3NRXA

Insights into anti-parallel microtubule crosslinking by prc1, a conserved non-motor microtubule binding protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
128
structure length
123
Chain Sequence
b'AALKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein regulator of cytokinesis 1
publication title Insights into Antiparallel Microtubule Crosslinking by PRC1, a Conserved Nonmotor Microtubule Binding Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 54
structure length 123
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1520 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3nrxA00
3NRXA 5KMGP 3NRYA
chains in the Genus database with same CATH superfamily
3BK9A 4IGUA 3FXDB 4KI0F 4H9PC 4TV9E 5AQIB 2QRXA 5CGMA 2WBLA 2I59A 5ABHA 2KXPB 3LK3B 1N34T 2N1GA 1LVFA 4U31A 4DV2T 1ZV4X 4H63V 2LKGA 3ZJ2A 2LLYA 2D0TA 3RC8A 4NPPA 1KNZA 2X0YA 1T7SA 1HCIA 3P4RA 3MKDA 1NAFA 4MLKA 2XQYA 2E5VA 4B6XA 3MZKB 2IUBA 2N9DA 3CMLA 1U5PA 3F2EA 4L5GA 2XQAA 3SFEA 3Q5WA 3RPUA 4UV9B 4EV6A 4H9RC 3AVRA 2L3LA 3AAIA 4HWFA 3ABVA 2BS2A 3RF1A 2WU5A 4U33A 3P50A 5HEUA 4EYYR 1XWMA 4AQFA 2R6GF 3ONLC 5HEJA 2E8IA 3V5UA 2Q9QC 4QX7B 1XDPA 2ZMAA 3SOLA 5JR9A 3DP7A 3N9PA 2LSGA 2GK9A 3ZMVB 3QUJA 1FEWA 3OYZA 3RYIE 2LSIA 4ZI2C 2WY2A 3N9LA 2JRKA 4L0RA 2Y6XA 5EK3A 3JC6C 2LOSA 2LT3A 2CBJA 5HXSA 3IBPA 5AQPB 4DR7T 3AE8A 3S4UA 3Q9DA 4U7IA 3GMIA 3UUNA 4OYKA 4GK0E 4HFDA 4DNDA 3AE2A 2XAFB 2LKHA 3CX8B 2XQ5A 3QOFA 3C98B 4G63A 5LOVE 4CN1A 4PK4A 4M1PA 2Y8DA 4TWFA 2XSAA 3ZC0A 3GWHA 2BG9B 1MNDA 5AQHB 3KBTA 1IZNB 3RX6A 2A9UA 4DV0T 3EABA 3P4PA 2H89A 4U72A 4WYVA 5CA0E 5ABEA 5LHGB 3ONXA 5LYJE 5ABGA 3IHRA 3SFDA 3SWHA 5LP6E 4EOZB 3DJBA 3H37A 4U74A 3AB3B 2NW7A 4ZI7E 4AQFC 1T72A 3LSVA 1MMNA 2C5JA 3LJCA 2V5DA 2BG9C 3L39A 2YOEA 3V5SA 3RIUA 3RI5A 3PJAA 4DUZT 2X9HA 2HHHT 2DWGA 4JI8T 2NW9A 4GIWA 2V7LA 2IIUA 2ZM6T 2A2FX 4AXPA 3KINB 3B13A 3HKBE 2NWBA 2YKSA 3UU8A 4PK5A 5BMVE 2DLRA 1HR0T 1IJ6A 5H6RB 1KK7A 4YJ2E 3LBXA 3OVUA 3JCFA 2X0HA 2L9QA 2E9XD 3AECA 2BDEA 4O4JE 1LVKA 4AKGA 2KSRA 2LHRA 3RRCA 4YXDA 4LF9T 1HF8A 2CHOA 4G2AA 3NZQA 4IL9A 5LG3A 3RYHE 3ZT7A 2L8KA 3E0ZA 5EZYE 3L09A 3K1SA 5L4EA 3N9NA 2XM2A 2KWIB 5LGTB 3HR0A 2K48A 5ABFA 1WFDA 4TV8E 2LRLA 2XSBA 5HEHA 5J2UE 5A1LA 2WWVA 3CIRA 4X1YE 2NOXA 5LBQB 4EIWA 5FXVA 5M4YA 2D0UA 1UX5A 2UXCT 2AE9A 1J1JA 1XZYA 2VKJA 3JC6D 4TNVA 4WNKA 2XQ8A 4DBRA 4EZHA 4AKLA 4YLHA 4CXWA 4ZEYA 4JI4T 1FMWA 2LSYA 2LM9A 4YSZA 3KDSE 4HKAA 3NBXX 1KNRA 3AE9A 2LJLA 4PFPA 4CI1B 4OYJA 3PUGA 4IDOA 4EZ4A 3VR9A 4X66T 2RP4A 2PFVA 1BR1A 1EZ3A 4HGAA 3AE3A 1HFAA 2IHR1 2KINB 1BR4A 5LGUB 3WI3A 2CWYA 1FJGT 3KVAA 2CE7A 3RQWA 4YTNA 1I6ZA 5DJQC 3KV5A 1MIWA 5CJ5A 4JUYA 1Y01A 1WCRA 4B3RT 5LMUT 4F6RC 4QH1A 5FXZA 4NUUA 2V1DB 3EI0A 1HX1B 4ILAA 5FXWA 4YSXA 4Z91A 3RIFA 3ZC1A 3AE1A 3C4XA 1MIYA 1L0VA 5J0ZA 1UUSA 3ZYLA 2DI4A 4QX8B 3FHNA 3ZJ1A 4E7ZA 1YQ3A 4X64T 5JRCA 5L2LA 3OBVE 2UXXB 2XQ6A 1G8XA 2BZBA 1OWAA 5L3DB 4KHZF 4YHJA 5L3FB 3UUXB 3ETUA 3HI2A 3E08A 1OEDA 1KNPA 4H9OC 2LM2A 5J2TE 3PE0A 2CXFA 1IJ5A 3P4SA 4HWCA 5LXTE 2BKNA 4ZI3D 1LRZA 5FL1A 4JBWF 1HG5A 4TZ4C 4O4LE 4DBQA 3NVOA 3I9YA 1FIOA 1J5WA 4GYRA 4FI5A 2MTQA 5C8YE 4X1IE 2NP9A 4JI7T 1US7B 2HH7A 2WB5A 3ETVA 2PJQA 2C0SA 2WU2A 4DR6T 3AVSA 2YEVC 4LF5T 3A7MA 2VQET 2DCFA 1OXZA 2XQ7A 4J2CA 4A98A 1OEDB 1UURA 1U4QA 2Z6EA 4CN4A 5JVDE 3EHZA 3N2GE 3JAFA 4DMVA 1S94A 4I4TE 4DR1T 2EHOD 1SUMB 5IUXA 1LKXA 2YK0A 3EAMA 3PUXF 2P9BA 3CK6A 3OJAA 2E9XB 1CUNA 4DIDB 1WYCA 4X62T 3AAAB 2VL8A 1W0BA 3IF8B 2HPLA 3TLWA 4Z8XA 3FB2A 1D1BA 3H3MA 3ZCIA 3Q5XA 3E22E 5L4HA 1JNZA 3D0TA 4O4HE 3I0OA 3ZYMA 5ETWA 3ZMZB 5AQGB 1OEDC 2A3DA 3M65A 4E7SA 4F8HA 4ILUA 5FY7A 3LK2B 3AA7B 3PURA 4K0UA 4HEAA 4IDNA 3MJXA 2NTYA 2XASB 1SHZC 1E7PA 3K3OA 4HFHA 2FJBA 4UXNB 3LG7A 2E9XC 1D1CA 1W09A 3R84B 5LJNA 4DV3T 3RKGA 2UXDT 4XAXB 5C2TA 2V6XA 2KWHA 2YDSA 4AKIA 1B7TA 1MMGA 4TX5A 3VKHA 4ASKA 4NXNT 3KVBA 4DUYT 3A5XA 3ZMSB 4B3ST 2FUPA 5GONE 1HG2A 4NIQA 2CCQA 2XAQB 2BG9A 3FBZA 3AEGA 5AQUB 2V6YB 1Z0PA 2HN2A 5AQTB 1IBMT 1M7KA 1XNQT 3UUMA 4U2ZA 4EAHA 2G0UA 1BR0A 1WRDA 1WYBA 4HWIB 3ANWA 3O1JA 5EK4A 4AQGA 1O3XA 4V1Av 5IWAT 3CKDA 1D0XA 5DABA 3OPCA 2XZEA 5HEOA 4JEHB 3VRAA 2MOZA 5LMNT 4IE7A 2MPKA 4LF4T 2JMHA 3CQCB 3HKEE 4TWDA 3AA6B 2W0GA 2N2NA 3IA3A 4PW8A 3TLTA 3MK7C 4XBFB 3AXJB 1YKEB 2LE8A 4KBMB 4JI5T 5FKYA 4HE8A 2C5KT 2VQFT 2V7IA 4HFVA 3ZYKA 2CWOA 2WM9A 1HNWT 2W63A 2H88A 2H7OA 2JIWA 4IE5A 4I0UA 4O8SA 1QLBA 2BS3A 5FNVE 3L8RA 1HS7A 4EGWA 2V8SV 4OHFA 5KDMC 3ANWB 3AE5A 4CI3B 2V26A 2CLYB 1HNZT 2QYWA 4U3CA 5JREA 4GKKT 3TLSA 3VU7H 1FMVA 2JQHA 1I94T 2VVSA 4ILBA 5AQJB 1UK5A 2W2UA 5KMGP 2WMNA 5LB7B 4JI0T 3RH3A 4Z90A 3C51A 4PAGA 5L3GB 3UU3A 2ZLYA 2WMOA 4YTPA 3C4WA 5HXRA 2MAWA 2WDVA 2CMRA 3PUZF 3TLVA 5AQVB 4X5TA 3T8OA 5CFBA 2Y48B 1WR0A 4QXCB 4ZXLA 2CLYC 3FBLA 2WDRA 4IE0A 4YHHT 3RKOA 2QA7A 4ZI3C 2X68A 3GN5B 4X1KE 4DR5T 3W15B 2XHEB 3TLUA 2W62A 3RQUA 1KF6A 2WQYA 4UELA 4I55E 1N36T 2YN6A 2EHOB 2I0MA 2YDQA 2E2AA 2LSJA 2DHRA 4TUYE 4HWHA 2VKHA 2XJ7A 2CBIA 1Y64B 1N32T 3N9OA 3AAEB 2JMKA 3VR8A 4BAYB 4COFA 2WAUA 4HWDA 2KZ7B 4NXMT 4MALA 3C50A 2VKDA 2WZHA 2UXNB 4OFZA 2BS4A 2NTXA 1W0AA 4JI2T 3RLFF 4CI2B 3QK6A 2DWKA 3UFGA 4DO0A 3FZLB 2WP9A 4DR3T 4O2AE 2PTFA 4DV6T 2WDQA 2XQ3A 5HWYA 2K24A 5AQOB 5KX5E 2EHOC 3QNUA 2KT9A 2JQKA 3RYCE 4ERRA 5FVLA 3UT5E 5AQNB 4H63H 5IYZE 4EYUA 2VVNA 1G73A 3AEFA 3CWZB 2BVLA 4QXBB 4WBNE 2I6HA 3ZPOA 4HFEA 2JPFA 5FVKA 4EEBA 5AQRB 1HX8A 5AQLB 4AIUA 4GOUA 2M67A 4QH4A 3ONJA 2ZM2A 4FJOA 2V5CA 2IW5B 2MYSA 4UF0B 4KP3C 3FZKB 2J62A 2IC9A 3WAJA 5FP3A 3I9WA 3Q2MA 5HAXA 2UUAT 5J1GA 1SE7A 2PG8A 4AI6A 1YD8G 4GK5E 2B76A 1QSDA 4C90A 4AKRB 2D5UA 3AA0B 1WLXA 2BG9E 3PJAJ 2WCAA 4LFCT 3ZT6A 1KFYA 3ZMTB 2OA5A 2HPJA 3Q5EA 4C91A 2XUEA 2LRKA 3HKDE 5LGNB 3PUWF 1NEKA 1NWMX 4P09A 5CB4E 4CXYA 3BQLA 4ILCA 2CXDA 4ZHQE 3X1DA 4IDZA 4PJMA 4UEMA 3MXZA 2XY8B 1IBLT 3O9XA 3UU6A 4LMLA 3NKZA 3RIAA 4LFBT 2KMFA 3PU3A 2VWAA 4A97A 5TAOA 2VL0A 4BJNA 4PJNA 2QVAA 3N9MA 3J7Yq 5LBMA 2J47A 3ZSTA 4LF6T 4QWNB 1HNXT 1H7CA 4CQIA 1QUUA 5FXXA 1VOMA 4ZS2A 2VASA 3P7IA 2VB6A 2E9XA 4IE6A 1UCUA 1M62A 3DTOA 4KX6A 3C4ZA 2LSKA 4IT4A 2CEAA 2K5BB 3PUQA 4AISA 2LEHA 2RA1A 3C64A 5HXEA 4H9QC 2ZM0A 4TNWA 3HA4A 3N2KE 4UVAB 1IBKT 4AQYT 2QGSA 1D1AA 4IREA 2WWUA 3K3NA 1ZEEA 3U3IA 1UGOA 2DL1A 3CPZA 5AQQB 2MBGA 4K0KT 4O2BE 1JNRA 1E2AA 3MA9A 3UTKA 2NW8A 4A5XA 4IDQA 4UV8B 2CHNA 1UX4A 4HFBA 2BKPA 5JDFA 1J5ET 4OX9T 3P4WA 2IAKA 1KEYA 4ANJA 3CQXC 2V7KA 3RYFE 3PUYF 2D9DA 2UUBT 1ZOYA 2A72A 3G06A 3Q5DA 3JAEA 5AQFB 2KLQA 2C5IT 3PUSA 3RC3A 3RRWA 1ZP0A 2K9AA 2V6YA 3AEEA 3PDYA 1MNEA 3UU5A 5AQSB 1X79A 4JI1T 4JI6T 4IIJE 4JV5T 1Z8UA 3ZMUB 1V9DA 4IE4A 2Q9QB 4LMKA 3SS1A 2XQ9A 2RPAA 3RHWA 3O1IA 2WZIA 3TKLB 4H9NC 2J1DG 4CZZB 3F31A 3PV0F 5JDHA 2F4VT 4U7YA 3PUVF 3A8YC 2IC6A 4HFCA 3AXJA 3HL6A 5JDLA 2PBIA 1D0ZA 3M3ZB 1T8BA 4ISTA 2CA5A 4QH5A 4CXXA 3N9QA 2IDOB 2YU1A 2UU9T 2ODVA 2M6BA 2W66A 2OV9A 3NRYA 5EK2A 4Q25A 3T1YT 3EVYA 5C3JA 2YU2A 2CM0A 3NZPA 4ISSA 3CX6B 1D0YA 4OK0A 3VKGA 3BQIA 4DV5T 2JQQA 4L9IA 3BQKA 3OTOT 2JQ9A 3AEDA 5E0OA 5KXJA 1ZKEA 3U78A 4PK6A 3LK42 3KV9A 3ESLA 5HWXA 5L47A 3F57A 3ZT5A 3K3QC 3LDQB 4DV7T 2X9XA 5ADXL 5AFUL 5L3CB 5H6QB 3CX7B 2XAHB 4LFAT 2W61A 5CA1E 3KV6A 2XAGB 4KMCA 4N78D 4DMWA 5HEGA 5HCMA 4DV4T 5FY0A 1XDOA 2HN1A 4HFIA 4B3MT 4TWHA 4YT0A 2M6IA 4NUVA 2SPCA 3CQGB 4LF8T 5LJMA 2VK9A 2X51A 3EDVA 5LG4A 2YINA 2H3RA 5L3BB 2ODUA 5JR9B 1S35A 4IDPA 4ZOLE 2W4XA 2V7JA 2LHNA 3ZN0B 4BJMA 2YDRA 1W9RA 3AE6A 4YTMA 5JDNA 3GN5A 4QHOA 1BR2A 4HN9A 2K3WA 1XMQT 3FZFB 2EHOA 3AEBA 2X67A 5JDGA 1WR6A 2FJDA 5HYAA 3P4QA 4WW0A 5F3JA 1OEDE 5JDMA 1GQEA 4A56A 3PUAA 3PTRB 5HXHA 4DV1T 5JR9C 1YW0A 2UUCT 5FMNA 4QXHB 2IMLA 1MIVA 5LA6E 4EXTA 4MHCA 2VURA 3QC9A 3UQ4A 4H9SE 4UVCB 2B1EA 2XPKA 3RGLA 4PJJA 5HCJA 1VCTA 4PFOA 4YFSA 4EEDA 5IHYA 3I0QA 2X66A 1R8IA 2AXDS 4GKJT 4UIGA 4KHPT 3AE7A 2KNDA 1MMAA 3CVRA 1X9BA 3L3PA 3QB5K 3IEEA 3WAKA 2X9WA 3UU4A 3KBUA 3JADA 4X65T 2CPTA 4HTEA 4UF0A 4JEUB 3FXEB 1VRBA 1XMOT 2Q9QD 5F5WA 1E1HB 5LNKA 4O4IE 4UVBB 3N5LA 5JTGA 2BVMA 5DQVA 1AJ3A 3OKQA 4P0BA 4I43B 5JDQA 3PU8A 4ZI2D 5FL0A 3O4XE 1VCSA 4TN7B 3VRBA 5DQWA 4BA9A 4ZZBA 3LBXB 4EB6E 4WZXA 4IHJE 5BR8T 4AKHA 2XTLA 3SRZA 3NRXA 3RIUC 4ZS3A 2H7VC 2LOPA 3VHLA 2CRBA 2W00A 4MBQA 2D2SA 2FJAA 3ZKRA 3FZHB 3I1AA 1DU2A 3J9X1 5ABFB 3ZSSA 3AE4A 2E5LT 5HXCA 3N2OA 2FBWA 3QB5A 3ZN1B 5JH7E 1SA0E 4I50E 4DR2T 5AQKB 2BBHA 2X0LB 1NENA 3OYXA 4PNIA 5L3EB 2V7MA 4LMJA 2BBJA 4YJ3E 2NR4A 2DNXA 3K8PC 4KUMB 3NWIA 2WS3A 3EUHA 2ACXA 3UUBA 3H3AA 3FZMB 5LCYA 2OLTA 4UR9A 3UQ7A 2W67A 4DVDA 3ZEFB 4JI3T 1IAPA 1YXRA 2XAJB 4JYAT 4P1NA 3T1HT 3AA1B 3KFWX 4PJLA 3EDUA 2FJEA 4YY3T 2UXBT 3MACA 5AQMB 2ZM8A 5F8PA 3O1HA 4LF7T 3UULA 5LHHB 3B5MA 4GYSA 5LHIB 3ZCJA 3UFEA 1HTJF 4QKNA 3ZLIA 5FYMA 4ZZCA 1MMDA 2ACZA 4CN6A 3LFMA 4DR4T 4IL4A 2WSSV 3GA8A 4U2YA 3R6NA 2CXLA 1ZHCA 2X9YA 1YKHB 5JRCB 4X20E 3AEAA 2Q9QA 2XQ4A 3B57A 4YSYA 4P0AA 3KV4A 1CHUA 2J4GA 1YQ4A 5FY1A 4WBOA 2VKOA 2XM1A 2ES0A 4MFRA 4XZCA 1XNRT 2BKOA 1T98A 2JJ9A 4ADZA 5JQGE 4B3TT 3P8CD 3HKCE 1N33T 4JLEA
chains in the Genus database with same CATH topology
4TUYE 2XAGB 4KMCA 4N78D 4DMWA 3BK9A 5FXWA 2VKHA 4IGUA 1Y64B 3FXDB 3N9OA 5FY0A 4H9PC 4TV9E 3ZC1A 3AAEB 3C4XA 1MIYA 2JMKA 3ZYLA 2DI4A 4QX8B 3FHNA 4BAYB 2WBLA 2I59A 4NUVA 3ZJ1A 4E7ZA 5L2LA 5JRCA 2SPCA 3CQGB 2WAUA 5LJMA 2KZ7B 2KXPB 2VK9A 2X51A 3OBVE 4MALA 3C50A 3EDVA 2VKDA 3LK3B 2N1GA 1LVFA 2UXXB 5LG4A 2UXNB 1ZV4X 2YINA 1G8XA 2BZBA 1OWAA 2H3RA 2NTXA 4H63V 4OFZA 4YHJA 5L3DB 5L3BB 2ODUA 5L3FB 3UUXB 5JR9B 3ZJ2A 3ETUA 3HI2A 1S35A 2D0TA 4CI2B 3QK6A 2DWKA 1KNZA 3RC8A 3E08A 4ZOLE 4DO0A 2V7JA 2LHNA 1HCIA 4O2AE 4H9OC 3ZN0B 4BJMA 5J2TE 3MKDA 3PE0A 1NAFA 4MLKA 2CXFA 5HWYA 2K24A 1IJ5A 5JDNA 2XQYA 3GN5A 4B6XA 5KX5E 2EHOC 3MZKB 4QHOA 2N9DA 1BR2A 2KT9A 3CMLA 5LXTE 4HN9A 1U5PA 3F2EA 4L5GA 3RYCE 4ZI3D 2EHOA 3Q5WA 3RPUA 2X67A 1LRZA 4UV9B 4ERRA 1HG5A 3UT5E 4TZ4C 5IYZE 4H63H 4H9RC 4O4LE 3AVRA 4DBQA 5JDGA 2L3LA 4EYUA 3I9YA 1FIOA 1WR6A 5HYAA 3AAIA 4WW0A 5F3JA 4GYRA 4FI5A 1G73A 5JDMA 2MTQA 3CWZB 5C8YE 2BVLA 4QXBB 4WBNE 4X1IE 4A56A 3ZPOA 2NP9A 3PUAA 3PTRB 4EYYR 1US7B 5HXHA 4AQFA 2HH7A 2JPFA 2E8IA 1HX8A 3ETVA 3V5UA 2Q9QC 4GOUA 2PJQA 2M67A 4QX7B 5JR9C 2C0SA 2ZM2A 1YW0A 2ZMAA 4FJOA 5FMNA 3AVSA 2YEVC 2IW5B 3SOLA 4QXHB 2MYSA 4UF0B 4KP3C 1MIVA 5LA6E 5JR9A 2IC9A 3DP7A 3N9PA 3WAJA 2LSGA 5FP3A 4EXTA 4MHCA 2DCFA 3I9WA 3Q2MA 5HAXA 1OXZA 2GK9A 3ZMVB 3QC9A 3QUJA 4JLEA 4H9SE 1FEWA 3OYZA 3RYIE 4J2CA 4UVCB 2B1EA 2LSIA 4PJJA 5J1GA 4ZI2C 1U4QA 2Z6EA 3N9LA 2JRKA 4PFOA 4YFSA 2PG8A 5JVDE 4L0RA 4AI6A 1YD8G 2Y6XA 3N2GE 4GK5E 5EK3A 1QSDA 3JC6C 4C90A 2LOSA 4DMVA 5IHYA 4AKRB 2LT3A 1S94A 2D5UA 2X66A 3AA0B 3I0QA 4I4TE 1WLXA 2EHOD 4UIGA 1LKXA 5HXSA 3IBPA 2YK0A 2KNDA 1MMAA 2P9BA 3CVRA 3OJAA 2E9XB 3ZMTB 3S4UA 2OA5A 1CUNA 2HPJA 3Q9DA 4C91A 2XUEA 3GMIA 4OYKA 3UUNA 1WYCA 3HKDE 4GK0E 3L3PA 3AAAB 5LGNB 2VL8A 3IF8B 1NWMX 3IEEA 4DNDA 2HPLA 3WAKA 2XAFB 4P09A 3CX8B 2X9WA 5CB4E 3BQLA 4CXYA 2CXDA 3C98B 4G63A 4Z8XA 3FB2A 3KBUA 5LOVE 4ZHQE 4IDZA 1D1BA 4HTEA 4PJMA 4UEMA 3MXZA 3ZCIA 3Q5XA 3E22E 4PK4A 3O9XA 4UF0A 3D0TA 4O4HE 3I0OA 4M1PA 4JEUB 3FXEB 1VRBA 2Y8DA 5ETWA 3ZMZB 3ZYMA 2Q9QD 3ZC0A 1E1HB 3GWHA 5LNKA 4O4IE 2A3DA 2KMFA 3PU3A 2VWAA 1MNDA 4UVBB 3M65A 3N5LA 3KBTA 1IZNB 3RX6A 4E7SA 2BVMA 4ILUA 5TAOA 4BJNA 4U72A 5FY7A 3LK2B 4PJNA 3AA7B 3PURA 4K0UA 5DQVA 5CA0E 3N9MA 5LHGB 3J7Yq 4HEAA 5LBMA 3MJXA 3ONXA 1AJ3A 2NTYA 2XASB 1SHZC 3OKQA 4P0BA 5LYJE 4I43B 5JDQA 4QWNB 3IHRA 3PU8A 3K3OA 4ZI2D 4UXNB 1H7CA 4CQIA 3SWHA 1QUUA 2E9XC 1VOMA 3LG7A 3O4XE 4ZS2A 5FXXA 1D1CA 5LP6E 2VASA 4TN7B 3DJBA 4EOZB 3R84B 3H37A 3KV6A 4U74A 5LJNA 3AB3B 4XAXB 5DQWA 3P7IA 2VB6A 4BA9A 2E9XA 3LBXB 4EB6E 4IE6A 2NW7A 4ZI7E 2KWHA 1UCUA 3DTOA 3C4ZA 4IHJE 4AKIA 4AQFC 2LSKA 1B7TA 2CEAA 1MMGA 2K5BB 3PUQA 4TX5A 4AKHA 3VKHA 4ASKA 2XTLA 3SRZA 1MMNA 2LEHA 3KVBA 3A5XA 3ZMSB 2C5JA 3NRXA 4ZS3A 2H7VC 3LJCA 2RA1A 3C64A 5GONE 2LOPA 5HXEA 3VHLA 4H9QC 2ZM0A 1HG2A 3V5SA 2W00A 4MBQA 2CCQA 2XAQB 3HA4A 2D2SA 3N2KE 4UVAB 2X9HA 2QGSA 1D1AA 3FBZA 2WWUA 3K3NA 1ZEEA 2DWGA 3I1AA 2NW9A 4GIWA 3J9X1 1Z0PA 3U3IA 2V7LA 3CPZA 2MBGA 4O2BE 5HXCA 3N2OA 3UUMA 2A2FX 4AXPA 3MA9A 3ZN1B 3KINB 2NW8A 3B13A 3UTKA 4EAHA 5JH7E 1SA0E 2G0UA 3HKBE 4I50E 4UV8B 1WRDA 2NWBA 1BR0A 1WYBA 1UX4A 4PK5A 3ANWA 2DLRA 3O1JA 5EK4A 4AQGA 5BMVE 1O3XA 1IJ6A 4V1Av 3CKDA 1D0XA 2X0LB 1KK7A 5H6RB 5DABA 5JDFA 3LBXA 4YJ2E 3OYXA 4PNIA 2L9QA 5L3EB 4JEHB 2V7MA 2E9XD 2IAKA 2BDEA 2MOZA 4ANJA 4YJ3E 4IE7A 4O4JE 3CQXC 1LVKA 2V7KA 2JMHA 3RYFE 3CQCB 4AKGA 2DNXA 3HKEE 2LHRA 2A72A 3K8PC 3RRCA 3AA6B 2W0GA 1HF8A 2N2NA 4PW8A 4KUMB 3MK7C 3EUHA 2ACXA 4XBFB 1YKEB 2LE8A 4KBMB 2KLQA 2C5IT 4G2AA 3H3AA 3NZQA 4HE8A 2C5KT 3RYHE 2L8KA 3PUSA 3E0ZA 5EZYE 5LCYA 2V7IA 3L09A 3RC3A 3RRWA 4HFVA 3N9NA 3ZYKA 2CWOA 2KWIB 2WM9A 5LGTB 3HR0A 2K48A 2K9AA 2W63A 4TV8E 4DVDA 3PDYA 2H7OA 1MNEA 3ZEFB 4IE5A 5A1LA 4O8SA 5J2UE 1IAPA 2XAJB 1X79A 5FNVE 4X1YE 2NOXA 5LBQB 4IIJE 3ZMUB 4EIWA 5FXVA 3AA1B 1V9DA 5M4YA 1HS7A 3KFWX 4IE4A 2D0UA 4PJLA 3EDUA 2Q9QB 3SS1A 1UX5A 4OHFA 5KDMC 3O1IA 3ANWB 3MACA 2VKJA 3JC6D 3TKLB 4WNKA 4H9NC 2ZM8A 5F8PA 2J1DG 4CI3B 4DBRA 2V26A 4EZHA 2CLYB 4CZZB 4AKLA 3F31A 3O1HA 4YLHA 4CXWA 5JDHA 5JREA 2IC6A 3UULA 5LHHB 4GYSA 5LHIB 3VU7H 1FMVA 3ZCJA 1FMWA 3UFEA 1HTJF 2LSYA 2LM9A 3KDSE 4QKNA 3ZLIA 3HL6A 5JDLA 4HKAA 3NBXX 5FYMA 2PBIA 1D0ZA 5KMGP 4ISTA 1MMDA 2LJLA 2WMNA 4PFPA 2CA5A 3RH3A 4CXXA 4CI1B 3N9QA 4OYJA 3PUGA 3C51A 2YU1A 4PAGA 2ODVA 3LFMA 3NRYA 5L3GB 5EK2A 4EZ4A 2WSSV 3GA8A 2ZLYA 2WMOA 2RP4A 2PFVA 1BR1A 3C4WA 3R6NA 3EVYA 1EZ3A 5HXRA 2CXLA 1ZHCA 4HGAA 2X9YA 2YU2A 2CM0A 3NZPA 1HFAA 1YKHB 2CMRA 2KINB 5JRCB 4X20E 4ISSA 1BR4A 3CX6B 1D0YA 4OK0A 3T8OA 5LGUB 3VKGA 2Y48B 3WI3A 2Q9QA 3BQIA 2CWYA 2JQQA 3B57A 4L9IA 3BQKA 3KVAA 2CE7A 4P0AA 4QXCB 5E0OA 2CLYC 1ZKEA 3U78A 5DJQC 3FBLA 4PK6A 3LK42 3KV4A 3KV5A 3KV9A 4IE0A 3ESLA 5HWXA 3RKOA 1MIWA 2QA7A 3F57A 5FY1A 4WBOA 4ZI3C 2VKOA 4JUYA 2X68A 2ES0A 4MFRA 4XZCA 3K3QC 3GN5B 4X1KE 3W15B 2XHEB 2X9XA 4F6RC 2W62A 5ADXL 5AFUL 5L3CB 5H6QB 3CX7B 2XAHB 1T98A 2JJ9A 4I55E 2EHOB 4UELA 4ADZA 5JQGE 2W61A 3P8CD 3HKCE 5FXZA 5CA1E 4NUUA 2V1DB 2LSJA 2DHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRX A;  5KMG P;  3NRY A; 
#chains in the Genus database with same CATH topology
 3BK9 A;  4IGU A;  3FXD B;  4KI0 F;  4H9P C;  4TV9 E;  5AQI B;  2QRX A;  5CGM A;  2WBL A;  2I59 A;  5ABH A;  2KXP B;  3LK3 B;  1N34 T;  2N1G A;  1LVF A;  4U31 A;  4DV2 T;  1ZV4 X;  4H63 V;  2LKG A;  3ZJ2 A;  2LLY A;  2D0T A;  3RC8 A;  4NPP A;  1KNZ A;  2X0Y A;  1T7S A;  1HCI A;  3P4R A;  3MKD A;  1NAF A;  4MLK A;  2XQY A;  2E5V A;  4B6X A;  3MZK B;  2IUB A;  2N9D A;  3CML A;  1U5P A;  3F2E A;  4L5G A;  2XQA A;  3SFE A;  3Q5W A;  3RPU A;  4UV9 B;  4EV6 A;  4H9R C;  3AVR A;  2L3L A;  3AAI A;  4HWF A;  3ABV A;  2BS2 A;  3RF1 A;  2WU5 A;  4U33 A;  3P50 A;  5HEU A;  4EYY R;  1XWM A;  4AQF A;  2R6G F;  3ONL C;  5HEJ A;  2E8I A;  3V5U A;  2Q9Q C;  4QX7 B;  1XDP A;  2ZMA A;  3SOL A;  5JR9 A;  3DP7 A;  3N9P A;  2LSG A;  2GK9 A;  3ZMV B;  3QUJ A;  1FEW A;  3OYZ A;  3RYI E;  2LSI A;  4ZI2 C;  2WY2 A;  3N9L A;  2JRK A;  4L0R A;  2Y6X A;  5EK3 A;  3JC6 C;  2LOS A;  2LT3 A;  2CBJ A;  5HXS A;  3IBP A;  5AQP B;  4DR7 T;  3AE8 A;  3S4U A;  3Q9D A;  4U7I A;  3GMI A;  3UUN A;  4OYK A;  4GK0 E;  4HFD A;  4DND A;  3AE2 A;  2XAF B;  2LKH A;  3CX8 B;  2XQ5 A;  3QOF A;  3C98 B;  4G63 A;  5LOV E;  4CN1 A;  4PK4 A;  4M1P A;  2Y8D A;  4TWF A;  2XSA A;  3ZC0 A;  3GWH A;  2BG9 B;  1MND A;  5AQH B;  3KBT A;  1IZN B;  3RX6 A;  2A9U A;  4DV0 T;  3EAB A;  3P4P A;  2H89 A;  4U72 A;  4WYV A;  5CA0 E;  5ABE A;  5LHG B;  3ONX A;  5LYJ E;  5ABG A;  3IHR A;  3SFD A;  3SWH A;  5LP6 E;  4EOZ B;  3DJB A;  3H37 A;  4U74 A;  3AB3 B;  2NW7 A;  4ZI7 E;  4AQF C;  1T72 A;  3LSV A;  1MMN A;  2C5J A;  3LJC A;  2V5D A;  2BG9 C;  3L39 A;  2YOE A;  3V5S A;  3RIU A;  3RI5 A;  3PJA A;  4DUZ T;  2X9H A;  2HHH T;  2DWG A;  4JI8 T;  2NW9 A;  4GIW A;  2V7L A;  2IIU A;  2ZM6 T;  2A2F X;  4AXP A;  3KIN B;  3B13 A;  3HKB E;  2NWB A;  2YKS A;  3UU8 A;  4PK5 A;  5BMV E;  2DLR A;  1HR0 T;  1IJ6 A;  5H6R B;  1KK7 A;  4YJ2 E;  3LBX A;  3OVU A;  3JCF A;  2X0H A;  2L9Q A;  2E9X D;  3AEC A;  2BDE A;  4O4J E;  1LVK A;  4AKG A;  2KSR A;  2LHR A;  3RRC A;  4YXD A;  4LF9 T;  1HF8 A;  2CHO A;  4G2A A;  3NZQ A;  4IL9 A;  5LG3 A;  3RYH E;  3ZT7 A;  2L8K A;  3E0Z A;  5EZY E;  3L09 A;  3K1S A;  5L4E A;  3N9N A;  2XM2 A;  2KWI B;  5LGT B;  3HR0 A;  2K48 A;  5ABF A;  1WFD A;  4TV8 E;  2LRL A;  2XSB A;  5HEH A;  5J2U E;  5A1L A;  2WWV A;  3CIR A;  4X1Y E;  2NOX A;  5LBQ B;  4EIW A;  5FXV A;  5M4Y A;  2D0U A;  1UX5 A;  2UXC T;  2AE9 A;  1J1J A;  1XZY A;  2VKJ A;  3JC6 D;  4TNV A;  4WNK A;  2XQ8 A;  4DBR A;  4EZH A;  4AKL A;  4YLH A;  4CXW A;  4ZEY A;  4JI4 T;  1FMW A;  2LSY A;  2LM9 A;  4YSZ A;  3KDS E;  4HKA A;  3NBX X;  1KNR A;  3AE9 A;  2LJL A;  4PFP A;  4CI1 B;  4OYJ A;  3PUG A;  4IDO A;  4EZ4 A;  3VR9 A;  4X66 T;  2RP4 A;  2PFV A;  1BR1 A;  1EZ3 A;  4HGA A;  3AE3 A;  1HFA A;  2IHR 1;  2KIN B;  1BR4 A;  5LGU B;  3WI3 A;  2CWY A;  1FJG T;  3KVA A;  2CE7 A;  3RQW A;  4YTN A;  1I6Z A;  5DJQ C;  3KV5 A;  1MIW A;  5CJ5 A;  4JUY A;  1Y01 A;  1WCR A;  4B3R T;  5LMU T;  4F6R C;  4QH1 A;  5FXZ A;  4NUU A;  2V1D B;  3EI0 A;  1HX1 B;  4ILA A;  5FXW A;  4YSX A;  4Z91 A;  3RIF A;  3ZC1 A;  3AE1 A;  3C4X A;  1MIY A;  1L0V A;  5J0Z A;  1UUS A;  3ZYL A;  2DI4 A;  4QX8 B;  3FHN A;  3ZJ1 A;  4E7Z A;  1YQ3 A;  4X64 T;  5JRC A;  5L2L A;  3OBV E;  2UXX B;  2XQ6 A;  1G8X A;  2BZB A;  1OWA A;  5L3D B;  4KHZ F;  4YHJ A;  5L3F B;  3UUX B;  3ETU A;  3HI2 A;  3E08 A;  1OED A;  1KNP A;  4H9O C;  2LM2 A;  5J2T E;  3PE0 A;  2CXF A;  1IJ5 A;  3P4S A;  4HWC A;  5LXT E;  2BKN A;  4ZI3 D;  1LRZ A;  5FL1 A;  4JBW F;  1HG5 A;  4TZ4 C;  4O4L E;  4DBQ A;  3NVO A;  3I9Y A;  1FIO A;  1J5W A;  4GYR A;  4FI5 A;  2MTQ A;  5C8Y E;  4X1I E;  2NP9 A;  4JI7 T;  1US7 B;  2HH7 A;  2WB5 A;  3ETV A;  2PJQ A;  2C0S A;  2WU2 A;  4DR6 T;  3AVS A;  2YEV C;  4LF5 T;  3A7M A;  2VQE T;  2DCF A;  1OXZ A;  2XQ7 A;  4J2C A;  4A98 A;  1OED B;  1UUR A;  1U4Q A;  2Z6E A;  4CN4 A;  5JVD E;  3EHZ A;  3N2G E;  3JAF A;  4DMV A;  1S94 A;  4I4T E;  4DR1 T;  2EHO D;  1SUM B;  5IUX A;  1LKX A;  2YK0 A;  3EAM A;  3PUX F;  2P9B A;  3CK6 A;  3OJA A;  2E9X B;  1CUN A;  4DID B;  1WYC A;  4X62 T;  3AAA B;  2VL8 A;  1W0B A;  3IF8 B;  2HPL A;  3TLW A;  4Z8X A;  3FB2 A;  1D1B A;  3H3M A;  3ZCI A;  3Q5X A;  3E22 E;  5L4H A;  1JNZ A;  3D0T A;  4O4H E;  3I0O A;  3ZYM A;  5ETW A;  3ZMZ B;  5AQG B;  1OED C;  2A3D A;  3M65 A;  4E7S A;  4F8H A;  4ILU A;  5FY7 A;  3LK2 B;  3AA7 B;  3PUR A;  4K0U A;  4HEA A;  4IDN A;  3MJX A;  2NTY A;  2XAS B;  1SHZ C;  1E7P A;  3K3O A;  4HFH A;  2FJB A;  4UXN B;  3LG7 A;  2E9X C;  1D1C A;  1W09 A;  3R84 B;  5LJN A;  4DV3 T;  3RKG A;  2UXD T;  4XAX B;  5C2T A;  2V6X A;  2KWH A;  2YDS A;  4AKI A;  1B7T A;  1MMG A;  4TX5 A;  3VKH A;  4ASK A;  4NXN T;  3KVB A;  4DUY T;  3A5X A;  3ZMS B;  4B3S T;  2FUP A;  5GON E;  1HG2 A;  4NIQ A;  2CCQ A;  2XAQ B;  2BG9 A;  3FBZ A;  3AEG A;  5AQU B;  2V6Y B;  1Z0P A;  2HN2 A;  5AQT B;  1IBM T;  1M7K A;  1XNQ T;  3UUM A;  4U2Z A;  4EAH A;  2G0U A;  1BR0 A;  1WRD A;  1WYB A;  4HWI B;  3ANW A;  3O1J A;  5EK4 A;  4AQG A;  1O3X A;  4V1A v;  5IWA T;  3CKD A;  1D0X A;  5DAB A;  3OPC A;  2XZE A;  5HEO A;  4JEH B;  3VRA A;  2MOZ A;  5LMN T;  4IE7 A;  2MPK A;  4LF4 T;  2JMH A;  3CQC B;  3HKE E;  4TWD A;  3AA6 B;  2W0G A;  2N2N A;  3IA3 A;  4PW8 A;  3TLT A;  3MK7 C;  4XBF B;  3AXJ B;  1YKE B;  2LE8 A;  4KBM B;  4JI5 T;  5FKY A;  4HE8 A;  2C5K T;  2VQF T;  2V7I A;  4HFV A;  3ZYK A;  2CWO A;  2WM9 A;  1HNW T;  2W63 A;  2H88 A;  2H7O A;  2JIW A;  4IE5 A;  4I0U A;  4O8S A;  1QLB A;  2BS3 A;  5FNV E;  3L8R A;  1HS7 A;  4EGW A;  2V8S V;  4OHF A;  5KDM C;  3ANW B;  3AE5 A;  4CI3 B;  2V26 A;  2CLY B;  1HNZ T;  2QYW A;  4U3C A;  5JRE A;  4GKK T;  3TLS A;  3VU7 H;  1FMV A;  2JQH A;  1I94 T;  2VVS A;  4ILB A;  5AQJ B;  1UK5 A;  2W2U A;  5KMG P;  2WMN A;  5LB7 B;  4JI0 T;  3RH3 A;  4Z90 A;  3C51 A;  4PAG A;  5L3G B;  3UU3 A;  2ZLY A;  2WMO A;  4YTP A;  3C4W A;  5HXR A;  2MAW A;  2WDV A;  2CMR A;  3PUZ F;  3TLV A;  5AQV B;  4X5T A;  3T8O A;  5CFB A;  2Y48 B;  1WR0 A;  4QXC B;  4ZXL A;  2CLY C;  3FBL A;  2WDR A;  4IE0 A;  4YHH T;  3RKO A;  2QA7 A;  4ZI3 C;  2X68 A;  3GN5 B;  4X1K E;  4DR5 T;  3W15 B;  2XHE B;  3TLU A;  2W62 A;  3RQU A;  1KF6 A;  2WQY A;  4UEL A;  4I55 E;  1N36 T;  2YN6 A;  2EHO B;  2I0M A;  2YDQ A;  2E2A A;  2LSJ A;  2DHR A;  4TUY E;  4HWH A;  2VKH A;  2XJ7 A;  2CBI A;  1Y64 B;  1N32 T;  3N9O A;  3AAE B;  2JMK A;  3VR8 A;  4BAY B;  4COF A;  2WAU A;  4HWD A;  2KZ7 B;  4NXM T;  4MAL A;  3C50 A;  2VKD A;  2WZH A;  2UXN B;  4OFZ A;  2BS4 A;  2NTX A;  1W0A A;  4JI2 T;  3RLF F;  4CI2 B;  3QK6 A;  2DWK A;  3UFG A;  4DO0 A;  3FZL B;  2WP9 A;  4DR3 T;  4O2A E;  2PTF A;  4DV6 T;  2WDQ A;  2XQ3 A;  5HWY A;  2K24 A;  5AQO B;  5KX5 E;  2EHO C;  3QNU A;  2KT9 A;  2JQK A;  3RYC E;  4ERR A;  5FVL A;  3UT5 E;  5AQN B;  4H63 H;  5IYZ E;  4EYU A;  2VVN A;  1G73 A;  3AEF A;  3CWZ B;  2BVL A;  4QXB B;  4WBN E;  2I6H A;  3ZPO A;  4HFE A;  2JPF A;  5FVK A;  4EEB A;  5AQR B;  1HX8 A;  5AQL B;  4AIU A;  4GOU A;  2M67 A;  4QH4 A;  3ONJ A;  2ZM2 A;  4FJO A;  2V5C A;  2IW5 B;  2MYS A;  4UF0 B;  4KP3 C;  3FZK B;  2J62 A;  2IC9 A;  3WAJ A;  5FP3 A;  3I9W A;  3Q2M A;  5HAX A;  2UUA T;  5J1G A;  1SE7 A;  2PG8 A;  4AI6 A;  1YD8 G;  4GK5 E;  2B76 A;  1QSD A;  4C90 A;  4AKR B;  2D5U A;  3AA0 B;  1WLX A;  2BG9 E;  3PJA J;  2WCA A;  4LFC T;  3ZT6 A;  1KFY A;  3ZMT B;  2OA5 A;  2HPJ A;  3Q5E A;  4C91 A;  2XUE A;  2LRK A;  3HKD E;  5LGN B;  3PUW F;  1NEK A;  1NWM X;  4P09 A;  5CB4 E;  4CXY A;  3BQL A;  4ILC A;  2CXD A;  4ZHQ E;  3X1D A;  4IDZ A;  4PJM A;  4UEM A;  3MXZ A;  2XY8 B;  1IBL T;  3O9X A;  3UU6 A;  4LML A;  3NKZ A;  3RIA A;  4LFB T;  2KMF A;  3PU3 A;  2VWA A;  4A97 A;  5TAO A;  2VL0 A;  4BJN A;  4PJN A;  2QVA A;  3N9M A;  3J7Y q;  5LBM A;  2J47 A;  3ZST A;  4LF6 T;  4QWN B;  1HNX T;  1H7C A;  4CQI A;  1QUU A;  5FXX A;  1VOM A;  4ZS2 A;  2VAS A;  3P7I A;  2VB6 A;  2E9X A;  4IE6 A;  1UCU A;  1M62 A;  3DTO A;  4KX6 A;  3C4Z A;  2LSK A;  4IT4 A;  2CEA A;  2K5B B;  3PUQ A;  4AIS A;  2LEH A;  2RA1 A;  3C64 A;  5HXE A;  4H9Q C;  2ZM0 A;  4TNW A;  3HA4 A;  3N2K E;  4UVA B;  1IBK T;  4AQY T;  2QGS A;  1D1A A;  4IRE A;  2WWU A;  3K3N A;  1ZEE A;  3U3I A;  1UGO A;  2DL1 A;  3CPZ A;  5AQQ B;  2MBG A;  4K0K T;  4O2B E;  1JNR A;  1E2A A;  3MA9 A;  3UTK A;  2NW8 A;  4A5X A;  4IDQ A;  4UV8 B;  2CHN A;  1UX4 A;  4HFB A;  2BKP A;  5JDF A;  1J5E T;  4OX9 T;  3P4W A;  2IAK A;  1KEY A;  4ANJ A;  3CQX C;  2V7K A;  3RYF E;  3PUY F;  2D9D A;  2UUB T;  1ZOY A;  2A72 A;  3G06 A;  3Q5D A;  3JAE A;  5AQF B;  2KLQ A;  2C5I T;  3PUS A;  3RC3 A;  3RRW A;  1ZP0 A;  2K9A A;  2V6Y A;  3AEE A;  3PDY A;  1MNE A;  3UU5 A;  5AQS B;  1X79 A;  4JI1 T;  4JI6 T;  4IIJ E;  4JV5 T;  1Z8U A;  3ZMU B;  1V9D A;  4IE4 A;  2Q9Q B;  4LMK A;  3SS1 A;  2XQ9 A;  2RPA A;  3RHW A;  3O1I A;  2WZI A;  3TKL B;  4H9N C;  2J1D G;  4CZZ B;  3F31 A;  3PV0 F;  5JDH A;  2F4V T;  4U7Y A;  3PUV F;  3A8Y C;  2IC6 A;  4HFC A;  3AXJ A;  3HL6 A;  5JDL A;  2PBI A;  1D0Z A;  3M3Z B;  1T8B A;  4IST A;  2CA5 A;  4QH5 A;  4CXX A;  3N9Q A;  2IDO B;  2YU1 A;  2UU9 T;  2ODV A;  2M6B A;  2W66 A;  2OV9 A;  3NRY A;  5EK2 A;  4Q25 A;  3T1Y T;  3EVY A;  5C3J A;  2YU2 A;  2CM0 A;  3NZP A;  4ISS A;  3CX6 B;  1D0Y A;  4OK0 A;  3VKG A;  3BQI A;  4DV5 T;  2JQQ A;  4L9I A;  3BQK A;  3OTO T;  2JQ9 A;  3AED A;  5E0O A;  5KXJ A;  1ZKE A;  3U78 A;  4PK6 A;  3LK4 2;  3KV9 A;  3ESL A;  5HWX A;  5L47 A;  3F57 A;  3ZT5 A;  3K3Q C;  3LDQ B;  4DV7 T;  2X9X A;  5ADX L;  5AFU L;  5L3C B;  5H6Q B;  3CX7 B;  2XAH B;  4LFA T;  2W61 A;  5CA1 E;  3KV6 A;  2XAG B;  4KMC A;  4N78 D;  4DMW A;  5HEG A;  5HCM A;  4DV4 T;  5FY0 A;  1XDO A;  2HN1 A;  4HFI A;  4B3M T;  4TWH A;  4YT0 A;  2M6I A;  4NUV A;  2SPC A;  3CQG B;  4LF8 T;  5LJM A;  2VK9 A;  2X51 A;  3EDV A;  5LG4 A;  2YIN A;  2H3R A;  5L3B B;  2ODU A;  5JR9 B;  1S35 A;  4IDP A;  4ZOL E;  2W4X A;  2V7J A;  2LHN A;  3ZN0 B;  4BJM A;  2YDR A;  1W9R A;  3AE6 A;  4YTM A;  5JDN A;  3GN5 A;  4QHO A;  1BR2 A;  4HN9 A;  2K3W A;  1XMQ T;  3FZF B;  2EHO A;  3AEB A;  2X67 A;  5JDG A;  1WR6 A;  2FJD A;  5HYA A;  3P4Q A;  4WW0 A;  5F3J A;  1OED E;  5JDM A;  1GQE A;  4A56 A;  3PUA A;  3PTR B;  5HXH A;  4DV1 T;  5JR9 C;  1YW0 A;  2UUC T;  5FMN A;  4QXH B;  2IML A;  1MIV A;  5LA6 E;  4EXT A;  4MHC A;  2VUR A;  3QC9 A;  3UQ4 A;  4H9S E;  4UVC B;  2B1E A;  2XPK A;  3RGL A;  4PJJ A;  5HCJ A;  1VCT A;  4PFO A;  4YFS A;  4EED A;  5IHY A;  3I0Q A;  2X66 A;  1R8I A;  2AXD S;  4GKJ T;  4UIG A;  4KHP T;  3AE7 A;  2KND A;  1MMA A;  3CVR A;  1X9B A;  3L3P A;  3QB5 K;  3IEE A;  3WAK A;  2X9W A;  3UU4 A;  3KBU A;  3JAD A;  4X65 T;  2CPT A;  4HTE A;  4UF0 A;  4JEU B;  3FXE B;  1VRB A;  1XMO T;  2Q9Q D;  5F5W A;  1E1H B;  5LNK A;  4O4I E;  4UVB B;  3N5L A;  5JTG A;  2BVM A;  5DQV A;  1AJ3 A;  3OKQ A;  4P0B A;  4I43 B;  5JDQ A;  3PU8 A;  4ZI2 D;  5FL0 A;  3O4X E;  1VCS A;  4TN7 B;  3VRB A;  5DQW A;  4BA9 A;  4ZZB A;  3LBX B;  4EB6 E;  4WZX A;  4IHJ E;  5BR8 T;  4AKH A;  2XTL A;  3SRZ A;  3NRX A;  3RIU C;  4ZS3 A;  2H7V C;  2LOP A;  3VHL A;  2CRB A;  2W00 A;  4MBQ A;  2D2S A;  2FJA A;  3ZKR A;  3FZH B;  3I1A A;  1DU2 A;  3J9X 1;  5ABF B;  3ZSS A;  3AE4 A;  2E5L T;  5HXC A;  3N2O A;  2FBW A;  3QB5 A;  3ZN1 B;  5JH7 E;  1SA0 E;  4I50 E;  4DR2 T;  5AQK B;  2BBH A;  2X0L B;  1NEN A;  3OYX A;  4PNI A;  5L3E B;  2V7M A;  4LMJ A;  2BBJ A;  4YJ3 E;  2NR4 A;  2DNX A;  3K8P C;  4KUM B;  3NWI A;  2WS3 A;  3EUH A;  2ACX A;  3UUB A;  3H3A A;  3FZM B;  5LCY A;  2OLT A;  4UR9 A;  3UQ7 A;  2W67 A;  4DVD A;  3ZEF B;  4JI3 T;  1IAP A;  1YXR A;  2XAJ B;  4JYA T;  4P1N A;  3T1H T;  3AA1 B;  3KFW X;  4PJL A;  3EDU A;  2FJE A;  4YY3 T;  2UXB T;  3MAC A;  5AQM B;  2ZM8 A;  5F8P A;  3O1H A;  4LF7 T;  3UUL A;  5LHH B;  3B5M A;  4GYS A;  5LHI B;  3ZCJ A;  3UFE A;  1HTJ F;  4QKN A;  3ZLI A;  5FYM A;  4ZZC A;  1MMD A;  2ACZ A;  4CN6 A;  3LFM A;  4DR4 T;  4IL4 A;  2WSS V;  3GA8 A;  4U2Y A;  3R6N A;  2CXL A;  1ZHC A;  2X9Y A;  1YKH B;  5JRC B;  4X20 E;  3AEA A;  2Q9Q A;  2XQ4 A;  3B57 A;  4YSY A;  4P0A A;  3KV4 A;  1CHU A;  2J4G A;  1YQ4 A;  5FY1 A;  4WBO A;  2VKO A;  2XM1 A;  2ES0 A;  4MFR A;  4XZC A;  1XNR T;  2BKO A;  1T98 A;  2JJ9 A;  4ADZ A;  5JQG E;  4B3T T;  3P8C D;  3HKC E;  1N33 T;  4JLE A; 
#chains in the Genus database with same CATH homology
 4TUY E;  2XAG B;  4KMC A;  4N78 D;  4DMW A;  3BK9 A;  5FXW A;  2VKH A;  4IGU A;  1Y64 B;  3FXD B;  3N9O A;  5FY0 A;  4H9P C;  4TV9 E;  3ZC1 A;  3AAE B;  3C4X A;  1MIY A;  2JMK A;  3ZYL A;  2DI4 A;  4QX8 B;  3FHN A;  4BAY B;  2WBL A;  2I59 A;  4NUV A;  3ZJ1 A;  4E7Z A;  5L2L A;  5JRC A;  2SPC A;  3CQG B;  2WAU A;  5LJM A;  2KZ7 B;  2KXP B;  2VK9 A;  2X51 A;  3OBV E;  4MAL A;  3C50 A;  3EDV A;  2VKD A;  3LK3 B;  2N1G A;  1LVF A;  2UXX B;  5LG4 A;  2UXN B;  1ZV4 X;  2YIN A;  1G8X A;  2BZB A;  1OWA A;  2H3R A;  2NTX A;  4H63 V;  4OFZ A;  4YHJ A;  5L3D B;  5L3B B;  2ODU A;  5L3F B;  3UUX B;  5JR9 B;  3ZJ2 A;  3ETU A;  3HI2 A;  1S35 A;  2D0T A;  4CI2 B;  3QK6 A;  2DWK A;  1KNZ A;  3RC8 A;  3E08 A;  4ZOL E;  4DO0 A;  2V7J A;  2LHN A;  1HCI A;  4O2A E;  4H9O C;  3ZN0 B;  4BJM A;  5J2T E;  3MKD A;  3PE0 A;  1NAF A;  4MLK A;  2CXF A;  5HWY A;  2K24 A;  1IJ5 A;  5JDN A;  2XQY A;  3GN5 A;  4B6X A;  5KX5 E;  2EHO C;  3MZK B;  4QHO A;  2N9D A;  1BR2 A;  2KT9 A;  3CML A;  5LXT E;  4HN9 A;  1U5P A;  3F2E A;  4L5G A;  3RYC E;  4ZI3 D;  2EHO A;  3Q5W A;  3RPU A;  2X67 A;  1LRZ A;  4UV9 B;  4ERR A;  1HG5 A;  3UT5 E;  4TZ4 C;  5IYZ E;  4H63 H;  4H9R C;  4O4L E;  3AVR A;  4DBQ A;  5JDG A;  2L3L A;  4EYU A;  3I9Y A;  1FIO A;  1WR6 A;  5HYA A;  3AAI A;  4WW0 A;  5F3J A;  4GYR A;  4FI5 A;  1G73 A;  5JDM A;  2MTQ A;  3CWZ B;  5C8Y E;  2BVL A;  4QXB B;  4WBN E;  4X1I E;  4A56 A;  3ZPO A;  2NP9 A;  3PUA A;  3PTR B;  4EYY R;  1US7 B;  5HXH A;  4AQF A;  2HH7 A;  2JPF A;  2E8I A;  1HX8 A;  3ETV A;  3V5U A;  2Q9Q C;  4GOU A;  2PJQ A;  2M67 A;  4QX7 B;  5JR9 C;  2C0S A;  2ZM2 A;  1YW0 A;  2ZMA A;  4FJO A;  5FMN A;  3AVS A;  2YEV C;  2IW5 B;  3SOL A;  4QXH B;  2MYS A;  4UF0 B;  4KP3 C;  1MIV A;  5LA6 E;  5JR9 A;  2IC9 A;  3DP7 A;  3N9P A;  3WAJ A;  2LSG A;  5FP3 A;  4EXT A;  4MHC A;  2DCF A;  3I9W A;  3Q2M A;  5HAX A;  1OXZ A;  2GK9 A;  3ZMV B;  3QC9 A;  3QUJ A;  4JLE A;  4H9S E;  1FEW A;  3OYZ A;  3RYI E;  4J2C A;  4UVC B;  2B1E A;  2LSI A;  4PJJ A;  5J1G A;  4ZI2 C;  1U4Q A;  2Z6E A;  3N9L A;  2JRK A;  4PFO A;  4YFS A;  2PG8 A;  5JVD E;  4L0R A;  4AI6 A;  1YD8 G;  2Y6X A;  3N2G E;  4GK5 E;  5EK3 A;  1QSD A;  3JC6 C;  4C90 A;  2LOS A;  4DMV A;  5IHY A;  4AKR B;  2LT3 A;  1S94 A;  2D5U A;  2X66 A;  3AA0 B;  3I0Q A;  4I4T E;  1WLX A;  2EHO D;  4UIG A;  1LKX A;  5HXS A;  3IBP A;  2YK0 A;  2KND A;  1MMA A;  2P9B A;  3CVR A;  3OJA A;  2E9X B;  3ZMT B;  3S4U A;  2OA5 A;  1CUN A;  2HPJ A;  3Q9D A;  4C91 A;  2XUE A;  3GMI A;  4OYK A;  3UUN A;  1WYC A;  3HKD E;  4GK0 E;  3L3P A;  3AAA B;  5LGN B;  2VL8 A;  3IF8 B;  1NWM X;  3IEE A;  4DND A;  2HPL A;  3WAK A;  2XAF B;  4P09 A;  3CX8 B;  2X9W A;  5CB4 E;  3BQL A;  4CXY A;  2CXD A;  3C98 B;  4G63 A;  4Z8X A;  3FB2 A;  3KBU A;  5LOV E;  4ZHQ E;  4IDZ A;  1D1B A;  4HTE A;  4PJM A;  4UEM A;  3MXZ A;  3ZCI A;  3Q5X A;  3E22 E;  4PK4 A;  3O9X A;  4UF0 A;  3D0T A;  4O4H E;  3I0O A;  4M1P A;  4JEU B;  3FXE B;  1VRB A;  2Y8D A;  5ETW A;  3ZMZ B;  3ZYM A;  2Q9Q D;  3ZC0 A;  1E1H B;  3GWH A;  5LNK A;  4O4I E;  2A3D A;  2KMF A;  3PU3 A;  2VWA A;  1MND A;  4UVB B;  3M65 A;  3N5L A;  3KBT A;  1IZN B;  3RX6 A;  4E7S A;  2BVM A;  4ILU A;  5TAO A;  4BJN A;  4U72 A;  5FY7 A;  3LK2 B;  4PJN A;  3AA7 B;  3PUR A;  4K0U A;  5DQV A;  5CA0 E;  3N9M A;  5LHG B;  3J7Y q;  4HEA A;  5LBM A;  3MJX A;  3ONX A;  1AJ3 A;  2NTY A;  2XAS B;  1SHZ C;  3OKQ A;  4P0B A;  5LYJ E;  4I43 B;  5JDQ A;  4QWN B;  3IHR A;  3PU8 A;  3K3O A;  4ZI2 D;  4UXN B;  1H7C A;  4CQI A;  3SWH A;  1QUU A;  2E9X C;  1VOM A;  3LG7 A;  3O4X E;  4ZS2 A;  5FXX A;  1D1C A;  5LP6 E;  2VAS A;  4TN7 B;  3DJB A;  4EOZ B;  3R84 B;  3H37 A;  3KV6 A;  4U74 A;  5LJN A;  3AB3 B;  4XAX B;  5DQW A;  3P7I A;  2VB6 A;  4BA9 A;  2E9X A;  3LBX B;  4EB6 E;  4IE6 A;  2NW7 A;  4ZI7 E;  2KWH A;  1UCU A;  3DTO A;  3C4Z A;  4IHJ E;  4AKI A;  4AQF C;  2LSK A;  1B7T A;  2CEA A;  1MMG A;  2K5B B;  3PUQ A;  4TX5 A;  4AKH A;  3VKH A;  4ASK A;  2XTL A;  3SRZ A;  1MMN A;  2LEH A;  3KVB A;  3A5X A;  3ZMS B;  2C5J A;  3NRX A;  4ZS3 A;  2H7V C;  3LJC A;  2RA1 A;  3C64 A;  5GON E;  2LOP A;  5HXE A;  3VHL A;  4H9Q C;  2ZM0 A;  1HG2 A;  3V5S A;  2W00 A;  4MBQ A;  2CCQ A;  2XAQ B;  3HA4 A;  2D2S A;  3N2K E;  4UVA B;  2X9H A;  2QGS A;  1D1A A;  3FBZ A;  2WWU A;  3K3N A;  1ZEE A;  2DWG A;  3I1A A;  2NW9 A;  4GIW A;  3J9X 1;  1Z0P A;  3U3I A;  2V7L A;  3CPZ A;  2MBG A;  4O2B E;  5HXC A;  3N2O A;  3UUM A;  2A2F X;  4AXP A;  3MA9 A;  3ZN1 B;  3KIN B;  2NW8 A;  3B13 A;  3UTK A;  4EAH A;  5JH7 E;  1SA0 E;  2G0U A;  3HKB E;  4I50 E;  4UV8 B;  1WRD A;  2NWB A;  1BR0 A;  1WYB A;  1UX4 A;  4PK5 A;  3ANW A;  2DLR A;  3O1J A;  5EK4 A;  4AQG A;  5BMV E;  1O3X A;  1IJ6 A;  4V1A v;  3CKD A;  1D0X A;  2X0L B;  1KK7 A;  5H6R B;  5DAB A;  5JDF A;  3LBX A;  4YJ2 E;  3OYX A;  4PNI A;  2L9Q A;  5L3E B;  4JEH B;  2V7M A;  2E9X D;  2IAK A;  2BDE A;  2MOZ A;  4ANJ A;  4YJ3 E;  4IE7 A;  4O4J E;  3CQX C;  1LVK A;  2V7K A;  2JMH A;  3RYF E;  3CQC B;  4AKG A;  2DNX A;  3HKE E;  2LHR A;  2A72 A;  3K8P C;  3RRC A;  3AA6 B;  2W0G A;  1HF8 A;  2N2N A;  4PW8 A;  4KUM B;  3MK7 C;  3EUH A;  2ACX A;  4XBF B;  1YKE B;  2LE8 A;  4KBM B;  2KLQ A;  2C5I T;  4G2A A;  3H3A A;  3NZQ A;  4HE8 A;  2C5K T;  3RYH E;  2L8K A;  3PUS A;  3E0Z A;  5EZY E;  5LCY A;  2V7I A;  3L09 A;  3RC3 A;  3RRW A;  4HFV A;  3N9N A;  3ZYK A;  2CWO A;  2KWI B;  2WM9 A;  5LGT B;  3HR0 A;  2K48 A;  2K9A A;  2W63 A;  4TV8 E;  4DVD A;  3PDY A;  2H7O A;  1MNE A;  3ZEF B;  4IE5 A;  5A1L A;  4O8S A;  5J2U E;  1IAP A;  2XAJ B;  1X79 A;  5FNV E;  4X1Y E;  2NOX A;  5LBQ B;  4IIJ E;  3ZMU B;  4EIW A;  5FXV A;  3AA1 B;  1V9D A;  5M4Y A;  1HS7 A;  3KFW X;  4IE4 A;  2D0U A;  4PJL A;  3EDU A;  2Q9Q B;  3SS1 A;  1UX5 A;  4OHF A;  5KDM C;  3O1I A;  3ANW B;  3MAC A;  2VKJ A;  3JC6 D;  3TKL B;  4WNK A;  4H9N C;  2ZM8 A;  5F8P A;  2J1D G;  4CI3 B;  4DBR A;  2V26 A;  4EZH A;  2CLY B;  4CZZ B;  4AKL A;  3F31 A;  3O1H A;  4YLH A;  4CXW A;  5JDH A;  5JRE A;  2IC6 A;  3UUL A;  5LHH B;  4GYS A;  5LHI B;  3VU7 H;  1FMV A;  3ZCJ A;  1FMW A;  3UFE A;  1HTJ F;  2LSY A;  2LM9 A;  3KDS E;  4QKN A;  3ZLI A;  3HL6 A;  5JDL A;  4HKA A;  3NBX X;  5FYM A;  2PBI A;  1D0Z A;  5KMG P;  4IST A;  1MMD A;  2LJL A;  2WMN A;  4PFP A;  2CA5 A;  3RH3 A;  4CXX A;  4CI1 B;  3N9Q A;  4OYJ A;  3PUG A;  3C51 A;  2YU1 A;  4PAG A;  2ODV A;  3LFM A;  3NRY A;  5L3G B;  5EK2 A;  4EZ4 A;  2WSS V;  3GA8 A;  2ZLY A;  2WMO A;  2RP4 A;  2PFV A;  1BR1 A;  3C4W A;  3R6N A;  3EVY A;  1EZ3 A;  5HXR A;  2CXL A;  1ZHC A;  4HGA A;  2X9Y A;  2YU2 A;  2CM0 A;  3NZP A;  1HFA A;  1YKH B;  2CMR A;  2KIN B;  5JRC B;  4X20 E;  4ISS A;  1BR4 A;  3CX6 B;  1D0Y A;  4OK0 A;  3T8O A;  5LGU B;  3VKG A;  2Y48 B;  3WI3 A;  2Q9Q A;  3BQI A;  2CWY A;  2JQQ A;  3B57 A;  4L9I A;  3BQK A;  3KVA A;  2CE7 A;  4P0A A;  4QXC B;  5E0O A;  2CLY C;  1ZKE A;  3U78 A;  5DJQ C;  3FBL A;  4PK6 A;  3LK4 2;  3KV4 A;  3KV5 A;  3KV9 A;  4IE0 A;  3ESL A;  5HWX A;  3RKO A;  1MIW A;  2QA7 A;  3F57 A;  5FY1 A;  4WBO A;  4ZI3 C;  2VKO A;  4JUY A;  2X68 A;  2ES0 A;  4MFR A;  4XZC A;  3K3Q C;  3GN5 B;  4X1K E;  3W15 B;  2XHE B;  2X9X A;  4F6R C;  2W62 A;  5ADX L;  5AFU L;  5L3C B;  5H6Q B;  3CX7 B;  2XAH B;  1T98 A;  2JJ9 A;  4I55 E;  2EHO B;  4UEL A;  4ADZ A;  5JQG E;  2W61 A;  3P8C D;  3HKC E;  5FXZ A;  5CA1 E;  4NUU A;  2V1D B;  2LSJ A;  2DHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...