2BKNA

Structure analysis of unknown function protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
PKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bknA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bknA02
2FY8A 1XWMA 4G65A 1SUMB 4L73A 4YS2A 1T8BA 3RBXA 4L75A 2AEJA 2OGUA 1LNQA 2OLTA 4J91A 4EI2A 2IIUA 3JXOA 4J90A 2AEMA 4L74A 4J9UE 2AEFA 2BKNA 2BKOA 4J9VA 3L4BC 3L39A 4J7CA 4XTTA 4Q25A 2I0MA 1T72A 1VCTA 4RO0A 4GVLA 3KXDA 4L76A 2BKPA 3RBZA
chains in the Genus database with same CATH superfamily
2MKSA 5DABA 4ZCKA 5KFAA 3NS5A 2VDIA 4E2FB 3BN4A 3MM5B 2CNOB 4DFMA 2BG9A 5AQPB 3KHRA 3GFZA 5LNKA 3QZ8A 3RJMB 2H65B 4O3OA 1K47A 4LFCT 4NLSA 3MPDA 4KHPT 3FUYA 2GIFA 4ZVUB 1YLXA 1JNRB 3NOGA 5ABFB 4KHRA 4C98A 4PWWA 4O3SA 2D2SA 1HD1A 4DU7A 2DH9A 4ZOSA 4UF0A 2K7KA 3VAHA 2DKOB 2E9XB 3MCOA 1RT4A 3BO2A 3I9ZA 5HXSA 1IBKT 1HWJA 4Y2AA 2VURA 2CJYB 4CLLA 4DL2A 4YHJA 2GJ2A 3GIIA 2BBJA 3UR0A 2QC3A 4ITSA 1C0UB 3KLFA 4L3NA 1S9EA 3DN9A 5L3DB 1VHIA 2RVJA 3EUNA 2EC2A 3T5HA 5K14B 2KM8B 4IOCQ 2VWAA 3AOBA 1RB0A 2R8GA 2HBQB 3ONXA 5DM6Q 3NBPA 5KFLA 5IS2A 2MQLA 3M2UB 2R8KA 1MNDA 3LJCA 4YR2A 3G6YA 4P09A 2YX7A 2X68A 1VK3A 4WP9A 2D69A 3OHBA 4XPCA 1WSRA 5ETVA 2UXDT 1U24A 3KJVA 2BE2A 1RT7B 3CKDA 3IM8A 1VQSA 1X79A 2KFZA 3BQLA 2KFNA 2WDVA 2FJWA 4U6PA 2KJVA 2HPLA 5D8HB 1UAWA 2EFPA 2DYAA 2H89A 4DR5J 3AOCA 1W0BA 1YDLA 2YDRA 2V4QA 2F8EX 2DHRA 1U26A 2KG1A 3E2EA 4TY8A 4WE1A 4C91A 1ZZNA 3EDQB 2AGQA 3ZT7A 3GN5B 3NKYA 3I87A 1ICEB 4F25A 2FPHX 4X66J 3T1HJ 3KUHA 1FXLA 1J5EF 1S79A 3UFCX 3OTCA 4O4RA 3VRAA 4IG3A 3HD2A 2CZ9A 2VICA 1HNWF 2AHOB 1HR0T 2XNQA 4EIWA 1OMSA 1RAJA 3TA2A 4LSNA 1QJHA 3JQJA 3BGOP 6AT1B 3M9NB 3NGDA 1HBOA 3HULA 3H2VE 1AB8A 3G87A 3N9NA 5HSPA 2DNYA 2C2RA 1MWQA 4G1QB 4JI3F 3MJXA 4JI2J 1Q53A 1KLNA 7AT1B 5JTGA 3OVBA 5J2NB 1AA1B 4B6XA 2BANA 4QIVA 3I0OA 2B3TB 3W2VB 3KLHA 1T05B 1N5SA 2ZE2A 2ZD1A 3VKHA 1EETB 1XMQF 1B3TA 2IM0A 1KLMB 4RW7B 2AE9A 3PNIA 2DRAA 1R31A 4LRBA 4NI2B 3TA0A 3F31A 3D0IE 2ADBA 3ZPOA 4QU7A 3ZN0B 1HKAA 1NSKL 4YEAA 5D15A 4LF9J 2GIRA 2XWYA 4WK3A 3O5TB 4I4TE 5I3QA 3CD5A 1NU4A 1FDBA 2HS4A 2HZVA 4KP3C 1YI2S 1O3XA 4DPOA 2CPZA 3QQCD 4MKVA 2ZH9A 3UI3A 5L2LA 2H5EA 4IGUA 3W66A 4ID8A 3H3AA 4J9SA 2N3OA 3QNWB 4RU9A 4EO8A 2E5JA 2YPYA 4JUYA 5KG0A 1S1WB 9RUBA 2NR4A 2HPJA 3N9UC 3UDEA 1KOHA 3EGZA 3V6HA 3UN2A 1US7B 5HANA 2HHSA 3Q5WA 4M95A 2ZNZA 3OXLA 1VMBA 5A6PA 2KMFA 1RHRB 3EGVA 1PJ6A 3BN7A 5LT5A 2X67A 4NOHA 3CJRA 1P1TA 4R25A 2RQKA 1X9MA 5LSRA 1J5OB 2ERRA 1IUJA 2V7MA 5LM7E 3IG1A 3OFEA 2QN6B 1U4BA 1S6QB 1SKUB 1E6VB 2M2BA 2LU2A 2K48A 1XR7A 3ITHA 1RLDA 1IKYA 1TL5A 3G71S 5ETKA 4IOBA 2GS8A 3C98B 4P72A 5DJQC 5EX0A 3ETVA 2ROPA 3AJ2A 2W66A 3SCIE 4A8WA 1T9VA 3AE2A 2OI2A 1HL6A 3J7A1 2J62A 4ECTA 5B09A 2KWHA 1OEDE 1T8BA 4LF2A 3LWLA 1TU0B 4CYUB 3EM1A 4NLYA 3HO1A 1GMWD 3KWMA 3D67A 2EKNA 5HROB 2ACMA 4WW0A 2HAIA 2WDRA 4UF0B 3L95X 4CI1B 3QB5K 4DR5T 2MKYA 1RT4B 4P1NA 3G6XA 2CPTA 2OV9A 2W9CB 1X5TA 1CSJA 3ZN1B 1OSDA 1MU2A 5DM7Q 2QFJA 4IKAA 4J9OA 3U27A 4ED6A 2F5GA 3CPWR 3WAKA 3KLFB 5KDMC 3ZTPA 2V7IA 5CZXA 3RQUA 4X66T 3T1HT 1S9EB 2ABYA 3FKBA 4Y2IA 1Y9OA 2VA2A 4AIUA 1DTTA 2W24A 2Y8WA 4UY85 3TVZA 1YQHA 2MOZA 3DGVA 5KFRA 2A0FB 3NBPB 5J2QA 3PUYF 3MACA 2ZM0A 1S99A 1FD2A 2KYXA 2K3KA 2LKGA 2HGNA 3MGJA 2FVPA 2ZHBA 3MAHA 5FLXU 3N5BA 1JLFA 1WHWA 2FHJA 4UELA 2BA9A 4L74A 4RW4B 4YJ2E 3VAMA 2OD6A 5DDPC 1HWUA 2XSBA 1JLCB 3K2YA 3M30B 2DPJA 3RI5A 2P9CA 4GYSA 1JLGA 1S57A 2GAGC 4C3KA 2OEJA 2BE2B 2R2SA 2ASDA 1ELOA 1SHZC 1SV5B 1WC4A 2QYGA 2RS2A 5F8GA 3JAMU 2WWVA 1AJ3A 1J5EJ 1NDKA 1HNIA 2E9RX 2E5HA 2BVMA 1RT2A 1HNWJ 5KFIA 3PFEA 3A8YC 4HKAA 1GEHA 3ONQA 1IR1A 1U2CA 4WE1B 2IDOB 2WB5A 5J2PA 3MTKA 2CA9A 2C22A 2I6HA 4ZPVR 5DG9A 4IG3B 1HG2A 2HGMA 2ZVSA 1OYDA 2LKHA 3OLBA 2MPKA 4EZ6A 2C2EA 3L39A 1XMQJ 4NXNF 2BM0A 5J1GA 1D1BA 4DLGA 1CJTA 4A56A 1HARA 1GXLA 2NWBA 4CO0A 4NZ0A 1NB7A 2WMNA 1HQEA 5LJ5Y 3CMAS 3PJAJ 5GMDA 4ZVGA 5FXXA 2BANB 1FWLA 2OPSA 4GKKJ 1TK8A 4G1PA 2LSJA 4OHFA 1U6BA 2ZE2B 2EK1A 2OPRA 4AQFA 1D1AA 2MY7A 3LH2S 4ED5A 2YBVA 4DSLA 3M1VA 1CEZA 3AVRA 1Q78A 2J7WA 2W7OA 4OYAA 3SDEA 4KSEB 2C2OB 2R8JA 4UV9B 2X9HA 4CNZA 4I7FB 4AT1B 1H73A 1SJ4P 1XMOJ 3SOLA 1KNPA 2ZZMA 3DMJB 1N52B 1Z2ZA 2FJDA 1NCLA 3MR7A 2C5JA 1WHVA 1D09B 3EMTA 2X9WA 5H9FK 3J80U 2RQ4A 4TU7A 3GONA 2PI5A 3D6FB 2X51A 4J9RA 2IC3A 3MI7X 2F3JA 2NTYA 2XSFA 5AXMA 3OTBA 3C4XA 3GPAA 1M62A 2L9DA 3BM7A 2FUPA 4ZK7M 1WRDA 2XJ7A 1N0VC 3M6VA 1PGZA 5CD4H 1IM6A 4PJNA 1QM9A 2A3JA 2DCLA 3J7ZT 4C0HA 1J1JA 2MQOA 3D54A 2A1BA 1OQ6A 3ETUA 3R1LA 2AKWB 5DRKA 2I8EA 3GR1A 4ZVSB 1ZZFA 4NL5A 2LEPA 4PYAA 3AD7C 3ITHB 4R8UB 1F5BA 5HQLA 4K50A 1IKYB 3TUZC 4TNVA 2BE9B 5K5MA 1RTHA 1WJ9A 2G0IA 4U7UK 5KG4A 4OI6A 3H2LA 4NE9C 1PC4A 4DR3F 5A0YA 1VQ7S 1IAPA 3TNVA 1OIAA 1WOSA 3UUMA 3D3CJ 3DM2A 1WTBA 3UUXB 2DHHA 1QVFR 3DLHA 3GE9A 3ZYKA 2QMXA 1J5ET 2A6OA 3SMZA 2OPQA 2WZ1A 3IRXA 5LGNB 3BGRB 4RW6B 1DQ9A 1IR0A 4OLPA 3NGKA 4UOFA 1WG1A 1HNWT 2W25A 3K5MA 4P2MA 4MFBA 3A4TA 1K44A 4YR0A 1XDPA 2WBRA 3ZZTA 3ISND 1SVDA 1HBMB 4RKUC 4YP3A 2PGCA 3QSIA 1I6JA 2E9XD 4FYDA 3G8TA 4JYAJ 2W2QP 2RDJA 2VKZG 1TVRA 3AAEB 2V7LA 2XQ8A 4EYYR 4U9RA 4LSLA 3KK1A 3C14B 3CMES 2XLKA 4FPIA 1N34J 4QOTA 3HHLC 2YQ1A 2GK9A 2X7IA 2LQ8A 2UUAF 1HPZA 4DR4F 1JWWA 5CABA 1FEHA 1XMQT 5KG7A 1N6QB 1DY3A 1WF0A 5AE1A 4URSA 5KAKA 2C3PA 5BXIA 3W7BA 1S1UA 2YX1A 4F50A 1JLFB 3AE1A 4MKAA 1NSAA 3H25A 5I4MA 4XDCA 4Y2CA 1K9MT 3DRSA 3Q0AA 3UULA 2IMLA 4X1IE 2F4FA 4MAKA 2BKNA 1EP4A 1BLUA 2KHDA 4GKKT 3CCTA 4NCAA 3Q5DA 4YB1P 2DHXA 4QX8B 2XQ3A 1CG2A 1BR0A 3BGFA 5C8YE 4UVAB 4ZCLA 1HNIB 4RW9A 1BQXA 2RDDA 2HBZB 4PK5A 1RT2B 1NSPA 3DYAA 4GK0E 1CULB 2BG9E 1VBYA 3M2VA 5EN1A 2QO3A 1YG0A 3FJ2A 4QH5A 2LSIA 2MHEA 5IWAF 2FY1A 4RUAA 5C25A 2W67A 1U1PA 1IJ6A 3I0QA 2C2KB 3U02A 4C8KA 1E6YB 3A3NB 2H88A 3HHNB 2WM9A 1SH3A 5KOXA 1U1KA 4WYWA 1UGOA 2H4WB 4IFYA 4CLKA 2FC8A 1RTZA 2LDYA 3NS6A 1CJTB 5CFBA 3L8RA 3MMAA 1KWMA 3C15A 1KSPA 2L3MA 4PKDB 4TWDA 1VQ8S 3LP2A 3NL0A 4MKBA 1S72S 2DTJA 2M9KA 2XYGB 3DTOA 2CFXA 3RYHE 4OQJA 5CGMA 4OI2A 4ILUA 1N0UA 2ASJA 2C3OA 2QMUB 2PO4A 1M1KT 3M8QB 2VL0A 3BBCA 3MCSA 1EKRA 1QTMA 5LHGB 4LF8J 5IUXA 4HVZA 3MEEA 1NK7A 3IHRA 4O4LE 3CDWA 3C50A 1N32F 3D4JA 1SC1B 3Q5EA 4H4KC 3SDEB 1HNVB 1A6LA 3PRBA 1SQEA 2O67A 1SUMB 4YT0A 3AE6A 2C2DA 3F44A 3GWCA 1CC7A 2IM2A 4ZS6A 4ADZA 3CMQA 2O5DA 2AP6A 2VASA 1N5YA 4Q2MA 3I0SA 3KV4A 4NPPA 1DQ8A 1R27B 5I42A 3EPGA 2VD3A 4YFUA 4NX9A 3LGHA 2J9CA 2APOA 2XAJB 1PG5B 2BEFA 2IC3B 4NYZA 2J9EA 1X4EA 1YZ6A 3MA9A 3P4UB 2XS5A 5KFTA 2BACA 4IR1A 1R0AB 3AB2B 2JH3A 5A8WA 4RJVA 2LHRA 1S12A 2WVCA 2QA4S 3KLVA 1Z0PA 4MTPA 1GFWB 4DZDA 3RAQA 3N9PA 5KTQA 2Q6CA 4JYAT 2HFSA 2HZAA 2YNGA 5JDGA 1AFIA 2AQ4A 4DR3J 3RKGA 3G96A 3UPFA 2XZTB 1MLAA 1N34T 4JV0A 5IC4B 2EG2A 4NPOA 1M90T 4C3LA 3QJPA 3RLFF 1ZPVA 4PWDA 2JIWA 1X5OA 3FRYA 3ZMVB 2RKIA 1XJWB 1RTHB 4RUBA 2GMJA 4WBNE 3PO5A 5MAOA 3ELHA 2JC1A 5AXNA 1ZHCA 2QE5A 3BK9A 5LBMA 4TV8E 4C6AA 4UUXA 4DBRA 2DR6A 2CWOA 5A0YB 3JXOA 2KU7A 4J9UE 5H1SV 4OZ0A 3MR6A 2X3DA 3BR9A 3JC6D 5HK4A 1LWEA 4HKQA 3KXDA 4KBIA 1PCAA 4PXDA 2V0NA 3R2DJ 5HYAA 4WP8A 1R89A 2QT7A 1HBNA 3W61A 4F2SA 2UVUA 2OPQB 1JXVA 3IRXB 1FEWA 4AKRB 3MMCA 3UW1A 3J7Yq 3JCFA 2YU1A 2F9DA 3RR8A 1S1TA 3BDEA 2QX0A 3UNGC 3Q2SC 1RTJA 1UCUA 3GFXA 4R0JA 3FBLA 2UUAJ 2ZBRA 4NRUA 4RBVA 1T11A 2V6XA 2FUG9 3SZ2A 2DL1A 4QWCA 4P73A 5HATA 4OX8A 1MIWA 2QMWA 4FYYB 5CHCB 1TVRB 5C5JA 4DG1A 4JEUB 2FLPA 2GX8A 1VOMA 3UQSA 2YWGA 1LWXA 4GYRA 3QSYB 2ES0A 2HHUA 1HPZB 2KNDA 2ZVIA 1JJHA 3PUGA 4KGZB 4C8MA 2BUNA 2UUBF 1S1UB 2YKMA 1VRTB 4L5GA 3DRSB 4AXJA 2AT1B 3FEYB 3UN3A 3PTWA 4MLKA 2XO7A 2JOQA 1EP4B 5JR9C 3EABA 2AYBA 3OR2A 2LDIA 2YEVC 4AKIA 2EBEA 3PJAA 2B9EA 4ZI3D 3NWIA 4U8YA 2J6SA 3GIKA 4CH7A 2HH7A 4A48A 1U47A 5KFCA 1RTDB 4LF8T 4RW9B 4OJ1A 4FYWB 4IFVA 2LA6A 2ASLA 3IGVA 4WBOA 3DYAB 2SPCA 3JSMB 1X60A 3UVJA 5FMNA 3CQGB 5JUMA 4OLOA 4CO1A 4PABA 4DV7F 1NK5A 4BAYB 4CP5A 1U02A 2AMCB 4IO1A 5C25B 3JTPA 4RX6A 3CJTA 4UEMA 4ECQA 4F36A 2H5IB 3DDIA 4DSFA 5HVGA 1YRXA 4XAKA 4H9RC 2CPDA 4EEYA 3ZEFB 1PILA 3KLGA 1ZTTA 4OX9F 3PZPA 2PI4A 2VKJA 1RBOB 1VQYA 3CCVS 3SRZA 4Z8XA 4IFYB 3VCDA 2P9GA 3P5TL 3CJKB 2BOPA 4J9LA 4DV6F 3N79A 5IQQA 4KPYA 4NMLA 3P4PA 3ONLC 2ZUAA 1N32J 4WKYA 2E1CA 2YXLA 1P1LA 4DFKA 2N1GA 1U6ZA 4GC7A 2D74B 1SUQB 1T98A 2GVZA 2E5GA 4DQPA 4LF4J 1V3RA 4DR3T 3IBWA 1HBUA 4U95A 4NYOA 2Q1LA 3CF5Q 5F3JA 1L5UA 5KFFA 5EK4A 5HQ8A 5L3FB 3EDRB 2GHVC 3LGNA 4M1KA 2IIHA 5DDQC 3EAMA 2UV8A 2ACYA 4ERDA 1EARA 2HMIA 3QYYA 3CCQS 3PUAA 3OSNA 3ZNJ1 4ZLLA 1ZPWX 2JHEA 3S7RA 3T9ZA 2V8SV 2OGUA 2CBJA 3FGVA 1QUVA 2CNNB 4DV5F 2NPIA 3MXZA 4HN9A 1TP7A 2J6UA 3AEGA 1VK8A 2MLYA 4TZ4C 1QUPA 2RH3A 3ICLA 2LLZA 5F8NA 4EBEA 2MYFA 5D0GA 1U1QA 4HT7A 2D0TA 2CIMA 2V2KA 4U7CA 4U31A 3AJDA 2AGPA 4CLSA 1BMQB 3A1YG 5F3TA 2UUAT 4DR4T 2H1YA 2WK4A 4KX6A 3THTA 4CH1A 2XMKA 3SFGA 1Q8IA 4DVDA 1TKTB 1HQUB 2ZOGA 3IWLA 5H9EJ 1FESA 4ZZCA 2HNYA 3ZNUA 1WHXA 3PU8A 5EX3A 2HPUA 3C6TA 1Q16B 3HHDA 2CE7A 3AXKA 3VQTA 1W2IA 2KDOA 3F56A 2Z56B 5L3GB 3G4SS 4E8UA 2F4VF 2GCFA 3T5KA 1HNXF 4CLYA 2ZKTA 2PN6A 1SH0A 4TWHA 3D28A 3PIOQ 4F3OA 1UX5A 1Q81T 3UWTA 2K8GA 1MMLA 5B08A 4F8RA 2DRBA 4YS2A 3R27A 2FLOA 2FB0A 1HQ2A 2EHOB 3CUNA 4M5DA 5ETQA 3BO3A 2HYIB 1FRJA 1VRQC 3J7YU 5HVHA 4RNOA 1AFJA 4KFBA 5HCMA 1RZMA 1T9XA 3SSQA 3TX8A 2V8VA 5IM0B 2A2FX 4Q8EA 4K4ZA 3MMCB 2AJ4A 4LF1A 2VFRA 1G73A 1VGYA 3HMJG 1WD6A 3FVYA 1RTJB 2BMBA 3NGSA 2MMYA 3R5DA 3EI0A 5CZVA 4EU0A 4TYAA 3PYEA 2W0GA 5AQTB 4ED2A 4A8FA 4NA2A 2IA0A 3ZC4A 4LF7J 2BDPA 3PRDA 4GIWA 2UUBJ 3QK6A 1CQNA 4DG1B 2BBEA 1ZEEA 4TY9A 4HTJA 4OYBA 4F7VA 1XR6A 5AQOB 5LBQB 2YNIA 2Z2LA 5LMUF 5B0DA 4ZN3A 2CLYC 2GV1A 5F41A 1FVSA 1H2TZ 4EWTA 2DY9A 2EC0A 2A18A 1F2GA 4OHYA 2OEMA 4DR6F 4ETZA 3OQ2A 2L48A 2B7BB 2IM3A 5H9FJ 1TV6A 3BV8A 2QG9B 4PPZA 3MUVP 2YKMB 4HTEA 2C5IT 2K3IA 1N32T 3R97A 4FBTA 4HI1A 3OTOF 2RSQA 2K3WA 3MPWA 3UUNA 2DNRA 3AOAA 4DV7J 4I68A 4Q2LA 3IEEA 4LF4T 1AZSB 4UOGA 4OZLA 4ECSA 2E66A 2FHJD 2XZWA 3VZIA 4CLZA 2ZC4A 2XGPA 3B13A 2ODUA 3CWZB 2B6AA 4HTIA 4ZHRA 2FJEB 5CA0E 2BV3A 2PT0A 2DR8A 3M32B 2JQHA 2HVEA 4DV6J 4F4ZA 1QLBA 3I0RB 4CT8A 4ZVRB 5KFKA 5JMNA 3JSRA 4YXDA 3GA8A 3AH6A 3QGGA 4EGLA 3ZCJA 2NXJA 3MPVA 2ZJPQ 4N8OA 3GLJA 4K59A 3ZT6A 1QAXA 3RYFE 3T1YF 1YSJA 1C4AA 1U8SA 2W2MP 2HS3A 5C2GA 1S7IA 1HX8A 3MOZA 5K9FA 3I9V9 1D9DA 3KJFB 3B4MA 3PUVF 3GIRA 2EFNA 2A72A 1R8HA 1S49A 2QL9B 2B9YA 3RKOA 4F2RA 2UXNB 4FJOA 2OTJS 4B3OB 5DDRC 2AEJA 1HWIA 2K9AA 5LSOA 3RRWA 4N41A 1TFYA 2XM1A 2XMJA 4CM0A 4WCEQ 5CYJA 1G8XA 3IBPA 1M1GA 1XEZA 4NA3A 5L46A 1S0VA 1FDDA 1SJ1A 3CC7S 5GADU 5LYJE 3VU7H 2JLFA 1RTIB 3FBEA 3K89A 4CLTA 4J9PA 4EYHB 5FKYA 4HWIB 4QWAA 4DS5A 3M8WA 2Q3PA 3DOMA 5HJYA 3IAM9 2X9XA 5L9NA 3WIUA 2NPFA 3CK6A 3RBZA 1UPPA 3Q8YA 1DU2A 1SXLA 4O4HE 4O2BE 2HQFA 2GW8A 2YWWA 1FO1A 1U1LA 4P71A 1GXTA 4KRWA 5C42A 4DV4F 1RWNB 2BKOA 1SPBP 3TQ1A 4AKLA 3UU6A 4WIIA 2X9YA 2JSXA 3DXBA 2Z58B 2R8IA 2VKHA 4JEHB 2DISA 2C2ZB 2ALZA 1RISA 4XIUA 2CRBA 2F4VJ 3UDCA 1HNXJ 4DR7J 1T0TV 1T94A 2ACZA 2R2TA 1CS4B 2CHOA 2DGTA 4EYIB 4NLVA 2POKA 2W2UA 4JV1A 3HLUA 3NRBA 3GSDA 5HWXA 4P0BA 2QL7B 1RSCA 3JTNA 3ZLIA 1JLBB 2MZJA 1XWLA 4LF7T 2UUBT 1O0PA 2IVFB 2M88A 3NEKA 2A6MA 1VHFA 2BJ1A 2E9ZA 4ZVQB 2A2DA 2CAJA 4QPXA 3I9YA 3P45B 4DU8A 2MZSA 2IW5B 5DQHA 3FEXB 3VGTA 3L9ZA 2D9DA 5LJ3Y 1XDOA 3ENQA 5F8IA 3L7OA 2HFNA 5HAXA 1H7XA 4O0NA 1VIOA 2ZM6F 1GQEA 5F8HA 4LMJA 1G2EA 2B0GA 5FP3A 4KB7A 4EEBA 3HVAA 4UTGA 4ED1A 1YKWA 4A8MP 3RRGA 4DV7T 4HHHA 5AQHB 4ECWA 1TELA 1CC8A 4KFBB 1FMVA 2VC0A 4LBHA 4ECYA 5LG3A 4DUYJ 4FNHA 3HA4A 5KT5A 5HN0A 2BW2A 4OX9T 3MD1A 3SCJE 3A8KA 2E7VA 3BKTA 1X4CA 2PIIA 3VVTA 5AQRB 1DZ5A 3Q8SB 4DR6J 3O44A 4DV6T 4ZA1A 5T7LA 2DHAA 3D66A 4YY3F 1HF8A 1P27B 3V81A 1UP1A 3RB3A 2EI5A 1E7PA 4ED8A 4QIGA 2LOSA 3TAMA 4G2AA 1N5VA 2NLWA 5FVLA 4AKHA 3I6PA 3ZZYA 1QDUB 4PG7A 2IYIA 2HK2A 2JZ5A 2CXLA 4OIXA 3CDAA 2LOPA 3NRYA 2QLWA 1RKIA 3NOCA 4YFSA 3HZEA 2MLXA 5A8KA 2R7WA 2QFIA 5AE2A 2NXUA 1Q5YA 1YQ3A 3AB4B 4IL4A 4K4YA 2JMKA 4PJMA 3RIUC 2P6TA 3QPIA 2B43A 5KFBA 2I5JB 2MKHA 4AE5A 1SE7A 4DV5T 5HWYA 5JVDE 4ZVHA 3UN5A 2DNXA 3GTYX 5L1LA 3HXMA 1DQAA 1Q8BA 4ICLA 3ISNC 3DRPB 3NY0A 5KG6A 2B6AB 2LFVA 2E9XC 3TO8A 2OFGX 2VL1A 4ZITA 1FX2A 2ZDPA 5FY7A 4JI8J 4LF5J 3G9CA 1UKUA 4QPTA 1U49A 4DN9A 4ED7A 2QLBB 1FIOA 3N01A 2V5HG 3ENAA 4QWDA 2VFSA 2KXHA 1Y01A 1GX5A 1DURA 3DOKB 4H9OC 4GVBA 1MROA 1Y5NB 1FMWA 5KT2A 3QT6A 1X0FA 3VR1A 3V4IB 5E41A 1VC6A 2KM8C 3BQ2A 4H4MA 4LR8A 1NK9A 3U7JA 3O1HA 5AQVB 5LMNF 3MXHP 2YDSA 4TN7B 1FJ7A 2F4VT 4A8SA 1FD8A 1HNXT 4BS2A 3MM8B 3ZMTB 2LRLA 1J2VA 4Q45A 1D8ZA 3HVWA 4EK2A 4ILBA 2RU3A 5JDQA 1LW0A 4JUZA 3AA1B 1B7TA 1NPPA 2GAHC 1LWFB 1VLOA 2KN4A 3BDPA 3CC2S 4IDKA 5HEJA 4OYWA 2CEAA 4G6VB 2O66A 3AODA 5JXSA 4EI2A 3B57A 5AQIB 4F3MA 3HVRA 4WYLA 3N9OA 1YVFA 4TVAB 4DV4J 2HN1A 1SL0A 3LBXA 3A8EA 5B0FA 4DV3F 4OZNA 2ZH7A 4KR0B 3I55S 2E9TA 2HQGA 2XBPA 1WDDA 5AQQB 1IQTA 1RYRA 3HL6A 5JDMA 3BQKA 3AQOA 4KIAA 5J2MB 4CDIA 3DOMB 3K8PC 3H20A 2R7QA 4DSKA 5LOVE 4OYJA 3GJQB 3KG1A 4P9SA 3KLEA 3Q83A 3C51A 4CLFA 2HVHA 4PQAA 4DFJA 4OHZA 2OEKA 3A8IA 3BBBA 3CSKA 1F3VA 2UXCF 4DUYT 3B8HA 2N3LA 2YWHA 4W4MA 3LP0B 4HGAA 3H4BA 1HCIA 5HJXA 2HNZA 1BE4A 2FHOB 1A9NB 2FLNA 4DFPA 5D4NA 4ZS3A 1S35A 4QIFA 3L7PA 2CQCA 4NXMF 3OTDA 3IA3A 3HHEA 4DR6T 3ZXWA 4DNDA 2PEHA 3CD6S 2B9XA 2BVZA 2DO0A 3OFGA 2ZM6J 5G0RA 1FI4A 3VWSA 4A8XA 4J9MA 2AZ1A 2RMLA 5CJ5A 1GMVA 2DBBA 2V8GA 1Y3KA 1QTNB 1FRHA 1D0YA 1FRIA 2IJFA 1FHTA 5KX5E 3H5YA 1UVJA 2M0GB 1FA0A 2EFVA 3RW6A 4OMFG 1T02A 1FFSB 4YHHJ 3UFGA 3ZMSB 3E51A 5HMWA 2FHMA 5ETSA 4IREA 4P0AA 1BXNA 1WKJA 2BE7D 3MMJA 1R8IA 2G2ZA 1BQNA 1DLOA 2CMRA 2NYHA 2WSCC 5DO2A 4CXWA 3EHZA 4ED4A 4YDDB 2XMAA 3TQEA 3QIPA 4A46A 5FXVA 3A7MA 4FF4A 2R9LA 2Z0GA 2I9SA 3MR5A 1FTRA 2AGOA 2DIVA 1B0PA 3VHLA 1WEYA 1C2PA 4ZCIA 2DPIA 4A47A 1KP6A 5FXWA 2LJLA 3JYTB 3PJWA 1R8PA 3ZFVA 4X65F 1YJNS 4JI8T 4LF5T 5ETOA 1G6BA 4ZDNA 3AXJA 3N4WA 4PAGA 2GJIA 1FNOA 5T7LB 3MURP 2ILYA 4GOUA 4PQUB 4ZEYA 5BR8F 4JI7J 2HURA 5AQFB 3GMGA 2DI4A 4C8YA 5ABGA 3F57A 1IBCB 1RDRA 3LPYA 4KV8A 5F0UA 3T6JA 3CIZA 4FN5A 2V26A 2BKPA 2JFDA 4COFA 1IKWA 1U6FA 5F9LA 2XAHB 2BS2A 3ZZ0A 4RNNA 4IG0B 5AFUL 4NLDA 5B7WA 3EGNA 1LKZA 2BG9C 3JC6C 1REGX 2OSRA 4LR7A 5AQKB 4C9DA 4IRDA 3MZIA 2WU2A 2HKEA 1LOUA 1N33F 2ACXA 4B3RF 3A8JA 3N6MA 1UFLA 4LFAF 4YJ3E 3NG8A 4QYZJ 4DV4T 2DJWA 2GA7A 2QA7A 4BC7A 1M5VC 1ITPA 4JI6F 5LB7B 3SBMA 1C1BB 3SFDA 2MPUA 1V3ZA 3TEHB 2R2UA 2NZ4A 4DQQA 3GG0A 3E01A 5LMNJ 1FX4A 4USIA 2PEBA 2R7TA 2DNMA 3BPSP 2WTFA 1F6TA 2VA3A 1XNRJ 2CWXA 5KFHA 3UFEA 4GRSA 2LYVA 2E5LF 1G4CA 3AAWB 1Q82T 2M52A 2LP4A 5KFUA 2YPZA 5ETTA 2HFVA 2RNEA 4MHCA 4H4MB 4QWBA 2CJAA 1TAUA 3D6MB 1XK8A 4WK1A 1BQMB 3FXDB 2MEWA 2F1FA 1DTQA 4ELVA 3VV2B 2O01C 4DV3J 3FB2A 4FVMA 3ETMA 2YU2A 4ZI3C 4O3RA 2AV5A 4C8LA 2ZM6T 2VH7A 2RD5C 2QGSA 2XHWA 1PAEX 3T41A 2DNLA 3NWGA 2WY2A 5ETLA 1TFWA 3CX6B 3FXEB 1IVZA 2MQ8A 3D5MA 3IWNC 2ZBIA 2M6BA 3HZGA 4F4KA 4IH6A 3LBXB 4J9QA 4X64J 1JXEA 4YHHT 1UCNA 3PHEA 2UXCJ 2VU5A 1U0SA 3PJXA 1N88A 2WDQA 4HACA 3AEBA 4OHWA 3HT3A 2J47A 3MM5A 4NXMJ 1YHQS 4U2ZA 4C90A 2EVZA 4LQ9A 2HFZA 3KDOA 2GO8A 1FKOA 3BH7B 3SCKE 1D1UA 3RIUA 4NUUA 3AECA 1K1SA 1RXOB 2W8LA 4PJJA 4J91A 1UW4A 2D5UA 4NCGB 5DETA 1JNRA 3WZ0A 3ZCIA 1JQGA 1RHKB 3M8YA 4LIRA 2IAKA 2HNZB 4H9QC 5AJ3J 5KXJA 3W1YC 2E9XA 3T1AA 3A12A 4XAXB 3CVKA 4TX5A 3QBCA 2YH1A 3PIPQ 2Y1JA 1V3SA 4JI7T 1ZOYA 1LWCB 4GVLA 2UP1A 1C0UA 4G65A 4HL9A 3AFGA 1RWXB 3LK3B 1HHSA 1QE1B 5B0AA 4P2SA 3KV6A 3LPEA 3BSNA 2ZWOA 3CX8B 3J7YI 4IE0A 8AT1B 2LSYA 3DNCA 4PAAA 4ANEA 2FJBB 2BYCA 3KJNB 1OY8A 5ITHA 4Z37A 1NZ8A 1NLKL 2PFDA 1RT3B 2ZHOA 4FI5A 2CQHA 3QUJA 1M5SA 4F67A 4X65J 1U0HB 3DDKA 1DLOB 2MAWA 2BJEA 3P8BB 3HT0A 5HLFB 1WG4A 3SCLE 2E1RA 1GX6A 4PEOA 1SBRA 2HS0A 2JC0A 3M2RA 4O2AE 4FBUA 4IE6A 2GGPA 1FJGF 3NXZA 2B4VA 2PMHA 1SCJB 2D3UA 1QLNA 2BM1A 5LHHB 2ASYA 2NZCA 4DUZJ 4K4SA 3KK2A 1GMUA 5LMNT 5L39A 3AXJB 4QIWD 2RRAA 1N54B 2LECA 1S0OA 4RR5A 2XI2A 1XNRT 2HQIA 4PJLA 3TX0A 2WZIA 3GN5A 3M4XA 1B0VA 3ZJ1A 2HHHF 4V19J 3UO0A 3SS1A 1QVGR 3UQ4A 3QAUA 4HT5A 4B3RJ 4K8RA 1RWKB 3QWUA 4B3MJ 4LFAJ 4NWBA 2EBGA 3CQXC 4F8HA 2WVFA 4KC5A 1IKWB 5IHYA 1H38A 3TKLB 1R8CA 4DV3T 5IT4A 1X7VA 3PV8A 1CUNA 2VHGA 1LNQA 1F0XA 4G1QA 2M8HA 1VQPS 3AE4A 3K8VA 2XQ9A 1KTVA 1SKWA 3OHAA 5B0BA 3KYLA 3MPYA 5KT7A 3AA9A 5J2NA 1VISA 3PW0A 1HS7A 3GMIA 2XY5A 2CJXB 2WW4A 1WWHA 2Q6BA 3RGIA 3W9JA 2W61A 3U1NA 2E5LJ 2BS3A 1VR6A 2VVNA 3X3UA 4TQRA 1N56A 3MF5A 4X64T 4EZ9A 2B4UA 2HBRB 4YSXA 2UXCT 1U7LA 3VR8A 4X4NA 3W63A 3BJYA 4KKOA 4NI2A 3E01B 2HW3A 3T8OA 1EZ3A 3OV7A 3H8YA 4IH5A 3IN5A 4NXMT 2RRNA 4OV1A 3RBEA 1KNRA 4DO0A 3B5MA 3OUYB 3O8WA 4ZP6A 2CQ1A 3RX6A 1GTEA 2IMWP 4NLQA 3KNGA 5HQMA 4ZHQE 5I3UB 3VAKA 3Q8RB 4LVNP 4QHOA 3O4XE 4J9KA 2FYXA 3FFIB 1GH8A 4CLPA 4S0MA 2LQ9A 3TWZA 1VBKA 2UXBJ 5L3EB 4B3TF 3LO3A 5LXYA 5LG4A 5FL1A 1V6HA 2CG4A 2FLLA 1BR2A 3DJBA 2MQMA 4MK9A 2CJ9A 4M8LA 1UVMA 5KG1A 3RC8A 3OFHA 2PSZA 5GADI 1SJRA 5L1JA 2XWXA 1RWPB 4ECZA 1SC6A 3GR0A 4JBCA 2HG4A 3LOUA 4NLGA 2I2YA 4JI4J 2CZVC 2VV5A 3ZYLA 4M5KA 2V5DA 3EXCX 1J5OA 2NXEA 3IBCB 3IGNA 1HFEL 5IOLA 1VCSA 1H72C 1S6QA 4B9VA 1E6VA 1SA0E 2OUGA 2Q9QA 3NP5A 1ZETA 4ILLA 2L9WA 1RU1A 4KO0B 4YMEA 3HHLB 5B0EA 4B9TA 3H3MA 2HZCA 3MM7A 1NBEB 4HACB 2IRUA 1W2BR 3KVBA 4X65T 1M7KA 1HHQA 4B9SA 3LK42 3EVOA 3GCWP 5DGBA 2V8HA 3D0HE 1FKOB 2QSWA 4AI6A 2V8DA 4YB6A 3NGTA 2UUWA 3EDUA 1WLXA 4QJVA 1A7GE 1SJFA 4CYUA 3RW7A 1UZDA 3OL9A 2ZMAA 1I5OB 3M6WA 5HI7A 2B7CB 4DUZT 4FP9A 3QOFA 5HROA 1CVJA 1YKHB 3CCMS 4DV0F 2L08A 4Z2XA 4MIWA 2MGZA 2W9CA 2VDHA 1OSCA 2XHCA 3D2WA 4LF6J 5A8RA 5FY1A 2PFFB 4FKYA 5D4LA 3I56S 3N2OA 1OY6A 4FKXA 4YN3B 1TKZA 4TKTA 4JLEA 4I0WA 4I43B 4B3RT 2XSJB 4C48A 2CVEA 3M8RA 4B3MT 4AQFC 4QWEA 4LFAT 1WSVA 1VQ4S 2IDEA 1VQ9S 2PMZD 4R5PA 5CCLA 5J0ZA 3CCUS 2CPHA 2R2RA 2YDQA 3RHWA 4LBPA 1UURA 4ID5B 4DX8H 2OJ3A 2H54B 2OPPB 2YK0A 4N7TA 2K1RB 1JMTA 2AYMA 2GFFA 1HYSA 1FRXA 5E3AA 3MOJB 4DMZA 2HQCA 1U5PA 2V67A 2YOEA 4RW4A 5KFNA 2AYEA 1JLCA 3ILOA 3M30A 2B9WA 2P5VA 1YJVA 4K4VA 4PRFA 3M2RB 4G1IA 4HWDA 2RU9A 1YJTA 1WKLA 2WBMA 4TLRA 2GGPB 4I1TA 2E5LT 1SV5A 3PEJA 3PU3A 2HHHJ 1NAFA 5M4YA 3PRVA 1S1XB 2NW9A 4MK8A 4E0DA 1RWMB 4EOZB 3KK2B 3RBDA 2Y0SD 1JLQB 3I5CA 2KL8A 3AB3B 3C6UB 3HHKA 4ES1A 2HWIA 1RT1A 1VQKS 4HDHA 4R0EA 3MUMP 4YSYA 1UW9A 4XDDA 5SUHA 4NEYA 4ZP9A 3BQ1A 1WC6A 2NOXA 1VBXA 3R8YA 2X0YA 2XG8A 4ZPBA 1KD1T 5FY0A 2COLA 1UMJA 2HIYA 2GVDB 3E08A 1LW2B 3E22E 4V19X 2OSQA 4B3SF 2KT3A 3QJJA 1UWAA 2UXBT 3EX7B 2AEMA 1OY9A 5L9XA 2W7AA 1S9GA 4USTA 3R3TA 2KINB 5EWFA 1QSSA 1BHNA 1YITS 1FRLA 1WC3A 5IV4A 4JI4T 3AEFA 4HH0A 1FE4A 1F5AA 5D0EA 1LVKA 1LK7A 4AL7A 2Q66A 2G0CA 3GSIA 3PX0A 2C0SA 3PHTA 3IP0A 1H2UX 5BYQA 3P7IA 3RC3A 3L7UA 1NRKA 1UFWA 1UZHA 4M63A 4WFAQ 4KKOB 1NDLA 4B3TJ 1S94A 3QATA 1B70B 3IFEA 2OP5A 4JB8B 3NGUA 3DGPB 1ZBTA 1L3SA 4I7FA 3HFKA 4HFDA 3AEDA 3W3SA 2G13A 3DMJA 5IZHA 4LMKA 3SXLA 3LAKA 4WFXA 4NLRA 1BC6A 2ZM2A 1YRTA 2ZZNA 1WNEA 1PO6A 4FZVA 4ZP7A 4XZCA 2VQEF 2V63A 5KG5A 5LL6d 3W8GA 8RUCA 4OZ2A 2WOMB 1HI0P 1NH8A 3ENVA 1XQIA 1Q4RA 5KOWA 1HW8A 1UWBB 5AQGB 4TV9E 3OT9A 4DV1F 3DRXA 3ZZZA 3Q8PB 3FZLB 4IRCA 2IRYA 2YKPA 4LF6T 1WUUA 2CPIA 2V2ZA 1KNZA 4O3PA 3RG6A 4YTPA 4BCAA 2WB4A 1O8BA 4OYIA 3BQIA 2P8IA 4NEZA 3K1SA 3KK3A 3ZTRA 3NS7B 4KUMB 2VBZA 2WSSV 3GG1A 4UXNB 4UUWA 2VBXA 1N5TA 1IKXA 1GXUA 1TMJA 4I6AA 2Q9QB 5HAOA 2ZH8A 4KHZF 1UVKA 1Z8UA 4U33A 1RBAA 4R8UA 2MTQA 3UDLA 3MM7B 2LKZA 2H9ZA 1RK8A 4W98A 4V1Av 4DV0J 2YWKA 1JJ4A 2VKRA 4FF2A 5CQGA 3BSOA 1FERA 2RUGA 3C4ZA 3KHGA 2FQQB 1RKJA 4IQMA 3PR5B 3BYPA 4RNHA 1I1GA 2AJ0A 5IXUA 2KSRA 2FJVA 4WTOB 3FCVA 3WC0A 2HHHT 4OX6A 2G9OA 4OI0A 3UU3A 4DN0A 1K8AT 1VS3A 1FFWB 3BGRA 3EXYA 4RW6A 4OFZA 2V50A 3CDUA 4F4XA 1XC9A 4TNWA 2MGZB 3QT5A 2EG1A 2JNJA 3EZ5A 4OYMA 3VRBA 2NW8A 3A13A 3CQCB 5GVQA 3ZKRA 5HVFA 2XLJA 1HBMA 5A8RB 2O1PA 3ZJ2A 1NKCA 1LXJA 5T41A 3TUIC 2BJ9A 2FVQA 1SI9A 3GV8B 3JB9k 3W5ZA 5DZ6A 5D77A 2ZUGA 1TKZB 2OD4A 3CJ5A 1BD6A 3ZTQA 4CTAB 3C14A 1KFDA 4CCHA 3JQMA 2UUCF 4DI6A 4BWMA 4R5PB 3OYXA 2R4FA 2MJUA 5C2TA 3JSYA 3CEDA 4KMCA 1G3OA 5LSLA 1OO0B 1N6QA 5KFQA 5CA1E 3D0GE 2HK3A 4PUOB 3J7AN 2G0JA 1HYSB 3T19A 1YTYA 1HMVB 1ZYQA 2VL8A 3TZXA 3H4DA 4QBUA 4L0RA 4PXCA 2FVCA 3SV4A 3AAAB 4U2YA 4ZI2D 5EWGA 5IT0A 1EB0A 1FRKA 4A8YA 3UCUP 1S5ZA 2VVSA 1H3DA 1BR4A 3CGIA 1MMGA 4B3SJ 4X4RA 1F2HA 2P2CB 4B3TT 4C11B 3TZYA 4U7IA 4IDQA 2B51A 4KI0F 1CULA 3R7BB 5ABEA 3C66A 3TLUA 3ZZUA 3Q2MA 1RT1B 4A98A 2WHOA 1M5HA 4TNOA 2M7SA 5EK2A 1T7SA 4JI3J 3SSSA 3KHHA 4WXWA 3IR6B 4F02A 2W01A 3TZZA 2SXLA 3QJLA 2Y9HA 5HMYA 2QGFB 3OYZA 1E6YA 2CQ2A 4RWXA 1BY9A 3IXQA 5GAGU 1FXDA 1S9GB 3O1LA 3WAJA 2WVBA 3L3PA 5JRCA 4DL3A 1F1BB 1FVQA 2DD8S 2KTQA 2ZBQA 4X4PA 4IDPA 4J9NA 2Y0BB 4HFEA 4Q5VA 3L09A 3V2UC 3GJSB 4USMA 4Q7AA 4UR9A 5L3BB 3HFZB 5C24B 2XASB 3KLIB 3QIDA 1AYEA 3K58A 4XBFB 4O3NA 3M8QA 3TI0A 2VQEJ 1Y5IB 4IE4A 2QLJB 2LT3A 3OLAA 3OBVE 1QSDA 1OEDA 4D3GA 3Q23A 3OVUA 4DV0T 3UT5E 5ETRA 2GC8A 2B1EA 1HNVA 2XMVA 4ALZA 3IM9A 4AFFA 1P9QC 2YINA 2YTCA 4DV1J 1TL1B 2MZ1A 1NKBA 5CYQA 4DLEA 1YBTA 4O4GA 4ZP8A 5LXTE 3M8SA 1R6YA 4OJ3A 2IBKA 3S8SA 4C8OA 2ZOMA 1RAFB 4N5SA 1Y64B 5KFXA 3W2WA 1IN0A 2F8HA 2J0SD 2KT5A 3QAEA 4I69A 2IBOA 4C2MA 2RQMA 1NJXA 3CWJA 1H6KX 1SB6A 1E2AA 5E3PA 2CXDA 2VPZB 3CT9A 2J9DE 2V94A 3FZBA 3R5BA 3N9LA 3N5FA 2EFQA 1R0AA 5CD4A 3VKGA 2HWHA 3H42A 1OPZA 5J1PA 4TUYE 4WFNQ 5AQMB 2XZEA 1EX8A 4RW8A 3OD2A 4P2FA 5E5NA 4ZIWA 3KK3B 3CDBA 3QWPA 2N4DA 4HHJA 2XS7A 2HNDA 2F9JA 3P50A 1IKXB 3BYRA 3UTKA 4J9VA 3FEZA 1F9HA 1R8BA 1ZKEA 3BB5A 1X9SA 5FVKA 3N28A 4L76A 1VQNS 3E0ZA 2NUUG 3PURA 2X66A 4ES3A 4DX7A 3RGLA 5FL0A 2I59A 4IDNA 4MH8A 2D7SA 1WACA 3VGUA 3HFVA 1I3OB 2CPYA 2JL9A 3RUBL 3CJ8A 2GNKA 2JWNA 3CCJS 4BJMA 2WCXA 4H9PC 4CT9A 3KUEA 5JVHQ 2KRRA 2HIQA 4B3ST 4CO3A 2VKDA 3RU0A 3T5LA 4DS4A 2CQIA 2QLFB 3K5OA 3OXFA 4QH1A 4QZVB 2OHDA 1F9EB 5JDHA 2CJKA 4DSIA 3DLKB 2KXNB 3H98A 3O1IA 1TUGB 2G1HA 3RPUA 5EWEA 1M5PC 3RRHA 3I5BA 5DQIA 2MKIA 4JI3T 4YB5A 2C2NA 3DP7A 3ENWA 1KF6A 2BDEA 4FVCA 3M8PB 2W4PA 1TL7A 2OAUA 2XSAA 3V5RA 5AQSB 2QVAA 2CCQA 3IS9A 4P75A 4ZVPB 4UT4A 1HA1A 3ZZPA 4DPXA 1IKVB 1JKHB 1UUSA 2V1DB 1KQKA 2HSEB 4ECUA 1FEEA 3HCXA 5J1NA 3NLCA 3ONJA 3V6KA 1VRTA 1WOOA 3CULA 4L75A 5HP1B 2MQQA 5KG3A 4USJC 2DNZA 2VOPA 1KVIA 4LMLA 2MXYA 2EEYA 4M5LA 1Q79A 4DX6A 4ZOLE 3ETOA 3C46A 3FBBA 2MY8A 1B4SA 2MQPA 3HI2A 3AJ1A 2AWZA 4TWFA 4ZVEA 1HG5A 2WSEC 4QXCB 1LK5A 3A3PB 3LWMA 1RTDA 3C2PA 1S76D 2VQET 1PAUB 4F6RC 3MAAA 5FDLA 3WDOA 3OL7A 4UQTA 5DQGA 4O3QA 5M2UA 4Z90A 1VFJA 2WRMA 4Q8FA 3JSMA 2Z2ZA 1XIQA 3Q22A 4B08A 2KYZA 5LXRA 4DV1T 4NXNJ 1V5IB 5KFDA 3PW2A 3F41A 3KBTA 2NUHA 3K59A 3U1LA 2OLWA 2V6YA 4NZ7A 3R6LB 4IT4A 1FKPA 3PEHA 2NP9A 1YJWS 2YKQA 1T3NA 3FCHA 3W5XA 2AX0A 4PG4A 2QYCA 2IIUA 1TR0A 4DIDB 3G6ES 3DRYA 2FJXA 4OZJA 3D3BJ 3FNNA 1B64A 2BJ3A 3CJKA 5JRCB 1ZOTA 1KQSR 2YVSA 5HCJA 1OYEA 2QRXA 1S6UA 2YNHB 4OJHA 5ETNA 4J5OA 1CJKA 1O6XA 4EEDA 3AEEA 1M0SA 1YJ9S 4Q0BB 4DV2F 4J2CA 1SUQA 1C4CA 2L8KA 4RLEA 1AUSL 2YNFA 1X9WA 1KN6A 3CCRS 3EVWA 1NZAA 2M67A 3GU0A 2XM3A 4NZ6A 3K0JA 3DRRA 2UU9F 1NM2A 4OL8A 4ASKA 1OEDB 4HE8A 5HEGA 2G0UA 3NNAA 4HR2A 4QW9A 4UIGA 1WG5A 4H4OB 4ZPCA 4KAIA 5CYQB 1Y5LB 4JI2F 5AQNB 2FJAA 3M9MB 4DL7A 2YQ3A 2X0HA 4O4GB 1OWAA 2NXNA 1H7CA 4C0OC 4ZI7E 2KLQA 1AUDA 3ET6B 1QSYA 4GO7X 3W2WB 2M5YA 1X31C 3AHPA 1TQLA 4ES2A 4CIOA 4LRCA 1UFKA 4EV6A 3O1JA 3TYTA 1EIYB 4DL6A 2ZZTA 4RNMA 3TP2A 2YKSA 1RABB 2YKAA 5D6GA 4ZLNA 1T72A 3EUHA 2LQJA 5JDLA 3LSVA 1WC1A 2C3UA 2ZFHA 3SQOP 1D0XA 3MAQA 1TKTA 1HQUA 2JQKA 4WWSA 4LF9F 4PK4A 1T9UA 5F3ZA 4RW8B 4HFVA 1OWXA 1Y7PA 3N0VA 1VI7A 1X4BA 5E3RA 2JEIA 3RRKA 4KGKA 2HNDB 1HFAA 2CQBA 3VHQA 1ZA2B 4N47A 1U1OA 2Z2YB 4D3HA 5D3GB 4Q43A 4P74A 3CCSS 1RA7A 3R5AA 4GMKA 3OFFA 4ER8A 1ZP0A 3WQPA 3K8WA 2CM0A 5GMKa 4DF4A 2BOAA 5D0HA 3QLHA 2PFVA 2Q9QD 2DO4A 5A2QY 2BQUA 2JQQA 2DNQA 3MZKB 2IA6A 2EHOA 2XAQB 3P8CD 2CPXA 2W1BA 5JH7E 3CCES 4NLXA 1VQMS 1C0TB 1HD0A 3VR9A 3UR3C 2AIRB 2PG8A 2A9UA 1H74A 2YX4A 4B02A 4BLGA 5IM0A 2U2FA 3EWGA 2V5CA 3H5XA 3NCPA 4B9UA 3RYCE 1AW0A 3PDNA 2XCAA 4X4VA 4DR4J 2JPFA 2QJ3A 5HXEA 2E44A 4NXNT 3PCOB 2L9QA 2RDIA 2AZ3A 2VUGA 4PPDA 1VJQA 2EW9A 1KVJA 4Z7CA 2E1PA 1REVA 1KONA 2A10A 5DLFA 3MEKA 3BF4A 2WS3A 3UDVA 1A0OB 1TL7B 2B8PA 4AXIA 4BHQA 4PCQA 3H2UB 4ZJOA 3KUGA 1CBKA 4F3QA 3CJSA 3DLJA 2R8HA 3V5SA 3IS9B 5LCYA 3P4RA 4NLTA 1NENA 3BREA 5GONE 3NCQA 2CBIA 5EZYE 1NO8A 5FYMA 3KMSA 4K4UA 4U67Q 3QRQA 3CCLS 4ELTA 1Y0HA 3C16B 1FJEB 3HKCE 2AF6A 1O5JA 3NNCA 1TKXB 3WBZA 5LGTB 4WTYA 1CLFA 1AZSA 3OJUA 5IWAJ 1IWAA 2DK2A 1D3WA 4TXSA 2MSSA 3AE5A 1RADB 1RHQB 1HIYA 1WKKA 3MM9B 3I4HX 2AXDS 3UD3P 3MAAB 5FDLB 1FF2A 3TOQA 2VG6B 4J90A 4HWFA 1JLAA 4YR3A 3M7VA 2I0XA 3FBFA 4MBQA 2FJEA 1VC5A 1TAQA 2WQYA 1YXRA 3M32A 5K8PA 3AE3A 5IQ6A 2AJ2A 3G82B 4UY8T 3FMBA 3I0RA 4UV8B 3IBFB 4M5NA 2F63A 2GQQA 1BGXT 2V6YB 3VAIA 3OXGA 2XO6A 4DV2J 3PYGA 1FKPB 1RT6B 3JS9A 1RAIB 4AXPA 3AY0A 1PSDA 1WR0A 1XZYA 1JLEA 1TUVA 2AW0A 4ZPWR 4IIJE 4OYZA 1APSA 1HW9A 1U25A 2QA4G 4RWWA 1IXKA 2HEKA 1NKEA 1EZZB 2UU9J 4PFPA 2ZJQQ 3PV0F 1HI8A 1WEXA 3NZPA 2KB2A 3FK4A 3NCRA 1CJKB 3H5UA 4CO5A 4B9LA 3CB4A 4XPEA 2MKKA 4JOUA 4E98A 2VOOA 4Y6IA 2Q79A 3RIFA 4B3OA 3AA0B 3EDVA 3PYDA 2YNFB 2W63A 3ZYMA 1S48A 4C8NA 2BJ8A 2KT2A 2FVRA 2E7WA 3DRRB 4X4TA 4DCJB 4KH0B 1Q0NA 1WTFA 4ZLJA 3KV5A 2HVDA 4HDGA 4WNKA 4X4SA 1RTIA 1EKSA 3L4BC 2W7PA 2XQ7A 3LK2B 2HQDA 4OX7A 2VG7A 3TJ8A 3G2XA 4HWCA 2WVEA 4ZJLA 1RWVB 4ECXA 3SYZA 3LGMA 4YUDA 3LFMA 4AISA 2FJAB 3PUQA 3MMBB 5KT3A 2LM9A 1TMMA 2DGOA 1UVNA 4GKKF 3BSCA 3TARA 3DLLQ 4K4WA 1RHMB 2E1AA 3BKFA 1DJ0A 3EZOA 2IMOA 2VFTA 3FDSA 2ZKUA 4O4JE 2HLTA 2E5VA 2KVIA 3AD8C 1HX1B 1CS4A 2VK9A 3KINB 5M2RA 2IHR1 1L3KA 4A8KA 1JLBA 3HSGA 2DNNA 4QYRA 3GV7B 3RYLA 1RJJA 1XMOF 3CJQA 2Q43A 1YK9A 1JNZB 4CNYA 1PBAA 4HHUA 3MHYA 3BGUA 3R6GB 3SQGA 4CN1A 4N77A 4AQGA 3R2CJ 4F0KA 1D8YA 3JSBA 1YBUA 3H40A 4J7CA 3QLHB 3TLTA 2QL5B 3POTA 3LG7A 2DR7A 1T9WA 1Q5VA 2FY8A 3MCMA 2J5AA 5F0WA 4OI3A 3BBFA 2IPOB 3TRGA 2RE1A 1QAJA 4UVBB 2JJ9A 2BG9B 1NXIA 1JXLA 3HF5A 2NCKL 5IWAT 2XQ4A 5ABHA 4EYUA 2KWIB 3PDYA 2N7YA 4OK0A 5IT9Y 3S01A 3PX4A 5BYRA 5EK3A 1KKHA 2WMOA 3VAJA 1R8AA 3JAEA 2ZJRQ 4Y0FA 1VJWA 2MZTA 1ROFA 2XEXA 2CQPA 2HFUA 1REVB 2ATLA 1KFSA 4EO6A 1PC5A 2VJUA 4DV2T 3X1DA 4DSJA 1KHWA 4ILAA 4LIWA 1S10A 4K0UA 1WDTA 2E5IA 1NH7A 3VGSA 1FE0A 2FIUA 3ILJA 5CYMA 4P7TA 2BRLA 2ZEJA 2OLTA 2UU9T 1YX2A 1ZS6A 4RPFA 1OPIA 3HKBE 2XCPA 3FZ2A 4YB7A 4AL6A 1GK8A 2VPYB 4QKNA 3N6LA 5F8PA 2PMWA 3NZQA 3MEGA 3LF0A 2D3O1 3PTRB 2KVQE 4HEAA 1RI7A 3RYIE 3AE8A 3HDSA 4YDXA 4YSZA 4JYAF 3KV9A 4NRTA 4JI2T 3SFUA 4TU8A 1D0ZA 2I5JA 3OVAA 3F73A 1NUEA 1S9FA 1JJCB 1H0HB 1N34F 4KT0C 4TN2A 2UXXB 3KJVB 4USVA 5GAEU 3DRPA 2LE8A 2CDQA 4OX9J 4X4UA 1JLAB 5GAGI 1UA1A 3VTIA 3FC9A 1WC0A 2HN2A 5H9EK 2N4CA 3Q8QB 2VPWB 1QD1A 4RUCA 4AYBD 3FSXA 3DOKA 3ZTSA 2B76A 2X1FA 4TY8B 4LF9T 3P3DA 4LQ3A 2L9NA 3X1LB 3V4IA 2WW8A 2XQAA 2HVIA 1JLEB 4QQBA 4HH1A 2DXEA 2PDAA 4P2XA 7FDRA 2WWUA 4JI1F 4OZ1A 4CLWA 3MM8A 3KNAA 2F65A 4M5JA 5BYSA 3AD9C 2YH0A 4ZI2C 4IR9A 4LSNB 3Q9DA 2J0QD 1WC5A 2U1AA 1LWFA 3D0TA 2KKHA 3CJ2A 1HBOB 2AJ1A 2LM2A 3I9WA 2Y6XA 4HFCA 5AQJB 1IJFB 4WPAA 1SC3B 4USUA 4ZCMA 5M2PA 4WF9Q 2B5JA 4CRJA 1U1MA 2B4OA 2XI3A 4MIBA 2DVIA 2IM1A 4DV5J 5F8JA 4PG5A 3A5XA 3K17A 2PD1A 2A2CA 3SI8A 4HFIA 1M1HA 1RACB 2BX6A 3KDSE 1MIVA 3KLHB 2IDLA 3J81Y 3LDQB 2VF3A 4WBFA 2ZD1B 1UJ4A 3MEDA 3B6BA 4KGMA 5L3CB 4H9NC 1NHUA 1XBWA 2VG7B 4NYPA 5J2MA 1DARA 5FJ4A 2H3EB 2CWKA 5AQUB 3PACA 2G2YA 3H7HB 1OQ3A 1T9TA 4WZXA 2LSKA 4KQZA 3CD7A 3RZAA 2IVYA 3RR7A 3DLEA 2WSFC 1KDNA 1T9YA 2ZH3A 2AU0A 5LA6E 4WIQA 3TLSA 4ZZBA 2MBGA 2CQ4A 4OYXA 3ULHA 3LP0A 4MYTA 5DZ7A 2LHNA 4LF8F 2G4BA 3BPDA 4NUVA 2ZC3A 2X1BA 2ZITA 3KFWX 1KC8T 2H7OA 2IAJA 1RCXB 4ENOA 2HHPA 3EVYA 1PBUA 4OJGA 1WF2A 2EK6A 1J27A 4IRKA 3R5CA 2HHQA 4DMVA 3MWBA 1FKAF 1RAHB 2VB6A 2BR0A 2XLIA 1Q86T 3AA7B 3EJMA 3CJ0A 2J0XA 4URQU 3CX7B 2CG8A 1R0BG 4DPTA 4IDOA 3SQGB 3VQSA 4IOAQ 5F8LA 4WXOA 1U1NA 2W62A 3OW2R 4AKGA 4QU6A 2CDRB 5BMVE 3IG1B 2GHWA 2GIQA 4L9IA 2NS1B 5A1LA 3T3FA 1R0CB 4I0UA 2XM2A 3POTB 5C3JA 2LQBA 4PW8A 3KVAA 3EE3A 1UEVA 1WI6A 2ROEA 3CIRA 2LEBA 3NVOA 4BA9A 4J37A 3MD3A 3FMWA 3W15B 3DHWC 3PUSA 3V6DA 4U72A 1NSQA 2XGQA 4A4JA 4CQ1A 2V8PA 3ZMUB 5E2QA 3VZHA 2MYSA 4EUVA 3GJRB 5HMXA 2WAQD 5LMUJ 2ZM8A 3KKFA 3JYTA 3MKDA 5I3PA 2DIUA 2CPEA 4EFAC 2DR5A 2JX2A 6FD1A 5D78A 1S0MA 5H6RB 1ZM9A 3EYZA 3N2KE 1NK6A 4PQUA 1SQFA 2XMTA 1W0AA 1CJVA 4DQRA 1MU2B 3QMQA 3UCZP 1BWEA 1IZNB 3V5UA 3OTOJ 2FZGB 1QY7A 3IF8B 2UVVA 2XQ6A 4IO9Q 1DTTB 5CXTA 3FSIA 1FWKA 5CYMB 2YN6A 3ESLA 2M3DA 3S1TA 4MT1A 3KTQA 3HVTA 4IG0A 4CO2A 4UOCA 2QZ8A 2XMMA 5J2QB 5JQGE 3NRXA 4RBTA 3R1HA 1LV5A 1FCAA 5AXLA 3MEGB 4PR6A 2CWYA 1Y3JA 2RQCA 5T14A 3RF1A 2KO1A 2HQ3A 3CVRA 1YJUA 2ZOFA 1Y10A 4N78D 3AT1B 3QB5A 4NMXA 4M5HA 3KJQB 4IYQA 1JLGB 1C1CA 4K4XA 1X9BA 1C1BA 3T1YJ 5MLCV 2W2OP 4Z7YA 3FQKA 4LRDA 2CPFA 3HPOA 3AAIA 2C42A 4JI1J 3IA0A 1VYAA 2KXPB 3JAFA 1S6PA 2LA4A 2LEAA 1U45A 4WJBA 4MMOA 2IJRA 3L3CA 4LRFA 2DNOA 2DT9A 2VFVA 1AXQA 2Y3YA 3CD0A 3DC2A 4MK7A 1XMOT 4EZHA 5ETPA 2V7KA 1W26A 5J2PB 4QCLA 2ADCA 5L4HA 3EVMA 1MN9A 1WFDA 3GIMA 1RAOA 4YQWA 4C97A 4DPYA 4ZN1A 3V6JA 1BQMA 1WF1A 3TAPA 4I55E 2ZH5A 4KTQA 3ZC1A 2LEHA 3V4MA 5KT4A 2WBLA 2XS2A 2LCWA 2FC9A 2Z57B 1K73T 3ZSSA 3ILIA 2GZOA 1PKUA 3GILA 3Q8UA 3QFWA 4P7VA 2B5JB 1HQEB 4PG6A 2ZBCA 2V7JA 4OZ3A 3H90A 3DOLA 1VLYA 1MIYA 2OPSB 4M1PA 2LVWA 3HM9A 3C3LA 1CHUA 3Q86A 5KFJA 4O8SA 1SIWB 4UZCA 2OPRB 3MEDB 4GO5X 3MFIA 2HRTA 3K5NA 3TEGA 3M1VB 2XMUA 3O3LA 2DGVA 4NLOA 2V68A 4UQGA 5K8OA 3OPKA 2VPXB 2EFGA 1NJZA 3AE7A 3PX6A 3TJAA 2MQNA 1U09A 2DH8A 1Q95G 1HWLA 3DLEB 1KQGB 4LF4F 4JI0F 3QRPA 3CJ4A 1ZV4X 4OV6A 4NCGA 2FJDB 2OA5A 3ILLA 5DS7A 2R7RA 5LMUT 1W25A 3HSZA 2D1CA 1VRBA 1RAGB 1WCRA 1N5QA 2IAJB 3HD1A 3F2EA 1WORA 3M65A 5ETWA 3BR8A 4CZZB 3UU5A 3P4SA 1TUWA 2HVZA 1LXNA 4Q44A 1LWCA 1MMAA 2JEFA 3OTOT 1YQ4A 2YWFA 3MM6A 1QE1A 1IBLF 4OZ5A 4FXWA 4WYVA 3BGLA 5DJBA 4LT6A 3Q2TC 4CH0S 3D1QA 1GNKA 2XTLA 2J7UA 5C2CA 1UK5A 2FJBA 1F5CA 4LVOP 1W09A 1WEZA 2DEIA 2D9PA 1RT3A 4LR9A 1TK0A 2EWHA 5IC6B 4FXVA 1ZAVA 2XULA 4I2PA 4DUTA 3GQCA 2D41A 3QFHA 1U0HA 5JJBA 4H63H 2Z4PA 4Z91A 5HLFA 2DEJA 3I82A 4YTNA 3O6QA 4KY3A 3RAMA 1FWPA 3V6DB 1WYBA 2XB2D 4YY3J 3TZWA 1VDHA 3HP6A 4LMZA 5F9NA 2NSCA 1VQLS 3K57A 1IBMF 4ZLPA 2EHOD 3DM2B 2CPJA 2XY8B 1JK9B 3T1YT 1URNA 1KHVA 2MKJA 3O2IA 5IYZE 3LALA 1NPKA 3H0PA 4JI1T 2M6IA 3NWRA 2CKWA 5KFVA 3PM9A 5E3QA 2NTXA 4MFBB 4ED0A 1CJVB 4CLUA 2UZAA 3QT7A 4MYUA 3LUYA 2DR9A 1MWZA 5DGAA 2RPAA 4ANDA 4I6WA 1X0PA 2V4RA 2FBWA 3IMQJ 1WHYA 2Q9QC 3G6VA 1NK0A 4LSLB 1ZH5A 3KK1B 3QGIA 2MTLA 4I6YA 3RB6A 3O9XA 2VBWA 3HVTB 1NDPA 2PA8D 1YKEB 2UV8G 3FBCA 5ADZA 2BXJA 3FZKB 3PO4A 4DWIA 4DQSA 4IE7A 2VIHA 1RU2A 3D1OA 2D3OR 4LF7F 1IM4A 2KH9A 1X4HA 2AD9A 1F9FA 4TLQA 1AROP 1YJRA 3Q89A 4ILRA 4I64A 2O3DA 1QAIA 2X1GA 3TJ9A 1C1CB 2IRXA 5LJNA 1X4DA 1K0TA 2B4PA 2I38A 3Q8VA 3HI9A 4CXYA 2H51B 4WP3A 4LBIA 2DHSA 3H59A 1T03A 1XMBA 4IHJE 5FIIA 2QYWA 1NK4A 4F0HA 4XK8C 1N48A 5GAHU 2J6TA 1S6PB 3GYXB 2UVWA 4ISTA 4ED3A 3QRRA 4G63A 1HI1A 2BW7A 3OUYA 2J7KA 2D3ZA 3M2VB 3AQPA 5I3UA 2OMLA 2BS4A 4O44A 5D0RA 5F5WA 4QXHB 1ZAWA 4PFOA 4CXXA 3FFIA 2FZCB 1ZA1B 3AE9A 4DBQA 4EGWA 1X5PA 4OYPA 2LRKA 2CXEA 2CUYA 4BWJA 3IRWP 3M6UA 2KJWA 3A3OB 2XAGB 3IWXA 4ISSA 4I2QA 1RWOB 1V9DA 1TK5A 2CHNA 4CWBA 4N8NA 3OL6A 4K4TA 4GC6A 3MMAB 2JMHA 2IUBA 3C15B 4ZMMA 4RNFA 5KFYA 4K5RA 3CNQP 5FXZA 3LP2B 4QX7B 2QA1A 3DOLB 2HLUA 3K5PA 3UD4P 1B7FA 3U78A 3K5LA 4DR2F 2DWGA 2NQPA 1FNMA 4DJBA 3TA1A 4JI0J 3FSYA 4KBMB 1N36F 2XHEB 4KO0A 3HHLA 4USKA 4AQYF 2IFXA 5CAAA 5FLXY 3MEEB 3OTEA 1R6VA 3KG0A 5L47A 2P9EA 4DX5A 3HKWA 2CA5A 1LFWA 4MJKA 3TANA 5KFGA 2XUEA 1Y4ZB 3D6HB 3VALA 2LXIA 4YY3T 1YJ7A 4L72B 3UNYA 3SV3A 2W2NP 5EDWA 1L3VA 5GMEA 3JAMY 4NLPA 1N5YB 3GV5B 1ZAXA 3RIAA 2HFOA 4DCPB 4DF8A 4U3CA 4A5XA 1IBLJ 2VG5A 2XPKA 1W9RA 3I0SB 4I56A 3LW5C 1KEYA 1KOOA 5I42B 3FQLA 1NPRA 3PXGa 2ZDOA 2B8QA 3PFOA 3R9LA 5HMZA 1P6TA 3JADA 2XQYA 3MR2A 4HLBA 4PWUA 3UUBA 1CPZA 1OXZA 2XTJP 5BJRA 2RAQA 3C19A 5A8WB 4QR2A 2YKOA 4ZKAA 1RCOB 3MM6B 4QYZK 4RZRA 4F0MA 1EHWA 5J2UE 4K0KF 4U7YA 5LOQA 2XSJA 4BDPA 2ILZA 2OH2A 2YNGB 5L8RC 3SFEA 1T8EA 2AJQA 2KFYA 4EBDA 2WU5A 1IBMJ 1KQFB 4ZVTB 2D0UA 4O4IE 2QLXA 1BUXA 2ZBPA 4DR7F 1S7HA 4ID5A 4PWDB 2A3DA 3TLWA 2DGQA 2R6GF 2EKYA 4I2PB 1NDCA 2OPPA 2XYPB 2RKIB 1HHTP 1DBDA 2K1RA 5E33A 3ZTOA 1MW7A 4IE5A 2DRDA 4ZPTR 4EZ4A 2CNKB 4FF3A 3NNHA 5BR8J 1SJ3P 2QA2A 5K20B 4BBYA 1ULRA 1TZ0A 2E1MC 3HKDE 3DU5A 4P52A 1LWEB 1S1XA 3MCNA 2IVMA 2RB7A 1HBNB 3OJSA 1JLQA 1Q7YT 3PUWF 4LSZB 4X2BA 3C6UA 4ECVA 1S1TB 1MSWD 4OYOA 2J0WA 1XNQF 2PC6A 4F4WA 4H4KA 4FXDA 1TL4A 3NAHA 1RAAB 1XWMA 1K1QA 3CPZA 3G06A 1L3TA 2K24A 4DXLA 2GVDA 1N33J 1LW2A 2R3VA 4UVCB 3J80Y 4OHVA 2JRSA 4CQIA 3ZZRA 3ZSTA 2XY7A 2KI2A 4DUYF 5EUHA 2XQ5A 4M5GA 2BZ2A 3HJFA 2YQ0A 3TR5A 3HSJA 4JI6J 3WX8A 5GAEI 4ZPDA 5D4PA 5LGUB 1R43A 4LFBF 2FZKB 4DZ6A 2KXFA 2DNKA 1BWVA 1RWWB 2RJZA 5KFWA 4M94A 2XNRA 2YWEA 2RRBA 3LP1A 1TL3A 4WU3A 4YOEA 2OKQA 4CO4A 3WIVA 2BBHA 4GKJF 3ADAC 3OR2B 4I4BA 1NHKL 4Y2KA 1H98A 4PG8A 2CADA 2MSTA 3FRZA 4JI0T 2VQFF 3S4UA 4FYVB 2PBIA 2I1RA 4X4OA 2RHSB 4TYBA 2F8MA 1T03B 4IFVB 4PNIA 2VBYA 3W9HA 1WI8A 3DGPA 2DY1A 4FF1A 3BKUA 1I94F 4WZMA 3UVJB 1R7IA 2DNPA 4F26A 1X5SA 2YY3A 4WKRA 3IR5B 4IDZA 3EGWB 4O44B 1CQMA 2H7VC 4FYXB 2M4MA 2DXDA 5A76A 2G1DA 5J2TE 5HEOA 5AE3A 1YBAA 5E3CA 3NMAA 3US5A 3UQ7A 4JP8A 2WOMA 3LQVA 1IBLT 1HWKA 2UUTA 2GHPA 2XYHB 2WP9A 3KLGB 1UWBA 1YWXA 4X5TA 3RQWA 2EXUA 3BQ0A 4DR2J 1GTHA 3E8OA 4NIQA 2XAFB 4DCOB 4I2QB 4JI8F 4LF5F 1N36J 5IV3A 2Y8DA 4F4YA 4IH7A 1VIXA 4AQYJ 4H54A 1SIZA 1Q8LA 3ZC0A 3D1HA 3AVSA 1P9YA 2GQ2A 4Y2MA 5EHHA 1SJQA 2IC6A 4C7QA 3ZZOA 2MKCA 3MK7C 1NWMX 2Z6EA 2ALYB 4KYZA 5DLGA 4RU2A 1KK7A 2GVZB 2FHKA 3K3OA 4ELUA 2GJFA 2H5JB 1HBUB 3PVXA 3NGRA 1IBMT 2V69A 3DHXA 3EPIA 2Y8YA 3PW5A 3TVYA 4FDFA 2OFHX 3T5JA 5L1KA 2HRYA 2L41A 5KFSA 5AQLB 2KZZA 2XMWA 1S1VA 4C3MA 3BS9A 3T6BA 9ATCB 3CC4S 1L3UA 3RRCA 3GYGA 2XC9A 1U8WA 3OSPA 5JDFA 2JVOA 2BQ3A 2CQ0A 1V9OA 2HMIB 2BQRA 4DR1F 2QTWA 5BR8T 3GIJA 5B0CA 3KG4A 1NMEB 3S6EA 1XERA 2FD2A 2BVLA 1FTCA 2W9BA 2JFKA 5JR9A 3JTOA 4QR1A 2AYGA 3DDNA 2VG5B 2RF2A 3LA0A 4K0KJ 4MALA 1UETA 3I31A 4ZIVA 3N9QA 3BSAA 2PJQA 4IL9A 2KHCA 4PXEA 4X4QA 5H6QB 2LXFA 1WYCA 3FBZA 4K5SA 5K8MA 1FRMA 4TQSA 4WFYA 3GP9A 2N82B 2IJNA 4NLWA 1SKSA 1Z2LA 3CTRA 1UJ6A 3QNUA 1W7WA 2R7XA 4C8ZA 2JRKA 1N33T 2L3LA 2HNYB 3TUJC 1SQGA 1MWYA 3C8YA 4P6QA 3C6TB 4CTAA 1V5VA 5IFMA 1PIEA 4E7SA 3N6NA 3NMRA 2W4CA 3DCAA 4MIAA 1FJGJ 2QSFA 4OI1A 5DG8A 2IYGA 3R84B 5E0OA 1OEDC 4JI6T 3W9IA 4X84A 2N7CA 2X3GA 1H7WA 2V2VA 4LREA 3TW0A 2HGLA 4PUOA 4DL0C 1HMVA 5JREA 2I0MA 1VQ6S 2DGUA 2V9WA 1VBZA 4ZPAA 1F60B 2QV6A 1XNQJ 2CYYA 3H37A 2DNHA 1F3FA 4M5DB 4X1KE 1Q7LB 3CCWA 1QAYA 3AEAA 1MMNA 3PYFA 2FVSA 2DCUB 3ZMZB 2DCFA 3TAQA 4WFZA 3M3ZB 4C11A 4YHHF 1U4QA 3Q24A 2FGOA 4DL5A 4DPUA 4URGA 5L38A 1Y11A 3D6TB 3I4PA 4JV5F 3PJ9A 1GAOA 3K7RA 3AXMA 4LJMA 2DXFA 2F40A 4LFBJ 2PA3A 3MR3A 2LMIA 4X1YE 2MLZA 5EGYA 3KHLA 3CXCR 2WONA 4UW2A 2CZ4A 2YNIB 3NAIA 4GKJJ 4M5IA 1HTJF 3HKEE 4DR2T 2CQ3A 5HXRA 1HNZF 1X8DA 2VQFJ 4JBWF 3PKMA 1RT5A 5KG2A 1N36T 1S6OA 4WZQA 5U47A 4AQYT 4HEA9 3CW2C 4M5MA 1JIHA 3DLBA 4CZCA 4H9SE 2H4YB 1TV6B 1VRUA 4JI7F 3D68A 3GFHA 1EJ7L 4PYDA 3LP1B 3B54A 1I94J 4ANCA 1TL3B 1FT8A 4U8VA 5A2QU 1PYSB 3KLIA 5C24A 3M05A 1UEKA 5JVGQ 4L6V3 1FNXH 3TVKA 1L0VA 2CJBA 3SEOA 2NREA 3DI6A 4RO0A 3D7SB 3W65A 3M6XA 3GB0A 2WB1D 2I6WA 1E1HB 3OPCA 1RGVA 4QW8A 5CB4E 3DKDA 3PW4A 2QRRA 2VFUA 1KTQA 4ZHRB 1LFPA 1TL1A 3QGPA 2R7UA 2KG0A 4K2JA 1IJEB 1NEKA 1EQMA 4MKYA 3R6NA 1SC4B 2P9BA 2PE8A 1NK8A 3P6YC 4DDFA 4DEZA 5KFOA 2Z30B 4K0KT 4V1Ak 2KZMA 4Q25A 4Y65A 3CMLA 2K06A 1PYTA 3TUPA 1UL3A 2DGSA 3B82A 1M5KC 4DR7T 3PR4A 3ABVA 2HAFA 1S77D 4ZVOB 2KRBA 1XNRF 3C4WA 4ATNA 2JEGA 3ZO7A 3M9OB 3P4QA 4H63V 4P10A 5L1IA 5SZTA 4DR1J 3P5BP 4JI5F 2YKNA 2JDJA 2E2AA 2NYIA 1FJGT 3RAXA 1OS5A 2MHNA 3UD5A 2ATCB 2CNLB 3CO9A 8ATCB 2X0LB 1NAQA 1DHMA 1S1VB 1DRZA 1I6ZA 1MN7A 2D9OA 5K8NA 4XO0A 1RLCL 2BJDA 3SIPB 3P49B 1XNQT 3J81j 2ZH2A 3OR1A 2IY5B 1GMWA 2W9BB 4DOZA 5F8MA 4FS1A 3VGVA 1GT8A 5JR9B 4OYKA 5L4EA 5C42B 2RF2B 3THPA 4K2XA 5TAOA 4PXBA 4F04B 2JJ4D 4X64F 2LLYA 1VCTA 2WCAA 1RHJB 4X62F 2RILA 2R7VA 3DLKA 4A8QA 3ANWA 2G2OA 1YIJS 3VAGA 5C7PA 3P96A 4U96A 1RYSA 2C3MA 4LFBT 4F4AA 2M8DB 2BJ7A 4CI0B 1UJ5A 1B99A 3M8PA 1SL1A 1ACMB 4BC9A 1X4AA 5FD1A 2JLEA 4RL1A 5KFEA 2DNGA 2FDNA 4QH4A 1RWUA 4ZS2A 3MPUB 1ZM3A 4GKJT 2ODVA 4HI2A 1ZM4A 3CCZA 7FD1A 1IWGA 1IKVA 1JKHA 2GMLA 5KFMA 4QIEA 5AJ3F 2VQFT 3HK2A 4ETXA 4W92B 5RUBA 1LQ9A 3RTVA 2RS8A 5DDOC 3R5GA 1YZ7A 5LJMA 3IO1A 3UU4A 1XTZA 5HP1A 5HXCA 1P8GA 1VQ5S 1I94T 3W64A 1Y00A 4JV5J 4ZJQA 1URRA 2X1AA 4KGXB 3UCGA 4EXTA 1O51A 2VKOA 2DHGA 2HRUA 1JX4A 3FCWA 4NA1A 3MECA 1D0EA 5KT6A 1FDAA 3BO4A 1NEEA 2RA1A 4UF4A 3FZFB 1I51B 4DMWA 1Q8KA 3C64A 1PYOB 2QIFA 1WELA 4OI4A 5HO4A 5G4DA 4C4WA 1MG7A 3QT8A 1RP5A 4ANJA 1NJWA 1HNZJ 2K7JA 3WI3A 3W8PA 2IC9A 2VC1A 1X4GA 3EZUA 1SL2A 2FTRA 2ZH4A 1YGYA 3PUXF 3GCXP 2JEJA 1VQOS 2J1DG 4LFCF 3V81B 3GWHA 4DHVA 5KFPA 5HXHA 2H48B 4UOHA 4KHPF 3N5LA 1YRUA 3PUZF 2WONB 5HBMA 3TAMB 1TKDA 2V34A 1RBLA 4MFRA 2GO9A 4DUZF 2BABA 4NLUA 3B4DA 2ZNYA 3KDNA 1RT5B 2YNHA 3LTOA 1U2RA 4U7UD 2MZQA 1IBKF 2DGWA 1G7CB 3G8QA 2OMOA 3NBXX 1MNEA 2MZRA 1CJUA 1VRUB 4WU2A 4CM2A 1SKRA 2EHOC 5GAHI 3TLVA 4Q0BA 5A8KB 2LQ5A 3JQKA 1B7YB 1PJ5A 4RBUA 4EMDA 1JJ2R 5AXKA 1U1RA 1RHUB 4I67A 4OHXA 4DR1T 4L73A 3VF0B 2H3RA 5LP6E 4PK6A 3FZMB 4B3MF 4Y34A 1WR6A 3KMQA 3DI6B 4TU9A 3DXSX 2BRKA 3HR0A 2WVDA 2JVRA 5A6WA 4NASA 1OJ4A 3R7NB 3GFYA 4ICLB 5DQVA 2NW7A 2DLRA 2WAUA 1U2FA 2MB0B 5IT9U 1AT1B 3F0NA 2Z8QA 1FJCA 1IJ5A 4ERRA 1QUUA 2VONA 1JB0C 3K3QC 1KR4A 4H4OA 1RQ0A 2E7XA 5J1EA 2J76E 3PG9A 2WZHA 5ADXL 3THVA 4ILMA 2GQCA 3CDEA 3QO9A 2UXDF 3ET6A 1KRPA 4IUFA 1G1XA 2R7OA 4EBCA 1Z4UA 2Y1RI 1MROB 4GVBB 2OO4A 5CA5A 1S4EA 3MDFA 2V4JA 1S4FA 2J8SA 3LAMA 1NNDA 1EQ0A 5THWA 2HHXA 4JI5J 2FGCA 1RAEB 3HKZD 1PJ7A 3LANA 3QGHA 1N8RT 2UVRA 3ISZA 4KJIA 3KBUA 4QR0A 2AX1A 2V9KA 4KE5A 3BH6B 3OKQA 3FZHB 4GK5E 3QZ7A 5HL7Q 4UZBA 2B56A 2ROGA 1LW0B 5HEUA 2W2PP 3MTJA 1YD8G 2DB1A 1T7PA 1FK9A 1NB2A 4IDKB 2R7SA 4L3KA 3OL8A 3PKYA 1FFGB 3M8ZA 2CXFA 3OJAA 3D9BA 2YKNB 3AA8A 5D3GA 2UXBF 1KFYA 3DLGA 3H5SA 4KPCA 1M5OC 1HR0F 5LHIB 1UA0A 2M70A 2C1EB 3WHIA 2CLYB 4N56A 2CVIA 2VZ9A 4AL5A 1S0NA 3UU8A 4X62J 3N9MA 2EFOA 2HWTA 3HHLD 4JV5T 4JI4F 1KVKA 3OR1B 3QC9A 2EPIA 1C0TA 3KLEB 3NKZA 1NJYA 1EAYC 2C5KT 3HJVA 5E7OB 5DQWA 2CRLA 3PE0A 2DITA 2UUCJ 4XTTA 3ZT5A 4X20E 2XZDB 4WFBQ 5ABFA 3I1AA 2W4XA 4NCBA 4USHA 1NHVA 4A97A 3SSRA 3OBIA 2N2NA 1HNZT 3ANWB 1X4FA 4DQIA 4G3IA 1S97A 5FNVE 3CJ3A 4ZXLA 1H2VZ 2JLGA 2C2MB 4E7ZA 4U74A 2PTFA 4QWNB 4FPRA 5G0RB 3BEGB 1KS2A 1IQZA 4O23A 4Y28C 6FDRA 2E8IA 3DFEA 1DFDA 4Y3CA 2ZHAA 2KZ7B 3MUTP 2RP4A 2MJNA 1SH2A 4YLHA 5K14A 1Z1ZA 4HYKA 2C3YA 1UEUA 3B78A 2NR0A 2W00A 2MDAA 4CN6A 2OIHA 3C16A 3M2UA 3J81U 1IR2A 1LEOA 4LF6F 2HHWA 1B0TA 3DU6A 3CO0P 1TKXA 2Y1LB 1BQNB 4CN4A 4N76A 1HLWA 4ECRA 4BJNA 1RUSA 3QIPB 1D9AA 1QSLA 2DGXA 4A8OA 3MECB 4LFCJ 3MM9A 2JQ9A 5KFZA 2RHQB 1RT7A 3N2GE 4DL4A 3P4WA 4KHPJ 4FS2A 4I50E 2HBYB 2AEFA 2VG6A 1FXRA 2Y1IA 4QXBB 3RB0A 1T3OA 4HFBA 4FNIA 4IQXA 1RE1B 1LVFA 3G86A 4ILCA 2J8AA 2V6AA 3G82A 1BR1A 4KGVB 1IBKJ 2J9DA 1ZM2A 4KH1B 2K5BB 4LUBA 1FDNA 4LRAA 2BZBA 2AJFE 2ZH1A 1RT6A 4KHMA 1VC0A 1J5WA 5CH7B 1D1CA 3W62A 5HBMB 3I32A 3I96A 1KBRA 4DPWA 4JI5T 4KV8B 1UVIA 3W60A 3WC2A 1WOPA 4AUKA 3PY8A 2DWKA 4DR5F 1MMDA 5KMGP 1Q1KA 2W4DA 1R3NA 3FHNA 3HX9A 3GYNA 2ZLYA 5CCMA 2HHVA 3U1MA 3KOAA 1CJUB 2LSGA 3IR7B 2V2QA 4C0BA 3WX4A 4X66F 3T1HF 1UPMB 2QEXS 4JV2A 2HHTA 3OVSA 3J9X1 2CQGA 1XN9A 1UX4A 4Y00A 2UXDJ 1N4LA 3CIMA 2F7VA 1XR5A 3W2VA 4PZVA 3G8SA 1T05A 1EETA 3IC1A 1KLMA 4RW7A 1D9FA 2GMHA 3J7Z5 4X62T 1RA6A 3GJTB 1YW0A 4AD6A 3HSDA 1UVLA 3IAS9 1NJIT 3RH3A 4RUHA 4DSEA 5J1EB 3MFHA 3VAFA 3MMBA 2RT3A 3QO9B 2XY6A 4B9MA 3R7SB 3W5YA 2K2PA 2KT9A 2LU1A 4CI3B 2ZWPA 2OTLS 1TTHB 4O0IA 3VVUA 2V4JB 5AT1B 3AA6B 3EICA 5ETMA 4HFHA 2RUSA 2N9DA 3UE2A 1K0VA 5HEHA 3K3NA 3GZ7A 2UUCT 4CI2B 2ZH6A 3E3XA 2W8KA 2Z2MA 3Q5XA 2XQCA 3SWHA 2R42A 4B9NA 1HR0J 1T95A 1DTQB 2W9AA 1S1WA 1U48A 4HWHA 3T9NA 3RBXA 1S59A 2P6SA 5JDNA 1JNZA 1KEKA 1FK9B 2OELA 2Y48B 1ZTWA 1DAXA 2VJVA 2VODA 2E29A 5D4OA 1UTAA 5B0GA 2C28A 3R5JB 4YTMA 3RB4A 1LKXA 2CQDA 3DLGB 4W90B 4EB6E 3CE8A 4ZVFA 2CJQA 5DG7A 3PW7A 2NSBA 3BZQA 3I5AA 2DH7A 2RIJA 2J4GA 1LRZA 2NXCA 4K7QA 4USWA 4EAHA 4B17A 3U3IA 2LXUA
chains in the Genus database with same CATH topology
2FY8A 1XWMA 4G65A 1SUMB 4L73A 4YS2A 1T8BA 3RBXA 4L75A 2AEJA 2OGUA 1LNQA 2OLTA 4J91A 4EI2A 2IIUA 3JXOA 4J90A 2AEMA 4L74A 4J9UE 2AEFA 2BKNA 2BKOA 4J9VA 3L4BC 3L39A 4J7CA 4XTTA 4Q25A 2I0MA 1T72A 1VCTA 4RO0A 4GVLA 3KXDA 4L76A 2BKPA 3RBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FY8 A;  1XWM A;  4G65 A;  1SUM B;  4L73 A;  4YS2 A;  1T8B A;  3RBX A;  4L75 A;  2AEJ A;  2OGU A;  1LNQ A;  2OLT A;  4J91 A;  4EI2 A;  2IIU A;  3JXO A;  4J90 A;  2AEM A;  4L74 A;  4J9U E;  2AEF A;  2BKN A;  2BKO A;  4J9V A;  3L4B C;  3L39 A;  4J7C A;  4XTT A;  4Q25 A;  2I0M A;  1T72 A;  1VCT A;  4RO0 A;  4GVL A;  3KXD A;  4L76 A;  2BKP A;  3RBZ A; 
#chains in the Genus database with same CATH topology
 2MKS A;  5DAB