2KLQA

The solution structure of cbd of human mcm6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'APKASLRLGFSEYSRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA replication licensing factor MCM6
molecule tags Replication
source organism Homo sapiens
publication title Characterization and structure determination of the Cdt1 binding domain of human minichromosome maintenance (Mcm) 6
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18263 MCM6_C MCM6 C-terminal winged-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.870 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2klqA00
2KLQA 2LE8A
chains in the Genus database with same CATH superfamily
2ZM8A 2LJLA 4AKGA 4UIGA 1HNWT 2MAWA 1EZ3A 3PURA 4ISTA 5AQUB 3AE7A 4EIWA 4DR1T 2BDEA 2WZHA 3NBXX 1VRBA 3F31A 3N9NA 1XNQT 1D1CA 4IDZA 2CWYA 2WS3A 4EOZB 2HN2A 3B57A 3ONXA 1HR0T 5HEHA 1FMWA 3B13A 3OYXA 2QRXA 4H9SE 4HFIA 5LGTB 3DJBA 2BG9A 3EDVA 4FI5A 1N34T 4IDOA 2QGSA 1WYBA 3CQXC 2VASA 5DQWA 3T1YT 4AKLA 1H7CA 2V7JA 3TLVA 1UUSA 1GQEA 2V6YB 4CZZB 3HA4A 4DUYT 3UU6A 1UX4A 2UXNB 2WU5A 3P8CD 4UEMA 3W15B 3ZYLA 3Q5XA 3ZJ1A 4DIDB 3UFEA 4YTPA 5HXEA 5JVDE 4GKJT 4Z8XA 1MMDA 3C4XA 1HG5A 5HAXA 4DV7T 3P4PA 2EHOB 1X79A 3D0TA 1YQ4A 4L9IA 2LEHA 3PUAA 3TLUA 2HHHT 2B1EA 2XY8B 4MFRA 1BR1A 2FJEA 2N9DA 1YKEB 1D1BA 3RQUA 2Q9QC 2X9WA 3PE0A 1J5ET 2XUEA 1DU2A 5FP3A 4C90A 4DR6T 1M62A 1L0VA 2W62A 2XQ9A 2LOSA 5LGUB 3EDUA 1MMNA 4DV6T 2DHRA 2XAJB 3AE5A 4H9RC 5AQSB 3QNUA 4OYJA 2CXLA 2L3LA 2W61A 3ABVA 1UCUA 3MJXA 2XASB 2IUBA 4IE6A 1OEDA 3UTKA 4HGAA 5AQKB 2XPKA 2D2SA 4JI4T 1NAFA 2BKOA 2A9UA 2M6IA 2LM9A 4B3RT 3AEAA 2EHOA 2XAHB 2JPFA 4PW8A 2V5DA 1E1HB 4IIJE 3I0OA 3RKOA 4CXYA 3AXJA 1HS7A 2KWHA 2A2FX 2XQ7A 5AQTB 2LKHA 5AQIB 3BQLA 4P0BA 2G0UA 3ZEFB 3AE2A 3AEDA 2LKGA 3HKCE 4IGUA 5JDHA 1WR0A 1YQ3A 2I6HA 2LRLA 3C4WA 3C98B 2BG9B 4O4JE 4H9QC 5FKYA 3UU5A 5HXCA 2R6GF 2J62A 4YSZA 1I6ZA 2XHEB 2BS4A 5AQRB 4YY3T 2XSBA 3JAEA 2XQ3A 5JR9B 2H88A 2VKHA 5ABGA 3SFEA 2XQ6A 2JQKA 4JLEA 2LSJA 4OYKA 2NWBA 1D1AA 1KEYA 3I9YA 4U72A 3NZPA 4GK0E 2FJDA 2WBLA 2V7KA 2CE7A 3AE4A 4HWCA 3RIUC 3CK6A 2BVMA 2LE8A 3K3OA 3PU3A 3QUJA 5LG3A 2OLTA 4LMKA 4OFZA 5FY0A 3P4SA 3SFDA 3ZMTB 4HFCA 2CLYC 2P9BA 3RYFE 2V7IA 2UXXB 4ISSA 1BR0A 2E2AA 1SUMB 5HWYA 1XMOT 2CRBA 1NWMX 3VHLA 1ZV4X 1OWAA 3TLWA 3ZYMA 4CN6A 3ZYKA 4F6RC 1QLBA 3KFWX 2D0TA 3Q5DA 3UUMA 4BAYB 3AVSA 4KP3C 4CQIA 4JBWF 4JI8T 5IYZE 5EZYE 3QB5A 4KBMB 3RKGA 2NW8A 3PDYA 4UV8B 1JNZA 1ZEEA 4ZS2A 4IL9A 3EABA 3IF8B 3T8OA 2X0YA 3CKDA 1IJ6A 2SPCA 1MIVA 3NWIA 5C3JA 4PFOA 3FBZA 2XAQB 3ONJA 4X1YE 4PJMA 5L3DB 4H9PC 3N9LA 2XQ4A 2CA5A 2V7LA 3ZMSB 2UUAT 2PBIA 3N2GE 3JAFA 3QC9A 5A1LA 2BS2A 2DWKA 5CFBA 1LVFA 5KXJA 2JQQA 3AA6B 3Q9DA 2LSKA 3I9WA 1G8XA 4KHZF 2CEAA 2FJBA 1UGOA 2L9QA 4MLKA 4U7YA 2MBGA 3SRZA 2HPJA 4YSXA 4MHCA 2DI4A 4EYYR 3ZSTA 4DV3T 1R8IA 3AE8A 5L2LA 3GN5A 3U3IA 1W0BA 3K1SA 1LKXA 2BBJA 4ZI2C 2XJ7A 4Z90A 5LHIB 4DNDA 3K3QC 4HWFA 5JDQA 1ZP0A 4I55E 4X62T 4ZI3C 5F5WA 2BG9E 2HN1A 2LSYA 1MMAA 2X0LB 1SA0E 2XQ5A 3ZLIA 2K3WA 2IC6A 4MBQA 3RYHE 2W00A 5L3BB 4AKIA 2MPKA 2OA5A 1T98A 3MA9A 3UUXB 5J2UE 2H7OA 1NENA 3AEFA 2PFVA 4NPPA 4QH1A 5FY1A 5C8YE 2CLYB 4QX7B 2KSRA 2X9XA 5FL1A 1N36T 4CI2B 3C50A 2W0GA 2W67A 4TNVA 4TWHA 1WLXA 3RC8A 5HXRA 4QWNB 3M65A 4KI0F 4X66T 4UF0A 1NEKA 2IIUA 3TKLB 4QHOA 1XMQT 2NTYA 5AQHB 5FNVE 5HWXA 2WDRA 5LCYA 5H6QB 3CPZA 5JR9C 3N2KE 1Z0PA 3CWZB 3RIAA 2JMHA 4QXBB 3ZMVB 5HXSA 4U7IA 5J0ZA 2VL0A 4DV0T 1MNDA 2LOPA 2M6BA 4JV5T 5JDMA 4JYAT 5LA6E 3DP7A 5E0OA 3X1DA 4E7ZA 4L0RA 5JREA 3BK9A 5ABHA 2ZM2A 2E9XC 4HFBA 1IBLT 3UUNA 4YFSA 4AKHA 3VRBA 3FZLB 4AKRB 4UVBB 2PG8A 5AQJB 4HWDA 2B76A 2VVNA 5F8PA 4F8HA 2BS3A 2MTQA 2VWAA 3AAAB 3KV5A 4U2ZA 2L8KA 1UURA 2H3RA 2ACXA 4O4LE 4TUYE 1WFDA 3B5MA 3KBTA 4O4IE 1Z8UA 5EK3A 2WY2A 2IMLA 1WYCA 3H3MA 3JC6C 3FBLA 4TZ4C 3RI5A 3ZT7A 3PU8A 4B3ST 4B3TT 4JI1T 4IE7A 4CI1B 4O8SA 1G73A 3IA3A 2WMOA 2XQAA 4LFBT 4HFVA 1W9RA 1YD8G 2K24A 2LSGA 4WYVA 4UVAB 1O3XA 1ZHCA 1B7TA 2A3DA 1WCRA 2LLYA 3CX6B 3RH3A 2UXCT 5GONE 3PJAJ 5L3EB 3LJCA 4HWHA 5JDNA 5LB7B 3TLTA 1MIWA 3AAEB 1XZYA 5EK4A 1T8BA 4Q25A 5DJQC 2VVSA 4JI0T 2UU9T 2KMFA 4K0UA 3N9QA 1M7KA 5AQPB 2VB6A 4NIQA 3J9X1 3AEGA 3OYZA 5AQLB 1T72A 4GYRA 3SWHA 3OVUA 2AXDS 2CXFA 3N9OA 1SHZC 3N2OA 3FHNA 3SS1A 2DCFA 3HR0A 3MKDA 3P50A 4QX8B 4CN4A 4QXHB 4ZHQE 5L3CB 1U5PA 4JEHB 5FXWA 1MNEA 1AJ3A 2XM2A 3UT5E 4EZHA 4LFCT 3FZMB 4BJMA 3P4WA 3F57A 3P4RA 2WCAA 2D9DA 3JADA 2IW5B 3FZKB 3IHRA 2JRKA 2X51A 3ETVA 3PJAA 5LBQB 4U74A 3ZT5A 4DV1T 4P0AA 3ZMUB 4UELA 1UX5A 5HEOA 3QOFA 1HNXT 2XQYA 1FIOA 2ZMAA 2DWGA 3EHZA 2E9XA 2E5VA 5FMNA 2XAFB 3VU7H 1BR2A 3PUWF 4LF4T 2CBJA 4ZS3A 3ZCJA 4O4HE 2V1DB 2DL1A 3RLFF 4I50E 4UV9B 4A97A 4ASKA 3ESLA 3DTOA 3LK42 4PJJA 4JI7T 4H63H 2YDQA 4HKAA 4AXPA 2IHR1 2UXDT 4MALA 2JQHA 3ZC0A 1W0AA 2ACZA 1E7PA 2JJ9A 4B3MT 2BVLA 4DV5T 4GKKT 2ODUA 2OV9A 2XZEA 2ZLYA 4IDPA 4I43B 3M3ZB 3FXDB 3E22E 3K3NA 5LHHB 1HCIA 5LGNB 5LP6E 1IBKT 1QUUA 2I0MA 4H63V 4OHFA 3K8PC 5TAOA 4YT0A 4DV4T 4LFAT 1XNRT 2MOZA 4PFPA 2WWVA 2NW9A 2KNDA 3PUZF 2BZBA 4CI3B 3MZKB 3WI3A 4AISA 4M1PA 2E9XB 2V7MA 4HE8A 3S4UA 4NXMT 5CJ5A 1Y01A 5AQVB 3Q2MA 4BJNA 1I94T 2KLQA 5AQMB 2N1GA 2Y8DA 1W09A 3CQCB 5EK2A 2UXBT 2QYWA 2WQYA 3RRWA 4YJ2E 4Z91A 4X1KE 3Q5WA 3AE1A 2RA1A 4IREA 2BG9C 5BMVE 3HKEE 5J2TE 2BKPA 3OJAA 3LK2B 5HYAA 2YINA 4DBRA 3L09A 4ZOLE 3WAKA 3ETUA 3UU8A 4LF8T 2UUBT 2XM1A 4LMJA 5DQVA 1T7SA 3VRAA 4EV6A 2ODVA 3L39A 3O1HA 3KDSE 5FXXA 3KINB 1OEDE 1KF6A 4PJLA 1FMVA 3LG7A 4N78D 4AQFA 4K0KT 4G63A 2EHOC 2W4XA 3CVRA 3P7IA 2V26A 3ONLC 1KK7A 4TWDA 3RHWA 4ILCA 3KVAA 2A72A 2WP9A 3L8RA 4J2CA 3FZHB 2NR4A 4IL4A 2CPTA 5HEGA 1N33T 3BQKA 1V9DA 2K5BB 2Q9QA 2ZM0A 4HFHA 5FYMA 2ES0A 3KVBA 3UUBA 5LBMA 1FEWA 3CX7B 3RX6A 4YLHA 4JI3T 5LYJE 5CA1E 4DR3T 4LF5T 3PUQA 5ABFA 3A5XA 2JQ9A 4JI5T 3CIRA 4XZCA 4TN7B 2H7VC 2LM2A 2JIWA 2YDRA 3EAMA 3NRXA 3I0QA 3J7Yq 4PK6A 3N9PA 3ZCIA 2WWUA 3GA8A 2C5IT 3H3AA 2RPAA 3RIUA 2KWIB 1VCSA 2Y48B 2Z6EA 4U31A 3RPUA 5FXZA 4DBQA 4CXXA 4G2AA 3TLSA 3MK7C 4HFEA 5CGMA 3AAIA 4WZXA 2J47A 5IHYA 5BR8T 2WZIA 2V5CA 3CX8B 4H9NC 4ILAA 5LNKA 3ZPOA 3AECA 2Y6XA 3MACA 4GOUA 3ZN1B 1ZOYA 2VURA 3NZQA 3RYCE 3F2EA 3ZKRA 2CBIA 2DLRA 2VKOA 4U33A 2CWOA 4UR9A 3R6NA 3G06A 3V5UA 2E8IA 2VL8A 3RF1A 3KV6A 2AE9A 2X67A 3GN5B 3CQGB 1YXRA 2FJAA 3GWHA 5CB4E 2X9YA 2NOXA 1HF8A 3HI2A 4YTMA 2C0SA 2V8SV 4ZXLA 3RRCA 2WM9A 2C5KT 4X5TA 4DUZT 1CHUA 3AE3A 2EHOD 1KNZA 5IUXA 3OPCA 4P1NA 4UF0B 5JDGA 5ABFB 3AA0B 4ZI7E 1HX8A 1J1JA 4OX9T 3FB2A 4YJ3E 2LHNA 3ZMZB 4A98A 5JDFA 2VKDA 4AQFC 3UU4A 4ILBA 3OBVE 2NP9A 4EYUA 3RIFA 5HEUA 5L4HA 3H37A 1IAPA 1IZNB 2DNXA 1Y64B 2LT3A 2XSAA 2YKSA 4IT4A 3UU3A 4WBNE 3QB5K 2J1DG 5KX5E 2WMNA 3ZJ2A 1D0YA 1XWMA 1WRDA 4KUMB 4DR5T 4EEDA 3MXZA 5CA0E 5AQOB 5LHGB 3EVYA 3QK6A 3O9XA 4IE0A 2Q9QD 3PUSA 1JNRA 4ZZCA 5C2TA 4ERRA 4JI6T 5AFUL 4NUVA 3C64A 2NTXA 4EGWA 2VQFT 4UVCB 2CM0A 3NVOA 4I0UA 4DV2T 3UQ7A 2ZM6T 1UK5A 4E7SA 4QXCB 3KV4A 5LMNT 2JMKA 4V1Av 4XBFB 2W2UA 3HL6A 1MIYA 3AE9A 3I1AA 3KV9A 3LBXB 4HEAA 3FZFB 4DVDA 1OEDC 1KFYA 4TV9E 1LRZA 2J4GA 3RQWA 2K48A 3UULA 5KMGP 5AQFB 4DR7T 2BKNA 1KNPA 2CHOA 2V6XA 3LBXA 4A5XA 2FBWA 2CXDA 2KINB 2X68A 4HN9A 3E0ZA 4BA9A 5HEJA 5ETWA 2UUCT 5LXTE 2N2NA 4EXTA 2KZ7B 3IEEA 3FXEB 5JR9A 4ZI2D 2LHRA 5LJMA 4TWFA 3WAJA 2Q9QB 2W66A 5ADXL 3N5LA 1D0XA 4WNKA 1SE7A 4TX5A 4B6XA 4DR2T 1ZKEA 2PTFA 1FJGT 1YW0A 3AB3B 1S35A 2PJQA 3N9MA 1WR6A 2C5JA 2GK9A 4H9OC 4X1IE 1XDOA 2WSSV 5FVLA 1X9BA 3ZT6A 4DO0A 4KHPT 2IC9A 2M67A 3RYIE 3O1JA 3R84B 4PK4A 4GK5E 1CUNA 4IE4A 5J1GA 2QVAA 3IBPA 4TV8E 2X66A 3AXJB 1YKHB 5FVKA 3VR8A 2NW7A 3OTOT 3U78A 2HPLA 4XAXB 5LG4A 2KT9A 4DMVA 3OKQA 2XQ8A 2F4VT 4X64T 1HTJF 3JC6D 4YTNA 5ABEA 4KMCA 1HX1B 3SOLA 4CN1A 4EB6E 4AQYT 4LF6T 4LF7T 2MYSA 4IE5A 5HCMA 4A56A 3L3PA 4P09A 5IWAT 2WU2A 4IDQA 4YSYA 4DR4T 2WDVA 4PAGA 4YXDA 2D5UA 1US7B 2YDSA 3AE6A 3LK3B 3O4XE 5DABA 1VCTA 3A7MA 1HFAA 2E9XD 4HTEA 4JEUB 5F3JA 4HFDA 4ZI3D 2X0HA 5JH7E 3T1HT 4NUUA 2WDQA 3AEEA 5JTGA 3VKGA 4U2YA 4QH5A 4FJOA 3KBUA 3LFMA 3NRYA 2QA7A 4PJNA 1OXZA 4IHJE 2HH7A 5L3GB 4EEBA 2WB5A 3PUGA 1VOMA 5AQQB 3RGLA 5HXHA 2LSIA 3V5SA 2H89A 4U3CA 4COFA 2W63A 4ZZBA 2CMRA 4AI6A 4ZEYA 2IDOB 2VK9A 4O2AE 3VR9A 4QH4A 3C4ZA 5FXVA 5LOVE 3HKDE 2CCQA 4GYSA 2XAGB 1J5WA 2YK0A 3EUHA 4EZ4A 3HKBE 2LRKA 1N32T 5L3FB 1OEDB 2YOEA 3A8YC 4PK5A 1E2AA 2WAUA 2YU1A 1IJ5A 2YN6A 4JUYA 4UXNB 2BBHA 3PUVF 4OK0A 1XDPA 5LJNA 4O2BE 3UQ4A 4NXNT 3LDQB 1IBMT 3E08A 4EAHA 4HWIB 3LSVA 5FL0A 3Q5EA 3PUXF 4ADZA 4C91A 4AQGA 1D0ZA 4KX6A 3ANWA 4X20E 5M4YA 5FY7A 4YHHT 2VKJA 5HCJA 1MMGA 3BQIA 4WW0A 3P4QA 4TNWA 2RP4A 3RC3A 3AA7B 2XTLA 3NKZA 4L5GA 3UFGA 3C51A 3ZN0B 5AQGB 5L47A 4WBOA 3PTRB 4LMLA 2E5LT 3O1IA 4PNIA 4DMWA 5JDLA 4GIWA 3VKHA 1QSDA 2KXPB 1U4QA 2X9HA 3JCFA 5JRCB 2CHNA 2V6YA 5LMUT 4AIUA 5JRCA 3ZC1A 2VQET 1LVKA 4I4TE 3PV0F 2YU2A 3AVRA 2FUPA 2IAKA 1S94A 3AEBA 3GMIA 4QKNA 5H6RB 5JQGE 5L4EA 3PUYF 4JI2T 3ZSSA 4ILUA 4IDNA 5AQNB 1HNZT 1BR4A 2D0UA 2K9AA 4LF9T 3CMLA 1KNRA 5KDMC 4CXWA 4YHJA 3EI0A 4ANJA 3ANWB 3AA1B 2I59A 1HG2A 2YEVC 4X65T
chains in the Genus database with same CATH topology
2ZM8A 2LJLA 4AKGA 4UIGA 1EZ3A 3PURA 4ISTA 4EIWA 2BDEA 3NBXX 1VRBA 3F31A 3N9NA 1D1CA 4IDZA 2CWYA 4EOZB 3B57A 3ONXA 1FMWA 3B13A 3OYXA 4H9SE 5LGTB 3DJBA 4FI5A 3EDVA 5DQWA 2QGSA 1WYBA 3CQXC 2VASA 4AKLA 1H7CA 2V7JA 4CZZB 3HA4A 1UX4A 2UXNB 3P8CD 4UEMA 3W15B 3ZYLA 5HXEA 3Q5XA 3ZJ1A 3UFEA 5JVDE 4Z8XA 1MMDA 3C4XA 1HG5A 5HAXA 2EHOB 1X79A 3D0TA 4L9IA 2LEHA 3PUAA 2B1EA 4MFRA 1BR1A 2N9DA 1YKEB 1D1BA 2Q9QC 2X9WA 3PE0A 2XUEA 5FP3A 4C90A 2W62A 2LOSA 5LGUB 3EDUA 1MMNA 2DHRA 2XAJB 4H9RC 4OYJA 2CXLA 2L3LA 2W61A 3MJXA 1UCUA 4IE6A 2XASB 3UTKA 4HGAA 2D2SA 1NAFA 2LM9A 2EHOA 2XAHB 2JPFA 4PW8A 4IIJE 1E1HB 3RKOA 3I0OA 4CXYA 2KWHA 2A2FX 3BQLA 4P0BA 2G0UA 3ZEFB 4IGUA 3HKCE 5JDHA 3VHLA 3VKGA 3C4WA 3C98B 4O4JE 4H9QC 5HXCA 2XHEB 5JR9B 2VKHA 4JLEA 2LSJA 4OYKA 2NWBA 1D1AA 3I9YA 4U72A 3NZPA 4GK0E 2WBLA 2V7KA 2CE7A 2BVMA 2LE8A 3K3OA 3PU3A 3QUJA 4OFZA 5FY0A 3ZMTB 2CLYC 2P9BA 3RYFE 2V7IA 2UXXB 4ISSA 1BR0A 5HWYA 1NWMX 1ZV4X 1OWAA 3ZYMA 3ZYKA 4F6RC 3KFWX 2D0TA 3UUMA 4BAYB 3AVSA 4KP3C 4CQIA 5IYZE 5EZYE 4KBMB 2NW8A 3PDYA 4UV8B 1ZEEA 4ZS2A 3IF8B 3T8OA 3CKDA 1IJ6A 2SPCA 1MIVA 4PFOA 3FBZA 2XAQB 4X1YE 5L3DB 4PJMA 4H9PC 3N9LA 2CA5A 2V7LA 3ZMSB 2PBIA 3N2GE 3QC9A 5A1LA 2DWKA 1LVFA 2JQQA 3AA6B 3Q9DA 2LSKA 3I9WA 1G8XA 3SRZA 2CEAA 2L9QA 4MLKA 2MBGA 1AJ3A 2HPJA 4MHCA 2DI4A 4EYYR 5L2LA 3GN5A 3U3IA 1LKXA 4ZI2C 5LHIB 4DNDA 3K3QC 5JDQA 4I55E 4ZI3C 2LSYA 1MMAA 2X0LB 1SA0E 3ZLIA 4MBQA 2IC6A 3RYHE 4AKIA 2W00A 5L3BB 2OA5A 3MA9A 1T98A 5J2UE 3UUXB 2H7OA 2PFVA 5C8YE 5FY1A 2CLYB 4QX7B 2X9XA 4CI2B 3C50A 2W0GA 3RC8A 1WLXA 5HXRA 4QWNB 3M65A 4UF0A 3TKLB 4QHOA 2NTYA 5FNVE 5HWXA 5LCYA 5H6QB 3CPZA 5JR9C 3N2KE 1Z0PA 3CWZB 2JMHA 4QXBB 3ZMVB 5HXSA 1MNDA 2LOPA 5JDMA 5LA6E 3DP7A 5E0OA 4E7ZA 4L0RA 5JREA 3BK9A 2ZM2A 2E9XC 3UUNA 4YFSA 4AKHA 4AKRB 4UVBB 2PG8A 5F8PA 2MTQA 2VWAA 3AAAB 3KV5A 2L8KA 2H3RA 2ACXA 4O4LE 4TUYE 4O4IE 3KBTA 5EK3A 3JC6C 1WYCA 4TZ4C 3FBLA 3PU8A 4IE7A 4CI1B 4O8SA 1G73A 2WMOA 4HFVA 1YD8G 2K24A 2LSGA 4UVAB 2A3DA 1O3XA 1B7TA 1ZHCA 3CX6B 3RH3A 5GONE 5L3EB 3LJCA 5JDNA 1MIWA 3AAEB 5EK4A 5DJQC 2KMFA 4K0UA 3N9QA 2VB6A 3J9X1 3OYZA 4GYRA 3SWHA 2CXFA 3N9OA 1SHZC 3N2OA 3FHNA 3SS1A 2DCFA 3HR0A 3MKDA 5L3CB 4QX8B 4ZHQE 4QXHB 1U5PA 4JEHB 5FXWA 1MNEA 4EZHA 3UT5E 4BJMA 3F57A 2IW5B 3IHRA 5LBQB 2JRKA 2X51A 3ETVA 4P0AA 4U74A 3ZMUB 4UELA 1UX5A 2XQYA 1FIOA 2ZMAA 2DWGA 2E9XA 5FMNA 2XAFB 3VU7H 1BR2A 4ZS3A 3ZCJA 4O4HE 2V1DB 4I50E 4UV9B 4ASKA 3ESLA 3DTOA 3LK42 4PJJA 4H63H 4HKAA 4AXPA 4MALA 3ZC0A 2JJ9A 2BVLA 2ODUA 2ZLYA 4I43B 3FXDB 3E22E 3K3NA 5LHHB 1HCIA 5LGNB 5LP6E 1QUUA 4H63V 4OHFA 3K8PC 5TAOA 2MOZA 4PFPA 2NW9A 2KNDA 2BZBA 4CI3B 3MZKB 3WI3A 4M1PA 2E9XB 2V7MA 4HE8A 3S4UA 3Q2MA 4BJNA 2KLQA 2N1GA 2Y8DA 3CQCB 5EK2A 3RRWA 4YJ2E 4X1KE 3Q5WA 2RA1A 5BMVE 3HKEE 5J2TE 3OJAA 3LK2B 5HYAA 2YINA 4DBRA 3L09A 4ZOLE 3WAKA 3ETUA 5DQVA 2ODVA 3O1HA 3KDSE 5FXXA 3KINB 4PJLA 4AQFA 1FMVA 3LG7A 4N78D 4G63A 2EHOC 3CVRA 3P7IA 2V26A 1KK7A 3KVAA 2A72A 4J2CA 3BQKA 1V9DA 2K5BB 2Q9QA 2ZM0A 5FYMA 2ES0A 3KVBA 5LBMA 1FEWA 3CX7B 3RX6A 4YLHA 5LYJE 5CA1E 3PUQA 3A5XA 4XZCA 4TN7B 2H7VC 3NRXA 3I0QA 3J7Yq 4PK6A 3N9PA 3ZCIA 2WWUA 3H3AA 2C5IT 3GA8A 2KWIB 2Y48B 2Z6EA 4DBQA 3RPUA 5FXZA 4CXXA 4G2AA 3MK7C 3AAIA 5IHYA 3CX8B 4H9NC 5LNKA 3ZPOA 2Y6XA 3MACA 4GOUA 3ZN1B 3RYCE 3NZQA 3F2EA 2DLRA 2VKOA 2CWOA 3R6NA 3V5UA 2E8IA 2VL8A 3KV6A 2X67A 3GWHA 3GN5B 3CQGB 5CB4E 2X9YA 2NOXA 1HF8A 3HI2A 2C0SA 3RRCA 2WM9A 2C5KT 2EHOD 1KNZA 4UF0B 5JDGA 3AA0B 4ZI7E 1HX8A 3FB2A 4YJ3E 2LHNA 3ZMZB 5JDFA 2VKDA 4AQFC 3OBVE 2NP9A 4EYUA 3H37A 1IAPA 1IZNB 2DNXA 1Y64B 2LT3A 4WBNE 5KX5E 2J1DG 2WMNA 3ZJ2A 1D0YA 1WRDA 4KUMB 3MXZA 5CA0E 5LHGB 3EVYA 3QK6A 3O9XA 4IE0A 2Q9QD 3PUSA 4ERRA 5AFUL 4NUVA 3C64A 2NTXA 4UVCB 2CM0A 4E7SA 4QXCB 3KV4A 2JMKA 4V1Av 4XBFB 3HL6A 1MIYA 3I1AA 3KV9A 3LBXB 4HEAA 4DVDA 4TV9E 1LRZA 3UULA 2K48A 5KMGP 1HS7A 3LBXA 2CXDA 2KINB 2X68A 4HN9A 3E0ZA 4BA9A 5ETWA 5LXTE 2N2NA 4EXTA 2KZ7B 3IEEA 3FXEB 5JR9A 4ZI2D 2LHRA 5LJMA 3WAJA 2Q9QB 5ADXL 3N5LA 1D0XA 4WNKA 4B6XA 4TX5A 1ZKEA 1YW0A 3AB3B 1S35A 2PJQA 3N9MA 1WR6A 2C5JA 2GK9A 4H9OC 4X1IE 4DO0A 2WSSV 2IC9A 2M67A 3RYIE 3O1JA 3R84B 4PK4A 4GK5E 1CUNA 4IE4A 5J1GA 4TV8E 3IBPA 2X66A 1YKHB 2NW7A 3U78A 2HPLA 4XAXB 5LG4A 2KT9A 4DMVA 3OKQA 1HTJF 3JC6D 4KMCA 3SOLA 4EB6E 2MYSA 4IE5A 4A56A 3L3PA 4P09A 4PAGA 2D5UA 1US7B 3LK3B 3O4XE 5DABA 4HTEA 5F3JA 1HFAA 2E9XD 4JEUB 4ZI3D 5JH7E 4NUUA 4FJOA 3KBUA 3LFMA 3NRYA 2QA7A 4PJNA 1OXZA 4IHJE 2HH7A 5L3GB 3PUGA 1VOMA 5HXHA 2LSIA 3V5SA 2W63A 4AI6A 2CMRA 2VK9A 4O2AE 3C4ZA 5FXVA 5LOVE 3HKDE 2CCQA 4GYSA 2XAGB 2YK0A 3EUHA 4EZ4A 3HKBE 5L3FB 4PK5A 2WAUA 2YU1A 1IJ5A 4JUYA 4UXNB 4OK0A 5LJNA 4O2BE 3E08A 4EAHA 4ADZA 4C91A 4AQGA 1D0ZA 3ANWA 4X20E 5M4YA 5FY7A 2VKJA 1MMGA 3BQIA 4WW0A 2RP4A 3RC3A 3AA7B 2XTLA 4L5GA 3C51A 3ZN0B 4WBOA 3PTRB 3O1IA 4PNIA 4DMWA 5JDLA 4GIWA 3VKHA 1QSDA 2KXPB 1U4QA 2X9HA 5JRCB 5JRCA 3ZC1A 1LVKA 4I4TE 3AVRA 2YU2A 2IAKA 4QKNA 1S94A 3GMIA 5H6RB 5JQGE 4ILUA 1BR4A 2D0UA 2K9AA 3CMLA 5KDMC 4CXWA 4YHJA 4ANJA 3ANWB 3AA1B 2I59A 1HG2A 2YEVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLQ A;  2LE8 A; 
#chains in the Genus database with same CATH topology
 2ZM8 A;  2LJL A;  4AKG A;  4UIG A;  1HNW T;  2MAW A;  1EZ3 A;  3PUR A;  4IST A;  5AQU B;  3AE7 A;  4EIW A;  4DR1 T;  2BDE A;  2WZH A;  3NBX X;  1VRB A;  3F31 A;  3N9N A;  1XNQ T;  1D1C A;  4IDZ A;  2CWY A;  2WS3 A;  4EOZ B;  2HN2 A;  3B57 A;  3ONX A;  1HR0 T;  5HEH A;  1FMW A;  3B13 A;  3OYX A;  2QRX A;  4H9S E;  4HFI A;  5LGT B;  3DJB A;  2BG9 A;  3EDV A;  4FI5 A;  1N34 T;  4IDO A;  2QGS A;  1WYB A;  3CQX C;  2VAS A;  5DQW A;  3T1Y T;  4AKL A;  1H7C A;  2V7J A;  3TLV A;  1UUS A;  1GQE A;  2V6Y B;  4CZZ B;  3HA4 A;  4DUY T;  3UU6 A;  1UX4 A;  2UXN B;  2WU5 A;  3P8C D;  4UEM A;  3W15 B;  3ZYL A;  3Q5X A;  3ZJ1 A;  4DID B;  3UFE A;  4YTP A;  5HXE A;  5JVD E;  4GKJ T;  4Z8X A;  1MMD A;  3C4X A;  1HG5 A;  5HAX A;  4DV7 T;  3P4P A;  2EHO B;  1X79 A;  3D0T A;  1YQ4 A;  4L9I A;  2LEH A;  3PUA A;  3TLU A;  2HHH T;  2B1E A;  2XY8 B;  4MFR A;  1BR1 A;  2FJE A;  2N9D A;  1YKE B;  1D1B A;  3RQU A;  2Q9Q C;  2X9W A;  3PE0 A;  1J5E T;  2XUE A;  1DU2 A;  5FP3 A;  4C90 A;  4DR6 T;  1M62 A;  1L0V A;  2W62 A;  2XQ9 A;  2LOS A;  5LGU B;  3EDU A;  1MMN A;  4DV6 T;  2DHR A;  2XAJ B;  3AE5 A;  4H9R C;  5AQS B;  3QNU A;  4OYJ A;  2CXL A;  2L3L A;  2W61 A;  3ABV A;  1UCU A;  3MJX A;  2XAS B;  2IUB A;  4IE6 A;  1OED A;  3UTK A;  4HGA A;  5AQK B;  2XPK A;  2D2S A;  4JI4 T;  1NAF A;  2BKO A;  2A9U A;  2M6I A;  2LM9 A;  4B3R T;  3AEA A;  2EHO A;  2XAH B;  2JPF A;  4PW8 A;  2V5D A;  1E1H B;  4IIJ E;  3I0O A;  3RKO A;  4CXY A;  3AXJ A;  1HS7 A;  2KWH A;  2A2F X;  2XQ7 A;  5AQT B;  2LKH A;  5AQI B;  3BQL A;  4P0B A;  2G0U A;  3ZEF B;  3AE2 A;  3AED A;  2LKG A;  3HKC E;  4IGU A;  5JDH A;  1WR0 A;  1YQ3 A;  2I6H A;  2LRL A;  3C4W A;  3C98 B;  2BG9 B;  4O4J E;  4H9Q C;  5FKY A;  3UU5 A;  5HXC A;  2R6G F;  2J62 A;  4YSZ A;  1I6Z A;  2XHE B;  2BS4 A;  5AQR B;  4YY3 T;  2XSB A;  3JAE A;  2XQ3 A;  5JR9 B;  2H88 A;  2VKH A;  5ABG A;  3SFE A;  2XQ6 A;  2JQK A;  4JLE A;  2LSJ A;  4OYK A;  2NWB A;  1D1A A;  1KEY A;  3I9Y A;  4U72 A;  3NZP A;  4GK0 E;  2FJD A;  2WBL A;  2V7K A;  2CE7 A;  3AE4 A;  4HWC A;  3RIU C;  3CK6 A;  2BVM A;  2LE8 A;  3K3O A;  3PU3 A;  3QUJ A;  5LG3 A;  2OLT A;  4LMK A;  4OFZ A;  5FY0 A;  3P4S A;  3SFD A;  3ZMT B;  4HFC A;  2CLY C;  2P9B A;  3RYF E;  2V7I A;  2UXX B;  4ISS A;  1BR0 A;  2E2A A;  1SUM B;  5HWY A;  1XMO T;  2CRB A;  1NWM X;  3VHL A;  1ZV4 X;  1OWA A;  3TLW A;  3ZYM A;  4CN6 A;  3ZYK A;  4F6R C;  1QLB A;  3KFW X;  2D0T A;  3Q5D A;  3UUM A;  4BAY B;  3AVS A;  4KP3 C;  4CQI A;  4JBW F;  4JI8 T;  5IYZ E;  5EZY E;  3QB5 A;  4KBM B;  3RKG A;  2NW8 A;  3PDY A;  4UV8 B;  1JNZ A;  1ZEE A;  4ZS2 A;  4IL9 A;  3EAB A;  3IF8 B;  3T8O A;  2X0Y A;  3CKD A;  1IJ6 A;  2SPC A;  1MIV A;  3NWI A;  5C3J A;  4PFO A;  3FBZ A;  2XAQ B;  3ONJ A;  4X1Y E;  4PJM A;  5L3D B;  4H9P C;  3N9L A;  2XQ4 A;  2CA5 A;  2V7L A;  3ZMS B;  2UUA T;  2PBI A;  3N2G E;  3JAF A;  3QC9 A;  5A1L A;  2BS2 A;  2DWK A;  5CFB A;  1LVF A;  5KXJ A;  2JQQ A;  3AA6 B;  3Q9D A;  2LSK A;  3I9W A;  1G8X A;  4KHZ F;  2CEA A;  2FJB A;  1UGO A;  2L9Q A;  4MLK A;  4U7Y A;  2MBG A;  3SRZ A;  2HPJ A;  4YSX A;  4MHC A;  2DI4 A;  4EYY R;  3ZST A;  4DV3 T;  1R8I A;  3AE8 A;  5L2L A;  3GN5 A;  3U3I A;  1W0B A;  3K1S A;  1LKX A;  2BBJ A;  4ZI2 C;  2XJ7 A;  4Z90 A;  5LHI B;  4DND A;  3K3Q C;  4HWF A;  5JDQ A;  1ZP0 A;  4I55 E;  4X62 T;  4ZI3 C;  5F5W A;  2BG9 E;  2HN1 A;  2LSY A;  1MMA A;  2X0L B;  1SA0 E;  2XQ5 A;  3ZLI A;  2K3W A;  2IC6 A;  4MBQ A;  3RYH E;  2W00 A;  5L3B B;  4AKI A;  2MPK A;  2OA5 A;  1T98 A;  3MA9 A;  3UUX B;  5J2U E;  2H7O A;  1NEN A;  3AEF A;  2PFV A;  4NPP A;  4QH1 A;  5FY1 A;  5C8Y E;  2CLY B;  4QX7 B;  2KSR A;  2X9X A;  5FL1 A;  1N36 T;  4CI2 B;  3C50 A;  2W0G A;  2W67 A;  4TNV A;  4TWH A;  1WLX A;  3RC8 A;  5HXR A;  4QWN B;  3M65 A;  4KI0 F;  4X66 T;  4UF0 A;  1NEK A;  2IIU A;  3TKL B;  4QHO A;  1XMQ T;  2NTY A;  5AQH B;  5FNV E;  5HWX A;  2WDR A;  5LCY A;  5H6Q B;  3CPZ A;  5JR9 C;  3N2K E;  1Z0P A;  3CWZ B;  3RIA A;  2JMH A;  4QXB B;  3ZMV B;  5HXS A;  4U7I A;  5J0Z A;  2VL0 A;  4DV0 T;  1MND A;  2LOP A;  2M6B A;  4JV5 T;  5JDM A;  4JYA T;  5LA6 E;  3DP7 A;  5E0O A;  3X1D A;  4E7Z A;  4L0R A;  5JRE A;  3BK9 A;  5ABH A;  2ZM2 A;  2E9X C;  4HFB A;  1IBL T;  3UUN A;  4YFS A;  4AKH A;  3VRB A;  3FZL B;  4AKR B;  4UVB B;  2PG8 A;  5AQJ B;  4HWD A;  2B76 A;  2VVN A;  5F8P A;  4F8H A;  2BS3 A;  2MTQ A;  2VWA A;  3AAA B;  3KV5 A;  4U2Z A;  2L8K A;  1UUR A;  2H3R A;  2ACX A;  4O4L E;  4TUY E;  1WFD A;  3B5M A;  3KBT A;  4O4I E;  1Z8U A;  5EK3 A;  2WY2 A;  2IML A;  1WYC A;  3H3M A;  3JC6 C;  3FBL A;  4TZ4 C;  3RI5 A;  3ZT7 A;  3PU8 A;  4B3S T;  4B3T T;  4JI1 T;  4IE7 A;  4CI1 B;  4O8S A;  1G73 A;  3IA3 A;  2WMO A;  2XQA A;  4LFB T;  4HFV A;  1W9R A;  1YD8 G;  2K24 A;  2LSG A;  4WYV A;  4UVA B;  1O3X A;  1ZHC A;  1B7T A;  2A3D A;  1WCR A;  2LLY A;  3CX6 B;  3RH3 A;  2UXC T;  5GON E;  3PJA J;  5L3E B;  3LJC A;  4HWH A;  5JDN A;  5LB7 B;  3TLT A;  1MIW A;  3AAE B;  1XZY A;  5EK4 A;  1T8B A;  4Q25 A;  5DJQ C;  2VVS A;  4JI0 T;  2UU9 T;  2KMF A;  4K0U A;  3N9Q A;  1M7K A;  5AQP B;  2VB6 A;  4NIQ A;  3J9X 1;  3AEG A;  3OYZ A;  5AQL B;  1T72 A;  4GYR A;  3SWH A;  3OVU A;  2AXD S;  2CXF A;  3N9O A;  1SHZ C;  3N2O A;  3FHN A;  3SS1 A;  2DCF A;  3HR0 A;  3MKD A;  3P50 A;  4QX8 B;  4CN4 A;  4QXH B;  4ZHQ E;  5L3C B;  1U5P A;  4JEH B;  5FXW A;  1MNE A;  1AJ3 A;  2XM2 A;  3UT5 E;  4EZH A;  4LFC T;  3FZM B;  4BJM A;  3P4W A;  3F57 A;  3P4R A;  2WCA A;  2D9D A;  3JAD A;  2IW5 B;  3FZK B;  3IHR A;  2JRK A;  2X51 A;  3ETV A;  3PJA A;  5LBQ B;  4U74 A;  3ZT5 A;  4DV1 T;  4P0A A;  3ZMU B;  4UEL A;  1UX5 A;  5HEO A;  3QOF A;  1HNX T;  2XQY A;  1FIO A;  2ZMA A;  2DWG A;  3EHZ A;  2E9X A;  2E5V A;  5FMN A;  2XAF B;  3VU7 H;  1BR2 A;  3PUW F;  4LF4 T;  2CBJ A;  4ZS3 A;  3ZCJ A;  4O4H E;  2V1D B;  2DL1 A;  3RLF F;  4I50 E;  4UV9 B;  4A97 A;  4ASK A;  3ESL A;  3DTO A;  3LK4 2;  4PJJ A;  4JI7 T;  4H63 H;  2YDQ A;  4HKA A;  4AXP A;  2IHR 1;  2UXD T;  4MAL A;  2JQH A;  3ZC0 A;  1W0A A;  2ACZ A;  1E7P A;  2JJ9 A;  4B3M T;  2BVL A;  4DV5 T;  4GKK T;  2ODU A;  2OV9 A;  2XZE A;  2ZLY A;  4IDP A;  4I43 B;  3M3Z B;  3FXD B;  3E22 E;  3K3N A;  5LHH B;  1HCI A;  5LGN B;  5LP6 E;  1IBK T;  1QUU A;  2I0M A;  4H63 V;  4OHF A;  3K8P C;  5TAO A;  4YT0 A;  4DV4 T;  4LFA T;  1XNR T;  2MOZ A;  4PFP A;  2WWV A;  2NW9 A;  2KND A;  3PUZ F;  2BZB A;  4CI3 B;  3MZK B;  3WI3 A;  4AIS A;  4M1P A;  2E9X B;  2V7M A;  4HE8 A;  3S4U A;  4NXM T;  5CJ5 A;  1Y01 A;  5AQV B;  3Q2M A;  4BJN A;  1I94 T;  2KLQ A;  5AQM B;  2N1G A;  2Y8D A;  1W09 A;  3CQC B;  5EK2 A;  2UXB T;  2QYW A;  2WQY A;  3RRW A;  4YJ2 E;  4Z91 A;  4X1K E;  3Q5W A;  3AE1 A;  2RA1 A;  4IRE A;  2BG9 C;  5BMV E;  3HKE E;  5J2T E;  2BKP A;  3OJA A;  3LK2 B;  5HYA A;  2YIN A;  4DBR A;  3L09 A;  4ZOL E;  3WAK A;  3ETU A;  3UU8 A;  4LF8 T;  2UUB T;  2XM1 A;  4LMJ A;  5DQV A;  1T7S A;  3VRA A;  4EV6 A;  2ODV A;  3L39 A;  3O1H A;  3KDS E;  5FXX A;  3KIN B;  1OED E;  1KF6 A;  4PJL A;  1FMV A;  3LG7 A;  4N78 D;  4AQF A;  4K0K T;  4G63 A;  2EHO C;  2W4X A;  3CVR A;  3P7I A;  2V26 A;  3ONL C;  1KK7 A;  4TWD A;  3RHW A;  4ILC A;  3KVA A;  2A72 A;  2WP9 A;  3L8R A;  4J2C A;  3FZH B;  2NR4 A;  4IL4 A;  2CPT A;  5HEG A;  1N33 T;  3BQK A;  1V9D A;  2K5B B;  2Q9Q A;  2ZM0 A;  4HFH A;  5FYM A;  2ES0 A;  3KVB A;  3UUB A;  5LBM A;  1FEW A;  3CX7 B;  3RX6 A;  4YLH A;  4JI3 T;  5LYJ E;  5CA1 E;  4DR3 T;  4LF5 T;  3PUQ A;  5ABF A;  3A5X A;  2JQ9 A;  4JI5 T;  3CIR A;  4XZC A;  4TN7 B;  2H7V C;  2LM2 A;  2JIW A;  2YDR A;  3EAM A;  3NRX A;  3I0Q A;  3J7Y q;  4PK6 A;  3N9P A;  3ZCI A;  2WWU A;  3GA8 A;  2C5I T;  3H3A A;  2RPA A;  3RIU A;  2KWI B;  1VCS A;  2Y48 B;  2Z6E A;  4U31 A;  3RPU A;  5FXZ A;  4DBQ A;  4CXX A;  4G2A A;  3TLS A;  3MK7 C;  4HFE A;  5CGM A;  3AAI A;  4WZX A;  2J47 A;  5IHY A;  5BR8 T;  2WZI A;  2V5C A;  3CX8 B;  4H9N C;  4ILA A;  5LNK A;  3ZPO A;  3AEC A;  2Y6X A;  3MAC A;  4GOU A;  3ZN1 B;  1ZOY A;  2VUR A;  3NZQ A;  3RYC E;  3F2E A;  3ZKR A;  2CBI A;  2DLR A;  2VKO A;  4U33 A;  2CWO A;  4UR9 A;  3R6N A;  3G06 A;  3V5U A;  2E8I A;  2VL8 A;  3RF1 A;  3KV6 A;  2AE9 A;  2X67 A;  3GN5 B;  3CQG B;  1YXR A;  2FJA A;  3GWH A;  5CB4 E;  2X9Y A;  2NOX A;  1HF8 A;  3HI2 A;  4YTM A;  2C0S A;  2V8S V;  4ZXL A;  3RRC A;  2WM9 A;  2C5K T;  4X5T A;  4DUZ T;  1CHU A;  3AE3 A;  2EHO D;  1KNZ A;  5IUX A;  3OPC A;  4P1N A;  4UF0 B;  5JDG A;  5ABF B;  3AA0 B;  4ZI7 E;  1HX8 A;  1J1J A;  4OX9 T;  3FB2 A;  4YJ3 E;  2LHN A;  3ZMZ B;  4A98 A;  5JDF A;  2VKD A;  4AQF C;  3UU4 A;  4ILB A;  3OBV E;  2NP9 A;  4EYU A;  3RIF A;  5HEU A;  5L4H A;  3H37 A;  1IAP A;  1IZN B;  2DNX A;  1Y64 B;  2LT3 A;  2XSA A;  2YKS A;  4IT4 A;  3UU3 A;  4WBN E;  3QB5 K;  2J1D G;  5KX5 E;  2WMN A;  3ZJ2 A;  1D0Y A;  1XWM A;  1WRD A;  4KUM B;  4DR5 T;  4EED A;  3MXZ A;  5CA0 E;  5AQO B;  5LHG B;  3EVY A;  3QK6 A;  3O9X A;  4IE0 A;  2Q9Q D;  3PUS A;  1JNR A;  4ZZC A;  5C2T A;  4ERR A;  4JI6 T;  5AFU L;  4NUV A;  3C64 A;  2NTX A;  4EGW A;  2VQF T;  4UVC B;  2CM0 A;  3NVO A;  4I0U A;  4DV2 T;  3UQ7 A;  2ZM6 T;  1UK5 A;  4E7S A;  4QXC B;  3KV4 A;  5LMN T;  2JMK A;  4V1A v;  4XBF B;  2W2U A;  3HL6 A;  1MIY A;  3AE9 A;  3I1A A;  3KV9 A;  3LBX B;  4HEA A;  3FZF B;  4DVD A;  1OED C;  1KFY A;  4TV9 E;  1LRZ A;  2J4G A;  3RQW A;  2K48 A;  3UUL A;  5KMG P;  5AQF B;  4DR7 T;  2BKN A;  1KNP A;  2CHO A;  2V6X A;  3LBX A;  4A5X A;  2FBW A;  2CXD A;  2KIN B;  2X68 A;  4HN9 A;  3E0Z A;  4BA9 A;  5HEJ A;  5ETW A;  2UUC T;  5LXT E;  2N2N A;  4EXT A;  2KZ7 B;  3IEE A;  3FXE B;  5JR9 A;  4ZI2 D;  2LHR A;  5LJM A;  4TWF A;  3WAJ A;  2Q9Q B;  2W66 A;  5ADX L;  3N5L A;  1D0X A;  4WNK A;  1SE7 A;  4TX5 A;  4B6X A;  4DR2 T;  1ZKE A;  2PTF A;  1FJG T;  1YW0 A;  3AB3 B;  1S35 A;  2PJQ A;  3N9M A;  1WR6 A;  2C5J A;  2GK9 A;  4H9O C;  4X1I E;  1XDO A;  2WSS V;  5FVL A;  1X9B A;  3ZT6 A;  4DO0 A;  4KHP T;  2IC9 A;  2M67 A;  3RYI E;  3O1J A;  3R84 B;  4PK4 A;  4GK5 E;  1CUN A;  4IE4 A;  5J1G A;  2QVA A;  3IBP A;  4TV8 E;  2X66 A;  3AXJ B;  1YKH B;  5FVK A;  3VR8 A;  2NW7 A;  3OTO T;  3U78 A;  2HPL A;  4XAX B;  5LG4 A;  2KT9 A;  4DMV A;  3OKQ A;  2XQ8 A;  2F4V T;  4X64 T;  1HTJ F;  3JC6 D;  4YTN A;  5ABE A;  4KMC A;  1HX1 B;  3SOL A;  4CN1 A;  4EB6 E;  4AQY T;  4LF6 T;  4LF7 T;  2MYS A;  4IE5 A;  5HCM A;  4A56 A;  3L3P A;  4P09 A;  5IWA T;  2WU2 A;  4IDQ A;  4YSY A;  4DR4 T;  2WDV A;  4PAG A;  4YXD A;  2D5U A;  1US7 B;  2YDS A;  3AE6 A;  3LK3 B;  3O4X E;  5DAB A;  1VCT A;  3A7M A;  1HFA A;  2E9X D;  4HTE A;  4JEU B;  5F3J A;  4HFD A;  4ZI3 D;  2X0H A;  5JH7 E;  3T1H T;  4NUU A;  2WDQ A;  3AEE A;  5JTG A;  3VKG A;  4U2Y A;  4QH5 A;  4FJO A;  3KBU A;  3LFM A;  3NRY A;  2QA7 A;  4PJN A;  1OXZ A;  4IHJ E;  2HH7 A;  5L3G B;  4EEB A;  2WB5 A;  3PUG A;  1VOM A;  5AQQ B;  3RGL A;  5HXH A;  2LSI A;  3V5S A;  2H89 A;  4U3C A;  4COF A;  2W63 A;  4ZZB A;  2CMR A;  4AI6 A;  4ZEY A;  2IDO B;  2VK9 A;  4O2A E;  3VR9 A;  4QH4 A;  3C4Z A;  5FXV A;  5LOV E;  3HKD E;  2CCQ A;  4GYS A;  2XAG B;  1J5W A;  2YK0 A;  3EUH A;  4EZ4 A;  3HKB E;  2LRK A;  1N32 T;  5L3F B;  1OED B;  2YOE A;  3A8Y C;  4PK5 A;  1E2A A;  2WAU A;  2YU1 A;  1IJ5 A;  2YN6 A;  4JUY A;  4UXN B;  2BBH A;  3PUV F;  4OK0 A;  1XDP A;  5LJN A;  4O2B E;  3UQ4 A;  4NXN T;  3LDQ B;  1IBM T;  3E08 A;  4EAH A;  4HWI B;  3LSV A;  5FL0 A;  3Q5E A;  3PUX F;  4ADZ A;  4C91 A;  4AQG A;  1D0Z A;  4KX6 A;  3ANW A;  4X20 E;  5M4Y A;  5FY7 A;  4YHH T;  2VKJ A;  5HCJ A;  1MMG A;  3BQI A;  4WW0 A;  3P4Q A;  4TNW A;  2RP4 A;  3RC3 A;  3AA7 B;  2XTL A;  3NKZ A;  4L5G A;  3UFG A;  3C51 A;  3ZN0 B;  5AQG B;  5L47 A;  4WBO A;  3PTR B;  4LML A;  2E5L T;  3O1I A;  4PNI A;  4DMW A;  5JDL A;  4GIW A;  3VKH A;  1QSD A;  2KXP B;  1U4Q A;  2X9H A;  3JCF A;  5JRC B;  2CHN A;  2V6Y A;  5LMU T;  4AIU A;  5JRC A;  3ZC1 A;  2VQE T;  1LVK A;  4I4T E;  3PV0 F;  2YU2 A;  3AVR A;  2FUP A;  2IAK A;  1S94 A;  3AEB A;  3GMI A;  4QKN A;  5H6R B;  5JQG E;  5L4E A;  3PUY F;  4JI2 T;  3ZSS A;  4ILU A;  4IDN A;  5AQN B;  1HNZ T;  1BR4 A;  2D0U A;  2K9A A;  4LF9 T;  3CML A;  1KNR A;  5KDM C;  4CXW A;  4YHJ A;  3EI0 A;  4ANJ A;  3ANW B;  3AA1 B;  2I59 A;  1HG2 A;  2YEV C;  4X65 T; 
#chains in the Genus database with same CATH homology
 2ZM8 A;  2LJL A;  4AKG A;  4UIG A;  1EZ3 A;  3PUR A;  4IST A;  4EIW A;  2BDE A;  3NBX X;  1VRB A;  3F31 A;  3N9N A;  1D1C A;  4IDZ A;  2CWY A;  4EOZ B;  3B57 A;  3ONX A;  1FMW A;  3B13 A;  3OYX A;  4H9S E;  5LGT B;  3DJB A;  4FI5 A;  3EDV A;  5DQW A;  2QGS A;  1WYB A;  3CQX C;  2VAS A;  4AKL A;  1H7C A;  2V7J A;  4CZZ B;  3HA4 A;  1UX4 A;  2UXN B;  3P8C D;  4UEM A;  3W15 B;  3ZYL A;  5HXE A;  3Q5X A;  3ZJ1 A;  3UFE A;  5JVD E;  4Z8X A;  1MMD A;  3C4X A;  1HG5 A;  5HAX A;  2EHO B;  1X79 A;  3D0T A;  4L9I A;  2LEH A;  3PUA A;  2B1E A;  4MFR A;  1BR1 A;  2N9D A;  1YKE B;  1D1B A;  2Q9Q C;  2X9W A;  3PE0 A;  2XUE A;  5FP3 A;  4C90 A;  2W62 A;  2LOS A;  5LGU B;  3EDU A;  1MMN A;  2DHR A;  2XAJ B;  4H9R C;  4OYJ A;  2CXL A;  2L3L A;  2W61 A;  3MJX A;  1UCU A;  4IE6 A;  2XAS B;  3UTK A;  4HGA A;  2D2S A;  1NAF A;  2LM9 A;  2EHO A;  2XAH B;  2JPF A;  4PW8 A;  4IIJ E;  1E1H B;  3RKO A;  3I0O A;  4CXY A;  2KWH A;  2A2F X;  3BQL A;  4P0B A;  2G0U A;  3ZEF B;  4IGU A;  3HKC E;  5JDH A;  3VHL A;  3VKG A;  3C4W A;  3C98 B;  4O4J E;  4H9Q C;  5HXC A;  2XHE B;  5JR9 B;  2VKH A;  4JLE A;  2LSJ A;  4OYK A;  2NWB A;  1D1A A;  3I9Y A;  4U72 A;  3NZP A;  4GK0 E;  2WBL A;  2V7K A;  2CE7 A;  2BVM A;  2LE8 A;  3K3O A;  3PU3 A;  3QUJ A;  4OFZ A;  5FY0 A;  3ZMT B;  2CLY C;  2P9B A;  3RYF E;  2V7I A;  2UXX B;  4ISS A;  1BR0 A;  5HWY A;  1NWM X;  1ZV4 X;  1OWA A;  3ZYM A;  3ZYK A;  4F6R C;  3KFW X;  2D0T A;  3UUM A;  4BAY B;  3AVS A;  4KP3 C;  4CQI A;  5IYZ E;  5EZY E;  4KBM B;  2NW8 A;  3PDY A;  4UV8 B;  1ZEE A;  4ZS2 A;  3IF8 B;  3T8O A;  3CKD A;  1IJ6 A;  2SPC A;  1MIV A;  4PFO A;  3FBZ A;  2XAQ B;  4X1Y E;  5L3D B;  4PJM A;  4H9P C;  3N9L A;  2CA5 A;  2V7L A;  3ZMS B;  2PBI A;  3N2G E;  3QC9 A;  5A1L A;  2DWK A;  1LVF A;  2JQQ A;  3AA6 B;  3Q9D A;  2LSK A;  3I9W A;  1G8X A;  3SRZ A;  2CEA A;  2L9Q A;  4MLK A;  2MBG A;  1AJ3 A;  2HPJ A;  4MHC A;  2DI4 A;  4EYY R;  5L2L A;  3GN5 A;  3U3I A;  1LKX A;  4ZI2 C;  5LHI B;  4DND A;  3K3Q C;  5JDQ A;  4I55 E;  4ZI3 C;  2LSY A;  1MMA A;  2X0L B;  1SA0 E;  3ZLI A;  4MBQ A;  2IC6 A;  3RYH E;  4AKI A;  2W00 A;  5L3B B;  2OA5 A;  3MA9 A;  1T98 A;  5J2U E;  3UUX B;  2H7O A;  2PFV A;  5C8Y E;  5FY1 A;  2CLY B;  4QX7 B;  2X9X A;  4CI2 B;  3C50 A;  2W0G A;  3RC8 A;  1WLX A;  5HXR A;  4QWN B;  3M65 A;  4UF0 A;  3TKL B;  4QHO A;  2NTY A;  5FNV E;  5HWX A;  5LCY A;  5H6Q B;  3CPZ A;  5JR9 C;  3N2K E;  1Z0P A;  3CWZ B;  2JMH A;  4QXB B;  3ZMV B;  5HXS A;  1MND A;  2LOP A;  5JDM A;  5LA6 E;  3DP7 A;  5E0O A;  4E7Z A;  4L0R A;  5JRE A;  3BK9 A;  2ZM2 A;  2E9X C;  3UUN A;  4YFS A;  4AKH A;  4AKR B;  4UVB B;  2PG8 A;  5F8P A;  2MTQ A;  2VWA A;  3AAA B;  3KV5 A;  2L8K A;  2H3R A;  2ACX A;  4O4L E;  4TUY E;  4O4I E;  3KBT A;  5EK3 A;  3JC6 C;  1WYC A;  4TZ4 C;  3FBL A;  3PU8 A;  4IE7 A;  4CI1 B;  4O8S A;  1G73 A;  2WMO A;  4HFV A;  1YD8 G;  2K24 A;  2LSG A;  4UVA B;  2A3D A;  1O3X A;  1B7T A;  1ZHC A;  3CX6 B;  3RH3 A;  5GON E;  5L3E B;  3LJC A;  5JDN A;  1MIW A;  3AAE B;  5EK4 A;  5DJQ C;  2KMF A;  4K0U A;  3N9Q A;  2VB6 A;  3J9X 1;  3OYZ A;  4GYR A;  3SWH A;  2CXF A;  3N9O A;  1SHZ C;  3N2O A;  3FHN A;  3SS1 A;  2DCF A;  3HR0 A;  3MKD A;  5L3C B;  4QX8 B;  4ZHQ E;  4QXH B;  1U5P A;  4JEH B;  5FXW A;  1MNE A;  4EZH A;  3UT5 E;  4BJM A;  3F57 A;  2IW5 B;  3IHR A;  5LBQ B;  2JRK A;  2X51 A;  3ETV A;  4P0A A;  4U74 A;  3ZMU B;  4UEL A;  1UX5 A;  2XQY A;  1FIO A;  2ZMA A;  2DWG A;  2E9X A;  5FMN A;  2XAF B;  3VU7 H;  1BR2 A;  4ZS3 A;  3ZCJ A;  4O4H E;  2V1D B;  4I50 E;  4UV9 B;  4ASK A;  3ESL A;  3DTO A;  3LK4 2;  4PJJ A;  4H63 H;  4HKA A;  4AXP A;  4MAL A;  3ZC0 A;  2JJ9 A;  2BVL A;  2ODU A;  2ZLY A;  4I43 B;  3FXD B;  3E22 E;  3K3N A;  5LHH B;  1HCI A;  5LGN B;  5LP6 E;  1QUU A;  4H63 V;  4OHF A;  3K8P C;  5TAO A;  2MOZ A;  4PFP A;  2NW9 A;  2KND A;  2BZB A;  4CI3 B;  3MZK B;  3WI3 A;  4M1P A;  2E9X B;  2V7M A;  4HE8 A;  3S4U A;  3Q2M A;  4BJN A;  2KLQ A;  2N1G A;  2Y8D A;  3CQC B;  5EK2 A;  3RRW A;  4YJ2 E;  4X1K E;  3Q5W A;  2RA1 A;  5BMV E;  3HKE E;  5J2T E;  3OJA A;  3LK2 B;  5HYA A;  2YIN A;  4DBR A;  3L09 A;  4ZOL E;  3WAK A;  3ETU A;  5DQV A;  2ODV A;  3O1H A;  3KDS E;  5FXX A;  3KIN B;  4PJL A;  4AQF A;  1FMV A;  3LG7 A;  4N78 D;  4G63 A;  2EHO C;  3CVR A;  3P7I A;  2V26 A;  1KK7 A;  3KVA A;  2A72 A;  4J2C A;  3BQK A;  1V9D A;  2K5B B;  2Q9Q A;  2ZM0 A;  5FYM A;  2ES0 A;  3KVB A;  5LBM A;  1FEW A;  3CX7 B;  3RX6 A;  4YLH A;  5LYJ E;  5CA1 E;  3PUQ A;  3A5X A;  4XZC A;  4TN7 B;  2H7V C;  3NRX A;  3I0Q A;  3J7Y q;  4PK6 A;  3N9P A;  3ZCI A;  2WWU A;  3H3A A;  2C5I T;  3GA8 A;  2KWI B;  2Y48 B;  2Z6E A;  4DBQ A;  3RPU A;  5FXZ A;  4CXX A;  4G2A A;  3MK7 C;  3AAI A;  5IHY A;  3CX8 B;  4H9N C;  5LNK A;  3ZPO A;  2Y6X A;  3MAC A;  4GOU A;  3ZN1 B;  3RYC E;  3NZQ A;  3F2E A;  2DLR A;  2VKO A;  2CWO A;  3R6N A;  3V5U A;  2E8I A;  2VL8 A;  3KV6 A;  2X67 A;  3GWH A;  3GN5 B;  3CQG B;  5CB4 E;  2X9Y A;  2NOX A;  1HF8 A;  3HI2 A;  2C0S A;  3RRC A;  2WM9 A;  2C5K T;  2EHO D;  1KNZ A;  4UF0 B;  5JDG A;  3AA0 B;  4ZI7 E;  1HX8 A;  3FB2 A;  4YJ3 E;  2LHN A;  3ZMZ B;  5JDF A;  2VKD A;  4AQF C;  3OBV E;  2NP9 A;  4EYU A;  3H37 A;  1IAP A;  1IZN B;  2DNX A;  1Y64 B;  2LT3 A;  4WBN E;  5KX5 E;  2J1D G;  2WMN A;  3ZJ2 A;  1D0Y A;  1WRD A;  4KUM B;  3MXZ A;  5CA0 E;  5LHG B;  3EVY A;  3QK6 A;  3O9X A;  4IE0 A;  2Q9Q D;  3PUS A;  4ERR A;  5AFU L;  4NUV A;  3C64 A;  2NTX A;  4UVC B;  2CM0 A;  4E7S A;  4QXC B;  3KV4 A;  2JMK A;  4V1A v;  4XBF B;  3HL6 A;  1MIY A;  3I1A A;  3KV9 A;  3LBX B;  4HEA A;  4DVD A;  4TV9 E;  1LRZ A;  3UUL A;  2K48 A;  5KMG P;  1HS7 A;  3LBX A;  2CXD A;  2KIN B;  2X68 A;  4HN9 A;  3E0Z A;  4BA9 A;  5ETW A;  5LXT E;  2N2N A;  4EXT A;  2KZ7 B;  3IEE A;  3FXE B;  5JR9 A;  4ZI2 D;  2LHR A;  5LJM A;  3WAJ A;  2Q9Q B;  5ADX L;  3N5L A;  1D0X A;  4WNK A;  4B6X A;  4TX5 A;  1ZKE A;  1YW0 A;  3AB3 B;  1S35 A;  2PJQ A;  3N9M A;  1WR6 A;  2C5J A;  2GK9 A;  4H9O C;  4X1I E;  4DO0 A;  2WSS V;  2IC9 A;  2M67 A;  3RYI E;  3O1J A;  3R84 B;  4PK4 A;  4GK5 E;  1CUN A;  4IE4 A;  5J1G A;  4TV8 E;  3IBP A;  2X66 A;  1YKH B;  2NW7 A;  3U78 A;  2HPL A;  4XAX B;  5LG4 A;  2KT9 A;  4DMV A;  3OKQ A;  1HTJ F;  3JC6 D;  4KMC A;  3SOL A;  4EB6 E;  2MYS A;  4IE5 A;  4A56 A;  3L3P A;  4P09 A;  4PAG A;  2D5U A;  1US7 B;  3LK3 B;  3O4X E;  5DAB A;  4HTE A;  5F3J A;  1HFA A;  2E9X D;  4JEU B;  4ZI3 D;  5JH7 E;  4NUU A;  4FJO A;  3KBU A;  3LFM A;  3NRY A;  2QA7 A;  4PJN A;  1OXZ A;  4IHJ E;  2HH7 A;  5L3G B;  3PUG A;  1VOM A;  5HXH A;  2LSI A;  3V5S A;  2W63 A;  4AI6 A;  2CMR A;  2VK9 A;  4O2A E;  3C4Z A;  5FXV A;  5LOV E;  3HKD E;  2CCQ A;  4GYS A;  2XAG B;  2YK0 A;  3EUH A;  4EZ4 A;  3HKB E;  5L3F B;  4PK5 A;  2WAU A;  2YU1 A;  1IJ5 A;  4JUY A;  4UXN B;  4OK0 A;  5LJN A;  4O2B E;  3E08 A;  4EAH A;  4ADZ A;  4C91 A;  4AQG A;  1D0Z A;  3ANW A;  4X20 E;  5M4Y A;  5FY7 A;  2VKJ A;  1MMG A;  3BQI A;  4WW0 A;  2RP4 A;  3RC3 A;  3AA7 B;  2XTL A;  4L5G A;  3C51 A;  3ZN0 B;  4WBO A;  3PTR B;  3O1I A;  4PNI A;  4DMW A;  5JDL A;  4GIW A;  3VKH A;  1QSD A;  2KXP B;  1U4Q A;  2X9H A;  5JRC B;  5JRC A;  3ZC1 A;  1LVK A;  4I4T E;  3AVR A;  2YU2 A;  2IAK A;  4QKN A;  1S94 A;  3GMI A;  5H6R B;  5JQG E;  4ILU A;  1BR4 A;  2D0U A;  2K9A A;  3CML A;  5KDM C;  4CXW A;  4YHJ A;  4ANJ A;  3ANW B;  3AA1 B;  2I59 A;  1HG2 A;  2YEV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...