2KLQA

The solution structure of cbd of human mcm6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
APKASLRLGFSEYSRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords DNA replication licensing factor MCM6
publication title Characterization and structure determination of the Cdt1 binding domain of human minichromosome maintenance (Mcm) 6
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 114
sequence length 114
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18263 MCM6_C MCM6 C-terminal winged-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.870 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2klqA00
2LE8A 2KLQA
chains in the Genus database with same CATH superfamily
2NW7A 2A3DA 1HG2A 3UQ4A 2XQ7A 3AE1A 1BR4A 1BR2A 2WU5A 1T8BA 2XAGB 3AE4A 4Z91A 4UVBB 3P4WA 4BAYB 1YQ3A 2CBIA 2HN1A 4UELA 2IHR1 3UU6A 5FY1A 3FBLA 4HWCA 2JRKA 2YU1A 4A97A 3E0ZA 5J0ZA 2FUPA 2LHNA 1IBMT 2VKDA 3O4XE 3P7IA 5FKYA 5LGNB 4U2ZA 2JQQA 2AXDS 1YXRA 2CPTA 3AEDA 2M6BA 4WZXA 1YKHB 2IAKA 4IE6A 3P8CD 5AQUB 2LOPA 3F31A 3PDYA 3IF8B 5L3GB 2LE8A 4LMLA 1KNPA 5L4EA 4DO0A 2Q9QA 3FZHB 2NTYA 1IZNB 3AECA 1UUSA 3N2OA 5LOVE 4PFPA 3ANWA 3LK42 3JAEA 2E9XB 5HEOA 2JQKA 3ANWB 1EZ3A 2XAFB 4IHJE 5KMGP 2W67A 3RGLA 2HH7A 5C2TA 1CHUA 4BA9A 5F3JA 2CHOA 2CWOA 4FI5A 1ZOYA 2XPKA 1J5ET 2VKHA 5LBQB 3HI2A 2BBHA 3B5MA 3OVUA 3RLFF 5ETWA 5J2UE 1N33T 4HFCA 4YLHA 5CA0E 2WM9A 3P50A 2LSGA 3H3AA 1X9BA 3LDQB 4DBQA 3CK6A 3ABVA 5LCYA 1OEDB 3K8PC 4IDNA 4X5TA 3N5LA 4DBRA 1G8XA 2XQ9A 1VCTA 1W9RA 1LRZA 4IE0A 1T72A 3QB5K 2BS2A 4EYYR 2LLYA 4A56A 2M67A 4HFIA 2EHOD 2VB6A 3ZMUB 5LYJE 4K0UA 4EB6E 3HKBE 3PE0A 5JRCA 5LHHB 3JCFA 3T1HT 3Q5EA 2XQ3A 2PTFA 5AFUL 5FL0A 5E0OA 4ISTA 4P09A 1IBKT 4EZHA 3ZN0B 1XMQT 4JI7T 3N9MA 1HX1B 2LM9A 4K0KT 2N2NA 2ACXA 4IDOA 5LBMA 5HEJA 4JI6T 3MACA 5FVKA 2YDSA 5JR9B 4UF0A 4NUUA 4X1KE 4TUYE 2CE7A 2E9XC 5HXHA 4NXNT 4QH4A 4ILCA 4DR5T 4DV4T 5HXEA 2NW9A 3LSVA 2K9AA 3H3MA 5L3CB 2YEVC 1NWMX 5EZYE 2XQ4A 4Z90A 3OKQA 3MJXA 2WMOA 3FZMB 4TZ4C 5IUXA 4PK4A 2JQHA 3ZYKA 5DJQC 1U4QA 2KMFA 5EK2A 3CQXC 4E7ZA 1L0VA 4QH1A 1LVFA 4DV6T 2H89A 4HTEA 2DWKA 2D2SA 4NIQA 3QK6A 2CRBA 1OEDC 2J47A 3CMLA 3NVOA 4L0RA 3ZPOA 4FJOA 3FZKB 2ACZA 4HFVA 4DMWA 3FZLB 4JEHB 2IW5B 2WAUA 3IEEA 5AQQB 2H7OA 3M3ZB 4ADZA 2Z6EA 1UGOA 3PUQA 1WFDA 3PUSA 4HEAA 4GK5E 3AEGA 4B3ST 2C5KT 2EHOA 3QC9A 2NW8A 5HEHA 5EK4A 3KBTA 2BS3A 4GK0E 4AQFC 2G0UA 3C4ZA 2X0HA 1KEYA 5ABGA 4HN9A 3AA7B 3UU5A 3ZKRA 2A72A 2RA1A 3OYXA 4G2AA 3NBXX 4OX9T 3KV5A 4HFDA 5L3FB 2BBJA 2YDQA 2CEAA 3J7Yq 4QWNB 4HFEA 4KUMB 5DABA 2HHHT 5FXZA 4DV5T 5JR9C 3ZMVB 5TAOA 4P0AA 5JDGA 3UTKA 3C98B 2KNDA 5CGMA 3AXJB 1KF6A 1HTJF 1MNEA 4JEUB 5L2LA 4ZI2C 1W09A 2E2AA 4OHFA 4IL9A 4ZXLA 1JNRA 1W0AA 4DV1T 4IE5A 4ILUA 2ZM6T 2MAWA 3LK2B 1HS7A 2BG9B 3GN5A 3PURA 4X20E 3UUMA 3CX7B 3UU3A 3HKDE 4DV3T 3GN5B 3MK7C 4DR4T 3HKEE 2FJAA 4IL4A 3HL6A 3C4XA 2WDQA 2R6GF 4DR6T 4EIWA 3ZT6A 3PUYF 5JDHA 2YKSA 2HN2A 4U74A 2BKPA 3ZYLA 3A8YC 4HKAA 2NP9A 4TX5A 4AKHA 3C50A 4YHHT 3FB2A 3RYHE 4I50E 2KT9A 3L39A 2XSAA 2HPJA 1HF8A 4QX8B 2JMHA 4KI0F 3OJAA 2A2FX 2V6YB 3QUJA 4ZHQE 4YSXA 2JMKA 3KV9A 4HWHA 4UXNB 2WB5A 1J5WA 5AQJB 4JI3T 3EHZA 5AQFB 4ANJA 4LF8T 3WAJA 4CI2B 1MIYA 4WW0A 4EGWA 3RC8A 3CIRA 2V5DA 2VVSA 5AQGB 5L4HA 3EI0A 2WQYA 5BMVE 3TLUA 2IIUA 2CCQA 5FVLA 3L8RA 5LG4A 2WZHA 1WCRA 4DV7T 5L3DB 1HR0T 2B76A 4CN6A 3BQIA 3KINB 2VURA 5HWXA 2QYWA 4U7YA 2IC9A 1UX5A 2LKGA 3NKZA 2XZEA 5A1LA 1IAPA 4B3RT 3GWHA 5GONE 2KINB 5ABFB 2XAQB 5JDLA 5KDMC 2VKOA 2XM1A 3UFEA 4EOZB 5JQGE 2CMRA 2XM2A 2V7MA 5AQKB 3LBXA 4DR7T 2Y48B 4UEMA 1O3XA 2BG9C 2XQ6A 3LBXB 5LGUB 1ZV4X 1DU2A 4TWFA 2V5CA 1NENA 2PG8A 4LFBT 1FMWA 4ZS2A 4AIUA 4HGAA 1Y01A 3AE3A 2WZIA 5FY7A 1UCUA 4B3MT 2H3RA 4QHOA 3B57A 3PU3A 2HPLA 4ZI3D 1FIOA 2X67A 2OLTA 4JV5T 3ZMSB 3P4PA 2J4GA 5L47A 4HWDA 4P1NA 2I6HA 5L3EB 3SOLA 3VRBA 3EUHA 5AQOB 4WYVA 3RX6A 1YW0A 3ZJ1A 1IJ6A 4KX6A 5LJMA 1HG5A 2Q9QB 3AAEB 3NRXA 3ZSSA 4JI2T 3SWHA 1XNRT 3W15B 4Z8XA 5AQNB 1VCSA 3KVBA 3RPUA 4LFAT 4EV6A 4PJLA 2F4VT 2PFVA 4UVCB 4CI3B 2DCFA 2WU2A 2XAJB 5ADXL 4G63A 4JI1T 1MMGA 3ZMTB 1BR0A 4ILAA 3RIUA 4LFCT 4GYSA 4AQGA 3RQUA 2LEHA 3PV0F 1D1BA 4X62T 3VR8A 4QKNA 2D0TA 4NUVA 3IBPA 4NPPA 2BS4A 2W0GA 2ZMAA 3L3PA 1D0ZA 5KX5E 2CXDA 3ETUA 4CXYA 4IE4A 4MALA 2WMNA 2V8SV 3RKGA 1D1AA 4TV9E 1OXZA 4JYAT 2FJBA 3AAIA 3ONLC 3N9OA 2W66A 1SE7A 1N32T 3QB5A 4MFRA 3ZT7A 4XAXB 3ONXA 2X9YA 1D0XA 4ILBA 3MZKB 4ZZBA 2DWGA 1WLXA 1XDOA 1MIWA 2XQAA 3AEAA 5JRCB 3O1IA 3R6NA 3ONJA 4Q25A 2XASB 5FMNA 3AE5A 2XQ8A 4AQFA 2UXCT 3AE2A 1V9DA 4IIJE 2E8IA 2CXLA 2V7LA 2KXPB 1E2AA 2E5VA 2WSSV 3PUGA 5HXRA 1QLBA 1MMNA 2FBWA 1YQ4A 2JIWA 2JQ9A 5IYZE 1KK7A 3ZCJA 2X68A 4ISSA 4DV0T 2W00A 3AA0B 1OEDE 4YY3T 3N9NA 2C5IT 4KMCA 4WBNE 4C91A 5L3BB 3OBVE 3C4WA 2X9HA 1ZKEA 4UF0B 3SFDA 2DI4A 3ZCIA 3N2KE 1OWAA 4A98A 4H9SE 4I4TE 3S4UA 4UVAB 3T8OA 2VWAA 2WWVA 4YSYA 3ZT5A 4MLKA 4AI6A 4TN7B 3RQWA 2VASA 2YK0A 2LKHA 4WBOA 3RF1A 4QX7B 4COFA 4ZZCA 3PJAJ 2YN6A 3CX6B 3GMIA 2L3LA 1SHZC 2XQYA 3AVRA 1JNZA 2DL1A 1ZHCA 4L9IA 3VU7H 5IHYA 5HEGA 2CXFA 4ASKA 3O1JA 4GYRA 4F6RC 4TNVA 3NZPA 1W0BA 4ZI7E 4U31A 3P4RA 4PK6A 4ZOLE 2LRKA 2XAHB 4DR3T 2V1DB 5LXTE 2PBIA 3OTOT 3ZLIA 2UU9T 2UXDT 3ZJ2A 2X66A 2VL8A 2QGSA 2XQ5A 1I94T 2KWIB 4O4IE 1US7B 2V7IA 1WYBA 2RPAA 2EHOB 5C3JA 4X1IE 1SA0E 1HFAA 5AQVB 5AQLB 3TLVA 3CQGB 2NOXA 5HWYA 2X0YA 3SS1A 2WS3A 4A5XA 4JBWF 2V26A 4YXDA 3SFEA 4CN1A 4O4LE 3LJCA 5LHIB 4GKKT 2I0MA 4JLEA 1FMVA 2MYSA 1E7PA 5CJ5A 2IC6A 4PNIA 2ZM0A 2CLYB 2IMLA 4PJNA 2QA7A 2XSBA 3VKHA 4LF5T 3BQLA 2RP4A 2D9DA 4JI0T 4PAGA 5JDMA 3AVSA 5J2TE 1FJGT 3O9XA 2YDRA 2KZ7B 5JDNA 3QOFA 5BR8T 1HNWT 1E1HB 4AKGA 3FHNA 1HX8A 4XZCA 1M62A 3M65A 4PW8A 3EDVA 2X9XA 2BKOA 1I6ZA 2NTXA 5LA6E 2W61A 2ES0A 2X51A 3MA9A 1CUNA 4OYJA 3AE8A 3IHRA 5AQSB 4L5GA 5AQMB 4AKRB 5FP3A 4BJMA 1HCIA 4ZEYA 5HXCA 2A9UA 4LMJA 3AE9A 3C64A 4EAHA 1XWMA 4I0UA 4O2BE 3CX8B 4PFOA 2XJ7A 5LB7B 3UQ7A 2XTLA 4B6XA 1WYCA 2UUAT 5FL1A 4IDPA 4TWDA 2CA5A 1U5PA 2BDEA 2MOZA 2IUBA 1WR6A 2Y6XA 3P4SA 3WAKA 2UXXB 2W4XA 1VRBA 4H9OC 3ZMZB 1MIVA 4ERRA 3C51A 2BKNA 4U72A 4NXMT 4DR2T 5ABEA 2EHOC 2QRXA 3ZSTA 1J1JA 4LF9T 1XMOT 1NAFA 2E9XD 4KP3C 2ZLYA 2GK9A 3CQCB 4CZZB 2BG9E 1FEWA 1S35A 3NRYA 1H7CA 4EEBA 3UT5E 3RH3A 5CFBA 3L09A 2QVAA 2E5LT 4O4HE 4GKJT 2VL0A 3EVYA 4GIWA 4YTNA 2W62A 4BJNA 2CLYC 1D0YA 1WR0A 4JI8T 4CI1B 3Q9DA 1MMAA 4YJ3E 2D0UA 4LMKA 3RRCA 2VK9A 3N9PA 4DUYT 5LGTB 4PK5A 3FZFB 3RC3A 2V7KA 5AQTB 4UV9B 4HWFA 5AQIB 4I43B 5CA1E 3VHLA 5AQHB 2H88A 3U78A 4OFZA 1XDPA 2LSIA 2VVNA 3VR9A 3T1YT 2UXNB 3I0OA 2CBJA 2NWBA 4EXTA 2H7VC 3V5UA 2WBLA 4YT0A 1HNXT 3ETVA 4HE8A 3JC6C 3ESLA 3Q5WA 3KV6A 3VRAA 1UK5A 1ZEEA 3BK9A 2VQET 2C5JA 3IA3A 4IDZA 4JUYA 4KHZF 3I9YA 3H37A 3K3OA 3ZN1B 1AJ3A 4JI4T 4HWIB 4EEDA 3NZQA 5H6RB 3V5SA 4YSZA 5F8PA 5F5WA 3EAMA 2CWYA 2UUCT 2UUBT 4MHCA 1UX4A 2IDOB 4X64T 2L9QA 3OPCA 3AE7A 4AKIA 4LF7T 2WDRA 4OK0A 1N34T 3NWIA 3AE6A 3KDSE 2E9XA 4IREA 4LF4T 3EDUA 4ZI2D 3JAFA 3MKDA 3PJAA 2LM2A 5HCMA 3D0TA 3PUZF 2LT3A 4P0BA 5H6QB 4J2CA 1VOMA 3RYIE 3O1HA 2JPFA 3UULA 2DNXA 3PUXF 1X79A 3OYZA 3CPZA 1Y64B 3UU8A 4CQIA 3ZEFB 5KXJA 3U3IA 1SUMB 5JH7E 2N1GA 1MNDA 5LNKA 3CVRA 1IJ5A 2DHRA 3ZYMA 4F8HA 2V6XA 3VKGA 3PU8A 3E08A 2P9BA 2I59A 2ZM8A 3K3QC 5LP6E 4CXWA 1OEDA 3UU4A 3TLTA 3EABA 3AEEA 2X9WA 3WI3A 2Y8DA 2AE9A 3MXZA 1QUUA 3AEBA 3E22E 4DNDA 3A5XA 4CXXA 5LHGB 5AQRB 4O8SA 4AISA 4H9PC 4PJMA 2K48A 1XNQT 2SPCA 2BVLA 4DR1T 3AA6B 4I55E 2FJDA 2BZBA 3CKDA 3KBUA 2C0SA 1LKXA 4TNWA 4U7IA 4IE7A 2LSYA 2YINA 2Q9QC 5DQWA 1YKEB 5FXVA 3J9X1 3P4QA 4DIDB 2WP9A 2D5UA 3LG7A 5JR9A 4DV2T 4U33A 3R84B 4U3CA 1R8IA 4IDQA 4X65T 4YTPA 2K5BB 1ZP0A 3HKCE 5HEUA 4N78D 5M4YA 3A7MA 3I9WA 5DQVA 5HXSA 4QXCB 3RIUC 3AEFA 2YOEA 4QH5A 3HA4A 3UUNA 3FBZA 2VQFT 2MPKA 3JC6D 3RYCE 3RI5A 4UV8B 2J62A 2XY8B 2WWUA 1YD8G 2J1DG 4YFSA 4KHPT 3GA8A 3F57A 2XHEB 4EZ4A 4OYKA 5LMUT 4M1PA 3QNUA 5HYAA 3PUAA 4O4JE 3I0QA 4KBMB 2VKJA 2CM0A 2B1EA 5FXXA 4UIGA 3LK3B 3FXDB 2LRLA 2MBGA 4X66T 3RKOA 4AKLA 1NEKA 5JDQA 1IBLT 4H9NC 3DTOA 3N2GE 5HCJA 3DP7A 3UUXB 1Z8UA 4DMVA 1N36T 4B3TT 5FY0A 1KFYA 5AQPB 3PUWF 2CHNA 1T98A 2K24A 4DVDA 2KWHA 2FJEA 4ZI3C 3ZC1A 3HR0A 1HNZT 4QXBB 4YJ2E 1QSDA 3B13A 5C8YE 4QXHB 3DJBA 5FNVE 3KV4A 3ZC0A 4TV8E 2ZM2A 3LFMA 1LVKA 2LJLA 3AXJA 1XZYA 2KSRA 5CB4E 4U2YA 3CWZB 4YHJA 2ODVA 2M6IA 4IT4A 2BVMA 4O2AE 4C90A 4MBQA 3PTRB 2WDVA 3RRWA 1M7KA 3K1SA 5J1GA 4LF6T 5LG3A 2V7JA 4YTMA 2BG9A 5LMNT 4EYUA 3PUVF 1D1CA 2ODUA 2DLRA 5FYMA 4HFHA 3AAAB 2JJ9A 2WCAA 4CN4A 3KFWX 2N9DA 4JI5T 3K3NA 3KVAA 2XUEA 5LJNA 1Z0PA 4H63V 4DUZT 2LSJA 3AB3B 4XBFB 1MMDA 1G73A 2LHRA 3RHWA 3I1AA 3Q5DA 3RYFE 4E7SA 5JREA 5JDFA 3AA1B 1S94A 3G06A 2UXBT 2LOSA 2V6YA 3UFGA 2L8KA 2Q9QD 2W63A 2LSKA 2MTQA 3RIAA 2YU2A 4HFBA 3Q5XA 3RIFA 2KLQA 2NR4A 2W2UA 4ZS3A 3N9QA 4UR9A 4AXPA 2X0LB 4X1YE 4PJJA 1KNRA 5JVDE 4WNKA 3BQKA 2OA5A 5IWAT 1B7TA 1GQEA 4TWHA 4IGUA 1KNZA 5JTGA 3FXEB 3UUBA 5HAXA 3TLWA 2PJQA 3JADA 1BR1A 5EK3A 5ABHA 3X1DA 3N9LA 2WY2A 3TKLB 4H9QC 3Q2MA 4GOUA 5FXWA 2K3WA 4H63H 4V1Av 3F2EA 4AQYT 1T7SA 5ABFA 4H9RC 3TLSA 1UURA 3SRZA 2OV9A 1WRDA
chains in the Genus database with same CATH topology
1ZHCA 4L9IA 3GN5A 3VU7H 3PURA 4X20E 5IHYA 3UUMA 2CXFA 2NW7A 4ASKA 3O1JA 3CX7B 2X9WA 4GYRA 2A3DA 3WI3A 1HG2A 2Y8DA 3HKDE 3GN5B 4F6RC 3MK7C 1BR4A 1BR2A 2XAGB 3HKEE 3NZPA 3MXZA 4UVBB 4ZI7E 1QUUA 4ZOLE 3E22E 3HL6A 3C4XA 4PK6A 2XAHB 4BAYB 4DNDA 4EIWA 2V1DB 3A5XA 4CXXA 5JDHA 5LHGB 5LXTE 4UELA 2PBIA 3ZLIA 5FY1A 4U74A 3ZJ2A 3ZYLA 4O8SA 2X66A 3FBLA 2VL8A 4HKAA 2NP9A 4TX5A 2QGSA 4AKHA 3C50A 4H9PC 4PJMA 2JRKA 2YU1A 3FB2A 3RYHE 3E0ZA 2K48A 4I50E 2SPCA 2BVLA 2KWIB 2LHNA 2KT9A 4O4IE 1US7B 2V7IA 2VKDA 3O4XE 3AA6B 1WYBA 2HPJA 3P7IA 5LGNB 1HF8A 2EHOB 4I55E 4QX8B 4X1IE 2JMHA 2JQQA 1SA0E 1HFAA 3OJAA 2BZBA 2A2FX 3QUJA 4ZHQE 3CQGB 2JMKA 3CKDA 3KV9A 3KBUA 2C0SA 2NOXA 1YKHB 2IAKA 4UXNB 5HWYA 4IE6A 3P8CD 1LKXA 2LOPA 3F31A 3PDYA 3IF8B 5L3GB 3SS1A 2LE8A 4IE7A 4DO0A 2V26A 4O4LE 2LSYA 2Q9QA 4ANJA 2NTYA 3LJCA 1IZNB 3WAJA 5LHIB 4CI2B 1MIYA 2YINA 4JLEA 1FMVA 2MYSA 2Q9QC 5DQWA 3N2OA 1YKEB 4WW0A 4PFPA 5LOVE 3ANWA 3RC8A 5FXVA 3LK42 2IC6A 4PNIA 2ZM0A 2CLYB 3J9X1 2E9XB 3ANWB 1EZ3A 2XAFB 2QA7A 4IHJE 4PJNA 2D5UA 5KMGP 3LG7A 5JR9A 3VKHA 3BQLA 2RP4A 2HH7A 4BA9A 5F3JA 4PAGA 5JDMA 5BMVE 2CWOA 4FI5A 3R84B 3AVSA 5J2TE 2CCQA 2K5BB 5LG4A 2VKHA 3HKCE 3HI2A 5LBQB 5L3DB 3O9XA 4N78D 5M4YA 3BQIA 3I9WA 3KINB 5DQVA 2KZ7B 5JDNA 5ETWA 5J2UE 1E1HB 5HWXA 4AKGA 3FHNA 5HXSA 4QXCB 1HX8A 2IC9A 4YLHA 4XZCA 5CA0E 1UX5A 2WM9A 3M65A 4PW8A 3EDVA 2X9XA 2LSGA 5A1LA 2NTXA 1IAPA 3H3AA 3HA4A 5LA6E 2W61A 3UUNA 2ES0A 2X51A 3MA9A 4DBQA 3FBZA 1CUNA 3GWHA 4OYJA 5GONE 3IHRA 2KINB 2XAQB 5JDLA 4L5GA 4AKRB 5LCYA 5KDMC 2VKOA 3JC6D 3RYCE 3K8PC 3UFEA 4EOZB 5FP3A 5JQGE 2CMRA 4BJMA 1HCIA 4UV8B 3N5LA 1G8XA 2V7MA 5HXCA 4DBRA 3LBXA 2WWUA 2Y48B 3C64A 4UEMA 1YD8G 4EAHA 2J1DG 4YFSA 1O3XA 1LRZA 3GA8A 4O2BE 4IE0A 3LBXB 3CX8B 5LGUB 3F57A 4PFOA 1ZV4X 2XHEB 4EZ4A 2XTLA 4OYKA 4EYYR 4B6XA 1WYCA 2PG8A 4A56A 2M67A 4M1PA 5HYAA 3PUAA 2EHOD 4O4JE 3I0QA 1FMWA 4KBMB 2VB6A 4ZS2A 3ZMUB 4HGAA 5LYJE 2CA5A 4K0UA 2VKJA 2CM0A 1U5PA 2BDEA 2MOZA 4EB6E 2B1EA 5FY7A 5FXXA 1WR6A 1UCUA 3HKBE 3PE0A 2Y6XA 5JRCA 4UIGA 3WAKA 3LK3B 3FXDB 2H3RA 2MBGA 5LHHB 2UXXB 4QHOA 3RKOA 4AKLA 3B57A 1VRBA 3PU3A 4H9OC 3ZMZB 2HPLA 4ZI3D 5JDQA 1FIOA 1MIVA 2X67A 4ERRA 3C51A 4H9NC 3DTOA 3N2GE 4U72A 3ZMSB 5AFUL 3DP7A 5E0OA 4ISTA 3UUXB 5L3EB 3SOLA 2EHOC 4DMVA 5FY0A 4P09A 3EUHA 4EZHA 3RX6A 3ZN0B 1NAFA 1YW0A 2E9XD 3ZJ1A 4KP3C 1IJ6A 2ZLYA 5LJMA 2GK9A 3CQCB 4CZZB 1HG5A 2Q9QB 3N9MA 1T98A 2K24A 4DVDA 3AAEB 2KWHA 2LM9A 3NRXA 4ZI3C 2N2NA 1FEWA 1S35A 3SWHA 2ACXA 3NRYA 3ZC1A 1H7CA 5LBMA 3UT5E 3W15B 4Z8XA 3RH3A 3HR0A 3L09A 3KVBA 3RPUA 3MACA 4PJLA 4QXBB 2PFVA 4YJ2E 4O4HE 4UVCB 4CI3B 1QSDA 2DCFA 5JR9B 3B13A 4UF0A 3EVYA 4GIWA 4QXHB 2W62A 5C8YE 4NUUA 4BJNA 4X1KE 4TUYE 2CLYC 3DJBA 2XAJB 2CE7A 1D0YA 5FNVE 5ADXL 2E9XC 4G63A 3KV4A 5HXHA 3ZC0A 1MMGA 4TV8E 4CI1B 3ZMTB 1BR0A 3Q9DA 2ZM2A 5HXEA 1MMAA 2NW9A 3LFMA 4YJ3E 4GYSA 2K9AA 1LVKA 4AQGA 2D0UA 2LEHA 2YEVC 2VK9A 3RRCA 5L3CB 3N9PA 2LJLA 5CB4E 5LGTB 4PK5A 1NWMX 3RC3A 1D1BA 2V7KA 3CWZB 5EZYE 4QKNA 4YHJA 2ODVA 2D0TA 4UV9B 4NUVA 3IBPA 3OKQA 4I43B 2BVMA 5CA1E 3MJXA 4O2AE 4C90A 4MBQA 2W0GA 2WMOA 2ZMAA 3L3PA 3PTRB 3VHLA 1D0ZA 4TZ4C 2CXDA 5KX5E 3RRWA 3ETUA 5J1GA 3U78A 4OFZA 4PK4A 4CXYA 4IE4A 3ZYKA 4MALA 2WMNA 5DJQC 1U4QA 2V7JA 2KMFA 4EYUA 1D1AA 3CQXC 1D1CA 2LSIA 4TV9E 4E7ZA 5EK2A 1LVFA 2ODUA 4HTEA 2DLRA 2DWKA 2UXNB 5FYMA 1OXZA 3I0OA 3AAAB 2D2SA 2JJ9A 2NWBA 4EXTA 3AAIA 3QK6A 3N9OA 2H7VC 3V5UA 2WBLA 3KFWX 2N9DA 3CMLA 3K3NA 4L0RA 3KVAA 3ZPOA 4FJOA 2XUEA 5LJNA 1Z0PA 3ETVA 4HE8A 4H63V 4HFVA 3JC6C 4DMWA 3ESLA 3Q5WA 4MFRA 3KV6A 2LSJA 3AB3B 3ONXA 4XAXB 2X9YA 1ZEEA 4JEHB 4XBFB 1MMDA 3BK9A 2IW5B 2WAUA 3IEEA 1G73A 1D0XA 3MZKB 2C5JA 2H7OA 2DWGA 2LHRA 4ADZA 2Z6EA 3PUQA 4IDZA 1WLXA 3I1AA 1MIWA 3PUSA 4GK5E 4HEAA 5JRCB 3O1IA 3RYFE 3R6NA 4E7SA 2C5KT 5JREA 2XASB 4JUYA 2EHOA 5JDFA 3AA1B 5FMNA 3QC9A 2NW8A 3I9YA 3H37A 3K3OA 5EK4A 1S94A 3ZN1B 1AJ3A 3KBTA 4AQFA 2LOSA 2L8KA 3NZQA 5H6RB 3V5SA 5F8PA 2Q9QD 2W63A 4GK0E 1V9DA 4AQFC 2G0UA 4IIJE 2E8IA 2CXLA 2LSKA 2V7LA 3C4ZA 2MTQA 2KXPB 2CWYA 4HN9A 2WSSV 3PUGA 2YU2A 5HXRA 3AA7B 3Q5XA 1MMNA 4MHCA 1UX4A 2KLQA 2A72A 5IYZE 1KK7A 3ZCJA 2RA1A 2X68A 3OYXA 4G2AA 2L9QA 4AKIA 4ISSA 3NBXX 4OK0A 2W00A 3KV5A 3AA0B 5L3FB 3N9NA 4ZS3A 3N9QA 2C5IT 4AXPA 4KMCA 2X0LB 4WBNE 2CEAA 4PJJA 3KDSE 4X1YE 4C91A 3J7Yq 5JVDE 5L3BB 3OBVE 4QWNB 2E9XA 3EDUA 4ZI2D 4WNKA 3C4WA 2X9HA 1ZKEA 3MKDA 4KUMB 4UF0B 5DABA 3BQKA 2OA5A 3D0TA 2LT3A 2DI4A 3ZCIA 4P0BA 3N2KE 1OWAA 1B7TA 5H6QB 4J2CA 1VOMA 4H9SE 3RYIE 5FXZA 4IGUA 4I4TE 1KNZA 5JR9C 3O1HA 3ZMVB 2JPFA 5TAOA 3UULA 2DNXA 3FXEB 3S4UA 4P0AA 5JDGA 3UTKA 3C98B 2KNDA 4UVAB 3T8OA 1X79A 2VWAA 3OYZA 3CPZA 4MLKA 5HAXA 1Y64B 2PJQA 4AI6A 4CQIA 1HTJF 3ZEFB 4TN7B 1BR1A 5EK3A 1MNEA 3U3IA 4JEUB 2VASA 2YK0A 5L2LA 3N9LA 4WBOA 3TKLB 4ZI2C 5JH7E 4H9QC 2N1GA 3Q2MA 1MNDA 3CVRA 4OHFA 4QX7B 4GOUA 5FXWA 1IJ5A 5LNKA 4H63H 2DHRA 3CX6B 3GMIA 4V1Av 3ZYMA 3VKGA 3F2EA 2L3LA 3PU8A 3E08A 4IE5A 4ILUA 2P9BA 4H9RC 3SRZA 2I59A 2ZM8A 3LK2B 1HS7A 3K3QC 1SHZC 5LP6E 4CXWA 2XQYA 3AVRA 1WRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE8 A;  2KLQ A; 
#chains in the Genus database with same CATH topology
 2NW7 A;  2A3D A;  1HG2 A;  3UQ4 A;  2XQ7 A;  3AE1 A;  1BR4 A;  1BR2 A;  2WU5 A;  1T8B A;  2XAG B;  3AE4 A;  4Z91 A;  4UVB B;  3P4W A;  4BAY B;  1YQ3 A;  2CBI A;  2HN1 A;  4UEL A;  2IHR 1;  3UU6 A;  5FY1 A;  3FBL A;  4HWC A;  2JRK A;  2YU1 A;  4A97 A;  3E0Z A;  5J0Z A;  2FUP A;  2LHN A;  1IBM T;  2VKD A;  3O4X E;  3P7I A;  5FKY A;  5LGN B;  4U2Z A;  2JQQ A;  2AXD S;  1YXR A;  2CPT A;  3AED A;  2M6B A;  4WZX A;  1YKH B;  2IAK A;  4IE6 A;  3P8C D;  5AQU B;  2LOP A;  3F31 A;  3PDY A;  3IF8 B;  5L3G B;  2LE8 A;  4LML A;  1KNP A;  5L4E A;  4DO0 A;  2Q9Q A;  3FZH B;  2NTY A;  1IZN B;  3AEC A;  1UUS A;  3N2O A;  5LOV E;  4PFP A;  3ANW A;  3LK4 2;  3JAE A;  2E9X B;  5HEO A;  2JQK A;  3ANW B;  1EZ3 A;  2XAF B;  4IHJ E;  5KMG P;  2W67 A;  3RGL A;  2HH7 A;  5C2T A;  1CHU A;  4BA9 A;  5F3J A;  2CHO A;  2CWO A;  4FI5 A;  1ZOY A;  2XPK A;  1J5E T;  2VKH A;  5LBQ B;  3HI2 A;  2BBH A;  3B5M A;  3OVU A;  3RLF F;  5ETW A;  5J2U E;  1N33 T;  4HFC A;  4YLH A;  5CA0 E;  2WM9 A;  3P50 A;  2LSG A;  3H3A A;  1X9B A;  3LDQ B;  4DBQ A;  3CK6 A;  3ABV A;  5LCY A;  1OED B;  3K8P C;  4IDN A;  4X5T A;  3N5L A;  4DBR A;  1G8X A;  2XQ9 A;  1VCT A;  1W9R A;  1LRZ A;  4IE0 A;  1T72 A;  3QB5 K;  2BS2 A;  4EYY R;  2LLY A;  4A56 A;  2M67 A;  4HFI A;  2EHO D;  2VB6 A;  3ZMU B;  5LYJ E;  4K0U A;  4EB6 E;  3HKB E;  3PE0 A;  5JRC A;  5LHH B;  3JCF A;  3T1H T;  3Q5E A;  2XQ3 A;  2PTF A;  5AFU L;  5FL0 A;  5E0O A;  4IST A;  4P09 A;  1IBK T;  4EZH A;  3ZN0 B;  1XMQ T;  4JI7 T;  3N9M A;  1HX1 B;  2LM9 A;  4K0K T;  2N2N A;  2ACX A;  4IDO A;  5LBM A;  5HEJ A;  4JI6 T;  3MAC A;  5FVK A;  2YDS A;  5JR9 B;  4UF0 A;  4NUU A;  4X1K E;  4TUY E;  2CE7 A;  2E9X C;  5HXH A;  4NXN T;  4QH4 A;  4ILC A;  4DR5 T;  4DV4 T;  5HXE A;  2NW9 A;  3LSV A;  2K9A A;  3H3M A;  5L3C B;  2YEV C;  1NWM X;  5EZY E;  2XQ4 A;  4Z90 A;  3OKQ A;  3MJX A;  2WMO A;  3FZM B;  4TZ4 C;  5IUX A;  4PK4 A;  2JQH A;  3ZYK A;  5DJQ C;  1U4Q A;  2KMF A;  5EK2 A;  3CQX C;  4E7Z A;  1L0V A;  4QH1 A;  1LVF A;  4DV6 T;  2H89 A;  4HTE A;  2DWK A;  2D2S A;  4NIQ A;  3QK6 A;  2CRB A;  1OED C;  2J47 A;  3CML A;  3NVO A;  4L0R A;  3ZPO A;  4FJO A;  3FZK B;  2ACZ A;  4HFV A;  4DMW A;  3FZL B;  4JEH B;  2IW5 B;  2WAU A;  3IEE A;  5AQQ B;  2H7O A;  3M3Z B;  4ADZ A;  2Z6E A;  1UGO A;  3PUQ A;  1WFD A;  3PUS A;  4HEA A;  4GK5 E;  3AEG A;  4B3S T;  2C5K T;  2EHO A;  3QC9 A;  2NW8 A;  5HEH A;  5EK4 A;  3KBT A;  2BS3 A;  4GK0 E;  4AQF C;  2G0U A;  3C4Z A;  2X0H A;  1KEY A;  5ABG A;  4HN9 A;  3AA7 B;  3UU5 A;  3ZKR A;  2A72 A;  2RA1 A;  3OYX A;  4G2A A;  3NBX X;  4OX9 T;  3KV5 A;  4HFD A;  5L3F B;  2BBJ A;  2YDQ A;  2CEA A;  3J7Y q;  4QWN B;  4HFE A;  4KUM B;  5DAB A;  2HHH T;  5FXZ A;  4DV5 T;  5JR9 C;  3ZMV B;  5TAO A;  4P0A A;  5JDG A;  3UTK A;  3C98 B;  2KND A;  5CGM A;  3AXJ B;  1KF6 A;  1HTJ F;  1MNE A;  4JEU B;  5L2L A;  4ZI2 C;  1W09 A;  2E2A A;  4OHF A;  4IL9 A;  4ZXL A;  1JNR A;  1W0A A;  4DV1 T;  4IE5 A;  4ILU A;  2ZM6 T;  2MAW A;  3LK2 B;  1HS7 A;  2BG9 B;  3GN5 A;  3PUR A;  4X20 E;  3UUM A;  3CX7 B;  3UU3 A;  3HKD E;  4DV3 T;  3GN5 B;  3MK7 C;  4DR4 T;  3HKE E;  2FJA A;  4IL4 A;  3HL6 A;  3C4X A;  2WDQ A;  2R6G F;  4DR6 T;  4EIW A;  3ZT6 A;  3PUY F;  5JDH A;  2YKS A;  2HN2 A;  4U74 A;  2BKP A;  3ZYL A;  3A8Y C;  4HKA A;  2NP9 A;  4TX5 A;  4AKH A;  3C50 A;  4YHH T;  3FB2 A;  3RYH E;  4I50 E;  2KT9 A;  3L39 A;  2XSA A;  2HPJ A;  1HF8 A;  4QX8 B;  2JMH A;  4KI0 F;  3OJA A;  2A2F X;  2V6Y B;  3QUJ A;  4ZHQ E;  4YSX A;  2JMK A;  3KV9 A;  4HWH A;  4UXN B;  2WB5 A;  1J5W A;  5AQJ B;  4JI3 T;  3EHZ A;  5AQF B;  4ANJ A;  4LF8 T;  3WAJ A;  4CI2 B;  1MIY A;  4WW0 A;  4EGW A;  3RC8 A;  3CIR A;  2V5D A;  2VVS A;  5AQG B;  5L4H A;  3EI0 A;  2WQY A;  5BMV E;  3TLU A;  2IIU A;  2CCQ A;  5FVL A;  3L8R A;  5LG4 A;  2WZH A;  1WCR A;  4DV7 T;  5L3D B;  1HR0 T;  2B76 A;  4CN6 A;  3BQI A;  3KIN B;  2VUR A;  5HWX A;  2QYW A;  4U7Y A;  2IC9 A;  1UX5 A;  2LKG A;  3NKZ A;  2XZE A;  5A1L A;  1IAP A;  4B3R T;  3GWH A;  5GON E;  2KIN B;  5ABF B;  2XAQ B;  5JDL A;  5KDM C;  2VKO A;  2XM1 A;  3UFE A;  4EOZ B;  5JQG E;  2CMR A;  2XM2 A;  2V7M A;  5AQK B;  3LBX A;  4DR7 T;  2Y48 B;  4UEM A;  1O3X A;  2BG9 C;  2XQ6 A;  3LBX B;  5LGU B;  1ZV4 X;  1DU2 A;  4TWF A;  2V5C A;  1NEN A;  2PG8 A;  4LFB T;  1FMW A;  4ZS2 A;  4AIU A;  4HGA A;  1Y01 A;  3AE3 A;  2WZI A;  5FY7 A;  1UCU A;  4B3M T;  2H3R A;  4QHO A;  3B57 A;  3PU3 A;  2HPL A;  4ZI3 D;  1FIO A;  2X67 A;  2OLT A;  4JV5 T;  3ZMS B;  3P4P A;  2J4G A;  5L47 A;  4HWD A;  4P1N A;  2I6H A;  5L3E B;  3SOL A;  3VRB A;  3EUH A;  5AQO B;  4WYV A;  3RX6 A;  1YW0 A;  3ZJ1 A;  1IJ6 A;  4KX6 A;  5LJM A;  1HG5 A;  2Q9Q B;  3AAE B;  3NRX A;  3ZSS A;  4JI2 T;  3SWH A;  1XNR T;  3W15 B;  4Z8X A;  5AQN B;  1VCS A;  3KVB A;  3RPU A;  4LFA T;  4EV6 A;  4PJL A;  2F4V T;  2PFV A;  4UVC B;  4CI3 B;  2DCF A;  2WU2 A;  2XAJ B;  5ADX L;  4G63 A;  4JI1 T;  1MMG A;  3ZMT B;  1BR0 A;  4ILA A;  3RIU A;  4LFC T;  4GYS A;  4AQG A;  3RQU A;  2LEH A;  3PV0 F;  1D1B A;  4X62 T;  3VR8 A;  4QKN A;  2D0T A;  4NUV A;  3IBP A;  4NPP A;  2BS4 A;  2W0G A;  2ZMA A;  3L3P A;  1D0Z A;  5KX5 E;  2CXD A;  3ETU A;  4CXY A;  4IE4 A;  4MAL A;  2WMN A;  2V8S V;  3RKG A;  1D1A A;  4TV9 E;  1OXZ A;  4JYA T;  2FJB A;  3AAI A;  3ONL C;  3N9O A;  2W66 A;  1SE7 A;  1N32 T;  3QB5 A;  4MFR A;  3ZT7 A;  4XAX B;  3ONX A;  2X9Y A;  1D0X A;  4ILB A;  3MZK B;  4ZZB A;  2DWG A;  1WLX A;  1XDO A;  1MIW A;  2XQA A;  3AEA A;  5JRC B;  3O1I A;  3R6N A;  3ONJ A;  4Q25 A;  2XAS B;  5FMN A;  3AE5 A;  2XQ8 A;  4AQF A;  2UXC T;  3AE2 A;  1V9D A;  4IIJ E;  2E8I A;  2CXL A;  2V7L A;  2KXP B;  1E2A A;  2E5V A;  2WSS V;  3PUG A;  5HXR A;  1QLB A;  1MMN A;  2FBW A;  1YQ4 A;  2JIW A;  2JQ9 A;  5IYZ E;  1KK7 A;  3ZCJ A;  2X68 A;  4ISS A;  4DV0 T;  2W00 A;  3AA0 B;  1OED E;  4YY3 T;  3N9N A;  2C5I T;  4KMC A;  4WBN E;  4C91 A;  5L3B B;  3OBV E;  3C4W A;  2X9H A;  1ZKE A;  4UF0 B;  3SFD A;  2DI4 A;  3ZCI A;  3N2K E;  1OWA A;  4A98 A;  4H9S E;  4I4T E;  3S4U A;  4UVA B;  3T8O A;  2VWA A;  2WWV A;  4YSY A;  3ZT5 A;  4MLK A;  4AI6 A;  4TN7 B;  3RQW A;  2VAS A;  2YK0 A;  2LKH A;  4WBO A;  3RF1 A;  4QX7 B;  4COF A;  4ZZC A;  3PJA J;  2YN6 A;  3CX6 B;  3GMI A;  2L3L A;  1SHZ C;  2XQY A;  3AVR A;  1JNZ A;  2DL1 A;  1ZHC A;  4L9I A;  3VU7 H;  5IHY A;  5HEG A;  2CXF A;  4ASK A;  3O1J A;  4GYR A;  4F6R C;  4TNV A;  3NZP A;  1W0B A;  4ZI7 E;  4U31 A;  3P4R A;  4PK6 A;  4ZOL E;  2LRK A;  2XAH B;  4DR3 T;  2V1D B;  5LXT E;  2PBI A;  3OTO T;  3ZLI A;  2UU9 T;  2UXD T;  3ZJ2 A;  2X66 A;  2VL8 A;  2QGS A;  2XQ5 A;  1I94 T;  2KWI B;  4O4I E;  1US7 B;  2V7I A;  1WYB A;  2RPA A;  2EHO B;  5C3J A;  4X1I E;  1SA0 E;  1HFA A;  5AQV B;  5AQL B;  3TLV A;  3CQG B;  2NOX A;  5HWY A;  2X0Y A;  3SS1 A;  2WS3 A;  4A5X A;  4JBW F;  2V26 A;  4YXD A;  3SFE A;  4CN1 A;  4O4L E;  3LJC A;  5LHI B;  4GKK T;  2I0M A;  4JLE A;  1FMV A;  2MYS A;  1E7P A;  5CJ5 A;  2IC6 A;  4PNI A;  2ZM0 A;  2CLY B;  2IML A;  4PJN A;  2QA7 A;  2XSB A;  3VKH A;  4LF5 T;  3BQL A;  2RP4 A;  2D9D A;  4JI0 T;  4PAG A;  5JDM A;  3AVS A;  5J2T E;  1FJG T;  3O9X A;  2YDR A;  2KZ7 B;  5JDN A;  3QOF A;  5BR8 T;  1HNW T;  1E1H B;  4AKG A;  3FHN A;  1HX8 A;  4XZC A;  1M62 A;  3M65 A;  4PW8 A;  3EDV A;  2X9X A;  2BKO A;  1I6Z A;  2NTX A;  5LA6 E;  2W61 A;  2ES0 A;  2X51 A;  3MA9 A;  1CUN A;  4OYJ A;  3AE8 A;  3IHR A;  5AQS B;  4L5G A;  5AQM B;  4AKR B;  5FP3 A;  4BJM A;  1HCI A;  4ZEY A;  5HXC A;  2A9U A;  4LMJ A;  3AE9 A;  3C64 A;  4EAH A;  1XWM A;  4I0U A;  4O2B E;  3CX8 B;  4PFO A;  2XJ7 A;  5LB7 B;  3UQ7 A;  2XTL A;  4B6X A;  1WYC A;  2UUA T;  5FL1 A;  4IDP A;  4TWD A;  2CA5 A;  1U5P A;  2BDE A;  2MOZ A;  2IUB A;  1WR6 A;  2Y6X A;  3P4S A;  3WAK A;  2UXX B;  2W4X A;  1VRB A;  4H9O C;  3ZMZ B;  1MIV A;  4ERR A;  3C51 A;  2BKN A;  4U72 A;  4NXM T;  4DR2 T;  5ABE A;  2EHO C;  2QRX A;  3ZST A;  1J1J A;  4LF9 T;  1XMO T;  1NAF A;  2E9X D;  4KP3 C;  2ZLY A;  2GK9 A;  3CQC B;  4CZZ B;  2BG9 E;  1FEW A;  1S35 A;  3NRY A;  1H7C A;  4EEB A;  3UT5 E;  3RH3 A;  5CFB A;  3L09 A;  2QVA A;  2E5L T;  4O4H E;  4GKJ T;  2VL0 A;  3EVY A;  4GIW A;  4YTN A;  2W62 A;  4BJN A;  2CLY C;  1D0Y A;  1WR0 A;  4JI8 T;  4CI1 B;  3Q9D A;  1MMA A;  4YJ3 E;  2D0U A;  4LMK A;  3RRC A;  2VK9 A;  3N9P A;  4DUY T;  5LGT B;  4PK5 A;  3FZF B;  3RC3 A;  2V7K A;  5AQT B;  4UV9 B;  4HWF A;  5AQI B;  4I43 B;  5CA1 E;  3VHL A;  5AQH B;  2H88 A;  3U78 A;  4OFZ A;  1XDP A;  2LSI A;  2VVN A;  3VR9 A;  3T1Y T;  2UXN B;  3I0O A;  2CBJ A;  2NWB A;  4EXT A;  2H7V C;  3V5U A;  2WBL A;  4YT0 A;  1HNX T;  3ETV A;  4HE8 A;  3JC6 C;  3ESL A;  3Q5W A;  3KV6 A;  3VRA A;  1UK5 A;  1ZEE A;  3BK9 A;  2VQE T;  2C5J A;  3IA3 A;  4IDZ A;  4JUY A;  4KHZ F;  3I9Y A;  3H37 A;  3K3O A;  3ZN1 B;  1AJ3 A;  4JI4 T;  4HWI B;  4EED A;  3NZQ A;  5H6R B;  3V5S A;  4YSZ A;  5F8P A;  5F5W A;  3EAM A;  2CWY A;  2UUC T;  2UUB T;  4MHC A;  1UX4 A;  2IDO B;  4X64 T;  2L9Q A;  3OPC A;  3AE7 A;  4AKI A;  4LF7 T;  2WDR A;  4OK0 A;  1N34 T;  3NWI A;  3AE6 A;  3KDS E;  2E9X A;  4IRE A;  4LF4 T;  3EDU A;  4ZI2 D;  3JAF A;  3MKD A;  3PJA A;  2LM2 A;  5HCM A;  3D0T A;  3PUZ F;  2LT3 A;  4P0B A;  5H6Q B;  4J2C A;  1VOM A;  3RYI E;  3O1H A;  2JPF A;  3UUL A;  2DNX A;  3PUX F;  1X79 A;  3OYZ A;  3CPZ A;  1Y64 B;  3UU8 A;  4CQI A;  3ZEF B;  5KXJ A;  3U3I A;  1SUM B;  5JH7 E;  2N1G A;  1MND A;  5LNK A;  3CVR A;  1IJ5 A;  2DHR A;  3ZYM A;  4F8H A;  2V6X A;  3VKG A;  3PU8 A;  3E08 A;  2P9B A;  2I59 A;  2ZM8 A;  3K3Q C;  5LP6 E;  4CXW A;  1OED A;  3UU4 A;  3TLT A;  3EAB A;  3AEE A;  2X9W A;  3WI3 A;  2Y8D A;  2AE9 A;  3MXZ A;  1QUU A;  3AEB A;  3E22 E;  4DND A;  3A5X A;  4CXX A;  5LHG B;  5AQR B;  4O8S A;  4AIS A;  4H9P C;  4PJM A;  2K48 A;  1XNQ T;  2SPC A;  2BVL A;  4DR1 T;  3AA6 B;  4I55 E;  2FJD A;  2BZB A;  3CKD A;  3KBU A;  2C0S A;  1LKX A;  4TNW A;  4U7I A;  4IE7 A;  2LSY A;  2YIN A;  2Q9Q C;  5DQW A;  1YKE B;  5FXV A;  3J9X 1;  3P4Q A;  4DID B;  2WP9 A;  2D5U A;  3LG7 A;  5JR9 A;  4DV2 T;  4U33 A;  3R84 B;  4U3C A;  1R8I A;  4IDQ A;  4X65 T;  4YTP A;  2K5B B;  1ZP0 A;  3HKC E;  5HEU A;  4N78 D;  5M4Y A;  3A7M A;  3I9W A;  5DQV A;  5HXS A;  4QXC B;  3RIU C;  3AEF A;  2YOE A;  4QH5 A;  3HA4 A;  3UUN A;  3FBZ A;  2VQF T;  2MPK A;  3JC6 D;  3RYC E;  3RI5 A;  4UV8 B;  2J62 A;  2XY8 B;  2WWU A;  1YD8 G;  2J1D G;  4YFS A;  4KHP T;  3GA8 A;  3F57 A;  2XHE B;  4EZ4 A;  4OYK A;  5LMU T;  4M1P A;  3QNU A;  5HYA A;  3PUA A;  4O4J E;  3I0Q A;  4KBM B;  2VKJ A;  2CM0 A;  2B1E A;  5FXX A;  4UIG A;  3LK3 B;  3FXD B;  2LRL A;  2MBG A;  4X66 T;  3RKO A;  4AKL A;  1NEK A;  5JDQ A;  1IBL T;  4H9N C;  3DTO A;  3N2G E;  5HCJ A;  3DP7 A;  3UUX B;  1Z8U A;  4DMV A;  1N36 T;  4B3T T;  5FY0 A;  1KFY A;  5AQP B;  3PUW F;  2CHN A;  1T98 A;  2K24 A;  4DVD A;  2KWH A;  2FJE A;  4ZI3 C;  3ZC1 A;  3HR0 A;  1HNZ T;  4QXB B;  4YJ2 E;  1QSD A;  3B13 A;  5C8Y E;  4QXH B;  3DJB A;  5FNV E;  3KV4 A;  3ZC0 A;  4TV8 E;  2ZM2 A;  3LFM A;  1LVK A;  2LJL A;  3AXJ A;  1XZY A;  2KSR A;  5CB4 E;  4U2Y A;  3CWZ B;  4YHJ A;  2ODV A;  2M6I A;  4IT4 A;  2BVM A;  4O2A E;  4C90 A;  4MBQ A;  3PTR B;  2WDV A;  3RRW A;  1M7K A;  3K1S A;  5J1G A;  4LF6 T;  5LG3 A;  2V7J A;  4YTM A;  2BG9 A;  5LMN T;  4EYU A;  3PUV F;  1D1C A;  2ODU A;  2DLR A;  5FYM A;  4HFH A;  3AAA B;  2JJ9 A;  2WCA A;  4CN4 A;  3KFW X;  2N9D A;  4JI5 T;  3K3N A;  3KVA A;  2XUE A;  5LJN A;  1Z0P A;  4H63 V;  4DUZ T;  2LSJ A;  3AB3 B;  4XBF B;  1MMD A;  1G73 A;  2LHR A;  3RHW A;  3I1A A;  3Q5D A;  3RYF E;  4E7S A;  5JRE A;  5JDF A;  3AA1 B;  1S94 A;  3G06 A;  2UXB T;  2LOS A;  2V6Y A;  3UFG A;  2L8K A;  2Q9Q D;  2W63 A;  2LSK A;  2MTQ A;  3RIA A;  2YU2 A;  4HFB A;  3Q5X A;  3RIF A;  2KLQ A;  2NR4 A;  2W2U A;  4ZS3 A;  3N9Q A;  4UR9 A;  4AXP A;  2X0L B;  4X1Y E;  4PJJ A;  1KNR A;  5JVD E;  4WNK A;  3BQK A;  2OA5 A;  5IWA T;  1B7T A;  1GQE A;  4TWH A;  4IGU A;  1KNZ A;  5JTG A;  3FXE B;  3UUB A;  5HAX A;  3TLW A;  2PJQ A;  3JAD A;  1BR1 A;  5EK3 A;  5ABH A;  3X1D A;  3N9L A;  2WY2 A;  3TKL B;  4H9Q C;  3Q2M A;  4GOU A;  5FXW A;  2K3W A;  4H63 H;  4V1A v;  3F2E A;  4AQY T;  1T7S A;  5ABF A;  4H9R C;  3TLS A;  1UUR A;  3SRZ A;  2OV9 A;  1WRD A; 
#chains in the Genus database with same CATH homology
 1ZHC A;  4L9I A;  3GN5 A;  3VU7 H;  3PUR A;  4X20 E;  5IHY A;  3UUM A;  2CXF A;  2NW7 A;  4ASK A;  3O1J A;  3CX7 B;  2X9W A;  4GYR A;  2A3D A;  3WI3 A;  1HG2 A;  2Y8D A;  3HKD E;  3GN5 B;  4F6R C;  3MK7 C;  1BR4 A;  1BR2 A;  2XAG B;  3HKE E;  3NZP A;  3MXZ A;  4UVB B;  4ZI7 E;  1QUU A;  4ZOL E;  3E22 E;  3HL6 A;  3C4X A;  4PK6 A;  2XAH B;  4BAY B;  4DND A;  4EIW A;  2V1D B;  3A5X A;  4CXX A;  5JDH A;  5LHG B;  5LXT E;  4UEL A;  2PBI A;  3ZLI A;  5FY1 A;  4U74 A;  3ZJ2 A;  3ZYL A;  4O8S A;  2X66 A;  3FBL A;  2VL8 A;  4HKA A;  2NP9 A;  4TX5 A;  2QGS A;  4AKH A;  3C50 A;  4H9P C;  4PJM A;  2JRK A;  2YU1 A;  3FB2 A;  3RYH E;  3E0Z A;  2K48 A;  4I50 E;  2SPC A;  2BVL A;  2KWI B;  2LHN A;  2KT9 A;  4O4I E;  1US7 B;  2V7I A;  2VKD A;  3O4X E;  3AA6 B;  1WYB A;  2HPJ A;  3P7I A;  5LGN B;  1HF8 A;  2EHO B;  4I55 E;  4QX8 B;  4X1I E;  2JMH A;  2JQQ A;  1SA0 E;  1HFA A;  3OJA A;  2BZB A;  2A2F X;  3QUJ A;  4ZHQ E;  3CQG B;  2JMK A;  3CKD A;  3KV9 A;  3KBU A;  2C0S A;  2NOX A;  1YKH B;  2IAK A;  4UXN B;  5HWY A;  4IE6 A;  3P8C D;  1LKX A;  2LOP A;  3F31 A;  3PDY A;  3IF8 B;  5L3G B;  3SS1 A;  2LE8 A;  4IE7 A;  4DO0 A;  2V26 A;  4O4L E;  2LSY A;  2Q9Q A;  4ANJ A;  2NTY A;  3LJC A;  1IZN B;  3WAJ A;  5LHI B;  4CI2 B;  1MIY A;  2YIN A;  4JLE A;  1FMV A;  2MYS A;  2Q9Q C;  5DQW A;  3N2O A;  1YKE B;  4WW0 A;  4PFP A;  5LOV E;  3ANW A;  3RC8 A;  5FXV A;  3LK4 2;  2IC6 A;  4PNI A;  2ZM0 A;  2CLY B;  3J9X 1;  2E9X B;  3ANW B;  1EZ3 A;  2XAF B;  2QA7 A;  4IHJ E;  4PJN A;  2D5U A;  5KMG P;  3LG7 A;  5JR9 A;  3VKH A;  3BQL A;  2RP4 A;  2HH7 A;  4BA9 A;  5F3J A;  4PAG A;  5JDM A;  5BMV E;  2CWO A;  4FI5 A;  3R84 B;  3AVS A;  5J2T E;  2CCQ A;  2K5B B;  5LG4 A;  2VKH A;  3HKC E;  3HI2 A;  5LBQ B;  5L3D B;  3O9X A;  4N78 D;  5M4Y A;  3BQI A;  3I9W A;  3KIN B;  5DQV A;  2KZ7 B;  5JDN A;  5ETW A;  5J2U E;  1E1H B;  5HWX A;  4AKG A;  3FHN A;  5HXS A;  4QXC B;  1HX8 A;  2IC9 A;  4YLH A;  4XZC A;  5CA0 E;  1UX5 A;  2WM9 A;  3M65 A;  4PW8 A;  3EDV A;  2X9X A;  2LSG A;  5A1L A;  2NTX A;  1IAP A;  3H3A A;  3HA4 A;  5LA6 E;  2W61 A;  3UUN A;  2ES0 A;  2X51 A;  3MA9 A;  4DBQ A;  3FBZ A;  1CUN A;  3GWH A;  4OYJ A;  5GON E;  3IHR A;  2KIN B;  2XAQ B;  5JDL A;  4L5G A;  4AKR B;  5LCY A;  5KDM C;  2VKO A;  3JC6 D;  3RYC E;  3K8P C;  3UFE A;  4EOZ B;  5FP3 A;  5JQG E;  2CMR A;  4BJM A;  1HCI A;  4UV8 B;  3N5L A;  1G8X A;  2V7M A;  5HXC A;  4DBR A;  3LBX A;  2WWU A;  2Y48 B;  3C64 A;  4UEM A;  1YD8 G;  4EAH A;  2J1D G;  4YFS A;  1O3X A;  1LRZ A;  3GA8 A;  4O2B E;  4IE0 A;  3LBX B;  3CX8 B;  5LGU B;  3F57 A;  4PFO A;  1ZV4 X;  2XHE B;  4EZ4 A;  2XTL A;  4OYK A;  4EYY R;  4B6X A;  1WYC A;  2PG8 A;  4A56 A;  2M67 A;  4M1P A;  5HYA A;  3PUA A;  2EHO D;  4O4J E;  3I0Q A;  1FMW A;  4KBM B;  2VB6 A;  4ZS2 A;  3ZMU B;  4HGA A;  5LYJ E;  2CA5 A;  4K0U A;  2VKJ A;  2CM0 A;  1U5P A;  2BDE A;  2MOZ A;  4EB6 E;  2B1E A;  5FY7 A;  5FXX A;  1WR6 A;  1UCU A;  3HKB E;  3PE0 A;  2Y6X A;  5JRC A;  4UIG A;  3WAK A;  3LK3 B;  3FXD B;  2H3R A;  2MBG A;  5LHH B;  2UXX B;  4QHO A;  3RKO A;  4AKL A;  3B57 A;  1VRB A;  3PU3 A;  4H9O C;  3ZMZ B;  2HPL A;  4ZI3 D;  5JDQ A;  1FIO A;  1MIV A;  2X67 A;  4ERR A;  3C51 A;  4H9N C;  3DTO A;  3N2G E;  4U72 A;  3ZMS B;  5AFU L;  3DP7 A;  5E0O A;  4IST A;  3UUX B;  5L3E B;  3SOL A;  2EHO C;  4DMV A;  5FY0 A;  4P09 A;  3EUH A;  4EZH A;  3RX6 A;  3ZN0 B;  1NAF A;  1YW0 A;  2E9X D;  3ZJ1 A;  4KP3 C;  1IJ6 A;  2ZLY A;  5LJM A;  2GK9 A;  3CQC B;  4CZZ B;  1HG5 A;  2Q9Q B;  3N9M A;  1T98 A;  2K24 A;  4DVD A;  3AAE B;  2KWH A;  2LM9 A;  3NRX A;  4ZI3 C;  2N2N A;  1FEW A;  1S35 A;  3SWH A;  2ACX A;  3NRY A;  3ZC1 A;  1H7C A;  5LBM A;  3UT5 E;  3W15 B;  4Z8X A;  3RH3 A;  3HR0 A;  3L09 A;  3KVB A;  3RPU A;  3MAC A;  4PJL A;  4QXB B;  2PFV A;  4YJ2 E;  4O4H E;  4UVC B;  4CI3 B;  1QSD A;  2DCF A;  5JR9 B;  3B13 A;  4UF0 A;  3EVY A;  4GIW A;  4QXH B;  2W62 A;  5C8Y E;  4NUU A;  4BJN A;  4X1K E;  4TUY E;  2CLY C;  3DJB A;  2XAJ B;  2CE7 A;  1D0Y A;  5FNV E;  5ADX L;  2E9X C;  4G63 A;  3KV4 A;  5HXH A;  3ZC0 A;  1MMG A;  4TV8 E;  4CI1 B;  3ZMT B;  1BR0 A;  3Q9D A;  2ZM2 A;  5HXE A;  1MMA A;  2NW9 A;  3LFM A;  4YJ3 E;  4GYS A;  2K9A A;  1LVK A;  4AQG A;  2D0U A;  2LEH A;  2YEV C;  2VK9 A;  3RRC A;  5L3C B;  3N9P A;  2LJL A;  5CB4 E;  5LGT B;  4PK5 A;  1NWM X;  3RC3 A;  1D1B A;  2V7K A;  3CWZ B;  5EZY E;  4QKN A;  4YHJ A;  2ODV A;  2D0T A;  4UV9 B;  4NUV A;  3IBP A;  3OKQ A;  4I43 B;  2BVM A;  5CA1 E;  3MJX A;  4O2A E;  4C90 A;  4MBQ A;  2W0G A;  2WMO A;  2ZMA A;  3L3P A;  3PTR B;  3VHL A;  1D0Z A;  4TZ4 C;  2CXD A;  5KX5 E;  3RRW A;  3ETU A;  5J1G A;  3U78 A;  4OFZ A;  4PK4 A;  4CXY A;  4IE4 A;  3ZYK A;  4MAL A;  2WMN A;  5DJQ C;  1U4Q A;  2V7J A;  2KMF A;  4EYU A;  1D1A A;  3CQX C;  1D1C A;  2LSI A;  4TV9 E;  4E7Z A;  5EK2 A;  1LVF A;  2ODU A;  4HTE A;  2DLR A;  2DWK A;  2UXN B;  5FYM A;  1OXZ A;  3I0O A;  3AAA B;  2D2S A;  2JJ9 A;  2NWB A;  4EXT A;  3AAI A;  3QK6 A;  3N9O A;  2H7V C;  3V5U A;  2WBL A;  3KFW X;  2N9D A;  3CML A;  3K3N A;  4L0R A;  3KVA A;  3ZPO A;  4FJO A;  2XUE A;  5LJN A;  1Z0P A;  3ETV A;  4HE8 A;  4H63 V;  4HFV A;  3JC6 C;  4DMW A;  3ESL A;  3Q5W A;  4MFR A;  3KV6 A;  2LSJ A;  3AB3 B;  3ONX A;  4XAX B;  2X9Y A;  1ZEE A;  4JEH B;  4XBF B;  1MMD A;  3BK9 A;  2IW5 B;  2WAU A;  3IEE A;  1G73 A;  1D0X A;  3MZK B;  2C5J A;  2H7O A;  2DWG A;  2LHR A;  4ADZ A;  2Z6E A;  3PUQ A;  4IDZ A;  1WLX A;  3I1A A;  1MIW A;  3PUS A;  4GK5 E;  4HEA A;  5JRC B;  3O1I A;  3RYF E;  3R6N A;  4E7S A;  2C5K T;  5JRE A;  2XAS B;  4JUY A;  2EHO A;  5JDF A;  3AA1 B;  5FMN A;  3QC9 A;  2NW8 A;  3I9Y A;  3H37 A;  3K3O A;  5EK4 A;  1S94 A;  3ZN1 B;  1AJ3 A;  3KBT A;  4AQF A;  2LOS A;  2L8K A;  3NZQ A;  5H6R B;  3V5S A;  5F8P A;  2Q9Q D;  2W63 A;  4GK0 E;  1V9D A;  4AQF C;  2G0U A;  4IIJ E;  2E8I A;  2CXL A;  2LSK A;  2V7L A;  3C4Z A;  2MTQ A;  2KXP B;  2CWY A;  4HN9 A;  2WSS V;  3PUG A;  2YU2 A;  5HXR A;  3AA7 B;  3Q5X A;  1MMN A;  4MHC A;  1UX4 A;  2KLQ A;  2A72 A;  5IYZ E;  1KK7 A;  3ZCJ A;  2RA1 A;  2X68 A;  3OYX A;  4G2A A;  2L9Q A;  4AKI A;  4ISS A;  3NBX X;  4OK0 A;  2W00 A;  3KV5 A;  3AA0 B;  5L3F B;  3N9N A;  4ZS3 A;  3N9Q A;  2C5I T;  4AXP A;  4KMC A;  2X0L B;  4WBN E;  2CEA A;  4PJJ A;  3KDS E;  4X1Y E;  4C91 A;  3J7Y q;  5JVD E;  5L3B B;  3OBV E;  4QWN B;  2E9X A;  3EDU A;  4ZI2 D;  4WNK A;  3C4W A;  2X9H A;  1ZKE A;  3MKD A;  4KUM B;  4UF0 B;  5DAB A;  3BQK A;  2OA5 A;  3D0T A;  2LT3 A;  2DI4 A;  3ZCI A;  4P0B A;  3N2K E;  1OWA A;  1B7T A;  5H6Q B;  4J2C A;  1VOM A;  4H9S E;  3RYI E;  5FXZ A;  4IGU A;  4I4T E;  1KNZ A;  5JR9 C;  3O1H A;  3ZMV B;  2JPF A;  5TAO A;  3UUL A;  2DNX A;  3FXE B;  3S4U A;  4P0A A;  5JDG A;  3UTK A;  3C98 B;  2KND A;  4UVA B;  3T8O A;  1X79 A;  2VWA A;  3OYZ A;  3CPZ A;  4MLK A;  5HAX A;  1Y64 B;  2PJQ A;  4AI6 A;  4CQI A;  1HTJ F;  3ZEF B;  4TN7 B;  1BR1 A;  5EK3 A;  1MNE A;  3U3I A;  4JEU B;  2VAS A;  2YK0 A;  5L2L A;  3N9L A;  4WBO A;  3TKL B;  4ZI2 C;  5JH7 E;  4H9Q C;  2N1G A;  3Q2M A;  1MND A;  3CVR A;  4OHF A;  4QX7 B;  4GOU A;  5FXW A;  1IJ5 A;  5LNK A;  4H63 H;  2DHR A;  3CX6 B;  3GMI A;  4V1A v;  3ZYM A;  3VKG A;  3F2E A;  2L3L A;  3PU8 A;  3E08 A;  4IE5 A;  4ILU A;  2P9B A;  4H9R C;  3SRZ A;  2I59 A;  2ZM8 A;  3LK2 B;  1HS7 A;  3K3Q C;  1SHZ C;  5LP6 E;  4CXW A;  2XQY A;  3AVR A;  1WRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...