4FJOA

Structure of the rev1 ctd-rev3/7-pol kappa rir complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
AAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/dna binding protein
molecule keywords DNA repair protein REV1
publication title Structural basis of Rev1-mediated assembly of a quaternary vertebrate translesion polymerase complex consisting of Rev1, heterodimeric Pol zeta and Pol kappa
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4fjoA00
2LSYA 4BA9A 2LSJA 2LSIA 4GK0E 2LSKA 4EXTA 3VU7H 4FJOA 2LSGA 4GK5E 2N1GA
chains in the Genus database with same CATH superfamily
2KMFA 2XSBA 4IGUA 5EZYE 2N2NA 3RGLA 4JV5T 5L2LA 2HHHT 3EDVA 4YJ2E 2HH7A 3KV6A 5HAXA 2JMKA 4AKIA 4HWFA 4KI0F 3ZT7A 4K0KT 2VQET 5FXWA 2NWBA 5JDMA 3Q9DA 1I6ZA 5AQUB 4IE0A 1X79A 3AAIA 2V7LA 3X1DA 3IA3A 4QH4A 2IMLA 3QUJA 4ZOLE 3W15B 2WBLA 3WAJA 3ZPOA 4WW0A 4U7IA 5JRCB 2PTFA 4PJNA 3MZKB 2LLYA 2Y8DA 4P0BA 3L09A 2KWHA 2YEVC 4IDQA 4YHHT 4DR6T 2BG9E 3QK6A 4HFHA 3UFGA 4NXMT 5L3CB 5F3JA 1YKHB 1KFYA 2E9XD 4UV8B 4QXHB 2MOZA 3PU3A 2OA5A 5HXSA 3ABVA 3CQCB 5GONE 4EAHA 3P7IA 4L0RA 1NAFA 3AVSA 3MKDA 2XZEA 2LHNA 3AEBA 1UX5A 2YU2A 4H63H 5HEHA 4KHZF 4NIQA 4H63V 4YTNA 2PJQA 2XAJB 4H9QC 5HCJA 3CMLA 3L8RA 2JMHA 2XSAA 4E7ZA 1SE7A 2LRLA 3AEAA 3NWIA 2OV9A 3NVOA 4GKKT 5FVKA 5LOVE 5FL1A 4DR2T 4ZEYA 2DCFA 2M67A 5J0ZA 1QSDA 1G8XA 3F31A 2XQAA 3JCFA 2VKOA 2WDVA 3C64A 1JNRA 5FY0A 4ILBA 4XBFB 1NWMX 3AEEA 4HN9A 4JEHB 1S35A 2CCQA 4NXNT 1OXZA 2BKPA 4ZHQE 1Y01A 3UQ4A 3AEDA 2DL1A 4YLHA 2X9YA 4DR4T 2LSJA 1BR4A 4AKHA 2X67A 5LGUB 4YSYA 4TWHA 4HKAA 4QX8B 3U78A 4YXDA 4HWIB 4EGWA 2LM2A 2YDQA 4NPPA 3UUMA 4ZS3A 4ISTA 4DMWA 2ZLYA 4PJLA 4C90A 3PJAA 3A7MA 2UUBT 2N1GA 4EIWA 2E5VA 3HR0A 4TWDA 3O4XE 4ZS2A 3VR8A 1XDOA 4X1KE 2DWKA 4IREA 2IC6A 1KNZA 4O4LE 4ILAA 4P09A 4P0AA 4QXCB 2BKOA 2XM2A 3E22E 4F6RC 5M4YA 1MMGA 5JDHA 1M7KA 4UVCB 3KBUA 1V9DA 1HNWT 2ODVA 2L3LA 3UUNA 5L47A 3UU3A 4DUYT 3EDUA 1HCIA 1WR6A 3K3OA 2WP9A 3RHWA 3ZKRA 1ZEEA 4U7YA 3L3PA 1XNRT 4O4JE 1EZ3A 1FIOA 2NW9A 2H89A 3VHLA 1WYCA 5FNVE 1XWMA 1KF6A 3C50A 2CLYC 2DHRA 3T8OA 2V26A 3AB3B 3Q5DA 2IW5B 5L3GB 2BZBA 2WSSV 5IHYA 5AQHB 1T8BA 5AQFB 3GN5A 5AQKB 2MBGA 4LMLA 5L3BB 4KP3C 2XAFB 2PFVA 4IDNA 3MK7C 2CRBA 2LT3A 2XQ5A 5AQMB 4CXYA 2BVLA 1HR0T 1UURA 2V6XA 4J2CA 3LK3B 5ETWA 2KXPB 2K3WA 2E2AA 2PBIA 4MHCA 4ZI3D 4X66T 1JNZA 4COFA 5L3DB 2V7KA 2X68A 3N2GE 3Q5WA 5AQOB 4Z8XA 2KZ7B 4B3MT 4NUVA 2LOSA 5LA6E 3H3MA 5LG3A 2ZM0A 2KWIB 2W63A 4UV9B 5LGTB 1M62A 2YOEA 3V5SA 4TNWA 2W2UA 5JDGA 1HG2A 3UULA 1IBLT 1Z0PA 5EK4A 4DMVA 1OEDE 5HEOA 2IIUA 3AE9A 4IE5A 2FJEA 1FJGT 2LJLA 2CA5A 2WQYA 2Y6XA 4CI3B 3ONXA 4AQGA 2ES0A 3GN5B 1U5PA 3UU4A 2YU1A 3AE4A 1SUMB 2VL8A 4PK6A 2K9AA 2XASB 4A97A 3AVRA 4BA9A 4DBQA 3VR9A 4DV5T 4JYAT 5LCYA 4IIJE 3AECA 4DV2T 5FMNA 2PG8A 1QUUA 2WDQA 1H7CA 1I94T 1ZV4X 5CA0E 4M1PA 3NRXA 4UVAB 4OX9T 2CXFA 5LGNB 1VOMA 2YDRA 4JI8T 1N34T 2XQ6A 2QVAA 2C5IT 4OFZA 2V7IA 4E7SA 1WFDA 3IF8B 2H7OA 2V5CA 5LNKA 1S94A 3O1IA 2BG9A 2V1DB 1ZOYA 5BR8T 4WZXA 4HTEA 3ZN0B 5FP3A 2VK9A 2XQ3A 3RF1A 3RYFE 3F2EA 4PW8A 4X1YE 5DJQC 3ZJ2A 5JR9C 2X9XA 3E08A 2W4XA 4CQIA 2KSRA 2BVMA 5L4EA 4ASKA 4OHFA 3CX6B 4PFPA 3BQLA 1W9RA 2XM1A 4WYVA 2CXLA 3BQKA 3CKDA 4AQFC 4I4TE 2XQ4A 5DQVA 2XQ7A 4MBQA 3LBXA 3P8CD 4DR3T 5LYJE 4JI5T 3CWZB 2C5KT 2SPCA 3PTRB 3JAEA 4QWNB 4O4HE 3AA1B 3FZFB 5LXTE 1GQEA 2UXDT 3EHZA 3PUGA 4UEMA 5HEJA 3IBPA 4DIDB 2D0UA 3CPZA 1MMAA 3FXEB 3O1HA 1G73A 2UXXB 2MTQA 4FJOA 3K8PC 2BG9B 2HPJA 3C98B 2J47A 1ZHCA 3KV5A 5H6QB 3UQ7A 4IDOA 4ILUA 1VRBA 2DI4A 2UXNB 5CJ5A 4AKLA 2XQ8A 3I0QA 3LG7A 1KEYA 4TZ4C 4B3ST 1MNEA 2VWAA 3P50A 5AQNB 3OKQA 4G63A 5FYMA 2V8SV 5L4HA 2IHR1 5LBQB 3QB5K 4WNKA 1FMWA 3TLVA 5AQQB 3CVRA 2W61A 2UXCT 2Q9QC 3LBXB 3UU5A 2UUCT 4LF8T 1W09A 4DNDA 3RX6A 4IE6A 4EZ4A 2LEHA 5FXZA 3PUXF 4LF7T 4QXBB 3F57A 4I43B 5JTGA 4AI6A 4FI5A 5AQJB 4BAYB 3KINB 4HFEA 4ZI2D 2JPFA 4U72A 1HF8A 5LMUT 2E5LT 3PDYA 4LF9T 3IEEA 4IDZA 4DBRA 4IT4A 1YW0A 4GK5E 2WY2A 3UUBA 4QX7B 2YK0A 2CHOA 5AQTB 2W00A 2D0TA 5ABGA 4U33A 5HXHA 1XMOT 5L3EB 4A5XA 3PUVF 3AE7A 4PK5A 5HXCA 1N32T 4ADZA 3AEGA 1E1HB 2N9DA 1X9BA 5H6RB 5J2TE 4HFCA 5LP6E 3PUQA 4HWHA 4IL9A 3M65A 1HS7A 4KMCA 3UU8A 4QH5A 3MJXA 1DU2A 5LJMA 3ETVA 3UFEA 3RRWA 5JVDE 3ANWA 4C91A 4CI1B 4TV8E 3RLFF 5EK3A 5AQRB 4EV6A 5JDNA 4PJJA 5JDQA 2CLYB 5AQSB 3AE2A 3Q5XA 2WZHA 3FZLB 3HI2A 3RIAA 4EB6E 2K24A 4DV6T 5LHGB 1OEDA 2WU2A 3ZC1A 3EAMA 3L39A 3KV4A 3U3IA 3RYCE 4JI1T 5AQPB 4QH1A 2Z6EA 3OTOT 1VCTA 3AXJA 2CMRA 3N9MA 1XNQT 3SS1A 2BBJA 5FY1A 1WCRA 4HWCA 3DJBA 3A5XA 5ABFA 1KNRA 2CBJA 4GOUA 5HEGA 2ZM8A 1R8IA 1IAPA 5FKYA 5FXXA 4Z91A 3K3NA 3SFDA 3CQXC 4LFAT 4HFVA 2XJ7A 4JI2T 3G06A 4I0UA 3RQUA 4K0UA 1BR1A 1O3XA 4CXXA 3N2OA 3ZSTA 4G2AA 4U2ZA 3ANWB 1E2AA 1BR0A 1N33T 2JQKA 5LJNA 3KDSE 3K1SA 3Q5EA 4TX5A 4O8SA 2EHOC 2KINB 3FZKB 2FJBA 3GMIA 3NKZA 2D5UA 2FJAA 2YKSA 3RC3A 1OEDB 2C0SA 5FVLA 3SRZA 4AIUA 2E9XC 2V7MA 5FL0A 4DV1T 5L3FB 2WCAA 2LSKA 2XHEB 3AXJB 3CX7B 1B7TA 4CN4A 2YN6A 1KK7A 5JR9A 4H9PC 4JI0T 2D9DA 2HPLA 1LKXA 3RRCA 1YQ4A 5ABFB 3LJCA 3RYIE 5FXVA 3P4SA 3P4QA 2H88A 3N5LA 3PV0F 4GKJT 4AQFA 4IDPA 2X51A 2KLQA 2VKDA 4KHPT 3N9QA 5IYZE 3NZQA 4UIGA 4AKRB 4CZZB 2KT9A 2XQ9A 1NEKA 4HFBA 2XPKA 4O2AE 4YTMA 5JQGE 2MPKA 2MYSA 3ZMVB 1MIYA 2J1DG 1ZKEA 4JBWF 5JDFA 4N78D 3HKDE 1D0XA 2I6HA 4LF6T 3M3ZB 2CE7A 4O2BE 2VURA 4CN1A 1IBKT 2WMNA 4ZI7E 4B3RT 4GYRA 4ZZBA 4JI3T 4TN7B 2XAHB 4X64T 3FZMB 2HN2A 5JR9B 2CBIA 3VRAA 3VKHA 4DR7T 3EI0A 1J5ET 4DR1T 3ZJ1A 4EEBA 2WWUA 2C5JA 4XZCA 5JH7E 3ONJA 2JQQA 4PJMA 4BJMA 3MACA 3PU8A 3ZC0A 2XAQB 2L8KA 3AE1A 2FBWA 5ADXL 3PUZF 4X5TA 3AE8A 4PNIA 4MFRA 2LKGA 3DTOA 3EVYA 1IZNB 5KMGP 4L5GA 4Q25A 5LG4A 3RKGA 3OPCA 3TLWA 5ABHA 4X62T 3O1JA 2CPTA 3WI3A 3PUWF 4LFCT 2X0YA 1IJ6A 3J9X1 2YINA 3OVUA 2MAWA 1US7B 3TKLB 4JI6T 5HWXA 1XZYA 3RKOA 3NZPA 4U3CA 2LSIA 4A98A 2OLTA 3ZN1B 3CIRA 4NUUA 3Q2MA 2GK9A 2NW8A 2QYWA 1KNPA 2CM0A 2BDEA 4AISA 3PUSA 4YT0A 4EYYR 3T1HT 2WU5A 3I0OA 2VVSA 3N2KE 2AXDS 2FJDA 4KBMB 4B6XA 1J5WA 4IE4A 2LM9A 5J1GA 4AXPA 4YFSA 3O9XA 2JRKA 4H9SE 3RYHE 3PUAA 3ZT6A 1YKEB 4HEAA 3PJAJ 3IHRA 3I9YA 5ABEA 5LHIB 4UVBB 4ZI3C 4OYJA 3OYXA 5C3JA 3ZYKA 2W66A 1FMVA 2BS3A 3HA4A 1VCSA 1ZP0A 1WLXA 3HKCE 4KUMB 3P4RA 2YDSA 5F8PA 3SOLA 1LVFA 1MIWA 3BK9A 4PAGA 4MALA 5BMVE 1YXRA 2ODUA 3SWHA 1SHZC 3P4WA 5KXJA 3FHNA 2WZIA 3ZSSA 2A9UA 5IUXA 3NRYA 3ZYMA 2XY8B 4TV9E 3CX8B 2RP4A 3ZYLA 3RIFA 3DP7A 4HWDA 4ZXLA 3GA8A 2IAKA 4UXNB 2ZM6T 3C4ZA 3JAFA 3ZMTB 4I50E 3C51A 4BJNA 4OYKA 1HX1B 3ZCJA 4X1IE 2HN1A 2EHOD 2W62A 1HTJF 4HFDA 3KV9A 3K3QC 1UCUA 5DQWA 2QGSA 4EXTA 1IBMT 3AAAB 2J62A 1UGOA 2WAUA 4L9IA 2XTLA 2BKNA 2XAGB 2BG9C 3ZCIA 3RIUC 4YY3T 3R6NA 4X20E 1IJ5A 4F8HA 5CFBA 2EHOA 1SA0E 2VKHA 3C4WA 2R6GF 5KX5E 3SFEA 2F4VT 2JJ9A 1WYBA 4HE8A 3EUHA 5AFUL 4LMKA 2JQHA 2E9XA 3R84B 3VU7H 5CGMA 3ZMSB 4DO0A 4LF4T 4U2YA 1FEWA 4DV4T 3RI5A 5CB4E 2E8IA 3AE6A 1MMDA 2FUPA 4DV0T 5TAOA 3PURA 2QRXA 2ACXA 3RC8A 5A1LA 2WS3A 1WRDA 4KX6A 4ISSA 2UU9T 3QC9A 2NOXA 3UU6A 4OK0A 2NTXA 4QKNA 3LDQB 3B5MA 1T7SA 3AE5A 2NP9A 3JC6C 3H37A 2WWVA 5HYAA 5FY7A 5HWYA 3P4PA 3V5UA 2EHOB 3B13A 2VL0A 1D1CA 3QNUA 1E7PA 2XUEA 3N9NA 1HNZT 1W0AA 3TLTA 2M6IA 4O4IE 3NBXX 2ACZA 2AE9A 4TUYE 4GYSA 2P9BA 2E9XB 2DLRA 2NW7A 4ANJA 3PUYF 4XAXB 3LK2B 3JADA 3CK6A 4IL4A 1UUSA 3HKBE 2BS4A 2H3RA 1HG5A 2QA7A 2D2SA 4U31A 2X0HA 2A72A 3ZT5A 1L0VA 1D0ZA 4Z90A 2L9QA 4EEDA 2V5DA 4H9RC 1U4QA 3FZHB 1CUNA 3KFWX 4QHOA 5IWAT 1T98A 2ZM2A 4YHJA 2VB6A 2LSGA 3ZMZB 2JQ9A 1HFAA 5C2TA 4YJ3E 3AA0B 4CI2B 4MLKA 4YSXA 3FB2A 1NENA 3E0ZA 3ZEFB 1OWAA 4EOZB 4JEUB 4WBNE 2UUAT 5LBMA 5LB7B 5AQLB 4TNVA 4DVDA 4JLEA 2NTYA 3A8YC 4HGAA 3KBTA 2DWGA 5C8YE 3T1YT 4JUYA 2WB5A 4DUZT 5HXEA 4ILCA 4H9OC 1HNXT 5HXRA 1QLBA 3N9OA 4ZI2C 2VASA 2VKJA 3OJAA 2WMOA 3TLUA 2W0GA 1LRZA 2JIWA 4IHJE 5AQGB 3PE0A 4UF0A 3RPUA 2X9WA 3MA9A 1W0BA 4JI4T 4PFOA 2VQFT 4YSZA 3QB5A 3N9LA 4IE7A 3ESLA 4DV7T 1LVKA 3FXDB 1J1JA 2X9HA 3LFMA 3EABA 2RA1A 2IC9A 4LFBT 5LMNT 3UTKA 1XDPA 1YQ3A 3I1AA 2W67A 2WDRA 3AAEB 3ETUA 1T72A 2LRKA 2B76A 4I55E 2X66A 2IDOB 3AA7B 4H9NC 2LE8A 2G0UA 2CWOA 2CEAA 3CQGB 2J4GA 3N9PA 5EK2A 1MMNA 4V1Av 2LKHA 4X65T 2Q9QD 2BBHA 3OYZA 3LSVA 3AA6B 1OEDC 2B1EA 4B3TT 1UK5A 2CXDA 3MXZA 3ONLC 4ZZCA 1D0YA 2ZMAA 3C4XA 3TLSA 1MNDA 5DABA 4LMJA 4ERRA 2A3DA 3VKGA 4UF0B 2Q9QA 3J7Yq 2UXBT 5J2UE 2A2FX 2K5BB 2Y48B 5F5WA 4DV3T 1AJ3A 1D1BA 2V6YA 5AQIB 3HKEE 1YD8G 3B57A 5HCMA 3WAKA 2CHNA 4LF5T 2RPAA 5CA1E 5E0OA 3KVBA 4UR9A 2H7VC 2I0MA 4CXWA 4YTPA 4U74A 5AQVB 3FBZA 3GWHA 3RIUA 2LSYA 3S4UA 4HFIA 5HEUA 3AEFA 4EZHA 1N36T 4CN6A 2BS2A 5JREA 4AKGA 4GIWA 2KNDA 4GK0E 1Y64B 1CHUA 1D1AA 3QOFA 5JDLA 2LOPA 4PK4A 3OBVE 1HX8A 5LHHB 4AQYT 2NR4A 1Z8UA 3RH3A 1MIVA 3I9WA 4DR5T 2Q9QB 3FBLA 1WR0A 3UUXB 5JRCA 2V6YB 2V7JA 3JC6D 3VRBA 2K48A 3ZMUB 3KVAA 2M6BA 1UX4A 4WBOA 3LK42 2X0LB 4A56A 4EYUA 3HL6A 2I59A 2XQYA 2VVNA 2IUBA 3BQIA 3ZLIA 3AE3A 1BR2A 4JI7T 2LHRA 4P1NA 3D0TA 1XMQT 5KDMC 4TWFA 4UELA 2CWYA 3UT5E 3H3AA 3RQWA 2WM9A 2DNXA
chains in the Genus database with same CATH topology
2KMFA 5FMNA 2PG8A 1QUUA 4IGUA 1H7CA 3GMIA 5TAOA 3PURA 5EZYE 2ACXA 3RC8A 2D5UA 5A1LA 2N2NA 3RC3A 1ZV4X 1WRDA 2C0SA 5CA0E 4M1PA 3SRZA 5L2LA 3EDVA 4YJ2E 3NRXA 4UVAB 2HH7A 4ISSA 3KV6A 5HAXA 2E9XC 2JMKA 2V7MA 5L3FB 3QC9A 4AKIA 2NOXA 2LSKA 2CXFA 2XHEB 5LGNB 2EHOC 3CX7B 1B7TA 2NWBA 5FXWA 1VOMA 4OK0A 5JDMA 2NTXA 1KK7A 4QKNA 4H9PC 5JR9A 3Q9DA 2C5IT 2HPLA 4OFZA 4IE0A 2V7IA 1X79A 1LKXA 4E7SA 3AAIA 3RRCA 3IF8B 3LJCA 3RYIE 2H7OA 2NP9A 3JC6C 2V7LA 3H37A 5LNKA 1S94A 3O1IA 2V1DB 5FXVA 5HYAA 5FY7A 4ZOLE 3QUJA 3W15B 5HWYA 2WBLA 3WAJA 4HTEA 3N5LA 3V5UA 2EHOB 3ZN0B 3ZPOA 4WW0A 3B13A 5JRCB 4AQFA 4PJNA 1D1CA 3MZKB 2X51A 2KLQA 2VKDA 5FP3A 2XUEA 2Y8DA 2VK9A 3N9NA 3L09A 4P0BA 2KWHA 2YEVC 3N9QA 4O4IE 3NBXX 5IYZE 3NZQA 4UIGA 4AKRB 3RYFE 4TUYE 4CZZB 4GYSA 2P9BA 2KT9A 3F2EA 2E9XB 4PW8A 2DLRA 4X1YE 5DJQC 3QK6A 2NW7A 3ZJ2A 2X9XA 5JR9C 4O2AE 4ANJA 5JQGE 3E08A 5L3CB 5F3JA 1YKHB 4CQIA 2E9XD 4UV8B 2MYSA 3ZMVB 4XAXB 2BVMA 3LK2B 1MIYA 2MOZA 4QXHB 3PU3A 4ASKA 2J1DG 2OA5A 5HXSA 4OHFA 1ZKEA 3CQCB 5GONE 3HKBE 3CX6B 4EAHA 4PFPA 2H3RA 1HG5A 2QA7A 3BQLA 2CXLA 2D2SA 3BQKA 5JDFA 4N78D 3HKDE 3P7IA 1D0XA 4L0RA 3CKDA 4AQFC 1NAFA 2A72A 4I4TE 2CE7A 5DQVA 4O2BE 3AVSA 1D0ZA 2L9QA 3MKDA 4MBQA 3LBXA 2WMNA 2LHNA 4ZI7E 3P8CD 1UX5A 2YU2A 4H63H 5LYJE 3CWZB 2C5KT 2SPCA 4H9RC 4GYRA 3PTRB 4QWNB 4TN7B 1U4QA 4O4HE 3AA1B 2XAHB 5LXTE 1CUNA 4H63V 3KFWX 4QHOA 2PJQA 1T98A 2XAJB 2ZM2A 3PUGA 4YHJA 4UEMA 4H9QC 2VB6A 2LSGA 3CMLA 3IBPA 2JMHA 5JR9B 2D0UA 3ZMZB 1HFAA 4YJ3E 4E7ZA 3AA0B 1MMAA 3CPZA 3FXEB 4MLKA 4CI2B 3O1HA 1G73A 3VKHA 3FB2A 3E0ZA 3ZEFB 1OWAA 3ZJ1A 2UXXB 4EOZB 2MTQA 2WWUA 4FJOA 3K8PC 2C5JA 4XZCA 5JH7E 2HPJA 4JEUB 4WBNE 2JQQA 4PJMA 5LOVE 3C98B 4BJMA 1ZHCA 5LBMA 3KV5A 3MACA 2DCFA 3PU8A 5H6QB 3ZC0A 2XAQB 2M67A 2L8KA 4DVDA 4ILUA 4JLEA 2NTYA 1QSDA 1VRBA 1G8XA 4HGAA 3KBTA 3F31A 5ADXL 2DWGA 2VKOA 3C64A 2DI4A 5C8YE 5FY0A 4JUYA 4PNIA 4XBFB 4MFRA 1NWMX 3DTOA 4HN9A 3EVYA 4JEHB 1S35A 2UXNB 2CCQA 5HXEA 4AKLA 1IZNB 1OXZA 4H9OC 5KMGP 3I0QA 3LG7A 4L5GA 4ZHQE 5LG4A 5HXRA 4TZ4C 3N9OA 4ZI2C 1MNEA 2VASA 2VWAA 2VKJA 3OKQA 3OJAA 4G63A 5FYMA 3O1JA 2WMOA 2W0GA 4YLHA 3WI3A 2X9YA 5LBQB 2LSJA 1BR4A 4WNKA 1FMWA 4AKHA 2X67A 5LGUB 3CVRA 1LRZA 1IJ6A 3J9X1 4HKAA 4IHJE 2YINA 4QX8B 3U78A 2W61A 3PE0A 4UF0A 1US7B 2Q9QC 3LBXB 3RPUA 3TKLB 5HWXA 2X9WA 3RKOA 4DNDA 3RX6A 3MA9A 3NZPA 4IE6A 4PFOA 2LSIA 3UUMA 2LEHA 4ZS3A 4EZ4A 4ISTA 5FXZA 3ZN1B 3N9LA 3F57A 4QXBB 4DMWA 2ZLYA 4IE7A 3ESLA 4I43B 4PJLA 4NUUA 3Q2MA 1LVKA 2GK9A 3FXDB 2NW8A 4C90A 2X9HA 2N1GA 4EIWA 4AI6A 3LFMA 2RA1A 2IC9A 3HR0A 2CM0A 3O4XE 4FI5A 2BDEA 4ZS2A 3PUSA 3UTKA 3I1AA 4BAYB 4EYYR 4X1KE 3KINB 4ZI2D 2DWKA 2JPFA 3AAEB 3ETUA 4U72A 1HF8A 2IC6A 1KNZA 4O4LE 3I0OA 4I55E 3PDYA 2X66A 4P09A 3N2KE 4P0AA 3AA7B 3IEEA 4H9NC 4QXCB 2LE8A 2G0UA 2CWOA 4IDZA 4KBMB 3E22E 4F6RC 4DBRA 4B6XA 5M4YA 1MMGA 2CEAA 5JDHA 4IE4A 3CQGB 4UVCB 1YW0A 3KBUA 3N9PA 1V9DA 2LM9A 5EK2A 4GK5E 1MMNA 5J1GA 2ODVA 2L3LA 4V1Av 4AXPA 4YFSA 3UUNA 2Q9QD 3O9XA 2JRKA 3OYZA 3EDUA 4QX7B 3AA6B 4H9SE 3RYHE 2B1EA 1HCIA 1WR6A 3PUAA 3K3OA 1YKEB 4HEAA 2YK0A 2CXDA 3MXZA 2W00A 1ZEEA 2D0TA 3I9YA 3IHRA 1D0YA 2ZMAA 3L3PA 5HXHA 3C4XA 5L3EB 5LHIB 4O4JE 1MNDA 1EZ3A 4UVBB 1FIOA 4ZI3C 2NW9A 4OYJA 3OYXA 3VHLA 5DABA 4PK5A 1WYCA 3ZYKA 1FMVA 5FNVE 5HXCA 3C50A 3HA4A 4ADZA 4ERRA 2A3DA 1E1HB 2CLYC 2DHRA 2N9DA 3T8OA 3VKGA 1WLXA 2Q9QA 2V26A 4UF0B 5H6RB 5J2TE 3J7Yq 3HKCE 5J2UE 2A2FX 2K5BB 4KUMB 2Y48B 3AB3B 5F8PA 5LP6E 3SOLA 3PUQA 1LVFA 2IW5B 5L3GB 1MIWA 2BZBA 3BK9A 4PAGA 1AJ3A 1D1BA 4MALA 5BMVE 2WSSV 3M65A 2ODUA 5IHYA 1HS7A 3HKEE 3SWHA 4KMCA 3GN5A 1YD8G 2MBGA 1SHZC 3MJXA 5L3BB 3B57A 4KP3C 2XAFB 2PFVA 3FHNA 5LJMA 3ETVA 3MK7C 2LT3A 3NRYA 3ZYMA 4TV9E 3CX8B 3RRWA 3UFEA 2RP4A 5JVDE 3WAKA 3ZYLA 3DP7A 4CXYA 3ANWA 4C91A 4CI1B 4TV8E 2BVLA 3GA8A 2IAKA 4J2CA 5ETWA 3LK3B 4UXNB 5CA1E 5E0OA 3KVBA 5EK3A 2H7VC 2KXPB 4CXWA 4U74A 5JDNA 3FBZA 3C4ZA 4PJJA 5JDQA 2CLYB 3GWHA 2PBIA 4MHCA 4ZI3D 3Q5XA 2LSYA 3S4UA 3ZMTB 3HI2A 5L3DB 4EZHA 4I50E 2V7KA 2X68A 4EB6E 3N2GE 3C51A 3Q5WA 2K24A 4BJNA 4Z8XA 5LHGB 5JREA 4AKGA 4OYKA 4GIWA 2KZ7B 2KNDA 3ZCJA 3ZC1A 4X1IE 4GK0E 4NUVA 2LOSA 3KV4A 3U3IA 5LA6E 3RYCE 2EHOD 1Y64B 2ZM0A 2KWIB 2W62A 1D1AA 1HTJF 2Z6EA 5JDLA 2W63A 4UV9B 3KV9A 2CMRA 2LOPA 5LGTB 3N9MA 4PK4A 3OBVE 3K3QC 1UCUA 5DQWA 3V5SA 1HX8A 2QGSA 3SS1A 4EXTA 5FY1A 5JDGA 1HG2A 3AAAB 3DJBA 3A5XA 5LHHB 3UULA 2WAUA 1Z0PA 2XTLA 4L9IA 3RH3A 5EK4A 4GOUA 2XAGB 4DMVA 1MIVA 3I9WA 2Q9QB 3FBLA 4IE5A 3ZCIA 2ZM8A 1IAPA 3R6NA 4X20E 1IJ5A 5FXXA 2EHOA 3UUXB 1SA0E 2LJLA 2VKHA 3C4WA 3K3NA 2CA5A 5JRCA 5KX5E 3CQXC 2Y6XA 2V7JA 3JC6D 4CI3B 3ONXA 4AQGA 4HFVA 2ES0A 2JJ9A 3GN5B 1U5PA 2K48A 1WYBA 4HE8A 3ZMUB 3EUHA 5AFUL 2YU1A 3KVAA 1UX4A 4K0UA 2VL8A 4PK6A 3LK42 4WBOA 2E9XA 2X0LB 2K9AA 2XASB 3R84B 3VU7H 1BR1A 3ZMSB 1O3XA 4CXXA 3N2OA 4A56A 4EYUA 3HL6A 2I59A 2XQYA 3AVRA 4G2AA 4DO0A 3ANWB 3BQIA 3ZLIA 1BR0A 1BR2A 1FEWA 4BA9A 4DBQA 5LJNA 2LHRA 3D0TA 5KDMC 5LCYA 4UELA 5CB4E 2CWYA 3KDSE 2E8IA 4IIJE 3UT5E 3H3AA 2WM9A 1MMDA 4TX5A 4O8SA 2DNXA 2KINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSY A;  4BA9 A;  2LSJ A;  2LSI A;  4GK0 E;  2LSK A;  4EXT A;  3VU7 H;  4FJO A;  2LSG A;  4GK5 E;  2N1G A; 
#chains in the Genus database with same CATH topology
 2KMF A;  2XSB A;  4IGU A;  5EZY E;  2N2N A;  3RGL A;  4JV5 T;  5L2L A;  2HHH T;  3EDV A;  4YJ2 E;  2HH7 A;  3KV6 A;  5HAX A;  2JMK A;  4AKI A;  4HWF A;  4KI0 F;  3ZT7 A;  4K0K T;  2VQE T;  5FXW A;  2NWB A;  5JDM A;  3Q9D A;  1I6Z A;  5AQU B;  4IE0 A;  1X79 A;  3AAI A;  2V7L A;  3X1D A;  3IA3 A;  4QH4 A;  2IML A;  3QUJ A;  4ZOL E;  3W15 B;  2WBL A;  3WAJ A;  3ZPO A;  4WW0 A;  4U7I A;  5JRC B;  2PTF A;  4PJN A;  3MZK B;  2LLY A;  2Y8D A;  4P0B A;  3L09 A;  2KWH A;  2YEV C;  4IDQ A;  4YHH T;  4DR6 T;  2BG9 E;  3QK6 A;  4HFH A;  3UFG A;  4NXM T;  5L3C B;  5F3J A;  1YKH B;  1KFY A;  2E9X D;  4UV8 B;  4QXH B;  2MOZ A;  3PU3 A;  2OA5 A;  5HXS A;  3ABV A;  3CQC B;  5GON E;  4EAH A;  3P7I A;  4L0R A;  1NAF A;  3AVS A;  3MKD A;  2XZE A;  2LHN A;  3AEB A;  1UX5 A;  2YU2 A;  4H63 H;  5HEH A;  4KHZ F;  4NIQ A;  4H63 V;  4YTN A;  2PJQ A;  2XAJ B;  4H9Q C;  5HCJ A;  3CML A;  3L8R A;  2JMH A;  2XSA A;  4E7Z A;  1SE7 A;  2LRL A;  3AEA A;  3NWI A;  2OV9 A;  3NVO A;  4GKK T;  5FVK A;  5LOV E;  5FL1 A;  4DR2 T;  4ZEY A;  2DCF A;  2M67 A;  5J0Z A;  1QSD A;  1G8X A;  3F31 A;  2XQA A;  3JCF A;  2VKO A;  2WDV A;  3C64 A;  1JNR A;  5FY0 A;  4ILB A;  4XBF B;  1NWM X;  3AEE A;  4HN9 A;  4JEH B;  1S35 A;  2CCQ A;  4NXN T;  1OXZ A;  2BKP A;  4ZHQ E;  1Y01 A;  3UQ4 A;  3AED A;  2DL1 A;  4YLH A;  2X9Y A;  4DR4 T;  2LSJ A;  1BR4 A;  4AKH A;  2X67 A;  5LGU B;  4YSY A;  4TWH A;  4HKA A;  4QX8 B;  3U78 A;  4YXD A;  4HWI B;  4EGW A;  2LM2 A;  2YDQ A;  4NPP A;  3UUM A;  4ZS3 A;  4IST A;  4DMW A;  2ZLY A;  4PJL A;  4C90 A;  3PJA A;  3A7M A;  2UUB T;  2N1G A;  4EIW A;  2E5V A;  3HR0 A;  4TWD A;  3O4X E;  4ZS2 A;  3VR8 A;  1XDO A;  4X1K E;  2DWK A;  4IRE A;  2IC6 A;  1KNZ A;  4O4L E;  4ILA A;  4P09 A;  4P0A A;  4QXC B;  2BKO A;  2XM2 A;  3E22 E;  4F6R C;  5M4Y A;  1MMG A;  5JDH A;  1M7K A;  4UVC B;  3KBU A;  1V9D A;  1HNW T;  2ODV A;  2L3L A;  3UUN A;  5L47 A;  3UU3 A;  4DUY T;  3EDU A;  1HCI A;  1WR6 A;  3K3O A;  2WP9 A;  3RHW A;  3ZKR A;  1ZEE A;  4U7Y A;  3L3P A;  1XNR T;  4O4J E;  1EZ3 A;  1FIO A;  2NW9 A;  2H89 A;  3VHL A;  1WYC A;  5FNV E;  1XWM A;  1KF6 A;  3C50 A;  2CLY C;  2DHR A;  3T8O A;  2V26 A;  3AB3 B;  3Q5D A;  2IW5 B;  5L3G B;  2BZB A;  2WSS V;  5IHY A;  5AQH B;  1T8B A;  5AQF B;  3GN5 A;  5AQK B;  2MBG A;  4LML A;  5L3B B;  4KP3 C;  2XAF B;  2PFV A;  4IDN A;  3MK7 C;  2CRB A;  2LT3 A;  2XQ5 A;  5AQM B;  4CXY A;  2BVL A;  1HR0 T;  1UUR A;  2V6X A;  4J2C A;  3LK3 B;  5ETW A;  2KXP B;  2K3W A;  2E2A A;  2PBI A;  4MHC A;  4ZI3 D;  4X66 T;  1JNZ A;  4COF A;  5L3D B;  2V7K A;  2X68 A;  3N2G E;  3Q5W A;  5AQO B;  4Z8X A;  2KZ7 B;  4B3M T;  4NUV A;  2LOS A;  5LA6 E;  3H3M A;  5LG3 A;  2ZM0 A;  2KWI B;  2W63 A;  4UV9 B;  5LGT B;  1M62 A;  2YOE A;  3V5S A;  4TNW A;  2W2U A;  5JDG A;  1HG2 A;  3UUL A;  1IBL T;  1Z0P A;  5EK4 A;  4DMV A;  1OED E;  5HEO A;  2IIU A;  3AE9 A;  4IE5 A;  2FJE A;  1FJG T;  2LJL A;  2CA5 A;  2WQY A;  2Y6X A;  4CI3 B;  3ONX A;  4AQG A;  2ES0 A;  3GN5 B;  1U5P A;  3UU4 A;  2YU1 A;  3AE4 A;  1SUM B;  2VL8 A;  4PK6 A;  2K9A A;  2XAS B;  4A97 A;  3AVR A;  4BA9 A;  4DBQ A;  3VR9 A;  4DV5 T;  4JYA T;  5LCY A;  4IIJ E;  3AEC A;  4DV2 T;  5FMN A;  2PG8 A;  1QUU A;  2WDQ A;  1H7C A;  1I94 T;  1ZV4 X;  5CA0 E;  4M1P A;  3NRX A;  4UVA B;  4OX9 T;  2CXF A;  5LGN B;  1VOM A;  2YDR A;  4JI8 T;  1N34 T;  2XQ6 A;  2QVA A;  2C5I T;  4OFZ A;  2V7I A;  4E7S A;  1WFD A;  3IF8 B;  2H7O A;  2V5C A;  5LNK A;  1S94 A;  3O1I A;  2BG9 A;  2V1D B;  1ZOY A;  5BR8 T;  4WZX A;  4HTE A;  3ZN0 B;  5FP3 A;  2VK9 A;  2XQ3 A;  3RF1 A;  3RYF E;  3F2E A;  4PW8 A;  4X1Y E;  5DJQ C;  3ZJ2 A;  5JR9 C;  2X9X A;  3E08 A;  2W4X A;  4CQI A;  2KSR A;  2BVM A;  5L4E A;  4ASK A;  4OHF A;  3CX6 B;  4PFP A;  3BQL A;  1W9R A;  2XM1 A;  4WYV A;  2CXL A;  3BQK A;  3CKD A;  4AQF C;  4I4T E;  2XQ4 A;  5DQV A;  2XQ7 A;  4MBQ A;  3LBX A;  3P8C D;  4DR3 T;  5LYJ E;  4JI5 T;  3CWZ B;  2C5K T;  2SPC A;  3PTR B;  3JAE A;  4QWN B;  4O4H E;  3AA1 B;  3FZF B;  5LXT E;  1GQE A;  2UXD T;  3EHZ A;  3PUG A;  4UEM A;  5HEJ A;  3IBP A;  4DID B;  2D0U A;  3CPZ A;  1MMA A;  3FXE B;  3O1H A;  1G73 A;  2UXX B;  2MTQ A;  4FJO A;  3K8P C;  2BG9 B;  2HPJ A;  3C98 B;  2J47 A;  1ZHC A;  3KV5 A;  5H6Q B;  3UQ7 A;  4IDO A;  4ILU A;  1VRB A;  2DI4 A;  2UXN B;  5CJ5 A;  4AKL A;  2XQ8 A;  3I0Q A;  3LG7 A;  1KEY A;  4TZ4 C;  4B3S T;  1MNE A;  2VWA A;  3P50 A;  5AQN B;  3OKQ A;  4G63 A;  5FYM A;  2V8S V;  5L4H A;  2IHR 1;  5LBQ B;  3QB5 K;  4WNK A;  1FMW A;  3TLV A;  5AQQ B;  3CVR A;  2W61 A;  2UXC T;  2Q9Q C;  3LBX B;  3UU5 A;  2UUC T;  4LF8 T;  1W09 A;  4DND A;  3RX6 A;  4IE6 A;  4EZ4 A;  2LEH A;  5FXZ A;  3PUX F;  4LF7 T;  4QXB B;  3F57 A;  4I43 B;  5JTG A;  4AI6 A;  4FI5 A;  5AQJ B;  4BAY B;  3KIN B;  4HFE A;  4ZI2 D;  2JPF A;  4U72 A;  1HF8 A;  5LMU T;  2E5L T;  3PDY A;  4LF9 T;  3IEE A;  4IDZ A;  4DBR A;  4IT4 A;  1YW0 A;  4GK5 E;  2WY2 A;  3UUB A;  4QX7 B;  2YK0 A;  2CHO A;  5AQT B;  2W00 A;  2D0T A;  5ABG A;  4U33 A;  5HXH A;  1XMO T;  5L3E B;  4A5X A;  3PUV F;  3AE7 A;  4PK5 A;  5HXC A;  1N32 T;  4ADZ A;  3AEG A;  1E1H B;  2N9D A;  1X9B A;  5H6R B;  5J2T E;  4HFC A;  5LP6 E;  3PUQ A;  4HWH A;  4IL9 A;  3M65 A;  1HS7 A;  4KMC A;  3UU8 A;  4QH5 A;  3MJX A;  1DU2 A;  5LJM A;  3ETV A;  3UFE A;  3RRW A;  5JVD E;  3ANW A;  4C91 A;  4CI1 B;  4TV8 E;  3RLF F;  5EK3 A;  5AQR B;  4EV6 A;  5JDN A;  4PJJ A;  5JDQ A;  2CLY B;  5AQS B;  3AE2 A;  3Q5X A;  2WZH A;  3FZL B;  3HI2 A;  3RIA A;  4EB6 E;  2K24 A;  4DV6 T;  5LHG B;  1OED A;  2WU2 A;  3ZC1 A;  3EAM A;  3L39 A;  3KV4 A;  3U3I A;  3RYC E;  4JI1 T;  5AQP B;  4QH1 A;  2Z6E A;  3OTO T;  1VCT A;  3AXJ A;  2CMR A;  3N9M A;  1XNQ T;  3SS1 A;  2BBJ A;  5FY1 A;  1WCR A;  4HWC A;  3DJB A;  3A5X A;  5ABF A;  1KNR A;  2CBJ A;  4GOU A;  5HEG A;  2ZM8 A;  1R8I A;  1IAP A;  5FKY A;  5FXX A;  4Z91 A;  3K3N A;  3SFD A;  3CQX C;  4LFA T;  4HFV A;  2XJ7 A;  4JI2 T;  3G06 A;  4I0U A;  3RQU A;  4K0U A;  1BR1 A;  1O3X A;  4CXX A;  3N2O A;  3ZST A;  4G2A A;  4U2Z A;  3ANW B;  1E2A A;  1BR0 A;  1N33 T;  2JQK A;  5LJN A;  3KDS E;  3K1S A;  3Q5E A;  4TX5 A;  4O8S A;  2EHO C;  2KIN B;  3FZK B;  2FJB A;  3GMI A;  3NKZ A;  2D5U A;  2FJA A;  2YKS A;  3RC3 A;  1OED B;  2C0S A;  5FVL A;  3SRZ A;  4AIU A;  2E9X C;  2V7M A;  5FL0 A;  4DV1 T;  5L3F B;  2WCA A;  2LSK A;  2XHE B;  3AXJ B;  3CX7 B;  1B7T A;  4CN4 A;  2YN6 A;  1KK7 A;  5JR9 A;  4H9P C;  4JI0 T;  2D9D A;  2HPL A;  1LKX A;  3RRC A;  1YQ4 A;  5ABF B;  3LJC A;  3RYI E;  5FXV A;  3P4S A;  3P4Q A;  2H88 A;  3N5L A;  3PV0 F;  4GKJ T;  4AQF A;  4IDP A;  2X51 A;  2KLQ A;  2VKD A;  4KHP T;  3N9Q A;  5IYZ E;  3NZQ A;  4UIG A;  4AKR B;  4CZZ B;  2KT9 A;  2XQ9 A;  1NEK A;  4HFB A;  2XPK A;  4O2A E;  4YTM A;  5JQG E;  2MPK A;  2MYS A;  3ZMV B;  1MIY A;  2J1D G;  1ZKE A;  4JBW F;  5JDF A;  4N78 D;  3HKD E;  1D0X A;  2I6H A;  4LF6 T;  3M3Z B;  2CE7 A;  4O2B E;  2VUR A;  4CN1 A;  1IBK T;  2WMN A;  4ZI7 E;  4B3R T;  4GYR A;  4ZZB A;  4JI3 T;  4TN7 B;  2XAH B;  4X64 T;  3FZM B;  2HN2 A;  5JR9 B;  2CBI A;  3VRA A;  3VKH A;  4DR7 T;  3EI0 A;  1J5E T;  4DR1 T;  3ZJ1 A;  4EEB A;  2WWU A;  2C5J A;  4XZC A;  5JH7 E;  3ONJ A;  2JQQ A;  4PJM A;  4BJM A;  3MAC A;  3PU8 A;  3ZC0 A;  2XAQ B;  2L8K A;  3AE1 A;  2FBW A;  5ADX L;  3PUZ F;  4X5T A;  3AE8 A;  4PNI A;  4MFR A;  2LKG A;  3DTO A;  3EVY A;  1IZN B;  5KMG P;  4L5G A;  4Q25 A;  5LG4 A;  3RKG A;  3OPC A;  3TLW A;  5ABH A;  4X62 T;  3O1J A;  2CPT A;  3WI3 A;  3PUW F;  4LFC T;  2X0Y A;  1IJ6 A;  3J9X 1;  2YIN A;  3OVU A;  2MAW A;  1US7 B;  3TKL B;  4JI6 T;  5HWX A;  1XZY A;  3RKO A;  3NZP A;  4U3C A;  2LSI A;  4A98 A;  2OLT A;  3ZN1 B;  3CIR A;  4NUU A;  3Q2M A;  2GK9 A;  2NW8 A;  2QYW A;  1KNP A;  2CM0 A;  2BDE A;  4AIS A;  3PUS A;  4YT0 A;  4EYY R;  3T1H T;  2WU5 A;  3I0O A;  2VVS A;  3N2K E;  2AXD S;  2FJD A;  4KBM B;  4B6X A;  1J5W A;  4IE4 A;  2LM9 A;  5J1G A;  4AXP A;  4YFS A;  3O9X A;  2JRK A;  4H9S E;  3RYH E;  3PUA A;  3ZT6 A;  1YKE B;  4HEA A;  3PJA J;  3IHR A;  3I9Y A;  5ABE A;  5LHI B;  4UVB B;  4ZI3 C;  4OYJ A;  3OYX A;  5C3J A;  3ZYK A;  2W66 A;  1FMV A;  2BS3 A;  3HA4 A;  1VCS A;  1ZP0 A;  1WLX A;  3HKC E;  4KUM B;  3P4R A;  2YDS A;  5F8P A;  3SOL A;  1LVF A;  1MIW A;  3BK9 A;  4PAG A;  4MAL A;  5BMV E;  1YXR A;  2ODU A;  3SWH A;  1SHZ C;  3P4W A;  5KXJ A;  3FHN A;  2WZI A;  3ZSS A;  2A9U A;  5IUX A;  3NRY A;  3ZYM A;  2XY8 B;  4TV9 E;  3CX8 B;  2RP4 A;  3ZYL A;  3RIF A;  3DP7 A;  4HWD A;  4ZXL A;  3GA8 A;  2IAK A;  4UXN B;  2ZM6 T;  3C4Z A;  3JAF A;  3ZMT B;  4I50 E;  3C51 A;  4BJN A;  4OYK A;  1HX1 B;  3ZCJ A;  4X1I E;  2HN1 A;  2EHO D;  2W62 A;  1HTJ F;  4HFD A;  3KV9 A;  3K3Q C;  1UCU A;  5DQW A;  2QGS A;  4EXT A;  1IBM T;  3AAA B;  2J62 A;  1UGO A;  2WAU A;  4L9I A;  2XTL A;  2BKN A;  2XAG B;  2BG9 C;  3ZCI A;  3RIU C;  4YY3 T;  3R6N A;  4X20 E;  1IJ5 A;  4F8H A;  5CFB A;  2EHO A;  1SA0 E;  2VKH A;  3C4W A;  2R6G F;  5KX5 E;  3SFE A;  2F4V T;  2JJ9 A;  1WYB A;  4HE8 A;  3EUH A;  5AFU L;  4LMK A;  2JQH A;  2E9X A;  3R84 B;  3VU7 H;  5CGM A;  3ZMS B;  4DO0 A;  4LF4 T;  4U2Y A;  1FEW A;  4DV4 T;  3RI5 A;  5CB4 E;  2E8I A;  3AE6 A;  1MMD A;  2FUP A;  4DV0 T;  5TAO A;  3PUR A;  2QRX A;  2ACX A;  3RC8 A;  5A1L A;  2WS3 A;  1WRD A;  4KX6 A;  4ISS A;  2UU9 T;  3QC9 A;  2NOX A;  3UU6 A;  4OK0 A;  2NTX A;  4QKN A;  3LDQ B;  3B5M A;  1T7S A;  3AE5 A;  2NP9 A;  3JC6 C;  3H37 A;  2WWV A;  5HYA A;  5FY7 A;  5HWY A;  3P4P A;  3V5U A;  2EHO B;  3B13 A;  2VL0 A;  1D1C A;  3QNU A;  1E7P A;  2XUE A;  3N9N A;  1HNZ T;  1W0A A;  3TLT A;  2M6I A;  4O4I E;  3NBX X;  2ACZ A;  2AE9 A;  4TUY E;  4GYS A;  2P9B A;  2E9X B;  2DLR A;  2NW7 A;  4ANJ A;  3PUY F;  4XAX B;  3LK2 B;  3JAD A;  3CK6 A;  4IL4 A;  1UUS A;  3HKB E;  2BS4 A;  2H3R A;  1HG5 A;  2QA7 A;  2D2S A;  4U31 A;  2X0H A;  2A72 A;  3ZT5 A;  1L0V A;  1D0Z A;  4Z90 A;  2L9Q A;  4EED A;  2V5D A;  4H9R C;  1U4Q A;  3FZH B;  1CUN A;  3KFW X;  4QHO A;  5IWA T;  1T98 A;  2ZM2 A;  4YHJ A;  2VB6 A;  2LSG A;  3ZMZ B;  2JQ9 A;  1HFA A;  5C2T A;  4YJ3 E;  3AA0 B;  4CI2 B;  4MLK A;  4YSX A;  3FB2 A;  1NEN A;  3E0Z A;  3ZEF B;  1OWA A;  4EOZ B;  4JEU B;  4WBN E;  2UUA T;  5LBM A;  5LB7 B;  5AQL B;  4TNV A;  4DVD A;  4JLE A;  2NTY A;  3A8Y C;  4HGA A;  3KBT A;  2DWG A;  5C8Y E;  3T1Y T;  4JUY A;  2WB5 A;  4DUZ T;  5HXE A;  4ILC A;  4H9O C;  1HNX T;  5HXR A;  1QLB A;  3N9O A;  4ZI2 C;  2VAS A;  2VKJ A;  3OJA A;  2WMO A;  3TLU A;  2W0G A;  1LRZ A;  2JIW A;  4IHJ E;  5AQG B;  3PE0 A;  4UF0 A;  3RPU A;  2X9W A;  3MA9 A;  1W0B A;  4JI4 T;  4PFO A;  2VQF T;  4YSZ A;  3QB5 A;  3N9L A;  4IE7 A;  3ESL A;  4DV7 T;  1LVK A;  3FXD B;  1J1J A;  2X9H A;  3LFM A;  3EAB A;  2RA1 A;  2IC9 A;  4LFB T;  5LMN T;  3UTK A;  1XDP A;  1YQ3 A;  3I1A A;  2W67 A;  2WDR A;  3AAE B;  3ETU A;  1T72 A;  2LRK A;  2B76 A;  4I55 E;  2X66 A;  2IDO B;  3AA7 B;  4H9N C;  2LE8 A;  2G0U A;  2CWO A;  2CEA A;  3CQG B;  2J4G A;  3N9P A;  5EK2 A;  1MMN A;  4V1A v;  2LKH A;  4X65 T;  2Q9Q D;  2BBH A;  3OYZ A;  3LSV A;  3AA6 B;  1OED C;  2B1E A;  4B3T T;  1UK5 A;  2CXD A;  3MXZ A;  3ONL C;  4ZZC A;  1D0Y A;  2ZMA A;  3C4X A;  3TLS A;  1MND A;  5DAB A;  4LMJ A;  4ERR A;  2A3D A;  3VKG A;  4UF0 B;  2Q9Q A;  3J7Y q;  2UXB T;  5J2U E;  2A2F X;  2K5B B;  2Y48 B;  5F5W A;  4DV3 T;  1AJ3 A;  1D1B A;  2V6Y A;  5AQI B;  3HKE E;  1YD8 G;  3B57 A;  5HCM A;  3WAK A;  2CHN A;  4LF5 T;  2RPA A;  5CA1 E;  5E0O A;  3KVB A;  4UR9 A;  2H7V C;  2I0M A;  4CXW A;  4YTP A;  4U74 A;  5AQV B;  3FBZ A;  3GWH A;  3RIU A;  2LSY A;  3S4U A;  4HFI A;  5HEU A;  3AEF A;  4EZH A;  1N36 T;  4CN6 A;  2BS2 A;  5JRE A;  4AKG A;  4GIW A;  2KND A;  4GK0 E;  1Y64 B;  1CHU A;  1D1A A;  3QOF A;  5JDL A;  2LOP A;  4PK4 A;  3OBV E;  1HX8 A;  5LHH B;  4AQY T;  2NR4 A;  1Z8U A;  3RH3 A;  1MIV A;  3I9W A;  4DR5 T;  2Q9Q B;  3FBL A;  1WR0 A;  3UUX B;  5JRC A;  2V6Y B;  2V7J A;  3JC6 D;  3VRB A;  2K48 A;  3ZMU B;  3KVA A;  2M6B A;  1UX4 A;  4WBO A;  3LK4 2;  2X0L B;  4A56 A;  4EYU A;  3HL6 A;  2I59 A;  2XQY A;  2VVN A;  2IUB A;  3BQI A;  3ZLI A;  3AE3 A;  1BR2 A;  4JI7 T;  2LHR A;  4P1N A;  3D0T A;  1XMQ T;  5KDM C;  4TWF A;  4UEL A;  2CWY A;  3UT5 E;  3H3A A;  3RQW A;  2WM9 A;  2DNX A; 
#chains in the Genus database with same CATH homology
 2KMF A;  5FMN A;  2PG8 A;  1QUU A;  4IGU A;  1H7C A;  3GMI A;  5TAO A;  3PUR A;  5EZY E;  2ACX A;  3RC8 A;  2D5U A;  5A1L A;  2N2N A;  3RC3 A;  1ZV4 X;  1WRD A;  2C0S A;  5CA0 E;  4M1P A;  3SRZ A;  5L2L A;  3EDV A;  4YJ2 E;  3NRX A;  4UVA B;  2HH7 A;  4ISS A;  3KV6 A;  5HAX A;  2E9X C;  2JMK A;  2V7M A;  5L3F B;  3QC9 A;  4AKI A;  2NOX A;  2LSK A;  2CXF A;  2XHE B;  5LGN B;  2EHO C;  3CX7 B;  1B7T A;  2NWB A;  5FXW A;  1VOM A;  4OK0 A;  5JDM A;  2NTX A;  1KK7 A;  4QKN A;  4H9P C;  5JR9 A;  3Q9D A;  2C5I T;  2HPL A;  4OFZ A;  4IE0 A;  2V7I A;  1X79 A;  1LKX A;  4E7S A;  3AAI A;  3RRC A;  3IF8 B;  3LJC A;  3RYI E;  2H7O A;  2NP9 A;  3JC6 C;  2V7L A;  3H37 A;  5LNK A;  1S94 A;  3O1I A;  2V1D B;  5FXV A;  5HYA A;  5FY7 A;  4ZOL E;  3QUJ A;  3W15 B;  5HWY A;  2WBL A;  3WAJ A;  4HTE A;  3N5L A;  3V5U A;  2EHO B;  3ZN0 B;  3ZPO A;  4WW0 A;  3B13 A;  5JRC B;  4AQF A;  4PJN A;  1D1C A;  3MZK B;  2X51 A;  2KLQ A;  2VKD A;  5FP3 A;  2XUE A;  2Y8D A;  2VK9 A;  3N9N A;  3L09 A;  4P0B A;  2KWH A;  2YEV C;  3N9Q A;  4O4I E;  3NBX X;  5IYZ E;  3NZQ A;  4UIG A;  4AKR B;  3RYF E;  4TUY E;  4CZZ B;  4GYS A;  2P9B A;  2KT9 A;  3F2E A;  2E9X B;  4PW8 A;  2DLR A;  4X1Y E;  5DJQ C;  3QK6 A;  2NW7 A;  3ZJ2 A;  2X9X A;  5JR9 C;  4O2A E;  4ANJ A;  5JQG E;  3E08 A;  5L3C B;  5F3J A;  1YKH B;  4CQI A;  2E9X D;  4UV8 B;  2MYS A;  3ZMV B;  4XAX B;  2BVM A;  3LK2 B;  1MIY A;  2MOZ A;  4QXH B;  3PU3 A;  4ASK A;  2J1D G;  2OA5 A;  5HXS A;  4OHF A;  1ZKE A;  3CQC B;  5GON E;  3HKB E;  3CX6 B;  4EAH A;  4PFP A;  2H3R A;  1HG5 A;  2QA7 A;  3BQL A;  2CXL A;  2D2S A;  3BQK A;  5JDF A;  4N78 D;  3HKD E;  3P7I A;  1D0X A;  4L0R A;  3CKD A;  4AQF C;  1NAF A;  2A72 A;  4I4T E;  2CE7 A;  5DQV A;  4O2B E;  3AVS A;  1D0Z A;  2L9Q A;  3MKD A;  4MBQ A;  3LBX A;  2WMN A;  2LHN A;  4ZI7 E;  3P8C D;  1UX5 A;  2YU2 A;  4H63 H;  5LYJ E;  3CWZ B;  2C5K T;  2SPC A;  4H9R C;  4GYR A;  3PTR B;  4QWN B;  4TN7 B;  1U4Q A;  4O4H E;  3AA1 B;  2XAH B;  5LXT E;  1CUN A;  4H63 V;  3KFW X;  4QHO A;  2PJQ A;  1T98 A;  2XAJ B;  2ZM2 A;  3PUG A;  4YHJ A;  4UEM A;  4H9Q C;  2VB6 A;  2LSG A;  3CML A;  3IBP A;  2JMH A;  5JR9 B;  2D0U A;  3ZMZ B;  1HFA A;  4YJ3 E;  4E7Z A;  3AA0 B;  1MMA A;  3CPZ A;  3FXE B;  4MLK A;  4CI2 B;  3O1H A;  1G73 A;  3VKH A;  3FB2 A;  3E0Z A;  3ZEF B;  1OWA A;  3ZJ1 A;  2UXX B;  4EOZ B;  2MTQ A;  2WWU A;  4FJO A;  3K8P C;  2C5J A;  4XZC A;  5JH7 E;  2HPJ A;  4JEU B;  4WBN E;  2JQQ A;  4PJM A;  5LOV E;  3C98 B;  4BJM A;  1ZHC A;  5LBM A;  3KV5 A;  3MAC A;  2DCF A;  3PU8 A;  5H6Q B;  3ZC0 A;  2XAQ B;  2M67 A;  2L8K A;  4DVD A;  4ILU A;  4JLE A;  2NTY A;  1QSD A;  1VRB A;  1G8X A;  4HGA A;  3KBT A;  3F31 A;  5ADX L;  2DWG A;  2VKO A;  3C64 A;  2DI4 A;  5C8Y E;  5FY0 A;  4JUY A;  4PNI A;  4XBF B;  4MFR A;  1NWM X;  3DTO A;  4HN9 A;  3EVY A;  4JEH B;  1S35 A;  2UXN B;  2CCQ A;  5HXE A;  4AKL A;  1IZN B;  1OXZ A;  4H9O C;  5KMG P;  3I0Q A;  3LG7 A;  4L5G A;  4ZHQ E;  5LG4 A;  5HXR A;  4TZ4 C;  3N9O A;  4ZI2 C;  1MNE A;  2VAS A;  2VWA A;  2VKJ A;  3OKQ A;  3OJA A;  4G63 A;  5FYM A;  3O1J A;  2WMO A;  2W0G A;  4YLH A;  3WI3 A;  2X9Y A;  5LBQ B;  2LSJ A;  1BR4 A;  4WNK A;  1FMW A;  4AKH A;  2X67 A;  5LGU B;  3CVR A;  1LRZ A;  1IJ6 A;  3J9X 1;  4HKA A;  4IHJ E;  2YIN A;  4QX8 B;  3U78 A;  2W61 A;  3PE0 A;  4UF0 A;  1US7 B;  2Q9Q C;  3LBX B;  3RPU A;  3TKL B;  5HWX A;  2X9W A;  3RKO A;  4DND A;  3RX6 A;  3MA9 A;  3NZP A;  4IE6 A;  4PFO A;  2LSI A;  3UUM A;  2LEH A;  4ZS3 A;  4EZ4 A;  4IST A;  5FXZ A;  3ZN1 B;  3N9L A;  3F57 A;  4QXB B;  4DMW A;  2ZLY A;  4IE7 A;  3ESL A;  4I43 B;  4PJL A;  4NUU A;  3Q2M A;  1LVK A;  2GK9 A;  3FXD B;  2NW8 A;  4C90 A;  2X9H A;  2N1G A;  4EIW A;  4AI6 A;  3LFM A;  2RA1 A;  2IC9 A;  3HR0 A;  2CM0 A;  3O4X E;  4FI5 A;  2BDE A;  4ZS2 A;  3PUS A;  3UTK A;  3I1A A;  4BAY B;  4EYY R;  4X1K E;  3KIN B;  4ZI2 D;  2DWK A;  2JPF A;  3AAE B;  3ETU A;  4U72 A;  1HF8 A;  2IC6 A;  1KNZ A;  4O4L E;  3I0O A;  4I55 E;  3PDY A;  2X66 A;  4P09 A;  3N2K E;  4P0A A;  3AA7 B;  3IEE A;  4H9N C;  4QXC B;  2LE8 A;  2G0U A;  2CWO A;  4IDZ A;  4KBM B;  3E22 E;  4F6R C;  4DBR A;  4B6X A;  5M4Y A;  1MMG A;  2CEA A;  5JDH A;  4IE4 A;  3CQG B;  4UVC B;  1YW0 A;  3KBU A;  3N9P A;  1V9D A;  2LM9 A;  5EK2 A;  4GK5 E;  1MMN A;  5J1G A;  2ODV A;  2L3L A;  4V1A v;  4AXP A;  4YFS A;  3UUN A;  2Q9Q D;  3O9X A;  2JRK A;  3OYZ A;  3EDU A;  4QX7 B;  3AA6 B;  4H9S E;  3RYH E;  2B1E A;  1HCI A;  1WR6 A;  3PUA A;  3K3O A;  1YKE B;  4HEA A;  2YK0 A;  2CXD A;  3MXZ A;  2W00 A;  1ZEE A;  2D0T A;  3I9Y A;  3IHR A;  1D0Y A;  2ZMA A;  3L3P A;  5HXH A;  3C4X A;  5L3E B;  5LHI B;  4O4J E;  1MND A;  1EZ3 A;  4UVB B;  1FIO A;  4ZI3 C;  2NW9 A;  4OYJ A;  3OYX A;  3VHL A;  5DAB A;  4PK5 A;  1WYC A;  3ZYK A;  1FMV A;  5FNV E;  5HXC A;  3C50 A;  3HA4 A;  4ADZ A;  4ERR A;  2A3D A;  1E1H B;  2CLY C;  2DHR A;  2N9D A;  3T8O A;  3VKG A;  1WLX A;  2Q9Q A;  2V26 A;  4UF0 B;  5H6R B;  5J2T E;  3J7Y q;  3HKC E;  5J2U E;  2A2F X;  2K5B B;  4KUM B;  2Y48 B;  3AB3 B;  5F8P A;  5LP6 E;  3SOL A;  3PUQ A;  1LVF A;  2IW5 B;  5L3G B;  1MIW A;  2BZB A;  3BK9 A;  4PAG A;  1AJ3 A;  1D1B A;  4MAL A;  5BMV E;  2WSS V;  3M65 A;  2ODU A;  5IHY A;  1HS7 A;  3HKE E;  3SWH A;  4KMC A;  3GN5 A;  1YD8 G;  2MBG A;  1SHZ C;  3MJX A;  5L3B B;  3B57 A;  4KP3 C;  2XAF B;  2PFV A;  3FHN A;  5LJM A;  3ETV A;  3MK7 C;  2LT3 A;  3NRY A;  3ZYM A;  4TV9 E;  3CX8 B;  3RRW A;  3UFE A;  2RP4 A;  5JVD E;  3WAK A;  3ZYL A;  3DP7 A;  4CXY A;  3ANW A;  4C91 A;  4CI1 B;  4TV8 E;  2BVL A;  3GA8 A;  2IAK A;  4J2C A;  5ETW A;  3LK3 B;  4UXN B;  5CA1 E;  5E0O A;  3KVB A;  5EK3 A;  2H7V C;  2KXP B;  4CXW A;  4U74 A;  5JDN A;  3FBZ A;  3C4Z A;  4PJJ A;  5JDQ A;  2CLY B;  3GWH A;  2PBI A;  4MHC A;  4ZI3 D;  3Q5X A;  2LSY A;  3S4U A;  3ZMT B;  3HI2 A;  5L3D B;  4EZH A;  4I50 E;  2V7K A;  2X68 A;  4EB6 E;  3N2G E;  3C51 A;  3Q5W A;  2K24 A;  4BJN A;  4Z8X A;  5LHG B;  5JRE A;  4AKG A;  4OYK A;  4GIW A;  2KZ7 B;  2KND A;  3ZCJ A;  3ZC1 A;  4X1I E;  4GK0 E;  4NUV A;  2LOS A;  3KV4 A;  3U3I A;  5LA6 E;  3RYC E;  2EHO D;  1Y64 B;  2ZM0 A;  2KWI B;  2W62 A;  1D1A A;  1HTJ F;  2Z6E A;  5JDL A;  2W63 A;  4UV9 B;  3KV9 A;  2CMR A;  2LOP A;  5LGT B;  3N9M A;  4PK4 A;  3OBV E;  3K3Q C;  1UCU A;  5DQW A;  3V5S A;  1HX8 A;  2QGS A;  3SS1 A;  4EXT A;  5FY1 A;  5JDG A;  1HG2 A;  3AAA B;  3DJB A;  3A5X A;  5LHH B;  3UUL A;  2WAU A;  1Z0P A;  2XTL A;  4L9I A;  3RH3 A;  5EK4 A;  4GOU A;  2XAG B;  4DMV A;  1MIV A;  3I9W A;  2Q9Q B;  3FBL A;  4IE5 A;  3ZCI A;  2ZM8 A;  1IAP A;  3R6N A;  4X20 E;  1IJ5 A;  5FXX A;  2EHO A;  3UUX B;  1SA0 E;  2LJL A;  2VKH A;  3C4W A;  3K3N A;  2CA5 A;  5JRC A;  5KX5 E;  3CQX C;  2Y6X A;  2V7J A;  3JC6 D;  4CI3 B;  3ONX A;  4AQG A;  4HFV A;  2ES0 A;  2JJ9 A;  3GN5 B;  1U5P A;  2K48 A;  1WYB A;  4HE8 A;  3ZMU B;  3EUH A;  5AFU L;  2YU1 A;  3KVA A;  1UX4 A;  4K0U A;  2VL8 A;  4PK6 A;  3LK4 2;  4WBO A;  2E9X A;  2X0L B;  2K9A A;  2XAS B;  3R84 B;  3VU7 H;  1BR1 A;  3ZMS B;  1O3X A;  4CXX A;  3N2O A;  4A56 A;  4EYU A;  3HL6 A;  2I59 A;  2XQY A;  3AVR A;  4G2A A;  4DO0 A;  3ANW B;  3BQI A;  3ZLI A;  1BR0 A;  1BR2 A;  1FEW A;  4BA9 A;  4DBQ A;  5LJN A;  2LHR A;  3D0T A;  5KDM C;  5LCY A;  4UEL A;  5CB4 E;  2CWY A;  3KDS E;  2E8I A;  4IIJ E;  3UT5 E;  3H3A A;  2WM9 A;  1MMD A;  4TX5 A;  4O8S A;  2DNX A;  2KIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...