2BKNA

Structure analysis of unknown function protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
b'PKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN PH0236
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Membrane protein
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bknA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bknA02
4J7CA 3L39A 2BKPA 4L73A 3RBZA 1T72A 4RO0A 3RBXA 4J90A 2BKOA 2AEFA 4Q25A 1SUMB 2OLTA 4L74A 2AEJA 4G65A 1LNQA 4EI2A 4J9VA 2I0MA 3L4BC 4J91A 4L75A 2FY8A 4GVLA 4YS2A 1XWMA 3JXOA 2BKNA 3KXDA 1VCTA 2IIUA 1T8BA 4J9UE 4L76A 2OGUA 4XTTA 2AEMA
chains in the Genus database with same CATH superfamily
1TMMA 3W65A 3AEDA 4NXMJ 2PMZD 2H9ZA 5HVHA 3I9V9 4M95A 1GX5A 2MSTA 5SZTA 4LR8A 1D0ZA 1LVKA 4FZVA 1LKXA 1WEZA 2BKNA 3K8VA 1CHUA 2NP9A 2L3LA 5JREA 2B9XA 1H7XA 4WCEQ 2A0FB 4L9IA 3UUBA 4LFAT 4DV2J 4JI6T 3QRPA 1GAOA 1ZAXA 3TEGA 4URSA 3KK1B 1UW4A 4DR6J 2N4DA 3DYAA 5L1LA 3K1SA 5BR8J 2N4CA 2C3YA 3U3IA 4H4KC 1QSYA 2PJQA 4WWSA 1RCXB 4QR0A 3J7YI 4Q25A 3RLFF 3QLHA 4DR2F 1YIJS 3FZHB 3M8RA 2ADCA 4L75A 3W5YA 3LK2B 3ITHA 4RW4B 2C5KT 4EEDA 4HFBA 2PEBA 1VRTB 1YXRA 2XSBA 2WRMA 1RWXB 4U33A 1JK9B 1ZM9A 3I9YA 2QLBB 5IS2A 2DVIA 3RYLA 1FTCA 3AB2B 1ZKEA 2OO4A 4CTAB 3VGSA 2XM3A 3PRDA 2JPFA 3IR6B 2QL5B 2IJRA 3NAIA 2KXFA 1SL0A 5TAOA 5CYMA 3BGUA 3ZZYA 2HLUA 2LXIA 2ROPA 2NR4A 1QUPA 1S4FA 3W2VA 5FXWA 2GGPA 1CLFA 3QGIA 4DR3F 2COLA 3KLEA 4MKBA 4IH7A 2ODVA 4DQRA 3OR1A 3U7JA 3Q0AA 3AA0B 2NPIA 2G13A 3AOCA 1TKZA 2PSZA 1RHMB 3O2IA 4IE0A 2XLJA 5CA5A 2KT2A 2RRBA 3G8QA 2CADA 3JXOA 1S1XA 4KT0C 3ZTQA 3PUWF 5DDQC 5HQ8A 3ANWA 3PX4A 2WB1D 2A3JA 1EHWA 3H5YA 3KLHA 2XQ6A 1FWLA 2BG9C 4PFPA 2EG1A 1R89A 3CC7S 4OIXA 2QC3A 2FYXA 3KK2B 1S1WB 1RA7A 2WMOA 5LL6d 2ZOGA 3BQIA 1X4CA 1YQ3A 2V63A 2HHXA 3DRYA 2WSSV 3ISND 5AT1B 2UUBT 4JV5J 2FJVA 2J6TA 3VAFA 1IKYA 2HRYA 4X4RA 4DX8H 1KEYA 2QA1A 1YG0A 4EOZB 4WJBA 3ZT6A 1XR6A 5FY0A 4OQJA 2VBWA 3KNAA 4QW8A 4WE1A 4TWHA 3C16A 3C6UB 4U67Q 2CJBA 3Q8VA 3OTOT 1SHZC 2UXBT 4RWXA 2XAFB 4ZPCA 5D4PA 3DDNA 5KFLA 1IZNB 3R27A 2EPIA 1XR5A 2AGOA 1NAQA 2WW4A 2XLKA 5AFUL 5KFJA 1FRMA 5AQUB 1AB8A 1ZA2B 5EK3A 1QAJA 1X79A 2D9DA 2IM3A 1V3RA 3SYZA 4ZHRA 4DQIA 3R1HA 1XNRJ 4NYOA 4C91A 4JI1T 2WTFA 1UVKA 5GAGU 1Y64B 4MYTA 1U6ZA 1RTDB 4UOCA 3AA9A 4HGAA 5T14A 4C8OA 5B0DA 3U78A 3I32A 4F4XA 3QFHA 4FI5A 2XO6A 5B0FA 1T3OA 1AYEA 1YJUA 2DGUA 4USKA 2W67A 5IUXA 3HHLC 3QJPA 5H6QB 5AQOB 1UW9A 3I4HX 3UR3C 2GC8A 1RT5B 2L9DA 2WVEA 2CQDA 3MM5A 4LSNA 1RAOA 2VJUA 5DGBA 3QSYB 1WG4A 2IBOA 3ENQA 1YHQS 4HL9A 2IFXA 3HZEA 3RAQA 1W0AA 2HK3A 1M7KA 1Z4UA 3OTEA 4ETZA 3N5BA 4FBUA 3JADA 4WYLA 1FRKA 2XNQA 5AXKA 2GHVC 3QC9A 4Z2XA 4AKHA 1LK7A 5HCMA 3CQCB 3OKQA 1L3TA 2UUBF 3H0PA 2CDQA 1ZV4X 4ERRA 1LW2A 2X67A 2VPWB 4DU8A 4JI3T 4AKGA 3IO1A 2LQBA 5ITHA 3IG1A 1VHFA 3GMIA 2DCLA 3OTOF 3OD2A 5AE2A 3DU5A 4IUFA 2UXBF 4PK6A 3D67A 3BV8A 1SH0A 2YWWA 3HD2A 2DO0A 2WDRA 2WK4A 1FNXH 1SQEA 2J9DE 1FVQA 4ILMA 2V6YA 4J37A 4M5KA 4IQMA 1NK9A 3ZSSA 2E9XA 3OSPA 2HS3A 4H4MA 4C48A 3V6JA 4X66J 3V81B 2DY1A 1OWXA 1C0UA 4IOCQ 3LK3B 4KBMB 2HFZA 4XIUA 1HYSA 2JHEA 3VR8A 2EHOA 2BXJA 4MFBB 3SSSA 2B7CB 2DXFA 2G2OA 1N34T 1UPMB 1LRZA 2WSFC 2YQ1A 3CC2S 3D1QA 2DY9A 1X31C 2RJZA 2VWAA 2DNZA 3UN3A 1HWUA 3D1OA 5E3AA 2AIRB 5H9FJ 1RHKB 2AGPA 4C3MA 3MMAA 4WTOB 3M2UB 2DNNA 3E0ZA 4IFYA 3JQKA 3I6PA 4YDXA 1RT4A 4ZVFA 2WOMA 2VG6A 4NUUA 2QRRA 4OYZA 3OVUA 1AXQA 2XM1A 1VGYA 3IF8B 2IC9A 3QO9B 3VHQA 4I2QB 3BO3A 3OW2R 1NJZA 2BACA 3NS7B 1W26A 3N2GE 4YY3J 2XYGB 4BJNA 1IN0A 3PIOQ 3WX8A 3CT9A 5AQIB 2D0TA 1ELOA 3U27A 4AFFA 4TQRA 1RT3A 3W5ZA 1UGOA 3OLBA 2ZH4A 5JDLA 4K4SA 4C0BA 1UUSA 4TU8A 1R8IA 1TL4A 2V6XA 2YH1A 4H9QC 1FRLA 1Q53A 3R97A 3FEXB 2H4YB 5D4NA 4ZP6A 4B6XA 3Q8PB 2FQQB 2AU0A 4JI3F 3NEKA 3KTQA 2V68A 1SB6A 4RU9A 4EGLA 5F8IA 1AJ3A 4CNZA 4W92B 2W8KA 2AJ0A 4EYHB 5FD1A 1BR0A 4NXMT 1CQNA 3DHXA 1WHXA 3AXJA 1QAIA 2JLFA 4WP9A 2DGSA 3HVTB 4LVNP 1HFEL 1TUVA 3RRKA 5J1PA 3MM6A 3LP2A 1NAFA 2VONA 3R9LA 3O44A 4OV1A 3CX6B 5HANA 3HT0A 5EK4A 1JLAB 4X4PA 2ZH1A 1F3FA 2KHCA 4PWDB 2Z4PA 3CGIA 3M30B 4DV2T 3M9NB 1B99A 2BEFA 3N28A 4PK4A 3LALA 4KYZA 2Q43A 4OJ3A 2NW9A 2CPYA 4DR6T 1EKSA 3EXYA 1RWKB 3MUMP 2QVAA 4M5GA 3PY8A 2WCXA 1X5PA 2FJBB 1GEHA 2XQ8A 4WKYA 4Y65A 5LJMA 4USTA 3SCLE 2DWGA 4JI0F 3HKWA 3UN5A 2EWHA 1W25A 5KG7A 3FZMB 1KONA 4DOZA 4EK2A 2DHGA 4LF1A 1T11A 1F3VA 3DRSB 3DLKA 3RBXA 2Z30B 5CD4A 1IR2A 1V5IB 2HVZA 4WZXA 1WEYA 3H2VE 2V7JA 4P2SA 1D1BA 1JJ4A 1UCNA 4PYAA 4NLQA 3H8YA 3NGRA 2I8EA 3ZZUA 5F8HA 3PU8A 4F0HA 4CN1A 2W62A 5AQFB 1YD8G 4ZP7A 5JR9A 3C2PA 2MBGA 3WIUA 3JAEA 5F8MA 1X4FA 2NXUA 5M2PA 3FBLA 4O4GA 2BQRA 1ZS6A 3UQ4A 1VQKS 5LA6E 5F5WA 2IPOB 5J2NA 4Q8EA 3T1HT 4IL4A 1HNIA 4ECVA 5B0AA 1MMNA 3R6NA 2F63A 3MEKA 3EPIA 1CJVB 1HR0J 4H63V 1DURA 3QNUA 2Q1LA 3CCVS 5AQRB 2AYBA 2YNGA 3W9IA 4V19X 4K59A 4IIJE 1YSJA 3T1YJ 4NXMF 2JOQA 1UJ5A 1TV6B 5D3GB 4PG4A 3TLVA 2BE2B 2B56A 2WU2A 4DLEA 3RRHA 3ZEFB 2YDQA 2ZBIA 3ZO7A 2DPIA 3NZQA 2FGOA 1VISA 3S8SA 3HJVA 5F3JA 2IA0A 2YWEA 3I4PA 2Y0BB 1JLFB 1M5HA 3NRYA 3SQOP 5IHYA 1U1NA 1UURA 1GMWA 1YX2A 1T9UA 3HHLD 3P3DA 1NU4A 4YJ3E 4FKYA 2XQ5A 2V4JB 1FXRA 2Z0GA 3NLCA 3VGTA 4OLOA 2VF3A 5LGNB 3A7MA 4C3LA 1W9RA 3NVOA 2ZM6J 3H2UB 5GMDA 4O0NA 3TO8A 2R7SA 1QAXA 4ZPBA 2M6BA 1N36J 3PO4A 2YTCA 4C3KA 3RC3A 3KG0A 2V7LA 2WMNA 1RWPB 3CIRA 1FA0A 5HXSA 2ACYA 1IBKJ 4YTPA 4OYAA 8RUCA 2RILA 4JUZA 1XMBA 4J9KA 1TL5A 4KH1B 3L3CA 2HHTA 4JI4J 2VA3A 1RBOB 1K1QA 2M7SA 1SH3A 1XWMA 3RR8A 4BHQA 1CBKA 5ADZA 4K4TA 3UDEA 2JLEA 4NE9C 4DQSA 2DNKA 2Q3PA 3UU3A 1WTFA 3AE6A 3QSIA 3MDFA 2GX8A 5KFIA 3RAXA 2YWKA 3BJYA 1F2HA 4CLFA 4UIGA 1ZAWA 2LQJA 1C1BB 3OFHA 1VQ4S 3ICLA 2MHNA 4USJC 1IJFB 4PJMA 3UI3A 2A1BA 4DN9A 4YSYA 3P96A 1EB0A 1MROA 4XBFB 4UTGA 3T1HF 5EZYE 3DLJA 5IWAJ 2W4CA 4NA3A 3ZMVB 2DISA 3DOMA 3VV2B 1FKAF 4A5XA 1S99A 1U02A 4NEZA 5J2PA 4U7YA 2Q9QA 3QZ7A 3KINB 1T8BA 4DCOB 3RU0A 2AX1A 3MMJA 1ZYQA 1NJXA 5CZVA 3MMCA 2BANB 3FC9A 2GQCA 4IDKB 3FHNA 2I5JB 3CCQS 3GPAA 3MEEA 3AA8A 3LH2S 3O9XA 5ETLA 4ZI2C 2AYGA 2ZUGA 1M5KC 3AEGA 3IN5A 1G4CA 3OPKA 1RT6A 3NZPA 2M2BA 3NS6A 3RQWA 4U9RA 2AJFE 2I59A 2JQQA 4OYXA 2K3IA 3MOZA 2WB5A 2ODUA 2HSEB 2KXPB 2NXCA 2BJ9A 1WRDA 2HBYB 4NLYA 5AQMB 1VQOS 1SBRA 3AFGA 3D66A 3J81U 2M6IA 3R5JB 4RW9B 2QSWA 2X51A 5T41A 4UUXA 1NK7A 2DHHA 3CCWA 4IYQA 5D15A 3OL9A 3LP0A 2QT7A 2H65B 4AUKA 1CJUA 2W7OA 3UUMA 2APOA 2WVFA 5JDFA 4DHVA 3OVBA 1PBUA 4OYPA 4ISTA 3IBWA 1EETA 2JMKA 3MM8A 3CDWA 2WONA 1TK8A 3B5MA 4M5IA 2BZBA 4NOHA 3TA0A 1KC8T 3EVWA 5CYJA 5IT0A 2F5GA 3UU4A 1VK3A 1GXTA 1JNRB 1SJQA 5JQGE 3D0GE 2OPSB 3G4SS 2IMWP 4PZVA 2UUAJ 3J80U 4P7VA 1Y7PA 3QBCA 4DG1B 3ZJ2A 1S0VA 1BQMA 4NUVA 2QYWA 5IQ6A 1WHVA 4EU0A 5ETKA 1YJNS 2XNRA 1YQ4A 4ZDNA 3MR5A 4MTPA 1TKXB 1DTQB 2LA6A 2ZVIA 1VHIA 4A4JA 4LMLA 1H38A 4B3RJ 2W4PA 4P6QA 2VQET 4F4AA 3CJKA 4YMEA 3MPUB 4I6AA 3QATA 3IRXB 2DKOB 1RT7B 1WC4A 4K4VA 3EDUA 2HWHA 1RBAA 4O44B 4NASA 4HFEA 4C8ZA 5KTQA 4RNHA 2VASA 1X0PA 2XPKA 3Q2TC 1S6PB 4EO8A 3H98A 3GQCA 1RTIA 4ZJQA 5HROA 2JJ4D 3TRGA 5L3CB 4WU3A 3MCMA 2CHOA 2HMIB 1BR2A 2MQPA 4IOBA 2G2ZA 3H42A 3DCAA 3FZLB 4CP5A 5AQLB 3HL6A 2HN2A 1A9NB 1Z1ZA 4WIIA 3PYFA 1VI7A 2K2PA 5A1LA 4C90A 3R3TA 3G82A 1RJJA 2NXJA 3MECB 1GNKA 4C8MA 5F8JA 1HG2A 3MAHA 2B5JA 1MN9A 3PW2A 1S7HA 2MGZB 3QB5A 1SUQB 4U7UK 3CJ0A 1RZMA 5HSPA 1OEDA 2KT9A 3GONA 4KO0A 3H25A 2ZUAA 5DQIA 4TU9A 3MGJA 1HNZJ 5I3PA 4P2FA 1JNZB 2E9XC 1RAEB 4F3OA 2V9KA 3CE8A 2Y1LB 1T03A 1X4GA 3FFIB 5BYQA 1LOUA 2E1PA 4ZVUB 1D0XA 4CLYA 4ZJLA 4R8UB 1QVGR 2NS1B 3K3QC 1R0CB 3CJ4A 5EHHA 4AQFA 3KLFA 3LW5C 3B8HA 4WYVA 3H59A 3H5UA 2FJXA 2C3MA 3T5LA 1KD1T 5AE3A 1UX4A 4X65T 3QIPA 2VQEF 4RW8B 3MMBB 3UU5A 2W4XA 1D1CA 4DF8A 5AE1A 4OHWA 1D9AA 3QMQA 1C1CB 2EKYA 3SQGB 1PC4A 1TKTB 3QT6A 1OS5A 4DV0F 4JI5J 5HXCA 3G2XA 3R5AA 4QWCA 3HXMA 3SFDA 4DX7A 2RPAA 2E1CA 2W2NP 2FHMA 3DC2A 3F31A 1HA1A 2CQ0A 2G9OA 3DOLA 3L9ZA 2HWTA 4AL5A 4QIWD 1M5OC 1O5JA 3RZAA 2E1MC 2ZITA 3U1MA 1LW0A 3CCJS 4NL5A 5A2QY 2OEMA 4P73A 3CDEA 1IKWB 5CYQA 4LF6J 3T1YT 2D2SA 3J7AN 5GMEA 3D1HA 4UQTA 2K9AA 4ZJOA 2LHNA 3FCVA 3I5CA 3ZYKA 4ID5B 3Q5WA 1SKSA 4QQBA 4G3IA 1S48A 4C0HA 3J7YU 1HX8A 3RYFE 2A10A 4I1TA 2BG9E 4RNFA 2VICA 2PFDA 4KJIA 4IT4A 1Y3JA 3EAMA 2N2NA 2GS8A 2LXUA 4F4ZA 4DL3A 3BK9A 3V4IB 4UY8T 2M67A 2RH3A 4IRKA 1F0XA 3QJJA 1Y11A 1RA6A 3FBCA 2V2VA 1RWNB 5JMNA 2RHSB 1RT1B 4GMKA 2ZM6T 1N36T 5MAOA 2UXDJ 2P9CA 2CJKA 4LF7J 4ZN1A 1S57A 1IJ5A 3HD1A 4UF0B 3KHGA 3NMAA 3LWMA 2BJ1A 2P8IA 4ZI2D 1ZPVA 1VQ8S 4X65F 2K1RA 4WXOA 3S7RA 2HURA 3MA9A 1NJIT 4OHYA 1HHTP 2Y1JA 3I55S 4ZS2A 3LBXA 4ECZA 4KHZF 2DT9A 3K2YA 1FK9B 1VQPS 4ECXA 3TLTA 1VR6A 1FXDA 2EFVA 1FKOB 2CNNB 5A8RA 4OYOA 2OTJS 1L3UA 3QFWA 1TK5A 3VR1A 4ICLA 1S59A 1WG1A 1NSPA 3KG1A 2PIIA 2KJVA 5JR9C 1U47A 3Q8QB 2MLYA 4B3TT 2CE7A 4GKJF 2WWVA 2UXCJ 3T1YF 5E3CA 1GT8A 2HNYA 3D0HE 1EZZB 2OI2A 2B0GA 3TWZA 2BW2A 2FJEB 4X4SA 2EG2A 1XTZA 4KR0B 1RI7A 7FD1A 1O6XA 3CWZB 3BM7A 3A8YC 3ZZPA 2MKKA 2OGUA 1R27B 4X4VA 4U2YA 5SUHA 4USHA 2GIRA 2F4VJ 1WOOA 2ZD1B 5KFUA 1TL7A 1RGVA 2UXNB 4ZKAA 2AJQA 4O2BE 1T0TV 2ZM2A 5LMUT 1RKJA 3KXDA 3D68A 4DV4J 3MUVP 3CJRA 3F44A 4HWFA 5DJBA 2AQ4A 3RRGA 4IQXA 3C4WA 3DXSX 2YU1A 1B0PA 1NHVA 1D1AA 1N36F 2OTLS 1OXZA 1WR6A 2VPYB 2FJDB 3RBEA 2VD3A 1RYSA 3KK1A 3MPWA 1IM4A 1ICEB 5JVDE 4W98A 1JLBB 4I6YA 1HBOB 5FXXA 1JXVA 2JDJA 2C3OA 1WWHA 1NWMX 3NWRA 4L74A 2F4FA 1RTHB 4LFCT 1M5SA 1JXEA 2IBKA 3QZ8A 2CRLA 5LT5A 1YGYA 2P6TA 4CLSA 4NPPA 4RW4A 3DI6B 3FEYB 5LMNJ 3BKUA 4CH0S 2K3KA 3QWUA 2MKCA 1C0TB 1HBUB 5J2TE 1Q79A 3NMRA 2GQ2A 3LTOA 3LJCA 5CCMA 3JAMY 2IMOA 2VQFF 1R31A 1RU1A 1FWPA 4CI2B 3QT7A 2YKNB 3ONLC 5F8PA 2MOZA 4C97A 2BX6A 4CTAA 1SKWA 2ZM0A 5F3TA 1SKRA 4Q0BB 2RF2B 3RB4A 4A46A 4C9DA 3NY0A 1GQEA 3QGPA 2FVCA 1B4SA 2XO7A 1UX5A 1FJCA 1DQ9A 2CFXA 4B3TF 2FUG9 3SIPB 1V3ZA 2KINB 3M9MB 5KG0A 4JV1A 2QGSA 3ZCIA 4K0KT 3EJMA 4B3RT 4FYYB 4BDPA 1FE4A 4DL0C 2C0SA 4ZI7E 2VKRA 1VC6A 2Q9QC 3SFUA 2NXNA 4FYWB 1J1JA 1NPRA 2E9XD 3DLGB 4HHUA 3MR2A 3RB0A 2BVLA 1H74A 2V4QA 3IFEA 5LMUF 3VKHA 1U6FA 3KK2A 2WZHA 4LT6A 1S1WA 4CZCA 3N6LA 3SRZA 2EHOD 2AEMA 2QRXA 3KBUA 1IBLJ 2NZ4A 2Y1RI 4XAKA 2CG8A 2NQPA 4IR1A 2J4GA 1PO6A 3MD3A 1I1GA 4C11B 3QWPA 4DL2A 1LK5A 3JAFA 4XAXB 4F4YA 4LRDA 3Q5DA 4AE5A 2KZZA 4OX9J 1AZSB 3FRZA 2V34A 3WAJA 3BZQA 4YR0A 3PW5A 1L3KA 2BABA 2KJWA 4DZDA 5J1EB 4WFXA 1FWKA 3C6UA 4LF8F 2BA9A 1U0HB 3UFGA 4LFCF 4OYIA 5HXEA 4KV8B 4WFNQ 4CCHA 4MHCA 2WP9A 1VS3A 2WHOA 5AQQB 4J9LA 3I1AA 4KB7A 1KLMB 1S0OA 2JFDA 5AQVB 4NYZA 1HNZT 3MCNA 5I42B 4O4RA 4ZIWA 1VDHA 3V5UA 4P1NA 3P8CD 2V0NA 2MJNA 4ER8A 3PUVF 1V9DA 2HRUA 1E6YB 2YK0A 2ZBQA 2GVZB 3ZMZB 2MQMA 4N47A 1RXOB 3HSDA 5GMKa 3A3NB 2XQ4A 2VB6A 4XZCA 2MKHA 3S4UA 4MJKA 2FC8A 3GP9A 1RTDA 3NWGA 1MIWA 1FXLA 5AQSB 4F8HA 2AHOB 2GIQA 3UW1A 4MIBA 4LUBA 1KVJA 3P4WA 1YWXA 4K0KF 1I6ZA 1N32J 2DITA 4BC9A 3C46A 2ZHBA 4B9VA 3OV7A 2AT1B 5DG7A 3A4TA 3WDOA 4KKOB 5L3FB 3NWIA 3LAMA 4QIEA 5HVFA 2RU9A 3CCTA 4J9OA 3TEHB 4PAGA 2LHRA 1KOOA 3HFVA 1S9EB 3TW0A 4OI1A 4HR2A 1S5ZA 5E2QA 2FZKB 5HXHA 3HKZD 2XASB 2HVIA 5HJYA 1YJ7A 1HNVA 5B08A 4O3RA 1RUSA 4LF6T 2HFVA 4A8XA 1N33J 1KVKA 3KV6A 4HFCA 1MSWD 1HQEB 2AP6A 2XAGB 1F9EB 1JJCB 5ETNA 3QRRA 4A8WA 1LKZA 4QCLA 2HHHF 1UA0A 2WM9A 2P9EA 5IM0B 4DV6J 1T7PA 2I1RA 3AE9A 2K8GA 1FI4A 3PX6A 3ZXWA 3HHNB 2Z2LA 2JIWA 2ABYA 1T98A 1XBWA 4DPOA 1DU2A 1Q5YA 4PXCA 3SDEB 2WOMB 4UF4A 3VRBA 3W8PA 1KS2A 1QD1A 3NCPA 2QLJB 3CPZA 2AWZA 1HNZF 2R2TA 2V7MA 1XMOJ 2HH7A 1B70B 3S1TA 4KIAA 3T5KA 3C66A 3M8YA 2VIHA 2H5JB 3L09A 2HGMA 3AD7C 4IFVB 3CMES 4NXNF 2ZWPA 2KT5A 4CYUB 1OEDC 3V81A 2VFSA 1Q8KA 2UXDT 4LF7T 3GIMA 2ZHAA 4Q45A 4I55E 3HCXA 1VC5A 3CJ3A 1DQAA 2ZMAA 3C50A 4MFBA 1FFWB 1K73T 8ATCB 4X4TA 1QVFR 4FVMA 1S4EA 3TVKA 3HZGA 1N6QB 2HAFA 2IDEA 1N5VA 3CCRS 4DR7J 4FYXB 2OFGX 3PJXA 2KYZA 1YZ7A 3JTNA 4AQFC 1HBMB 2BYCA 3KLGB 4A8FA 1RYRA 3A12A 2DCUB 4ETXA 1VJQA 3M2UA 3MM6B 2XHWA 4MK8A 5DLFA 4QIVA 3LPEA 2CPFA 1RACB 1D1UA 4UZCA 1TL1B 2CPHA 3D3CJ 3FBZA 4MYUA 3CNQP 3EZOA 4YDDB 4QR2A 4TKTA 3QO9A 4I2QA 5HL7Q 4I4TE 1GMWD 3AXKA 3TLUA 1U1MA 3BREA 2MJUA 1FJGJ 4FJOA 3IM9A 1XNQJ 1VCTA 2YX1A 4J9MA 2UXCT 1TUGB 4DQPA 5B0BA 1TUWA 3SZ2A 4TQSA 3EGVA 4MK7A 1XMQJ 2NSBA 1VC0A 3O1LA 2OEKA 3H5XA 3W9JA 3FZ2A 1U1RA 5HAOA 4JBWF 4IH5A 4OYMA 2XCAA 2DPJA 1V5VA 1AA1B 2XQ7A 4QWAA 4URQU 2B4VA 4TU7A 2NR0A 2I2YA 4F36A 4RBTA 3V4MA 2GW8A 4WPAA 3O1JA 5C42B 4YN3B 2B51A 2XS5A 3T8OA 3HVTA 2OA5A 4KQZA 4JI8T 1IWGA 5KT3A 1PJ6A 3W7BA 4CXWA 3ZN1B 1BMQB 2XAHB 2QFIA 1WNEA 1F2GA 4OZ1A 2XTLA 1JLAA 2HN1A 1MWYA 2DJWA 3CDUA 4PW8A 3D54A 4PWDA 2XI3A 2D3OR 1EJ7L 1XQIA 5K8NA 3M30A 3WZ0A 2CA5A 5JDGA 2PFFB 5L2LA 3GJQB 2VBXA 1UPPA 2LQ5A 4LF7F 1SC6A 5GAHU 5H9EJ 3AT1B 3EDQB 3ZTOA 2LFVA 2CLYC 2ZE2B 2J6UA 1WCRA 1H2VZ 4OI0A 3RX6A 2B4UA 2X3DA 4YUDA 3B13A 3BH7B 3Q8RB 2Q9QD 2IJFA 2Y8WA 1P9YA 2ALYB 5M2UA 4O23A 2DH9A 3OXLA 4QU6A 2YOEA 3THVA 2LT3A 4GC7A 5DLGA 1M1KT 2KXNB 4DV5J 2DR8A 4YXDA 2AF6A 4JBCA 3DRSA 3BS9A 1JJ2R 2E66A 4RUHA 1TK0A 2OV9A 1QUUA 4UZBA 3JSYA 3E3XA 4PFOA 5IXUA 1E7PA 4DV3T 3KG4A 1U8WA 4HWIB 5HP1B 3D6MB 2I0XA 3I9ZA 1NSQA 5F0WA 1P1TA 3UQ7A 3PKYA 2ZHOA 4M5LA 1TTHB 2YBVA 4G63A 5KFTA 3CQGB 2GZOA 1ZH5A 4W4MA 4OHXA 3O4XE 1U48A 1HNWT 2WU5A 3G87A 5FL1A 1WC0A 3M65A 1CJVA 1QE1B 2KRBA 3PU3A 3AJ2A 5G4DA 4DFPA 3IBPA 3CQXC 2ILYA 7FDRA 2ADBA 4ED5A 2J0SD 1HWJA 1R7IA 5L38A 2XMKA 2OLTA 1K9MT 3BSOA 4AQYT 5D3GA 1L0VA 4DR2J 1R0AB 2LOSA 2BE2A 2ROGA 3N9QA 1P9QC 1RP5A 3G86A 4JI8F 2RRAA 4NLWA 4Y2AA 4TNOA 3TJAA 4LQ3A 3DTOA 4I64A 1NLKL 5KXJA 3LGHA 1IBLT 4HI1A 1W0BA 1S9GB 3TI0A 3JC6D 2E1AA 2DR6A 3CO0P 1JLFA 5D4OA 1B3TA 2BQ3A 1GXLA 3G71S 1S12A 3DRXA 3Q22A 1LFWA 2VC0A 4RL1A 3HP6A 2V4JA 3AEAA 4OK0A 5ABHA 1IKXB 2CQIA 2V9WA 2DGOA 5BXIA 2E7XA 1NKEA 5D77A 2VKHA 4KPYA 1JLCB 1HTJF 4DR3J 4QR1A 4XDCA 3MACA 3SSRA 3AEEA 3TVYA 2UZAA 2E7WA 1NSKL 4N8OA 4DPTA 2PMHA 1T72A 1AW0A 3BDEA 3PUQA 3KUEA 5IC6B 4NYPA 3VAHA 3H4DA 3RBDA 3VR9A 4YB1P 5AJ3F 3IM8A 1FO1A 2VFTA 5K9FA 3EM1A 3BN7A 1M1GA 1LWFB 1CJKB 3JYTB 3D0TA 2D1CA 4DV3F 2CZ9A 3UDCA 3MXHP 5EWEA 4ZIVA 2VL1A 3PW4A 4M94A 2K7JA 1PYOB 3PW0A 4ZCIA 4F3MA 1C1BA 5FXVA 3IS9B 4EYIB 3TZYA 2FVQA 1C4CA 2F65A 2QA4S 1VQ9S 1N32T 4X84A 1HNWF 2UV8A 3AOBA 3SWHA 1GXUA 4ZPWR 4Z8XA 5L4EA 4EO6A 1FT8A 1NK0A 2MXYA 1U4QA 1FCAA 1IBMT 3R5CA 2DB1A 1UCUA 3PE0A 1BQNB 1D0EA 1PSDA 4NLPA 2UUTA 5GADI 3O5TB 3N9UC 4U8VA 3OBIA 3BGRB 5K14B 2HNZB 4GKKT 2W00A 2R8IA 3P50A 4WXWA 3KDOA 2DXDA 3MXZA 3SCJE 4AQYF 2BANA 1U1PA 4IDKA 4ELVA 2I5JA 2GAGC 4X4OA 3NGTA 1Q8LA 4AKRB 2Z57B 4CLPA 2X1GA 2Z56B 2GCFA 1ULRA 4GO5X 4D3GA 1Y9OA 1KNZA 3POTB 1N33T 3NBXX 1AT1B 5KOWA 2OMOA 3QAEA 2R8HA 2CZ4A 1RTJB 3WQPA 1OMSA 3ZYMA 4ED2A 3KV4A 5JRCB 1BR4A 2DO4A 4JP8A 2CJAA 1SKUB 2VDIA 3N01A 2LOPA 4FXVA 5IYZE 4YTNA 4IE4A 3W64A 2V67A 2A6MA 4RW9A 5K8PA 1SJ3P 3W5XA 5KT5A 3RIFA 5G0RB 2HBRB 2LDIA 4N56A 4OL8A 1HIYA 1IR0A 4TNVA 5LM7E 3TZWA 1EQ0A 3R2DJ 2W61A 1RWVB 2DHSA 4ZEYA 3EXCX 3K5NA 1MU2B 4L3NA 1JNRA 3NNHA 5IQQA 2ZZMA 3L3PA 3KDSE 3PJWA 2ASDA 2OPSA 1RB0A 4DBRA 4NWBA 4ECWA 2J8AA 2RS8A 1VQNS 3MM9B 3GSIA 3OUYB 3ESLA 1U0SA 4HKAA 2RNEA 4DG1A 2LSYA 4KE5A 1N32F 3VZIA 3A8JA 2UUBJ 2JC1A 5T7LA 3GCXP 1IBMF 3RTVA 3K5LA 2O3DA 4DS4A 2V8SV 1TKXA 4GKKF 1T9XA 4RW7B 1DTQA 3N6MA 4J9VA 3OTOJ 1P27B 1M5VC 2RD5C 4K5SA 1KN6A 2ZC3A 1DZ5A 2R6GF 4LF5J 4DO0A 3IRXA 1RT7A 5HJXA 2EFGA 3AD9C 1FEHA 4O44A 3OL8A 3RB6A 4NX9A 3BR9A 2AYEA 4CM0A 1TU0B 1FNMA 4QH5A 1WI8A 1OO0B 3UU8A 1XNQT 1RHUB 5HEJA 4KHRA 2NCKL 1S6PA 1N33F 3K8PC 3SFGA 3KMQA 2YX7A 1RWUA 4J9PA 4A8KA 4IO1A 4QZVB 1YBAA 2HMIA 1KRPA 4WFAQ 2PC6A 4USWA 2N3LA 1SPBP 3VQTA 2XAQB 2OHDA 3CDBA 4TNWA 5HO4A 2AJ1A 4GIWA 4MALA 3C6TB 1LQ9A 5HBMB 5ETPA 4DPXA 3DRPB 1OQ3A 5A0YB 1NDKA 4J9RA 3HSJA 2QZ8A 3DGVA 3W9HA 3T5HA 3QIPB 3JSRA 3CD6S 1PYSB 2QLFB 3MECA 4CQ1A 5FXZA 4I2PB 4CLZA 4YQWA 2CNKB 1OJ4A 3GG0A 2YDSA 4YR2A 2XQ9A 4GK5E 4R5PB 1HBNB 2RT3A 2NSCA 3L7PA 2MGZA 1SUQA 3MAAB 3AE4A 4U7IA 3IGVA 3RIUA 4DUTA 2VA2A 1LNQA 5HXRA 1KR4A 3OHAA 4YT0A 2LQ9A 4DR4T 5HATA 4ZLPA 3TKLB 3MKDA 2XZWA 5AQNB 3UT5E 1JNZA 2R2SA 4UVAB 2HYIB 3K59A 1SVDA 1FF2A 3FZKB 4N7TA 3C51A 3FFIA 1NJYA 2H7VC 5H6RB 4R8UA 4IKAA 4QHOA 5AQKB 5ETMA 2DGTA 4FYVB 2ASLA 4N8NA 2CEAA 3NRXA 3QPIA 4PG6A 4YSXA 1XEZA 5KT6A 3ADAC 4DV5T 4HTIA 2R8GA 2RQMA 1OYEA 2QA4G 2CJQA 1XERA 3ISZA 3IR5B 4CRJA 2M4MA 4UEMA 1HWLA 4EV6A 3V6DB 4F4WA 1XDPA 2BZ2A 2IC3B 1FD8A 1X0FA 4NPOA 4RW8A 3MMBA 4HFVA 1TL3B 3JSMB 2FLPA 5AXMA 3HSGA 3B57A 3K3OA 1C1CA 4MFRA 2YWGA 2RRNA 3P4SA 3SQGA 3HX9A 1MMDA 1TKTA 4DI6A 2ROEA 1UMJA 2AEFA 2MZTA 4CO3A 1HWIA 5LP6E 3KLVA 4NMLA 1RBLA 4DZ6A 5KG2A 3GIRA 3M2RB 3BQ2A 5I3UB 1XNQF 2OPRB 5CA0E 2IRYA 3SCIE 3QNWB 2G0UA 3ZJ1A 2JEFA 3VKGA 1NH7A 4ES3A 2SXLA 1SXLA 4RW6B 2KYXA 2QSFA 3EGWB 3KV5A 3FJ2A 4H9NC 3C64A 3A13A 4TLQA 4QYZK 3T1AA 2HBZB 3CCUS 2CZVC 2DNXA 4K4XA 2HZCA 4U96A 4NRTA 4KP3C 5H9FK 4FS2A 1IKWA 1ZA1B 2B4PA 3KFWX 3IAS9 1TAQA 5HCJA 2XMVA 3UCZP 2B8QA 1WKKA 1VK8A 1YI2S 4O4JE 2EFQA 4ID5A 3ZTRA 1RT2B 3PJAJ 4FYDA 4I67A 2L8KA 2H5EA 4JI0J 2HHSA 1TAUA 2DNGA 1VYAA 1Q82T 1HW8A 4ZVHA 2KLQA 3I5AA 2WDQA 3EPGA 4NIQA 5L3GB 4WTYA 5EUHA 2KM8B 2PA3A 4FDFA 2J0WA 4C7QA 3V4IA 2ZJPQ 4DR4F 1Y0HA 4QWNB 3NXZA 5KFNA 4KHPT 4USIA 3VALA 2CPXA 3UCGA 2YQ0A 5A6WA 4YLHA 1RT1A 3J81j 2KWIB 4J9SA 2OAUA 1V9OA 3Q89A 4DVDA 2AZ3A 2HVHA 4DR3T 3CW2C 3MPVA 3PRVA 4OYKA 1ACMB 1SJFA 3PR5B 2HHWA 4QH1A 1JXLA 4UF0A 1S6UA 4DV5F 1ZTWA 3VRAA 1OSCA 4PUOB 4FXWA 4LMZA 3SSQA 3D0IE 4TY9A 2HZAA 2JFKA 2VG5B 4DFJA 3LF0A 4KAIA 1FVSA 2X0HA 2WBRA 1VRBA 2VODA 4CLKA 5CB4E 4QXBB 5F9NA 3RBZA 1U5PA 2W2UA 1HMVB 1MWZA 3KJQB 2GMJA 5J2MB 1FK9A 1FFGB 2W2MP 2J9CA 2K7KA 2BBJA 1FDBA 4OHZA 1FKOA 2XZDB 3PYDA 2I6HA 4RNNA 4USVA 4F25A 4IDOA 1OPZA 1FD2A 5F9LA 2AZ1A 2DYAA 3RI5A 3PHEA 3C14B 2KB2A 2RQKA 2DNLA 1Q5VA 2U1AA 2VV5A 3EUNA 1G2EA 1MN7A 5L1IA 2MKYA 4EEYA 5KFEA 4U8YA 2FHKA 3C4XA 2CPEA 4E2FB 2C3PA 1NHUA 5KG6A 2ASJA 2NW8A 2HPJA 2H3RA 4KGVB 3MM7B 5LJ5Y 2FJEA 4CN4A 2XMAA 5C3JA 1GH8A 3FMWA 4QU7A 5F8NA 2QE5A 1WKJA 1EP4B 3I5BA 3AB4B 2BJ8A 1SC1B 1JMTA 3BQ0A 2J7KA 3GIIA 3DN9A 1MMGA 2FB0A 3US5A 2ZD1A 3SI8A 2J1DG 3SS1A 3FCHA 4FPRA 4I43B 2PEHA 3D4JA 3UPFA 2CXDA 5KFYA 4KHPF 1KTQA 1ZOYA 4L0RA 1CUNA 5KAKA 1S0NA 4PPZA 4ED1A 5DM7Q 3W8GA 3PHTA 4AL6A 4A56A 3F0NA 5LXRA 1T9YA 1HLWA 2YH0A 2FJDA 1UK5A 4YFUA 1JJHA 2BMBA 1VCSA 1Y3KA 1N5QA 3T1HJ 1JLBA 1HBOA 1IQTA 1DAXA 2I6WA 3QT5A 2QL7B 4B02A 1RTHA 3NOCA 3W15B 3QIDA 2LA4A 1UWBB 1SC3B 4ZITA 4DPWA 2F8EX 1OPIA 2NREA 5JXSA 2DIUA 4LRBA 2KWHA 3E51A 3DI6A 1PIEA 2GJIA 5ABEA 3ZZOA 5HN0A 4LIWA 1OEDE 2BQUA 4YS2A 1C0TA 1HBUA 3KLIB 4OJHA 2WB4A 5CABA 3QK6A 4BAYB 4X5TA 3CCZA 2YKNA 5E33A 1S97A 1MW7A 2YPZA 1T94A 4NLTA 3BBFA 2KT3A 2H88A 1CPZA 3OR2B 4OI4A 3RYCE 4XPCA 2EC2A 2NPFA 4CO0A 1N5SA 1X4AA 2XQCA 4Q0BA 2RF2A 1K47A 2DEIA 4PK5A 3LUYA 3PTWA 3ENAA 2MLXA 4LMKA 2LDYA 4CXXA 3NP5A 3T9NA 3N9PA 1TVRB 4KGMA 4LVOP 3DLLQ 4CT8A 2ACMA 3UFEA 2DNPA 2X0LB 4B3MJ 4LF5T 4LSZB 4ED3A 5LOVE 1GX6A 1SQFA 5DO2A 1ZEEA 1RU2A 3VVUA 4PJLA 2BW7A 3DLGA 1GMUA 3UD3P 4U3CA 3GR1A 4JV2A 2BVZA 2HKEA 2YWFA 2ZKTA 2WW8A 2W9BB 3M6WA 3KUGA 2BJDA 2ILZA 1B7FA 1FKPB 4FN5A 3ETVA 1K1SA 3Q24A 1BXNA 4KC5A 3TUJC 2MYSA 4IDPA 3VWSA 4HHJA 2UUCJ 3G6VA 4C11A 2OEJA 1J5OB 4UXNB 2V50A 2JZ5A 3UVJB 3OJUA 5LG3A 4U7CA 2HS4A 3M8ZA 2YQ3A 1AZSA 3Q2MA 4NLRA 4OMFG 5DETA 3KVBA 3UU6A 1BLUA 3MCSA 5ETWA 5J1EA 3AJ1A 3NRBA 2XWYA 2C2DA 3HVWA 4TV9E 1U0HA 2JNJA 1DLOB 4LREA 2D5UA 3DDKA 4OJ1A 1FE0A 4KV8A 8AT1B 2MQLA 4TXSA 2KZMA 1VRUB 1KLMA 3X1DA 2X9YA 4U2ZA 3IBCB 1U4BA 5D4LA 5I42A 1ZHCA 2HLTA 3CX8B 5FY1A 1LXJA 1WJ9A 3VGVA 2J7UA 3MAQA 2KRRA 3IXQA 1HNVB 2WDVA 4LRFA 1DARA 2I9SA 2FLOA 6AT1B 1PG5B 2C2KB 2SPCA 1E6YA 1NBEB 1URNA 2GVZA 1IM6A 3HA4A 2D69A 2DNHA 2KFNA 4ZOSA 3OHBA 2AGQA 3M05A 1U1OA 3H3MA 3CC4S 1WC6A 3MR3A 3BO2A 4ZCMA 4PKDB 2D3ZA 2VURA 1ZBTA 1QTNB 4EYUA 1FDNA 4OYJA 4TY8B 4ASKA 4Z90A 3F57A 2NUHA 4M5HA 2XCPA 4LF5F 3OYXA 4F3QA 2N3OA 4AKIA 2JEIA 3C4ZA 4KKOA 1H7CA 1X7VA 4LRAA 5HQMA 5B09A 2LSGA 5DZ6A 1RDRA 1WSRA 2V8HA 2W2QP 4COFA 3TJ9A 1WOSA 3KNGA 1RAGB 3GWCA 1S9EA 4NZ7A 1R8HA 4J9UE 1VQYA 1L5UA 3O1HA 2W2PP 1LV5A 4EB6E 3T19A 2OJ3A 4WNKA 5L47A 5FVKA 3RF1A 3OXFA 1IVZA 3FSYA 3BF4A 1UFWA 1U1QA 2MPUA 4UELA 5ABGA 4X64T 4KRWA 4Q44A 3LGMA 1HI8A 5F0UA 2A6OA 3DOKB 1R6YA 1HQEA 2CQ1A 4D3HA 3GIJA 4ILUA 3HF5A 5IM0A 4WF9Q 2MZSA 4Q5VA 4LFBJ 4MKVA 4JI0T 2IRXA 3BGFA 2P6SA 1U09A 1T9VA 3TQ1A 2AD9A 3FB2A 2W25A 2N9DA 1GTHA 1BR1A 3SDEA 3FDSA 1R8PA 4OYWA 5D0RA 4Z7YA 4DU7A 2VQEJ 2ZDOA 3O6QA 2M3DA 4LQ9A 4B9NA 3DJBA 3OXGA 4F8RA 3FEZA 3W1YC 3E2EA 4U74A 4DV0J 3IA3A 4K0UA 5L1KA 4IFVA 1TR0A 2K24A 3RIUC 2HNDB 5L3BB 4CYUA 9RUBA 4KGKA 4BC7A 5D0GA 2NTXA 3VAMA 3PACA 4WW0A 4TWFA 2BV3A 1QAYA 1C2PA 1SV5B 3ETUA 4YFSA 1KFYA 1N6QA 5KT7A 2B9YA 3ZMUB 1P1LA 4LSLB 3UR0A 3U1NA 2QYGA 4HEAA 5HEOA 4ZCLA 3ZZ0A 3BDPA 1G3OA 4J9QA 4JOUA 3VHLA 1HBMA 3KLGA 4MH8A 3KJVB 3KJNB 3IEEA 4ZPAA 2E5JA 1X4HA 3R5GA 2DCFA 2BM1A 1H98A 1F9HA 1S1VB 3GR0A 2BS3A 2CAJA 1TL1A 4CO5A 5AQJB 1K0VA 4LRCA 1H72C 4DPYA 5DZ7A 2LMIA 3F41A 1SUMB 3T9ZA 3ONQA 3WC2A 2RVJA 5D78A 4ES1A 4J91A 1VMBA 4YB5A 3ULHA 4B3OB 3H7HB 3PFEA 2RSQA 2J47A 4K7QA 4X64F 2AW0A 3S6EA 4R0EA 1UA1A 1Q78A 1FESA 1WF2A 2WZIA 2M9KA 4ILAA 4ZLJA 4X4NA 2RUSA 5K8OA 3EZUA 3ZKRA 4ISSA 4E7SA 2FGCA 2YKQA 4WZMA 1YJTA 2G1DA 3Q23A 2R7VA 1FRHA 4ZVTB 2VDHA 2PA8D 4V1Av 2L9NA 4DUZT 1FDAA 5ETTA 1VBKA 2LKZA 4X65J 4YHJA 4KBIA 2BOAA 5C42A 3I82A 2CPDA 4JYAT 1S6QB 1TMJA 1EKRA 3TANA 3OL6A 4ILRA 3OJAA 1NXIA 3PEHA 3EHZA 4HVZA 5I3QA 1WSVA 2ZZNA 4UW2A 4ADZA 3X1LB 2IAKA 2RA1A 3OBVE 4UUWA 3N9OA 2R8KA 3IGNA 3RYIE 2ZOMA 1HX1B 2ZE2A 4FS1A 1EARA 3GFZA 3HO1A 3LAKA 5HMYA 2Z6EA 1MG7A 2H7OA 3VAJA 2HQ3A 2IRUA 4GKJJ 5CAAA 3K89A 4CLWA 3ONJA 5KFPA 5GADU 4ZK7M 1NKCA 5KFOA 1PJ5A 1RE1B 3L95X 4JB8B 1LEOA 3H5SA 4DL7A 3AQPA 3AQOA 4LF9J 2NW7A 4JLEA 3K0JA 5JVGQ 5A8WB 3KWMA 1N48A 3CD0A 1U2RA 2HPUA 3I0RB 2GVDB 2KSRA 2HS0A 5B7WA 2ZC4A 4YR3A 5E41A 3BH6B 3CMQA 2RE1A 2HFUA 1NPPA 3I96A 5HP1A 3RGIA 4DSEA 4NZ0A 2MY7A 3CF5Q 4OZ3A 3BYRA 3TZZA 2KNDA 3AA7B 2VVNA 3KYLA 1FDDA 2LXFA 2C2NA 4G65A 4K8RA 2ES0A 3UQSA 2F9JA 5GONE 3OVAA 4B3MT 1TKDA 2XZTB 1QE1A 3GV5B 2LQ8A 4NCAA 1MLAA 1V3SA 3MPDA 2KFZA 4ZS6A 2GMLA 4IHJE 1G1XA 3J7Z5 4E0DA 4DUZF 1VBYA 5FYMA 3PV8A 1R0AA 3NGUA 5CXTA 3THPA 4HACB 1NZAA 2HQCA 1KOHA 4JYAF 1NK6A 4P9SA 4ZHQE 4DX6A 1S9GA 3LK42 3EUHA 2XMWA 5GAHI 2CJ9A 1J5EF 2UUCT 3NOGA 2VQFJ 3CVKA 3FXEB 4I0WA 3K8WA 2IVYA 3GWHA 2JSXA 2IAJB 5HEGA 2FTRA 5CCLA 1R8CA 1IKXA 1SIWB 4USMA 1NEKA 1WI6A 4TLRA 4KGXB 4QJVA 1WYCA 2JMHA 1HI1A 2H3EB 3L7OA 2FVPA 3BYPA 2E9RX 2XGPA 4ECYA 4B3TJ 4U6PA 2EI5A 1BGXT 1JLCA 3EVYA 3DM2B 4JV0A 2LP4A 3QUJA 2DRAA 1I3OB 4G1PA 3MHYA 3I0SB 4X4UA 1KWMA 1WACA 4PXEA 4ENOA 4LF4T 4H4OB 1NK8A 2OPQB 2OPPB 3QQCD 2E44A 3DFEA 1KFDA 1QSSA 4K4YA 4ZP9A 3TAMB 2MLZA 2W1BA 2A2DA 1YRXA 3JYTA 1LWFA 1CJKA 2KZ7B 2E8IA 3K58A 5E3QA 3RW6A 1OY8A 2H54B 4DR1T 2HFNA 4AYBD 5LMUJ 3SFEA 4P10A 1X4BA 2B1EA 3HKDE 1GTEA 2B43A 1ZAVA 1MNDA 5B0EA 4PJNA 3EZ5A 3AVRA 3IS9A 5HVGA 5D0EA 2CG4A 1ZOTA 4HKQA 5DQWA 2ZLYA 3CEDA 5DS7A 1X60A 2V5CA 1WELA 4B3MF 3H3AA 4JI7J 3AE2A 2RDIA 4YB7A 1BQNA 4F7VA 2U2FA 2R4FA 1DRZA 3R6LB 3C3LA 4LF8J 3BGRA 5K14A 2HNZA 4LFCJ 4DCJB 4NI2A 3R7NB 3CIZA 4KGZB 4IG0B 2AXDS 3LANA 4WFZA 3EGZA 3TX0A 3IWLA 3BKFA 2F40A 3CCES 1HS7A 4AT1B 4P2MA 2CXEA 3P5TL 1HD1A 2HGLA 4PRFA 2UUCF 3DGPB 5C8YE 3POTA 2V8PA 1WDTA 5FNVE 3SOLA 3AE3A 3HVAA 2OIHA 3ZYLA 2CMRA 5JVHQ 4WP3A 4OZNA 4CNYA 3OLAA 1RTJA 1RHRB 2D74B 2B9WA 5JRCA 2AEJA 5T7LB 2ZNZA 4LFBT 3HT3A 4A8SA 5GAEU 5CQGA 2CBIA 1Q86T 1Y5NB 4EIWA 3T6JA 3TUZC 3PVXA 1W09A 3PIPQ 4RNOA 2OMLA 3V6KA 5C24B 2RIJA 4K0KJ 1S10A 1UVLA 1WC3A 3CTRA 4BJMA 4LF4F 1OYDA 2ZH2A 5G0RA 3HHKA 4Y2CA 3LGNA 1QUVA 3Q5XA 2QFJA 4F50A 4YJ2E 5FLXU 4DV0T 1MNEA 4WFBQ 4TN7B 5LOQA 2LSJA 4QYRA 1JKHB 4HWHA 2XSFA 1TQLA 1RKIA 1YK9A 4ZXLA 4DR1F 3NKZA 2WCAA 1H3DA 4Q43A 1NB2A 1MU2A 2WVDA 3E08A 2J62A 4ZVPB 4U31A 4C0OC 5CFBA 3MCOA 2LU2A 3UFCX 1U24A 1SJ1A 4PQUB 3MM9A 3OUYA 5EWFA 4C8YA 4DSJA 1F9FA 1S72S 1KNRA 4AIUA 3P45B 1X9MA 3QRQA 3AB3B 3OTBA 1LFPA 2HHHJ 4JI2T 2RB7A 4OV6A 5BJRA 2CNOB 1NK4A 2G0IA 2LE8A 4M5JA 2W9CB 1G73A 2CA9A 3E01B 3L4BC 1VIXA 3QOFA 3P8BB 4RW7A 1B64A 2G0CA 1IKVB 3P4QA 3W3SA 3K5OA 4A47A 1TZ0A 3FQLA 4XO0A 4NLUA 4UOHA 1QSLA 2XHCA 4OLPA 2Z2MA 1LWEB 1ZM2A 2R7XA 2E2AA 2J5AA 3RW7A 2EVZA 3GV8B 4ZLLA 2H1YA 1K8AT 4NXNJ 3QGHA 2C2ZB 2AV5A 5KFFA 4ELTA 1R8BA 1YJRA 3A1YG 2EHOC 4ZA1A 4QPTA 1OQ6A 4LFBF 3GLJA 2YKMB 3OT9A 3C6TA 5HBMA 3V6HA 2LM2A 3DRPA 4OFZA 4MKYA 4Q2MA 5A0YA 2FC9A 1VLOA 2VZ9A 5LCYA 4X2BA 1FFSB 2M8DB 3W2WB 2FZCB 3ENWA 2R42A 3VAGA 2HHPA 1X4DA 2CQGA 1AFJA 4I2PA 1UFKA 1NJWA 2FHJD 4R5PA 1HBNA 4QOTA 1YQHA 2C2MB 4A97A 2CUYA 3OTDA 4DX5A 4I4BA 3NBPB 4FF3A 3MAAA 4EUVA 3C15B 2LCWA 1BUXA 2MEWA 2VPZB 3I0QA 2H5IB 2XM2A 4KX6A 4UR9A 1E6VB 1XIQA 2V94A 1WC5A 3ETOA 4PG8A 4DN0A 1F5CA 2E5LJ 2A72A 2RU3A 2XAJB 1VFJA 2CKWA 2M88A 2QMUB 2KVQE 3CVRA 4GKJT 1FMWA 5HWXA 2W2OP 4QXCB 1R43A 2WS3A 3PRBA 4JI2F 3J7A1 5L39A 2W01A 5B0GA 2DNYA 3NGDA 3MTKA 3VGUA 2KMFA 3B78A 3QB5K 5FKYA 2YDRA 3V6DA 4LF9T 2GO8A 2IC3A 2YKPA 2F3JA 1TL3A 3JSMA 4EBCA 2B4OA 5JH7E 4ED0A 3I0OA 2XEXA 4ZZCA 2VG7B 4LFAF 4JI6F 3Q83A 2IM0A 3M8WA 1IJ6A 4CO2A 1U2FA 1KLNA 2QYCA 1WKLA 3PURA 3WBZA 3M2RA 5I3UA 2OPRA 2ATLA 1HNXT 4DJBA 4A98A 1WTBA 1MWQA 5HMZA 1M62A 4RW6A 2V8VA 2MTQA 3LSVA 2DIVA 5F41A 4GVLA 4KPCA 5D6GA 4IREA 3TAQA 4BLGA 3M32B 4ERDA 2PO4A 2LVWA 3K7RA 2ZFHA 4J7CA 2OUGA 5AQGB 4EBDA 4MT1A 3N9MA 1QM9A 4CXYA 4EFAC 2H89A 5KFDA 4HWCA 5IZHA 3P49B 3ZC1A 1RT2A 2OSRA 3MURP 4RU2A 3AECA 1CVJA 1C4AA 3EMTA 1Q7YT 3DMJB 3P4PA 2MY8A 3SEOA 2N82B 2GMHA 4DV1T 1RAIB 4EI2A 4IG3B 3PYGA 2MZRA 1D0YA 2VQFT 2NTYA 2P2CB 1NUEA 4ES2A 3AOAA 5C7PA 3RUBL 3WHIA 4O0IA 2LYVA 1KP6A 2HQFA 1KDNA 1PC5A 4ZVEA 3TZXA 2N7YA 4G1QB 3MEDB 4KUMB 2FLNA 3MEGB 5EX0A 2CWKA 4UV9B 2CDRB 4LBHA 2DNQA 5ETQA 3V5RA 2XMJA 1HD0A 5HLFB 2Z8QA 1TFYA 1WD6A 1OWAA 4P0AA 3J9X1 5LHHB 1RK8A 2YY3A 5L1JA 3DXBA 3OQ2A 4JEHB 1NK5A 3DRRB 1H73A 4ZVSB 4HH1A 2R3VA 1NNDA 2V5DA 3VQSA 4PUOA 3FSIA 4UQGA 3EVOA 2EK6A 2MYFA 2QLXA 4LF9F 2YKAA 4OI6A 2VG5A 4HT7A 2XG8A 3HKCE 5C2GA 5C5JA 3DLEB 4IDZA 2XGQA 2EW9A 1J5WA 4JI8J 1HMVA 4AD6A 2H51B 5J2MA 1S76D 1US7B 3LP1B 1FEWA 4OZ0A 4WZQA 2WBLA 1HNXF 2MB0B 3NCRA 2IM1A 5F8GA 5H9EK 3MTJA 2V2KA 2CCQA 4QWEA 3ZC4A 3C14A 3FXDB 1T9WA 2O01C 5KMGP 1CJTB 4JI7T 2UU9T 2CHNA 2E9ZA 2D3O1 2PI5A 3HKEE 2Z58B 4LF8T 5BYRA 4NA2A 4BWMA 2N1GA 2MQ8A 1S49A 3MM7A 3R5DA 3O8WA 4CN6A 3PM9A 4KH0B 4CI1B 4E8UA 3AH6A 4X62T 1N0VC 4ZI3C 2CPIA 1EP4A 1YW0A 2LEBA 1IR1A 3MR7A 2V26A 2HIYA 3M7VA 4K2XA 4JI1F 4FF4A 3A8EA 1RHJB 4DV1F 2I0MA 1M0SA 5AJ3J 1I51B 3DLHA 5E0OA 3F2EA 3N5FA 2IUBA 3Q8SB 5LSLA 4RX6A 5A2QU 5HYAA 1YITS 4DV3J 4QYZJ 1Q8IA 2FHOB 1N5YB 2B7BB 1N88A 3CMLA 4DSIA 4ZOLE 3CJ5A 2QLWA 1E2AA 2O66A 5F8LA 2Y0SD 3Q86A 3CCSS 3NNAA 4C8LA 2R7WA 3H2LA 4N77A 3PCOB 5E3PA 1HNWJ 3IHRA 5FDLB 2W4DA 3AHPA 2X0YA 1CG2A 4O3QA 4DBQA 5D0HA 1L3SA 3AJDA 2HAIA 3KMSA 2VJVA 3F56A 5BMVE 1UWBA 5CGMA 4ECTA 3KBTA 2MHEA 1X5OA 2JRKA 2FJAB 5KOXA 4AQYJ 2V8GA 3DDIA 5KG5A 1WEXA 4USUA 4QWBA 2FVSA 3UUNA 4NCGB 2XY5A 3KLIA 2GQQA 1CS4B 3OFFA 4ZCKA 4V1Ak 3CCLS 3C8YA 2KL8A 3CWJA 4RZRA 3PFOA 3G8TA 2PD1A 3A3OB 3GFYA 3NG8A 3OR2A 4B3SJ 5L9XA 4LIRA 2HHQA 2HHHT 4JI7F 2UU9F 5A8KB 4B9LA 3FVYA 2HVDA 3JSBA 4Y2KA 3ZTSA 5EWGA 1NM2A 4FNHA 3UNYA 4I7FB 1D8ZA 1TVRA 2DH7A 2RAQA 1SJRA 1DY3A 3IBFB 4M5DB 4EAHA 2CJXB 4IOAQ 2RUGA 3GN5B 4X62F 3KHLA 3CCMS 5L3EB 6FDRA 3TA2A 4HI2A 2YNFB 2ALZA 3N6NA 5FY7A 3FMBA 4A8MP 2CQHA 4X1KE 4C98A 4M1PA 4OX8A 2Z2ZA 5BR8T 2BRLA 2MDAA 4NXNT 1F60B 2P9GA 1N34F 2CRBA 3RRWA 1ROFA 1U26A 2W9BA 4KTQA 1UVIA 1FKPA 1YDLA 2FDNA 3DKDA 3ELHA 2QIFA 5HEHA 4DNDA 1XR7A 3B6BA 3BSCA 2R9LA 4NLSA 4OX7A 3PTRB 3JC6C 4ED6A 1G6BA 1ZETA 4NCBA 1Y01A 4ANJA 1RLCL 2NZCA 4HTEA 1JLGB 5DQVA 3J81Y 2DGWA 1YJVA 1J5OA 3UVJA 2G4BA 3PG9A 4LBIA 2KN4A 2IA6A 1NDPA 2HPLA 1PBAA 1TELA 4DR5J 3TX8A 3RYHE 1AUDA 3VAKA 5KFZA 3KK3B 1IBMJ 4CI3B 3FCWA 2KG0A 3FZBA 5DDOC 1DLOA 1Z0PA 3SXLA 2IVMA 4FP9A 5AQHB 4GKKJ 3GSDA 2C28A 2X9WA 3C98B 3QJLA 1VRUA 2VKOA 5BYSA 1P6TA 2N7CA 3CIMA 2KH9A 2ZBRA 3VZHA 2E5LT 4N76A 2JQKA 5K20B 1HFAA 4HYKA 3LQVA 2E29A 2KG1A 2QG9B 3QT8A 3J80Y 4MK9A 2A2CA 2LKHA 2E5VA 3ZNUA 1JLQB 5RUBA 1SQGA 4FBTA 1YBTA 4M8LA 1HHSA 3LDQB 1MMAA 4DF4A 2RKIB 2DLRA 1HPZB 2V8DA 4CQIA 4P52A 3AA6B 1CC8A 2C3UA 4TY8A 1YRTA 2DNMA 2BJ7A 2ZZTA 5E7OB 1WFDA 2E5GA 3JAMU 1VQMS 1OSDA 2YU2A 4J5OA 3NNCA 3N9LA 2CWOA 4DV2F 4GOUA 2DHAA 5C25B 4O2AE 1S9FA 4GO7X 3Q8UA 4JV5T 2J0XA 5FLXY 2X68A 2X1BA 1UEVA 1KHWA 2L48A 4DR6F 3HKBE 5BR8F 1NENA 3AAAB 1O0PA 5IV4A 3GV7B 1SL2A 4RBVA 1KQSR 2NWBA 2J6SA 4IRCA 1PKUA 1R8AA 1Y5IB 2RHQB 2RQCA 2ZH3A 2R8JA 1JB0C 4K5RA 3C19A 3JTOA 4DL4A 2BG9B 3DOKA 1UFLA 4X1YE 2C5IT 2XULA 1HW9A 1URRA 2OP5A 4NRUA 2AYMA 2BBEA 2IVFB 1T05B 3W66A 4FKXA 4PWWA 4PWUA 1JIHA 2NUUG 3TP2A 2KVIA 1B7TA 2VUGA 3DHWC 1N54B 1XNRT 2XMUA 1NB7A 3GJRB 5HQLA 4ECQA 3BSAA 1GK8A 4B9TA 2DXEA 3A3PB 3TOQA 4HFHA 3I56S 2OFHX 1PAEX 2HZVA 4YTMA 4YP3A 3D7SB 3FQKA 3VCDA 2E5LF 4DL5A 3HI9A 3RG6A 5KFMA 3HK2A 4GVBB 4F2SA 4CT9A 3OSNA 2D0UA 2MZQA 2HNDA 1WF1A 3R2CJ 4ZVOB 3G96A 4EYYR 5THWA 4Y0FA 1YJWS 4O3SA 1T95A 3RHWA 1S1TB 1G7CB 3PW7A 3EABA 5HI7A 1SV5A 2RP4A 4N41A 4NLGA 2J7WA 5ABFB 4OZJA 4ZI3D 1IXKA 2PGCA 3N5LA 3TR5A 4DXLA 1N4LA 4LSLA 3ILOA 4LJMA 4KFBB 1TP7A 3EGNA 3JQMA 4XDDA 3PJAA 2UVWA 4ED8A 3KJVA 3KUHA 4P74A 5L4HA 1T7SA 2IYGA 4JV5F 3D2WA 2EEYA 3QYYA 5DABA 4S0MA 3MI7X 1PILA 3M6UA 1HQUB 1JLEB 1QSDA 2LM9A 1S1VA 3HHLB 4UOFA 2XWXA 2HIQA 3ZNJ1 2YKOA 4L73A 2RS2A 2JL9A 4WFYA 2MKSA 1FHTA 1MIVA 1T9TA 2B6AB 2PE8A 3AD8C 2VKZG 3CJQA 1BD6A 1EZ3A 2QA7A 4ANDA 4ANCA 4DR4J 2DR7A 3TUPA 3FSXA 4B3OA 2XYHB 1XWLA 2LRKA 3R5BA 2LRLA 2C42A 2JQHA 2X7IA 3I87A 2XSJB 1HARA 3D6FB 4QXHB 4ZPTR 4AXPA 3CKDA 4IH6A 2PI4A 4IDQA 1H2TZ 3FK4A 1XNRF 4X66T 4B17A 4GYSA 5LSOA 4EBEA 2CVEA 1Y10A 5EX3A 3A8IA 3HR0A 4EZ9A 1VRQC 4IDNA 1H6KX 3OL7A 1DTTB 5KG1A 3P7IA 3PUAA 2CXFA 4HLBA 1REVB 3GFXA 1S6QA 1CQMA 1KQFB 2BR0A 4RBUA 1A7GE 2CQ3A 1AFIA 2VK9A 4OZ5A 2POKA 2KO1A 5L46A 3B4DA 4TZ4C 1KK7A 3I9WA 4ALZA 1HG5A 3L7UA 2KM8C 5L9NA 3RQUA 4HDGA 4NMXA 3AEBA 3IWXA 2ZH5A 2VU5A 1VBZA 2D9PA 2VVSA 1WORA 4HEA9 5LHGB 2BDPA 1S7IA 2LLYA 4YY3T 4HE8A 4QIFA 3Q9DA 3G6ES 1S1UB 1X5SA 2X66A 2OH2A 5A6PA 1ITPA 2CXLA 3GILA 2YKSA 4U95A 4PCQA 4P71A 2Y8YA 4RNMA 3D9BA 4M5MA 4HDHA 3MWBA 3UULA 5KFCA 2WSEC 4DFKA 2UUWA 3OFGA 1WR0A 4YOEA 4F04B 4K4ZA 3GCWP 5A8WA 3M3ZB 2IHR1 1UJ4A 3I0RA 2GVDA 1WLXA 5ETOA 3LG7A 1VLYA 1I94J 4B3ST 2DI4A 4FNIA 1U45A 2J76E 2C2EA 3IWNC 4KHPJ 4A8OA 2LSIA 4PNIA 1UZHA 5D8HB 3H4BA 4Y2IA 4I50E 2G2YA 4Y28C 3RRCA 4MAKA 1NO8A 2R7UA 2XJ7A 3FBBA 3TLWA 3CD5A 1X9BA 3WI3A 4X66F 4IE6A 1BWVA 3HHEA 3X3UA 4UOGA 5AQPB 4R0JA 2JC0A 2XQAA 4NLVA 2BS4A 1EAYC 1HKAA 1NSAA 2WQYA 2MKIA 3F73A 4CLTA 2C1EB 3SBMA 4HACA 3ZZTA 1NDCA 1M5PC 4PYDA 2OLWA 2CQCA 4MKAA 1NMEB 1SJ4P 2EFPA 1FTRA 2FUPA 4QWDA 3M1VB 4ILCA 4QIGA 2PMWA 1FX2A 4HWDA 4H54A 1IWAA 1VQSA 1YKWA 2QMXA 1RHQB 1UKUA 2CQPA 1KSPA 3VTIA 2O1PA 2F1FA 4TYBA 1UTAA 4YSZA 2ZH7A 5LYJE 2R7OA 1CULB 5KX5E 4ID8A 2J9EA 3CPWR 3M8QB 2IAJA 4DR5T 5LBQB 1U2CA 4NEYA 2C22A 3FGVA 2BJ3A 5H1SV 4YY3F 3K17A 2MQNA 2IYIA 3UWTA 4WBNE 3DM2A 1UAWA 1LWCB 4NI2B 1YTYA 3UCUP 1OY9A 5I4MA 2B3TB 2DWKA 3I0SA 3ZFVA 3MZIA 5KFRA 3CJSA 3M2VB 5MLCV 2R7RA 4H4OA 4ZP8A 2OPQA 1YKHB 1SH2A 2OPPA 4DIDB 3TAMA 4ITSA 2AJ2A 4WBOA 4ED7A 1NKBA 3FBEA 1HR0T 2PT0A 3T6BA 5LNKA 3KKFA 2XHEB 3N4WA 3N79A 5HK4A 4B9MA 4B3SF 1CC7A 2IMLA 3UD5A 3CXCR 3NL0A 4ZS3A 1XN9A 3G6YA 4K4WA 5E5NA 2LEAA 2IDLA 2W8LA 3WX4A 5HEUA 4FXDA 3NGKA 4FF1A 2I38A 1XK8A 1F5BA 4ZN3A 2YNHB 4WP8A 3I31A 4AI6A 3CB4A 3W63A 1KHVA 4QW9A 4Z7CA 3GA8A 1ZZFA 1S79A 1RQ0A 4FPIA 2X1AA 4J9NA 4DV7J 2HG4A 2R2RA 5AXLA 5FVLA 3ET6B 3PNIA 3EICA 4RUAA 4NZ6A 2VKJA 1F6TA 2W0GA 2YNIB 2F9DA 3JS9A 2XB2D 3PDNA 4IG0A 5U47A 3IRWP 2OKQA 2E5HA 3ILIA 1QDUB 5J2QB 2ERRA 3FBFA 2KTQA 2RQ4A 3DGPA 3BR8A 4K50A 1IBKT 3LPYA 1RAFB 3DNCA 1CEZA 1YVFA 5LXYA 4JI4T 1PGZA 4DR5F 3M8PB 4U72A 4C8KA 2JWNA 2KU7A 1VOMA 3PX0A 1I5OB 4AXJA 2J9DA 3GIKA 5KFSA 2V6AA 3AE8A 4WBFA 1O3XA 3GFHA 3BB5A 3R8YA 5C24A 4O8SA 2HQGA 1NZ8A 5B0CA 5M4YA 2E7VA 7AT1B 2W63A 5KFBA 3D3BJ 2V2ZA 3ZTPA 5DG8A 1BC6A 3RKOA 2HGNA 3VAIA 4L3KA 4TWDA 3UD4P 1Q7LB 1VIOA 3ZMSB 5IWAT 1HR0F 4OYBA 3DYAB 1JKHA 3B82A 2OD4A 1S6OA 4GK0E 1WDDA 2C2OB 1RCOB 4W90B 2ACZA 3QLHB 2XY8B 5IOLA 3GJSB 3PJ9A 5KFAA 5DRKA 3ITHB 3M9OB 3H37A 4PQUA 2WVCA 4PXDA 1WOPA 3RPUA 2BBHA 4ZVRB 4XTTA 3P6YC 3BBBA 3TARA 2E9TA 3ILLA 4LR7A 1ZM4A 2Y6XA 1M90T 3PZPA 4H9SE 1KKHA 2L3MA 3B4MA 3AEFA 2GNKA 2W9CA 5ETRA 4R25A 3Q8YA 2XYPB 3E01A 3LOUA 4Q8FA 2CIMA 1F5AA 2D3UA 1IKVA 5CYMB 1HQ2A 5EGYA 2ZM6F 4HN9A 2VFRA 3W2VB 2GGPB 2WAQD 3BGLA 4DSLA 1FEEA 1LWEA 3KLEB 3JQJA 3EI0A 4NLXA 1SI9A 1OIAA 3OR1B 1EQMA 5IV3A 5KG3A 1TKZB 4CLUA 1IBKF 4DSKA 1O8BA 1EX8A 3UTKA 1G8XA 5GAEI 1SA0E 2UVUA 4JI4F 1S1XB 1RWMB 4MMOA 3J7ZT 3SV4A 3ANWB 1VQ5S 1HF8A 2YKMA 4ELUA 2QN6B 1U25A 3OJSA 4OHVA 5IT9U 5FL0A 3KLHB 2HQIA 3PO5A 2DGQA 3CJ2A 3DU6A 2BKOA 2Q66A 1VRTA 4Y6IA 2GHWA 5KFVA 2D9OA 2IIHA 2VHGA 1IAPA 2WY2A 3M6VA 3W2WA 3ZMTB 2CQ2A 2UUAT 2CVIA 2DD8S 3IMQJ 5C2TA 3PUSA 3MF5A 4YHHJ 2EK1A 4CDIA 1NRKA 3N9NA 3GTYX 1T8EA 1IKYB 3NBPA 5IWAF 4IR9A 5JDQA 3C15A 4MBQA 3R84B 3G9CA 2DTJA 1CSJA 2W7AA 4A8QA 4WE1B 3C16B 3TVZA 1QY7A 1LWXA 1E6VA 2F7VA 3EWGA 2ZH6A 2V4RA 4J90A 1VQ6S 3GU0A 2VOOA 1KFSA 2Y3YA 2FLLA 4Y00A 4X64J 1HL6A 2RMLA 3H20A 4RUBA 5KFHA 2WWUA 2GJFA 4EZHA 5KDMC 2ZVSA 2WZ1A 1DFDA 4Y34A 3Q2SC 4ZHRB 3SMZA 2F8MA 4HTJA 5M2RA 2EC0A 4ANEA 1XJWB 5DJQC 4CIOA 3FUYA 2HHVA 3GYXB 2Q79A 2W9AA 3AA1B 2XSAA 2DEJA 2QX0A 1K0TA 1PYTA 4IGUA 4NA1A 1I94T 1PAUB 1RISA 2M5YA 2VG7A 1APSA 3BPDA 3IR7B 1A0OB 3HJFA 5LGTB 2E5IA 2HW3A 3AY0A 2MTLA 2KHDA 2XC9A 1B0TA 2GA7A 2XZEA 2IJNA 1ZTTA 3MM5B 3N2KE 4TX5A 4LSNB 1WUUA 4DSFA 2L41A 3M32A 3R6GB 2YINA 1ZM3A 5LBMA 3T41A 3BGOP 2RDDA 2DH8A 4CZZB 2XQYA 2EKNA 3UDLA 1Y5LB 3CD7A 1IJEB 4PQAA 3FRYA 2P5VA 3HDSA 1RAHB 2M52A 2UUAF 4A48A 1VQ7S 4ZLNA 2H48B 1UVMA 5J0ZA 2CPTA 1GMVA 1QLNA 4WK1A 4CO1A 1NPKA 2FHJA 3DMJA 4X20E 2IDOB 3D6TB 1RADB 2FPHX 3MOJB 2KDOA 4RWWA 5JJBA 4RUCA 4OJGA 4IG3A 3MJXA 2VL8A 1LW2B 5KFGA 1REGX 1BQXA 4BCAA 3OFEA 3IG1B 5IT4A 5CZXA 3CX7B 6FD1A 5F3ZA 4QX8B 1RWOB 2PN6A 2X9HA 1Q95G 4B3RF 2JRSA 3WAKA 4G1QA 2NYIA 3MEDA 3SCKE 4QH4A 4UVCB 1YZ6A 2CYYA 3PUGA 3GB0A 3MEGA 2VBYA 1FMVA 4PG5A 2EBGA 2BM0A 2FIUA 4NLDA 5HLFA 4O4LE 1RT5A 4Y2MA 4AXIA 5FMNA 1Q16B 2V6YB 4JI5T 2EBEA 3MUTP 3AE7A 4DWIA 4KMCA 2E9XB 3DRRA 2C2RA 2BVMA 5HWYA 2V7IA 4H4MB 2BJEA 4JEUB 1C0UB 4G2AA 2QTWA 3D28A 5FJ4A 4RR5A 4LR9A 1HYSB 4LMJA 4DMVA 1KQGB 2EHOB 1RWWB 3Q5EA 2AJ4A 1X9WA 3TNVA 4DUZJ 2OELA 2X3GA 3DLEA 1D3WA 4BBYA 1U8SA 1W2IA 4Y3CA 3NS5A 1JX4A 3MK7C 1I94F 4HFDA 3R7SB 2BE7D 3EE3A 2G1HA 1LXNA 2KKHA 4M1KA 3TJ8A 5DGAA 4JYAJ 2XUEA 3LP1A 2MZ1A 2HHUA 3H40A 5L3DB 2YXLA 1H2UX 2ASYA 2PFVA 3MMAB 2DRBA 1J5EJ 1IBCB 1E1HB 4IFYB 3LO3A 4ILBA 3BN4A 1FNOA 3S01A 2D7SA 2FY1A 1RT4B 4P7TA 2VG6B 1CJTA 2JQ9A 3O1IA 4DV7T 1HWKA 2JVOA 3MR6A 3PUZF 2V7KA 3E22E 1UWAA 3GJTB 2WBMA 3IA0A 4DS5A 1D8YA 3GYGA 5GAGI 1BHNA 4F4KA 2ZNYA 3ZT7A 1RT3B 2CM0A 1W2BR 2R7QA 5GVQA 1Z2ZA 5ETVA 4TN2A 2KI2A 1HI0P 4AKLA 1ZPWX 4YEAA 1RAAB 3RB3A 3BKTA 2VFVA 2UV8G 2FD2A 4LBPA 3MFHA 1N5YA 4QPXA 5K5MA 2O5DA 4G1IA 1KVIA 2VL0A 2M8HA 2QJ3A 1DHMA 3AXJB 1M1HA 3V5SA 3BEGB 4F67A 3D5MA 2YVSA 4JI5F 4QKNA 3LP2B 4O4IE 1BE4A 2QV6A 3ZZRA 4OZLA 3BO4A 1WG5A 3AE5A 4DCPB 5FDLA 1XDOA 4CI0B 2OD6A 4JUYA 4DUYJ 3U1LA 1SE7A 1BY9A 3WC0A 3OYZA 2JEJA 4QX7B 4EZ6A 1NH8A 2VOPA 1VBXA 1N0UA 1WC1A 4OZ2A 1D9DA 4P2XA 4MIAA 1Q81T 2GHPA 2A18A 2FJAA 3P4UB 2YEVC 2Z2YB 2K3WA 4LF6F 2HK2A 4DEZA 4NCGA 3J7Yq 4L6V3 4K2JA 3OVSA 1CS4A 3HM9A 2NXEA 3N2OA 4UV8B 4EGWA 1UVNA 2ZJQQ 2PG8A 2GJ2A 2GFFA 1AUSL 5CHCB 1NEEA 4O4HE 1FJ7A 2F4VT 3DLKB 4KSEB 3L8RA 5A8KA 5LGUB 2D41A 2MPKA 1N5TA 2R7TA 2DNOA 2FJWA 5FP3A 4DV7F 1QTMA 4RPFA 4RLEA 2UP1A 1Q4RA 4PXBA 2NYHA 1Q8BA 4I7FA 4DV4T 4ZVGA 2M70A 4O3OA 1YRUA 2LECA 2L9QA 1XC9A 4M5DA 1VQLS 3PEJA 5JR9B 5CD4H 3GN5A 1Q0NA 2LEPA 2DL1A 3VVTA 2AKWB 4PABA 4LF4J 4ZPVR 4O4GB 2YNFA 3KHRA 2UXDF 3KOAA 2K48A 3BQLA 4ATNA 5J2NB 3UUXB 1HNIB 2K5BB 1NCLA 4NLOA 1UVJA 4N5SA 3K57A 4IE7A 3RH3A 5J2UE 2FJBA 4YB6A 1SC4B 2Y48B 5K8MA 3HSZA 3HHDA 2YNGB 2IW5B 4DR1J 1K44A 4EZ4A 4B9SA 2B76A 3UE2A 1ZP0A 1N52B 3PUYF 2A9UA 2IIUA 2NOXA 5DM6Q 1DQ8A 1FIOA 3KHHA 4CM2A 2VKDA 4TYAA 1O51A 2KFYA 5LMNT 5KFQA 3EYZA 3G6XA 2ATCB 1JLGA 4PEOA 3NGSA 2JJ9A 5JUMA 3ENVA 2FY8A 2XS2A 4DPUA 3KVAA 1I6JA 2MKJA 3ZCJA 1DJ0A 2CWXA 2CPZA 2CPJA 3KK3A 4YHHT 1S77D 3AVSA 2JX2A 4ILLA 4V19J 2J0QD 4CLLA 3HFKA 4P09A 4P72A 2A3DA 3LWLA 5LHIB 3IC1A 4IL9A 2DGXA 5CJ5A 4H4KA 1H0HB 3PYEA 1NHKL 2UXCF 5HMWA 2JVRA 5FIIA 2MZJA 2W24A 2YPYA 3GYNA 2X9XA 1RAJA 3CJTA 4A8YA 3PR4A 2CWYA 3EX7B 4KI0F 1UETA 3MFIA 4IE5A 2F4VF 2FBWA 3VF0B 1F1BB 1JLQA 4I56A 3THTA 1TV6A 4I68A 3KJFB 4U7UD 3OPCA 1KNPA 4O3PA 3TUIC 3T3FA 4PG7A 4DV4F 2RKIA 3ZT5A 2PDAA 2MSSA 1HPZA 2HVEA 4TV8E 3GZ7A 3QAUA 4F0MA 1U1LA 4Z37A 2ZKUA 4F0KA 5JTGA 3HPOA 1EIYB 1Y4ZB 2JEGA 5C25A 1MROB 5LSRA 5A76A 3BQKA 3K3NA 2BKPA 4OX9T 1U7LA 1Z2LA 2EFNA 1J27A 2GK9A 3TLSA 2DR5A 1UJ6A 4FF2A 2LJLA 3DOMB 4L5GA 1RLDA 1FRIA 5J2PB 3RC8A 2Q9QB 2MQOA 3HLUA 2HFOA 1UL3A 3RGLA 3AE1A 3JB9k 2MMYA 3BBCA 1R6VA 2FZGB 3MMCB 3CMAS 2L08A 3B54A 5LJNA 3KDNA 5LMNF 5AXNA 4WKRA 1RSCA 2HQDA 3MZKB 2AX0A 1WYBA 2BG9A 4C6AA 3MEEB 4TVAB 4PPDA 3IP0A 4OI3A 2BRKA 2XY7A 1T05A 3W60A 5C2CA 2JH3A 4JI2J 1XZYA 1RT6B 2HEKA 2LSKA 5LJ3Y 3ONXA 2QEXS 4YHHF 4HFIA 4ECSA 1UP1A 1VJWA 3TA1A 3DP7A 2ZBCA 3MPYA 4EWTA 3GMGA 2BDEA 2ZM8A 2O67A 4UY85 4RO0A 4B9UA 4LFAJ 4JI6J 3H90A 4P75A 3RJMB 4XPEA 5KFXA 4ZZBA 1UZDA 4GVBA 1S0MA 4C2MA 2BE9B 4GRSA 1GFWB 3L39A 3LP0B 1AROP 5JDMA 2DRDA 4CO4A 1CJUB 2B8PA 2K06A 2UVRA 1X5TA 3R7BB 2B9EA 3R1LA 1S1TA 1EETB 2XI2A 3K5MA 3PUXF 5DDRC 3ZN0B 2QL9B 3AAEB 5ABFA 2WONB 3MM8B 5IT9Y 5IC4B 4AQGA 4K4UA 2OSQA 3HFZB 1Z8UA 4KFBA 4PAAA 3BPSP 1IBLF 3P5BP 4WK3A 1SIZA 3AODA 3JCFA 5DDPC 3D6HB 4FVCA 4XK8C 1P8GA 3P4RA 2CJYB 4URGA 5IFMA 3FZFB 3W62A 3SV3A 2QO3A 2LKGA 1N56A 1BQMB 1HQUA 1JLEA 4UVBB 4OX9F 5E3RA 4TUYE 3HHLA 4DV6T 4F26A 4MLKA 4PR6A 3M8SA 4I6WA 4OHFA 1J5ET 2EXUA 4EEBA 1FX4A 2B6AA 3PDYA 4HH0A 4H9OC 5KT2A 3RIAA 1S35A 2XBPA 4RKUC 1BWEA 4M63A 4QBUA 2YN6A 2XLIA 3CJKB 2IY5B 1FERA 2XSJA 2H4WB 2ACXA 2HBQB 4KY3A 3TYTA 1MMLA 1XMOT 1U49A 2AE9A 1HCIA 2GIFA 1KQKA 2Y1IA 2DGVA 1N8RT 4HT5A 1RTIB 1JQGA 2NLWA 3A8KA 4EXTA 4ED4A 1KF6A 4GYRA 5HROB 2DR9A 3PKMA 2Q6CA 2ZH9A 4WYWA 1DTTA 4UT4A 4KHMA 4WU2A 3CDAA 2V5HG 2IM2A 1R0BG 5KG4A 3BSNA 2LU1A 1REVA 4DR7T 2HWIA 1D09B 3G8SA 2E1RA 1FRJA 3OTCA 5JDNA 2PTFA 1YJ9S 4DL6A 1W7WA 2L9WA 4OI2A 3CK6A 3G82B 2PBIA 1HNXJ 4BA9A 2XY6A 4C4WA 2X1FA 3G06A 4EMDA 3EVMA 3ZPOA 3IAM9 2B5JB 3FNNA 2FVRA 2VPXB 4C8NA 3KV9A 3CULA 2DHXA 1R3NA 2UXBJ 4DUYT 3QGGA 3A5XA 4GC6A 2ZH8A 2XMTA 1OEDB 1ZZNA 5HAXA 4KO0B 4RJVA 1Q1KA 1FJGT 5HMXA 1S1UA 1X9SA 1KBRA 4ZPDA 4AL7A 5L8RC 4F6RC 3ABVA 3AAIA 1SL1A 1TFWA 1T03B 2V69A 1NDLA 3BQ1A 1YLXA 4WIQA 2ZDPA 2KXHA 5ADXL 1FRXA 3EDVA 2BOPA 1XMQT 5EN1A 4JI1J 4DV6F 3FKBA 3EDRB 1U6BA 3GG1A 4DV1J 3T5JA 4I0UA 3KLFB 4H63H 2QGFB 2CBJA 5KFWA 4CH7A 3PV0F 2QA2A 5EK2A 4DMZA 3CO9A 4E7ZA 3ISNC 1PJ7A 3UO0A 2WAUA 2CNLB 1H7WA 2V2QA 4HHHA 4ECUA 2XQ3A 1Y00A 1T3NA 1XMOF 4LF2A 3N0VA 5JDHA 3VU7H 2ZJRQ 2Y9HA 4O3NA 3ZSTA 3ZZZA 4PJJA 2UVVA 1UEUA 2A2FX 1KTVA 5CH7B 2XTJP 3DOLB 2Q6BA 2LLZA 2Y8DA 2P9BA 2CQ4A 3CUNA 3WIVA 2C5JA 3HULA 2M0GB 1LW0B 4DR7F 5CYQB 4IRDA 4CWBA 3M1VA 3CSKA 4H9PC 2V1DB 5DG9A 4DFMA 2DK2A 2AMCB 4IO9Q 3ILJA 4JI3J 4ZMMA 2MAWA 1WHWA 5DQHA 3NCQA 2LEHA 1CULA 3M6XA 2MQQA 3M4XA 4ZVQB 3M8QA 2HFSA 3UN2A 2HRTA 4DUYF 1WF0A 5J1NA 1DBDA 2UU9J 1QJHA 1U1KA 1YBUA 3JTPA 4J2CA 1B7YB 2R2UA 1PCAA 2YWHA 1HHQA 1FJGF 1LWCA 3V2UC 3RAMA 4MIWA 5CA1E 2F8HA 1S94A 5LB7B 2CLYB 3TAPA 3LFMA 2ZOFA 3M2VA 2ZEJA 4AISA 4CH1A 4DMWA 4X62J 4Z91A 2ZBPA 1T02A 3CJ8A 1L3VA 3HMJG 4G6VB 1A6LA 1XMQF 4X4QA 2BS2A 1WHYA 1IQZA 1KEKA 3UNGC 2GO9A 3AAWB 4E98A 1OY6A 4F2RA 4BS2A 2DBBA 1LVFA 1MIYA 3UDVA 2DNRA 1N34J 2UXXB 4ECRA 2YX4A 1X4EA 3RKGA 2XMMA 4B08A 3K5PA 3MD1A 1V6HA 3U02A 3NKYA 2VFUA 3ZLIA 2GAHC 2K1RB 3ZC0A 4DR2T 1FJEB 2JLGA 1YKEB 5LXTE 3RR7A 2YNHA 3LBXB 3HI2A 4DLGA 4F02A 3TQEA 1RTZA 2QMWA 2J8SA 4DQQA 3LA0A 5ETSA 5LG4A 2IC6A 2VH7A 2EFOA 2WVBA 5A8RB 2G0JA 5EDWA 4L76A 2CQBA 4ICLB 2BUNA 4P0BA 3ET6A 1X8DA 5J1GA 2YNIA 3DLBA 3ETMA 1UEKA 3O3LA 3GE9A 3PXGa 5KT4A 2ZWOA 2DHRA 4H9RC 4Q2LA 1SCJB 4L72B 2GV1A 5AQTB 5KFKA 2VBZA 2W7PA 3W61A 5J2QA 4DDFA 1J2VA 2HNYB 2WSCC 4N78D 2RDJA 2W66A 2VC1A 1B0VA 4Q7AA 4BWJA 4I69A 4OX6A 1QLBA 3AXMA 1RABB 2XS7A 1JWWA 5DQGA 4M5NA 9ATCB 1D9FA 3M8PA 3HVRA 3E8OA 1IUJA 3NAHA 1TL7B 4X1IE
chains in the Genus database with same CATH topology
4J7CA 3L39A 2BKPA 4L73A 3RBZA 1T72A 4RO0A 3RBXA 4J90A 2BKOA 2AEFA 4Q25A 1SUMB 2OLTA 4L74A 2AEJA 4G65A 1LNQA 4EI2A 4J9VA 2I0MA 3L4BC 4J91A 4L75A 2FY8A 4GVLA 4YS2A 1XWMA 3JXOA 2BKNA 3KXDA 1VCTA 2IIUA 1T8BA 4J9UE 4L76A 2OGUA 4XTTA 2AEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7C A;  3L39 A;  2BKP A;  4L73 A;  3RBZ A;  1T72 A;  4RO0 A;  3RBX A;  4J90 A;  2BKO A;  2AEF A;  4Q25 A;  1SUM B;  2OLT A;  4L74 A;  2AEJ A;  4G65 A;  1LNQ A;  4EI2 A;  4J9V A;  2I0M A;  3L4B C;  4J91 A;  4L75 A;  2FY8 A;  4GVL A;  4YS2 A;  1XWM A;  3JXO A;  2BKN A;  3KXD A;  1VCT A;  2IIU A;  1T8B A;  4J9U E;  4L76 A;  2OGU A;  4XTT A;  2AEM A; 
#chains in the Genus database with same CATH topology
 1TMM A;  3W65 A;  3AE