2BKNA

Structure analysis of unknown function protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
PKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Membrane protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bknA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bknA02
4J90A 2I0MA 1LNQA 2FY8A 2BKOA 2IIUA 2AEJA 1XWMA 4G65A 4EI2A 4J91A 2AEFA 3L4BC 2OGUA 2BKPA 4RO0A 3RBZA 1T72A 4L73A 4J9VA 3KXDA 4L76A 4L75A 3JXOA 2AEMA 1T8BA 4Q25A 3RBXA 1SUMB 3L39A 1VCTA 4XTTA 4GVLA 4J9UE 4L74A 2BKNA 2OLTA 4YS2A 4J7CA
chains in the Genus database with same CATH superfamily
1LWEA 3M2RA 3PKMA 4JUYA 4C3MA 5LB7B 1D1BA 3JAEA 2Y1RI 5LJ3Y 5E41A 4CYUA 2CXEA 2G0IA 1HNZT 4L74A 3QK6A 2KLQA 4DSKA 4DMZA 4GKJT 3KK3B 2W4XA 2FHJA 2K2PA 4ED5A 1LXNA 4LF1A 5FL1A 4CXWA 4WU2A 1TL1A 2ADCA 1HIYA 5KFBA 4JI0F 1OPZA 2ZOFA 1OXZA 2ZWOA 4QIFA 3KLVA 4ILMA 2BXJA 2VURA 4JP8A 1OIAA 3J7Yq 3GE9A 5GADU 4U96A 2R2RA 2Z2MA 1CJKA 3SDEB 1XNRF 1WACA 2WWUA 2OSQA 2HLUA 3IRXA 2UP1A 2DCUB 4AT1B 3H2LA 2HBZB 2R7SA 2QLBB 2F65A 1B64A 2CQDA 2XUEA 5GAGU 1KNPA 3QWUA 3FDSA 3QIDA 2AZ3A 3AA8A 1NJZA 1UCNA 4C9DA 2W7AA 4NEZA 4NRTA 1JXVA 2CPXA 3MHYA 4WNKA 3I1AA 1NHVA 2AE9A 3F44A 3VHLA 4L3KA 3BB5A 5GMEA 2UXBJ 4KQZA 3G9CA 5EN1A 5AQJB 3TLUA 1O0PA 4HKQA 3V6DA 2RU3A 2Y8DA 1NPKA 5IOLA 2IIHA 2CPYA 3PDNA 4LF4J 4RNFA 2F4VJ 1K0VA 4NXMT 2EKNA 3CD0A 3OL6A 4DBRA 5JR9A 1C0UB 2YQ1A 1H7XA 1HNWF 3OYXA 3MMBB 3PX4A 2JVOA 2M2BA 2V69A 2ATLA 2X67A 2D3ZA 4CCHA 3PHEA 2W8KA 2R2SA 4PXBA 1RT4A 2XHEB 1KRPA 1N32T 4MKVA 4ZP6A 3SDEA 1F5CA 1H0HB 1VQMS 2ACMA 4URSA 2ATCB 5FLXY 2YEVC 3LAKA 3DM2B 4ZVQB 4W98A 2W2PP 1HF8A 5IV4A 4UV8B 2E44A 1SH2A 2KHCA 2GGPB 1OWXA 3TANA 1T11A 2JFDA 5T41A 1RADB 2OHDA 1SV5A 3A7MA 3CVRA 3T41A 1HBUB 3L7OA 3JADA 4DCPB 3WAJA 3KVAA 2ZH8A 1HMVB 3WZ0A 3LW5C 2H3EB 4KY3A 2XEXA 1FNOA 4J9VA 5L2LA 1HR0T 2PMWA 2E5LJ 4USVA 4F8RA 1Y64B 1XMOJ 3M6UA 4PAAA 2CBJA 4CLZA 4Y28C 2CQ2A 3UPFA 1R3NA 5HVFA 1U26A 1PGZA 1B7TA 4NLSA 1IKWA 3QRPA 2ZKTA 4P52A 5A2QU 4NE9C 2K9AA 1FDBA 2DI4A 2CQ3A 3DOLB 3W63A 1G6BA 5DETA 3UUNA 2K5BB 1APSA 3RRKA 4ZIVA 1BD6A 3FBZA 5D3GB 3HD1A 2ASDA 3NCRA 3P49B 3AXJA 1REVB 1MMGA 3LGNA 2HS3A 1UVLA 2IBKA 1S6PB 3HA4A 3HKEE 2KU7A 1LW0A 4ED8A 3LO3A 2CJQA 3P5TL 3AEFA 4OYXA 5LMNJ 1RTDA 4YHJA 1P6TA 4P6QA 2OPRB 4I0WA 1RAGB 3KV5A 4FYWB 2WWVA 3UI3A 4X66F 4U7UD 2IMWP 2HQ3A 1AZSA 4QX7B 2CWYA 2JEGA 1YLXA 3OLAA 3NBPA 5CA5A 3LGHA 1SH0A 4LRDA 1FD2A 5M2UA 3FB2A 2V7KA 2WB5A 2HPUA 2DCFA 1XMQF 2DPIA 2CQIA 4XPEA 4J9MA 3RB0A 4ZLJA 3CQCB 3TZZA 4TU8A 1EETB 2A10A 1YQ3A 2JQ9A 3T6JA 4ZPVR 2DKOB 4TV9E 5KFIA 4M63A 4EWTA 2LLZA 4ZI3C 4ZJQA 4EEYA 1Q0NA 1PBAA 2J7UA 2MDAA 1NH8A 2JDJA 4YFUA 3GB0A 1Q5YA 1ZAXA 2E9ZA 3TARA 1FA0A 3ZT7A 2O1PA 4AKRB 3K2YA 5KT6A 4B3TT 5L3BB 2PD1A 3I6PA 4IRDA 2RP4A 2W0GA 4I6AA 4UY8T 3BKFA 3QZ7A 1UVKA 3I9ZA 1TKDA 3F57A 4P75A 4CLUA 2G2YA 1F3FA 3D6FB 1XNQT 2VH7A 4JI0T 2D69A 3Q5XA 1RT1B 1C0UA 4ICLA 5BMVE 1LKXA 2Z2LA 1N33T 2FJEA 5LBMA 1XMBA 2JJ9A 1RACB 2MKCA 4R25A 2LKZA 2E5LT 2JMKA 3MCOA 4QJVA 2MKIA 4ED7A 3OXFA 3H25A 3H59A 3I55S 2XBPA 5KFFA 3DRPA 5A0YB 1TUWA 2YNHB 1TK0A 5LM7E 3O6QA 1X60A 1UGOA 4ZVUB 3MA9A 3MD1A 4ZP7A 4KT0C 2FJEB 4P71A 1PYTA 3T1HT 3OVUA 3HCXA 2QVAA 1VFJA 1IJ5A 1VQYA 3ITHB 1LW0B 4DR4T 2DGWA 4GYRA 4DMVA 2FJAA 1S6QA 1HI1A 1RKIA 2OGUA 1U6BA 1TMMA 4B9LA 2FB0A 2AJ0A 1LFPA 4ZVPB 1AYEA 2RRBA 1OWAA 1NSAA 1Z2LA 4BBYA 3SOLA 2IMOA 4ELUA 1OQ6A 4B9TA 3EPGA 2OFGX 4IFVB 3W61A 4OV1A 5HMXA 1WYCA 4QWNB 3RZAA 2BDPA 1IJ6A 3M2RB 3C15A 5AQHB 1FKPB 4U95A 5DG8A 5D78A 4DUZT 3MFIA 2CPEA 1IBKT 3ETVA 3MMCA 3KMQA 2WW8A 2QJ3A 3MM5B 2V26A 2B4UA 3KJQB 4WE1A 4DR4J 3GMGA 3FCWA 4PJLA 2KZZA 1VRBA 4HDHA 4EOZB 2R7QA 4UELA 3W5XA 2H7VC 4EXTA 5FNVE 3NBPB 2IA6A 1WELA 2QMWA 2COLA 1RWXB 4EZ9A 2QSFA 1FRMA 4TX5A 1LQ9A 1XJWB 4M5DA 2AGQA 2QLFB 4HFEA 5ETNA 4NZ6A 1FX2A 4BJMA 5IFMA 3Q8YA 5EK3A 2DNZA 4I4TE 4LFCT 4JBCA 4XDDA 2B4VA 2XYPB 5KFZA 4BC7A 5DJBA 2IY5B 2AHOB 5AT1B 2OPPA 5KT2A 2VC1A 1KNZA 2V7IA 2I6HA 1X8DA 1NDPA 2OEMA 1FI4A 2YU2A 4HHJA 4NLVA 1SIZA 4A97A 4WBOA 4UVBB 3BN4A 4A8MP 3V6KA 2CJKA 4AQYJ 1RYRA 1CULB 3GG0A 3QNWB 3TJ8A 1YWXA 1DURA 5ETSA 4PZVA 4QYZK 4YTPA 3RGLA 3LDQB 4DV5T 2W67A 5AQQB 2DO4A 1IBMF 1BXNA 3N9PA 1B0PA 4TN2A 2R4FA 2D1CA 4EYUA 3VAKA 2BG9B 3SV4A 4UW2A 1CVJA 1RXOB 1LWXA 1C0TA 2G4BA 5L1IA 4QCLA 3DM2A 1UX4A 1VIOA 4G1QA 1S57A 5D4LA 1UPMB 2CQPA 4CDIA 3OTEA 1CPZA 3ZYKA 2VKRA 3CD6S 3MI7X 1AXQA 2H4WB 5A8RA 4Y0FA 3OL7A 1QAYA 2GMHA 1DQ8A 3V5UA 4PWUA 4DN9A 3ULHA 4WFAQ 4JI3J 4Q44A 1T72A 4OX9F 4QXHB 4RW4B 2OH2A 2F1FA 4KKOA 5AQSB 3EUHA 4KGVB 2E5VA 2D7SA 4K2JA 4UV9B 5G0RA 1RSCA 3UULA 2V8GA 3PR5B 3DTOA 4LF6F 4G1QB 4DFKA 5L4HA 1U4QA 5L47A 1NH7A 4C8KA 4AQYF 2UZAA 5EX0A 4ILBA 1WC4A 2D74B 3D9BA 4LVNP 1IR2A 3OJUA 1QLNA 3DDKA 4Y65A 3GTYX 4DV1J 3GYGA 4EUVA 4DL0C 2JC0A 4RJVA 2AKWB 3DRSA 4O8SA 2JPFA 3DJBA 3DLGA 3C4WA 1WOOA 2V8PA 3QSIA 3RJMB 4O0NA 1U49A 3O4XE 3AH6A 4QIEA 1XQIA 3J7ZT 3TJ9A 4YHHF 1M5VC 3NGTA 1A6LA 2JOQA 3WC0A 4WXWA 4OI4A 3R9LA 3LP0A 1IKYB 1REVA 3MECB 4JV0A 3CMQA 2AX1A 4FYVB 1RP5A 1HKAA 3FQLA 5JJBA 3K3QC 5EHHA 5KFUA 5L46A 2EHOB 3O1HA 1MIWA 2HQDA 1M5SA 4U7CA 3T1HF 4NXNT 4FBUA 2OPPB 2XQYA 3I5BA 3TW0A 4OZLA 3HXMA 4OYMA 4CI2B 2V6YA 2IPOB 2YKSA 5AXKA 5LMUJ 4A48A 3AVSA 4C8ZA 1UFKA 5EZYE 2DGXA 5CJ5A 4ZJOA 4IQXA 4CNYA 4MYUA 5D77A 3RB6A 1WCRA 1WHYA 3BR9A 2V4RA 3BQ2A 3MCSA 3NGSA 5DQGA 4NXMF 3EUNA 5ETTA 2DNKA 4RO0A 3UDEA 1QUPA 1NKEA 5FYMA 3BK9A 1UFLA 2J8AA 4KV8B 1EQ0A 3EDQB 1HNZF 4FF1A 1SJ3P 3N28A 3B8HA 2G2OA 4K50A 2IFXA 1RISA 2IM0A 3CX6B 3AQPA 2IA0A 2NREA 2HHQA 2GJFA 1GX6A 5JQGE 2RIJA 1ICEB 4P09A 4DHVA 2WBLA 2YX1A 1M7KA 4DV6T 2HHHT 1UJ6A 4LVOP 2YU1A 3QUJA 4HYKA 3MECA 5AXNA 1WEXA 2VFSA 5H1SV 2Y1JA 4NZ0A 3AE5A 3HO1A 3AB4B 2DVIA 4LMKA 2ODUA 1AA1B 3HHDA 4X4NA 5E3PA 2VQET 2AEJA 5LMNT 4WK3A 1LEOA 2ODVA 3M05A 1K8AT 2W25A 2FZKB 2OIHA 4HTJA 2AEMA 1Q8KA 3CCWA 5DDRC 4YTMA 3ZMTB 3UD4P 3CCSS 2BJ9A 3JQMA 1IM4A 5HWYA 3VCDA 3LWMA 4F4KA 2YWHA 3EVOA 3VU7H 1H74A 2GIFA 2V68A 5FP3A 2CKWA 3VVUA 2VD3A 4YJ3E 1A0OB 5IM0A 3U7JA 3NP5A 1C2PA 5DZ7A 2WVBA 4NYZA 2XULA 1WF2A 4NLQA 3OR2A 1KOOA 2MOZA 2BE2A 2ZVIA 1RHUB 3T5HA 2MKJA 4YSXA 3O44A 4AKGA 3RI5A 3V81A 5C42A 2YPYA 3RB3A 4CN6A 2PFDA 1RT1A 2XWXA 4ZP8A 2CWOA 1LK5A 4WW0A 2XGQA 5J2NA 3HULA 1M0SA 4RW6A 3EJMA 5HK4A 4OX8A 4RX6A 3EI0A 5CGMA 3D1HA 2BDEA 1HR0J 3GYNA 1S72S 2CHOA 5AFUL 1FT8A 1LNQA 2MQQA 3ZZYA 2XPKA 2ROPA 1D0XA 4I2QB 5AE1A 2DRAA 1HNWJ 2KMFA 1SL1A 4K0KT 3KUGA 5IT9U 2SXLA 5HQMA 4QH1A 3KG4A 4ZHRB 3EPIA 3VKHA 2D0UA 3G8TA 4CN1A 3VZHA 3H5SA 2W63A 3MAHA 3DKDA 1EB0A 1M90T 4U8VA 3Q8RB 5HLFA 2XQ4A 5HJYA 2LCWA 5IWAJ 2RNEA 4PXCA 2WHOA 4LIWA 4IH6A 5ETWA 4TXSA 2V7LA 3GJRB 3NOGA 4X20E 2DB1A 3CB4A 4UTGA 4UOFA 2PJQA 3M1VA 4DPUA 4EYYR 1L3KA 3IR7B 3NOCA 2UUWA 3D1QA 2H48B 2CQBA 2LKHA 2FUPA 4J5OA 3QJPA 2PT0A 3RR7A 3DRRA 3QGPA 1T03A 3GWCA 2MSTA 4OI3A 3FBEA 3P8BB 4EMDA 2K7JA 5KFAA 2EFVA 5KFKA 4GYSA 4DI6A 3TX8A 2MZQA 2XASB 4P7VA 1SV5B 1RCOB 4ES2A 3MPYA 3QGHA 3K3OA 1JQGA 2DY9A 2MY7A 2ZKUA 5JDQA 1KQKA 1S35A 4R5PA 2LM9A 2HHPA 1HHTP 2UUAF 3FVYA 1W2BR 3RC8A 4FVCA 3QZ8A 2HBYB 3CDBA 2J9EA 2KJWA 4F0HA 3DNCA 1UX5A 3O1JA 3PXGa 3PEJA 1TKXA 4CO5A 4M5DB 4TNVA 4KYZA 4W90B 3TVYA 2GQQA 1U5PA 3EICA 1S1VA 2XMTA 3HX9A 1OJ4A 2BQUA 3GV5B 4WE1B 4L75A 2LEAA 2PEBA 1RT7B 3LBXA 2YNFB 3HFZB 1VRUB 4RW6B 3PRDA 4GC7A 3BV8A 3HLUA 5C25B 2LYVA 4DV6F 4RNHA 3GR1A 4IH5A 3NEKA 3CXCR 3RQUA 4KKOB 1LWCB 3DLJA 2HPLA 2KXHA 4F2RA 1ZH5A 4JI2J 3ENWA 1NEEA 3TEHB 4JI4J 3DLHA 1R31A 2HNYA 1W25A 3KLGB 1PYSB 3HVTB 3PW7A 3JYTA 5LT5A 3GPAA 3MPUB 2XMUA 3NNAA 1MROB 4M5NA 5BR8F 4ZN3A 2EEYA 3EE3A 2WAQD 4KC5A 1REGX 2LXFA 3R2DJ 5LXRA 4F4YA 2J0SD 4OK0A 3V6DB 5F3TA 2WDQA 2CQ1A 2WVEA 5JREA 4B3OB 1FKOB 4KFBA 2P9BA 2CJXB 1HYSB 1FE0A 1T9WA 3AXKA 3I87A 4NLTA 4ID8A 2J76E 1UTAA 3W2WB 4HFDA 4F8HA 2DGUA 5F8LA 3T3FA 2XI2A 2KXNB 4QR2A 4NYOA 1BQMB 3SIPB 3RG6A 5DDPC 3DXBA 1JX4A 1IQTA 2I9SA 1US7B 2LU2A 3RIFA 1TMJA 4O4JE 3K8VA 1BWVA 2FY8A 5H9EK 4ILRA 2BOPA 1WJ9A 3QO9A 1T9VA 4UF4A 4EU0A 1D9FA 4DCJB 4B3TJ 4MALA 2GS8A 2C5KT 2W62A 3O5TB 1LWCA 1U25A 4OYBA 1HFEL 5MLCV 4I2PB 4LF6J 2YKAA 4NWBA 2BR0A 1RU2A 3ZSSA 3ZT6A 2AJQA 2Q3PA 4MTPA 4RUBA 1OEDE 3MURP 1KEYA 2XI3A 3LQVA 3N2KE 5LOVE 3ZKRA 3HSZA 3RRCA 2ZNZA 3HF5A 3QYYA 4JOUA 2M67A 5DABA 1DTQB 2U2FA 4FYDA 3ADAC 4DV0F 5LGNB 2EBGA 2B1EA 4TLQA 2N1GA 2PI4A 4JV5T 1AB8A 4KRWA 4EEDA 1GMWD 5FIIA 1YBAA 1YKEB 2MY8A 4CZZB 1JLBA 4JBWF 5B7WA 5C2GA 1QUUA 2UXNB 3ICLA 2NUUG 3POTA 4QWBA 1FERA 3J81U 3D4JA 4LF9F 5DQHA 1T3OA 2X1AA 4YFSA 1RTZA 2RT3A 1ZZNA 2VPXB 2WY2A 1GMWA 1Z1ZA 2KTQA 2OKQA 5DRKA 5DQIA 4DR7T 1F9EB 2Y8WA 1N6QB 1S6QB 1HS7A 5A2QY 5GONE 5HVHA 4YB7A 4NCGA 4CLYA 2AX0A 2W9AA 3C15B 4OI2A 1NBEB 1VRQC 1J5EF 3BN7A 5AQVB 4USJC 3V6JA 4P2FA 5FVKA 3ZTSA 4U33A 2DEIA 4JEUB 4QYRA 1N0VC 3THPA 3VAFA 5H9EJ 2B6AB 1FKPA 4B9VA 2QEXS 1SB6A 3PUGA 2BABA 3ZZOA 3AE9A 1ZAWA 3FZHB 3PRVA 3SQOP 2N9DA 3CD7A 1GQEA 2E7VA 3CDAA 2DL1A 1Y01A 1X0PA 3VR9A 2DEJA 2X7IA 4ED0A 5K5MA 3SFGA 3F56A 3MEGB 4ISSA 2MEWA 4JB8B 4IE4A 3R27A 1I1GA 5KFNA 3AE2A 3N5LA 3I4HX 8RUCA 5JVGQ 1R43A 1R0AB 3U1MA 4CQIA 3SFEA 2BM1A 2EVZA 2KRBA 4JI0J 1X9BA 1K73T 4OYKA 1S9GB 4NZ7A 1N32J 2ZWPA 2J9DE 2IDEA 1F2HA 4Q5VA 4QU7A 1JJ4A 5HROA 1EETA 4NA3A 2CNLB 4JI2T 2I1RA 3EAMA 2NPIA 2YKPA 4KGZB 4HEA9 4LFAT 3S01A 4C11B 2WCXA 3HPOA 4YR2A 2XQAA 1U1LA 2DHXA 3GLJA 1TL3A 2M5YA 2UXCJ 3B54A 2YINA 3TA1A 4FF3A 3VGUA 2KFYA 5KG7A 2XZEA 3SMZA 2CPZA 2HRTA 5AQNB 5M2RA 2VFTA 3MR3A 1X4HA 3QATA 1QDUB 3MUVP 2V5HG 4PG7A 3AE4A 4RUCA 2RH3A 4UT4A 2MPKA 4ID5B 4N56A 4ZS2A 2QE5A 3G87A 5GADI 4C8YA 3L39A 4NLUA 2HAFA 1NWMX 3TOQA 4J2CA 4HL9A 3H8YA 4LBHA 3V6HA 2LOPA 4TYBA 1N48A 4TLRA 3V5SA 3BO3A 3UU8A 5FD1A 3R6LB 3FZLB 2CAJA 2FC8A 4HFCA 2HK3A 3T9NA 3HR0A 2RUSA 4MFBB 1RLCL 1YJRA 4YY3T 5HMZA 2AXDS 2ZH6A 1RT7A 1AW0A 3C16B 3P5BP 3CO0P 3KVBA 1RWOB 3HD2A 5AQUB 3KK3A 4LJMA 1Y00A 5A8WA 4WZXA 3QRRA 4H9PC 4LR8A 4DV3T 1CJUB 2HGLA 1VQOS 3N0VA 4TWFA 2POKA 5IQQA 4DUYJ 1Q53A 3KUEA 3R5DA 3N01A 3LPEA 4I69A 4CLFA 5LSOA 1V5VA 2E9RX 5HEJA 1AUSL 4UVAB 1UKUA 3C14B 1HR0F 4QZVB 1Y0HA 4CT9A 2BKNA 1SQFA 1MIYA 4OYWA 2ZM0A 2WSEC 2XAQB 4A4JA 4LSNB 1LW2B 3BDPA 3KLEB 1R8BA 1J5EJ 2A6MA 3MAAB 3R5GA 3AFGA 4ECTA 3NAIA 2N4DA 2W01A 3RBXA 2NLWA 4OYAA 3QO9B 1L3UA 5GAGI 1DLOA 1WOPA 3I31A 5HJXA 4WPAA 1I94F 2RPAA 4MFRA 4ASKA 2PFVA 2FJVA 1BR4A 5FDLB 3G8SA 2UUBF 2GA7A 3D0IE 4AQFA 4X84A 4DUYF 1YJ9S 3AA0B 2CG8A 3PG9A 2YDRA 2W2UA 2C2RA 2HWTA 2RAQA 1GXTA 3IAS9 5FXVA 2ERRA 2BVZA 3DOKB 3PKYA 5C2CA 2E2AA 1KEKA 3CWZB 3N4WA 5JH7E 1NK6A 4QKNA 1VQKS 5DG9A 4DWIA 4OHZA 2I5JB 1IVZA 3ILOA 3P8CD 2CQ0A 2G1HA 3O3LA 4DZDA 1G8XA 4M5GA 2KT3A 4LRFA 2JRKA 2IDOB 1RLDA 1U1MA 4O2BE 2VL1A 4KHPF 3O1LA 4K4YA 3H2VE 3ESLA 3UU5A 2QL7B 3GJSB 2BJ1A 4XAXB 2OP5A 3AOCA 1U4BA 1LOUA 1R27B 3S8SA 2IMLA 1D0ZA 4Q25A 3PU3A 2DHHA 4E2FB 2AT1B 4RWWA 1M5HA 1RB0A 1ZHCA 2HQFA 3EMTA 3RUBL 2J1DG 3BH6B 5B0GA 3FRYA 2ZD1A 5HXEA 1OEDB 4PYDA 3RLFF 2UXCF 1NJXA 3Q0AA 1W09A 1TUGB 4R0EA 2MYFA 3HJFA 3ELHA 5LBQB 1SKRA 1Z4UA 4PR6A 3M8RA 3EVMA 2OPQA 4YOEA 5D4PA 4PK5A 1S7IA 2WZ1A 2ALZA 1RHJB 2V7MA 1LXJA 2HWIA 5JDGA 3H90A 1RHMB 5E2QA 3DP7A 1GT8A 4LIRA 3W7BA 5CFBA 3M2UB 3TJAA 3MKDA 4TU7A 2L3LA 3IS9A 3H98A 1J5OB 3AT1B 4CT8A 3KG0A 5AE2A 2R8IA 1J27A 2RDIA 4ICLB 5KFGA 2CXDA 1FK9A 5CB4E 4GKJJ 1F5BA 3AOAA 3RIAA 1NXIA 3GILA 1QJHA 3K8PC 1WYBA 2M8DB 1GX5A 4IG3A 1N34J 4LF4F 2F4VF 3H5UA 2AYMA 1RTDB 3HI2A 2UUAT 4AD6A 3F0NA 5GVQA 2XMKA 3NRBA 4HTIA 1EP4B 2QLWA 3G6ES 2VHGA 4LSNA 1Q95G 1VBZA 2BQRA 3ZSTA 4TY9A 1WLXA 4LF8F 1DTQA 1Z8UA 5LHHB 3T1HJ 3NMAA 2OV9A 3UFGA 2WCAA 3ZTOA 4WFBQ 3RPUA 5L39A 4BWJA 2KL8A 2XG8A 2CDQA 2OLWA 4OI1A 3BR8A 4ZZBA 1GMUA 2K06A 3M2VB 3R1HA 1VOMA 3ENVA 2VL8A 4JI2F 4HWHA 3IBPA 3MDFA 5ETRA 1UL3A 4DPWA 1NAFA 4EFAC 5DJQC 3ZTQA 1O5JA 3H7HB 1D3WA 1FRKA 4L72B 1BE4A 2JVRA 3K89A 3J7Z5 1YRXA 4ECRA 4FZVA 1ZTWA 3NXZA 2EFNA 1VBYA 2VVNA 5ITHA 2IUBA 1U1PA 1VHIA 1T3NA 3Q8QB 3KHLA 2BBJA 4B9MA 1T0TV 3QAEA 3FBCA 3U1LA 3E8OA 2VUGA 4CLWA 1MMDA 3QT8A 4P10A 4PWWA 3C19A 3BJYA 2CM0A 2JEFA 4TY8B 2ACZA 3TVKA 3IMQJ 1QSYA 3KJVB 1X7VA 2V63A 2ZUAA 3FMBA 5BYSA 2QRXA 4H4MA 2PE8A 3PW5A 1RT6A 2FPHX 3Q2TC 2HVIA 4NCAA 5KTQA 1KFSA 3QFWA 2F3JA 4MH8A 4LRAA 3DLKA 2QA4S 3EZOA 1OY6A 3CJ4A 3P45B 4ZCIA 1S0NA 3ZN1B 2MHEA 2VU5A 3RGIA 1Y5NB 2ZVSA 4ED4A 5EUHA 1AJ3A 3IR6B 5JUMA 3N9MA 3GU0A 3EWGA 2DH8A 1RT6B 4YSYA 4EI2A 3A8KA 3QLHA 4J91A 4WZQA 1HARA 4EGLA 3AEAA 3ONQA 3AA9A 3FZ2A 3IP0A 4CI3B 3WC2A 4ALZA 3EM1A 2GVDA 1CHUA 3AEBA 2Z30B 4USWA 3HKWA 1RUSA 1RWVB 3CCJS 5E0OA 1VC5A 1NPRA 3FMWA 4MKYA 1HNVA 5KFMA 1MMNA 4OZNA 1YHQS 1GEHA 3D68A 2K1RB 3JSMA 1FJCA 3R3TA 1DFDA 1S5ZA 3GA8A 2CJ9A 2ROEA 2CLYC 4OZ5A 2HVEA 4URGA 3R8YA 5E5NA 3PO5A 2A3DA 3DN9A 3PYDA 2ZUGA 3RRGA 4TY8A 4J9LA 1E1HB 1U1QA 2RHQB 1EQMA 1V3RA 3BZQA 1S97A 3US5A 2I2YA 1HWJA 2VQEF 3N79A 2BOAA 3RF1A 3ETUA 1DQAA 1U24A 1Q7LB 4HE8A 1QLBA 2XY7A 2AYGA 4A46A 2FDNA 2AJ4A 3SCJE 2XHWA 1FRXA 4F3MA 2WVFA 3G82B 3SFUA 5C7PA 4TVAB 5CZVA 4PPZA 4IFYA 5KFRA 3I82A 5ETOA 2L9WA 4QHOA 4ERDA 2KSRA 1UK5A 3A3PB 4PG5A 7FDRA 1QVFR 4Y2IA 2HZVA 3RYFE 2DJWA 1HLWA 2LKGA 2ZH1A 1M62A 4IHJE 1AFJA 4DFPA 1FTRA 5K14B 5FJ4A 1FMVA 4DQSA 4M5LA 2HHHJ 2BVMA 3QJJA 4DR1F 4DV2F 3G2XA 4FVMA 2YKNB 4WCEQ 3KV6A 3POTB 4X64J 4HTEA 4Q0BA 3JSMB 2K1RA 2YXLA 5D3GA 3FCVA 4U8YA 3QT6A 1FHTA 1YZ6A 1MSWD 4YJ2E 3HKZD 3I0QA 2XCPA 2O5DA 1N5VA 4MKAA 2AQ4A 4ZHRA 1SA0E 1ZPVA 2K48A 1YQHA 2CWXA 3PJAJ 2ILZA 2C2OB 4K4ZA 3V81B 4L76A 2ZOMA 4CH7A 1Q1KA 3OVBA 1HPZB 4ETXA 3AXMA 3S4UA 3QT5A 1WHWA 4I68A 3UD3P 3PZPA 1N4LA 4WP8A 1T9XA 5DQWA 3MMAA 4DG1A 1UA0A 3TP2A 3KFWX 5LXTE 2DPJA 2OFHX 2HHVA 3MPDA 1YW0A 4EO6A 2JRSA 3H3MA 4YTNA 3QGGA 2YKQA 3KLHA 4W92B 3L7UA 3DRSB 1FK9B 3WQPA 2LXUA 2YWWA 4AQGA 2XSBA 2X0HA 1KTQA 4CH0S 2B51A 2QA1A 1YRTA 4OL8A 1WR6A 3Q22A 4RPFA 2WVDA 4XBFB 4C8MA 3W9HA 2MLXA 5HMYA 2VVSA 4X5TA 5KMGP 3CUNA 1Q82T 2VA3A 4OZ3A 3HZGA 5B0EA 1PKUA 2IC3A 4DZ6A 4DF8A 4BHQA 2LSKA 2LECA 5IUXA 3IF8B 1NJWA 2JEJA 4L73A 4ZI2C 1RA7A 2MQ8A 2C42A 4FXVA 3S1TA 4BLGA 2MZTA 4LF7F 2RHSB 5L3CB 1I51B 2XMMA 5BYQA 4NCBA 1HCIA 3W5ZA 4IR1A 2YNFA 1CULA 2H51B 3UFEA 1VQPS 3AY0A 4E98A 4LSLB 1XMOF 2DT9A 4K4TA 3BF4A 4CLTA 3DI6B 1VHFA 2EI5A 4OX9J 2XLIA 3B13A 1NU4A 1XMOT 2DK2A 1U2RA 4JV1A 5ABGA 4CI0B 2UU9F 2KKHA 2GO9A 1NRKA 4DR1T 2J0XA 3ILIA 4ISTA 2VG6B 3DMJA 3MM9A 1NSKL 3CTRA 3D0GE 4Q0BB 1ZA2B 4WYLA 2MJUA 4XTTA 3NZQA 3V4MA 2DHGA 4X66T 3OTOT 4IOBA 4JI6J 2FYXA 3M8QA 1T7SA 5I3UA 1HNXJ 3P96A 2BJEA 3BGOP 5DDOC 2HVZA 2LT3A 2DXEA 2DR5A 2OEJA 5CZXA 1FJGJ 2XQ5A 1SL0A 2BUNA 3PW4A 1LWEB 4TV8E 4S0MA 4JI7F 2MKYA 4DX7A 3VGVA 3C16A 5HXHA 4G1PA 1FFWB 4OYPA 5CYQA 4PXDA 3CK6A 4NYPA 4ZVFA 2HWHA 5JR9C 3M7VA 2DBBA 4TWHA 1SJRA 1SKWA 2BMBA 5T14A 4PJMA 4ETZA 5L1LA 2ZDPA 4JI4T 5HP1A 3LA0A 4PG8A 1S1TB 2C2ZB 1GTHA 3PYGA 4LBIA 5HANA 3CVKA 5E3QA 1IR1A 1E6VA 3P6YC 2HKEA 1JJCB 4F25A 4M5JA 1B7FA 3EDRB 4H4OB 3CULA 2E9XB 2CMRA 5J2UE 2ZH5A 2IIUA 2RQCA 3A1YG 1WR0A 1WHXA 5D0GA 2ZM6J 2FZGB 2IC3B 2KWHA 3PDYA 3C6UA 4DV4F 1UVIA 5ETLA 3B82A 3WDOA 1UZDA 1VQNS 4EEBA 4OQJA 3CC4S 2BEFA 3FZBA 4ECWA 3OR2B 3EGVA 5HAXA 1R7IA 2RSQA 1BR1A 3BQ1A 3Q83A 2BS3A 3KWMA 2CA5A 1HL6A 2IRYA 2VFUA 4B3ST 4BAYB 1CC7A 1JWWA 4N7TA 1ZBTA 3WAKA 3F73A 4EZHA 3CKDA 3NGUA 3VAHA 4N78D 2ZEJA 2HW3A 4Y6IA 4P2XA 4K2XA 2C3PA 2OELA 3BSCA 4YR0A 4I2QA 3HSDA 2DXDA 3HHNB 3U27A 5CA1E 3KDNA 4OHVA 2NXUA 3DDIA 5D15A 2M6BA 3M32B 4Y2KA 4U6PA 4B3MT 3UCZP 4QW9A 2Z2ZA 2M0GB 3GIIA 4OZ0A 3KHGA 1H73A 2MLYA 2HHUA 4ZK7M 2CUYA 2D3O1 2A72A 1WDDA 7AT1B 4FNIA 4LRCA 4UR9A 2G0CA 1WC1A 3AAWB 5GMKa 3Q8PB 4B08A 4PQUB 3GQCA 4B17A 5AJ3J 4WIIA 1YTYA 1VCTA 4X62J 3E08A 2YH0A 3UQ7A 1RBAA 4DSLA 4TQRA 2W00A 3UN2A 4HFVA 1D8ZA 1VQ9S 4H63H 3IWLA 2YPZA 1QSLA 1SVDA 4K5SA 1RWNB 2KG0A 1FNMA 2V5DA 2ZLYA 2AYEA 1SJ4P 4P73A 1UURA 2F9DA 2GX8A 3THTA 2PBIA 3P3DA 1IAPA 2Z8QA 3CCUS 1MN7A 4NLPA 2YKNA 4DCOB 4FYXB 1SJQA 1N8RT 2V4JB 2EW9A 3CDWA 4A8SA 3C14A 4KH1B 2FY1A 4UIGA 2EFOA 2JQHA 3ZTPA 1DBDA 3TVZA 4DV5J 4RU2A 2OMLA 4ANDA 3FC9A 5J1GA 3QJLA 4HT5A 4YY3J 1YKWA 2G0UA 5KFYA 4BJNA 5EWFA 2BKPA 4M5HA 2FVCA 2X1BA 4CLLA 4IE0A 2H1YA 4AXIA 4KPYA 5HEUA 5E3RA 4UXNB 5CYMB 1T94A 1OYEA 2A2DA 2RQMA 4RW8A 1I94J 3Q8VA 5HQLA 3LGMA 3PYEA 4JEHB 1MU2B 1TL7B 4DR3F 3O9XA 4I7FA 5K9FA 1JKHB 3MM6B 4RW7A 1XWMA 1W9RA 4ZVEA 2ZFHA 2UXDJ 1S94A 1X5PA 4F50A 2PI5A 2C2KB 4Y3CA 4FS1A 5J2PA 3MJXA 3L8RA 3G96A 4M1PA 2VA2A 1GTEA 1MLAA 3TAMB 3LFMA 4MK7A 2XAHB 4DV3J 4DV5F 3BPSP 1IJEB 2VFRA 1UVMA 2I38A 1NHUA 3T6BA 4J9NA 2IJNA 3PJAA 4H9NC 4C91A 4U67Q 4HEAA 2O3DA 3LALA 2MZRA 4Q2MA 3RAXA 5F3ZA 4PJNA 4IDOA 3A3OB 4H9RC 1SE7A 3TUIC 4X4RA 5ABEA 3KHRA 3V5RA 3RAQA 5IM0B 4QYZJ 2H3RA 2WU2A 3MMAB 2MXYA 1PILA 1U02A 3OVSA 3M9NB 3RKGA 5B0AA 5LMUT 1HQUA 2X3DA 2ACXA 4YDDB 1Y3JA 4C98A 2X9HA 5B08A 3M9MB 2X9WA 4I56A 5KG4A 1KVIA 1H2TZ 5AQKB 1TL4A 2MKSA 1PO6A 1S0MA 4BC9A 1Y4ZB 4NIQA 3SRZA 3M8ZA 3C6TA 2EHOD 1FESA 2XQ6A 2XZWA 2HLTA 2LQ5A 4X1YE 1D1AA 4K0UA 5JR9B 2C5JA 1TL1B 2HN2A 2H89A 1ZM4A 2EK1A 2LU1A 4J90A 2NPFA 3ILLA 4ZI3D 2KT2A 2BG9E 4P0AA 4IOAQ 2CNOB 3UNGC 2XLJA 1BLUA 2W61A 1KSPA 1B99A 3J81j 2KM8C 4H4MB 3GYXB 1QM9A 5J2QB 2NR0A 3JSBA 4JV5F 4G63A 3MF5A 1VMBA 3AAEB 1OY9A 2I5JA 3ZLIA 3E3XA 2F8HA 2NWBA 4WYWA 2HFNA 2D9DA 1JLQA 2D3OR 2WBRA 3E0ZA 1VISA 3PACA 3BKTA 3MAAA 1VS3A 1EJ7L 1E6VB 3CMAS 1Q81T 5KFCA 2ZJRQ 5CYQB 3IWNC 5A8KB 4JI5F 3DYAB 1UWBB 5FXWA 1U09A 1U6FA 4RU9A 5FDLA 3AB2B 1SHZC 2VWAA 4UY85 4ED1A 3CX7B 4KBIA 4X4OA 2JL9A 2VKZG 2EFPA 4G1IA 3CCQS 2KHDA 1TAUA 4ILAA 2BS4A 3VV2B 9RUBA 4LMJA 4FP9A 2UVUA 1NK4A 2DTJA 3OVAA 3EVYA 2OEKA 4X66J 3LP2B 1RAFB 4GO7X 2BV3A 3VTIA 2BW7A 2MTQA 1JLCA 1HX8A 3KJNB 5ADZA 2ASLA 1UWBA 4CP5A 2RF2B 3DDNA 1GAOA 3ET6B 2JFKA 5DDQC 4N8OA 1JNRA 3UUBA 3BDEA 1IZNB 3R84B 3KINB 3QBCA 1F60B 2EG2A 2VG6A 1J2VA 4DV0T 4ED2A 4IFYB 2WZIA 2DNYA 4H9QC 1MN9A 2M7SA 4DUYT 4DL5A 3W15B 1UA1A 3R5BA 1OMSA 4H54A 1SJ1A 1VGYA 2NQPA 3BQLA 4GOUA 1XNRT 2ZHAA 4LBPA 3PUQA 3C6TB 5E33A 1HBOA 4ECSA 1JXLA 1DQ9A 4RBUA 4ZKAA 2X66A 4ZOLE 4P2SA 4YXDA 4C90A 5B0BA 4WK1A 4FI5A 1RT2A 2YX7A 3MM7B 4O4IE 2QN6B 4E8UA 2GGPA 1PIEA 2GC8A 2CNNB 4ES3A 3ZC0A 3VKGA 3UCUP 1CC8A 1X79A 3GONA 3HK2A 3A8JA 3AAAB 1FWLA 2UUBT 1M1KT 4GVLA 1UZHA 2VG5B 2LSYA 2HGMA 5J2MB 5DG7A 3Q2MA 2D9OA 3KBTA 3G6VA 2M8HA 3HKCE 2HFOA 4DG1B 5CQGA 5KAKA 1RAAB 1SKUB 2DCLA 1NK7A 2GIQA 2F63A 5A8RB 3ZYMA 1TKTA 1F9FA 2GFFA 2Z57B 4LSZB 4OIXA 4FF2A 2B9EA 4EYIB 1R8CA 1JLEA 2KZ7B 4K4XA 1TV6A 5J2NB 4PQAA 1HNVB 2CVIA 3DOMA 1WD6A 3M30B 4ZI7E 2BJ3A 1ZEEA 3UD5A 1DZ5A 4ZPWR 1RHKB 2OTJS 5F3JA 4K4VA 4NXMJ 2G0JA 1MMAA 4JI1F 3E51A 1MW7A 2YOEA 1WSVA 4N47A 1FO1A 3IFEA 2M70A 4DV7T 5AQFB 5KFOA 1S48A 1T02A 1YJTA 3KJVA 3JAMY 3ET6A 3UR3C 2JEIA 5FMNA 3ZC1A 5H6RB 4U2ZA 3IGNA 2NXCA 2E7XA 3OSNA 2XMVA 3OTCA 2J9DA 5DO2A 2V4QA 2XSAA 1P1TA 3K5NA 2BRLA 2XZTB 3UQ4A 2MMYA 2ZZMA 2H88A 4OI6A 2YDSA 2VJUA 2JWNA 2RDDA 2R8HA 2AWZA 2G1DA 1YJWS 2RF2A 1AZSB 4DR7F 5CHCB 3DGPA 4USMA 3W2VA 2KXFA 2Z6EA 2JLFA 1ITPA 4LF5J 2D0TA 5D0RA 3RU0A 3PURA 3KLEA 4PRFA 5KFHA 4LMZA 2WP9A 1UAWA 4KSEB 1GXLA 2PMHA 1N6QA 3N5FA 3VVTA 2OA5A 5K14A 1V6HA 1KD1T 1VQ6S 1R89A 3VQSA 3FEYB 2PIIA 3J7YI 4LFBF 4M5IA 3BQ0A 2QYWA 3SXLA 1T8EA 3HDSA 3M8QB 5I3QA 5LCYA 5T7LA 3X1LB 3ZMZB 1Q5VA 5LHGB 2NCKL 4YB1P 2FQQB 1H38A 3ISNC 2YQ0A 4HACB 5L1KA 4IDZA 2RDJA 4PG4A 1ZZFA 4DS4A 1X4AA 3H4BA 1U0SA 2KRRA 5HWXA 1O51A 4YT0A 3QOFA 4N77A 1W0BA 2KWIB 3PV8A 3OBIA 4B3SF 2J0WA 2XCAA 4H63V 4ZPAA 2ZBPA 1H2UX 4DR1J 1D0YA 1C1CA 2A3JA 4KJIA 1I94T 2HNDB 3HHEA 4CI1B 1ZPWX 1X4GA 2OD4A 4YB6A 4A98A 1W2IA 1P1LA 2XS5A 2YDQA 1JLGA 4ZVGA 2M6IA 2UU9J 2FJAB 2HFZA 5ADXL 1AFIA 2LSJA 4UEMA 2E1MC 4HGAA 2DGSA 2R42A 3LAMA 2PMZD 2OSRA 5L38A 1UEVA 1RAEB 4DR7J 2VODA 4K0KF 2MQNA 2XTJP 1JJHA 2KNDA 2DY1A 4QPXA 5ABFB 3MMJA 3ZYLA 3KLFA 5KFJA 1NB2A 1SBRA 3X3UA 1PC4A 4IQMA 4LF7J 5HCJA 2BYCA 5FVLA 1QTMA 1MWQA 3OKQA 3IS9B 1LRZA 2WDRA 2BVLA 2QIFA 4IGUA 1IBLJ 3TAMA 1BQMA 1Q16B 4KHMA 4KFBB 1X9MA 4MLKA 1CJTB 2WONA 4DX8H 2Q9QB 2EBEA 2DR8A 5BR8T 4ECQA 5F0UA 1TU0B 4USTA 2HVDA 1ZOYA 3SEOA 3JQJA 2DR7A 3M65A 3OXGA 1DARA 2JLGA 3LOUA 1JIHA 5LA6E 4JYAJ 4DR3T 3BGLA 4U7UK 3CD5A 4DPOA 3H5XA 5KFLA 3Q8UA 2J0QD 3KKFA 2DNOA 2ZHBA 4BCAA 4R8UB 4RW7B 2KI2A 1QE1A 3PFOA 3OTDA 4F3OA 2H7OA 1YRUA 4QWCA 3CJ5A 1FDNA 2FGOA 3FZMB 4I64A 1IBKJ 3IAM9 1SC6A 1CQMA 1AT1B 2K24A 1FKAF 3FNNA 4DL6A 1VR6A 5IT9Y 3MACA 3G71S 5DGAA 2D2SA 2FD2A 3RIUA 2XO7A 2B7CB 2ZH7A 2P2CB 4EYHB 5FXZA 5F8PA 2AJ1A 4DV6J 4OFZA 2LQ8A 1RWMB 3CCLS 4ECYA 2BW2A 3HJVA 4ZN1A 2IAJA 4DF4A 4B3SJ 3E01A 1LWFA 2V4JA 2V0NA 1GXUA 3Q9DA 4IKAA 2A6OA 3KXDA 3QQCD 4M8LA 4YLHA 4ZP9A 1CUNA 4RWXA 3JXOA 3MPVA 1JLQB 3TEGA 4F0KA 4MHCA 4U74A 2P6SA 4ZI2D 3MEEA 2QTWA 3LK42 4N76A 5FY0A 5K8PA 2X0YA 5HXSA 1ZOTA 4N8NA 1Q7YT 1RAOA 5IT4A 4J9PA 1S1UA 5AQPB 2KZMA 1QSDA 3UWTA 1FRHA 1UW4A 3OBVE 4NPPA 3AXJB 4AQFC 3M8WA 5ETQA 4YS2A 4NI2B 5I3UB 1HD0A 2P6TA 3PUYF 4IUFA 2VIHA 4O3QA 1RCXB 3HT0A 1UP1A 3GMIA 3W62A 2W9BA 4F67A 4TKTA 2EHOA 3NWRA 5KFDA 3DU5A 2L08A 1U48A 4DV4T 3MMCB 1L3VA 3ZNJ1 1C1BB 3QB5A 2ZH3A 4F02A 3DOMB 3K7RA 1FXDA 3FSXA 2B5JA 4M5KA 4ID5A 3DLGB 2BKOA 3FFIB 4D3GA 1H3DA 2R8GA 2GQCA 5CA0E 3I56S 1FKOA 2CPFA 3EXCX 4Q2LA 3ITHA 2XQ8A 4DFJA 1SXLA 2QG9B 3SSSA 2YY3A 3RYLA 4P7TA 4HT7A 3GG1A 1RBOB 5JTGA 1V3ZA 3TWZA 2VKDA 2OJ3A 1NPPA 1LK7A 1IXKA 2ACYA 2NP9A 5C25A 2HK2A 4DR6T 3HI9A 1U6ZA 4KGXB 5LMNF 4MIBA 5HROB 4KHPT 2N82B 5KFPA 1S4EA 5B0CA 5J2TE 2KYXA 2W1BA 3ZZTA 1GK8A 3L3PA 4L0RA 4YY3F 1ZYQA 4OX6A 1RZMA 3PIPQ 1R8PA 3K5PA 3BQKA 1X0FA 2Z58B 1QY7A 5CD4H 3UR0A 4KO0B 4G6VB 3RW7A 3D5MA 2FLNA 3VAGA 1YBTA 2A18A 2VZ9A 3BYRA 4ZITA 2HNYB 3KLGA 3T1YT 2KN4A 5A1LA 3WIUA 2AZ1A 4Y2CA 1JNZB 3EXYA 3SBMA 3EHZA 5FLXU 3KK1A 5DS7A 2YVSA 4NOHA 5KT4A 4UUXA 2B3TB 3KK2A 1UEUA 3HHLD 4DL2A 3PJWA 4OYOA 3JCFA 4H9OC 2B9YA 2NOXA 3MXHP 3I5CA 3IM8A 2FC9A 3KOAA 5KFQA 4HACA 4ZJLA 5HEGA 2HURA 3MD3A 1GH8A 1HI0P 2MZJA 2ZNYA 5L8RC 3W8PA 4H9SE 2PGCA 3AE6A 3M9OB 4A8YA 1MWZA 3I96A 4MFBA 2H5IB 1YXRA 3NKYA 4J9KA 5F8GA 7FD1A 3ILJA 4X1KE 2ASYA 4USUA 5KX5E 2J7WA 2UXXB 4Y2AA 2BBHA 3UW1A 3D6MB 1RQ0A 5A6PA 4WKYA 3ETMA 3D6TB 3MXZA 2EHOC 3K8WA 3MM5A 2C3UA 3LH2S 3VGTA 3VAIA 1JLBB 3U3IA 2VBWA 5L3FB 4CLPA 1KONA 2CEAA 1GNKA 4PPDA 2RKIB 4O0IA 4CLSA 1I6ZA 1SC4B 2V2KA 3LP2A 2C2NA 1UCUA 1MNEA 2R2TA 3GWHA 1RGVA 2YN6A 1X5TA 3D66A 4F4WA 2OD6A 5HLFB 4YB5A 1S99A 1CJTA 3UCGA 3ZCIA 1PG5B 4DR4F 1KS2A 3MK7C 4TQSA 3DRXA 1S4FA 4F4ZA 4JI5J 1N34T 5ETPA 4K59A 1ROFA 3A8EA 1HWUA 3IXQA 3JSYA 1HNIA 2R8KA 2CZ9A 2E5IA 3Q5EA 4LUBA 1X5OA 5DQVA 1BQNA 2J7KA 3CIMA 1HWIA 4I2PA 3MCMA 3P50A 2PDAA 3I32A 4JI4F 2GW8A 2MB0B 2WQYA 2JJ4D 1DRZA 1UPPA 3KG1A 1W26A 4DR5F 3SQGA 3HVWA 2LRLA 2VONA 4TU9A 2DNMA 2N4CA 3FSYA 2B0GA 4DV7F 1N33F 1VI7A 1MROA 1ZV4X 1JK9B 3Q5DA 1W0AA 2GAHC 4WTYA 2WB1D 3MGJA 3FQKA 3TZWA 3DRYA 1J1JA 5H6QB 1CJKB 2E5HA 4R0JA 1S9GA 3CQGB 3UUMA 3DRPB 1SH3A 4ZLPA 3W5YA 4FPRA 5CCMA 5CYJA 5HBMA 4M1KA 1N36J 2LRKA 1HPZA 2DH7A 4PCQA 2EPIA 1B70B 3CCZA 2HHWA 3NS5A 4PK6A 4TYAA 1S1TA 4F3QA 3BSNA 4LF8T 2XAJB 3N2OA 4PNIA 1N33J 1M5KC 1BY9A 1KHVA 1R0AA 1TVRA 1N54B 3J80U 3EGWB 3HVTA 3LUYA 4A8KA 3MR6A 3ANWB 2RKIA 4IL4A 4CO3A 2WOMB 4OHYA 5E7OB 4KHPJ 2I0MA 4MK8A 1ELOA 1XIQA 1K47A 4MMOA 2AEFA 3TLWA 2CPHA 1RWWB 4PAGA 1FTCA 2Y3YA 4OYZA 2HYIB 4UZCA 3VHQA 3M4XA 2DGVA 3IRWP 1H98A 2MAWA 2DXFA 2NXNA 4EK2A 1VC6A 4PABA 2LM2A 3TQEA 3CJ2A 4V19J 3K59A 5GAEI 2R6GF 3BO4A 4H4KC 1UFWA 2V94A 5HP1B 4I43B 1N0UA 4O3SA 3B57A 2B9XA 4AISA 1DY3A 2BE9B 2XHCA 3BGRA 2DGOA 5IZHA 4DIDB 3RYHE 2F5GA 4JI3T 2CYYA 2FZCB 3LP1A 1S76D 1HBUA 3TNVA 1WHVA 4ZXLA 1IKXB 4ZMMA 4CH1A 4IO9Q 2XSJB 2Q1LA 5KG5A 1VDHA 4X2BA 2WW4A 5A8KA 2FHMA 3HM9A 3H42A 1XDOA 5KDMC 1Q86T 2DRDA 2APOA 5ABHA 1PBUA 3IWXA 2LE8A 3GSIA 3U02A 2FHKA 1RT4B 1WTFA 3I0RA 2V8HA 2YWFA 4JI7J 1TUVA 1QAJA 4KR0B 3O2IA 2X0LB 4I55E 3PTRB 5KG6A 1WSRA 5CD4A 5HSPA 2DWGA 3W9JA 3CMES 2R7UA 1OSDA 3W9IA 4C4WA 3T5JA 4IO1A 2E66A 3RH3A 4FF4A 2F7VA 3PFEA 2W4DA 3D0HE 1FCAA 1XR6A 2FLPA 4A8WA 3BQIA 4DL3A 1K1SA 3QFHA 2Q66A 2H9ZA 4O2AE 3TYTA 3HZEA 2C2MB 3FEZA 2J6UA 3FFIA 4LFAF 1RTHB 1CQNA 1KLNA 2B4OA 4QXBB 2XMAA 4DL7A 4C3LA 1FWPA 1VRTB 5EGYA 2MPUA 2L9DA 1JLEB 1LVKA 3MPWA 2QFIA 3QNUA 3N9OA 4RKUC 3OL8A 2EK6A 2DO0A 2VOPA 2F9JA 1HWKA 5CH7B 2VC0A 3QC9A 4IE5A 4MJKA 3CJ3A 1TELA 3DHXA 4ANJA 2ZOGA 2MJNA 4OMFG 4G65A 2W66A 2Q79A 3NWGA 1N36F 1KK7A 1KWMA 4B3MF 4UUWA 4B3TF 1NNDA 3P4SA 3T5KA 1FDDA 4DV2J 4DX6A 2CJAA 2MQLA 5LOQA 1VRUA 4OZ1A 1DHMA 1X9WA 2WONB 4FS2A 4AYBD 4GKKJ 3R97A 2JIWA 1HBMB 1HQEA 4ZVTB 3HHKA 3GCXP 2XY6A 4DQRA 5DLGA 4B9SA 1EAYC 4LR7A 2KB2A 4CO0A 1LV5A 2XSJA 2BG9C 1IWGA 1F6TA 2D5UA 2RVJA 3BGUA 1CBKA 5EK4A 5MAOA 2X3GA 4IDKA 3PW0A 5ETKA 3ZMUB 2FJDA 3CIZA 5J0ZA 5BXIA 2XY5A 2UXBF 3OTOJ 1IBLT 2IW5B 3W65A 3J7A1 1BWEA 4TUYE 3VZIA 3K5MA 2KFZA 1RTJA 2YK0A 3E22E 3DXSX 4ENOA 3OV7A 1FEWA 3GFYA 4YHHJ 1S7HA 2MSSA 5BR8J 3MEDA 2NW8A 1J5WA 4UOCA 3LBXB 2W8LA 3VRAA 5IC6B 3GIMA 5LHIB 5HN0A 4OX9T 3SCLE 5KT7A 5HXCA 1XMQJ 3G4SS 2IM1A 1PAEX 2Z56B 4ZVOB 3AJDA 4QH4A 5CAAA 2YBVA 4USHA 3NL0A 3CCRS 2BBEA 4ZPCA 1CSJA 1JB0C 2LXIA 3GJTB 4DR6F 4NUUA 3DMJB 3MM9B 2HIYA 3NZPA 4OLPA 2WMNA 3N9NA 4EZ4A 4DV1F 3T5LA 3RBZA 1KQGB 4AQYT 2DNRA 5F8HA 3GV8B 4WYVA 3PUAA 4B3MJ 2BRKA 3MM8B 4PWDA 4HWFA 1XTZA 1URRA 2VFVA 1HMVA 4I50E 1NJYA 3PRBA 2WAUA 1PJ7A 2P9EA 4WU3A 2C2EA 4M95A 1FWKA 1Q8IA 1XMQT 2DR6A 2CIMA 4JI8T 5LJMA 2OPQB 4IOCQ 3KJFB 4C0OC 1HNXF 1YVFA 2GVZB 5EWGA 2R7VA 2FBWA 2IJFA 3DCAA 2BX6A 3PUVF 2MGZA 3NCQA 2P5VA 1KBRA 4O44A 2AMCB 2ZM8A 2I59A 2SPCA 1WI6A 3W2VB 3JS9A 1N36T 1BR2A 3E2EA 4DV7J 3WHIA 3PJXA 4P74A 2VPYB 4O3OA 5DZ6A 2X68A 3KK1B 3CPWR 4C8LA 1WEZA 5GMDA 3UTKA 4HR2A 1RT5A 1UETA 3RTVA 5HBMB 5JDNA 4HWDA 4RNOA 1WKLA 3KLHB 2GHPA 4NXNF 3C8YA 1FFGB 5FXXA 3RC3A 3W66A 5G0RB 4YP3A 1EX8A 4GVBA 2N3OA 2PO4A 1QTNB 2AIRB 1TK5A 3CDUA 3C66A 3CGIA 5D0EA 3W2WA 3AD7C 1RAJA 8ATCB 5EK2A 1FXRA 1ZETA 1F9HA 2B56A 5A6WA 4KE5A 1E6YB 1Y7PA 2HRYA 3JB9k 2LQJA 3OHAA 4RW4A 1BQXA 1OEDA 5KT5A 4DR3J 3NGRA 2QMUB 5AQTB 4OI0A 2FTRA 4U3CA 4I4BA 1YJ7A 4NA1A 2HHTA 3GIJA 4UF0B 3SI8A 1S0VA 4DPTA 2BZBA 5L4EA 1XERA 1WRDA 4CO1A 4AXJA 3TZYA 2B5JB 2QX0A 2HS4A 2EKYA 3PTWA 1FX4A 3FJ2A 3PNIA 3R7BB 4NRUA 1NMEB 3ISND 3VRBA 2GHVC 2HZCA 4F2SA 1KR4A 1LVFA 3UU6A 4FDFA 1PYOB 5C3JA 4QW8A 4DV1T 3HSJA 3FBBA 3L3CA 3NWIA 4U7YA 2UUCF 4AKIA 4N5SA 2CHNA 4NCGB 4DVDA 5F9LA 4DR5T 3PUSA 3C98B 5HYAA 3GCWP 2W9CA 2ZBCA 4U31A 1EZ3A 4MK9A 1CLFA 1FIOA 3BKUA 4F0MA 4DSEA 5KFWA 2HNDA 3K0JA 1V3SA 2ZBRA 2PG8A 1D09B 2PEHA 1TP7A 1ZAVA 5J1NA 1HFAA 2EC0A 2H5JB 3IM9A 3LP1B 3JC6C 4U7IA 2HZAA 3OPCA 3MOJB 3D67A 4ZIWA 3MM8A 2UXBT 2IC9A 3ZEFB 3P4QA 1JLFA 1S79A 2Q6CA 2BACA 1HG5A 3BREA 3V4IA 3DGPB 3C46A 1KLMA 3PV0F 1FMWA 4X65T 3VAMA 4LFCF 3UDLA 1YGYA 1K9MT 4LF7T 1BR0A 5F8MA 5U47A 1PJ5A 2FJBB 3R1LA 4RUHA 3LK3B 4U72A 1F0XA 1T9TA 4FXWA 1Q8LA 4A8XA 1VJQA 2W7OA 2WBMA 4UVCB 5DLFA 4WKRA 1H7CA 1KQFB 1WC5A 2CJBA 1WUUA 4P1NA 4DU8A 2FVSA 3T1AA 2IRXA 1EP4A 2KDOA 3RYCE 5DM6Q 3WBZA 9ATCB 3D3CJ 4DV2T 4OYIA 1JJ2R 4HI2A 1NDKA 3BO2A 1HG2A 3CIRA 3I0SA 2Q9QC 2ZC3A 3ZO7A 1AUDA 4NA2A 2PN6A 4UF0A 2XGPA 2FIUA 1EARA 5AQIB 5B09A 2VDHA 4C3KA 5F0WA 1IBKF 3MWBA 4CM0A 5GAHU 3CO9A 3BEGB 8AT1B 1VBKA 2HNZA 3M30A 2VK9A 1YIJS 3I9V9 5KFTA 4PFPA 1ZKEA 1L3SA 2LOSA 4WP9A 3A13A 1KVJA 4LT6A 1Q79A 1JXEA 2J47A 1FRIA 1JLAA 5AXMA 1NZ8A 3B78A 2FLLA 5AE3A 2UVRA 4ECVA 2V9KA 1C1BA 2J9CA 3BBCA 3BM7A 4A8OA 3C2PA 3HHLC 1YSJA 1NHKL 3FGVA 4NI2A 3VQTA 3FZKB 3P4PA 4HI1A 3NAHA 2DNQA 4BDPA 3RB4A 1U1OA 3UE2A 2ZZNA 3M32A 2HQCA 3MTKA 3VR8A 2YNIA 3RW6A 1JLAB 2XNQA 4IDNA 4B3RJ 1D1CA 4GC6A 2B76A 1RT2B 1D9DA 1RT3A 2CPTA 4IE7A 4FNHA 2W9BB 2GVZA 3ZMVB 4X4SA 3QIPA 4I67A 5B0DA 2CXLA 3NS7B 1XN9A 2XO6A 4KMCA 2GJIA 1FJGF 4QXCB 1V9OA 2L9QA 2NXEA 2IVYA 1SCJB 4WBFA 2DISA 5F9NA 4C97A 5LGTB 4NPOA 2E9TA 1EKRA 1X4DA 1C0TB 4JLEA 3OFFA 4JI3F 2WVCA 2ZHOA 1YITS 3HHLB 3QT7A 2HG4A 2A1BA 3Q23A 1Y3KA 1R8IA 1SC3B 3J7AN 4CM2A 2NUHA 5SUHA 3D3BJ 2LHRA 2WB4A 3L09A 3OYZA 5KFSA 4TNWA 4GK5E 2D41A 2AV5A 4DQIA 2HAIA 1O3XA 2VQFT 4O4GB 1RK8A 3FHNA 2CXFA 4Z7YA 1IJFB 3A5XA 2PA8D 3R5JB 3ISZA 3F41A 1Y11A 1X31C 2FVRA 4HDGA 1IBMT 1S1WB 2IYIA 3X1DA 4G2AA 2R7RA 1JLFB 1SIWB 1JNRB 5FY1A 1S6PA 5HCMA 3N9QA 4P2MA 2WMOA 5JDMA 2M4MA 3MZIA 3DI6A 5D4NA 4HHUA 1HHQA 1UUSA 4L5GA 5L9XA 2EC2A 2RE1A 2B8PA 2GAGC 2ILYA 4DPYA 3IBCB 1B7YB 4MKBA 4XAKA 4LFBJ 4OJHA 4Q43A 1XWLA 4EAHA 2CA9A 4UZBA 3THVA 5AQRB 1PC5A 4IYQA 3PCOB 4Z2XA 4Q7AA 3LP0B 1U0HB 3GFHA 3W3SA 1P9YA 4R8UA 2W2OP 3DLEA 2Q9QA 4PW8A 1HQEB 4WZMA 2UUCT 2BANB 3HT3A 3RX6A 3CJ8A 1XK8A 4DQQA 2NTXA 1YJVA 1U8SA 2RB7A 1YJUA 4K0KJ 1S49A 2BA9A 2RMLA 2DNLA 4V1Av 2V6XA 1HW8A 1NO8A 4GRSA 1IKYA 2CVEA 4KO0A 3SV3A 3LK2B 2NXJA 2BZ2A 4KPCA 5EDWA 2VOOA 1F5AA 4DU7A 2JQKA 3P4RA 4OHFA 4HLBA 2YTCA 3R6GB 3UDVA 3AQOA 3KYLA 2JHEA 3AECA 3N6LA 2WU5A 1MMLA 2RQKA 3MR2A 5IT0A 4RBVA 4EBEA 1C1CB 1HQUB 4OZJA 3NG8A 2WZHA 4KAIA 3K57A 2F8MA 2R7XA 1O8BA 3H40A 3AA1B 4U2YA 5M4YA 4CRJA 2XAGB 2OTLS 1HD1A 2LEHA 2H54B 3TKLB 3LF0A 1WWHA 3IA0A 4WJBA 2A0FB 2RS8A 4ZOSA 4X64F 4WWSA 1G3OA 2KYZA 4AKHA 2XNRA 2ZH4A 2UVVA 1WFDA 3EDVA 1UMJA 1BUXA 1NZAA 2W4CA 1HNWT 2EFQA 1S1VB 1YJNS 1U1RA 3RYIE 4NUVA 4CXXA 2W7PA 4W4MA 2DNHA 5IV3A 2DYAA 4YUDA 1MNDA 1T95A 3EZ5A 1EIYB 3MCNA 4I6WA 4ES1A 4KGMA 1Y10A 2XTLA 1YX2A 5E3CA 4LQ9A 5LXYA 1WTBA 2QLXA 3PE0A 2QA4G 3MUTP 1Y5IB 4LF5F 1DJ0A 4NLRA 2K3IA 3PO4A 4CTAB 3TQ1A 2MGZB 2L48A 2RU9A 2CPIA 2BE7D 2E29A 4RW9B 1B0VA 3ENQA 3MR5A 3NKZA 2QO3A 4CIOA 2WS3A 3MEEB 3KBUA 1TTHB 4AL6A 2HRUA 3K58A 2IJRA 2ZH9A 2VG7A 1OS5A 2VBXA 5JRCA 1Q8BA 4PKDB 4DSJA 2LSIA 1ZS6A 5T7LB 4K7QA 3KMSA 4KB7A 1VQ7S 3T8OA 3FZFB 1WOSA 2IM3A 2C3OA 1N5YB 3V4IB 4E7ZA 4GK0E 3IN5A 1B4SA 1C4CA 1S12A 3H2UB 4RZRA 1FJ7A 4JI5T 3UT5E 1QAIA 2ZM6T 3D28A 1XZYA 3C51A 3PX0A 1SC1B 1S59A 2HFSA 5HEOA 1K1QA 1TFWA 2PA3A 2WOMA 3AD8C 4ZZCA 3MEDB 1S1XB 3CJKA 2XY8B 4DR2T 4LF9J 1Q4RA 4DBQA 2CLYB 1S9EA 2CZ4A 1TQLA 3CJTA 4E7SA 1RBLA 2LDYA 2MQMA 1D8YA 1MIVA 3HFVA 5H9FK 3NLCA 2E1RA 4YR3A 1PAUB 2DR9A 5KG1A 3NCPA 1SPBP 2BQ3A 2MHNA 4WFYA 2VJVA 3DGVA 5JXSA 5KG3A 1NB7A 5LYJE 5JVHQ 3JAFA 1SQEA 4WFXA 5J2MA 1VQ5S 1WKJA 3T9ZA 1MWYA 5L3GB 4PUOB 1RKJA 3IG1B 3GFZA 4CLKA 3ZPOA 1HTJF 4AE5A 4NLYA 2EG1A 2QL5B 2XJ7A 4X62F 4JUZA 2CPDA 1TL3B 1RT3B 3W60A 2ZC4A 3RBEA 4GMKA 4QH5A 1NCLA 4QIGA 5I42A 2JSXA 2UVWA 1XC9A 3TUJC 2C1EB 1XDPA 1G7CB 3JTNA 2CG4A 3AE3A 2MQOA 1RHQB 2LMIA 3GIRA 4EBCA 2CQCA 4PG6A 4ZPBA 3M6VA 1TFYA 4PUOA 3CEDA 2NS1B 1U1NA 2XM2A 4TWDA 4P0BA 4C7QA 5J2PB 4CYUB 2X9YA 2YNHA 3JYTB 2B8QA 1VQ8S 1RWUA 1RYSA 3W1YC 3EDUA 3AE1A 1P8GA 3TX0A 1GFWB 2DHAA 2QRRA 1T98A 4X65F 3UO0A 1X4CA 2ROGA 4ITSA 1RU1A 1WF1A 2B4PA 1A7GE 1VLYA 2KJVA 2ZH2A 3GIKA 3RKOA 1VK8A 3HSGA 1KLMB 1PJ6A 2GQ2A 2VASA 2P8IA 4IG0A 5RUBA 1HW9A 1A9NB 3CJSA 2HFUA 3TA2A 2F40A 3P7IA 4B6XA 2JMHA 3AEDA 2DNPA 2MLZA 4COFA 3DLEB 4V1Ak 4OHXA 4J7CA 3FKBA 1DTTA 3FXEB 3OR1A 2CRBA 3Q8SB 5KG0A 3KUHA 4ATNA 2UUCJ 2D9PA 2AJFE 1URNA 4KP3C 4DDFA 2GO8A 2LEPA 2Q43A 2IRUA 2VICA 2VQEJ 3JTOA 2DNNA 3ZC4A 3DYAA 2RQ4A 2M88A 3VR1A 5L1JA 4ZDNA 5D4OA 2I0XA 2EFGA 1S10A 4PFOA 1XR5A 4DV3F 3A3NB 1TKZB 4X62T 4QWDA 1LWFB 3Q2SC 1J5ET 1X4EA 4X4UA 1P9QC 3AEGA 1CS4B 2QA7A 3IEEA 2RA1A 3CJQA 4KHRA 4WIQA 3CX8B 1RWPB 3CCVS 1U2FA 2JC1A 4GKKT 4LF6T 3JTPA 2IBOA 4IIJE 4WFNQ 4A47A 2AD9A 2XLKA 3KTQA 2X51A 5KFVA 1FFSB 4A8QA 4FYYB 1RI7A 1UVNA 2DD8S 2FGCA 4IDPA 1HBNB 2V7JA 4AL5A 2HFVA 2U1AA 4IFVA 2Y1IA 4ZS6A 2KT9A 5BYRA 1NK9A 2Z2YB 1NDCA 2X9XA 2GK9A 1R8AA 1KKHA 3OXLA 2ZMAA 1EHWA 1YD8G 3I9WA 1RJJA 3TA0A 4MBQA 1HWLA 1F1BB 4NXNJ 2QFJA 3CJ0A 3CC7S 3PM9A 4ELTA 4XPCA 2YKMA 4DN0A 4A5XA 1UVJA 3RQWA 2Y48B 4ERRA 3MEKA 2KM8B 1TR0A 3LG7A 1FF2A 1D9AA 2LVWA 3A8YC 5JDLA 3OUYB 5H9FJ 4ZLLA 2WDVA 3ETOA 4ZCKA 3DU6A 2O66A 1H7WA 1BC6A 5J1EB 3GV7B 2LJLA 3KLFB 1VIXA 3OT9A 4QWAA 2AW0A 5BJRA 2I8EA 3QAUA 2XQCA 4P72A 2J5AA 3K5OA 4QWEA 1IBCB 4C48A 2L8KA 1WDTA 1SUMB 4WF9Q 5F41A 1MG7A 1TKTB 3QLHB 3Q24A 5HL7Q 1LKZA 4B3RF 3CWJA 1QUVA 3NMRA 4NMXA 1FRJA 1VQLS 5ABFA 2W2QP 3NGKA 2VG5A 1HBOB 2KVIA 2BJDA 2DGQA 2H65B 4Z7CA 2B6AA 2XYHB 4NLXA 4J9UE 2V9WA 3BPDA 2DH9A 1T9YA 2LEBA 5F8JA 2HS0A 1L5UA 1RDRA 3KV4A 3MM7A 1N5TA 3N9UC 2IVFB 2K3WA 4ED3A 5FKYA 2LDIA 2V6AA 4WP3A 5KXJA 2W2MP 4KIAA 4DR6J 2GZOA 1XNQF 1P27B 4J37A 2K3KA 1NLKL 2UV8G 2ALYB 3CCMS 1S6OA 2NSBA 4JI6T 3RBDA 5HVGA 1MU2A 2YKMB 1G1XA 5J1EA 1JKHA 3MM6A 3PYFA 1YZ7A 2W4PA 3U78A 2E5GA 3FEXB 3AOBA 2DITA 1BMQB 2E9XC 2MZ1A 4AI6A 1NEKA 3IHRA 1N52B 1S1UB 4K8RA 4WFZA 3C6UB 4MIAA 4RBTA 3F2EA 5KG2A 4GIWA 3SFDA 2L9NA 3ZT5A 1KF6A 4QPTA 5EX3A 2NW7A 3AA7B 3UQSA 2Y0BB 1WG1A 3BGRB 2BM0A 4HFIA 3QWPA 1VK3A 4J9OA 2R7TA 3DC2A 2K7KA 1XNRJ 4L9IA 2G2ZA 1WI8A 3VWSA 3J7YU 2ZM6F 2RUGA 2RD5C 1YDLA 3M2VA 1BHNA 3OFEA 4D3HA 4C0HA 3E01B 1KP6A 3K17A 3TZXA 5IYZE 2V6YB 4NLGA 2WTFA 1D0EA 1ZM2A 3OFHA 3ABVA 5DGBA 2Y6XA 2FJWA 1HHSA 1OO0B 4GKKF 4IDKB 1TKXB 1ZM9A 1QE1B 1O6XA 3PHTA 5AQLB 1L3TA 2LQBA 1IUJA 2IAKA 3J80Y 3G82A 1T8BA 2OUGA 5JRCB 1TVRB 3OQ2A 2KT5A 4J9QA 4IREA 2V50A 4LF2A 1TL5A 3CPZA 1EKSA 4CXYA 3LPYA 3SSQA 1RTJB 4HH1A 3W8GA 1H6KX 3AE8A 1QVGR 4TN7B 4OJ1A 3ZXWA 2JX2A 2YWKA 5LJ5Y 1NENA 3BBFA 5D6GA 2KH9A 1B3TA 3TRGA 2AGOA 4BS2A 3UNYA 4FKYA 3CCTA 2V2ZA 3ZN0B 1M1HA 4DLEA 2YQ3A 3A12A 4DR5J 2HBRB 2QYGA 1FEEA 2CNKB 3PIOQ 4LMLA 4C0BA 4F6RC 2B43A 2OMOA 3FUYA 1PCAA 2QMXA 4OV6A 3H37A 4LFAJ 3N6MA 3PJ9A 2DIUA 2A2CA 1H72C 1UJ5A 1X9SA 3WI3A 3UDCA 3ZZRA 2XM1A 5IWAF 2RILA 4EO8A 3M6XA 4NEYA 4CWBA 4Q45A 1T05A 3B5MA 3AE7A 1IWAA 5K8MA 1JNZA 1VJWA 2LSGA 1K0TA 4EB6E 2O67A 2GVDB 4IDQA 3N9LA 4XZCA 1XBWA 2QGSA 3OTOF 2LHNA 1FNXH 4O4HE 5LGUB 2VQFJ 3IA3A 2B7BB 3T19A 5I42B 3O1IA 2C28A 2BS2A 2E1PA 1BQNB 3I4PA 2UUBJ 3AEEA 2J4GA 3T1YF 2GJ2A 4DUTA 3M8PA 5CXTA 2Z0GA 2EXUA 1R0CB 4AFFA 3D0TA 3GFXA 1OSCA 1IKVA 2VKOA 3PY8A 3TLVA 3K3NA 5E3AA 1VCSA 4RLEA 1NM2A 5DM7Q 2CADA 3UU3A 1RAHB 1U47A 4TNOA 1TAQA 4O3PA 1IBLF 1KC8T 4FBTA 5LP6E 3ZZZA 3JQKA 4DFMA 2OPSB 3IG1A 3EGNA 3WIVA 5AQOB 1OEDC 4AXPA 3ONJA 2V5CA 4Z91A 3PEHA 1TK8A 3DOKA 2HVHA 1UWAA 1RTHA 3FXDB 2O01C 4A8FA 2YNGB 1IN0A 2QT7A 4FXDA 2X1FA 3GR0A 4ZLNA 4NMLA 5LL6d 4WBNE 2V8VA 4RR5A 4ZPTR 1IQZA 4HWCA 2HQIA 2E1AA 3TAPA 4YSZA 2FHJD 3KNGA 1KHWA 4PEOA 5CYMA 2ZITA 4LF4T 2F4VT 2B9WA 3EVWA 1TL7A 4DS5A 4BWMA 2QV6A 2K8GA 2F8EX 4UOGA 2JLEA 1HBNA 2JQQA 4F4AA 2ZBQA 5THWA 1U1KA 1U8WA 4N41A 2IC6A 4CTAA 4ILUA 1QSSA 2UXDT 4QR1A 5C24A 2R9LA 2GV1A 1ZTTA 3I9YA 2Q6BA 4Z37A 4FJOA 1RTIB 2NYHA 2Z4PA 4XDCA 4Q8FA 2VPWB 3MZKB 2V34A 4C2MA 2CQGA 2I6WA 3MR7A 1YI2S 4NLDA 4YQWA 2IDLA 3AD9C 2DHSA 5D0HA 1S77D 1NAQA 2OAUA 4JI8J 3IR5B 4E0DA 1J5OA 1K44A 1IR0A 2ES0A 4KX6A 4O23A 3ZNUA 4JI7T 3MTJA 5AJ3F 2W24A 2QLJB 2C22A 1G2EA 2P9CA 3SZ2A 3CW2C 1HNZJ 4IRCA 4A56A 1VQ4S 5LG3A 1WC0A 5G4DA 2G9OA 4IRKA 3ZMSB 2VG7B 2DNXA 1TV6B 4ER8A 5C8YE 4LF8J 6AT1B 5LSLA 1YBUA 2N2NA 3IBWA 2GHWA 4K4UA 1VQSA 2XMJA 5IQ6A 2R3VA 5CCLA 3PUZF 5GAHI 4B02A 2C3YA 1E6YA 4F4XA 4CNZA 4ANEA 2YNIB 1TZ0A 4AIUA 1ACMB 2FJDB 4ILLA 2J6TA 1I3OB 1WF0A 1Y9OA 4UQGA 2KINB 2ABYA 3JC6D 3DHWC 4Y2MA 4HFBA 1KN6A 1WG4A 2PFFB 2DHRA 5M2PA 3KV9A 4OHWA 2QSWA 3EX7B 1NSQA 4B3OA 2OPSA 3M8PB 3HKDE 1W7WA 2QA2A 3NY0A 3ZZPA 2JNJA 4NLOA 2H5EA 5HATA 2CDRB 4IT4A 1WKKA 4KUMB 2NSCA 4DLGA 3P4WA 3BH7B 4ZCMA 1N34F 5IXUA 4RNMA 3R7SB 4ZCLA 4JI1J 1S6UA 4UOHA 1E7PA 4F04B 2AU0A 3UN5A 5IHYA 2KXPB 2HPJA 5AXLA 5ETVA 2CE7A 5EWEA 3EGZA 4K5RA 4DXLA 4URQU 5C42B 2WSCC 3L7PA 2BG9A 2AYBA 2HMIB 2UV8A 4K4SA 5L9NA 2AJ2A 1OYDA 4WTOB 1XR7A 2DRBA 3IGVA 3D1OA 5F8IA 2N3LA 3MMBA 4X65J 3SSRA 3KNAA 2CFXA 4B9NA 1X5SA 3UVJB 4HKAA 2DLRA 3N5BA 1N5SA 2ASJA 4OYJA 4DX5A 4ZVHA 3ZZ0A 2VPZB 1PSDA 3BBBA 4M94A 3FRZA 3S6EA 1FJGT 2DGTA 2LA6A 1OQ3A 3AVRA 2XMWA 5C5JA 3C50A 4NASA 2RJZA 2YWGA 1KFDA 2ZE2B 3LTOA 1FE4A 1AROP 3ENAA 4DPXA 3UUXB 5TAOA 1OY8A 3NRXA 4Z8XA 1JLGB 1RA6A 3EZUA 4ELVA 5C2TA 2NR4A 3I0RB 4C6AA 2WK4A 2F4FA 4F36A 2OPRA 2M9KA 6FD1A 3IO1A 4KGKA 1Q78A 3ZJ1A 1OPIA 3NVOA 1FRLA 4YMEA 2JZ5A 1F3VA 1T03B 4JYAF 1YQ4A 3CC2S 4EBDA 1X4BA 2C3MA 5I4MA 1XEZA 1NK8A 1I5OB 3IC1A 3ANWA 3QMQA 3Q5WA 4B3RT 4WXOA 1IBMJ 4AL7A 1SUQB 2XSFA 3CNQP 1SQGA 2IAJB 4DJBA 2E7WA 4PK4A 4CQ1A 2HQGA 2QZ8A 5A76A 3WX8A 3RR8A 3M3ZB 1TKZA 2YH1A 2VB6A 2V1DB 2KG1A 2KFNA 1UJ4A 2WSSV 3MOZA 3TLTA 4O4GA 2V8DA 1HNXT 1QD1A 4LR9A 1IM6A 1Y5LB 2ADBA 3VGSA 3HFKA 3OR1B 4IG3B 1CS4A 4YDXA 4OJ3A 2R2UA 2YNGA 3Q89A 2ZE2A 2XS7A 2PTFA 2W2NP 3F31A 3ONXA 4DEZA 3M2UA 1R0BG 3CCES 2VKJA 5K8NA 4EGWA 2MKHA 2GMJA 1U2CA 4XIUA 3UVJA 3RHWA 1HBMA 3TUPA 3QRQA 2YX4A 3N6NA 5FY7A 4H4KA 2HMIA 1U45A 4HN9A 1FD8A 2GCFA 5K8OA 2VKHA 3HL6A 1HA1A 4ILCA 2LLYA 3MEGA 3PUWF 2YKOA 3W64A 1KTVA 4UQTA 2R7OA 1BGXT 4DO0A 4JV5J 3D7SB 4Z90A 3UFCX 4ZVSB 2EWHA 2GIRA 1RHRB 3FCHA 4KBMB 1DU2A 2HHSA 2M3DA 2OO4A 4MYTA 3SQGB 1VYAA 2HHXA 5IS2A 3M8YA 3B6BA 3DLLQ 3IRXB 1IKVB 1KDNA 2CZVC 5LJNA 2CRLA 5KFEA 4KHZF 1VRTA 1NK5A 4F7VA 2XAFB 3R5AA 3B4MA 3JSRA 4USKA 3H4DA 3H5YA 2XC9A 2UUAJ 1NKBA 1G4CA 2AF6A 3OUYA 2J8SA 5HXRA 1HYSA 1S0OA 4J9SA 2M52A 4ZA1A 2Y9HA 2CJYB 1S9FA 4X64T 3U1NA 1ZA1B 3OHBA 3I0SB 4HHHA 3PW2A 3CF5Q 3QGIA 5ETMA 2NZCA 3ZJ2A 4Y00A 4O3NA 1FVSA 5LNKA 1M5OC 2ZBIA 5I3PA 4AKLA 3IBFB 3AAIA 1H2VZ 2WSFC 2FJBA 4OJGA 1R6YA 1N32F 4U9RA 2KVQE 4C8NA 3O8WA 2G13A 4OLOA 3BS9A 1SJFA 4HH0A 4KH0B 2XZDB 2ZJPQ 4C8OA 2V67A 5FL0A 2N7CA 5JDFA 3FK4A 1T7PA 5HQ8A 2LP4A 1WG5A 1CEZA 1VBXA 4QIWD 5IC4B 3GP9A 5HAOA 1FDAA 1ULRA 3NRYA 3G06A 2WM9A 3ZFVA 4RW8B 4CZCA 1RTIA 4JYAT 4AUKA 3AODA 3D6HB 2UXDF 1LFWA 4F26A 4V19X 4CO4A 2HEKA 4DV4J 4LFBT 1KVKA 3OW2R 3SYZA 3FSIA 2V2QA 1C4AA 2D3UA 2ZM2A 4PWDB 3OFGA 4EV6A 3DRRB 1JLCB 1VLOA 3PR4A 5L3DB 3OPKA 5J1PA 1X4FA 3J9X1 2QL9B 4I0UA 4PQUA 3BSOA 3M1VB 5HEHA 1V5IB 2X1GA 1XNQJ 1CG2A 4DL4A 3OJSA 3AA6B 2OI2A 4J9RA 4FKXA 2P9GA 2E8IA 2XS2A 4O4LE 1YG0A 2ZZTA 1DTTB 3A8IA 3HKBE 4JI8F 3VALA 2MBGA 5KFXA 4LQ3A 5D8HB 4G3IA 4IG0B 4FPIA 1R6VA 4ECUA 3QIPB 4MAKA 1CJVB 2CBIA 4LF9T 1CJUA 4DR2J 4O3RA 3GSDA 3NGDA 1NJIT 4MIWA 4JV2A 2HH7A 4RL1A 2E5LF 3PVXA 2CQ4A 1U7LA 1L0VA 3TO8A 5HMWA 2JH3A 1ZM3A 4ADZA 1E2AA 2ZD1B 3ONLC 2HNZB 3BGFA 4Q8EA 4MT1A 3V2UC 3EABA 3PX6A 4QU6A 3R5CA 1B0TA 4B9UA 3OSPA 3VF0B 2KO1A 1T9UA 3GN5B 1N88A 4IH7A 5JDHA 1RABB 1T05B 2VL0A 2HIQA 5AQGB 4GO5X 1HI8A 2HGNA 2PC6A 4LREA 1JMTA 2MTLA 3H0PA 3M8SA 2BJ7A 4PXEA 4NX9A 3L9ZA 3BSAA 2E1CA 1WEYA 4QR0A 1HQ2A 5IWAT 3TR5A 3GZ7A 3G6YA 2C0SA 1Z0PA 2E9XA 4USIA 4GVBB 4K4WA 4ECXA 3RRHA 4YN3B 3GN5A 4C11A 3RRWA 2UU9T 4ZPDA 2XYGB 3SCKE 4X4VA 3C4XA 3ZZUA 1KNRA 4OZ2A 2V2VA 1UEKA 3G86A 4QQBA 2WRMA 1IKXA 3KHHA 5F8NA 4YEAA 2NZ4A 2CQHA 4HVZA 4NL5A 2CCQA 2MKKA 3OLBA 5LMUF 2VF3A 4ZHQE 1HNIB 4M5MA 1VC0A 3K5LA 2IVMA 3QPIA 3CJKB 4OX7A 2PSZA 4CN4A 3R2CJ 2FLOA 1DAXA 4HWIB 1S9EB 1R8HA 3PU8A 4H4OA 3CQXC 4KTQA 1SKSA 3TAQA 4XO0A 1U0HA 3A4TA 4R5PB 1QAXA 3K1SA 3B4DA 3H3AA 3MFHA 3DFEA 2C2DA 3TUZC 3I0OA 2Y8YA 3DOLA 2W9CB 4I6YA 2FVPA 4KV8A 2E5JA 2HN1A 3H20A 1CJVA 4QBUA 2VBYA 5HI7A 2HBQB 2ZJQQ 2H4YB 3HMJG 1LW2A 2N7YA 4GKJF 4PYAA 3C4ZA 2RRAA 5JMNA 4LRBA 4X4TA 3SS1A 4DNDA 4RNNA 4ZS3A 3TLSA 5CABA 3RAMA 5KT3A 2YWEA 2AGPA 1D1UA 4O4RA 2RS2A 5B0FA 3OL9A 2DWKA 3LANA 4IL9A 2RRNA 4LF5T 3WX4A 3AHPA 3J81Y 4X4PA 1FVQA 3Q86A 2V8SV 1NDLA 3CJRA 2LQ9A 3CSKA 4FN5A 4EZ6A 5LG4A 2J62A 2QYCA 3D2WA 3D54A 4LFCJ 2R8JA 2L3MA 1S1WA 1RAIB 5J2QA 1NKCA 3CE8A 2NYIA 3P4UB 4LSLA 1M1GA 2FUG9 2DIVA 4QX8B 4NLWA 1WNEA 3L95X 5HO4A 2HHHF 1N5QA 1NSPA 2XWYA 3ZTRA 4XK8C 4CO2A 4RUAA 5A8WB 4JI6F 3HVAA 3S7RA 4QOTA 4TZ4C 2BE2B 4KI0F 5GAEU 3SWHA 5L3EB 1FJEB 1N56A 4HFHA 3I5AA 3QB5K 3NNCA 1HX1B 4QIVA 2FJXA 3GJQB 3NBXX 3ZCJA 4DMWA 4DUZJ 5F5WA 2FVQA 3KK2B 2UXCT 1GMVA 2QGFB 3PUXF 2VV5A 3KLIB 3VAJA 4DSFA 3C3LA 2ZDOA 3EYZA 4X4QA 2A2FX 3BYPA 1YK9A 1RE1B 3G8QA 2LA4A 3RIUC 3AB3B 3DLKB 2BANA 5A0YA 1G73A 2IM2A 3N2GE 2E9XD 2Q9QD 1RT5B 2BJ8A 3R7NB 3LSVA 4PJJA 3SCIE 2LFVA 2VDIA 3DLBA 3MAQA 2CWKA 2FHOB 3KLIA 2XM3A 4L3NA 4ZVRB 6FDRA 4O44B 3OD2A 3G6XA 3L4BC 3CDEA 5LSRA 3KDSE 2AP6A 2MQPA 3HVRA 4I1TA 1DLOB 1M5PC 2Y1LB 1NK0A 5K20B 3AJ2A 1SI9A 4P9SA 3T1YJ 2XQ9A 4DOZA 4ECZA 2MZSA 4DSIA 2A9UA 1RWKB 1F2GA 4ANCA 4BA9A 1Z2ZA 2VQFF 2HSEB 2NW9A 4ED6A 2VBZA 1WORA 4Y34A 2MYSA 2QC3A 1S1XA 2OLTA 1ZP0A 3OTBA 4DQPA 1NUEA 1KFYA 1FXLA 1YKHB 4IE6A 2GMLA 4X1IE 3FBFA 5JVDE 1UW9A 4DUZF 1SUQA 4DV0J 4JI1T 3QSYB 2R7WA 1FEHA 2L41A 3AJ1A 3FBLA 2UUTA 2XQ3A 1N5YA 1EZZB 1WC6A 5KOXA 4EIWA 2IYGA 3NS6A 5AQMB 2XQ7A 2Y0SD 3CT9A 3KDOA 3C64A 1SL2A 1WC3A 5SZTA 3JAMU 1I6JA 1IKWB 4YHHT 3LWLA 3NNHA 1KQSR 2J6SA 4IR9A 3R6NA 2DNGA 3MUMP 2NTYA 4DR2F 2XB2D 3HP6A 2CPJA 2GNKA 3HHLA 5KOWA 1KOHA 4RW9A 3UN3A 4I7FB 3UU4A 3OJAA 3TI0A 3LJCA 2C5IT 5C24B 4ZEYA 2IHR1 3CMLA 1V9DA 3M6WA 4L6V3
chains in the Genus database with same CATH topology
4J90A 2I0MA 1LNQA 2FY8A 2BKOA 2IIUA 2AEJA 1XWMA 4G65A 4EI2A 4J91A 2AEFA 3L4BC 2OGUA 2BKPA 4RO0A 3RBZA 1T72A 4L73A 4J9VA 3KXDA 4L76A 4L75A 3JXOA 2AEMA 1T8BA 4Q25A 3RBXA 1SUMB 3L39A 1VCTA 4XTTA 4GVLA 4J9UE 4L74A 2BKNA 2OLTA 4YS2A 4J7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J90 A;  2I0M A;  1LNQ A;  2FY8 A;  2BKO A;  2IIU A;  2AEJ A;  1XWM A;  4G65 A;  4EI2 A;  4J91 A;  2AEF A;  3L4B C;  2OGU A;  2BKP A;  4RO0 A;  3RBZ A;  1T72 A;  4L73 A;  4J9V A;  3KXD A;  4L76 A;  4L75 A;  3JXO A;  2AEM A;  1T8B A;  4Q25 A;  3RBX A;  1SUM B;  3L39 A;  1VCT A;  4XTT A;  4GVL A;  4J9U E;  4L74 A;  2BKN A;  2OLT A;  4YS2 A;  4J7C A; 
#chains in the Genus database with same CATH topology
 1LWE A;  3M2R A;  3PKM A;  4JUY A;  4C3M A;  5LB7 B;  1D1B A;