2KLQA

The solution structure of cbd of human mcm6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
APKASLRLGFSEYSRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA replication licensing factor MCM6
publication title Characterization and structure determination of the Cdt1 binding domain of human minichromosome maintenance (Mcm) 6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 28
structure length 114
sequence length 114
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18263 MCM6_C MCM6 C-terminal winged-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.870 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2klqA00
2LE8A 2KLQA
chains in the Genus database with same CATH superfamily
4YTMA 3V5SA 3LK42 4UF0A 4PK5A 2UXCT 3AB3B 4MALA 1LRZA 2YDQA 3AEEA 1M7KA 5LGUB 4PFPA 5LCYA 3SFDA 3UU3A 2LHRA 2V7KA 3T1YT 4K0KT 2XAHB 3WAJA 3C4ZA 1I94T 5HEGA 2CMRA 2JQ9A 1ZV4X 3FBLA 3AXJA 2FJEA 2QRXA 2W67A 5L3GB 1B7TA 5FVLA 1YW0A 3RF1A 4OYJA 4PJMA 5KDMC 2YK0A 2J4GA 3EVYA 4UR9A 4AKRB 5AQOB 3WAKA 5F5WA 2WAUA 1IZNB 3PUYF 3RIUC 2MYSA 4ANJA 4DV6T 3AE1A 5FYMA 2YDSA 2WMOA 4CXYA 5HYAA 4TWFA 4IE5A 2C5JA 3RIFA 4ILUA 3OPCA 5HEJA 4PNIA 3RYHE 2RPAA 1XMOT 4G2AA 2XQ8A 5ADXL 1UK5A 4CXXA 4DR1T 1W0BA 5LHGB 1LVFA 3RGLA 3BK9A 3P4RA 4KMCA 5AQLB 3MA9A 2CBIA 2BG9E 4GKKT 1BR1A 3PV0F 2CBJA 3EUHA 5AQVB 1KK7A 2WM9A 2XASB 4HFCA 2H89A 1FJGT 2B76A 3C98B 5LHHB 3ANWB 4IL9A 3ZMTB 3H3AA 5LG3A 3SS1A 2N9DA 2XZEA 2J1DG 3O9XA 4DUZT 5JDFA 2GK9A 2I59A 3I0QA 3ZC1A 4H63H 3KINB 4LMKA 1UGOA 4PJLA 2UUBT 5IHYA 4KBMB 2N2NA 4IDOA 1AJ3A 1DU2A 5HWYA 4DV2T 3P4PA 2BG9A 2JQHA 3FBZA 2BZBA 3RHWA 4DV7T 1X79A 2W4XA 4UXNB 3IHRA 1UURA 2QGSA 4UF0B 5GONE 5KX5E 2V7IA 1WYCA 1HX1B 3ZT6A 4JBWF 2JPFA 1MMDA 2BS2A 2NW7A 2WDVA 3NZQA 5JREA 3I9YA 2V5DA 5JDGA 4YSYA 4J2CA 3HA4A 4LF9T 2LT3A 5LMUT 4YSXA 2MAWA 2YDRA 3ZN0B 4EZ4A 3AXJB 4X1YE 2BS3A 2UUCT 4NXNT 2A72A 4YTNA 2AE9A 3PURA 3ONXA 4BA9A 5JDQA 4DR3T 3CQXC 2LRLA 2Q9QC 5F3JA 4ZI7E 4TX5A 4JI8T 5L4EA 2A2FX 1XZYA 4ASKA 3FXDB 2BKPA 2IUBA 3ZT5A 4YTPA 1ZKEA 1UCUA 4U7IA 4EEBA 3G06A 5CJ5A 1D1CA 5C8YE 3J7Yq 5HXSA 2DWKA 3BQKA 4JI4T 4PJJA 5F8PA 2J62A 3ZSSA 1NWMX 2LOPA 2V7MA 3KDSE 4JI0T 2HH7A 2LEHA 1MMAA 3JAFA 2LE8A 3M65A 3AECA 4XBFB 3B5MA 2CRBA 1MIVA 1O3XA 3RQUA 3QNUA 4ZZCA 5CA1E 4ZXLA 4B3ST 3PUZF 2LSGA 4UEMA 4EXTA 4IDQA 3Q9DA 3I0OA 4JYAT 2XAQB 3L39A 2H7OA 3N9NA 2IC9A 1V9DA 3KV9A 3PTRB 2LM2A 1HNWT 4EIWA 2KNDA 2N1GA 2HPLA 4GK5E 2SPCA 5FXWA 5DJQC 4GKJT 4JEHB 4TWHA 5FVKA 4KI0F 1IBLT 1IBMT 3P4QA 4QH1A 1S94A 1WR0A 3CQGB 5L3EB 4ISTA 5EZYE 3CWZB 4TWDA 3K3NA 3AE5A 5A1LA 3A5XA 3MK7C 3VHLA 2KMFA 5HAXA 5JDNA 3MACA 4QWNB 3VRAA 4B3MT 2IMLA 5JQGE 5LA6E 1HR0T 2WB5A 4CZZB 4DR6T 3LK2B 3CIRA 4DO0A 2OLTA 3T1HT 4IDNA 4IDZA 2EHOA 3RIAA 2D2SA 2JQKA 2IHR1 4Q25A 2CPTA 3RC8A 3WI3A 2JJ9A 3QB5K 5LJMA 3LDQB 4GYSA 5ABFB 5LBMA 4CN1A 4HEAA 3RPUA 1VCTA 4DV0T 4U2ZA 3C51A 3CX7B 1W0AA 3JAEA 3RC3A 3PUXF 4LMJA 1FEWA 4AISA 5DQVA 3CK6A 2A3DA 1KNZA 1T72A 2OV9A 5AQSB 2CLYC 3PUQA 5HEHA 2XJ7A 2BS4A 2HN1A 5AQQB 2YN6A 4N78D 3NBXX 2X9XA 1IJ5A 4DUYT 4EB6E 2JMHA 4ILCA 4ILBA 3FXEB 2A9UA 3AAAB 3C64A 4AIUA 3I1AA 3N9OA 3ANWA 5L3CB 3MJXA 3A8YC 1FMVA 3A7MA 2KLQA 5JR9C 3ESLA 2FBWA 4IE4A 2WU2A 4YHHT 4QXCB 4PK4A 2NW8A 5J2TE 2UXNB 5KMGP 4FI5A 5ABEA 2WMNA 5L2LA 3DTOA 3N2OA 3UUXB 4QH5A 5LMNT 3TLWA 2DNXA 3N2GE 2PTFA 2M67A 2XQYA 1WYBA 3UUBA 3O1HA 4O4IE 2CXFA 3KV5A 4KP3C 2BDEA 3PJAJ 3N9PA 3CX6B 4H9RC 2W62A 3R6NA 1SHZC 3K3QC 4KHZF 2JIWA 1HX8A 3AEFA 4AI6A 4YY3T 1US7B 3RKGA 4LF8T 5LYJE 4U3CA 4HGAA 4AQFA 2MOZA 4QX8B 1YKEB 2CE7A 3OKQA 3UU4A 1KFYA 2D0TA 2BVMA 5L3BB 3KVBA 2HHHT 2D5UA 4U74A 2W2UA 4PJNA 2F4VT 4EYUA 2E9XB 4JI6T 2CXDA 4COFA 2EHOB 4IE7A 4LF6T 3UFEA 2W63A 4U72A 1G8XA 2FJAA 2JMKA 2YU2A 2IIUA 3OJAA 3P50A 4CI1B 2J47A 2JQQA 4WBNE 5J0ZA 4IT4A 4CXWA 1WCRA 3U3IA 4HFBA 4OHFA 2X9YA 3TLTA 2W0GA 3AVRA 1CUNA 1HG2A 1XDPA 4Z8XA 3V5UA 4ISSA 4NXMT 2VB6A 4QX7B 4ZS2A 4U2YA 2X0HA 1OEDA 4X1KE 3Q5DA 2XQ9A 4JI2T 5JDMA 3C4WA 4O2BE 2QA7A 2VWAA 5AQJB 1VOMA 3NRYA 3T8OA 2YKSA 2UXXB 3B57A 3ZYMA 4HFHA 4Z91A 4X66T 3VR8A 5HXRA 2NWBA 4DBQA 4ZZBA 3P8CD 1MNDA 4EAHA 3OYXA 5IWAT 2ZMAA 2V6YA 1HF8A 2VKOA 2C5IT 3D0TA 2IDOB 2XHEB 5LNKA 2FJBA 2WS3A 4X65T 2KXPB 3Q5WA 4B3RT 5FMNA 5L3DB 4HE8A 4IREA 1KNRA 2WZIA 3LBXB 3P4SA 2WSSV 4JI1T 3CQCB 2Z6EA 4U31A 3FZKB 1R8IA 4KHPT 5HXHA 4ZOLE 4ZHQE 2XQ7A 3RYCE 5ABFA 5AQPB 3UU8A 5J1GA 1HFAA 3TLUA 2WP9A 3OYZA 2UU9T 3KBTA 4JV5T 2VVSA 5AFUL 3S4UA 1T8BA 3N9MA 2CXLA 1YQ3A 2XTLA 4HWIB 4GYRA 3PU3A 4OK0A 2CCQA 2WBLA 5L4HA 1UX4A 3AEGA 2ZM6T 2MBGA 2NW9A 3ETVA 2BBHA 3GA8A 4TUYE 2LHNA 4X62T 4K0UA 3PUSA 2WDQA 4X1IE 1WR6A 3AE7A 2BG9C 2YEVC 2V7JA 4LMLA 5EK2A 4YFSA 1WLXA 4U33A 4OX9T 3AVSA 2VKJA 3RYIE 3AEBA 3RQWA 2H3RA 2DI4A 2L3LA 3GN5A 3W15B 2CEAA 2E2AA 3PE0A 4O4HE 4B3TT 5HEUA 4CI2B 3IBPA 2CHNA 2ODVA 3RH3A 1CHUA 3ZC0A 2DL1A 3L8RA 1YKHB 2XQ4A 5LP6E 3AA1B 4I0UA 1J5WA 3CVRA 4V1Av 5FL0A 4HTEA 2NTYA 3EHZA 1E2AA 2X9WA 4HWDA 5IYZE 5BMVE 3Q2MA 3ZJ1A 4PFOA 4WNKA 2EHOD 5DABA 5AQTB 4TZ4C 1UUSA 3RLFF 5L3FB 1XWMA 2CWYA 3C4XA 2M6BA 3Q5EA 4HKAA 3LK3B 1OEDB 3DJBA 1JNZA 3J9X1 2XM2A 5HWXA 3ZYLA 4Z90A 4JI3T 2LRKA 4UIGA 4A56A 4FJOA 1L0VA 1HNXT 4M1PA 4O8SA 2DLRA 4UELA 4DV3T 2XQ3A 3UQ4A 1HS7A 4KUMB 3VU7H 3AEDA 4O2AE 4DIDB 4AKIA 1I6ZA 3KV4A 3FZHB 3JCFA 1YQ4A 2V6YB 2CWOA 3E0ZA 4PK6A 3LG7A 5FXVA 5EK4A 3ZT7A 4UVCB 4IGUA 4TV9E 4P1NA 5FNVE 4NPPA 2NR4A 5LBQB 3O1IA 2RA1A 3L3PA 1H7CA 5J2UE 2E9XA 5AQUB 4HFDA 1KF6A 3ZMUB 3GWHA 3AE8A 1BR4A 3FHNA 5LHIB 3CKDA 5H6QB 4C90A 2VK9A 4MBQA 5EK3A 2IW5B 1MNEA 1LKXA 3O1JA 3MXZA 2Q9QB 4ZI2D 3NRXA 3AEAA 2LJLA 4IIJE 4P09A 3QC9A 3EDVA 2CHOA 5HXCA 5LOVE 2XQ6A 1QLBA 4IE6A 3KFWX 3RI5A 2QYWA 4NUVA 3HR0A 2YOEA 2XUEA 3NZPA 3AA0B 1E1HB 4EGWA 1D1AA 3RRCA 3MZKB 4CN6A 1ZOYA 4TV8E 2XQAA 4X64T 2EHOC 2LOSA 4QXHB 2BVLA 4AXPA 3OTOT 3C50A 5H6RB 3ZMZB 4AQGA 1MMNA 3U78A 2WZHA 3ETUA 4IL4A 2KT9A 5FY0A 3ZMVB 3GN5B 5AQNB 2V26A 4LFCT 4HFEA 4YJ2E 4CQIA 4U7YA 4EZHA 1E7PA 1UX5A 2ZLYA 3QB5A 3CX8B 3K1SA 3IEEA 1HG5A 4A97A 3FZMB 2LSKA 2X9HA 4ZS3A 2WWUA 1N33T 3UT5E 2L8KA 5JRCB 4HWHA 3N2KE 4I50E 3PUVF 3LBXA 4HWCA 4L0RA 3N5LA 2L9QA 3F31A 2H88A 4ZI3D 4LF7T 4HWFA 4DMVA 3EI0A 5JTGA 3JADA 5AQHB 2LLYA 3GMIA 3K3OA 5C3JA 2BKNA 4QH4A 4KX6A 2PFVA 2X0YA 5FP3A 3LJCA 1D0ZA 4AKHA 4L5GA 2PBIA 5AQGB 3FB2A 2WQYA 3UU6A 3RIUA 4AKLA 4ZI2C 1S35A 2UUAT 4LF5T 5LGNB 4X5TA 5ABHA 2VQET 1D0YA 1SE7A 1HNZT 4HFIA 3F57A 3TKLB 2VURA 2XAFB 4WYVA 1OEDE 1GQEA 4P0AA 5CA0E 4CN4A 2CLYB 4E7SA 2FJDA 3ABVA 3ZEFB 5CGMA 1M62A 4P0BA 2JRKA 1Z8UA 4DV5T 2V6XA 4LF4T 1Y01A 5M4YA 2V1DB 3EABA 2M6IA 3UTKA 3M3ZB 3VRBA 4XZCA 3CPZA 4EV6A 3FZFB 4DBRA 4GIWA 3LFMA 4AQFC 2B1EA 1MMGA 4DV1T 1U4QA 2ZM2A 1WRDA 5JR9B 4UV9B 1XNRT 4UV8B 2UXDT 2Q9QD 2WDRA 3ZMSB 4O4JE 1SUMB 5E0OA 4H9QC 3ZYKA 2Y48B 3LSVA 5HCJA 4QHOA 2XPKA 2V7LA 3UFGA 3AE2A 4ZEYA 1EZ3A 2XY8B 4ZI3C 5CFBA 3EAMA 1KEYA 2KWHA 1XMQT 4JUYA 3KV6A 3ZLIA 5KXJA 2DHRA 3QUJA 4H9SE 2V8SV 3SWHA 3PJAA 2VL8A 4MHCA 5LXTE 3EDUA 3UULA 1OXZA 1OEDC 2R6GF 3UQ7A 1YXRA 2DCFA 3ZCIA 4JI5T 2P9BA 1BR2A 2LSYA 4HFVA 3VKHA 2Y8DA 4E7ZA 4TN7B 3AE9A 1N36T 4H9OC 1T7SA 1NEKA 5CB4E 5TAOA 3PU8A 1ZP0A 2Q9QA 4LFAT 4TNVA 3UU5A 2IAKA 1X9BA 5IUXA 1YD8G 3ZJ2A 3IF8B 1U5PA 3E08A 2ES0A 2WY2A 1JNRA 4O4LE 2ZM0A 2VKHA 2UXBT 5ABGA 2Y6XA 3QOFA 3JC6D 3NVOA 4IHJE 4DV4T 3HI2A 3VKGA 2VL0A 5FL1A 3X1DA 3O4XE 4IE0A 2YINA 3CMLA 2IC6A 2W61A 4BJNA 1T98A 5L47A 2KZ7B 3H37A 3TLSA 3N9LA 4G63A 5FY1A 1WFDA 3ZPOA 2XAJB 3ONJA 4JI7T 1MIYA 2X66A 3NKZA 4XAXB 4IDPA 2ZM8A 2BKOA 4JEUB 3RKOA 4DR7T 2OA5A 2I0MA 4DVDA 2E5LT 4WBOA 4YLHA 2WU5A 3PUWF 1HTJF 2ACZA 3IA3A 3UUNA 2E9XD 3KBUA 4YT0A 5JH7E 5AQRB 5JRCA 3L09A 2K48A 3HKCE 1J5ET 2ACXA 3P7IA 2VQFT 4GOUA 4WZXA 2C0SA 4B6XA 4TNWA 2NTXA 1SA0E 4BJMA 5AQKB 2K9AA 3E22E 4H9PC 4DR2T 3HKEE 2C5KT 2QVAA 4OFZA 2RP4A 2VVNA 4H9NC 2XQ5A 5LJNA 4MLKA 2MTQA 3OBVE 4C91A 3H3MA 4WW0A 2WCAA 3B13A 3QK6A 5ETWA 4EOZB 2CA5A 2G0UA 1KNPA 3AAEB 3VR9A 1MIWA 1D0XA 4NUUA 2W66A 3UUMA 2XSAA 2DWGA 2KWIB 3ZSTA 4ADZA 4F8HA 4GK0E 4A98A 3DP7A 4LFBT 4BAYB 1G73A 4JLEA 4HN9A 4CI3B 3KVAA 3RYFE 4DR4T 2LSIA 3PUAA 2K3WA 3AAIA 2I6HA 3JC6C 2K24A 2D9DA 3HKDE 3RRWA 1FMWA 2WWVA 5JVDE 1ZHCA 2H7VC 1FIOA 3OVUA 2V5CA 2BG9B 2X68A 3AA7B 4I55E 3HKBE 3K8PC 3AE3A 4DMWA 2LSJA 1N34T 4DNDA 1VRBA 2YU1A 2BBJA 5AQMB 3HL6A 4DR5T 3RX6A 4I4TE 2AXDS 2PG8A 2LKGA 1Y64B 4PW8A 5JR9A 4AQYT 4UVAB 4ILAA 1XNQT 5LB7B 2KSRA 2E8IA 2VASA 2CM0A 1HCIA 2XM1A 4MFRA 3FZLB 5HXEA 2E9XC 3R84B 3SOLA 5HCMA 3ZN1B 3Q5XA 2XAGB 3F2EA 3PDYA 5FXXA 2LKHA 1IAPA 5HEOA 3BQIA 1IBKT 1NAFA 1VCSA 1W9RA 2FUPA 2X0LB 2X67A 4YXDA 3AA6B 5DQWA 4YHJA 5FKYA 1BR0A 2D0UA 1XDOA 2W00A 2PJQA 1NENA 5FXZA 5LGTB 1J1JA 2LM9A 2HPJA 5JDLA 3MKDA 4QKNA 3SFEA 3N9QA 2K5BB 5C2TA 1OWAA 2X51A 4QXBB 2HN2A 1D1BA 5FY7A 1W09A 3BQLA 4NIQA 4EYYR 1QSDA 2NP9A 2MPKA 3P4WA 3PUGA 3TLVA 1IJ6A 2XSBA 2E5VA 4YJ3E 3AE4A 5BR8T 4F6RC 3AE6A 4OYKA 3ZKRA 4L9IA 3ONLC 1N32T 2VKDA 2ODUA 5LG4A 3I9WA 5JDHA 4AKGA 1LVKA 4YSZA 5AQFB 4ERRA 3ZCJA 4H63V 4UVBB 5AQIB 4X20E 1ZEEA 4A5XA 2KINB 3NWIA 4PAGA 4I43B 1Z0PA 3SRZA 2NOXA 4EEDA 1QUUA
chains in the Genus database with same CATH topology
4ZI3C 3V5SA 4CI2B 3LK42 3IBPA 2JJ9A 2ODVA 3RH3A 4UF0A 5LJMA 4PK5A 3ZC0A 4GYSA 1YKHB 3AB3B 4MALA 1LRZA 5LP6E 2KWHA 3AA1B 5LBMA 3CVRA 4HEAA 3RPUA 5LGUB 4V1Av 4HTEA 4PFPA 2NTYA 5LCYA 4JUYA 2LHRA 3C51A 3CX7B 2X9WA 5IYZE 2V7KA 3KV6A 3ZLIA 5BMVE 2XAHB 3RC3A 3Q2MA 3WAJA 1FEWA 3C4ZA 3ZJ1A 5DQVA 2DHRA 3QUJA 4H9SE 2A3DA 2CMRA 4PFOA 4WNKA 1KNZA 2EHOD 3SWHA 2CLYC 1ZV4X 3PUQA 3FBLA 5DABA 4TZ4C 2VL8A 4MHCA 5LXTE 3EDUA 5L3FB 3UULA 1OXZA 2CWYA 3C4XA 4HKAA 3LK3B 2DCFA 3ZCIA 2P9BA 1BR2A 2LSYA 4HFVA 3VKHA 2Y8DA 5L3GB 4N78D 3NBXX 4E7ZA 2X9XA 3DJBA 4TN7B 1IJ5A 1B7TA 4H9OC 1YW0A 4EB6E 3J9X1 5HWXA 5CB4E 2JMHA 3ZYLA 4OYJA 4PJMA 5TAOA 5KDMC 2YK0A 3PU8A 3FXEB 2Q9QA 3AAAB 3EVYA 4AKRB 4UIGA 3C64A 4A56A 4FJOA 4M1PA 3I1AA 3N9OA 4O8SA 3ANWA 2DLRA 3WAKA 5L3CB 2IAKA 2WAUA 4UELA 1YD8G 1HS7A 4KUMB 3VU7H 3ZJ2A 1IZNB 3IF8B 3MJXA 4O2AE 1U5PA 3E08A 4AKIA 3KV4A 2MYSA 1FMVA 4ANJA 2ES0A 2KLQA 2CWOA 3E0ZA 4PK6A 3LG7A 5JR9C 5FYMA 4O4LE 3ESLA 2ZM0A 5FXVA 2WMOA 2VKHA 4CXYA 5HYAA 5EK4A 4UVCB 4IE5A 2C5JA 4IE4A 4IGUA 4ILUA 2Y6XA 4TV9E 3JC6D 4PNIA 3RYHE 4IHJE 5FNVE 4QXCB 4PK4A 2NW8A 5J2TE 2UXNB 5KMGP 4FI5A 4G2AA 3HI2A 5LBQB 2WMNA 5L2LA 3VKGA 5ADXL 3O1IA 2RA1A 3L3PA 3O4XE 3DTOA 4IE0A 4CXXA 1H7CA 3N2OA 5J2UE 2E9XA 3UUXB 2YINA 3CMLA 3ZMUB 3GWHA 2IC6A 2W61A 4BJNA 1LVFA 1T98A 5LHGB 2DNXA 2KZ7B 3BK9A 3H37A 3N9LA 4KMCA 4G63A 5FY1A 1BR4A 3N2GE 3FHNA 3MA9A 5LHIB 3CKDA 3ZPOA 2XAJB 5H6QB 2M67A 2XQYA 1BR1A 1MIYA 1WYBA 2X66A 3O1HA 4MBQA 2VK9A 4O4IE 2CXFA 3EUHA 4XAXB 4C90A 5EK3A 3KV5A 2ZM8A 2IW5B 1MNEA 2BDEA 1LKXA 1KK7A 2WM9A 3MXZA 3O1JA 4KP3C 2XASB 2Q9QB 3RKOA 4JEUB 4ZI2D 3NRXA 2LJLA 4IIJE 2OA5A 4P09A 3QC9A 3C98B 3CX6B 3N9PA 4DVDA 5LHHB 3EDVA 3ANWB 4H9RC 2W62A 3R6NA 5HXCA 1SHZC 3K3QC 4WBOA 3ZMTB 3H3AA 5LOVE 1HX8A 4YLHA 4AI6A 1HTJF 1US7B 3UUNA 2E9XD 3SS1A 4IE6A 2N9DA 3KBUA 5JH7E 5LYJE 3KFWX 2J1DG 3O9XA 5JDFA 2GK9A 4HGAA 2I59A 5JRCA 3I0QA 3L09A 4H63H 2K48A 3ZC1A 4NUVA 3HKCE 4AQFA 2MOZA 4QX8B 3KINB 3HR0A 2ACXA 1YKEB 2CE7A 2XUEA 3OKQA 3P7IA 3NZPA 4GOUA 2D0TA 2BVMA 4PJLA 3AA0B 1E1HB 1D1AA 3RRCA 3KVBA 5L3BB 3MZKB 2C0SA 2D5UA 5IHYA 4B6XA 4TV8E 4U74A 2NTXA 4KBMB 2N2NA 2EHOC 2LOSA 1SA0E 4QXHB 1AJ3A 4PJNA 4BJMA 2BVLA 4EYUA 2K9AA 3E22E 4H9PC 2E9XB 3HKEE 5HWYA 2C5KT 2CXDA 4AXPA 2EHOB 3C50A 4IE7A 4OFZA 2RP4A 3FBZA 5H6RB 3ZMZB 3UFEA 2BZBA 4AQGA 2W63A 1MMNA 4H9NC 3U78A 4U72A 1G8XA 1X79A 3ETUA 2KT9A 4UXNB 5FY0A 3ZMVB 3IHRA 3GN5B 5LJNA 2JMKA 2V26A 4MLKA 2MTQA 3OBVE 4C91A 4WW0A 2YU2A 4YJ2E 4CQIA 3OJAA 4EZHA 3B13A 1UX5A 3QK6A 5ETWA 4EOZB 2CA5A 2QGSA 4UF0B 5GONE 5KX5E 2V7IA 2G0UA 1WYCA 2ZLYA 4CI1B 3AAEB 1MIWA 2JPFA 1D0XA 1MMDA 2JQQA 3CX8B 4WBNE 4NUUA 4CXWA 2NW7A 3IEEA 3NZQA 3U3IA 3UUMA 5JREA 1HG5A 2DWGA 2KWIB 3I9YA 2LSKA 4OHFA 5JDGA 4ADZA 2X9YA 4GK0E 2X9HA 4ZS3A 4J2CA 3DP7A 2W0GA 3AVRA 3HA4A 2WWUA 2LT3A 4BAYB 3UT5E 2L8KA 1G73A 1CUNA 3ZN0B 1HG2A 4EZ4A 5JRCB 4JLEA 4HN9A 4X1YE 4CI3B 3N2KE 4Z8XA 4I50E 3KVAA 3RYFE 3V5UA 4ISSA 3LBXA 2VB6A 4QX7B 4ZS2A 2LSIA 4L0RA 2A72A 3N5LA 3AAIA 3PUAA 4X1KE 2L9QA 3JC6C 2K24A 3F31A 3PURA 3HKDE 3ONXA 3RRWA 4BA9A 5JDQA 3CQXC 5JDMA 2Q9QC 3C4WA 4ZI3D 5F3JA 4O2BE 4ZI7E 1FMWA 2QA7A 4TX5A 2VWAA 4DMVA 2A2FX 4ASKA 5JVDE 1VOMA 3NRYA 1ZHCA 2H7VC 1FIOA 3FXDB 3T8OA 1ZKEA 1UCUA 3GMIA 3K3OA 2X68A 1D1CA 2PFVA 2UXXB 3AA7B 5C8YE 3B57A 4I55E 3J7Yq 3ZYMA 5HXSA 2DWKA 5FP3A 3BQKA 3HKBE 3LJCA 1D0ZA 4PJJA 5HXRA 3K8PC 5F8PA 2NWBA 4DMWA 2LSJA 4DBQA 3P8CD 1MNDA 4DNDA 4EAHA 4AKHA 1NWMX 1VRBA 2LOPA 2PBIA 3FB2A 3OYXA 4L5GA 2YU1A 2V7MA 3KDSE 2ZMAA 2HH7A 3HL6A 2LEHA 1HF8A 1MMAA 2VKOA 4AKLA 4ZI2C 2LE8A 3M65A 4I4TE 2C5IT 3RX6A 3D0TA 2PG8A 1S35A 1Y64B 4XBFB 4PW8A 5JR9A 4UVAB 5LGNB 2XHEB 2E8IA 2VASA 5LNKA 2CM0A 1D0YA 1MIVA 1HCIA 4MFRA 1O3XA 5HXEA 3F57A 3TKLB 2E9XC 3R84B 3SOLA 2KXPB 2XAFB 3ZN1B 3Q5XA 5CA1E 3Q5WA 4P0AA 5FMNA 2XAGB 3F2EA 3PDYA 5FXXA 5L3DB 2LSGA 5CA0E 4HE8A 1IAPA 4UEMA 2CLYB 4E7SA 3BQIA 3LBXB 4EXTA 3ZEFB 3Q9DA 3I0OA 4P0BA 2XAQB 2WSSV 1NAFA 2H7OA 2JRKA 3N9NA 2IC9A 1V9DA 3CQCB 3KV9A 3PTRB 2X0LB 2X67A 2Z6EA 5HXHA 3AA6B 5DQWA 4EIWA 4ZOLE 4YHJA 4ZHQE 2KNDA 1BR0A 2D0UA 2N1GA 2W00A 3RYCE 2HPLA 2PJQA 5M4YA 2V1DB 4GK5E 2SPCA 5FXWA 5DJQC 4JEHB 3UTKA 5J1GA 5FXZA 5LGTB 1HFAA 1S94A 2LM9A 2HPJA 3CQGB 4XZCA 3OYZA 5JDLA 5L3EB 3CPZA 3KBTA 3MKDA 4ISTA 4QKNA 5EZYE 3CWZB 3N9QA 2K5BB 5AFUL 1OWAA 2X51A 4DBRA 4GIWA 3K3NA 4QXBB 3S4UA 3N9MA 1D1BA 3LFMA 4AQFC 5FY7A 2CXLA 3BQLA 2B1EA 2XTLA 4EYYR 1QSDA 1MMGA 5A1LA 2NP9A 4GYRA 3A5XA 3PUGA 3PU3A 4OK0A 2CCQA 1U4QA 2WBLA 1IJ6A 2ZM2A 1UX4A 3MK7C 3VHLA 4YJ3E 1WRDA 5JR9B 2KMFA 2MBGA 4UV9B 2NW9A 3ETVA 4UV8B 5HAXA 3GA8A 4TUYE 4F6RC 5JDNA 2LHNA 3MACA 4QWNB 2Q9QD 4OYKA 5JQGE 5LA6E 3ZMSB 4K0UA 4L9IA 4O4JE 4CZZB 2VKDA 3PUSA 4X1IE 5E0OA 2ODUA 1WR6A 4H9QC 5LG4A 3I9WA 3ZYKA 2YEVC 2V7JA 3LK2B 2Y48B 4DO0A 5JDHA 4AKGA 5EK2A 4YFSA 1WLXA 1LVKA 3AVSA 4IDZA 2EHOA 4ERRA 2D2SA 3ZCJA 2VKJA 4H63V 4UVBB 3RYIE 4QHOA 4X20E 1ZEEA 2H3RA 2DI4A 2KINB 2L3LA 2V7LA 4PAGA 3GN5A 3W15B 4I43B 1Z0PA 2CEAA 3SRZA 2NOXA 3RC8A 3PE0A 4O4HE 1EZ3A 1QUUA 3WI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE8 A;  2KLQ A; 
#chains in the Genus database with same CATH topology
 4YTM A;  3V5S A;  3LK4 2;  4UF0 A;  4PK5 A;  2UXC T;  3AB3 B;  4MAL A;  1LRZ A;  2YDQ A;  3AEE A;  1M7K A;  5LGU B;  4PFP A;  5LCY A;  3SFD A;  3UU3 A;  2LHR A;  2V7K A;  3T1Y T;  4K0K T;  2XAH B;  3WAJ A;  3C4Z A;  1I94 T;  5HEG A;  2CMR A;  2JQ9 A;  1ZV4 X;  3FBL A;  3AXJ A;  2FJE A;  2QRX A;  2W67 A;  5L3G B;  1B7T A;  5FVL A;  1YW0 A;  3RF1 A;  4OYJ A;  4PJM A;  5KDM C;  2YK0 A;  2J4G A;  3EVY A;  4UR9 A;  4AKR B;  5AQO B;  3WAK A;  5F5W A;  2WAU A;  1IZN B;  3PUY F;  3RIU C;  2MYS A;  4ANJ A;  4DV6 T;  3AE1 A;  5FYM A;  2YDS A;  2WMO A;  4CXY A;  5HYA A;  4TWF A;  4IE5 A;  2C5J A;  3RIF A;  4ILU A;  3OPC A;  5HEJ A;  4PNI A;  3RYH E;  2RPA A;  1XMO T;  4G2A A;  2XQ8 A;  5ADX L;  1UK5 A;  4CXX A;  4DR1 T;  1W0B A;  5LHG B;  1LVF A;  3RGL A;  3BK9 A;  3P4R A;  4KMC A;  5AQL B;  3MA9 A;  2CBI A;  2BG9 E;  4GKK T;  1BR1 A;  3PV0 F;  2CBJ A;  3EUH A;  5AQV B;  1KK7 A;  2WM9 A;  2XAS B;  4HFC A;  2H89 A;  1FJG T;  2B76 A;  3C98 B;  5LHH B;  3ANW B;  4IL9 A;  3ZMT B;  3H3A A;  5LG3 A;  3SS1 A;  2N9D A;  2XZE A;  2J1D G;  3O9X A;  4DUZ T;  5JDF A;  2GK9 A;  2I59 A;  3I0Q A;  3ZC1 A;  4H63 H;  3KIN B;  4LMK A;  1UGO A;  4PJL A;  2UUB T;  5IHY A;  4KBM B;  2N2N A;  4IDO A;  1AJ3 A;  1DU2 A;  5HWY A;  4DV2 T;  3P4P A;  2BG9 A;  2JQH A;  3FBZ A;  2BZB A;  3RHW A;  4DV7 T;  1X79 A;  2W4X A;  4UXN B;  3IHR A;  1UUR A;  2QGS A;  4UF0 B;  5GON E;  5KX5 E;  2V7I A;  1WYC A;  1HX1 B;  3ZT6 A;  4JBW F;  2JPF A;  1MMD A;  2BS2 A;  2NW7 A;  2WDV A;  3NZQ A;  5JRE A;  3I9Y A;  2V5D A;  5JDG A;  4YSY A;  4J2C A;  3HA4 A;  4LF9 T;  2LT3 A;  5LMU T;  4YSX A;  2MAW A;  2YDR A;  3ZN0 B;  4EZ4 A;  3AXJ B;  4X1Y E;  2BS3 A;  2UUC T;  4NXN T;  2A72 A;  4YTN A;  2AE9 A;  3PUR A;  3ONX A;  4BA9 A;  5JDQ A;  4DR3 T;  3CQX C;  2LRL A;  2Q9Q C;  5F3J A;  4ZI7 E;  4TX5 A;  4JI8 T;  5L4E A;  2A2F X;  1XZY A;  4ASK A;  3FXD B;  2BKP A;  2IUB A;  3ZT5 A;  4YTP A;  1ZKE A;  1UCU A;  4U7I A;  4EEB A;  3G06 A;  5CJ5 A;  1D1C A;  5C8Y E;  3J7Y q;  5HXS A;  2DWK A;  3BQK A;  4JI4 T;  4PJJ A;  5F8P A;  2J62 A;  3ZSS A;  1NWM X;  2LOP A;  2V7M A;  3KDS E;  4JI0 T;  2HH7 A;  2LEH A;  1MMA A;  3JAF A;  2LE8 A;  3M65 A;  3AEC A;  4XBF B;  3B5M A;  2CRB A;  1MIV A;  1O3X A;  3RQU A;  3QNU A;  4ZZC A;  5CA1 E;  4ZXL A;  4B3S T;  3PUZ F;  2LSG A;  4UEM A;  4EXT A;  4IDQ A;  3Q9D A;  3I0O A;  4JYA T;  2XAQ B;  3L39 A;  2H7O A;  3N9N A;  2IC9 A;  1V9D A;  3KV9 A;  3PTR B;  2LM2 A;  1HNW T;  4EIW A;  2KND A;  2N1G A;  2HPL A;  4GK5 E;  2SPC A;  5FXW A;  5DJQ C;  4GKJ T;  4JEH B;  4TWH A;  5FVK A;  4KI0 F;  1IBL T;  1IBM T;  3P4Q A;  4QH1 A;  1S94 A;  1WR0 A;  3CQG B;  5L3E B;  4IST A;  5EZY E;  3CWZ B;  4TWD A;  3K3N A;  3AE5 A;  5A1L A;  3A5X A;  3MK7 C;  3VHL A;  2KMF A;  5HAX A;  5JDN A;  3MAC A;  4QWN B;  3VRA A;  4B3M T;  2IML A;  5JQG E;  5LA6 E;  1HR0 T;  2WB5 A;  4CZZ B;  4DR6 T;  3LK2 B;  3CIR A;  4DO0 A;  2OLT A;  3T1H T;  4IDN A;  4IDZ A;  2EHO A;  3RIA A;  2D2S A;  2JQK A;  2IHR 1;  4Q25 A;  2CPT A;  3RC8 A;  3WI3 A;  2JJ9 A;  3QB5 K;  5LJM A;  3LDQ B;  4GYS A;  5ABF B;  5LBM A;  4CN1 A;  4HEA A;  3RPU A;  1VCT A;  4DV0 T;  4U2Z A;  3C51 A;  3CX7 B;  1W0A A;  3JAE A;  3RC3 A;  3PUX F;  4LMJ A;  1FEW A;  4AIS A;  5DQV A;  3CK6 A;  2A3D A;  1KNZ A;  1T72 A;  2OV9 A;  5AQS B;  2CLY C;  3PUQ A;  5HEH A;  2XJ7 A;  2BS4 A;  2HN1 A;  5AQQ B;  2YN6 A;  4N78 D;  3NBX X;  2X9X A;  1IJ5 A;  4DUY T;  4EB6 E;  2JMH A;  4ILC A;  4ILB A;  3FXE B;  2A9U A;  3AAA B;  3C64 A;  4AIU A;  3I1A A;  3N9O A;  3ANW A;  5L3C B;  3MJX A;  3A8Y C;  1FMV A;  3A7M A;  2KLQ A;  5JR9 C;  3ESL A;  2FBW A;  4IE4 A;  2WU2 A;  4YHH T;  4QXC B;  4PK4 A;  2NW8 A;  5J2T E;  2UXN B;  5KMG P;  4FI5 A;  5ABE A;  2WMN A;  5L2L A;  3DTO A;  3N2O A;  3UUX B;  4QH5 A;  5LMN T;  3TLW A;  2DNX A;  3N2G E;  2PTF A;  2M67 A;  2XQY A;  1WYB A;  3UUB A;  3O1H A;  4O4I E;  2CXF A;  3KV5 A;  4KP3 C;  2BDE A;  3PJA J;  3N9P A;  3CX6 B;  4H9R C;  2W62 A;  3R6N A;  1SHZ C;  3K3Q C;  4KHZ F;  2JIW A;  1HX8 A;  3AEF A;  4AI6 A;  4YY3 T;  1US7 B;  3RKG A;  4LF8 T;  5LYJ E;  4U3C A;  4HGA A;  4AQF A;  2MOZ A;  4QX8 B;  1YKE B;  2CE7 A;  3OKQ A;  3UU4 A;  1KFY A;  2D0T A;  2BVM A;  5L3B B;  3KVB A;  2HHH T;  2D5U A;  4U74 A;  2W2U A;  4PJN A;  2F4V T;  4EYU A;  2E9X B;  4JI6 T;  2CXD A;  4COF A;  2EHO B;  4IE7 A;  4LF6 T;  3UFE A;  2W63 A;  4U72 A;  1G8X A;  2FJA A;  2JMK A;  2YU2 A;  2IIU A;  3OJA A;  3P50 A;  4CI1 B;  2J47 A;  2JQQ A;  4WBN E;  5J0Z A;  4IT4 A;  4CXW A;  1WCR A;  3U3I A;  4HFB A;  4OHF A;  2X9Y A;  3TLT A;  2W0G A;  3AVR A;  1CUN A;  1HG2 A;  1XDP A;  4Z8X A;  3V5U A;  4ISS A;  4NXM T;  2VB6 A;  4QX7 B;  4ZS2 A;  4U2Y A;  2X0H A;  1OED A;  4X1K E;  3Q5D A;  2XQ9 A;  4JI2 T;  5JDM A;  3C4W A;  4O2B E;  2QA7 A;  2VWA A;  5AQJ B;  1VOM A;  3NRY A;  3T8O A;  2YKS A;  2UXX B;  3B57 A;  3ZYM A;  4HFH A;  4Z91 A;  4X66 T;  3VR8 A;  5HXR A;  2NWB A;  4DBQ A;  4ZZB A;  3P8C D;  1MND A;  4EAH A;  3OYX A;  5IWA T;  2ZMA A;  2V6Y A;  1HF8 A;  2VKO A;  2C5I T;  3D0T A;  2IDO B;  2XHE B;  5LNK A;  2FJB A;  2WS3 A;  4X65 T;  2KXP B;  3Q5W A;  4B3R T;  5FMN A;  5L3D B;  4HE8 A;  4IRE A;  1KNR A;  2WZI A;  3LBX B;  3P4S A;  2WSS V;  4JI1 T;  3CQC B;  2Z6E A;  4U31 A;  3FZK B;  1R8I A;  4KHP T;  5HXH A;  4ZOL E;  4ZHQ E;  2XQ7 A;  3RYC E;  5ABF A;  5AQP B;  3UU8 A;  5J1G A;  1HFA A;  3TLU A;  2WP9 A;  3OYZ A;  2UU9 T;  3KBT A;  4JV5 T;  2VVS A;  5AFU L;  3S4U A;  1T8B A;  3N9M A;  2CXL A;  1YQ3 A;  2XTL A;  4HWI B;  4GYR A;  3PU3 A;  4OK0 A;  2CCQ A;  2WBL A;  5L4H A;  1UX4 A;  3AEG A;  2ZM6 T;  2MBG A;  2NW9 A;  3ETV A;  2BBH A;  3GA8 A;  4TUY E;  2LHN A;  4X62 T;  4K0U A;  3PUS A;  2WDQ A;  4X1I E;  1WR6 A;  3AE7 A;  2BG9 C;  2YEV C;  2V7J A;  4LML A;  5EK2 A;  4YFS A;  1WLX A;  4U33 A;  4OX9 T;  3AVS A;  2VKJ A;  3RYI E;  3AEB A;  3RQW A;  2H3R A;  2DI4 A;  2L3L A;  3GN5 A;  3W15 B;  2CEA A;  2E2A A;  3PE0 A;  4O4H E;  4B3T T;  5HEU A;  4CI2 B;  3IBP A;  2CHN A;  2ODV A;  3RH3 A;  1CHU A;  3ZC0 A;  2DL1 A;  3L8R A;  1YKH B;  2XQ4 A;  5LP6 E;  3AA1 B;  4I0U A;  1J5W A;  3CVR A;  4V1A v;  5FL0 A;  4HTE A;  2NTY A;  3EHZ A;  1E2A A;  2X9W A;  4HWD A;  5IYZ E;  5BMV E;  3Q2M A;  3ZJ1 A;  4PFO A;  4WNK A;  2EHO D;  5DAB A;  5AQT B;  4TZ4 C;  1UUS A;  3RLF F;  5L3F B;  1XWM A;  2CWY A;  3C4X A;  2M6B A;  3Q5E A;  4HKA A;  3LK3 B;  1OED B;  3DJB A;  1JNZ A;  3J9X 1;  2XM2 A;  5HWX A;  3ZYL A;  4Z90 A;  4JI3 T;  2LRK A;  4UIG A;  4A56 A;  4FJO A;  1L0V A;  1HNX T;  4M1P A;  4O8S A;  2DLR A;  4UEL A;  4DV3 T;  2XQ3 A;  3UQ4 A;  1HS7 A;  4KUM B;  3VU7 H;  3AED A;  4O2A E;  4DID B;  4AKI A;  1I6Z A;  3KV4 A;  3FZH B;  3JCF A;  1YQ4 A;  2V6Y B;  2CWO A;  3E0Z A;  4PK6 A;  3LG7 A;  5FXV A;  5EK4 A;  3ZT7 A;  4UVC B;  4IGU A;  4TV9 E;  4P1N A;  5FNV E;  4NPP A;  2NR4 A;  5LBQ B;  3O1I A;  2RA1 A;  3L3P A;  1H7C A;  5J2U E;  2E9X A;  5AQU B;  4HFD A;  1KF6 A;  3ZMU B;  3GWH A;  3AE8 A;  1BR4 A;  3FHN A;  5LHI B;  3CKD A;  5H6Q B;  4C90 A;  2VK9 A;  4MBQ A;  5EK3 A;  2IW5 B;  1MNE A;  1LKX A;  3O1J A;  3MXZ A;  2Q9Q B;  4ZI2 D;  3NRX A;  3AEA A;  2LJL A;  4IIJ E;  4P09 A;  3QC9 A;  3EDV A;  2CHO A;  5HXC A;  5LOV E;  2XQ6 A;  1QLB A;  4IE6 A;  3KFW X;  3RI5 A;  2QYW A;  4NUV A;  3HR0 A;  2YOE A;  2XUE A;  3NZP A;  3AA0 B;  1E1H B;  4EGW A;  1D1A A;  3RRC A;  3MZK B;  4CN6 A;  1ZOY A;  4TV8 E;  2XQA A;  4X64 T;  2EHO C;  2LOS A;  4QXH B;  2BVL A;  4AXP A;  3OTO T;  3C50 A;  5H6R B;  3ZMZ B;  4AQG A;  1MMN A;  3U78 A;  2WZH A;  3ETU A;  4IL4 A;  2KT9 A;  5FY0 A;  3ZMV B;  3GN5 B;  5AQN B;  2V26 A;  4LFC T;  4HFE A;  4YJ2 E;  4CQI A;  4U7Y A;  4EZH A;  1E7P A;  1UX5 A;  2ZLY A;  3QB5 A;  3CX8 B;  3K1S A;  3IEE A;  1HG5 A;  4A97 A;  3FZM B;  2LSK A;  2X9H A;  4ZS3 A;  2WWU A;  1N33 T;  3UT5 E;  2L8K A;  5JRC B;  4HWH A;  3N2K E;  4I50 E;  3PUV F;  3LBX A;  4HWC A;  4L0R A;  3N5L A;  2L9Q A;  3F31 A;  2H88 A;  4ZI3 D;  4LF7 T;  4HWF A;  4DMV A;  3EI0 A;  5JTG A;  3JAD A;  5AQH B;  2LLY A;  3GMI A;  3K3O A;  5C3J A;  2BKN A;  4QH4 A;  4KX6 A;  2PFV A;  2X0Y A;  5FP3 A;  3LJC A;  1D0Z A;  4AKH A;  4L5G A;  2PBI A;  5AQG B;  3FB2 A;  2WQY A;  3UU6 A;  3RIU A;  4AKL A;  4ZI2 C;  1S35 A;  2UUA T;  4LF5 T;  5LGN B;  4X5T A;  5ABH A;  2VQE T;  1D0Y A;  1SE7 A;  1HNZ T;  4HFI A;  3F57 A;  3TKL B;  2VUR A;  2XAF B;  4WYV A;  1OED E;  1GQE A;  4P0A A;  5CA0 E;  4CN4 A;  2CLY B;  4E7S A;  2FJD A;  3ABV A;  3ZEF B;  5CGM A;  1M62 A;  4P0B A;  2JRK A;  1Z8U A;  4DV5 T;  2V6X A;  4LF4 T;  1Y01 A;  5M4Y A;  2V1D B;  3EAB A;  2M6I A;  3UTK A;  3M3Z B;  3VRB A;  4XZC A;  3CPZ A;  4EV6 A;  3FZF B;  4DBR A;  4GIW A;  3LFM A;  4AQF C;  2B1E A;  1MMG A;  4DV1 T;  1U4Q A;  2ZM2 A;  1WRD A;  5JR9 B;  4UV9 B;  1XNR T;  4UV8 B;  2UXD T;  2Q9Q D;  2WDR A;  3ZMS B;  4O4J E;  1SUM B;  5E0O A;  4H9Q C;  3ZYK A;  2Y48 B;  3LSV A;  5HCJ A;  4QHO A;  2XPK A;  2V7L A;  3UFG A;  3AE2 A;  4ZEY A;  1EZ3 A;  2XY8 B;  4ZI3 C;  5CFB A;  3EAM A;  1KEY A;  2KWH A;  1XMQ T;  4JUY A;  3KV6 A;  3ZLI A;  5KXJ A;  2DHR A;  3QUJ A;  4H9S E;  2V8S V;  3SWH A;  3PJA A;  2VL8 A;  4MHC A;  5LXT E;  3EDU A;  3UUL A;  1OXZ A;  1OED C;  2R6G F;  3UQ7 A;  1YXR A;  2DCF A;  3ZCI A;  4JI5 T;  2P9B A;  1BR2 A;  2LSY A;  4HFV A;  3VKH A;  2Y8D A;  4E7Z A;  4TN7 B;  3AE9 A;  1N36 T;  4H9O C;  1T7S A;  1NEK A;  5CB4 E;  5TAO A;  3PU8 A;  1ZP0 A;  2Q9Q A;  4LFA T;  4TNV A;  3UU5 A;  2IAK A;  1X9B A;  5IUX A;  1YD8 G;  3ZJ2 A;  3IF8 B;  1U5P A;  3E08 A;  2ES0 A;  2WY2 A;  1JNR A;  4O4L E;  2ZM0 A;  2VKH A;  2UXB T;  5ABG A;  2Y6X A;  3QOF A;  3JC6 D;  3NVO A;  4IHJ E;  4DV4 T;  3HI2 A;  3VKG A;  2VL0 A;  5FL1 A;  3X1D A;  3O4X E;  4IE0 A;  2YIN A;  3CML A;  2IC6 A;  2W61 A;  4BJN A;  1T98 A;  5L47 A;  2KZ7 B;  3H37 A;  3TLS A;  3N9L A;  4G63 A;  5FY1 A;  1WFD A;  3ZPO A;  2XAJ B;  3ONJ A;  4JI7 T;  1MIY A;  2X66 A;  3NKZ A;  4XAX B;  4IDP A;  2ZM8 A;  2BKO A;  4JEU B;  3RKO A;  4DR7 T;  2OA5 A;  2I0M A;  4DVD A;  2E5L T;  4WBO A;  4YLH A;  2WU5 A;  3PUW F;  1HTJ F;  2ACZ A;  3IA3 A;  3UUN A;  2E9X D;  3KBU A;  4YT0 A;  5JH7 E;  5AQR B;  5JRC A;  3L09 A;  2K48 A;  3HKC E;  1J5E T;  2ACX A;  3P7I A;  2VQF T;  4GOU A;  4WZX A;  2C0S A;  4B6X A;  4TNW A;  2NTX A;  1SA0 E;  4BJM A;  5AQK B;  2K9A A;  3E22 E;  4H9P C;  4DR2 T;  3HKE E;  2C5K T;  2QVA A;  4OFZ A;  2RP4 A;  2VVN A;  4H9N C;  2XQ5 A;  5LJN A;  4MLK A;  2MTQ A;  3OBV E;  4C91 A;  3H3M A;  4WW0 A;  2WCA A;  3B13 A;  3QK6 A;  5ETW A;  4EOZ B;  2CA5 A;  2G0U A;  1KNP A;  3AAE B;  3VR9 A;  1MIW A;  1D0X A;  4NUU A;  2W66 A;  3UUM A;  2XSA A;  2DWG A;  2KWI B;  3ZST A;  4ADZ A;  4F8H A;  4GK0 E;  4A98 A;  3DP7 A;  4LFB T;  4BAY B;  1G73 A;  4JLE A;  4HN9 A;  4CI3 B;  3KVA A;  3RYF E;  4DR4 T;  2LSI A;  3PUA A;  2K3W A;  3AAI A;  2I6H A;  3JC6 C;  2K24 A;  2D9D A;  3HKD E;  3RRW A;  1FMW A;  2WWV A;  5JVD E;  1ZHC A;  2H7V C;  1FIO A;  3OVU A;  2V5C A;  2BG9 B;  2X68 A;  3AA7 B;  4I55 E;  3HKB E;  3K8P C;  3AE3 A;  4DMW A;  2LSJ A;  1N34 T;  4DND A;  1VRB A;  2YU1 A;  2BBJ A;  5AQM B;  3HL6 A;  4DR5 T;  3RX6 A;  4I4T E;  2AXD S;  2PG8 A;  2LKG A;  1Y64 B;  4PW8 A;  5JR9 A;  4AQY T;  4UVA B;  4ILA A;  1XNQ T;  5LB7 B;  2KSR A;  2E8I A;  2VAS A;  2CM0 A;  1HCI A;  2XM1 A;  4MFR A;  3FZL B;  5HXE A;  2E9X C;  3R84 B;  3SOL A;  5HCM A;  3ZN1 B;  3Q5X A;  2XAG B;  3F2E A;  3PDY A;  5FXX A;  2LKH A;  1IAP A;  5HEO A;  3BQI A;  1IBK T;  1NAF A;  1VCS A;  1W9R A;  2FUP A;  2X0L B;  2X67 A;  4YXD A;  3AA6 B;  5DQW A;  4YHJ A;  5FKY A;  1BR0 A;  2D0U A;  1XDO A;  2W00 A;  2PJQ A;  1NEN A;  5FXZ A;  5LGT B;  1J1J A;  2LM9 A;  2HPJ A;  5JDL A;  3MKD A;  4QKN A;  3SFE A;  3N9Q A;  2K5B B;  5C2T A;  1OWA A;  2X51 A;  4QXB B;  2HN2 A;  1D1B A;  5FY7 A;  1W09 A;  3BQL A;  4NIQ A;  4EYY R;  1QSD A;  2NP9 A;  2MPK A;  3P4W A;  3PUG A;  3TLV A;  1IJ6 A;  2XSB A;  2E5V A;  4YJ3 E;  3AE4 A;  5BR8 T;  4F6R C;  3AE6 A;  4OYK A;  3ZKR A;  4L9I A;  3ONL C;  1N32 T;  2VKD A;  2ODU A;  5LG4 A;  3I9W A;  5JDH A;  4AKG A;  1LVK A;  4YSZ A;  5AQF B;  4ERR A;  3ZCJ A;  4H63 V;  4UVB B;  5AQI B;  4X20 E;  1ZEE A;  4A5X A;  2KIN B;  3NWI A;  4PAG A;  4I43 B;  1Z0P A;  3SRZ A;  2NOX A;  4EED A;  1QUU A; 
#chains in the Genus database with same CATH homology
 4ZI3 C;  3V5S A;  4CI2 B;  3LK4 2;  3IBP A;  2JJ9 A;  2ODV A;  3RH3 A;  4UF0 A;  5LJM A;  4PK5 A;  3ZC0 A;  4GYS A;  1YKH B;  3AB3 B;  4MAL A;  1LRZ A;  5LP6 E;  2KWH A;  3AA1 B;  5LBM A;  3CVR A;  4HEA A;  3RPU A;  5LGU B;  4V1A v;  4HTE A;  4PFP A;  2NTY A;  5LCY A;  4JUY A;  2LHR A;  3C51 A;  3CX7 B;  2X9W A;  5IYZ E;  2V7K A;  3KV6 A;  3ZLI A;  5BMV E;  2XAH B;  3RC3 A;  3Q2M A;  3WAJ A;  1FEW A;  3C4Z A;  3ZJ1 A;  5DQV A;  2DHR A;  3QUJ A;  4H9S E;  2A3D A;  2CMR A;  4PFO A;  4WNK A;  1KNZ A;  2EHO D;  3SWH A;  2CLY C;  1ZV4 X;  3PUQ A;  3FBL A;  5DAB A;  4TZ4 C;  2VL8 A;  4MHC A;  5LXT E;  3EDU A;  5L3F B;  3UUL A;  1OXZ A;  2CWY A;  3C4X A;  4HKA A;  3LK3 B;  2DCF A;  3ZCI A;  2P9B A;  1BR2 A;  2LSY A;  4HFV A;  3VKH A;  2Y8D A;  5L3G B;  4N78 D;  3NBX X;  4E7Z A;  2X9X A;  3DJB A;  4TN7 B;  1IJ5 A;  1B7T A;  4H9O C;  1YW0 A;  4EB6 E;  3J9X 1;  5HWX A;  5CB4 E;  2JMH A;  3ZYL A;  4OYJ A;  4PJM A;  5TAO A;  5KDM C;  2YK0 A;  3PU8 A;  3FXE B;  2Q9Q A;  3AAA B;  3EVY A;  4AKR B;  4UIG A;  3C64 A;  4A56 A;  4FJO A;  4M1P A;  3I1A A;  3N9O A;  4O8S A;  3ANW A;  2DLR A;  3WAK A;  5L3C B;  2IAK A;  2WAU A;  4UEL A;  1YD8 G;  1HS7 A;  4KUM B;  3VU7 H;  3ZJ2 A;  1IZN B;  3IF8 B;  3MJX A;  4O2A E;  1U5P A;  3E08 A;  4AKI A;  3KV4 A;  2MYS A;  1FMV A;  4ANJ A;  2ES0 A;  2KLQ A;  2CWO A;  3E0Z A;  4PK6 A;  3LG7 A;  5JR9 C;  5FYM A;  4O4L E;  3ESL A;  2ZM0 A;  5FXV A;  2WMO A;  2VKH A;  4CXY A;  5HYA A;  5EK4 A;  4UVC B;  4IE5 A;  2C5J A;  4IE4 A;  4IGU A;  4ILU A;  2Y6X A;  4TV9 E;  3JC6 D;  4PNI A;  3RYH E;  4IHJ E;  5FNV E;  4QXC B;  4PK4 A;  2NW8 A;  5J2T E;  2UXN B;  5KMG P;  4FI5 A;  4G2A A;  3HI2 A;  5LBQ B;  2WMN A;  5L2L A;  3VKG A;  5ADX L;  3O1I A;  2RA1 A;  3L3P A;  3O4X E;  3DTO A;  4IE0 A;  4CXX A;  1H7C A;  3N2O A;  5J2U E;  2E9X A;  3UUX B;  2YIN A;  3CML A;  3ZMU B;  3GWH A;  2IC6 A;  2W61 A;  4BJN A;  1LVF A;  1T98 A;  5LHG B;  2DNX A;  2KZ7 B;  3BK9 A;  3H37 A;  3N9L A;  4KMC A;  4G63 A;  5FY1 A;  1BR4 A;  3N2G E;  3FHN A;  3MA9 A;  5LHI B;  3CKD A;  3ZPO A;  2XAJ B;  5H6Q B;  2M67 A;  2XQY A;  1BR1 A;  1MIY A;  1WYB A;  2X66 A;  3O1H A;  4MBQ A;  2VK9 A;  4O4I E;  2CXF A;  3EUH A;  4XAX B;  4C90 A;  5EK3 A;  3KV5 A;  2ZM8 A;  2IW5 B;  1MNE A;  2BDE A;  1LKX A;  1KK7 A;  2WM9 A;  3MXZ A;  3O1J A;  4KP3 C;  2XAS B;  2Q9Q B;  3RKO A;  4JEU B;  4ZI2 D;  3NRX A;  2LJL A;  4IIJ E;  2OA5 A;  4P09 A;  3QC9 A;  3C98 B;  3CX6 B;  3N9P A;  4DVD A;  5LHH B;  3EDV A;  3ANW B;  4H9R C;  2W62 A;  3R6N A;  5HXC A;  1SHZ C;  3K3Q C;  4WBO A;  3ZMT B;  3H3A A;  5LOV E;  1HX8 A;  4YLH A;  4AI6 A;  1HTJ F;  1US7 B;  3UUN A;  2E9X D;  3SS1 A;  4IE6 A;  2N9D A;  3KBU A;  5JH7 E;  5LYJ E;  3KFW X;  2J1D G;  3O9X A;  5JDF A;  2GK9 A;  4HGA A;  2I59 A;  5JRC A;  3I0Q A;  3L09 A;  4H63 H;  2K48 A;  3ZC1 A;  4NUV A;  3HKC E;  4AQF A;  2MOZ A;  4QX8 B;  3KIN B;  3HR0 A;  2ACX A;  1YKE B;  2CE7 A;  2XUE A;  3OKQ A;  3P7I A;  3NZP A;  4GOU A;  2D0T A;  2BVM A;  4PJL A;  3AA0 B;  1E1H B;  1D1A A;  3RRC A;  3KVB A;  5L3B B;  3MZK B;  2C0S A;  2D5U A;  5IHY A;  4B6X A;  4TV8 E;  4U74 A;  2NTX A;  4KBM B;  2N2N A;  2EHO C;  2LOS A;  1SA0 E;  4QXH B;  1AJ3 A;  4PJN A;  4BJM A;  2BVL A;  4EYU A;  2K9A A;  3E22 E;  4H9P C;  2E9X B;  3HKE E;  5HWY A;  2C5K T;  2CXD A;  4AXP A;  2EHO B;  3C50 A;  4IE7 A;  4OFZ A;  2RP4 A;  3FBZ A;  5H6R B;  3ZMZ B;  3UFE A;  2BZB A;  4AQG A;  2W63 A;  1MMN A;  4H9N C;  3U78 A;  4U72 A;  1G8X A;  1X79 A;  3ETU A;  2KT9 A;  4UXN B;  5FY0 A;  3ZMV B;  3IHR A;  3GN5 B;  5LJN A;  2JMK A;  2V26 A;  4MLK A;  2MTQ A;  3OBV E;  4C91 A;  4WW0 A;  2YU2 A;  4YJ2 E;  4CQI A;  3OJA A;  4EZH A;  3B13 A;  1UX5 A;  3QK6 A;  5ETW A;  4EOZ B;  2CA5 A;  2QGS A;  4UF0 B;  5GON E;  5KX5 E;  2V7I A;  2G0U A;  1WYC A;  2ZLY A;  4CI1 B;  3AAE B;  1MIW A;  2JPF A;  1D0X A;  1MMD A;  2JQQ A;  3CX8 B;  4WBN E;  4NUU A;  4CXW A;  2NW7 A;  3IEE A;  3NZQ A;  3U3I A;  3UUM A;  5JRE A;  1HG5 A;  2DWG A;  2KWI B;  3I9Y A;  2LSK A;  4OHF A;  5JDG A;  4ADZ A;  2X9Y A;  4GK0 E;  2X9H A;  4ZS3 A;  4J2C A;  3DP7 A;  2W0G A;  3AVR A;  3HA4 A;  2WWU A;  2LT3 A;  4BAY B;  3UT5 E;  2L8K A;  1G73 A;  1CUN A;  3ZN0 B;  1HG2 A;  4EZ4 A;  5JRC B;  4JLE A;  4HN9 A;  4X1Y E;  4CI3 B;  3N2K E;  4Z8X A;  4I50 E;  3KVA A;  3RYF E;  3V5U A;  4ISS A;  3LBX A;  2VB6 A;  4QX7 B;  4ZS2 A;  2LSI A;  4L0R A;  2A72 A;  3N5L A;  3AAI A;  3PUA A;  4X1K E;  2L9Q A;  3JC6 C;  2K24 A;  3F31 A;  3PUR A;  3HKD E;  3ONX A;  3RRW A;  4BA9 A;  5JDQ A;  3CQX C;  5JDM A;  2Q9Q C;  3C4W A;  4ZI3 D;  5F3J A;  4O2B E;  4ZI7 E;  1FMW A;  2QA7 A;  4TX5 A;  2VWA A;  4DMV A;  2A2F X;  4ASK A;  5JVD E;  1VOM A;  3NRY A;  1ZHC A;  2H7V C;  1FIO A;  3FXD B;  3T8O A;  1ZKE A;  1UCU A;  3GMI A;  3K3O A;  2X68 A;  1D1C A;  2PFV A;  2UXX B;  3AA7 B;  5C8Y E;  3B57 A;  4I55 E;  3J7Y q;  3ZYM A;  5HXS A;  2DWK A;  5FP3 A;  3BQK A;  3HKB E;  3LJC A;  1D0Z A;  4PJJ A;  5HXR A;  3K8P C;  5F8P A;  2NWB A;  4DMW A;  2LSJ A;  4DBQ A;  3P8C D;  1MND A;  4DND A;  4EAH A;  4AKH A;  1NWM X;  1VRB A;  2LOP A;  2PBI A;  3FB2 A;  3OYX A;  4L5G A;  2YU1 A;  2V7M A;  3KDS E;  2ZMA A;  2HH7 A;  3HL6 A;  2LEH A;  1HF8 A;  1MMA A;  2VKO A;  4AKL A;  4ZI2 C;  2LE8 A;  3M65 A;  4I4T E;  2C5I T;  3RX6 A;  3D0T A;  2PG8 A;  1S35 A;  1Y64 B;  4XBF B;  4PW8 A;  5JR9 A;  4UVA B;  5LGN B;  2XHE B;  2E8I A;  2VAS A;  5LNK A;  2CM0 A;  1D0Y A;  1MIV A;  1HCI A;  4MFR A;  1O3X A;  5HXE A;  3F57 A;  3TKL B;  2E9X C;  3R84 B;  3SOL A;  2KXP B;  2XAF B;  3ZN1 B;  3Q5X A;  5CA1 E;  3Q5W A;  4P0A A;  5FMN A;  2XAG B;  3F2E A;  3PDY A;  5FXX A;  5L3D B;  2LSG A;  5CA0 E;  4HE8 A;  1IAP A;  4UEM A;  2CLY B;  4E7S A;  3BQI A;  3LBX B;  4EXT A;  3ZEF B;  3Q9D A;  3I0O A;  4P0B A;  2XAQ B;  2WSS V;  1NAF A;  2H7O A;  2JRK A;  3N9N A;  2IC9 A;  1V9D A;  3CQC B;  3KV9 A;  3PTR B;  2X0L B;  2X67 A;  2Z6E A;  5HXH A;  3AA6 B;  5DQW A;  4EIW A;  4ZOL E;  4YHJ A;  4ZHQ E;  2KND A;  1BR0 A;  2D0U A;  2N1G A;  2W00 A;  3RYC E;  2HPL A;  2PJQ A;  5M4Y A;  2V1D B;  4GK5 E;  2SPC A;  5FXW A;  5DJQ C;  4JEH B;  3UTK A;  5J1G A;  5FXZ A;  5LGT B;  1HFA A;  1S94 A;  2LM9 A;  2HPJ A;  3CQG B;  4XZC A;  3OYZ A;  5JDL A;  5L3E B;  3CPZ A;  3KBT A;  3MKD A;  4IST A;  4QKN A;  5EZY E;  3CWZ B;  3N9Q A;  2K5B B;  5AFU L;  1OWA A;  2X51 A;  4DBR A;  4GIW A;  3K3N A;  4QXB B;  3S4U A;  3N9M A;  1D1B A;  3LFM A;  4AQF C;  5FY7 A;  2CXL A;  3BQL A;  2B1E A;  2XTL A;  4EYY R;  1QSD A;  1MMG A;  5A1L A;  2NP9 A;  4GYR A;  3A5X A;  3PUG A;  3PU3 A;  4OK0 A;  2CCQ A;  1U4Q A;  2WBL A;  1IJ6 A;  2ZM2 A;  1UX4 A;  3MK7 C;  3VHL A;  4YJ3 E;  1WRD A;  5JR9 B;  2KMF A;  2MBG A;  4UV9 B;  2NW9 A;  3ETV A;  4UV8 B;  5HAX A;  3GA8 A;  4TUY E;  4F6R C;  5JDN A;  2LHN A;  3MAC A;  4QWN B;  2Q9Q D;  4OYK A;  5JQG E;  5LA6 E;  3ZMS B;  4K0U A;  4L9I A;  4O4J E;  4CZZ B;  2VKD A;  3PUS A;  4X1I E;  5E0O A;  2ODU A;  1WR6 A;  4H9Q C;  5LG4 A;  3I9W A;  3ZYK A;  2YEV C;  2V7J A;  3LK2 B;  2Y48 B;  4DO0 A;  5JDH A;  4AKG A;  5EK2 A;  4YFS A;  1WLX A;  1LVK A;  3AVS A;  4IDZ A;  2EHO A;  4ERR A;  2D2S A;  3ZCJ A;  2VKJ A;  4H63 V;  4UVB B;  3RYI E;  4QHO A;  4X20 E;  1ZEE A;  2H3R A;  2DI4 A;  2KIN B;  2L3L A;  2V7L A;  4PAG A;  3GN5 A;  3W15 B;  4I43 B;  1Z0P A;  2CEA A;  3SRZ A;  2NOX A;  3RC8 A;  3PE0 A;  4O4H E;  1EZ3 A;  1QUU A;  3WI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...