3NRXA

Insights into anti-parallel microtubule crosslinking by prc1, a conserved non-motor microtubule binding protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
128
structure length
123
Chain Sequence
AALKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein regulator of cytokinesis 1
publication title Insights into Antiparallel Microtubule Crosslinking by PRC1, a Conserved Nonmotor Microtubule Binding Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 123
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1520 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3nrxA00
3NRYA 3NRXA 5KMGP
chains in the Genus database with same CATH superfamily
2E5VA 2C5JA 3PTRB 1HS7A 2PJQA 5ABHA 4DV7T 3RYFE 2CRBA 3C4WA 1VOMA 2UXCT 4MBQA 1VRBA 4AQYT 3C51A 1W0BA 3LK3B 3ANWA 3AE3A 5EZYE 3K1SA 4IDNA 3VR8A 2XAJB 2VVNA 4WZXA 3PUWF 1BR4A 3MXZA 2X9YA 3CQGB 4LF9T 4TN7B 2H7OA 5CJ5A 2VL8A 4KP3C 4IE5A 3RHWA 2YINA 3O1IA 4UVBB 4IIJE 2XPKA 5JDHA 3WAJA 2KXPB 5ABEA 3FBZA 4K0UA 5FNVE 1UX5A 3RKOA 5JR9C 2YDSA 5FYMA 4ZI2D 2YU1A 2WCAA 1XDPA 3HA4A 5IHYA 3AEDA 4LFBT 3VHLA 4ZI7E 5CB4E 2WY2A 3DTOA 3A8YC 2XQ3A 3KFWX 5ETWA 4TV9E 2PFVA 4LFAT 2UUAT 3UFGA 1T72A 3KV4A 5TAOA 2MBGA 4ERRA 2KWIB 4TX5A 3MKDA 3B5MA 3U78A 1BR0A 5ABFA 4AKRB 1S94A 2FJBA 3SRZA 1IBKT 4KHZF 2YK0A 1T7SA 1WYBA 4O4LE 3ZKRA 2ZM6T 4AISA 2LSIA 2BG9B 2BG9C 2IMLA 5C2TA 4HFVA 4DR7T 2MYSA 4XBFB 2HN1A 4ASKA 2ES0A 5AFUL 3KVBA 3ZT6A 5J2TE 3P4SA 2W4XA 3UFEA 4IDOA 3F2EA 3H3AA 3SFDA 2LEHA 2RA1A 2XAHB 2DWKA 2HPLA 3L39A 4PAGA 3ZC1A 4WYVA 3AA6B 3EHZA 2W00A 4EIWA 5LOVE 2DL1A 5ABGA 5H6QB 2P9BA 4A5XA 5AQTB 5EK4A 4HN9A 4YHHT 5HEOA 4O4JE 1QUUA 3PU3A 2H7VC 4H9SE 3UU3A 3NBXX 5AQIB 3E22E 4X1IE 5GONE 3C4XA 2PTFA 5LMUT 4WBNE 4EZHA 1HNZT 3LSVA 1W0AA 1S35A 2BS2A 1OXZA 1Y01A 2LKGA 5AQPB 4AQFC 5CA0E 1J5ET 3BK9A 1ZEEA 4V1Av 2BBHA 2C5KT 5FP3A 2BKPA 2LKHA 3CX6B 3QC9A 2MTQA 3N2GE 3ZSSA 3QUJA 5ADXL 3J9X1 2A72A 3M65A 4PJLA 4GKKT 4H9OC 4IE6A 3MJXA 1SE7A 4QXCB 2IDOB 1HR0T 2ODVA 3C64A 4TUYE 2FUPA 1FMWA 2CXFA 3O1JA 3MACA 3NRXA 1VCSA 1YQ3A 4H63H 4P09A 3TLVA 2JIWA 4L0RA 3AB3B 2XQ6A 4BA9A 5HXRA 3N9PA 2VKDA 3RQWA 2VQFT 5IWAT 4YTMA 5JRCB 5JVDE 3PUGA 4EXTA 3JAEA 2WZIA 2WDVA 4FJOA 1Z0PA 4E7SA 4JEUB 1EZ3A 3EDUA 4H9PC 5LG3A 2CXLA 4L5GA 2NP9A 4JI8T 2FJAA 5HEGA 4ZHQE 4GOUA 4NXNT 5HWYA 4X5TA 2IW5B 1BR2A 4F8HA 3T1HT 3OYXA 1UX4A 4HFDA 4AKIA 2LHRA 2ZLYA 5F5WA 3OPCA 4IL4A 1OEDC 4CI3B 5BMVE 1T8BA 3CMLA 3P50A 2WM9A 4X1YE 4JBWF 4ZEYA 4B3RT 4E7ZA 2OV9A 4OYKA 3RX6A 4IE4A 2NW7A 1HG5A 2AE9A 3D0TA 4DV4T 3VR9A 3QB5A 4ZXLA 1JNZA 3UUXB 4LMJA 5AQVB 4YFSA 4ZOLE 3RQUA 3F57A 4UV9B 5LGNB 2BG9A 4CZZB 2Q9QB 2XQ4A 3LK42 4YLHA 3FZFB 4DV1T 1I94T 4X20E 3P7IA 1CUNA 3T8OA 3ZN0B 1D1BA 5LBQB 4YSXA 5HCMA 5HWXA 2XZEA 2DI4A 4DIDB 4AIUA 1CHUA 5HYAA 1MMGA 5CA1E 4AXPA 4I4TE 4CQIA 4JYAT 4EEBA 4HFHA 3RYHE 3ZMVB 5A1LA 2LLYA 1LKXA 3PJAJ 2W0GA 4LMLA 3AXJB 5L3BB 2KLQA 3GMIA 4LFCT 3KDSE 2W67A 4LF4T 1SA0E 3NRYA 5C8YE 3N5LA 4P0AA 2PBIA 2UXBT 2VL0A 2A3DA 4OHFA 3PUVF 5CFBA 4WNKA 2LT3A 3WAKA 3N2KE 3EVYA 4AQFA 3AECA 3F31A 3LBXB 4O2AE 4EEDA 2Y6XA 5EK3A 3GWHA 4CI1B 4K0KT 2DCFA 4U2YA 2E2AA 3EDVA 4I43B 4DV0T 2J47A 4M1PA 1YXRA 4O4IE 3K3NA 2G0UA 4PK5A 3PU8A 2BS4A 3CX7B 3AEBA 3BQIA 2X67A 1BR1A 4DMWA 2E5LT 4JI7T 2BKNA 2D9DA 4C90A 4YT0A 1U5PA 2WAUA 2L8KA 5JRCA 3P4QA 3B57A 3RF1A 4U2ZA 3AE4A 5JDLA 2EHOB 2KZ7B 3SWHA 2ZM8A 4CXWA 1WFDA 3PUSA 5L3DB 4OYJA 3AEGA 3FBLA 2E9XB 3RRCA 2E9XC 1HNXT 2BBJA 4DR6T 5AQKB 5L3EB 1YKHB 2QA7A 2JQKA 2I59A 5FXZA 3RYIE 1IBMT 4HWIB 3UQ7A 2LHNA 4CXXA 3DJBA 3UU6A 2F4VT 3AE9A 4JLEA 5L2LA 5FXVA 4DBRA 5LHIB 2WS3A 3ETUA 3TLWA 3TLUA 1IJ6A 5CGMA 4G63A 2YKSA 3AE5A 3I1AA 4BJNA 1U4QA 3UU5A 2D0UA 5HXSA 1XMOT 4U7YA 2LJLA 2CWOA 2K3WA 2VKHA 2M67A 1FJGT 3BQLA 2Q9QA 5J2UE 2YN6A 5JDMA 2K48A 3HR0A 4ILCA 2X0HA 2DWGA 2GK9A 3ZMZB 2LOPA 3ZSTA 4DR3T 5FKYA 2V5DA 5L3CB 3I0QA 2JMKA 5LYJE 4JI5T 4UELA 2PG8A 4X66T 2D5UA 1D1CA 3JC6D 4UR9A 1MIWA 3IA3A 4JUYA 3AXJA 4JI0T 3AAEB 1H7CA 3EUHA 4A98A 2XSBA 4OX9T 5LBMA 4ADZA 2VB6A 4KMCA 3AEEA 2H88A 2WSSV 2XHEB 2VK9A 3P4PA 2UUCT 2JMHA 4J2CA 2OA5A 2NW8A 3AEFA 3RI5A 2XQAA 3L8RA 4DV5T 5JDFA 3LBXA 4YSYA 4HWDA 4TNVA 2CWYA 4COFA 5LGUB 3N9OA 2X9XA 4H9RC 2XJ7A 3AE1A 4YHJA 4CI2B 3MK7C 3FZMB 2FJEA 2UU9T 5FMNA 2WZHA 5LHHB 1X9BA 2ACZA 1QLBA 4U33A 1VCTA 3IBPA 4GK0E 2CE7A 5FVLA 2VWAA 5LGTB 1D0YA 1D0XA 3C98B 3LK2B 2J1DG 3FZKB 3ABVA 4QH1A 4G2AA 2K9AA 5LJNA 5LCYA 4EV6A 1OWAA 3VRBA 5JDQA 4HWHA 4PFOA 5JTGA 2FJDA 4Z8XA 1N36T 2JRKA 2EHOA 1E7PA 2XAQB 3IHRA 1UK5A 3JAFA 5AQJB 1ZKEA 2ACXA 2E9XA 3CQXC 3PUYF 3H37A 4BJMA 5H6RB 3ONLC 3OTOT 4ILUA 5HXCA 2YDRA 4IL9A 4GIWA 3RRWA 4YTPA 4U72A 3PURA 3LFMA 3RIFA 5M4YA 4EZ4A 5FL1A 4C91A 3ONJA 2JJ9A 2FBWA 2V6YB 4KI0F 4QKNA 1L0VA 2WU5A 2QYWA 4TWFA 1SUMB 3ZT7A 4PJNA 4A56A 4IE7A 4O2BE 2ZMAA 4LF5T 1ZOYA 3AE6A 2WQYA 4IT4A 2WB5A 2D0TA 2IUBA 3RPUA 1N33T 2QVAA 5LP6E 1MMNA 1JNRA 3N9NA 3UULA 3UUNA 4ZZBA 1NWMX 4B3MT 4IDZA 5HEUA 3UT5E 1GQEA 1J5WA 2CEAA 3IF8B 5L3FB 2NTYA 2A2FX 2LM9A 2JQQA 1FMVA 2UXNB 5FY0A 4GYSA 2X9WA 2OLTA 3MZKB 3RYCE 4HE8A 4NIQA 2LM2A 3LDQB 4DV6T 3RGLA 4UVAB 3NKZA 3L3PA 1NENA 1UUSA 4A97A 4GK5E 4DBQA 1LVKA 2XASB 1M7KA 2V7LA 4MFRA 1MIVA 2XTLA 1SHZC 1HX1B 5JDNA 4PNIA 2V7KA 4QXHB 3U3IA 2K24A 2R6GF 3K3OA 3AE7A 2CBIA 1WR6A 2ODUA 2KWHA 2VASA 3FZHB 4O8SA 2Q9QC 4B3TT 2CXDA 3AE2A 3PUQA 1KNZA 2LE8A 1HX8A 2LRLA 1ZHCA 4JI6T 4HTEA 4JEHB 1T98A 2XUEA 1XNRT 1KF6A 3QB5K 3AA0B 4OFZA 4HFBA 1XNQT 5AQRB 3OYZA 3TLTA 4N78D 2V7JA 3O9XA 3PV0F 3TKLB 2H3RA 3UUBA 2C0SA 4ISSA 5IYZE 2Y8DA 3CX8B 2Y48B 5LG4A 3H3MA 2HH7A 5LHGB 3LJCA 5C3JA 3RH3A 2X0YA 1WCRA 4IHJE 2CHNA 4XAXB 3ZT5A 4P1NA 2BS3A 5AQFB 3HKEE 4NXMT 3SS1A 2WMOA 1V9DA 1IBLT 4F6RC 3FB2A 4WBOA 2QRXA 2V6YA 3P4WA 4QXBB 1G73A 3ZJ1A 2L9QA 1N32T 3JADA 3A5XA 2K5BB 3HI2A 4HKAA 1YW0A 1R8IA 2WDRA 2MOZA 5FY7A 3QNUA 4IDPA 4EYYR 4HFIA 5EK2A 3CPZA 4UV8B 2NTXA 2X9HA 3KVAA 3RIUA 1FEWA 4BAYB 3NZPA 3W15B 2BDEA 2UXXB 3EABA 1LRZA 3AVRA 2J62A 3ZN1B 2CPTA 4UXNB 2LSKA 3ZMUB 2BZBA 4DO0A 4EOZB 2EHOC 2YOEA 2NW9A 4H63V 1HTJF 1DU2A 4MHCA 1WLXA 2LSGA 5AQNB 3E0ZA 2IHR1 3FZLB 4DR1T 2HN2A 3EI0A 4CN6A 4HFEA 4TV8E 3Q5XA 3R6NA 4JI3T 2ZM0A 3CK6A 1HF8A 3PE0A 1MMAA 4LMKA 3G06A 2XQ5A 4IE0A 2HHHT 4GKJT 4DV2T 3O1HA 1YQ4A 5F3JA 3I9YA 1WR0A 2JQ9A 4LF7T 4EGWA 1IJ5A 3CIRA 3RKGA 3ZMTB 3ZEFB 4I0UA 2WMNA 2V1DB 4CN1A 3OKQA 3N9MA 2CLYB 4DUZT 3A7MA 2CLYC 4Z90A 3V5UA 3N9QA 4QH5A 2NWBA 3S4UA 1YD8G 1Z8UA 3RLFF 3T1YT 5FL0A 2N1GA 1G8XA 1YKEB 1XZYA 1HCIA 4GYRA 2BVLA 3AEAA 3HL6A 4WW0A 2XQ7A 4DNDA 4CXYA 2Q9QD 2V26A 2MPKA 2XQ8A 3ZYKA 2VURA 3N2OA 1W09A 4X62T 3VRAA 4NUUA 4UEMA 3ZYMA 3P8CD 1KNPA 3HKDE 3I0OA 1IZNB 4DR4T 5JR9B 3M3ZB 1KFYA 2XSAA 5KX5E 5JDGA 2WDQA 3VU7H 4HWFA 1M62A 4OK0A 3ZYLA 4AKHA 5L4HA 2M6IA 1O3XA 1J1JA 4HWCA 5F8PA 4JI4T 2VQET 2XQ9A 5AQSB 1D1AA 3L09A 3RC3A 5LMNT 5LB7B 3ESLA 1Y64B 3OBVE 2N2NA 2KNDA 2QGSA 5HEJA 5KXJA 4U74A 4PK4A 4EAHA 3OVUA 2WBLA 2XM2A 1MNEA 4EB6E 5JREA 3GN5B 4QHOA 2YEVC 3QOFA 2DNXA 2NOXA 3E08A 3Q5DA 2BVMA 3EAMA 3ZPOA 2V7MA 5L47A 4ILAA 3KINB 1XWMA 3HKBE 2V6XA 3Q5WA 4IDQA 1HFAA 1UGOA 4LF6T 4MALA 2CBJA 4QWNB 4ZI3C 3KV6A 5LNKA 4KUMB 3BQKA 3PDYA 3K8PC 3LG7A 5HCJA 2L3LA 4JI1T 1WYCA 3P4RA 2ZM2A 4U7IA 5KDMC 2IC6A 3KV5A 3ONXA 2B1EA 4NUVA 2IC9A 3O4XE 1WRDA 5AQLB 2WP9A 3UU8A 4AKLA 2XM1A 3CQCB 4ZS2A 2EHOD 4MLKA 3CKDA 4KX6A 3OJAA 4P0BA 5DJQC 4I50E 2E9XD 2X66A 2LOSA 5JQGE 3PUZF 5AQUB 2CMRA 5L3GB 3VKGA 1KEYA 3AA1B 3QK6A 2LSJA 3K3QC 2LRKA 5AQGB 2D2SA 2H89A 4DUYT 2I0MA 4DMVA 4ISTA 2XY8B 3SOLA 5KMGP 4LF8T 3AAAB 5L4EA 1HG2A 5HXHA 1AJ3A 4DV3T 3KBTA 4PJMA 1XDOA 4PJJA 5LXTE 3JCFA 2BKOA 2WWUA 3RIUC 4I55E 3PUAA 4UF0B 1KK7A 5LA6E 2BG9E 1IAPA 1MMDA 2SPCA 4TWDA 3C4ZA 1E2AA 4PW8A 3UU4A 1MIYA 2CA5A 4AI6A 4PFPA 2C5IT 5DQVA 4YJ2E 2KSRA 2XQYA 4YY3T 5AQOB 4TZ4C 1US7B 2RPAA 3ZMSB 5JR9A 2XAFB 1ZP0A 2VKOA 4TWHA 5IUXA 2W61A 5AQHB 3RIAA 3UTKA 4U31A 4X1KE 3MA9A 1N34T 2KT9A 4YXDA 2KINB 1OEDB 4CN4A 1NAFA 3NZQA 2W63A 1D0ZA 3FHNA 2NR4A 3PUXF 5J0ZA 3AE8A 5FY1A 3WI3A 3NWIA 3GN5A 2Z6EA 3ANWB 4ANJA 1X79A 2DHRA 4ZS3A 3R84B 5FXXA 5LJMA 4DVDA 3C50A 3GA8A 1XMQT 2V8SV 2UUBT 1UURA 3JC6C 1I6ZA 4O4HE 2YDQA 4ZI2C 4H9QC 4ILBA 4IREA 4AKGA 3TLSA 2CM0A 2X0LB 4B6XA 4H9NC 4TNWA 4QH4A 3VKHA 3AAIA 2N9DA 2IAKA 2B76A 4X64T 4DR2T 3ETVA 2VKJA 5E0OA 4JI2T 1MNDA 3UUMA 3X1DA 2X68A 3CWZB 4QX8B 3FXDB 4ZI3D 4YJ3E 2W66A 1QSDA 1KNRA 4ZZCA 2IIUA 4UVCB 3V5SA 4KHPT 4L9IA 2XAGB 4JV5T 2JQHA 3AVSA 2I6HA 4Q25A 1W9RA 3KBUA 3HKCE 3N9LA 2HPJA 3KV9A 3FXEB 2M6BA 3CVRA 2AXDS 5ABFB 2CCQA 4U3CA 1B7TA 3Q9DA 1OEDE 2WWVA 4DR5T 3AA7B 2E8IA 2A9UA 4HEAA 1HNWT 2JPFA 4QX7B 2LSYA 4EYUA 2VVSA 5DABA 4YTNA 2V5CA 5AQQB 1E1HB 3I9WA 5HAXA 1NEKA 3ZLIA 2MAWA 4XZCA 5J1GA 2W62A 1LVFA 4NPPA 4HFCA 2DLRA 1FIOA 2RP4A 4UIGA 5FXWA 2V7IA 3RC8A 3NVOA 4UF0A 3Q5EA 1ZV4X 3SFEA 2YU2A 2UXDT 4YSZA 2X51A 3J7Yq 3UQ4A 3PJAA 4X65T 3ZCIA 3ZC0A 4B3ST 3ZCJA 2WU2A 2KMFA 5HXEA 3DP7A 1UCUA 4AQGA 5BR8T 4HGAA 4FI5A 4KBMB 5DQWA 4IGUA 3Q2MA 4Z91A 5JH7E 5HEHA 3ZJ2A 2CHOA 2W2UA 3B13A 2J4GA 5FVKA 4PK6A 5AQMB 1OEDA 3IEEA
chains in the Genus database with same CATH topology
2V7MA 5C8YE 4IDZA 2C5JA 3N5LA 3PTRB 4P0AA 2PJQA 1HS7A 2PBIA 3UT5E 3RYFE 2CEAA 3KINB 2A3DA 3IF8B 4OHFA 5L3FB 3C4WA 1VOMA 2NTYA 3HKBE 4MBQA 3Q5WA 1VRBA 2A2FX 4WNKA 2LM9A 2LT3A 3WAKA 1HFAA 3C51A 2JQQA 3N2KE 3EVYA 1FMVA 2UXNB 3LK3B 4MALA 5FY0A 4AQFA 3ANWA 4GYSA 3F31A 3LBXB 4O2AE 2X9WA 3MZKB 4QWNB 5EZYE 4HE8A 3RYCE 2XAJB 4ZI3C 3KV6A 5LNKA 2Y6XA 4KUMB 3BQKA 3PDYA 4UVAB 5EK3A 3GWHA 3K8PC 1BR4A 4CI1B 3LG7A 2L3LA 3MXZA 2X9YA 3L3PA 3CQGB 1WYCA 2ZM2A 5KDMC 2IC6A 3KV5A 2DCFA 3ONXA 4TN7B 2B1EA 4NUVA 2H7OA 4GK5E 2IC9A 4DBQA 1LVKA 2XASB 3EDVA 3O4XE 1WRDA 2V7LA 4MFRA 2VL8A 4KP3C 1MIVA 4I43B 2XTLA 4IE5A 1SHZC 4M1PA 4AKLA 5JDNA 4PNIA 3CQCB 4O4IE 2YINA 3K3NA 2G0UA 3O1IA 4ZS2A 2V7KA 4PK5A 2EHOD 4MLKA 3PU8A 4UVBB 4IIJE 5JDHA 4QXHB 3WAJA 3CKDA 3U3IA 2K24A 2KXPB 3OJAA 3CX7B 3BQIA 3K3OA 3FBZA 4P0BA 2X67A 1BR1A 5DJQC 4K0UA 1WR6A 4I50E 2E9XD 5FNVE 1UX5A 2X66A 3RKOA 4DMWA 5JR9C 2LOSA 5JQGE 2ODUA 2KWHA 5FYMA 4C90A 2VASA 2CMRA 4ZI2D 2YU1A 5L3GB 3VKGA 4O8SA 2Q9QC 1U5PA 2WAUA 2L8KA 3AA1B 5JRCA 3QK6A 2CXDA 2LSJA 3B57A 3HA4A 3K3QC 3PUQA 1KNZA 2D2SA 5IHYA 2LE8A 1HX8A 5JDLA 1ZHCA 2EHOB 3VHLA 2KZ7B 4HTEA 5CB4E 4JEHB 3SWHA 4ZI7E 3DTOA 3KFWX 1T98A 2XUEA 2ZM8A 5ETWA 4CXWA 4TV9E 4DMVA 3PUSA 4ISTA 5L3DB 2PFVA 3AA0B 4OYJA 3SOLA 5KMGP 4OFZA 3AAAB 3FBLA 2E9XB 3RRCA 2E9XC 3KV4A 1HG2A 5TAOA 2MBGA 4ERRA 2KWIB 4TX5A 5HXHA 1AJ3A 3OYZA 3KBTA 3MKDA 5L3EB 4PJMA 5LXTE 4PJJA 1YKHB 2QA7A 2WWUA 4N78D 2I59A 2V7JA 5FXZA 3U78A 3O9XA 4I55E 3RYIE 1BR0A 3TKLB 4AKRB 2H3RA 1S94A 2LHNA 4CXXA 3SRZA 3PUAA 2YK0A 2C0SA 3DJBA 4ISSA 5IYZE 2Y8DA 1WYBA 4O4LE 4UF0B 1KK7A 3CX8B 5LA6E 4JLEA 5L2LA 5FXVA 4DBRA 1IAPA 1MMDA 2Y48B 5LHIB 2SPCA 2LSIA 3ETUA 3C4ZA 5LG4A 1IJ6A 4HFVA 2HH7A 5LHGB 2MYSA 4PW8A 4G63A 1MIYA 2CA5A 3LJCA 4XBFB 3RH3A 3I1AA 4ASKA 4AI6A 2ES0A 4PFPA 4BJNA 5AFUL 1U4QA 4IHJE 3KVBA 4XAXB 2C5IT 2D0UA 5HXSA 5DQVA 4YJ2E 5J2TE 3UFEA 3HKEE 2LJLA 2XQYA 3F2EA 3SS1A 2WMOA 4TZ4C 3H3AA 1US7B 3ZMSB 5JR9A 1V9DA 2LEHA 2RA1A 2XAHB 2XAFB 2CWOA 3FB2A 4WBOA 4F6RC 2VKOA 2DWKA 2HPLA 4PAGA 3ZC1A 2VKHA 4QXBB 2M67A 3BQLA 2Q9QA 3AA6B 5J2UE 2W61A 5JDMA 2W00A 1G73A 2K48A 4EIWA 3ZJ1A 3HR0A 2L9QA 5LOVE 2DWGA 2GK9A 3ZMZB 5H6QB 2P9BA 3UTKA 4X1KE 2LOPA 5EK4A 4HN9A 3MA9A 3A5XA 2K5BB 2KT9A 3HI2A 4HKAA 1YW0A 5L3CB 4O4JE 1QUUA 3PU3A 2KINB 3I0QA 2JMKA 5LYJE 2H7VC 2MOZA 5FY7A 4UELA 2PG8A 4H9SE 3NBXX 4EYYR 3E22E 4X1IE 1NAFA 2D5UA 3NZQA 2W63A 5GONE 5EK2A 1D0ZA 3FHNA 1D1CA 3CPZA 3JC6D 3C4XA 4UV8B 4WBNE 4EZHA 2NTXA 1MIWA 2X9HA 3KVAA 4JUYA 1FEWA 3NZPA 3W15B 4BAYB 5FY1A 2BDEA 2UXXB 3WI3A 1LRZA 3AVRA 3ZN1B 1S35A 4UXNB 1OXZA 2LSKA 3AAEB 3GN5A 3ZMUB 1H7CA 2Z6EA 3ANWB 2BZBA 3EUHA 4AQFC 5CA0E 4ANJA 3BK9A 1ZEEA 4DO0A 4EOZB 4V1Av 1X79A 2EHOC 2NW9A 2DHRA 2C5KT 4H63V 5FP3A 3CX6B 4ZS3A 1HTJF 5LBMA 4ADZA 2VB6A 3R84B 3QC9A 5FXXA 2MTQA 4KMCA 5LJMA 4MHCA 3N2GE 1WLXA 2LSGA 2WSSV 3QUJA 4DVDA 5ADXL 2XHEB 3J9X1 2VK9A 2A72A 3E0ZA 3M65A 2JMHA 3C50A 3GA8A 4PJLA 4J2CA 3JC6C 4H9OC 2OA5A 2NW8A 4IE6A 3MJXA 4O4HE 4ZI2C 4H9QC 4QXCB 2ODVA 4AKGA 3C64A 4TUYE 2CM0A 2X0LB 3Q5XA 4TV8E 5JDFA 4B6XA 3LBXA 4H9NC 1FMWA 2CXFA 3R6NA 2ZM0A 3O1JA 3VKHA 3MACA 2CWYA 3NRXA 3AAIA 2N9DA 2IAKA 1HF8A 3PE0A 3N9OA 4H63H 4P09A 5LGUB 2X9XA 4H9RC 1MMAA 4L0RA 4YHJA 4CI2B 3MK7C 3AB3B 4IE0A 3ETVA 5FMNA 4BA9A 5HXRA 3O1HA 5LHHB 2VKJA 3N9PA 2VKDA 5E0OA 5F3JA 1MNDA 3I9YA 3UUMA 5JRCB 3IBPA 4GK0E 5JVDE 3PUGA 2CE7A 4EXTA 2X68A 3CWZB 2VWAA 5LGTB 1D0YA 1D0XA 3C98B 4QX8B 3FXDB 3LK2B 1Z0PA 4FJOA 2J1DG 4YJ3E 4ZI3D 1QSDA 1IJ5A 3ZMTB 4E7SA 4JEUB 1EZ3A 3ZEFB 2WMNA 2V1DB 3EDUA 4UVCB 4H9PC 3V5SA 4L9IA 2XAGB 4G2AA 3AVSA 3OKQA 2CXLA 3N9MA 4L5GA 2K9AA 5LJNA 2CLYB 2CLYC 3KBUA 5LCYA 2NP9A 3HKCE 3N9LA 3V5UA 1OWAA 4ZHQE 2HPJA 3N9QA 4GOUA 3KV9A 3FXEB 2NWBA 5HWYA 3S4UA 1YD8G 5JDQA 2IW5B 1BR2A 3CVRA 4PFOA 4Z8XA 3OYXA 1UX4A 2N1GA 2JRKA 2CCQA 1G8XA 4AKIA 1YKEB 2EHOA 2LHRA 2ZLYA 2XAQB 1HCIA 1B7TA 4GYRA 3Q9DA 2BVLA 3IHRA 3AA7B 4CI3B 5BMVE 1ZKEA 2ACXA 2E8IA 2E9XA 3CMLA 3CQXC 3HL6A 4HEAA 4WW0A 3H37A 4BJMA 2JPFA 4QX7B 2WM9A 4DNDA 2LSYA 5H6RB 4CXYA 4EYUA 2Q9QD 4X1YE 5DABA 2V26A 4ILUA 1E1HB 5HXCA 3ZYKA 4E7ZA 3N2OA 3I9WA 5HAXA 4OYKA 3ZLIA 4NUUA 4GIWA 4UEMA 3RX6A 4IE4A 3RRWA 3P8CD 3ZYMA 4U72A 3HKDE 4XZCA 2NW7A 1HG5A 2W62A 3I0OA 3PURA 1IZNB 1LVFA 3D0TA 5J1GA 3LFMA 2DLRA 1FIOA 5M4YA 4EZ4A 2RP4A 4UIGA 5FXWA 4C91A 2V7IA 3RC8A 5JR9B 3UUXB 2JJ9A 4UF0A 1ZV4X 4YFSA 4ZOLE 5JDGA 5KX5E 3F57A 4UV9B 2YU2A 5LGNB 2X51A 4CZZB 3VU7H 3J7Yq 2Q9QB 3LK42 4YLHA 4QKNA 4OK0A 4X20E 3ZYLA 3P7IA 1CUNA 3T8OA 3ZN0B 1D1BA 5LBQB 3ZCIA 3ZC0A 4AKHA 1O3XA 5HWXA 3ZCJA 2DI4A 2KMFA 5HXEA 5HYAA 3DP7A 5F8PA 1MMGA 5CA1E 1D1AA 4PJNA 4AXPA 1UCUA 4A56A 4IE7A 3L09A 4O2BE 3RC3A 4AQGA 4HGAA 4I4TE 4FI5A 4KBMB 4CQIA 3ESLA 5DQWA 4IGUA 2ZMAA 3Q2MA 1Y64B 3RYHE 3ZMVB 3OBVE 2N2NA 2KNDA 2QGSA 5A1LA 5JH7E 4U74A 4PK4A 3ZJ2A 1LKXA 4EAHA 2W0GA 2D0TA 2WBLA 5L3BB 1MNEA 4EB6E 3B13A 3RPUA 5JREA 2KLQA 3GN5B 3GMIA 4QHOA 2YEVC 2DNXA 5LP6E 4PK6A 3KDSE 1MMNA 2NOXA 3E08A 3N9NA 3UULA 2BVMA 3UUNA 3ZPOA 3IEEA 1SA0E 3NRYA 1NWMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRY A;  3NRX A;  5KMG P; 
#chains in the Genus database with same CATH topology
 2E5V A;  2C5J A;  3PTR B;  1HS7 A;  2PJQ A;  5ABH A;  4DV7 T;  3RYF E;  2CRB A;  3C4W A;  1VOM A;  2UXC T;  4MBQ A;  1VRB A;  4AQY T;  3C51 A;  1W0B A;  3LK3 B;  3ANW A;  3AE3 A;  5EZY E;  3K1S A;  4IDN A;  3VR8 A;  2XAJ B;  2VVN A;  4WZX A;  3PUW F;  1BR4 A;  3MXZ A;  2X9Y A;  3CQG B;  4LF9 T;  4TN7 B;  2H7O A;  5CJ5 A;  2VL8 A;  4KP3 C;  4IE5 A;  3RHW A;  2YIN A;  3O1I A;  4UVB B;  4IIJ E;  2XPK A;  5JDH A;  3WAJ A;  2KXP B;  5ABE A;  3FBZ A;  4K0U A;  5FNV E;  1UX5 A;  3RKO A;  5JR9 C;  2YDS A;  5FYM A;  4ZI2 D;  2YU1 A;  2WCA A;  1XDP A;  3HA4 A;  5IHY A;  3AED A;  4LFB T;  3VHL A;  4ZI7 E;  5CB4 E;  2WY2 A;  3DTO A;  3A8Y C;  2XQ3 A;  3KFW X;  5ETW A;  4TV9 E;  2PFV A;  4LFA T;  2UUA T;  3UFG A;  1T72 A;  3KV4 A;  5TAO A;  2MBG A;  4ERR A;  2KWI B;  4TX5 A;  3MKD A;  3B5M A;  3U78 A;  1BR0 A;  5ABF A;  4AKR B;  1S94 A;  2FJB A;  3SRZ A;  1IBK T;  4KHZ F;  2YK0 A;  1T7S A;  1WYB A;  4O4L E;  3ZKR A;  2ZM6 T;  4AIS A;  2LSI A;  2BG9 B;  2BG9 C;  2IML A;  5C2T A;  4HFV A;  4DR7 T;  2MYS A;  4XBF B;  2HN1 A;  4ASK A;  2ES0 A;  5AFU L;  3KVB A;  3ZT6 A;  5J2T E;  3P4S A;  2W4X A;  3UFE A;  4IDO A;  3F2E A;  3H3A A;  3SFD A;  2LEH A;  2RA1 A;  2XAH B;  2DWK A;  2HPL A;  3L39 A;  4PAG A;  3ZC1 A;  4WYV A;  3AA6 B;  3EHZ A;  2W00 A;  4EIW A;  5LOV E;  2DL1 A;  5ABG A;  5H6Q B;  2P9B A;  4A5X A;  5AQT B;  5EK4 A;  4HN9 A;  4YHH T;  5HEO A;  4O4J E;  1QUU A;  3PU3 A;  2H7V C;  4H9S E;  3UU3 A;  3NBX X;  5AQI B;  3E22 E;  4X1I E;  5GON E;  3C4X A;  2PTF A;  5LMU T;  4WBN E;  4EZH A;  1HNZ T;  3LSV A;  1W0A A;  1S35 A;  2BS2 A;  1OXZ A;  1Y01 A;  2LKG A;  5AQP B;  4AQF C;  5CA0 E;  1J5E T;  3BK9 A;  1ZEE A;  4V1A v;  2BBH A;  2C5K T;  5FP3 A;  2BKP A;  2LKH A;  3CX6 B;  3QC9 A;  2MTQ A;  3N2G E;  3ZSS A;  3QUJ A;  5ADX L;  3J9X 1;  2A72 A;  3M65 A;  4PJL A;  4GKK T;  4H9O C;  4IE6 A;  3MJX A;  1SE7 A;  4QXC B;  2IDO B;  1HR0 T;  2ODV A;  3C64 A;  4TUY E;  2FUP A;  1FMW A;  2CXF A;  3O1J A;  3MAC A;  3NRX A;  1VCS A;  1YQ3 A;  4H63 H;  4P09 A;  3TLV A;  2JIW A;  4L0R A;  3AB3 B;  2XQ6 A;  4BA9 A;  5HXR A;  3N9P A;  2VKD A;  3RQW A;  2VQF T;  5IWA T;  4YTM A;  5JRC B;  5JVD E;  3PUG A;  4EXT A;  3JAE A;  2WZI A;  2WDV A;  4FJO A;  1Z0P A;  4E7S A;  4JEU B;  1EZ3 A;  3EDU A;  4H9P C;  5LG3 A;  2CXL A;  4L5G A;  2NP9 A;  4JI8 T;  2FJA A;  5HEG A;  4ZHQ E;  4GOU A;  4NXN T;  5HWY A;  4X5T A;  2IW5 B;  1BR2 A;  4F8H A;  3T1H T;  3OYX A;  1UX4 A;  4HFD A;  4AKI A;  2LHR A;  2ZLY A;  5F5W A;  3OPC A;  4IL4 A;  1OED C;  4CI3 B;  5BMV E;  1T8B A;  3CML A;  3P50 A;  2WM9 A;  4X1Y E;  4JBW F;  4ZEY A;  4B3R T;  4E7Z A;  2OV9 A;  4OYK A;  3RX6 A;  4IE4 A;  2NW7 A;  1HG5 A;  2AE9 A;  3D0T A;  4DV4 T;  3VR9 A;  3QB5 A;  4ZXL A;  1JNZ A;  3UUX B;  4LMJ A;  5AQV B;  4YFS A;  4ZOL E;  3RQU A;  3F57 A;  4UV9 B;  5LGN B;  2BG9 A;  4CZZ B;  2Q9Q B;  2XQ4 A;  3LK4 2;  4YLH A;  3FZF B;  4DV1 T;  1I94 T;  4X20 E;  3P7I A;  1CUN A;  3T8O A;  3ZN0 B;  1D1B A;  5LBQ B;  4YSX A;  5HCM A;  5HWX A;  2XZE A;  2DI4 A;  4DID B;  4AIU A;  1CHU A;  5HYA A;  1MMG A;  5CA1 E;  4AXP A;  4I4T E;  4CQI A;  4JYA T;  4EEB A;  4HFH A;  3RYH E;  3ZMV B;  5A1L A;  2LLY A;  1LKX A;  3PJA J;  2W0G A;  4LML A;  3AXJ B;  5L3B B;  2KLQ A;  3GMI A;  4LFC T;  3KDS E;  2W67 A;  4LF4 T;  1SA0 E;  3NRY A;  5C8Y E;  3N5L A;  4P0A A;  2PBI A;  2UXB T;  2VL0 A;  2A3D A;  4OHF A;  3PUV F;  5CFB A;  4WNK A;  2LT3 A;  3WAK A;  3N2K E;  3EVY A;  4AQF A;  3AEC A;  3F31 A;  3LBX B;  4O2A E;  4EED A;  2Y6X A;  5EK3 A;  3GWH A;  4CI1 B;  4K0K T;  2DCF A;  4U2Y A;  2E2A A;  3EDV A;  4I43 B;  4DV0 T;  2J47 A;  4M1P A;  1YXR A;  4O4I E;  3K3N A;  2G0U A;  4PK5 A;  3PU8 A;  2BS4 A;  3CX7 B;  3AEB A;  3BQI A;  2X67 A;  1BR1 A;  4DMW A;  2E5L T;  4JI7 T;  2BKN A;  2D9D A;  4C90 A;  4YT0 A;  1U5P A;  2WAU A;  2L8K A;  5JRC A;  3P4Q A;  3B57 A;  3RF1 A;  4U2Z A;  3AE4 A;  5JDL A;  2EHO B;  2KZ7 B;  3SWH A;  2ZM8 A;  4CXW A;  1WFD A;  3PUS A;  5L3D B;  4OYJ A;  3AEG A;  3FBL A;  2E9X B;  3RRC A;  2E9X C;  1HNX T;  2BBJ A;  4DR6 T;  5AQK B;  5L3E B;  1YKH B;  2QA7 A;  2JQK A;  2I59 A;  5FXZ A;  3RYI E;  1IBM T;  4HWI B;  3UQ7 A;  2LHN A;  4CXX A;  3DJB A;  3UU6 A;  2F4V T;  3AE9 A;  4JLE A;  5L2L A;  5FXV A;  4DBR A;  5LHI B;  2WS3 A;  3ETU A;  3TLW A;  3TLU A;  1IJ6 A;  5CGM A;  4G63 A;  2YKS A;  3AE5 A;  3I1A A;  4BJN A;  1U4Q A;  3UU5 A;  2D0U A;  5HXS A;  1XMO T;  4U7Y A;  2LJL A;  2CWO A;  2K3W A;  2VKH A;  2M67 A;  1FJG T;  3BQL A;  2Q9Q A;  5J2U E;  2YN6 A;  5JDM A;  2K48 A;  3HR0 A;  4ILC A;  2X0H A;  2DWG A;  2GK9 A;  3ZMZ B;  2LOP A;  3ZST A;  4DR3 T;  5FKY A;  2V5D A;  5L3C B;  3I0Q A;  2JMK A;  5LYJ E;  4JI5 T;  4UEL A;  2PG8 A;  4X66 T;  2D5U A;  1D1C A;  3JC6 D;  4UR9 A;  1MIW A;  3IA3 A;  4JUY A;  3AXJ A;  4JI0 T;  3AAE B;  1H7C A;  3EUH A;  4A98 A;  2XSB A;  4OX9 T;  5LBM A;  4ADZ A;  2VB6 A;  4KMC A;  3AEE A;  2H88 A;  2WSS V;  2XHE B;  2VK9 A;  3P4P A;  2UUC T;  2JMH A;  4J2C A;  2OA5 A;  2NW8 A;  3AEF A;  3RI5 A;  2XQA A;  3L8R A;  4DV5 T;  5JDF A;  3LBX A;  4YSY A;  4HWD A;  4TNV A;  2CWY A;  4COF A;  5LGU B;  3N9O A;  2X9X A;  4H9R C;  2XJ7 A;  3AE1 A;  4YHJ A;  4CI2 B;  3MK7 C;  3FZM B;  2FJE A;  2UU9 T;  5FMN A;  2WZH A;  5LHH B;  1X9B A;  2ACZ A;  1QLB A;  4U33 A;  1VCT A;  3IBP A;  4GK0 E;  2CE7 A;  5FVL A;  2VWA A;  5LGT B;  1D0Y A;  1D0X A;  3C98 B;  3LK2 B;  2J1D G;  3FZK B;  3ABV A;  4QH1 A;  4G2A A;  2K9A A;  5LJN A;  5LCY A;  4EV6 A;  1OWA A;  3VRB A;  5JDQ A;  4HWH A;  4PFO A;  5JTG A;  2FJD A;  4Z8X A;  1N36 T;  2JRK A;  2EHO A;  1E7P A;  2XAQ B;  3IHR A;  1UK5 A;  3JAF A;  5AQJ B;  1ZKE A;  2ACX A;  2E9X A;  3CQX C;  3PUY F;  3H37 A;  4BJM A;  5H6R B;  3ONL C;  3OTO T;  4ILU A;  5HXC A;  2YDR A;  4IL9 A;  4GIW A;  3RRW A;  4YTP A;  4U72 A;  3PUR A;  3LFM A;  3RIF A;  5M4Y A;  4EZ4 A;  5FL1 A;  4C91 A;  3ONJ A;  2JJ9 A;  2FBW A;  2V6Y B;  4KI0 F;  4QKN A;  1L0V A;  2WU5 A;  2QYW A;  4TWF A;  1SUM B;  3ZT7 A;  4PJN A;  4A56 A;  4IE7 A;  4O2B E;  2ZMA A;  4LF5 T;  1ZOY A;  3AE6 A;  2WQY A;  4IT4 A;  2WB5 A;  2D0T A;  2IUB A;  3RPU A;  1N33 T;  2QVA A;  5LP6 E;  1MMN A;  1JNR A;  3N9N A;  3UUL A;  3UUN A;  4ZZB A;  1NWM X;  4B3M T;  4IDZ A;  5HEU A;  3UT5 E;  1GQE A;  1J5W A;  2CEA A;  3IF8 B;  5L3F B;  2NTY A;  2A2F X;  2LM9 A;  2JQQ A;  1FMV A;  2UXN B;  5FY0 A;  4GYS A;  2X9W A;  2OLT A;  3MZK B;  3RYC E;  4HE8 A;  4NIQ A;  2LM2 A;  3LDQ B;  4DV6 T;  3RGL A;  4UVA B;  3NKZ A;  3L3P A;  1NEN A;  1UUS A;  4A97 A;  4GK5 E;  4DBQ A;  1LVK A;  2XAS B;  1M7K A;  2V7L A;  4MFR A;  1MIV A;  2XTL A;  1SHZ C;  1HX1 B;  5JDN A;  4PNI A;  2V7K A;  4QXH B;  3U3I A;  2K24 A;  2R6G F;  3K3O A;  3AE7 A;  2CBI A;  1WR6 A;  2ODU A;  2KWH A;  2VAS A;  3FZH B;  4O8S A;  2Q9Q C;  4B3T T;  2CXD A;  3AE2 A;  3PUQ A;  1KNZ A;  2LE8 A;  1HX8 A;  2LRL A;  1ZHC A;  4JI6 T;  4HTE A;  4JEH B;  1T98 A;  2XUE A;  1XNR T;  1KF6 A;  3QB5 K;  3AA0 B;  4OFZ A;  4HFB A;  1XNQ T;  5AQR B;  3OYZ A;  3TLT A;  4N78 D;  2V7J A;  3O9X A;  3PV0 F;  3TKL B;  2H3R A;  3UUB A;  2C0S A;  4ISS A;  5IYZ E;  2Y8D A;  3CX8 B;  2Y48 B;  5LG4 A;  3H3M A;  2HH7 A;  5LHG B;  3LJC A;  5C3J A;  3RH3 A;  2X0Y A;  1WCR A;  4IHJ E;  2CHN A;  4XAX B;  3ZT5 A;  4P1N A;  2BS3 A;  5AQF B;  3HKE E;  4NXM T;  3SS1 A;  2WMO A;  1V9D A;  1IBL T;  4F6R C;  3FB2 A;  4WBO A;  2QRX A;  2V6Y A;  3P4W A;  4QXB B;  1G73 A;  3ZJ1 A;  2L9Q A;  1N32 T;  3JAD A;  3A5X A;  2K5B B;  3HI2 A;  4HKA A;  1YW0 A;  1R8I A;  2WDR A;  2MOZ A;  5FY7 A;  3QNU A;  4IDP A;  4EYY R;  4HFI A;  5EK2 A;  3CPZ A;  4UV8 B;  2NTX A;  2X9H A;  3KVA A;  3RIU A;  1FEW A;  4BAY B;  3NZP A;  3W15 B;  2BDE A;  2UXX B;  3EAB A;  1LRZ A;  3AVR A;  2J62 A;  3ZN1 B;  2CPT A;  4UXN B;  2LSK A;  3ZMU B;  2BZB A;  4DO0 A;  4EOZ B;  2EHO C;  2YOE A;  2NW9 A;  4H63 V;  1HTJ F;  1DU2 A;  4MHC A;  1WLX A;  2LSG A;  5AQN B;  3E0Z A;  2IHR 1;  3FZL B;  4DR1 T;  2HN2 A;  3EI0 A;  4CN6 A;  4HFE A;  4TV8 E;  3Q5X A;  3R6N A;  4JI3 T;  2ZM0 A;  3CK6 A;  1HF8 A;  3PE0 A;  1MMA A;  4LMK A;  3G06 A;  2XQ5 A;  4IE0 A;  2HHH T;  4GKJ T;  4DV2 T;  3O1H A;  1YQ4 A;  5F3J A;  3I9Y A;  1WR0 A;  2JQ9 A;  4LF7 T;  4EGW A;  1IJ5 A;  3CIR A;  3RKG A;  3ZMT B;  3ZEF B;  4I0U A;  2WMN A;  2V1D B;  4CN1 A;  3OKQ A;  3N9M A;  2CLY B;  4DUZ T;  3A7M A;  2CLY C;  4Z90 A;  3V5U A;  3N9Q A;  4QH5 A;  2NWB A;  3S4U A;  1YD8 G;  1Z8U A;  3RLF F;  3T1Y T;  5FL0 A;  2N1G A;  1G8X A;  1YKE B;  1XZY A;  1HCI A;  4GYR A;  2BVL A;  3AEA A;  3HL6 A;  4WW0 A;  2XQ7 A;  4DND A;  4CXY A;  2Q9Q D;  2V26 A;  2MPK A;  2XQ8 A;  3ZYK A;  2VUR A;  3N2O A;  1W09 A;  4X62 T;  3VRA A;  4NUU A;  4UEM A;  3ZYM A;  3P8C D;  1KNP A;  3HKD E;  3I0O A;  1IZN B;  4DR4 T;  5JR9 B;  3M3Z B;  1KFY A;  2XSA A;  5KX5 E;  5JDG A;  2WDQ A;  3VU7 H;  4HWF A;  1M62 A;  4OK0 A;  3ZYL A;  4AKH A;  5L4H A;  2M6I A;  1O3X A;  1J1J A;  4HWC A;  5F8P A;  4JI4 T;  2VQE T;  2XQ9 A;  5AQS B;  1D1A A;  3L09 A;  3RC3 A;  5LMN T;  5LB7 B;  3ESL A;  1Y64 B;  3OBV E;  2N2N A;  2KND A;  2QGS A;  5HEJ A;  5KXJ A;  4U74 A;  4PK4 A;  4EAH A;  3OVU A;  2WBL A;  2XM2 A;  1MNE A;  4EB6 E;  5JRE A;  3GN5 B;  4QHO A;  2YEV C;  3QOF A;  2DNX A;  2NOX A;  3E08 A;  3Q5D A;  2BVM A;  3EAM A;  3ZPO A;  2V7M A;  5L47 A;  4ILA A;  3KIN B;  1XWM A;  3HKB E;  2V6X A;  3Q5W A;  4IDQ A;  1HFA A;  1UGO A;  4LF6 T;  4MAL A;  2CBJ A;  4QWN B;  4ZI3 C;  3KV6 A;  5LNK A;  4KUM B;  3BQK A;  3PDY A;  3K8P C;  3LG7 A;  5HCJ A;  2L3L A;  4JI1 T;  1WYC A;  3P4R A;  2ZM2 A;  4U7I A;  5KDM C;  2IC6 A;  3KV5 A;  3ONX A;  2B1E A;  4NUV A;  2IC9 A;  3O4X E;  1WRD A;  5AQL B;  2WP9 A;  3UU8 A;  4AKL A;  2XM1 A;  3CQC B;  4ZS2 A;  2EHO D;  4MLK A;  3CKD A;  4KX6 A;  3OJA A;  4P0B A;  5DJQ C;  4I50 E;  2E9X D;  2X66 A;  2LOS A;  5JQG E;  3PUZ F;  5AQU B;  2CMR A;  5L3G B;  3VKG A;  1KEY A;  3AA1 B;  3QK6 A;  2LSJ A;  3K3Q C;  2LRK A;  5AQG B;  2D2S A;  2H89 A;  4DUY T;  2I0M A;  4DMV A;  4IST A;  2XY8 B;  3SOL A;  5KMG P;  4LF8 T;  3AAA B;  5L4E A;  1HG2 A;  5HXH A;  1AJ3 A;  4DV3 T;  3KBT A;  4PJM A;  1XDO A;  4PJJ A;  5LXT E;  3JCF A;  2BKO A;  2WWU A;  3RIU C;  4I55 E;  3PUA A;  4UF0 B;  1KK7 A;  5LA6 E;  2BG9 E;  1IAP A;  1MMD A;  2SPC A;  4TWD A;  3C4Z A;  1E2A A;  4PW8 A;  3UU4 A;  1MIY A;  2CA5 A;  4AI6 A;  4PFP A;  2C5I T;  5DQV A;  4YJ2 E;  2KSR A;  2XQY A;  4YY3 T;  5AQO B;  4TZ4 C;  1US7 B;  2RPA A;  3ZMS B;  5JR9 A;  2XAF B;  1ZP0 A;  2VKO A;  4TWH A;  5IUX A;  2W61 A;  5AQH B;  3RIA A;  3UTK A;  4U31 A;  4X1K E;  3MA9 A;  1N34 T;  2KT9 A;  4YXD A;  2KIN B;  1OED B;  4CN4 A;  1NAF A;  3NZQ A;  2W63 A;  1D0Z A;  3FHN A;  2NR4 A;  3PUX F;  5J0Z A;  3AE8 A;  5FY1 A;  3WI3 A;  3NWI A;  3GN5 A;  2Z6E A;  3ANW B;  4ANJ A;  1X79 A;  2DHR A;  4ZS3 A;  3R84 B;  5FXX A;  5LJM A;  4DVD A;  3C50 A;  3GA8 A;  1XMQ T;  2V8S V;  2UUB T;  1UUR A;  3JC6 C;  1I6Z A;  4O4H E;  2YDQ A;  4ZI2 C;  4H9Q C;  4ILB A;  4IRE A;  4AKG A;  3TLS A;  2CM0 A;  2X0L B;  4B6X A;  4H9N C;  4TNW A;  4QH4 A;  3VKH A;  3AAI A;  2N9D A;  2IAK A;  2B76 A;  4X64 T;  4DR2 T;  3ETV A;  2VKJ A;  5E0O A;  4JI2 T;  1MND A;  3UUM A;  3X1D A;  2X68 A;  3CWZ B;  4QX8 B;  3FXD B;  4ZI3 D;  4YJ3 E;  2W66 A;  1QSD A;  1KNR A;  4ZZC A;  2IIU A;  4UVC B;  3V5S A;  4KHP T;  4L9I A;  2XAG B;  4JV5 T;  2JQH A;  3AVS A;  2I6H A;  4Q25 A;  1W9R A;  3KBU A;  3HKC E;  3N9L A;  2HPJ A;  3KV9 A;  3FXE B;  2M6B A;  3CVR A;  2AXD S;  5ABF B;  2CCQ A;  4U3C A;  1B7T A;  3Q9D A;  1OED E;  2WWV A;  4DR5 T;  3AA7 B;  2E8I A;  2A9U A;  4HEA A;  1HNW T;  2JPF A;  4QX7 B;  2LSY A;  4EYU A;  2VVS A;  5DAB A;  4YTN A;  2V5C A;  5AQQ B;  1E1H B;  3I9W A;  5HAX A;  1NEK A;  3ZLI A;  2MAW A;  4XZC A;  5J1G A;  2W62 A;  1LVF A;  4NPP A;  4HFC A;  2DLR A;  1FIO A;  2RP4 A;  4UIG A;  5FXW A;  2V7I A;  3RC8 A;  3NVO A;  4UF0 A;  3Q5E A;  1ZV4 X;  3SFE A;  2YU2 A;  2UXD T;  4YSZ A;  2X51 A;  3J7Y q;  3UQ4 A;  3PJA A;  4X65 T;  3ZCI A;  3ZC0 A;  4B3S T;  3ZCJ A;  2WU2 A;  2KMF A;  5HXE A;  3DP7 A;  1UCU A;  4AQG A;  5BR8 T;  4HGA A;  4FI5 A;  4KBM B;  5DQW A;  4IGU A;  3Q2M A;  4Z91 A;  5JH7 E;  5HEH A;  3ZJ2 A;  2CHO A;  2W2U A;  3B13 A;  2J4G A;  5FVK A;  4PK6 A;  5AQM B;  1OED A;  3IEE A; 
#chains in the Genus database with same CATH homology
 2V7M A;  5C8Y E;  4IDZ A;  2C5J A;  3N5L A;  3PTR B;  4P0A A;  2PJQ A;  1HS7 A;  2PBI A;  3UT5 E;  3RYF E;  2CEA A;  3KIN B;  2A3D A;  3IF8 B;  4OHF A;  5L3F B;  3C4W A;  1VOM A;  2NTY A;  3HKB E;  4MBQ A;  3Q5W A;  1VRB A;  2A2F X;  4WNK A;  2LM9 A;  2LT3 A;  3WAK A;  1HFA A;  3C51 A;  2JQQ A;  3N2K E;  3EVY A;  1FMV A;  2UXN B;  3LK3 B;  4MAL A;  5FY0 A;  4AQF A;  3ANW A;  4GYS A;  3F31 A;  3LBX B;  4O2A E;  2X9W A;  3MZK B;  4QWN B;  5EZY E;  4HE8 A;  3RYC E;  2XAJ B;  4ZI3 C;  3KV6 A;  5LNK A;  2Y6X A;  4KUM B;  3BQK A;  3PDY A;  4UVA B;  5EK3 A;  3GWH A;  3K8P C;  1BR4 A;  4CI1 B;  3LG7 A;  2L3L A;  3MXZ A;  2X9Y A;  3L3P A;  3CQG B;  1WYC A;  2ZM2 A;  5KDM C;  2IC6 A;  3KV5 A;  2DCF A;  3ONX A;  4TN7 B;  2B1E A;  4NUV A;  2H7O A;  4GK5 E;  2IC9 A;  4DBQ A;  1LVK A;  2XAS B;  3EDV A;  3O4X E;  1WRD A;  2V7L A;  4MFR A;  2VL8 A;  4KP3 C;  1MIV A;  4I43 B;  2XTL A;  4IE5 A;  1SHZ C;  4M1P A;  4AKL A;  5JDN A;  4PNI A;  3CQC B;  4O4I E;  2YIN A;  3K3N A;  2G0U A;  3O1I A;  4ZS2 A;  2V7K A;  4PK5 A;  2EHO D;  4MLK A;  3PU8 A;  4UVB B;  4IIJ E;  5JDH A;  4QXH B;  3WAJ A;  3CKD A;  3U3I A;  2K24 A;  2KXP B;  3OJA A;  3CX7 B;  3BQI A;  3K3O A;  3FBZ A;  4P0B A;  2X67 A;  1BR1 A;  5DJQ C;  4K0U A;  1WR6 A;  4I50 E;  2E9X D;  5FNV E;  1UX5 A;  2X66 A;  3RKO A;  4DMW A;  5JR9 C;  2LOS A;  5JQG E;  2ODU A;  2KWH A;  5FYM A;  4C90 A;  2VAS A;  2CMR A;  4ZI2 D;  2YU1 A;  5L3G B;  3VKG A;  4O8S A;  2Q9Q C;  1U5P A;  2WAU A;  2L8K A;  3AA1 B;  5JRC A;  3QK6 A;  2CXD A;  2LSJ A;  3B57 A;  3HA4 A;  3K3Q C;  3PUQ A;  1KNZ A;  2D2S A;  5IHY A;  2LE8 A;  1HX8 A;  5JDL A;  1ZHC A;  2EHO B;  3VHL A;  2KZ7 B;  4HTE A;  5CB4 E;  4JEH B;  3SWH A;  4ZI7 E;  3DTO A;  3KFW X;  1T98 A;  2XUE A;  2ZM8 A;  5ETW A;  4CXW A;  4TV9 E;  4DMV A;  3PUS A;  4IST A;  5L3D B;  2PFV A;  3AA0 B;  4OYJ A;  3SOL A;  5KMG P;  4OFZ A;  3AAA B;  3FBL A;  2E9X B;  3RRC A;  2E9X C;  3KV4 A;  1HG2 A;  5TAO A;  2MBG A;  4ERR A;  2KWI B;  4TX5 A;  5HXH A;  1AJ3 A;  3OYZ A;  3KBT A;  3MKD A;  5L3E B;  4PJM A;  5LXT E;  4PJJ A;  1YKH B;  2QA7 A;  2WWU A;  4N78 D;  2I59 A;  2V7J A;  5FXZ A;  3U78 A;  3O9X A;  4I55 E;  3RYI E;  1BR0 A;  3TKL B;  4AKR B;  2H3R A;  1S94 A;  2LHN A;  4CXX A;  3SRZ A;  3PUA A;  2YK0 A;  2C0S A;  3DJB A;  4ISS A;  5IYZ E;  2Y8D A;  1WYB A;  4O4L E;  4UF0 B;  1KK7 A;  3CX8 B;  5LA6 E;  4JLE A;  5L2L A;  5FXV A;  4DBR A;  1IAP A;  1MMD A;  2Y48 B;  5LHI B;  2SPC A;  2LSI A;  3ETU A;  3C4Z A;  5LG4 A;  1IJ6 A;  4HFV A;  2HH7 A;  5LHG B;  2MYS A;  4PW8 A;  4G63 A;  1MIY A;  2CA5 A;  3LJC A;  4XBF B;  3RH3 A;  3I1A A;  4ASK A;  4AI6 A;  2ES0 A;  4PFP A;  4BJN A;  5AFU L;  1U4Q A;  4IHJ E;  3KVB A;  4XAX B;  2C5I T;  2D0U A;  5HXS A;  5DQV A;  4YJ2 E;  5J2T E;  3UFE A;  3HKE E;  2LJL A;  2XQY A;  3F2E A;  3SS1 A;  2WMO A;  4TZ4 C;  3H3A A;  1US7 B;  3ZMS B;  5JR9 A;  1V9D A;  2LEH A;  2RA1 A;  2XAH B;  2XAF B;  2CWO A;  3FB2 A;  4WBO A;  4F6R C;  2VKO A;  2DWK A;  2HPL A;  4PAG A;  3ZC1 A;  2VKH A;  4QXB B;  2M67 A;  3BQL A;  2Q9Q A;  3AA6 B;  5J2U E;  2W61 A;  5JDM A;  2W00 A;  1G73 A;  2K48 A;  4EIW A;  3ZJ1 A;  3HR0 A;  2L9Q A;  5LOV E;  2DWG A;  2GK9 A;  3ZMZ B;  5H6Q B;  2P9B A;  3UTK A;  4X1K E;  2LOP A;  5EK4 A;  4HN9 A;  3MA9 A;  3A5X A;  2K5B B;  2KT9 A;  3HI2 A;  4HKA A;  1YW0 A;  5L3C B;  4O4J E;  1QUU A;  3PU3 A;  2KIN B;  3I0Q A;  2JMK A;  5LYJ E;  2H7V C;  2MOZ A;  5FY7 A;  4UEL A;  2PG8 A;  4H9S E;  3NBX X;  4EYY R;  3E22 E;  4X1I E;  1NAF A;  2D5U A;  3NZQ A;  2W63 A;  5GON E;  5EK2 A;  1D0Z A;  3FHN A;  1D1C A;  3CPZ A;  3JC6 D;  3C4X A;  4UV8 B;  4WBN E;  4EZH A;  2NTX A;  1MIW A;  2X9H A;  3KVA A;  4JUY A;  1FEW A;  3NZP A;  3W15 B;  4BAY B;  5FY1 A;  2BDE A;  2UXX B;  3WI3 A;  1LRZ A;  3AVR A;  3ZN1 B;  1S35 A;  4UXN B;  1OXZ A;  2LSK A;  3AAE B;  3GN5 A;  3ZMU B;  1H7C A;  2Z6E A;  3ANW B;  2BZB A;  3EUH A;  4AQF C;  5CA0 E;  4ANJ A;  3BK9 A;  1ZEE A;  4DO0 A;  4EOZ B;  4V1A v;  1X79 A;  2EHO C;  2NW9 A;  2DHR A;  2C5K T;  4H63 V;  5FP3 A;  3CX6 B;  4ZS3 A;  1HTJ F;  5LBM A;  4ADZ A;  2VB6 A;  3R84 B;  3QC9 A;  5FXX A;  2MTQ A;  4KMC A;  5LJM A;  4MHC A;  3N2G E;  1WLX A;  2LSG A;  2WSS V;  3QUJ A;  4DVD A;  5ADX L;  2XHE B;  3J9X 1;  2VK9 A;  2A72 A;  3E0Z A;  3M65 A;  2JMH A;  3C50 A;  3GA8 A;  4PJL A;  4J2C A;  3JC6 C;  4H9O C;  2OA5 A;  2NW8 A;  4IE6 A;  3MJX A;  4O4H E;  4ZI2 C;  4H9Q C;  4QXC B;  2ODV A;  4AKG A;  3C64 A;  4TUY E;  2CM0 A;  2X0L B;  3Q5X A;  4TV8 E;  5JDF A;  4B6X A;  3LBX A;  4H9N C;  1FMW A;  2CXF A;  3R6N A;  2ZM0 A;  3O1J A;  3VKH A;  3MAC A;  2CWY A;  3NRX A;  3AAI A;  2N9D A;  2IAK A;  1HF8 A;  3PE0 A;  3N9O A;  4H63 H;  4P09 A;  5LGU B;  2X9X A;  4H9R C;  1MMA A;  4L0R A;  4YHJ A;  4CI2 B;  3MK7 C;  3AB3 B;  4IE0 A;  3ETV A;  5FMN A;  4BA9 A;  5HXR A;  3O1H A;  5LHH B;  2VKJ A;  3N9P A;  2VKD A;  5E0O A;  5F3J A;  1MND A;  3I9Y A;  3UUM A;  5JRC B;  3IBP A;  4GK0 E;  5JVD E;  3PUG A;  2CE7 A;  4EXT A;  2X68 A;  3CWZ B;  2VWA A;  5LGT B;  1D0Y A;  1D0X A;  3C98 B;  4QX8 B;  3FXD B;  3LK2 B;  1Z0P A;  4FJO A;  2J1D G;  4YJ3 E;  4ZI3 D;  1QSD A;  1IJ5 A;  3ZMT B;  4E7S A;  4JEU B;  1EZ3 A;  3ZEF B;  2WMN A;  2V1D B;  3EDU A;  4UVC B;  4H9P C;  3V5S A;  4L9I A;  2XAG B;  4G2A A;  3AVS A;  3OKQ A;  2CXL A;  3N9M A;  4L5G A;  2K9A A;  5LJN A;  2CLY B;  2CLY C;  3KBU A;  5LCY A;  2NP9 A;  3HKC E;  3N9L A;  3V5U A;  1OWA A;  4ZHQ E;  2HPJ A;  3N9Q A;  4GOU A;  3KV9 A;  3FXE B;  2NWB A;  5HWY A;  3S4U A;  1YD8 G;  5JDQ A;  2IW5 B;  1BR2 A;  3CVR A;  4PFO A;  4Z8X A;  3OYX A;  1UX4 A;  2N1G A;  2JRK A;  2CCQ A;  1G8X A;  4AKI A;  1YKE B;  2EHO A;  2LHR A;  2ZLY A;  2XAQ B;  1HCI A;  1B7T A;  4GYR A;  3Q9D A;  2BVL A;  3IHR A;  3AA7 B;  4CI3 B;  5BMV E;  1ZKE A;  2ACX A;  2E8I A;  2E9X A;  3CML A;  3CQX C;  3HL6 A;  4HEA A;  4WW0 A;  3H37 A;  4BJM A;  2JPF A;  4QX7 B;  2WM9 A;  4DND A;  2LSY A;  5H6R B;  4CXY A;  4EYU A;  2Q9Q D;  4X1Y E;  5DAB A;  2V26 A;  4ILU A;  1E1H B;  5HXC A;  3ZYK A;  4E7Z A;  3N2O A;  3I9W A;  5HAX A;  4OYK A;  3ZLI A;  4NUU A;  4GIW A;  4UEM A;  3RX6 A;  4IE4 A;  3RRW A;  3P8C D;  3ZYM A;  4U72 A;  3HKD E;  4XZC A;  2NW7 A;  1HG5 A;  2W62 A;  3I0O A;  3PUR A;  1IZN B;  1LVF A;  3D0T A;  5J1G A;  3LFM A;  2DLR A;  1FIO A;  5M4Y A;  4EZ4 A;  2RP4 A;  4UIG A;  5FXW A;  4C91 A;  2V7I A;  3RC8 A;  5JR9 B;  3UUX B;  2JJ9 A;  4UF0 A;  1ZV4 X;  4YFS A;  4ZOL E;  5JDG A;  5KX5 E;  3F57 A;  4UV9 B;  2YU2 A;  5LGN B;  2X51 A;  4CZZ B;  3VU7 H;  3J7Y q;  2Q9Q B;  3LK4 2;  4YLH A;  4QKN A;  4OK0 A;  4X20 E;  3ZYL A;  3P7I A;  1CUN A;  3T8O A;  3ZN0 B;  1D1B A;  5LBQ B;  3ZCI A;  3ZC0 A;  4AKH A;  1O3X A;  5HWX A;  3ZCJ A;  2DI4 A;  2KMF A;  5HXE A;  5HYA A;  3DP7 A;  5F8P A;  1MMG A;  5CA1 E;  1D1A A;  4PJN A;  4AXP A;  1UCU A;  4A56 A;  4IE7 A;  3L09 A;  4O2B E;  3RC3 A;  4AQG A;  4HGA A;  4I4T E;  4FI5 A;  4KBM B;  4CQI A;  3ESL A;  5DQW A;  4IGU A;  2ZMA A;  3Q2M A;  1Y64 B;  3RYH E;  3ZMV B;  3OBV E;  2N2N A;  2KND A;  2QGS A;  5A1L A;  5JH7 E;  4U74 A;  4PK4 A;  3ZJ2 A;  1LKX A;  4EAH A;  2W0G A;  2D0T A;  2WBL A;  5L3B B;  1MNE A;  4EB6 E;  3B13 A;  3RPU A;  5JRE A;  2KLQ A;  3GN5 B;  3GMI A;  4QHO A;  2YEV C;  2DNX A;  5LP6 E;  4PK6 A;  3KDS E;  1MMN A;  2NOX A;  3E08 A;  3N9N A;  3UUL A;  2BVM A;  3UUN A;  3ZPO A;  3IEE A;  1SA0 E;  3NRY A;  1NWM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...