3JAF A;  5L4E A;  2BG9 E;  4ILA A;  3RIF A;  3UQ4 A;  2M6B A;  4QH1 A;  5J0Z A;  2LKG A;  5HEO A;  4QH5 A;  4HFH A;  1OED B;  4NPP A;  2KSR A;  5IUX A;  3RIA A;  3TLT A;  1OED E;  3UU6 A;  3RHW A;  2LLY A;  3TLS A;  4F8H A;  3TLV A;  5HCM A;  4TNW A;  4HFI A;  2BG9 B;  4IL9 A;  2MAW A;  5HEU A;  2XQ3 A;  4A97 A;  1OED C;  5LG3 A;  5HEG A;  3EHZ A;  3RQU A;  2YKS A;  3TLW A;  3RQW A;  2M6I A;  3P50 A;  2XQ5 A;  2XQ6 A;  4HFC A;  4TWF A;  3UU3 A;  2BG9 C;  3JAD A;  4HFE A;  2XQ4 A;  3P4W A;  2YN6 A;  3UU8 A;  3TLU A;  4HFB A;  1OED A;  2LKH A;  4IRE A;  2XQ9 A;  4ZZB A;  2LM2 A;  4TWD A;  5CFB A;  4LMJ A;  4ZZC A;  4COF A;  2YOE A;  4IL4 A;  5L4H A;  4Z90 A;  2XQ8 A;  5HEH A;  2BG9 A;  3UQ7 A;  4LMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...