2BKNA

Structure analysis of unknown function protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
PKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Membrane protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bknA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bknA02
1T72A 2AEJA 4J9UE 1LNQA 3RBZA 3L39A 3KXDA 2BKOA 2AEMA 4J9VA 1VCTA 2OGUA 4L75A 1T8BA 2BKPA 2FY8A 3L4BC 4EI2A 4L76A 2OLTA 4J91A 4Q25A 4XTTA 4J90A 3JXOA 1XWMA 4L74A 2AEFA 2BKNA 4L73A 4J7CA 4G65A 2IIUA 4GVLA 1SUMB 3RBXA 2I0MA 4RO0A 4YS2A
chains in the Genus database with same CATH superfamily
3A13A 3QWPA 3DDNA 3M8ZA 3NP5A 3OFEA 2YOEA 1M5SA 3OL6A 3UVJB 4LF7J 2RRBA 3N6NA 2CQHA 1NSPA 5ETWA 1ZPVA 4K4XA 1RAAB 4HR2A 3CX8B 3M9MB 3OL9A 2KJWA 2DNYA 2IYGA 1F5CA 3DRXA 5DETA 4NCBA 4TY8B 1SQEA 3D28A 3SOLA 4K0KF 1F5BA 3MPDA 2FZGB 2GVDB 2SXLA 2LCWA 4JI8T 2ILYA 3MMBA 1KTVA 4QWBA 2BE7D 2VURA 3E01B 2DD8S 3HCXA 1TL7B 3HULA 5EK2A 2HFUA 4J9LA 3RYHE 4E7SA 3V5SA 3VHQA 4PAGA 1KNPA 2JEIA 4C8LA 2JRKA 2ZH6A 2LKHA 3M9OB 2BKOA 4DL7A 4DQRA 1XIQA 4PG4A 3ETOA 3NXZA 1W25A 2DO0A 2HG4A 2VG5A 4I6WA 2QEXS 3BGRA 4DV0F 4J9RA 4NIQA 5HBMB 5KT7A 2LEAA 3C16A 5LBMA 4RUBA 3C6UB 2DEIA 2RP4A 3H20A 1QM9A 2YNFB 3I0RB 1PIEA 3BQ0A 1KWMA 4DZDA 2BDPA 1NEEA 3HHKA 1JMTA 1SXLA 2UXDT 4F4YA 2QGSA 3H5YA 1V6HA 4MKAA 2HZAA 3MEDA 2WTFA 3CDBA 4CI0B 4CO4A 2ZUGA 1NDPA 4C2MA 2YX7A 1RTZA 3W15B 2XAHB 3NWIA 4QQBA 3HKBE 2XWYA 4QYZK 1JKHB 1A9NB 4RX6A 2H4WB 1C0UA 5JVGQ 2CUYA 3G6YA 2Y8YA 1FVQA 4ILAA 2V4JB 4QIFA 2Y8DA 2V2QA 2MPUA 1IJEB 3OD2A 5FL1A 2NTYA 2B8PA 2XM2A 4A48A 4J2CA 5DZ7A 3CDEA 4HACA 3FSIA 4X5TA 2AMCB 3QLHA 4ECYA 2JMHA 4LF7T 1SJ3P 1JJHA 2V8PA 3GJTB 2V67A 2IC6A 2E9XA 1RT2A 1S9GA 4PRFA 3DOLB 5J1EA 3DCAA 3K8VA 4NLPA 2Q9QC 2A9UA 1VDHA 3EXCX 1S12A 3DRRA 2N7YA 3L39A 3MTJA 2QSWA 3MR6A 5K14B 2MZJA 2LEHA 1JJ2R 2JDJA 3Q9DA 1P9QC 4DL3A 4TNVA 2MBGA 2XMUA 4A8KA 5F5WA 2GHWA 5FLXU 2V4QA 3UN3A 4B3ST 5LSLA 4ECRA 4KV8A 1N34J 3PUVF 1MWQA 4UF4A 3SQOP 2IRXA 4NLTA 3IN5A 2AWZA 3KLGB 3POTA 2B6AB 5A0YA 3KK1A 2CPJA 3JXOA 1XC9A 3Q2SC 4NLUA 2PEBA 5C3JA 3LUYA 1WEXA 2Y1RI 1I3OB 3T1YF 1CJVB 4EMDA 2VKHA 4X4QA 1U49A 1RU2A 1ZM4A 2EHOA 3FQLA 4CLTA 4HFHA 3HJVA 3AVSA 3EWGA 5ABGA 4QYZJ 3CC7S 1KBRA 4DEZA 1NDKA 2XQ7A 2HHHF 3DLGB 1DQ8A 1RA6A 2DVIA 4H9SE 3VWSA 3BO4A 3MUVP 1NPRA 3P8BB 2DLRA 3NS7B 4N8OA 4JB8B 2NUHA 3GB0A 1GFWB 3H40A 4C9DA 1ULRA 3L7OA 4FKYA 5J2PA 4P72A 3NRYA 3SFUA 2CVIA 2HHHJ 2JC0A 4X84A 3KJQB 2ADBA 2WRMA 1SVDA 3SCIE 3KXDA 3PIOQ 1JIHA 4DR3J 4F26A 4DR6F 3QAUA 3L3PA 2M8HA 1U2FA 3HXMA 1SBRA 3FRZA 3LOUA 4F02A 5FXWA 3ZZRA 5C24A 1FK9B 1GXTA 1KFSA 2LQJA 3MACA 2V2VA 2QFJA 3KLVA 2WSCC 2QJ3A 5DABA 4F8HA 5A8RA 4NLWA 5FY0A 1VQ7S 5KG2A 1I5OB 3OL8A 2C3OA 1RT1B 1S79A 2XS2A 3IC1A 4QYRA 1LW0B 3M8YA 3V2UC 3THPA 4K4ZA 3RIUA 1SIZA 5J1EB 4DPXA 3AE8A 4OFZA 1FDNA 2C2MB 2JOQA 2FJBA 5EK4A 4X4NA 1FT8A 3M9NB 3I4PA 4LSZB 4NLYA 3E2EA 2RE1A 5F3JA 2WZ1A 3WAJA 4ZVOB 3ENQA 2DXDA 5HXHA 3BYRA 2HHXA 2RIJA 5E2QA 1TFWA 1JLEB 5IHYA 3OXLA 4KE5A 2HHSA 3W9JA 2E1AA 3GG1A 4USVA 3ZN1B 2LDIA 5IUXA 1WACA 2GIRA 1VOMA 1KRPA 5CH7B 5A8WB 3R3TA 1ELOA 1S57A 3N5LA 3ZZOA 4EIWA 4CLFA 2VZ9A 1RZMA 4UVBB 3KOAA 1YWXA 3N2KE 3KHLA 2HVZA 1S1VA 4LFBT 2AZ1A 2WDRA 5KFYA 4QPTA 2MQOA 2QVAA 1IBCB 4H9OC 3ZNJ1 1ZAWA 3OBVE 1IJFB 1M1KT 2YWWA 4RW8B 3ZKRA 3ZTPA 2F4VT 4ECQA 4OYMA 4GKJT 2R7WA 2KLQA 3JQKA 1VQPS 3QATA 2DR6A 1SJ4P 3GLJA 2V6AA 5BXIA 3LBXB 5KFNA 3R27A 3PIPQ 4BWJA 2J6SA 2JQQA 2WZIA 1NHUA 3TAPA 5LL6d 1S6PA 4DV2F 1SIWB 3I9WA 5DJBA 2EWHA 1VRTA 3RI5A 4TXSA 3WX4A 3ZYLA 4GKJJ 4YSZA 1MROB 1F60B 3THVA 2Q6CA 3KFWX 5HO4A 1IZNB 3V4IB 2KYXA 2XBPA 3ITHB 2RQ4A 3M6WA 4A8OA 5ETTA 4OYZA 2OFGX 1K1SA 4KTQA 3O8WA 3R9LA 4UIGA 4LBIA 4PYAA 3M32B 2XO6A 3T1YT 4DV7J 4NPOA 1O8BA 3PURA 2OEKA 1V3ZA 2VD3A 3K7RA 1VC6A 4RPFA 4YR0A 2ZWPA 2QZ8A 1RWPB 1X9BA 3ZJ2A 2LQ5A 3TO8A 3ZZYA 4J9KA 4ECVA 2YKPA 1HTJF 1RT1A 4P73A 3TI0A 1HI0P 2PE8A 2H5IB 3M65A 2WS3A 1WEZA 3NRBA 5LB7B 2CE7A 2KT3A 5LP6E 2UU9J 1LKZA 1FWKA 2VL0A 1YRUA 4DNDA 1KEKA 2EHOD 1PILA 2XZTB 1RXOB 2UVVA 2J0XA 3WC2A 2VQFJ 4OI6A 4NXNF 4JI1T 2KVIA 3DKDA 3G6VA 1C1CB 5CYMA 5E3AA 5FLXY 4RW7B 2ASLA 3MK7C 2CRLA 1RTHB 1NKEA 5KT2A 3MA9A 3TUIC 2M3DA 1S7HA 4AL6A 1Q53A 3HJFA 3ZZ0A 5D0GA 2VQFT 4ILLA 4CXXA 4M5JA 3CJ0A 3BBFA 2MYFA 1DLOA 4F4AA 1HWKA 4PNIA 3DOMB 3IM8A 1I1GA 2CQDA 3KV9A 4RUCA 1U48A 5IM0B 3J81U 2HMIB 1URRA 5L1IA 1I6JA 1KKHA 4YTNA 4JI6T 1TKZB 1T8EA 3EYZA 2MKYA 4IG3A 1H7WA 2FJXA 1U0HA 1MLAA 2CCQA 2WBRA 2ATLA 2XO7A 1I51B 1U02A 1FFGB 3PXGa 2NXEA 3MD3A 2DISA 2AGOA 2CKWA 3HT3A 4KHPT 1AT1B 4F4XA 2B7BB 3IFEA 4RR5A 5IOLA 2HWIA 4AKLA 3RU0A 1C4CA 3R84B 5J2NB 1U45A 2MMYA 3K58A 4PK6A 2MXYA 2YNIA 4F2RA 1SC1B 2VB6A 3DLJA 1IAPA 4J9UE 1GT8A 4PAAA 2KXNB 3SSRA 1RWXB 4KV8B 4DR2T 4M5DB 4DXLA 1B3TA 3C6TA 3QO9A 4LMKA 1FKOA 4M5LA 4PJJA 1E6YA 1IM6A 3GMGA 1Y5NB 4AL5A 4KGMA 2ERRA 2LEBA 3KYLA 5D4OA 3VALA 2PO4A 2IVYA 1NK4A 4B9SA 2KU7A 4AL7A 4J7CA 4OJ1A 1APSA 4K4VA 2BJ8A 2QO3A 1TKXA 4DX6A 1HHQA 3EM1A 1E6YB 2C42A 4QR2A 3GFZA 2UUAT 3MUTP 3CJTA 3KG4A 2BACA 1MMLA 2GAGC 1CEZA 2MTLA 2HK2A 1WF0A 1ZTTA 3M2UA 4WFYA 2GIQA 1D1CA 3VZHA 4KRWA 1VBZA 3DC2A 3UCGA 2MDAA 2FYXA 4HGAA 2CZ4A 3RAQA 2HFVA 2MKKA 3H59A 3DGPB 5HVHA 1UW9A 4OX8A 5JMNA 3UFCX 4LFAJ 4ETXA 3HFZB 2FVSA 4OZ5A 3ZN0B 3VCDA 5L4EA 1SCJB 2LSYA 5KG5A 3K8WA 1YW0A 1AROP 3I4HX 4QW8A 3FK4A 2MZQA 1X79A 3NG8A 5KFVA 4FYXB 1OY8A 4A8WA 2XGPA 1MW7A 1UEVA 1SKSA 4TWFA 1UZHA 1HBNA 2FPHX 5BYQA 4QCLA 3P4SA 3TWZA 1Q5VA 2I1RA 5F8HA 1AW0A 3G9CA 3DRRB 2MJUA 2CWOA 1FD8A 3HI9A 1VMBA 2X0LB 1NKBA 4LREA 1A6LA 4J9OA 1JLEA 5CYQB 4Q2MA 2ZOMA 2YH0A 5LCYA 3R97A 1FRJA 4QKNA 4LR9A 4QH5A 1HNWF 2CPXA 3UI3A 1T03B 1DTTA 5GAGI 2EI5A 2Y48B 5KFEA 1MROA 2IIUA 5HROB 4X4UA 2H4YB 4HL9A 4ZVHA 3JYTA 4OV1A 1IBMF 1WC1A 1BLUA 4M5MA 4EZHA 2DWKA 1MMAA 2V7IA 1J5OA 1MSWD 2OTJS 1SA0E 2DHRA 3R5GA 1WUUA 5DRKA 1S1XA 2GCFA 2VICA 4WW0A 3HZGA 5B09A 2RQCA 4MTPA 4S0MA 2MQNA 1J5OB 3CCWA 2BMBA 2X1GA 4ZVEA 5HLFA 4CI1B 2B56A 1N4LA 2E1CA 3HD2A 2B9WA 3N9MA 2XQ5A 3DNCA 1N34T 3UDCA 3MCSA 3T8OA 3K89A 2F9DA 4TLQA 3CXCR 2PT0A 4O4IE 4NRUA 1WC0A 2V2ZA 4RL1A 5J2TE 1EP4A 5G4DA 4EEYA 2DGSA 3O4XE 4ENOA 1KEYA 1XK8A 3AXJA 3LWMA 3RBEA 4R5PA 4WPAA 1TVRA 2JFKA 3G6XA 1HX8A 4EBEA 1UP1A 4LRAA 3MF5A 4OV6A 3MKDA 2XMJA 1FXDA 1D9DA 1AXQA 2JVRA 5AXNA 3BK9A 3DOKA 2L8KA 4PG8A 4ZVFA 4J9MA 4OYWA 2C5KT 2E1MC 5D3GA 2WSEC 2G2YA 3CD0A 2BRKA 3A8EA 3BDEA 3NGTA 2FUPA 4FVCA 2KYZA 4ZHRA 4DQSA 2QC3A 4KGKA 2OPQB 1UWBB 2PC6A 3L8RA 2HBQB 4EBCA 2CQ1A 2G1HA 3BGRB 4X62T 2VFVA 5L3GB 4I68A 1EKRA 4O3RA 2WHOA 2B9EA 3ZT7A 1HQUA 4YHHF 2DR9A 1L3SA 1N5SA 2O3DA 4ZCMA 4HHJA 4DZ6A 3TEGA 3OT9A 4EEBA 2ACXA 4MT1A 3HLUA 3MAAA 4ZPCA 2Q79A 5DM7Q 1TKTA 3B4MA 2ZZMA 4P7VA 3RGLA 3AEDA 2AZ3A 1NJXA 2DEJA 1N5YB 1AFJA 3S01A 3AHPA 4RW6B 4HEA9 3OVBA 1WI8A 2IJRA 1Q78A 2BQRA 4LF8J 4R8UB 2Z2ZA 2HS3A 3P4RA 3ZTRA 1HYSA 4I2PB 4LF9F 4MK8A 1REGX 7FD1A 4USWA 1N5YA 3T3FA 1V5IB 3EZ5A 1RI7A 2D69A 4LVNP 1KVKA 4YEAA 5ITHA 4ED6A 3AA6B 3NAHA 5RUBA 1CLFA 1V3SA 3NBPB 2MGZB 2XHEB 5MAOA 2WB4A 2CPHA 2CPIA 2JWNA 2KI2A 5AXKA 2R7OA 4HFIA 1KFDA 1TV6B 3RH3A 3NGRA 4IKAA 3TARA 3H8YA 4LJMA 4OMFG 1XNQF 4ID8A 5EWEA 2NXCA 3ENAA 1JLBA 4NRTA 1HCIA 1OO0B 1B7TA 4FF3A 2MQLA 2D7SA 1HNZJ 1X9MA 5KAKA 2ZWOA 2HRYA 4ERRA 4JV2A 4P2MA 3KKFA 4IG3B 1H0HB 1S9FA 2R2TA 2I8EA 4FP9A 2MQMA 2NCKL 2BXJA 3A3NB 2MYSA 1NJWA 4K5SA 2N3OA 4EFAC 3N9OA 1V9DA 2VOOA 2I5JB 2Y0SD 2LMIA 4E8UA 1O0PA 4ED3A 1SH3A 2XC9A 5SUHA 4X62J 3JTPA 4YT0A 3F44A 2X68A 4JI3J 4FS2A 3EGWB 1RCOB 4LRFA 4A4JA 2E8IA 3ISND 3KK2A 3L09A 4YSYA 1XR5A 1CS4A 1U1LA 2LHNA 3IS9B 4F3OA 2Y1JA 1RWWB 3V4IA 4RJVA 3VAHA 1KLMA 5I3UA 2RRAA 5I4MA 1FJCA 2OD6A 3GE9A 1B4SA 1R0AA 5KG0A 1QUVA 3RR7A 4ED5A 1FX4A 1NHKL 2MQQA 3VV2B 5KX5E 3Q83A 2UU9F 2NW7A 2DNRA 3KDSE 3NWGA 5A76A 1LQ9A 4QOTA 4KPYA 2KVQE 5JDFA 2MHEA 3DM2A 2P5VA 5FKYA 3C6UA 2KJVA 4YS2A 4RWXA 1WG1A 3J80U 3PU8A 4HHHA 4F8RA 2AIRB 2F8MA 2A10A 4HWDA 3G06A 3ZMUB 5D4LA 1KR4A 2WM9A 4W92B 5ETNA 5F9NA 2KB2A 1FJGT 3V6KA 5E7OB 1URNA 4O8SA 4Q5VA 5HAOA 3JAMY 3N0VA 2MZ1A 2B51A 1P6TA 3K57A 4NEZA 4PWDA 2YDSA 5FIIA 1S7IA 5GAEU 3B78A 4U96A 2HHHT 1WOSA 1TKZA 3AE7A 2V7LA 2NR4A 1QTNB 4H4MA 1HR0T 4GRSA 1LVFA 1WD6A 3ZC4A 4CQIA 4NLRA 4I6AA 2KM8B 4KGVB 4HFDA 4TLRA 3L95X 4UR9A 3MM8A 4QXCB 1WYCA 2EHOB 2XY8B 4LRCA 3ILOA 4P0AA 4OLOA 2X0YA 1RTIB 4PUOB 1N5VA 4MLKA 1WDTA 2J0WA 2ZMAA 1ZS6A 4Z2XA 4WXWA 1HWJA 2UV8G 1BD6A 1RACB 4LMZA 3EX7B 4IO1A 5LSRA 3CQXC 3CWJA 3AXMA 3HSZA 2N7CA 4I0WA 2IDOB 4H4MB 2KMFA 4FYVB 2WSFC 1NSKL 1HD1A 2UUBT 2HBYB 3W5XA 2CQGA 3H7HB 4HYKA 3IRWP 2DNZA 1YJWS 2BW2A 4NXMJ 4OHXA 4WP3A 4X64T 2X3GA 1IVZA 3TAQA 1AZSB 2FHKA 2YX1A 2QE5A 2WU5A 4IRDA 1U0SA 1CHUA 4JI8J 4NZ6A 4AT1B 1FTCA 3Q8VA 4B9LA 4DR7J 2MZRA 2W7PA 3ETVA 2RH3A 1HMVB 5LHGB 5IT9Y 4Z91A 1B7YB 1RTDA 1RJJA 4GO7X 3CCSS 2RU9A 4OYPA 4OYJA 4P0BA 4U72A 1J5WA 2AX0A 4L75A 3CJ8A 4Y6IA 4I4TE 4JI7F 1RHMB 3LALA 4H4OA 1K1QA 1Q8KA 4W90B 1RTDB 5JUMA 1G8XA 3O3LA 3OR1A 5CAAA 3FKBA 4URQU 1J2VA 2A2FX 1HQEA 3LK3B 1HNVA 3ICLA 3O1LA 5JXSA 2QMXA 2Q66A 4U7UD 4ZZBA 5M2PA 3Q89A 3Q86A 1TAQA 3PKYA 5LYJE 3M8SA 1CULA 3KLHB 2KL8A 4IQXA 3BN4A 3J7Z5 6FD1A 1G3OA 4N41A 1CQNA 4ZZCA 3TZZA 3BDPA 3H2UB 1WF1A 5SZTA 2ZDOA 5HCJA 4ZJLA 4TYBA 4WKYA 4KQZA 1H2UX 3PTWA 1QJHA 4UF0B 3WIVA 1FJGF 4C11A 2IM0A 3TA0A 2B4VA 2KHCA 4QH1A 1TL5A 1T03A 3H5SA 3N28A 2W2UA 1FMVA 4CH1A 3H4DA 3FEYB 3GJSB 2N2NA 3KMSA 5KFKA 1VHIA 1Y5IB 2CZ9A 2VIHA 4A5XA 1AUSL 1HBUA 1HBOA 5K8MA 2EW9A 2YXLA 5HMWA 1ROFA 4CO1A 3KNGA 5L38A 3HVTB 1NRKA 1IBMJ 1X4GA 3PW4A 2MY7A 2RD5C 3LP1A 3GIRA 1J27A 4Z7YA 4AQYJ 3GJRB 3LWLA 1XN9A 4PXDA 5JH7E 1CUNA 3S6EA 5DQGA 2HWTA 5LXTE 3NVOA 4I7FB 4ELTA 1OWXA 3PYFA 4RNFA 2V63A 2QN6B 4F3QA 2NR0A 3G96A 4RO0A 1VISA 2J9CA 1QLBA 2ZM6F 4YR3A 3QC9A 2B3TB 4DR7F 5AQNB 3ZTSA 3VR8A 1J1JA 2JRSA 3KNAA 4MMOA 3PUWF 4OZ0A 3ZSTA 3TAMA 2CQIA 2X9XA 2F40A 4H4KA 2W0GA 3S7RA 1N36T 4MBQA 3SV4A 2C2EA 3KV6A 1S9EB 1VQNS 4C90A 4NE9C 5LBQB 2EFNA 5DLFA 3EI0A 1DFDA 3UN5A 4IE6A 3MR7A 5LM7E 1OMSA 3O44A 4DPOA 1T9XA 4K0UA 4KHZF 1NK9A 1Y11A 5BYRA 4OX9J 2MKHA 3HX9A 3H98A 1FNXH 1S48A 4ZVQB 1JXLA 4HTEA 4IH7A 3MEKA 2CG4A 2CJ9A 1EJ7L 4YHHJ 2JEGA 3ZCIA 2W01A 2UUCF 5KFCA 1PCAA 2LRLA 2QMUB 4EYIB 1BGXT 4DUZT 2V8VA 2ALZA 1M1GA 3N9NA 2GC8A 3DU6A 3ZT6A 3OFFA 3TA2A 2DH8A 2LSIA 3CPZA 2W9AA 1S0OA 3OUYA 4KBIA 5L3DB 4HFCA 3I0RA 4F67A 2XSJA 1V5VA 2CEAA 1N32F 3M6VA 1XNRJ 1RA7A 2RQMA 2DGXA 1P8GA 3AJ2A 4YFUA 2ZNZA 1XMQF 3B8HA 1RT4A 1DQ9A 3QQCD 3ZPOA 2YNHA 1NDCA 2DITA 1JLQB 5LJ3Y 1Y7PA 3E22E 1RHKB 1KOOA 1REVA 4CNYA 3DI6A 2D9DA 2B4UA 2FVQA 5IT4A 2CJXB 3W2VB 2BA9A 3FHNA 2C5IT 3Q5XA 4I1TA 4ICLA 4WFNQ 3M8WA 4X4TA 4JI2T 2V4RA 5A2QU 4MK9A 1NEKA 3M1VB 1TK0A 3GZ7A 1CJTA 2UU9T 3P5BP 4KY3A 2XYHB 3QLHB 3MEGB 1L5UA 2MOZA 2J7KA 3TKLB 3U02A 1T9VA 3CMQA 1X4EA 2I6WA 2BKPA 4IFVB 3ONXA 2V5CA 3MCNA 3LQVA 1BQMB 4LQ9A 4LBPA 5DQWA 5LMUF 3CJ3A 3W2WA 2F3JA 4OX6A 2LYVA 1UVLA 3Q8PB 2IRUA 3T41A 5J2UE 1U26A 1FNOA 1K8AT 1IKVB 1VQYA 4A8SA 2W2PP 1NK6A 3FGVA 5KFDA 4DMZA 4MKYA 5A6PA 3U7JA 4DR2J 2AYBA 3CSKA 3BGFA 1R8PA 2I0XA 5D3GB 3A5XA 4O3OA 2QYCA 3FSXA 3RB3A 4I2QB 4Y2AA 2YNIB 2K8GA 4OHWA 5IWAJ 4ZP9A 2HZCA 3MCOA 5JVHQ 4I0UA 2HNYB 1OIAA 2HGLA 4O3SA 1Y10A 2XAFB 5E3PA 3L7UA 1KS2A 4PPDA 3ZMSB 4FZVA 3TJ9A 1OEDC 4PPZA 4WP8A 2BJDA 1Y00A 4ELVA 2GQ2A 4DX5A 2P9EA 1N52B 3FQKA 4DR6T 2I59A 1HMVA 1E6VA 4ES2A 1G4CA 3HKCE 2ZBIA 2AGPA 1FD2A 2CLYB 3U3IA 5H9EK 4AD6A 5I42A 5CYMB 4CXWA 1TKXB 2UUAF 5L39A 1QAXA 1CSJA 3W9IA 2CMRA 4LFAF 1IR2A 2GJFA 2WK4A 3LFMA 2EVZA 2EC2A 2YKSA 3KDOA 5GAHI 1F0XA 3K5PA 1LWCA 4B6XA 2QSFA 4CT8A 1IWGA 1TKTB 1BQXA 4CO5A 2EFVA 4YB5A 2E5JA 1X4HA 1N56A 3SDEA 2J9DE 2AU0A 4I64A 4NCGB 1HR0F 4OHVA 2V7MA 1FKPB 3MURP 5FP3A 4EWTA 3JB9k 3JC6D 1UVNA 4QBUA 1N33F 2DGQA 7AT1B 2BKNA 1H2VZ 4G1IA 2ZBPA 1WORA 1PYOB 1T9TA 2C2OB 4ZCLA 3TQEA 1J5EJ 3NS6A 3QB5K 2XZDB 3DP7A 2ODVA 5D77A 2WMOA 4JI4J 5LG4A 3DRPB 3Q23A 2OKQA 3OTEA 5ABHA 2E7XA 1YKEB 4PR6A 1RU1A 3LA0A 3FCHA 5AQMB 3DLHA 3HKZD 4NLXA 1XBWA 2RU3A 4EU0A 5L3BB 2B9YA 2V5HG 4FNIA 9ATCB 3LP0A 4UELA 5IWAF 2KT9A 2FZKB 2BE9B 1SQGA 5CABA 1RQ0A 2AE9A 3W5YA 1R8CA 3W8GA 5I3PA 2E7WA 3GSDA 3GMIA 4JI3T 5B0DA 4EO8A 5LHIB 4ZI3D 4IYQA 3LAKA 8RUCA 2DH9A 2XQCA 4J9QA 1F2HA 3ZTQA 2AJ0A 1FHTA 3QNUA 5FNVE 2ZBRA 4IFYB 3KLGA 5EWFA 3BQ1A 3Q8YA 2K3WA 3UU4A 1R6YA 2Z0GA 5DDQC 4URSA 3H0PA 4YTMA 1ZM2A 2E9ZA 2WOMA 5IXUA 2O5DA 3WQPA 3VQTA 2QT7A 1R6VA 2ALYB 4PABA 4O23A 1D0ZA 3FBLA 2DNQA 4O4GA 2ZKTA 1PKUA 2ZKUA 2RNEA 1W09A 1SKUB 2FTRA 3ABVA 2V9WA 2UXBJ 1HNVB 4COFA 1RT6B 3K1SA 3MXZA 3OLAA 3K0JA 1G2EA 2Y1LB 4UUWA 2XMKA 4DU8A 5C2GA 2J6UA 1IKYB 1GTHA 5E41A 4B17A 3C15A 1CC8A 3DHWC 3UUMA 1RT3A 1SJQA 2ZUAA 2ZD1A 3ZLIA 2H7VC 2CQ3A 2RPAA 1XTZA 4PCQA 4JI8F 1FEWA 1RAOA 3VRBA 3RBDA 2R8HA 3JCFA 1IKYA 2ZE2B 2LKGA 5LMNF 4FDFA 2IAJB 2BG9B 3RPUA 1U8SA 2A1BA 3J7YU 1BC6A 1KDNA 2Y3YA 5A2QY 4GYSA 2HNDB 3RIFA 5IQ6A 1HNIB 3D2WA 1Q1KA 2A18A 2UXCJ 2IJNA 4ITSA 2UZAA 2R4FA 4RNOA 1R3NA 3V5RA 3R2CJ 1W2BR 1QY7A 2VG7B 4RU9A 2AJ1A 3ZT5A 4U7IA 2DNGA 3MM7B 3FRYA 3SV3A 1AA1B 2HEKA 2PBIA 4AE5A 5ETLA 3LBXA 2GZOA 3R6LB 2FY1A 4B9VA 2V26A 3W2WB 4ILMA 3CMES 5FXVA 1F3FA 2HURA 3BO3A 4GKJF 1TAUA 1IR0A 3OTOJ 3GFHA 2ZHBA 3RGIA 1WJ9A 4RNNA 1GH8A 3UQ4A 2ROGA 1Z2ZA 3QSYB 2HFZA 2AW0A 2WU2A 2ASJA 2IVFB 4ES1A 1Q8BA 2BX6A 1S4EA 3PDYA 4LF5T 1VQ9S 2UXXB 3DLKA 3MPYA 4O0IA 2AJ2A 1JNZB 4DV6F 4UV9B 3V81A 4C8KA 5ABEA 4WE1A 3M8QA 1XEZA 2D2SA 1FJGJ 4DUYF 2WP9A 5KT6A 5MLCV 1EP4B 2C5JA 1TUGB 4GC6A 4WYVA 4C7QA 5CA5A 4DR4F 3M3ZB 3EICA 3QSIA 2VK9A 4ZP6A 1CPZA 2C22A 1D0YA 4TU8A 1RYRA 3R2DJ 2PI5A 2FVCA 4QR1A 4ALZA 5J2MB 2M0GB 3NY0A 4Z37A 2AT1B 4LFBJ 4FBUA 2FJVA 2G0UA 1VBKA 3V4MA 2RQKA 2VJUA 5H9EJ 4DUYJ 2BBHA 1TL3A 2WCAA 1YJTA 1XDOA 2WB1D 3HHEA 3KLHA 4WFZA 1FMWA 3P96A 3C4WA 1BMQB 3P7IA 2JZ5A 1HA1A 1NKCA 1CVJA 4NXNT 2AX1A 2P2CB 1YDLA 3AE2A 4EYHB 5CD4A 4DCPB 4F36A 5L3EB 2QG9B 4N47A 4GC7A 3NGDA 1SUMB 1EIYB 1HBOB 2RHSB 4DN0A 3UU8A 1RT6A 2MKCA 1HR0J 1X31C 3VU7H 4Z8XA 4YY3J 2NZ4A 1FA0A 1KSPA 1UK5A 3MPWA 2HLUA 4B3RF 3T5HA 2YPYA 1T05A 2VG6B 4Q7AA 1S76D 2KXHA 4HTIA 4QR0A 3SWHA 3BM7A 4ILBA 5F8LA 3MEDB 1VQ6S 5JDGA 2OH2A 4IUFA 3QJLA 4YJ3E 1LWFB 4TX5A 4USJC 1DTTB 3PV0F 3I56S 1RISA 1WELA 2LQ9A 3AQPA 3MAQA 2WBLA 3SDEB 2Z56B 2E9XC 1RBOB 2ZC3A 5KDMC 3AE9A 2IRYA 2QRRA 5GAHU 3M8PB 1HS7A 2DGOA 3IG1B 2XI3A 3ZCJA 2CYYA 5D4NA 5HXCA 2VONA 5ABFA 4XDCA 1VK8A 1EB0A 3LK2B 1DBDA 2BM1A 5KG3A 2NTXA 4C3LA 4EV6A 1S9GB 3PHEA 3LJCA 4R8UA 3VHLA 1ZAXA 3CJ5A 5FMNA 3JC6C 1CC7A 1ZV4X 2V6YA 1UPPA 2PG8A 4DR2F 3TZYA 5BYSA 1WC5A 3TLTA 1KVIA 2DY9A 2WMNA 2NZCA 3HDSA 5HMXA 2N3LA 1GX5A 1C0TB 3D68A 4IOCQ 4HWCA 5AXMA 4ELUA 4J37A 1GNKA 4B9NA 1NK0A 1VGYA 2CXEA 4ZP7A 1K73T 3IR5B 1RHUB 3RB6A 4OX9F 3ZC0A 2XWXA 4XDDA 2LKZA 4OZ1A 3GV8B 2XQ4A 1PG5B 2R2UA 1NK8A 1M0SA 3KJVB 2NUUG 4CWBA 2QFIA 3RX6A 1TR0A 1RWNB 3DLLQ 2K9AA 1B0VA 4TU7A 2VUGA 1S6UA 5GMEA 4KIAA 1TELA 4IH6A 3VTIA 3Q8SB 3ZFVA 4P74A 3KWMA 2YQ3A 3SCLE 1NH8A 1NDLA 3A1YG 2V7KA 3AVRA 1YKWA 1YG0A 1H7CA 3R1LA 2WVFA 1BR0A 3ONLC 2PIIA 1X0FA 1DY3A 3BBBA 3UQSA 2K3IA 2DPIA 4N77A 4KHPJ 3ZNUA 1I6ZA 2HHUA 3O5TB 3PRBA 5LHHB 2W7AA 4WCEQ 5CGMA 5LMUT 4DR4T 2BG9E 1JB0C 2OMOA 3AA8A 5KFBA 3P6YC 2VV5A 2V0NA 2Y1IA 5C42B 3LGHA 3C51A 3OHAA 1YQHA 3V6JA 3UN2A 3D9BA 1J5EF 3DXBA 2V8GA 2QA7A 1S99A 4LF8F 5JDMA 1N5QA 3TZXA 5B0BA 3DTOA 4LIRA 2OJ3A 4TV8E 4DL2A 3QGIA 2VFSA 2DH7A 2JL9A 5HXSA 3HHLB 4ZS6A 1Q7LB 3EVYA 1K44A 2ZJRQ 3BN7A 5CFBA 3G87A 3KUGA 4DJBA 3H5XA 2W4CA 1XNRT 3GCXP 2DHGA 5JDQA 4N5SA 1T8BA 3RRKA 3TVZA 3W8PA 1M1HA 5C25A 1XR7A 1HF8A 5HCMA 3CF5Q 4CZZB 2VG7A 2EXUA 3IWLA 2B76A 2VBYA 1JLCA 3CJ2A 3EABA 1L3KA 3WIUA 5DQHA 1Y5LB 5DDOC 4OI3A 3KLEA 2XI2A 2P6SA 4XAKA 3HK2A 1UURA 1CJKA 2R9LA 2FJEA 4Q8FA 1KK7A 4ERDA 1QVFR 4EO6A 1N0UA 5KFQA 5FY7A 3NCQA 4QPXA 1D1UA 2V68A 4O44B 3QIDA 3OYXA 1DHMA 1NH7A 4JEHB 3AD7C 2FY8A 3EDRB 3MAHA 5F8IA 4KAIA 3GIMA 2ZM6T 3IP0A 4I2QA 4WK1A 1Q0NA 5E33A 1IBKT 2JFDA 3JSBA 5EX0A 3RR8A 3KVBA 2E66A 3MDFA 2LQ8A 3Q0AA 1YX2A 4DV4T 2PTFA 4BC9A 5GADI 3QRRA 3HF5A 3RB0A 2ZM6J 3DDKA 5A8RB 4TN2A 3AY0A 4ZOSA 2V7JA 2C3MA 2P9GA 3HVAA 3SFEA 4IL9A 2O1PA 5K8OA 4Y2CA 5ETKA 4GKKJ 2L08A 2L9NA 3UR3C 1KQFB 2G0JA 2QX0A 4K2XA 3BGUA 4LF4J 2JNJA 1NZ8A 5AQGB 1IJ6A 3VAKA 3KHHA 2OD4A 1S35A 3CQGB 4KH0B 3K3NA 1GXLA 3X1LB 4WZMA 4ZHQE 4DV1T 1Y64B 2BJ1A 3IRXA 5J2PB 4P1NA 4V1Ak 5AQOB 4Y34A 2R7XA 4H9PC 3RYFE 3GR0A 5AE1A 1MU2A 4BJMA 5K20B 2ZJPQ 3MAAB 3MGJA 3DOKB 1XWLA 2YK0A 1NAQA 3PE0A 3J81Y 2ILZA 4LMJA 2GNKA 5CYQA 1Q5YA 2OUGA 3CJSA 5IC4B 1VC0A 4NLGA 4CRJA 2DYAA 4TKTA 1NBEB 1U8WA 5LT5A 4DV6J 1S6QA 4CLSA 3P4QA 2MEWA 5B0CA 1WR0A 3I82A 3UDLA 2Q9QB 4M94A 2HVDA 4ECXA 1TKDA 1KVJA 4QXHB 3B54A 4ZEYA 3GN5B 4AKHA 3UCZP 2CRBA 4U7YA 1JQGA 3U1MA 3J7Yq 5LJNA 2R6GF 1Q4RA 2OPPB 4OYIA 2QRXA 3FBZA 3W60A 5J2NA 5H6QB 3UU6A 2MJNA 3C4ZA 5AE2A 2VKDA 2FBWA 1SJRA 3SS1A 4YLHA 5LMNJ 3I0QA 4CLZA 5KG6A 2QMWA 1WFDA 4Q0BA 1IKXA 4WWSA 3TEHB 4ZJOA 1BWEA 2JQKA 4NZ0A 4ZPWR 2ASDA 1WKKA 3EJMA 3CJKB 1BQNA 4W98A 1B99A 4LSNB 3JAEA 2Q43A 4U31A 2YVSA 5HJXA 2L48A 4FVMA 2OELA 3FZFB 1RHJB 4JI7T 2EFPA 2KXPB 1US7B 2ZH3A 1YSJA 3BBCA 2J76E 2HPLA 2GS8A 3VVTA 3W5ZA 1NJZA 4BBYA 1ZHCA 2I2YA 2VODA 2OSRA 4DV2J 4PW8A 2PDAA 4L5GA 3W62A 3J81j 1VCSA 1KONA 3C14A 2Z8QA 2QV6A 4X2BA 1E1HB 3RF1A 5L8RC 2E1RA 2MY8A 4A8FA 3DLEA 2W4PA 1CBKA 3W61A 5DG7A 3PY8A 1KLNA 2FQQB 3SMZA 2P9BA 4ZHRB 5J1PA 4QH4A 4DVDA 4K5RA 4I43B 4O3PA 2X9HA 4EGLA 2L9DA 4CLPA 3ISZA 3KV4A 3P8CD 2D9PA 4HLBA 3VF0B 3MJXA 5H6RB 5IC6B 3FBCA 3SRZA 3BSNA 4HFEA 1HW9A 1LFPA 2I6HA 2CPYA 3GJQB 4C6AA 2BG9A 1JX4A 4J5OA 3UDVA 1KTQA 2LA4A 4X66T 1OXZA 3VAMA 1Q82T 4WJBA 2YU2A 2VBZA 1KLMB 3CCMS 1HYSB 5L3FB 3JADA 4YTPA 4JI4T 1WOPA 2NXNA 5HMYA 3D54A 3V6DA 2W66A 4IR1A 2YU1A 1FXRA 2C3UA 4QWNB 1YTYA 1RT7A 4DV3J 4WBNE 3CULA 1RYSA 3W1YC 1YZ6A 3QIPB 2YX4A 1M5KC 4WFXA 4FJOA 4WKRA 1Q79A 5AQTB 4WTOB 3NKYA 5HQ8A 1JWWA 2K1RA 4OQJA 3RZAA 1WKLA 1FEHA 4O2BE 3FJ2A 2DB1A 2VL1A 1JLQA 1RE1B 1XQIA 4B3RJ 3CQCB 3G82B 5AJ3J 1UMJA 3BEGB 1ZZNA 1SQFA 3I32A 3EPIA 2XQAA 4Y2MA 1JLFB 1KQSR 1RBLA 3SSQA 4XPEA 1T7SA 1BXNA 2F9JA 2YNHB 4GVLA 4FBTA 1PAEX 3PUXF 1NM2A 3TAMB 1B7FA 2YY3A 4M5KA 3MM7A 4CH0S 6FDRA 5ADXL 2PEHA 4I67A 2AYMA 2XS7A 2FJAA 4HH0A 4DOZA 1H74A 5JDHA 1EAYC 1G7CB 1UFKA 4Q44A 2CQ4A 2E5LJ 4ZCIA 5A1LA 4NCAA 3MTKA 1HL6A 1QD1A 5CCMA 3R7SB 2M52A 3D0IE 1NENA 3HPOA 3TLVA 3NBPA 4OYXA 4PXEA 3HSDA 1D8ZA 4A56A 4U2ZA 3WHIA 4JI7J 4ZK7M 4FYWB 4Z90A 3T1HF 4P71A 5L1JA 3CJ4A 3FEXB 1H98A 1CS4B 4H9QC 3T9ZA 2VC1A 2WDVA 4DV7F 4YB7A 1M90T 3RRGA 1OQ6A 1O6XA 4J9PA 4RUHA 4IE4A 4C8NA 2RDIA 3T6JA 3M2RB 4WFBQ 4C48A 1F2GA 1P1LA 1W0BA 3GTYX 2ACYA 2H7OA 4C3MA 4K8RA 1Q8LA 2AEJA 3CJRA 2XASB 2KRBA 4WBOA 2MKSA 1VRBA 4R0JA 1D1BA 2Y6XA 2GIFA 2LXUA 1M5VC 3AODA 4N78D 5I3QA 2KM8C 4L9IA 2CWKA 2V5DA 3EGZA 4AISA 3N9PA 2DCUB 1AB8A 3NOGA 1HNXF 2KINB 1T05B 3H25A 4I55E 3O6QA 4NMLA 4ZP8A 3KK2B 4M1KA 1S1WA 2CJQA 3HKEE 4CN6A 3BGOP 3CEDA 5L9XA 2XAGB 4ETZA 3CCLS 2QLBB 3UU3A 1RAEB 1R89A 2H48B 5GAEI 4ED2A 4N56A 1TL3B 1NCLA 4MFBA 5KT3A 2V94A 2LRKA 1RWVB 2B43A 4ZITA 2Z2MA 2H3RA 1YBUA 3AA9A 1Q95G 4G65A 3E08A 3KV5A 2WW4A 2LLYA 4IG0A 4I2PA 2CHOA 3KLFA 4RZRA 4OI4A 1VQMS 1X5TA 4N76A 3QGGA 1ZEEA 2V8HA 3BGLA 3ZZPA 1BUXA 4DSJA 1U1OA 1ZH5A 3OPKA 2VKOA 3GYNA 2WVCA 1YJRA 3CMLA 2P8IA 2XY6A 3WI3A 3D6MB 4NA3A 2VPZB 3UNYA 3EAMA 2AQ4A 4M95A 1FRHA 2VQET 2DRDA 2ES0A 5F8PA 5EGYA 2XSFA 4YMEA 5B0FA 1OYEA 2C1EB 2FGOA 4XO0A 4PJLA 4CN4A 2ZJQQ 2K5BB 1H73A 3DLKB 3RW7A 2DRAA 5K14A 5JVDE 3MHYA 3DOLA 3D4JA 3CC4S 3HD1A 2CQ2A 1VK3A 4OJHA 3KBUA 2DT9A 4FXVA 4KBMB 4ATNA 1SUQA 2E9RX 3MECB 1C0TA 4DR3T 4CQ1A 3LDQB 4B08A 2YKMB 3N9LA 2FDNA 4NMXA 3ZMTB 2V8SV 1NLKL 1EKSA 3MUMP 1KOHA 3LO3A 2QYGA 4DF8A 1XNRF 3Q8RB 3M05A 1R8AA 3R7BB 2X0HA 5J0ZA 2W8LA 3C4XA 4IR9A 2LOSA 4JI0T 2OPSA 4DR1F 2FJAB 2D9OA 4PXBA 4R5PB 4ANEA 3CO0P 3FBBA 3PACA 5F8NA 3E0ZA 3RRWA 2DRBA 1U2CA 4NYOA 4HFBA 3MMJA 2EG1A 4F04B 2NYIA 2YNFA 3IXQA 1E6VB 1VQ8S 1L3UA 2IM3A 2IFXA 3B82A 1SJ1A 3F31A 5HMZA 4ZDNA 1NMEB 4DMWA 4DLGA 4YB1P 4Y3CA 3I0SB 1I94J 2W24A 4QXBB 4EYYR 4LSLA 4NX9A 1HNZF 1IBLT 2VDIA 2J62A 2VKJA 4LF5J 2X7IA 2JJ4D 4CO0A 2A6MA 1JXVA 4AYBD 2BJ3A 4DV4J 4DSKA 3FZKB 2HHTA 4IG0B 4QWAA 4ILCA 2Q9QA 2J9DA 2RB7A 1R0AB 4K4SA 5DLGA 3HP6A 4GIWA 3PRVA 2A2CA 5KT5A 1WHWA 1CJUA 4D3HA 3GFXA 1D09B 3BREA 3PYDA 2OO4A 3CTRA 1QAJA 1GX6A 5L3CB 3AE3A 1NJYA 1P9YA 1WTFA 2W7OA 3JQMA 2JJ9A 2WB5A 1S10A 3BQIA 3OTBA 2OGUA 3A3OB 3HVWA 2GMJA 2ZBQA 4IT4A 3R5BA 4HT7A 4L3KA 4E0DA 5DDPC 4Q45A 2XMVA 2BJEA 5C25B 2V4JA 4UZBA 2BOAA 4DUZF 4UEMA 1JLFA 4JYAJ 4LR8A 3EUNA 4FF2A 2IUBA 3FUYA 3T5JA 4B3SF 3PJAJ 2VWAA 1NO8A 4DIDB 1RAFB 1EZZB 1RDRA 3UQ7A 3TUPA 4CTAB 2JLGA 2L9QA 2GW8A 2HKEA 3RTVA 2HHQA 2FHOB 5BR8J 1NUEA 3CD6S 3PZPA 2E5IA 3K17A 3NRXA 4NWBA 2W9BB 1ZM9A 3C8YA 4G1PA 5KFLA 1LWFA 1VQLS 4AQFC 2ZH1A 1S1UA 2UUBJ 2OPPA 2HAIA 4PJMA 4N8NA 3MEEB 2FLNA 3PVXA 4TU9A 3AAAB 2B5JB 2RHQB 3HHDA 1FERA 3ZSSA 1LWXA 2HHWA 2BW7A 4ID5A 4UV8B 1VQ4S 3ZZUA 3AEFA 3NMRA 2NSCA 2QL9B 2ZOGA 1ZZFA 4RUAA 3WDOA 4NPPA 4QWCA 4OHZA 3CDUA 4CZCA 4NA1A 5AQPB 3RYLA 5KOXA 3C64A 4WIIA 2EFGA 4AQYT 1OEDE 1UVKA 2E29A 4IOAQ 1HPZB 3LPYA 4IGUA 2EFOA 1MWYA 4DUZJ 3NZPA 1WC6A 4PWWA 2R8KA 2KDOA 5K8NA 1YHQS 5LOVE 2KT2A 1UFWA 4ZA1A 3WBZA 3OV7A 3MI7X 1FE4A 3L7PA 3BQ2A 5AQUB 4USMA 3MMCB 1VQSA 1MU2B 2YNGB 3AOBA 5C2CA 3MFIA 1AZSA 3QAEA 4D3GA 2NSBA 3IRXB 4JI5T 2PGCA 2XUEA 3M30B 4O4HE 5HEJA 4PG5A 3IGNA 2R2RA 4P75A 4LF7F 3NMAA 3FMWA 3UW1A 5KFIA 3PFOA 4NCGA 5LSOA 4I56A 2CAJA 4CDIA 2XMAA 3TUZC 4ZVGA 2RILA 4DV7T 3EDVA 1ZOYA 1A0OB 2ZH8A 1HD0A 3GU0A 3GN5A 3X1DA 3ILJA 2CDRB 2IC3A 5JDLA 1RWUA 4AFFA 1WNEA 3CD7A 3BZQA 1ICEB 4IE7A 2P6TA 3TLWA 1DQAA 4J9SA 5THWA 1YJUA 2VPXB 2A72A 4ZKAA 2N4DA 3KINB 2B7CB 3BS9A 4NL5A 2E5LF 4L6V3 1IKXB 2UUAJ 2VVNA 2Z57B 4WF9Q 3F41A 1VBXA 4YHJA 5E0OA 2M88A 5KG1A 3PHTA 4JV5J 1WG5A 2ODUA 1U25A 2MLZA 5B0AA 5KMGP 3I9ZA 2IDLA 2QL5B 1X4BA 2AXDS 1UETA 1S5ZA 3CCUS 4GO5X 4EZ9A 2OPRA 3CE8A 2H3EB 3PEJA 4AQYF 3FXDB 1T7PA 3OR2B 2DHXA 1WI6A 2R3VA 4JV0A 1HBUB 2KWHA 3UD5A 1H7XA 4Y00A 1SV5B 1AUDA 1JNRB 3UNGC 2K2PA 1VRTB 2KG1A 4J91A 2GO8A 1S9EA 4GVBB 2P9CA 2ROPA 3MMBB 3OR2A 3SCJE 4WU3A 4USKA 3VAIA 4LF6J 1RB0A 2EC0A 4A97A 1JJCB 2RF2A 4DCJB 3LPEA 1GMVA 2Z2YB 1QAYA 1K0VA 3GWCA 2K06A 4OIXA 4C8ZA 5HROA 4PKDB 3AE6A 3GIIA 2YDQA 3MEGA 5FYMA 4IO9Q 4HN9A 2CJBA 2VH7A 1UAWA 3M2RA 3PUQA 2D41A 3VR1A 2VBWA 2HQIA 3ETMA 4KYZA 2CHNA 1SUQB 2OV9A 5HAXA 5KFUA 5C2TA 4OZJA 4A8XA 4CIOA 2ZVSA 2ZLYA 3SYZA 5L1LA 4GK0E 4NUUA 2VU5A 2KFNA 3UD3P 1FDAA 5DDRC 4RNHA 2C2ZB 2CPDA 3QZ7A 1EZ3A 4WXOA 4DU7A 1HQUB 2PMZD 3H3AA 3U78A 2DTJA 1MIWA 3P4UB 4C97A 4GK5E 3W66A 5KOWA 5C7PA 2W1BA 1RABB 2C2NA 3CW2C 3VQSA 4KJIA 5KFAA 3A4TA 4JI0F 3T1YJ 5ETOA 1P27B 2FD2A 4NI2A 4X62F 3D67A 3LTOA 2RDDA 2HRTA 3EDQB 1HW8A 1G73A 2XULA 2B8QA 1MN9A 2XSBA 3QOFA 4ANCA 3OSNA 3TZWA 1QUUA 4TWDA 5I3UB 3A8JA 3MM6A 4MAKA 3L9ZA 4OYBA 1U47A 4DI6A 2X1AA 3IBPA 5HANA 2OTLS 5IT0A 3HVTA 1S59A 2ZH9A 2FLPA 2GAHC 1LXJA 3M4XA 1VJQA 4PQUB 2F4FA 1N0VC 5KFJA 4ILRA 2W2NP 4LSNA 3MOJB 1S49A 3AEBA 3GYXB 3ILLA 2U2FA 3RBZA 3HSJA 2MKIA 1PJ6A 2NQPA 1UEKA 3OJSA 2HPUA 3CJKA 3E51A 3UFGA 3N4WA 2UXDJ 4WIQA 3HM9A 1R8IA 4DR3F 3OVUA 4F50A 1YIJS 4HHUA 5CA1E 3N5FA 1TK8A 3RLFF 3T9NA 3R5DA 4PWDB 1VRUA 4OK0A 2ZNYA 4IFYA 3ZZZA 2K7KA 1RBAA 5EWGA 1UFLA 4JUZA 2RUGA 5KG7A 2E7VA 2AGQA 5LJ5Y 1MMDA 1P1TA 1QSYA 3DLBA 5KFRA 1PJ5A 3TQ1A 2RA1A 1ZTWA 3POTB 4XK8C 1YRXA 4I7FA 3OFHA 2RSQA 5DO2A 2KH9A 2FHMA 2C2RA 3BB5A 3UFEA 4EAHA 1H38A 3PW0A 5AQSB 1NB7A 1IBKF 3IHRA 5JR9A 1SC6A 3D3BJ 1FWLA 5HL7Q 5KT4A 3V81B 3FDSA 3LW5C 2IVMA 2GVZB 1U4QA 2VJVA 4BS2A 2F1FA 1CJKB 1B0TA 5CB4E 3ZJ1A 1TL1A 4O4RA 1MIYA 3AQOA 4X65T 4EBDA 4DV3F 3M2VB 3SQGA 1YKHB 2BM0A 2HHVA 4XZCA 2FJWA 3MM9B 2VPYB 3RIAA 4QIEA 4EEDA 2R8JA 2AD9A 3PX0A 2BRLA 4EGWA 2LM2A 4KB7A 2GHPA 2LT3A 3QK6A 2HS4A 4ED4A 4Z7CA 4UF0A 2HQGA 3I96A 2DKOB 3BH6B 1LWCB 1VCTA 3FVYA 4P2XA 3U1NA 2NLWA 2M7SA 5J2MA 2KO1A 4K4YA 5HN0A 2D5UA 2C28A 2UUCJ 2YNGA 4DV5F 2HWHA 3C16B 1SHZC 2EKYA 2OA5A 3EHZA 5L9NA 3EVWA 4ANJA 1LEOA 2OEMA 1UWBA 2KG0A 2HFNA 4P52A 4NXNJ 3HKDE 3AXKA 3SBMA 1AJ3A 3CIMA 2H65B 2F7VA 4K50A 2OSQA 1IQTA 3LG7A 4TQSA 3DYAB 3GV7B 3P4WA 2YWGA 2JLEA 4HI1A 4QWEA 4Y65A 1U0HB 3C3LA 3RIUC 3JAFA 2HSEB 4CLWA 2UXCT 2X67A 2KKHA 5C8YE 3RQUA 2LECA 5CJ5A 2HFOA 1FFSB 4ZVPB 4WZXA 2XJ7A 3VAFA 1WLXA 2POKA 4ZI2C 4YUDA 1XMQJ 5AT1B 3D3CJ 4K59A 3IF8B 4AQFA 1WOOA 2DGWA 4PFOA 1IN0A 4NYZA 5AQHB 1Z0PA 3GV5B 1YJVA 1T0TV 4OHFA 4ECZA 2VG6A 1EHWA 2BUNA 1GK8A 3OTCA 3J7ZT 2YKMA 3ESLA 2O01C 4DPYA 1B70B 2BEFA 2PFDA 2XY5A 3HHLA 3IA3A 1YGYA 5FXXA 3QJPA 1IUJA 2BOPA 1LFWA 4RBUA 2QLWA 2IA6A 1JLAA 3R5AA 4IHJE 1IBLF 2IDEA 4KGXB 4UQGA 3EGVA 4KC5A 3ELHA 5LA6E 3C14B 2J0SD 2CPEA 1Z2LA 4AXPA 2HFSA 4AXIA 4NXMF 4NZ7A 3PV8A 4TQRA 4LF2A 1HIYA 2OHDA 3WZ0A 2HAFA 1VC5A 2CNLB 4MYTA 2N4CA 1E7PA 2YKNA 3PEHA 3C46A 3DHXA 5HJYA 4QWDA 3RC8A 3TYTA 2QGFB 3VAGA 4ZVRB 5J2QB 5KG4A 3NAIA 3DLGA 2FIUA 3PDNA 4JUYA 5JR9C 2YBVA 4F4WA 3NNHA 1S1TA 3C15B 2UVRA 2XQ9A 1TMJA 1WC4A 5F3TA 5F41A 3RRCA 3AXJB 4MFBB 3TW0A 4U33A 2CQBA 3TANA 2G0CA 2UP1A 4P2SA 1FCAA 4IDNA 2W00A 4B3TT 1XMOJ 4C0BA 5HI7A 2IC3B 2NWBA 1XJWB 3O2IA 2BBEA 4QU7A 1X4AA 2IMWP 2A6OA 2LSGA 1MNDA 1G6BA 5D8HB 2PFFB 1KNRA 2ZZNA 1UJ4A 3K3QC 1Y3KA 3SFDA 4JYAT 1WR6A 4OZ3A 4ZS3A 2DIUA 1R8BA 3C66A 7FDRA 2RRNA 1Y3JA 4F2SA 2B1EA 3EUHA 4YSXA 4X1KE 4DQPA 1L3TA 3JYTB 4TZ4C 3VRAA 4ASKA 2PD1A 2NS1B 2LU2A 3V6DB 1RLCL 4FS1A 2F8HA 4PFPA 2ASYA 1S0MA 1X5PA 3OLBA 3CWZB 4QIGA 2DGTA 1VI7A 4K2JA 5A6WA 1JLGB 4MIBA 2XM3A 3N2OA 3D1QA 2O67A 3Q8UA 2AJ4A 3I9V9 3VR9A 2BS3A 4ECWA 5L47A 3KUHA 1PO6A 1RUSA 2HH7A 3Q5DA 2BQ3A 4YJ2E 3UUNA 2IA0A 2YQ1A 1IQZA 4M5IA 4KFBA 4ED8A 3DRYA 4IDPA 3UD4P 1YK9A 5F9LA 2MGZA 2XS5A 2NYHA 5CQGA 2CBIA 5HATA 5HWXA 1X5OA 4JLEA 1SC4B 4IH5A 3CMAS 1S1TB 5KFGA 3GPAA 5J2QA 4LUBA 3FMBA 3PM9A 2KSRA 4KUMB 3F56A 3BSAA 2QLFB 1HLWA 3NOCA 2CQ0A 3N2GE 3EZUA 5T7LB 4MJKA 5LOQA 1YQ3A 4EI2A 2HGMA 2YWHA 1OEDB 4WYLA 4NOHA 4BCAA 4H63H 4DG1A 3J7AN 2R7VA 4BJNA 3K2YA 3DFEA 3M2UB 1N48A 2G2ZA 2YEVC 1M5OC 2XAQB 3OJAA 4DL5A 1HI1A 1X4DA 2ZH2A 2E9TA 4DUYT 4K4TA 2M67A 4K0KJ 1YI2S 5LNKA 4J9VA 3J80Y 2UXCF 2HNZA 1F9EB 4DSEA 1RGVA 4IREA 3CCQS 4JI6F 1U6BA 5KFMA 4DSLA 3MM6B 4CLLA 2OEJA 3UUXB 2KTQA 2WOMB 4LVOP 5D0RA 2R8GA 2V1DB 2PFVA 1CJUB 1U1RA 1HARA 1SKRA 3LK42 5AQRB 2LU1A 2V2KA 3H3MA 1VQKS 1XMBA 4F4ZA 3SI8A 3PTRB 2IHR1 4YY3T 4G1QB 2CA5A 5B0EA 3DU5A 4OZNA 4KR0B 3HKWA 2CXLA 2K1RB 1FNMA 4PEOA 4NA2A 5D15A 1CQMA 4ZPDA 3A8YC 5AQIB 1T11A 4F25A 2KFZA 3MWBA 3NLCA 2K7JA 3FSYA 1D9FA 3CDAA 3TLUA 4IL4A 5GAGU 1OY6A 4IDKB 1KD1T 1HQ2A 4O4JE 2VPWB 2LDYA 1LVKA 3R6GB 3ULHA 4R0EA 1N36J 1S77D 1Q7YT 2QA4S 2VHGA 2KNDA 4M8LA 2XLJA 4CN1A 2FJBB 1IM4A 1NNDA 1TMMA 4JI6J 2IC9A 4JP8A 1S0NA 2RF2B 2F63A 1U24A 4Y2IA 2JQ9A 5G0RB 4A46A 1IKWB 1VQ5S 1W26A 3FZHB 3D6TB 3VZIA 1FJ7A 2MZTA 3TA1A 3PX6A 3F0NA 4RU2A 4C8YA 1MNEA 1NSQA 4LRDA 5KFTA 1EX8A 5L2LA 2XQ8A 3TJAA 3UUBA 3S8SA 1RWOB 3ENWA 3GFYA 4ECTA 2JEFA 1D9AA 2MQ8A 1SKWA 2DR8A 2WAQD 5H9FJ 2OIHA 3QMQA 3RB4A 3QWUA 4U8YA 2E5VA 2HVEA 3MFHA 3JSRA 1AFIA 3HZEA 3CIRA 4AIUA 3ENVA 2FVRA 3M2VA 3AECA 3MMCA 2X9YA 1ACMB 4BAYB 2R2SA 4KGZB 4TWHA 3T1HT 4WK3A 3SEOA 3UPFA 4USIA 5ETSA 1CG2A 4ZLNA 2AJFE 3W9HA 2G13A 2M70A 3JQJA 1LRZA 3OR1B 4WFAQ 3IMQJ 1X4FA 5J1GA 4IDZA 1DJ0A 4G2AA 1S97A 2V6XA 1VR6A 2COLA 4OZLA 1Z1ZA 3QT8A 3DMJB 1HPZA 2DL1A 4F0HA 3KJNB 1VLYA 5CYJA 2G1DA 5H9FK 5KFHA 2C0SA 3GYGA 4H9RC 1JK9B 2YINA 3P49B 5CZXA 1NXIA 4ECSA 5GMDA 5U47A 5FD1A 4H9NC 3N79A 5DZ6A 4WU2A 3PRDA 5F8GA 3DMJA 5T14A 4K4WA 1UA0A 3AFGA 1RTJA 3M8RA 3P3DA 4J9NA 3IS9A 4JI2F 1OYDA 1LW0A 1VIXA 1UWAA 2HBZB 2DWGA 3IA0A 4L74A 4LSLB 1Y4ZB 3WX8A 1QAIA 1OSDA 2BE2A 1WSRA 4CI2B 4XBFB 3MPUB 4DFKA 4DPUA 1OSCA 1UTAA 3UULA 4URGA 3OVAA 4PQAA 3OYZA 4ZPTR 3BPDA 3M30A 4UXNB 4NI2B 3JSYA 2H54B 3VVUA 2CLYC 2ZH7A 2XYGB 4TUYE 2XNRA 3I31A 5CA0E 2V9KA 1TL4A 2Q3PA 1TUVA 4IE5A 3QYYA 5LGNB 1GMUA 3DRSB 5KTQA 5KFFA 1UJ5A 4UVCB 3ZZTA 5FXZA 2XMWA 3OUYB 4G3IA 1U6FA 4M1PA 3AE4A 4DQIA 4IFVA 1Q86T 3CCZA 4ZIWA 1RT5B 1IKWA 2WVDA 4PG7A 3RJMB 2M6BA 4DR5J 4HWIB 1VLOA 1NPKA 4B9UA 2Z30B 3FXEB 4Q25A 3LP0B 2DHAA 2H5JB 4AXJA 2VC0A 1R8HA 2EK1A 5E3RA 3ANWB 4YDXA 4LR7A 4DR5T 2M6IA 3DI6B 3MXHP 2B9XA 3IEEA 1RP5A 3IG1A 3LAMA 2SPCA 3O1JA 1VRUB 3EE3A 4B9TA 4LFCJ 3CIZA 3U1LA 2VOPA 4LF4F 2VASA 4DWIA 1SL2A 3MD1A 2OPRB 1T02A 2N1GA 2B6AA 1FF2A 1LWEB 3GONA 2LHRA 4GVBA 3PFEA 3EZOA 1N5TA 3VGVA 4A8YA 3CPWR 3AT1B 1SV5A 1L3VA 5FDLB 4K7QA 3W65A 3O9XA 2WVBA 3B57A 3BR9A 4F0MA 4ZN3A 1IWAA 5TAOA 4JV5T 4X1IE 3PUGA 1VS3A 2HLTA 3S4UA 4C98A 3MCMA 5C24B 3SFGA 2CNKB 3MPVA 3KVAA 2W67A 1LW2B 2YKAA 4QJVA 2ZDPA 5KFSA 3QUJA 5DG9A 4DDFA 4C0OC 4USTA 5F8MA 2KWIB 1GEHA 1WTBA 3R5CA 3GA8A 2VVSA 1SH0A 5KFXA 2CM0A 2DIVA 3AE5A 4U7UK 2DR5A 1HQEB 2J0QD 3CB4A 4CNZA 1GQEA 1LW2A 3ET6A 1QSSA 2XTLA 5FVLA 3PKMA 4CO2A 1C2PA 5AQVB 2E5GA 4GOUA 4DG1B 2A3DA 1FDDA 4U7CA 2OMLA 1X60A 2NOXA 4XTTA 1YJ7A 1J5ET 3BKUA 2D74B 4MIWA 3ADAC 1AYEA 1X9WA 4RW9B 3UTKA 3GIJA 1WKJA 4TNOA 5LXRA 2DPJA 3V6HA 4ZLLA 3KTQA 3OQ2A 1XMQT 5HEHA 2H5EA 3ISNC 3SZ2A 8ATCB 4DS4A 4WYWA 4DR1T 3QFHA 2BS2A 4C4WA 2A2DA 3NZQA 1U09A 2BV3A 3TLSA 5C42A 3D0HE 2U1AA 2VFRA 2MSTA 3LGMA 3NGSA 2GQQA 5L46A 4DX7A 5D4PA 2YH1A 3UO0A 3ANWA 3IBWA 1FRMA 2XTJP 1X9SA 4CCHA 4LFCT 1S6QB 4ZI3C 1N8RT 4DR1J 2EPIA 4EOZB 4P09A 4LF1A 3EGNA 4CLUA 4C91A 2VBXA 1F3VA 1BR2A 5AQKB 3FZMB 2BVLA 2BS4A 3DYAA 4JOUA 1B0PA 1DLOB 1RSCA 1RHRB 2AYEA 1RT5A 5ETQA 4X66J 4Q8EA 3RHWA 2HN1A 4EXTA 1S6PB 4F4KA 2NPIA 5J1NA 4P7TA 2XPKA 5LXYA 3M1VA 2W4DA 3RQWA 1VHFA 2VQEJ 2VQEF 2NXJA 2HVIA 2DNKA 3I87A 4Q0BB 3QFWA 3B5MA 4RW8A 1OEDA 1K47A 1U1QA 4WBFA 2IMOA 1VFJA 1ZOTA 2CJYB 4A8QA 2G4BA 1YQ4A 5E5NA 4JI4F 3RYIE 4YQWA 2MPKA 2DCFA 2RKIA 1CJVA 2CBJA 4ER8A 2HNYA 2OAUA 4DHVA 2IJFA 1WG4A 5GONE 2Y9HA 5A0YB 3KK1B 5A8KA 2CPFA 1S6OA 1U4BA 1N36F 2PN6A 3JS9A 2UUWA 1IKVA 1PAUB 1DAXA 1TZ0A 4ZVTB 1FWPA 2FJDA 1F9FA 2UUCT 4YFSA 1HX1B 3U27A 2XY7A 3AA1B 3BF4A 2UXBT 2J4GA 4XIUA 4YB6A 1SPBP 3FCWA 1OWAA 2QTWA 1T9UA 1PGZA 4AKGA 2ABYA 1XERA 2KXFA 5LG3A 2ADCA 4PYDA 1FX2A 3C50A 4EUVA 4YDDB 1XNQJ 2YTCA 4DV2T 4RW7A 1WHYA 3KG1A 4X64J 2V69A 2IPOB 8AT1B 3BYPA 4A8MP 3OTDA 1T9YA 4RW6A 1QDUB 2G2OA 5IZHA 3GR1A 4ZCKA 5DQVA 4HWFA 1FRXA 3FBFA 3GG0A 2ZHOA 2RS8A 1UVIA 2A3JA 1N32J 5HWYA 1N54B 4KP3C 3Q5WA 3N01A 2CWXA 3I6PA 1SL0A 3CNQP 3OW2R 5JQGE 5G0RA 3OPCA 4U8VA 2VFTA 1U1KA 5CHCB 4IIJE 4PK5A 3HR0A 4USUA 3G4SS 2E5LT 1VBYA 3OFGA 3E8OA 2H51B 1U1PA 1KF6A 2IIHA 3KBTA 1SI9A 3FC9A 5IV3A 5LJMA 2M2BA 1BQNB 2KZZA 3B13A 1OY9A 2MZSA 2JX2A 4R25A 4MH8A 4BLGA 2DY1A 3RKGA 5GVQA 4X4SA 2VQFF 4NYPA 3KLFB 2J8AA 2XQ6A 1WF2A 3P45B 2PMWA 3AJ1A 5LGUB 3I5AA 2WDQA 4B9MA 2CA9A 4ID5B 5K5MA 2H9ZA 5C5JA 5HVFA 2J47A 3MR3A 2YKNB 3KK3A 4OI1A 4A98A 2LOPA 1T94A 5E3CA 3FB2A 4DL0C 1K9MT 1MG7A 2JVOA 1NSAA 4DLEA 4OX9T 1S1UB 3MMAB 2I5JA 4IE0A 2R7SA 2DNXA 2BVMA 3RC3A 1OQ3A 3G2XA 3CX6B 1JLBB 1YD8G 3QPIA 2CWYA 3EVMA 3KHRA 2CVEA 4I50E 3AA7B 3TR5A 4TV9E 1RWKB 4CH7A 1FTRA 2OLTA 2XGQA 3H37A 4PWUA 3IWXA 5EDWA 2HVHA 3D0TA 1H3DA 2XZWA 2YWFA 1FRKA 1UW4A 1N88A 2GVDA 3EDUA 3IM9A 4AQGA 4C0HA 1WC3A 2YKOA 1EQ0A 2XZEA 2CXDA 4RW4A 1OS5A 3TX0A 4RWWA 4ZMMA 2HRUA 2GQCA 2HZVA 1X5SA 4UY85 4FF4A 3A7MA 2ZITA 2BYCA 4JV5F 1WSVA 1FDBA 3TUJC 3J7YI 3PYGA 3PJAA 2B4PA 5HXRA 3PYEA 1DRZA 4H63V 2K48A 1HNXT 4QIVA 2XLIA 2ZM2A 4ZPBA 1HG2A 2L9WA 3ZYMA 2DNOA 2UUTA 3O1IA 1D1AA 1T3OA 3IR7B 4JI0J 1IXKA 1HBNB 1G1XA 4MHCA 2E9XD 1UVMA 3CCVS 2BJ9A 4HWHA 2BJ7A 1NWMX 3OTOF 1T95A 1KHWA 1BWVA 2HIQA 1IBKJ 3PR4A 3LP1B 3QGPA 4A47A 3KJFB 1YBAA 2LA6A 4CLKA 2LE8A 1H2TZ 2X3DA 2VA3A 5HP1A 3B4DA 2HGNA 1PC5A 4W4MA 3Q5EA 2WBMA 4ED1A 5JTGA 3SSSA 4PXCA 2EBGA 3OJUA 2D3ZA 4NXMT 2YKQA 2HNDA 1S0VA 2ZE2A 4TYAA 2XCAA 1WYBA 3JTNA 3FZ2A 5JREA 1PYTA 4CM0A 2W2OP 1HWUA 2D3UA 1BQMA 1HWLA 2ZM0A 2V50A 1UZDA 3VAJA 4ZVUB 4PQUA 2LVWA 2XG8A 1YVFA 2JC1A 4BWMA 4MFRA 1DTQB 5ETRA 4LRBA 3FNNA 2MLYA 1S1VB 4DV1J 1M62A 4U74A 3DRSA 2KZMA 3PU3A 4DF4A 4E2FB 2BZBA 2FC8A 4OLPA 6AT1B 3CT9A 1PC4A 3UDEA 5DGBA 1HBMA 1GTEA 1WCRA 3VGTA 3G71S 4FPRA 1WRDA 3J7A1 4OI0A 3GILA 3QNWB 1M5HA 5JR9B 3D6HB 4ECUA 3AJDA 4DV1F 1UL3A 3RAMA 1TK5A 2GVZA 3CVKA 3T19A 3AB2B 4OYOA 3QRQA 3UVJA 2NXUA 2MLXA 2OLWA 3RAXA 3EMTA 2K3KA 1GMWA 1NZAA 4X4PA 3BV8A 5GMKa 4OL8A 4DX8H 2DO4A 5LMUJ 3F57A 2IMLA 3R5JB 3KK3B 1RK8A 1SC3B 4KMCA 3UR0A 3QBCA 4HT5A 1NK7A 2JMKA 3LANA 2M9KA 1R7IA 2R7UA 4XAXB 2ZOFA 1R31A 3KJVA 2WW8A 3C2PA 2RMLA 2WONA 4L76A 4DL6A 3UU5A 5DM6Q 2WWUA 4K0KT 3VKHA 2ZD1B 5HYAA 3H42A 4JI1F 2XSAA 5KFPA 3FZBA 3AE1A 2CQCA 5T41A 1NPPA 5CD4H 4OZ2A 4FF1A 4LBHA 5HVGA 4DV5J 3ZMZB 3ET6B 2YDRA 5B7WA 5B0GA 3AA0B 3HFKA 2BR0A 3KLIB 3VKGA 3ILIA 2X51A 4DN9A 1RWMB 2ACZA 3Q22A 4O4GB 1LV5A 3FBEA 4MKVA 1YITS 1FVSA 4U2YA 1REVB 5AQQB 4O4LE 5JRCB 4DQQA 4ICLB 2CDQA 3PUAA 3PUZF 1DU2A 1F6TA 4DPTA 1F1BB 5LGTB 2XQYA 3AAWB 4EK2A 4E7ZA 4UUXA 3CK6A 1KNZA 1VJWA 1QVGR 3TP2A 1RKJA 4KHRA 2BQUA 4DPWA 3W2VA 4P2FA 2DNPA 2PMHA 4JBWF 3TVYA 1CULB 4H54A 4YHHT 2BABA 3EVOA 4CM2A 2ROEA 5KFOA 2DXEA 3OXGA 3G8TA 1A7GE 2X1BA 3QT5A 1UCUA 1F5AA 4JI2J 1O3XA 2IAJA 3ZXWA 4HTJA 3Q2TC 4DR4J 1HG5A 4O0NA 1WWHA 3OHBA 1TV6A 4WTYA 2J8SA 3QRPA 4JI1J 4X65J 2W25A 5BR8T 1FKAF 3GWHA 4O44A 3DXSX 3D1OA 5FY1A 4LQ3A 2XM1A 2K24A 1HWIA 2JQHA 2CJAA 3BJYA 4HDGA 3UE2A 4CYUB 1M5PC 2WSSV 4LF9T 2OFHX 2W2MP 4UTGA 2HQDA 4QIWD 3C6TB 1UCNA 2LM9A 4DO0A 2YPZA 3P5TL 1FI4A 2E44A 2YQ0A 2GO9A 3ITHA 1Y01A 1D0EA 5AQFB 2RUSA 4HFVA 1QE1A 3KMQA 3W7BA 2QL7B 2LEPA 4WNKA 2UXDF 2H89A 4TN7B 1S1XB 4L73A 1SE7A 1W7WA 3THTA 2W4XA 2XHWA 3HFVA 3LF0A 3K3OA 1H72C 5IWAT 1EARA 3T6BA 2NP9A 4RLEA 3MECA 3T1AA 3KHGA 2RT3A 3P4PA 2HBRB 4TY9A 3T5KA 1U1NA 2UXNB 2FUG9 4OJ3A 3BQKA 2OPQA 5HXEA 4P6QA 3MMAA 2V34A 4DCOB 2I0MA 1LWEA 2J7WA 2IYIA 5HBMA 3JTOA 1UGOA 2QIFA 1S72S 2CJKA 3IWNC 1IBMT 3AOAA 2DJWA 3C98B 4GKKT 4C8OA 4WZQA 4IQMA 3D5MA 4LFCF 4B3OB 1ZKEA 4JV1A 3BQLA 2N82B 4LF9J 2NREA 1ITPA 2R7RA 2AEMA 1QSDA 3I9YA 2X9WA 4QX8B 2EEYA 2JIWA 4X64F 2WVEA 5D0EA 4FYYB 3HSGA 3PUSA 3PJXA 4B02A 2XYPB 4FKXA 3N5BA 4DV5T 3UT5E 2Q9QD 1W2IA 4ZIVA 3N9UC 1RTHA 3CVRA 4HKQA 2IM1A 4B3OA 5HSPA 3NCPA 4YN3B 1K0TA 2UXBF 4UOFA 2AJQA 4B3MJ 2E1PA 3OBIA 1DURA 1BHNA 2HQFA 3I1AA 4CO3A 4LF4T 3TOQA 2W9CB 4KX6A 3MZKB 3K5OA 5E3QA 3K5NA 3PNIA 1JNRA 1N6QB 2IM2A 1JLGA 1NHVA 2LFVA 3O1HA 3QZ8A 1OPIA 2D1CA 4YOEA 2J6TA 1PBUA 4DFPA 5DS7A 4OJGA 2IW5B 2HHPA 2E2AA 5IFMA 4LT6A 3ZYKA 1D3WA 3A3PB 1QE1B 5H1SV 3DOMA 2QYWA 2GJ2A 2HN2A 4K4UA 2V6YB 4GYRA 4B3SJ 4L3NA 1C1BB 3HHNB 3F73A 5A8WA 3ETUA 4CP5A 3BSOA 4M5HA 1XR6A 1CJTB 2HQCA 4B3TJ 4O3QA 2GX8A 1B64A 4M63A 4CYUA 3H5UA 2W61A 3OSPA 2IBOA 4NLVA 5FDLA 5GADU 3TNVA 5F0WA 4X1YE 4UOHA 2Q1LA 2CNNB 3R6NA 2FJDB 2R7QA 2APOA 4UW2A 1KC8T 2ZVIA 5D0HA 2VL8A 2GHVC 1ZP0A 4BA9A 3NEKA 3PUYF 1IJ5A 3PG9A 3RKOA 1PJ7A 2D3OR 5LMNT 2O66A 1UA1A 2KFYA 1S4FA 3A8IA 1V9OA 3NBXX 5M2UA 3W64A 1VIOA 2WZHA 4UY8T 1IR1A 1FJEB 3D66A 3OKQA 3PW7A 1ZETA 3VGUA 5EN1A 1M7KA 2IAKA 2MAWA 5JJBA 1HNZT 2RS2A 2JLFA 3Q8QB 4RW9A 5ETPA 1C4AA 4G1QA 4LF6T 2GA7A 5EZYE 2XHCA 1RT3B 1XWMA 4LIWA 3WAKA 3DLEB 3X3UA 1XZYA 2HS0A 2GMHA 5KFZA 5K8PA 1UPMB 1UKUA 1TFYA 4ZVSB 3M32A 3E01A 2HNZB 3NS5A 3PW2A 2XLKA 2Z6EA 5IV4A 3QGHA 1UX5A 1YRTA 4C8MA 1PBAA 3US5A 5D78A 1RTJB 3QIPA 2GMLA 3MM9A 4NLOA 4F7VA 3L3CA 1WHVA 5I42B 5AE3A 4G63A 2VFUA 3ONQA 2LP4A 4V19J 4GKKF 1FRIA 4ZPVR 5CXTA 2VKZG 3FZLB 1EETA 4UT4A 2XB2D 2FB0A 4LF8T 2AHOB 4DBRA 4LMLA 3SIPB 4HE8A 2JSXA 3EPGA 2HYIB 4KHPF 3BH7B 4ZLPA 4M5GA 2L3MA 3IBCB 5F8JA 4LF5F 3AOCA 3CKDA 4B3MF 2PJQA 3K59A 3FFIA 5AFUL 5BJRA 4HVZA 2EFQA 2DHSA 4KH1B 2ZEJA 1YJ9S 4BDPA 2LQBA 3OTOT 4UVAB 3GP9A 2W8KA 3RW6A 4U3CA 1SH2A 1XNQT 4LFAT 3LGNA 1D0XA 2DCLA 3NNCA 3I0OA 1E2AA 4F0KA 4QHOA 1KQKA 1HNWT 4KKOA 2OPSB 2WQYA 3R7NB 4WE1B 2NW9A 1DARA 3C19A 3OVSA 3EXYA 2EG2A 1RTIA 1LOUA 4YP3A 2GFFA 2IY5B 1X0PA 2BZ2A 3K5LA 4PZVA 4NASA 1HHTP 4MK7A 4DFJA 2H88A 4AI6A 4DV0J 4I4BA 2AV5A 5FL0A 4KI0F 1HNWJ 3G8SA 9RUBA 5JDNA 4ISTA 4X4OA 1LK7A 1JLCB 3LP2A 1LXNA 2DNHA 4AKIA 1SB6A 3PJ9A 1RAJA 2HQ3A 1R0CB 3IBFB 4NLQA 3NWRA 4UOCA 1MWZA 2FLLA 2CIMA 2F65A 3ONJA 5HLFB 3CCTA 3GIKA 3MM5A 4F6RC 3CGIA 3NGKA 1FK9A 1LKXA 2Z58B 4NEYA 4M5DA 4OI2A 2OI2A 1HNXJ 1VYAA 4DV3T 1FRLA 2B4OA 3K8PC 3LP2B 4TVAB 4FYDA 2CADA 1R27B 4IOBA 1KP6A 1V3RA 4DMVA 2UVWA 2BDEA 5DG8A 1O51A 3H2LA 2J7UA 2BVZA 2KN4A 4PJNA 4KT0C 5HEGA 4ZI7E 4JI3F 2FC9A 2HPJA 1MIVA 4FN5A 3H2VE 1BE4A 3R1HA 3D6FB 1HHSA 2G9OA 2FVPA 4ZI2D 1Y9OA 3CX7B 2PA3A 2WONB 3ZO7A 5FVKA 1NB2A 2QLJB 4ED7A 5AQJB 1Z4UA 4DSIA 4U95A 3G8QA 3AD9C 5EX3A 2FHJD 1RKIA 4FXDA 4X4VA 3MR5A 3FFIB 3PO5A 1ZM3A 3CUNA 1DZ5A 4YY3F 3A8KA 1TUWA 3DRPA 2D3O1 2BANB 4U6PA 3HA4A 4PK4A 3PW5A 5ETVA 2C2KB 2W9BA 3DM2B 3BKFA 1QLNA 4ANDA 1DTQA 1YXRA 3I5CA 2DI4A 1RHQB 1C1CA 4ES3A 4DV0T 2YN6A 1S94A 1QUPA 4HKAA 2L41A 3AD8C 1XDPA 2UV8A 2EK6A 2QA4G 3F2EA 4CI3B 2JEJA 5L1KA 2CG8A 3IAS9 4EZ6A 1EETB 4CT9A 2I38A 2CPZA 2BANA 4MALA 4ZS2A 2EKNA 2W9CA 2FLOA 3BPSP 4LFBF 4MKBA 4QX7B 4GMKA 2LSJA 2CQPA 1GMWD 2DGUA 1VRQC 3P50A 1VQOS 1ZPWX 3RRHA 2XQ3A 3AEAA 2JPFA 3NNAA 4TY8A 5IT9U 4KSEB 2PSZA 3D0GE 3PX4A 4U67Q 2J9EA 4UZCA 1BR4A 4ZPAA 2CPTA 1TVRB 2RJZA 3T5LA 3W63A 1Y0HA 2FJEB 5ETMA 3AAEB 1GAOA 4DS5A 3DDIA 4FPIA 1EQMA 1XMOT 2D0TA 2VG5B 3Q24A 5F3ZA 4XPCA 2UUBF 5L4HA 4KFBB 1N33T 4RW4B 2B0GA 2UVUA 1RCXB 2MB0B 5M4YA 1LK5A 5EK3A 3H4BA 3M8QB 3A12A 5F0UA 4L0RA 3VGSA 2ZM8A 2GGPA 4Q2LA 4DUTA 1MMNA 2DXFA 5BR8F 3HVRA 2MSSA 5AXLA 2WWVA 5D6GA 2MQPA 3N9QA 5HEUA 4FXWA 4CLYA 4I69A 2HIYA 2VKRA 1MMGA 3PJWA 1WHXA 2ATCB 3BSCA 1IBLJ 3MM5B 4QW9A 1RADB 2ZFHA 4DR5F 4Q43A 3NGUA 4DR7T 2ZC4A 3TJ8A 1X7VA 1L0VA 2DNNA 1C0UB 4Y0FA 1R0BG 1BR1A 2F4VF 3KLIA 1GXUA 2E5HA 3HMJG 3L4BC 3B6BA 4JEUB 3UWTA 3RG6A 2YWEA 3N6LA 4IRCA 5HK4A 2H1YA 4HH1A 2CNOB 2XEXA 4RBTA 5CZVA 3AB3B 3MR2A 3DJBA 4N7TA 4JBCA 1PSDA 2LJLA 5IS2A 4RKUC 3OXFA 4C3KA 1JJ4A 1TTHB 2DBBA 1Z8UA 2VDHA 3PCOB 3FCVA 4B3TF 1N33J 3D1HA 1U6ZA 5HP1B 3Q2MA 2AKWB 2W62A 2KZ7B 3M7VA 2FHJA 3KG0A 4V19X 1Q16B 2Q6BA 1RT4B 1ZA1B 2W2QP 2WCXA 3SCKE 1T72A 4YR2A 1O5JA 3T1HJ 3QB5A 3HO1A 1U1MA 1YZ7A 1SL1A 2ZH4A 3DN9A 3DGVA 1HKAA 3CC2S 3G82A 1WDDA 4OYAA 2C3PA 4EB6E 4CTAA 3AEGA 4KPCA 4WP9A 4EZ4A 5IM0A 1F9HA 3SXLA 2X1FA 1T3NA 1C1BA 2KT5A 2DK2A 5DJQC 3TRGA 4KHMA 1Q8IA 1HFEL 2C3YA 3V5UA 3FEZA 3HT0A 4JI5F 1UJ6A 4RNMA 5KXJA 2Z2LA 3SQGB 2X66A 2LXIA 2F4VJ 3PR5B 5AJ3F 2N9DA 4HDHA 3TVKA 4QU6A 1QTMA 4MYUA 4EYUA 4H4OB 4LF6F 4P10A 3D7SB 3HHLD 2DNMA 2NW8A 3CCJS 3AH6A 1RAGB 5HQLA 2XMTA 2L3LA 1T98A 1FFWB 2RVJA 3WC0A 1QSLA 2LXFA 1ZA2B 4IDQA 3QO9B 1FE0A 4O2AE 3BR8A 2ZBCA 1N34F 4HI2A 5DGAA 5K9FA 2Z4PA 1Q81T 4OHYA 4L72B 4DFMA 1FESA 1RAIB 4JI5J 2J1DG 3G6ES 2WAUA 4DV6T 2G0IA 2BE2B 3CO9A 1HNIA 3RUBL 4TNWA 1PYSB 4MIAA 1FIOA 1YBTA 1YLXA 2C2DA 1X4CA 3I0SA 5EHHA 3QJJA 4H4KC 2DR7A 1FEEA 4KO0B 1XMOF 4X4RA 3S1TA 4DSFA 3CCES 3I5BA 4NLDA 3CDWA 1KN6A 3N6MA 3IGVA 1I94T 2VA2A 1ZYQA 5IYZE 2R8IA 2HMIA 4DR6J 2M4MA 3PO4A 2D0UA 4YXDA 3MZIA 3ZTOA 2KRRA 3GQCA 3KUEA 2NPFA 1H6KX 4ZOLE 3MM8B 3RBXA 3OL7A 4Y28C 3UCUP 1OJ4A 3QT6A 4OYKA 3IAM9 4ZLJA 1S1WB 2I9SA 4ADZA 1JKHA 3GSIA 1X8DA 3MOZA 2JH3A 1YJNS 2QLXA 2QA1A 5ADZA 4KKOB 2BG9C 2XCPA 1UUSA 5BMVE 4Y2KA 2CXFA 5HEOA 4UOGA 2W63A 2MHNA 2ZHAA 1OPZA 2AP6A 2AYGA 4IDOA 3HL6A 1N6QA 5FJ4A 4ISSA 3CD5A 4X65F 1U7LA 2ZZTA 2BBJA 3AEEA 1TU0B 5B08A 4M5NA 1W0AA 2HK3A 3H90A 3JAMU 2F8EX 2EBEA 5CCLA 2E9XB 1RT2B 2LSKA 3JSMB 1MN7A 3AAIA 4ILUA 2AEFA 1BY9A 4O3NA 4PUOA 4G6VB 4ZJQA 1FXLA 1ZAVA 1TL1B 2Y8WA 2CFXA 2DHHA 1W9RA 1HI8A 2DGVA 2J5AA 2OP5A 1FKOB 1U5PA 3HI2A 3RYCE 3K5MA 4X20E 4B3MT 2M5YA 4CXYA 1NAFA 5T7LA 4J90A 5ABFB 3AB4B 4NLSA 2B5JA 2RAQA 4E98A 1JNZA 1TQLA 2HW3A 4QZVB 1HBMB 1KFYA 1T9WA 5M2RA 4I6YA 2IBKA 3M6UA 2FGCA 2DNLA 4HEAA 1UVJA 3G86A 3NCRA 5IQQA 2ZH5A 2A0FB 3NL0A 5A8KB 3IR6B 1RAHB 2PA8D 1NK5A 1SJFA 4AUKA 3DGPA 3QT7A 2R7TA 2GJIA 2GV1A 1RLDA 4FNHA 2JHEA 4USHA 1HFAA 2VF3A 2KHDA 5HQMA 2Y0BB 2R42A 3LSVA 3TX8A 5EUHA 1KHVA 4ZN1A 4RBVA 3BKTA 4C11B 1NJIT 5DQIA 2WY2A 1LNQA 1TL7A 4BC7A 4V1Av 1JXEA 5JRCA 1U2RA 3BO2A 1R43A 3E3XA 4ZXLA 3R8YA 1D8YA 4HACB 4AKRB 3HHLC 2GGPB 5AQLB 4FI5A 2FZCB 4PG6A 2CZVC 1RT7B 2XMMA 2AF6A 2XAJB 1NU4A 2MKJA 4KO0A 3J9X1 3W3SA 2LLZA 3I55S 3LH2S 1UX4A 3M8PA 2QA2A 2XNQA 2GK9A 3GCWP 2YWKA 3ZC1A 3ZMVB 3ZEFB 1TP7A 2M8DB 4DL4A 4P9SA 4DV4F 1N32T 4IRKA 2PI4A 4ED0A 3CJQA 4UQTA 3JSMA 3IO1A 4B3RT 4F3MA 2ACMA 3KLEB 1FO1A 2XSJB 2MTQA 4IDKA 4DBQA 5KFWA 1I94F 4X66F 1UEUA 4NUVA 2F5GA 3KDNA 3M6XA 1FKPA 1ZBTA 3CCRS 3MEEA 2RDJA 3NKZA 4U9RA 1WEYA 2EHOC 4JYAF 4OX7A 1JLAB 1KQGB 2RKIB 2V8DA 4BHQA
chains in the Genus database with same CATH topology
1T72A 2AEJA 4J9UE 1LNQA 3RBZA 3L39A 3KXDA 2BKOA 2AEMA 4J9VA 1VCTA 2OGUA 4L75A 1T8BA 2BKPA 2FY8A 3L4BC 4EI2A 4L76A 2OLTA 4J91A 4Q25A 4XTTA 4J90A 3JXOA 1XWMA 4L74A 2AEFA 2BKNA 4L73A 4J7CA 4G65A 2IIUA 4GVLA 1SUMB 3RBXA 2I0MA 4RO0A 4YS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T72 A;  2AEJ A;  4J9U E;  1LNQ A;  3RBZ A;  3L39 A;  3KXD A;  2BKO A;  2AEM A;  4J9V A;  1VCT A;  2OGU A;  4L75 A;  1T8B A;  2BKP A;  2FY8 A;  3L4B C;  4EI2 A;  4L76 A;  2OLT A;  4J91 A;  4Q25 A;  4XTT A;  4J90 A;  3JXO A;  1XWM A;  4L74 A;  2AEF A;  2BKN A;  4L73 A;  4J7C A;  4G65 A;  2IIU A;  4GVL A;  1SUM B;  3RBX A;  2I0M A;  4RO0 A;  4YS2 A; 
#chains in the Genus database with same CATH topology
 3A13 A;  3QWP A;  3DDN A;  3M8Z A;  3NP5 A;  3OFE A;  2YOE A;