4FJOA

Structure of the rev1 ctd-rev3/7-pol kappa rir complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
AAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title Structural basis of Rev1-mediated assembly of a quaternary vertebrate translesion polymerase complex consisting of Rev1, heterodimeric Pol zeta and Pol kappa
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/dna binding protein
total genus 32
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4fjoA00
2LSJA 4FJOA 3VU7H 4GK0E 4EXTA 2LSKA 2LSGA 4BA9A 4GK5E 2N1GA 2LSYA 2LSIA
chains in the Genus database with same CATH superfamily
3Q5XA 3H3AA 3ANWB 5ABEA 2VKJA 3T1HT 3UFGA 3CX7B 5CJ5A 3PUVF 2JMKA 4EZHA 3ZMUB 1S35A 4H9NC 3PUGA 4YSXA 4JEUB 4BA9A 3MZKB 3N5LA 3I9YA 3RYIE 1HNWT 2V7JA 4WZXA 1SUMB 2LHNA 3ZSTA 3SFEA 5DABA 4V1Av 3GA8A 4K0KT 2Z6EA 2BBJA 2YDRA 3NRXA 4ZS2A 2V7LA 2LSGA 3EUHA 3N9PA 4LF7T 4QH4A 2K5BB 5LHGB 2BBHA 3JAFA 2YDSA 3V5SA 3N2OA 1CUNA 3I1AA 1GQEA 2CE7A 3SOLA 3UUMA 4AKRB 4I43B 3V5UA 4LMJA 3QC9A 5FL1A 4B3ST 3UU3A 2KWHA 2BG9C 2FBWA 3BQKA 1M62A 1FMWA 3JC6D 5LOVE 4UVBB 1WCRA 4PAGA 4ILCA 5DQWA 2V6YB 1OEDC 3AE4A 3B57A 5LA6E 2JQHA 3CPZA 3P7IA 4IL9A 3HKDE 1KF6A 2OV9A 2JRKA 3F57A 4IT4A 4ILBA 4DV2T 1SA0E 4I50E 3FXEB 5JDFA 4NIQA 5HXCA 2V1DB 2BS4A 3P4RA 4HFCA 4N78D 3D0TA 4TX5A 2VKDA 4HFIA 1J5WA 5IWAT 1E2AA 4NUUA 3QOFA 3JC6C 4CN6A 2ZM0A 3LJCA 2IC9A 3AA6B 3RGLA 4U31A 1MMAA 2Q9QD 4WYVA 3N9NA 1YKHB 4LMLA 3C98B 3AECA 2LSKA 3TLWA 3FHNA 3RIUA 1YQ4A 5AQPB 1Y01A 4WBNE 4DV5T 4JBWF 2V7IA 5CGMA 2JQQA 2XQ6A 2XQAA 1FIOA 2LSYA 2CPTA 2WDVA 3P8CD 2XPKA 3PE0A 1I6ZA 4UXNB 4YHJA 4ZI3C 2X9HA 4TV8E 3KVAA 2LEHA 2CWYA 3OTOT 4PJLA 4WBOA 3AB3B 3OJAA 1HTJF 5IHYA 4NXMT 5BMVE 2X9YA 5C8YE 1UK5A 1ZP0A 2MPKA 3C50A 3FB2A 5AQMB 5HEHA 5CB4E 3U3IA 2W2UA 5AQVB 3Q2MA 1MIWA 1T98A 2X68A 4HN9A 4IREA 4F6RC 3T1YT 2RPAA 3SS1A 2XQ3A 4O4JE 3QB5A 4IE0A 5E0OA 4CXWA 1NWMX 3AE1A 1NENA 3OKQA 4O4HE 2AXDS 4PFOA 5LXTE 4AI6A 4X1IE 4LFCT 2CMRA 5AQTB 2CLYC 1VCSA 4TWFA 2VQET 1J1JA 3J9X1 4IE5A 2LHRA 4B6XA 1XDPA 4Z8XA 4X64T 2ZM2A 1R8IA 3I0QA 4IE6A 3OBVE 4B3MT 2JIWA 5LJMA 1G8XA 3O9XA 3ZT7A 5KX5E 3LG7A 5LBMA 4E7SA 2YEVC 5JTGA 4O8SA 3HR0A 1JNRA 1IBMT 4AISA 4JI5T 2WMOA 3AVSA 5ABFA 4DUZT 2BG9B 1N33T 2XQ4A 3EDVA 1YD8G 3EI0A 1XMQT 5JR9A 4DV6T 2XY8B 1IJ6A 3MACA 5CA0E 5HYAA 1G73A 4MFRA 1OEDB 3LK42 3W15B 4KI0F 1XDOA 5J1GA 5CA1E 4TNWA 3PUWF 4TNVA 4TWDA 2UUBT 2CM0A 4MLKA 2VL8A 4JI8T 3JADA 3C51A 2K48A 3N2KE 3CQXC 2LSJA 2D0TA 3FZHB 2ODUA 5FYMA 2XAJB 2VQFT 5C2TA 2WDQA 1UUSA 4UF0A 2VURA 5ABGA 5J2UE 1BR4A 3ZMSB 3KV5A 5AQLB 1WR0A 1WFDA 4U33A 2ZLYA 3RHWA 3T8OA 3QK6A 3UQ4A 1KK7A 4H9OC 3HI2A 5AQJB 1HCIA 2LRLA 2DWKA 4H9QC 2LM9A 2WBLA 5JREA 4JYAT 2MTQA 4CQIA 5HEUA 5M4YA 4L9IA 2I6HA 3JAEA 2K9AA 3RI5A 2Q9QB 3LK2B 2VB6A 4ZZCA 3WI3A 4CXYA 2DL1A 2CA5A 4DV1T 4NPPA 3N2GE 3QB5K 2KSRA 3MA9A 5JQGE 4X20E 1LRZA 2L9QA 3UUNA 5ADXL 4DR3T 1HFAA 4ZI2C 1D0ZA 3AE6A 4P0BA 2WS3A 2XSAA 4ANJA 4LF8T 4EYYR 3GMIA 1EZ3A 2CXFA 2KMFA 3ZYLA 3MK7C 2B76A 1AJ3A 2M6BA 3ZJ1A 3P4SA 4YTMA 4QX7B 4DMVA 3ZCIA 3P4PA 4U72A 3SRZA 1YW0A 2XQ8A 4JEHB 5LHIB 4UELA 3P50A 5L2LA 2CLYB 1WLXA 2CBJA 2NTXA 4QWNB 4G2AA 2YKSA 5L3EB 2JQKA 3WAJA 3DJBA 1M7KA 2FJAA 5LGUB 4HE8A 2V5DA 4KP3C 2E8IA 2NW9A 2C5JA 4AKHA 5LG3A 2KZ7B 4HFVA 2C0SA 4QXBB 4QHOA 4PW8A 1E7PA 3EABA 2LE8A 2X9WA 5JR9C 1BR2A 1UCUA 4KMCA 2V7MA 3OPCA 2FUPA 2M6IA 4AKIA 2IUBA 1MMNA 2VKOA 2KWIB 1WYBA 1N34T 3A8YC 3ETUA 3KFWX 2J47A 4HFHA 4CZZB 1WRDA 3LBXB 4A98A 4AQFA 2KXPB 3QNUA 2E9XA 4KUMB 1HNXT 2WY2A 3ZN1B 2W67A 2UU9T 3E22E 5FY0A 2N1GA 4OYKA 5FVKA 2D5UA 3F31A 3AA0B 2XQYA 2IAKA 3KV9A 4ZEYA 2LM2A 1OWAA 2CWOA 2XASB 4GOUA 1ZOYA 1IBLT 3KVBA 2BKNA 4U2YA 4OK0A 4JI6T 1HF8A 2CXLA 3RYCE 1VRBA 2K24A 2WCAA 3OYXA 2UXNB 3Q9DA 2MOZA 3PV0F 4BAYB 5LHHB 4JI1T 3FZMB 3UU5A 3Q5EA 3RRCA 5JH7E 1H7CA 3L3PA 2UXXB 4AKGA 4JLEA 1YXRA 3ESLA 4UEMA 2N9DA 5FXXA 2W4XA 1XNRT 4TUYE 3PTRB 2EHOD 3QUJA 5KDMC 4OHFA 4JI2T 4HKAA 4ZHQE 4DIDB 2YINA 3UULA 3VKGA 2BG9E 2W66A 3ZKRA 5L4EA 2VL0A 4OX9T 5HXEA 1OEDE 4I55E 2NWBA 2V26A 5AQGB 4AIUA 1ZV4X 3BK9A 3ZC1A 2D2SA 4NUVA 2WU2A 2FJBA 2EHOC 1MIVA 4HWDA 4H63V 3G06A 1KNRA 4DNDA 4GYSA 4ASKA 1KFYA 4OFZA 3B13A 2DHRA 5LMUT 2BKOA 5AQQB 5IYZE 3KINB 4A97A 3RRWA 3BQLA 3O1JA 4FJOA 4GYRA 3I0OA 5AQNB 4TZ4C 5LMNT 2QRXA 2WDRA 5JDNA 1J5ET 2J1DG 1QLBA 3HA4A 4EXTA 2UXCT 3AE5A 4LMKA 2NR4A 3VR9A 4KHPT 1ZHCA 3UTKA 4M1PA 2Q9QC 3B5MA 3PJAA 4X65T 4ZZBA 2BVMA 4IDNA 2CHOA 2L8KA 1XZYA 4DO0A 2YU2A 2LKGA 2KNDA 2YDQA 2HH7A 2RA1A 5JR9B 2WAUA 3AVRA 3ZN0B 5IUXA 4BJNA 4YFSA 2XZEA 3AAEB 4FI5A 3GN5A 4O2AE 1LVFA 4ZS3A 2V6YA 3CVRA 3AE7A 2WU5A 3ZT6A 1XMOT 1UGOA 3FZKB 3ETVA 3SFDA 1HX8A 1I94T 3OYZA 4U74A 1D0XA 5EK2A 2CRBA 2YOEA 4LF5T 3ZJ2A 1KEYA 2CCQA 4PFPA 3AE2A 4TN7B 2X0LB 4UF0B 4DV7T 3PDYA 4JI7T 2JPFA 2YK0A 3PURA 2XQ7A 3FBLA 2SPCA 4X1YE 1DU2A 3A5XA 2WB5A 4PK6A 4EB6E 4HWIB 1E1HB 2G0UA 4ADZA 3C4ZA 3NRYA 3RLFF 4X1KE 2W00A 2N2NA 3N9QA 3FBZA 3VHLA 5AQUB 2H88A 2D9DA 4B3RT 3KBTA 3UUBA 3RC3A 3LK3B 2ACXA 5HXHA 5GONE 5A1LA 4KX6A 1Y64B 3RIAA 4JV5T 1IZNB 3MXZA 4C91A 4B3TT 1XNQT 3PU8A 3AE3A 5LB7B 4F8HA 4AQGA 2A3DA 5HAXA 2BKPA 3AXJB 2J62A 4H63H 4IE4A 2Y6XA 3K3OA 4EV6A 2EHOB 3L09A 3PUYF 4YJ3E 5F8PA 4TV9E 3RYFE 2XM2A 3UFEA 4DVDA 5HXSA 3RH3A 5LGTB 4DV0T 4UR9A 3L39A 4Z90A 1N32T 3RIUC 3ZMZB 5FY1A 2LOSA 4ILUA 1HR0T 2W61A 5CFBA 3RC8A 1HG5A 5HWYA 4YXDA 4Z91A 2PJQA 5JRCB 2V5CA 5FKYA 4J2CA 2HPJA 2CEAA 5DQVA 1S94A 1D0YA 2HPLA 2X66A 5AQKB 2E2AA 1FJGT 2KT9A 5KMGP 2D0UA 4ILAA 3CK6A 2C5KT 2H7VC 1W09A 4LF4T 4IL4A 3ZYMA 2XAQB 2W62A 2BVLA 3IA3A 4QH5A 4YY3T 4HFBA 2A2FX 3AEAA 4CN4A 4IIJE 3UUXB 1SE7A 2VASA 4GKJT 4EAHA 3KDSE 3CKDA 5LGNB 5ETWA 4HTEA 2BG9A 4HWHA 1CHUA 4AKLA 5J2TE 4X66T 2NW7A 4AXPA 1Z8UA 5FP3A 1UX4A 4LFBT 3TLUA 1OEDA 5H6QB 3PUAA 3VRBA 1NAFA 5FL0A 5C3JA 4CI2B 3WAKA 3CWZB 3TKLB 2QYWA 2X0YA 2BDEA 3LSVA 2FJEA 2VKHA 1U5PA 2DNXA 5L3BB 1IBKT 3NWIA 1YQ3A 3ZPOA 2PFVA 4E7ZA 5TAOA 2JMHA 1HS7A 5AQOB 4P1NA 4DBRA 5HWXA 3CX8B 1T7SA 2JJ9A 3ZMTB 4IE7A 4IHJE 4XBFB 2UXDT 5LBQB 5FXWA 5AQFB 4Q25A 3FZFB 1T72A 1X79A 5LYJE 3ONXA 4UV8B 2IMLA 3PUSA 2R6GF 1FEWA 3ONLC 3K1SA 5J0ZA 2NW8A 5FVLA 1W0BA 2KINB 2W63A 4YSYA 3ZC0A 5JDGA 1VCTA 2ACZA 3UU4A 4O4LE 5LNKA 2X0HA 4L0RA 4WNKA 4EGWA 4WW0A 2IHR1 4QXHB 1IJ5A 1D1BA 3EAMA 5FXVA 5LCYA 3HKCE 3R6NA 3TLTA 4JI3T 2WQYA 2I0MA 2J4GA 3P4QA 1IAPA 2X9XA 3F2EA 5HCMA 2XQ9A 2YU1A 3EDUA 4H9PC 3AAAB 5AQRB 1QSDA 1KNPA 2W0GA 2UXBT 1QUUA 4CN1A 1LVKA 1N36T 5JDLA 3AEFA 1WR6A 3EHZA 5L4HA 3MJXA 5L3GB 1MNDA 2MAWA 2AE9A 4GKKT 4YJ2E 4PJMA 3KBUA 4C90A 3EVYA 4DR2T 5HEJA 2WZHA 1MIYA 2DCFA 2E5VA 4HGAA 3DTOA 1WYCA 3J7Yq 3UU6A 4L5GA 2ZM6T 4U7YA 4YHHT 2NTYA 2XSBA 3RX6A 3AE9A 5L47A 4O4IE 1ZKEA 5AQSB 2MBGA 4DV3T 4CI1B 3S4UA 2PBIA 3FXDB 3LFMA 2ZM8A 2FJDA 4XZCA 2LJLA 3GN5B 4HWCA 2V7KA 4U2ZA 2XHEB 3FZLB 5BR8T 3ANWA 4PJJA 5AQHB 3VR8A 3LBXA 2BZBA 4YLHA 3SWHA 2GK9A 5FNVE 3LDQB 4HWFA 1LKXA 5F3JA 4PNIA 2RP4A 3HL6A 2LSIA 3AA1B 2OA5A 2LOPA 2H89A 3AEEA 2WP9A 2IIUA 4ZI3D 4JI0T 3RKGA 2IDOB 5HEGA 2E9XD 4I0UA 4KBMB 1U4QA 4EOZB 3IBPA 4XAXB 3CX6B 3RKOA 1JNZA 4DR7T 3K3NA 1MMGA 4GIWA 4OYJA 2A9UA 4YTNA 5ABFB 5FY7A 2BS3A 4YTPA 3CMLA 1FMVA 4DMWA 3O1IA 2E5LT 2XQ5A 3BQIA 1O3XA 3JCFA 3O4XE 2WZIA 1T8BA 2XTLA 4X62T 4DR6T 4AQFC 3AE8A 2E9XC 3VKHA 5JDHA 4PK5A 4MALA 4LFAT 1ZEEA 2CXDA 2DLRA 2LT3A 1KNZA 4DBQA 1OXZA 3AA7B 4U7IA 4X5TA 5JDMA 4MHCA 2XAHB 4P0AA 3VRAA 3ZLIA 2HN2A 3CIRA 3P4WA 2LLYA 3M3ZB 4HEAA 1YKEB 2XUEA 2V8SV 2H3RA 3PUZF 3DP7A 1Z0PA 1SHZC 2CHNA 3RPUA 5EZYE 1BR1A 2A72A 4A56A 5KXJA 4K0UA 3KV4A 3UU8A 5EK4A 2WWVA 3PU3A 5DJQC 4A5XA 4ZOLE 4ISTA 5JVDE 2OLTA 4EEBA 5L3DB 4IGUA 2VK9A 4O2BE 4QX8B 5FXZA 2I59A 4COFA 2IC6A 2QA7A 3O1HA 2UUAT 2QVAA 4IDPA 3RYHE 2C5IT 2PG8A 3AEGA 1L0VA 4YSZA 2LRKA 3NZPA 4IDOA 2M67A 2Y8DA 2H7OA 2WM9A 3ZT5A 2HHHT 3IF8B 4QXCB 2XM1A 4HFEA 3GWHA 4EEDA 1B7TA 3I9WA 3X1DA 2NOXA 3A7MA 2Y48B 4H9SE 2F4VT 4EYUA 4UVAB 3TLSA 3PUXF 1HG2A 3OVUA 4LF9T 1UX5A 2ZMAA 3N9LA 3U78A 3UQ7A 3AAIA 3H3MA 2PTFA 3Q5WA 5LP6E 2WWUA 3RIFA 4CI3B 4CXXA 4NXNT 2NP9A 3CQGB 3NBXX 3ZMVB 2X51A 1UURA 1XWMA 2V6XA 4GK5E 3VU7H 2HN1A 3L8RA 3ZCJA 1MMDA 3N9OA 1NEKA 3E08A 4EZ4A 4LF6T 1HX1B 4ZI2D 2QGSA 4P09A 3PJAJ 4AQYT 4DR5T 4U3CA 4BJMA 2DWGA 3IEEA 4DR4T 5HEOA 5LJNA 4KHZF 3Q5DA 2CBIA 2ODVA 2MYSA 2YN6A 3K3QC 5HXRA 3E0ZA 4ZXLA 3C64A 2E9XB 1X9BA 4G63A 2VVSA 2XAGB 2BS2A 5JDQA 4MBQA 5L3CB 1VOMA 4IDZA 3KV6A 4PJNA 2KLQA 3HKBE 2XJ7A 4DR1T 2IW5B 1BR0A 1HNZT 3AEBA 3MKDA 3AXJA 5F5WA 4GK0E 2UUCT 4ZI7E 4UV9B 3H37A 4I4TE 2P9BA 2EHOA 4H9RC 3ZSSA 2WMNA 4UVCB 4DV4T 1D1CA 1V9DA 5H6RB 3IHRA 1D1AA 4TWHA 1W0AA 2VWAA 4YT0A 4JUYA 2K3WA 4PK4A 4IDQA 4QKNA 3UT5E 2L3LA 3ZYKA 2XAFB 2ES0A 3CQCB 4ISSA 3RF1A 3ONJA 4HFDA 2WSSV 5EK3A 5JRCA 4ERRA 4EIWA 2DI4A 3C4XA 2B1EA 2JQ9A 4JI4T 4UIGA 3M65A 5AQIB 3ABVA 3NKZA 3NZQA 5AFUL 3RQUA 2VVNA 1W9RA 3C4WA 4DUYT 3AEDA 3N9MA 2Q9QA 3R84B 5L3FB 2X67A 3K8PC 3TLVA 3ZEFB 5HCJA 1US7B 3RQWA 1MNEA 3NVOA 5FMNA 4QH1A 2LKHA 5LG4A 3PUQA 3HKEE 5ABHA
chains in the Genus database with same CATH topology
3Q5XA 1LKXA 2K9AA 1E1HB 5F3JA 2G0UA 2RP4A 3H3AA 3HL6A 2Q9QB 4PNIA 4ADZA 3ANWB 3C4ZA 2LSIA 3NRYA 3AA1B 3LK2B 2VB6A 4X1KE 3WI3A 4CXYA 2W00A 2CA5A 2N2NA 2VKJA 2OA5A 3N9QA 3FBZA 2LOPA 3CX7B 3VHLA 3N2GE 2JMKA 4ZI3D 3MA9A 4EZHA 3ZMUB 5JQGE 1S35A 4X20E 4H9NC 1LRZA 2L9QA 3PUGA 3UUNA 5ADXL 3KBTA 2E9XD 4JEUB 4KBMB 1U4QA 1HFAA 4EOZB 4ZI2C 1D0ZA 4BA9A 3IBPA 4XAXB 3CX6B 3MZKB 3RC3A 3LK3B 2ACXA 3N5LA 3I9YA 3RYIE 5HXHA 2V7JA 3RKOA 4P0BA 5GONE 5A1LA 4ANJA 4EYYR 2LHNA 3K3NA 3GMIA 1MMGA 5DABA 4GIWA 4OYJA 1Y64B 4V1Av 3GA8A 1IZNB 1EZ3A 2Z6EA 3MXZA 4C91A 2CXFA 2KMFA 5FY7A 3ZYLA 3MK7C 3PU8A 3NRXA 4ZS2A 2V7LA 4AQGA 1AJ3A 2LSGA 3EUHA 3N9PA 3CMLA 3ZJ1A 1FMVA 2A3DA 4DMWA 3O1IA 3BQIA 1O3XA 3O4XE 4QX7B 3ZCIA 4DMVA 5HAXA 2K5BB 4U72A 2XTLA 5LHGB 3SRZA 1YW0A 4AQFC 4H63H 3V5SA 4IE4A 3N2OA 1CUNA 4JEHB 5LHIB 3I1AA 2E9XC 2Y6XA 4UELA 2CE7A 3K3OA 5L2LA 2CLYB 3SOLA 1WLXA 3VKHA 2EHOB 3L09A 3UUMA 2NTXA 4QWNB 4AKRB 4YJ3E 4G2AA 5F8PA 5JDHA 4PK5A 4MALA 4I43B 4TV9E 3RYFE 3V5UA 5L3EB 3UFEA 3QC9A 3WAJA 3DJBA 1ZEEA 2CXDA 4DVDA 5HXSA 2DLRA 3RH3A 5LGTB 2KWHA 5LGUB 4HE8A 2LT3A 1KNZA 3BQKA 4DBQA 1OXZA 3AA7B 4KP3C 5JDMA 2E8IA 4MHCA 2XAHB 4P0AA 1FMWA 3ZMZB 3ZLIA 3JC6D 5FY1A 5LOVE 2NW9A 4UVBB 2C5JA 2LOSA 4PAGA 4AKHA 4ILUA 2KZ7B 2W61A 4HFVA 4HEAA 5DQWA 1HG5A 5HWYA 3RC8A 1YKEB 2C0SA 2XUEA 3B57A 4QXBB 2H3RA 4QHOA 5LA6E 2PJQA 5JRCB 4PW8A 3DP7A 1Z0PA 4J2CA 1SHZC 2HPJA 2CEAA 3CPZA 3P7IA 5DQVA 3RPUA 5EZYE 1S94A 2LE8A 1D0YA 2HPLA 1BR1A 2A72A 2X66A 2X9WA 4A56A 3HKDE 5JR9C 1BR2A 2JRKA 2KT9A 1UCUA 3F57A 4KMCA 2V7MA 4K0UA 3KV4A 1SA0E 5KMGP 5EK4A 2D0UA 4I50E 3PU3A 5DJQC 3FXEB 4AKIA 1MMNA 4ZOLE 2VKOA 5JDFA 2C5KT 4ISTA 2H7VC 5HXCA 5JVDE 2KWIB 1WYBA 2V1DB 4N78D 3D0TA 4TX5A 3ETUA 3KFWX 5L3DB 2VKDA 4IGUA 4CZZB 2VK9A 1WRDA 4O2BE 3LBXB 4NUUA 4AQFA 3ZYMA 4QX8B 3JC6C 2XAQB 5FXZA 2W62A 2KXPB 2E9XA 4KUMB 2BVLA 2ZM0A 3LJCA 2IC9A 3AA6B 1MMAA 2I59A 2IC6A 2Q9QD 3N9NA 3ZN1B 2QA7A 2A2FX 3O1HA 3E22E 4IIJE 2N1GA 5FY0A 3UUXB 3RYHE 2VASA 4OYKA 2C5IT 4EAHA 3KDSE 3CKDA 5LGNB 1YKHB 5ETWA 2PG8A 4HTEA 3C98B 2D5UA 3F31A 3AA0B 2LSKA 2XQYA 3NZPA 2IAKA 4AKLA 3KV9A 3FHNA 1OWAA 2CWOA 5J2TE 2XASB 2NW7A 4AXPA 2M67A 4GOUA 5FP3A 1UX4A 2Y8DA 2H7OA 2WM9A 3KVBA 3IF8B 4WBNE 4QXCB 2V7IA 5H6QB 3GWHA 2JQQA 3PUAA 1B7TA 3I9WA 4OK0A 1HF8A 1NAFA 2CXLA 2NOXA 3RYCE 1FIOA 1VRBA 2LSYA 2Y48B 2K24A 3P8CD 4CI2B 3PE0A 3WAKA 4UXNB 3OYXA 4YHJA 3CWZB 2UXNB 4ZI3C 2X9HA 3Q9DA 4TV8E 2MOZA 4BAYB 3TKLB 3KVAA 4H9SE 4EYUA 5LHHB 2LEHA 2BDEA 2CWYA 2VKHA 4UVAB 1U5PA 2DNXA 4PJLA 4WBOA 3RRCA 5JH7E 1H7CA 3AB3B 3OJAA 1HTJF 5IHYA 3L3PA 2UXXB 5L3BB 4JLEA 4AKGA 3ESLA 4UEMA 2N9DA 3ZPOA 5BMVE 2PFVA 5FXXA 4E7ZA 5TAOA 2X9YA 1HG2A 5C8YE 2JMHA 1UX5A 1HS7A 4TUYE 3PTRB 2ZMAA 3C50A 2EHOD 3N9LA 3U78A 3AAIA 4DBRA 3FB2A 5HWXA 3CX8B 3QUJA 3Q5WA 2JJ9A 5CB4E 3ZMTB 5KDMC 2WWUA 4IE7A 4IHJE 4OHFA 5LP6E 4XBFB 3U3IA 3Q2MA 4CI3B 4HKAA 4CXXA 1MIWA 4ZHQE 1T98A 2X68A 4HN9A 2YINA 3UULA 2NP9A 5LBQB 3VKGA 5FXWA 3CQGB 3NBXX 4F6RC 3ZMVB 3SS1A 4O4JE 2X51A 4IE0A 1X79A 5E0OA 5LYJE 3ONXA 1NWMX 3OKQA 4PFOA 4O4HE 4UV8B 4CXWA 5LXTE 4AI6A 5HXEA 3PUSA 4GK5E 1FEWA 4X1IE 4I55E 2NWBA 2V26A 3VU7H 1ZV4X 3BK9A 3ZC1A 2CMRA 2D2SA 3ZCJA 1MMDA 2NW8A 4NUVA 3N9OA 2KINB 2CLYC 2W63A 2EHOC 1MIVA 3E08A 4EZ4A 3ZC0A 5JDGA 4H63V 3J9X1 4DNDA 4IE5A 4GYSA 4ASKA 4ZI2D 2QGSA 4OFZA 2LHRA 4O4LE 4B6XA 4P09A 4Z8XA 5LNKA 3B13A 2DHRA 2ZM2A 3I0QA 4L0RA 4IE6A 4WNKA 2DWGA 4BJMA 3IEEA 3OBVE 5IYZE 3KINB 3RRWA 3BQLA 3O1JA 4WW0A 5LJNA 4QXHB 1IJ5A 4FJOA 5LJMA 1G8XA 3O9XA 4GYRA 3I0OA 1D1BA 2ODVA 3K3QC 2MYSA 3LG7A 5HXRA 5KX5E 5LBMA 3E0ZA 4E7SA 3C64A 2YEVC 2E9XB 4TZ4C 5FXVA 4O8SA 3HR0A 5LCYA 3HKCE 3R6NA 5JDNA 2J1DG 4G63A 2XAGB 3HA4A 4EXTA 5JDQA 5L3CB 4MBQA 2WMOA 1IAPA 3AVSA 2X9XA 1VOMA 3F2EA 4IDZA 3KV6A 4PJNA 2KLQA 3HKBE 2YU1A 3EDVA 1YD8G 3EDUA 2IW5B 1BR0A 5JR9A 4H9PC 1ZHCA 3AAAB 3UTKA 4M1PA 2Q9QC 3MKDA 1QSDA 4GK0E 1IJ6A 2W0GA 3MACA 1QUUA 1LVKA 5CA0E 5HYAA 2BVMA 4ZI7E 5JDLA 4UV9B 3H37A 4I4TE 1WR6A 2L8KA 1G73A 4MFRA 2P9BA 3LK42 4DO0A 2EHOA 4H9RC 2YU2A 3MJXA 5L3GB 2WMNA 4UVCB 3W15B 2KNDA 1D1CA 1MNDA 2HH7A 1V9DA 5H6RB 4YJ2E 4PJMA 3KBUA 2RA1A 3IHRA 4C90A 1D1AA 5JR9B 3EVYA 5J1GA 5CA1E 2VWAA 2CM0A 1MIYA 4MLKA 2VL8A 2WAUA 3AVRA 2DCFA 3ZN0B 4HGAA 4JUYA 3C51A 3DTOA 4PK4A 2K48A 1WYCA 3N2KE 4QKNA 3CQXC 3UT5E 2L3LA 3ZYKA 2LSJA 2XAFB 2ES0A 4BJNA 3J7Yq 4YFSA 3CQCB 4ISSA 4L5GA 3AAEB 4FI5A 2D0TA 2NTYA 3GN5A 3RX6A 4O2AE 4O4IE 1LVFA 4ZS3A 2WSSV 5EK3A 1ZKEA 3CVRA 5JRCA 4ERRA 4EIWA 2DI4A 3C4XA 2B1EA 2ODUA 5FYMA 2XAJB 2MBGA 4CI1B 4UIGA 3M65A 3S4UA 2PBIA 4UF0A 3FXDB 3ETVA 3LFMA 2ZM8A 3NZQA 1HX8A 5J2UE 5AFUL 4XZCA 1BR4A 2LJLA 3GN5B 3OYZA 4U74A 3ZMSB 1D0XA 5EK2A 3KV5A 3C4WA 2ZLYA 3T8OA 3QK6A 3ZJ2A 2V7KA 3N9MA 2XHEB 1KK7A 2Q9QA 3R84B 2CCQA 2X67A 3ANWA 3K8PC 4PJJA 4PFPA 5L3FB 3LBXA 2BZBA 4TN7B 4YLHA 2X0LB 3ZEFB 4H9OC 4UF0B 3PDYA 2JPFA 1US7B 3HI2A 3SWHA 2YK0A 1HCIA 2DWKA 1MNEA 3PURA 4H9QC 2LM9A 2WBLA 5FMNA 2GK9A 2SPCA 3FBLA 5FNVE 4X1YE 5JREA 2MTQA 4CQIA 3A5XA 5LG4A 5M4YA 3PUQA 4PK6A 3HKEE 4L9IA 4EB6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSJ A;  4FJO A;  3VU7 H;  4GK0 E;  4EXT A;  2LSK A;  2LSG A;  4BA9 A;  4GK5 E;  2N1G A;  2LSY A;  2LSI A; 
#chains in the Genus database with same CATH topology
 3Q5X A;  3H3A A;  3ANW B;  5ABE A;  2VKJ A;  3T1H T;  3UFG A;  3CX7 B;  5CJ5 A;  3PUV F;  2JMK A;  4EZH A;  3ZMU B;  1S35 A;  4H9N C;  3PUG A;  4YSX A;  4JEU B;  4BA9 A;  3MZK B;  3N5L A;  3I9Y A;  3RYI E;  1HNW T;  2V7J A;  4WZX A;  1SUM B;  2LHN A;  3ZST A;  3SFE A;  5DAB A;  4V1A v;  3GA8 A;  4K0K T;  2Z6E A;  2BBJ A;  2YDR A;  3NRX A;  4ZS2 A;  2V7L A;  2LSG A;  3EUH A;  3N9P A;  4LF7 T;  4QH4 A;  2K5B B;  5LHG B;  2BBH A;  3JAF A;  2YDS A;  3V5S A;  3N2O A;  1CUN A;  3I1A A;  1GQE A;  2CE7 A;  3SOL A;  3UUM A;  4AKR B;  4I43 B;  3V5U A;  4LMJ A;  3QC9 A;  5FL1 A;  4B3S T;  3UU3 A;  2KWH A;  2BG9 C;  2FBW A;  3BQK A;  1M62 A;  1FMW A;  3JC6 D;  5LOV E;  4UVB B;  1WCR A;  4PAG A;  4ILC A;  5DQW A;  2V6Y B;  1OED C;  3AE4 A;  3B57 A;  5LA6 E;  2JQH A;  3CPZ A;  3P7I A;  4IL9 A;  3HKD E;  1KF6 A;  2OV9 A;  2JRK A;  3F57 A;  4IT4 A;  4ILB A;  4DV2 T;  1SA0 E;  4I50 E;  3FXE B;  5JDF A;  4NIQ A;  5HXC A;  2V1D B;  2BS4 A;  3P4R A;  4HFC A;  4N78 D;  3D0T A;  4TX5 A;  2VKD A;  4HFI A;  1J5W A;  5IWA T;  1E2A A;  4NUU A;  3QOF A;  3JC6 C;  4CN6 A;  2ZM0 A;  3LJC A;  2IC9 A;  3AA6 B;  3RGL A;  4U31 A;  1MMA A;  2Q9Q D;  4WYV A;  3N9N A;  1YKH B;  4LML A;  3C98 B;  3AEC A;  2LSK A;  3TLW A;  3FHN A;  3RIU A;  1YQ4 A;  5AQP B;  1Y01 A;  4WBN E;  4DV5 T;  4JBW F;  2V7I A;  5CGM A;  2JQQ A;  2XQ6 A;  2XQA A;  1FIO A;  2LSY A;  2CPT A;  2WDV A;  3P8C D;  2XPK A;  3PE0 A;  1I6Z A;  4UXN B;  4YHJ A;  4ZI3 C;  2X9H A;  4TV8 E;  3KVA A;  2LEH A;  2CWY A;  3OTO T;  4PJL A;  4WBO A;  3AB3 B;  3OJA A;  1HTJ F;  5IHY A;  4NXM T;  5BMV E;  2X9Y A;  5C8Y E;  1UK5 A;  1ZP0 A;  2MPK A;  3C50 A;  3FB2 A;  5AQM B;  5HEH A;  5CB4 E;  3U3I A;  2W2U A;  5AQV B;  3Q2M A;  1MIW A;  1T98 A;  2X68 A;  4HN9 A;  4IRE A;  4F6R C;  3T1Y T;  2RPA A;  3SS1 A;  2XQ3 A;  4O4J E;  3QB5 A;  4IE0 A;  5E0O A;  4CXW A;  1NWM X;  3AE1 A;  1NEN A;  3OKQ A;  4O4H E;  2AXD S;  4PFO A;  5LXT E;  4AI6 A;  4X1I E;  4LFC T;  2CMR A;  5AQT B;  2CLY C;  1VCS A;  4TWF A;  2VQE T;  1J1J A;  3J9X 1;  4IE5 A;  2LHR A;  4B6X A;  1XDP A;  4Z8X A;  4X64 T;  2ZM2 A;  1R8I A;  3I0Q A;  4IE6 A;  3OBV E;  4B3M T;  2JIW A;  5LJM A;  1G8X A;  3O9X A;  3ZT7 A;  5KX5 E;  3LG7 A;  5LBM A;  4E7S A;  2YEV C;  5JTG A;  4O8S A;  3HR0 A;  1JNR A;  1IBM T;  4AIS A;  4JI5 T;  2WMO A;  3AVS A;  5ABF A;  4DUZ T;  2BG9 B;  1N33 T;  2XQ4 A;  3EDV A;  1YD8 G;  3EI0 A;  1XMQ T;  5JR9 A;  4DV6 T;  2XY8 B;  1IJ6 A;  3MAC A;  5CA0 E;  5HYA A;  1G73 A;  4MFR A;  1OED B;  3LK4 2;  3W15 B;  4KI0 F;  1XDO A;  5J1G A;  5CA1 E;  4TNW A;  3PUW F;  4TNV A;  4TWD A;  2UUB T;  2CM0 A;  4MLK A;  2VL8 A;  4JI8 T;  3JAD A;  3C51 A;  2K48 A;  3N2K E;  3CQX C;  2LSJ A;  2D0T A;  3FZH B;  2ODU A;  5FYM A;  2XAJ B;  2VQF T;  5C2T A;  2WDQ A;  1UUS A;  4UF0 A;  2VUR A;  5ABG A;  5J2U E;  1BR4 A;  3ZMS B;  3KV5 A;  5AQL B;  1WR0 A;  1WFD A;  4U33 A;  2ZLY A;  3RHW A;  3T8O A;  3QK6 A;  3UQ4 A;  1KK7 A;  4H9O C;  3HI2 A;  5AQJ B;  1HCI A;  2LRL A;  2DWK A;  4H9Q C;  2LM9 A;  2WBL A;  5JRE A;  4JYA T;  2MTQ A;  4CQI A;  5HEU A;  5M4Y A;  4L9I A;  2I6H A;  3JAE A;  2K9A A;  3RI5 A;  2Q9Q B;  3LK2 B;  2VB6 A;  4ZZC A;  3WI3 A;  4CXY A;  2DL1 A;  2CA5 A;  4DV1 T;  4NPP A;  3N2G E;  3QB5 K;  2KSR A;  3MA9 A;  5JQG E;  4X20 E;  1LRZ A;  2L9Q A;  3UUN A;  5ADX L;  4DR3 T;  1HFA A;  4ZI2 C;  1D0Z A;  3AE6 A;  4P0B A;  2WS3 A;  2XSA A;  4ANJ A;  4LF8 T;  4EYY R;  3GMI A;  1EZ3 A;  2CXF A;  2KMF A;  3ZYL A;  3MK7 C;  2B76 A;  1AJ3 A;  2M6B A;  3ZJ1 A;  3P4S A;  4YTM A;  4QX7 B;  4DMV A;  3ZCI A;  3P4P A;  4U72 A;  3SRZ A;  1YW0 A;  2XQ8 A;  4JEH B;  5LHI B;  4UEL A;  3P50 A;  5L2L A;  2CLY B;  1WLX A;  2CBJ A;  2NTX A;  4QWN B;  4G2A A;  2YKS A;  5L3E B;  2JQK A;  3WAJ A;  3DJB A;  1M7K A;  2FJA A;  5LGU B;  4HE8 A;  2V5D A;  4KP3 C;  2E8I A;  2NW9 A;  2C5J A;  4AKH A;  5LG3 A;  2KZ7 B;  4HFV A;  2C0S A;  4QXB B;  4QHO A;  4PW8 A;  1E7P A;  3EAB A;  2LE8 A;  2X9W A;  5JR9 C;  1BR2 A;  1UCU A;  4KMC A;  2V7M A;  3OPC A;  2FUP A;  2M6I A;  4AKI A;  2IUB A;  1MMN A;  2VKO A;  2KWI B;  1WYB A;  1N34 T;  3A8Y C;  3ETU A;  3KFW X;  2J47 A;  4HFH A;  4CZZ B;  1WRD A;  3LBX B;  4A98 A;  4AQF A;  2KXP B;  3QNU A;  2E9X A;  4KUM B;  1HNX T;  2WY2 A;  3ZN1 B;  2W67 A;  2UU9 T;  3E22 E;  5FY0 A;  2N1G A;  4OYK A;  5FVK A;  2D5U A;  3F31 A;  3AA0 B;  2XQY A;  2IAK A;  3KV9 A;  4ZEY A;  2LM2 A;  1OWA A;  2CWO A;  2XAS B;  4GOU A;  1ZOY A;  1IBL T;  3KVB A;  2BKN A;  4U2Y A;  4OK0 A;  4JI6 T;  1HF8 A;  2CXL A;  3RYC E;  1VRB A;  2K24 A;  2WCA A;  3OYX A;  2UXN B;  3Q9D A;  2MOZ A;  3PV0 F;  4BAY B;  5LHH B;  4JI1 T;  3FZM B;  3UU5 A;  3Q5E A;  3RRC A;  5JH7 E;  1H7C A;  3L3P A;  2UXX B;  4AKG A;  4JLE A;  1YXR A;  3ESL A;  4UEM A;  2N9D A;  5FXX A;  2W4X A;  1XNR T;  4TUY E;  3PTR B;  2EHO D;  3QUJ A;  5KDM C;  4OHF A;  4JI2 T;  4HKA A;  4ZHQ E;  4DID B;  2YIN A;  3UUL A;  3VKG A;  2BG9 E;  2W66 A;  3ZKR A;  5L4E A;  2VL0 A;  4OX9 T;  5HXE A;  1OED E;  4I55 E;  2NWB A;  2V26 A;  5AQG B;  4AIU A;  1ZV4 X;  3BK9 A;  3ZC1 A;  2D2S A;  4NUV A;  2WU2 A;  2FJB A;  2EHO C;  1MIV A;  4HWD A;  4H63 V;  3G06 A;  1KNR A;  4DND A;  4GYS A;  4ASK A;  1KFY A;  4OFZ A;  3B13 A;  2DHR A;  5LMU T;  2BKO A;  5AQQ B;  5IYZ E;  3KIN B;  4A97 A;  3RRW A;  3BQL A;  3O1J A;  4FJO A;  4GYR A;  3I0O A;  5AQN B;  4TZ4 C;  5LMN T;  2QRX A;  2WDR A;  5JDN A;  1J5E T;  2J1D G;  1QLB A;  3HA4 A;  4EXT A;  2UXC T;  3AE5 A;  4LMK A;  2NR4 A;  3VR9 A;  4KHP T;  1ZHC A;  3UTK A;  4M1P A;  2Q9Q C;  3B5M A;  3PJA A;  4X65 T;  4ZZB A;  2BVM A;  4IDN A;  2CHO A;  2L8K A;  1XZY A;  4DO0 A;  2YU2 A;  2LKG A;  2KND A;  2YDQ A;  2HH7 A;  2RA1 A;  5JR9 B;  2WAU A;  3AVR A;  3ZN0 B;  5IUX A;  4BJN A;  4YFS A;  2XZE A;  3AAE B;  4FI5 A;  3GN5 A;  4O2A E;  1LVF A;  4ZS3 A;  2V6Y A;  3CVR A;  3AE7 A;  2WU5 A;  3ZT6 A;  1XMO T;  1UGO A;  3FZK B;  3ETV A;  3SFD A;  1HX8 A;  1I94 T;  3OYZ A;  4U74 A;  1D0X A;  5EK2 A;  2CRB A;  2YOE A;  4LF5 T;  3ZJ2 A;  1KEY A;  2CCQ A;  4PFP A;  3AE2 A;  4TN7 B;  2X0L B;  4UF0 B;  4DV7 T;  3PDY A;  4JI7 T;  2JPF A;  2YK0 A;  3PUR A;  2XQ7 A;  3FBL A;  2SPC A;  4X1Y E;  1DU2 A;  3A5X A;  2WB5 A;  4PK6 A;  4EB6 E;  4HWI B;  1E1H B;  2G0U A;  4ADZ A;  3C4Z A;  3NRY A;  3RLF F;  4X1K E;  2W00 A;  2N2N A;  3N9Q A;  3FBZ A;  3VHL A;  5AQU B;  2H88 A;  2D9D A;  4B3R T;  3KBT A;  3UUB A;  3RC3 A;  3LK3 B;  2ACX A;  5HXH A;  5GON E;  5A1L A;  4KX6 A;  1Y64 B;  3RIA A;  4JV5 T;  1IZN B;  3MXZ A;  4C91 A;  4B3T T;  1XNQ T;  3PU8 A;  3AE3 A;  5LB7 B;  4F8H A;  4AQG A;  2A3D A;  5HAX A;  2BKP A;  3AXJ B;  2J62 A;  4H63 H;  4IE4 A;  2Y6X A;  3K3O A;  4EV6 A;  2EHO B;  3L09 A;  3PUY F;  4YJ3 E;  5F8P A;  4TV9 E;  3RYF E;  2XM2 A;  3UFE A;  4DVD A;  5HXS A;  3RH3 A;  5LGT B;  4DV0 T;  4UR9 A;  3L39 A;  4Z90 A;  1N32 T;  3RIU C;  3ZMZ B;  5FY1 A;  2LOS A;  4ILU A;  1HR0 T;  2W61 A;  5CFB A;  3RC8 A;  1HG5 A;  5HWY A;  4YXD A;  4Z91 A;  2PJQ A;  5JRC B;  2V5C A;  5FKY A;  4J2C A;  2HPJ A;  2CEA A;  5DQV A;  1S94 A;  1D0Y A;  2HPL A;  2X66 A;  5AQK B;  2E2A A;  1FJG T;  2KT9 A;  5KMG P;  2D0U A;  4ILA A;  3CK6 A;  2C5K T;  2H7V C;  1W09 A;  4LF4 T;  4IL4 A;  3ZYM A;  2XAQ B;  2W62 A;  2BVL A;  3IA3 A;  4QH5 A;  4YY3 T;  4HFB A;  2A2F X;  3AEA A;  4CN4 A;  4IIJ E;  3UUX B;  1SE7 A;  2VAS A;  4GKJ T;  4EAH A;  3KDS E;  3CKD A;  5LGN B;  5ETW A;  4HTE A;  2BG9 A;  4HWH A;  1CHU A;  4AKL A;  5J2T E;  4X66 T;  2NW7 A;  4AXP A;  1Z8U A;  5FP3 A;  1UX4 A;  4LFB T;  3TLU A;  1OED A;  5H6Q B;  3PUA A;  3VRB A;  1NAF A;  5FL0 A;  5C3J A;  4CI2 B;  3WAK A;  3CWZ B;  3TKL B;  2QYW A;  2X0Y A;  2BDE A;  3LSV A;  2FJE A;  2VKH A;  1U5P A;  2DNX A;  5L3B B;  1IBK T;  3NWI A;  1YQ3 A;  3ZPO A;  2PFV A;  4E7Z A;  5TAO A;  2JMH A;  1HS7 A;  5AQO B;  4P1N A;  4DBR A;  5HWX A;  3CX8 B;  1T7S A;  2JJ9 A;  3ZMT B;  4IE7 A;  4IHJ E;  4XBF B;  2UXD T;  5LBQ B;  5FXW A;  5AQF B;  4Q25 A;  3FZF B;  1T72 A;  1X79 A;  5LYJ E;  3ONX A;  4UV8 B;  2IML A;  3PUS A;  2R6G F;  1FEW A;  3ONL C;  3K1S A;  5J0Z A;  2NW8 A;  5FVL A;  1W0B A;  2KIN B;  2W63 A;  4YSY A;  3ZC0 A;  5JDG A;  1VCT A;  2ACZ A;  3UU4 A;  4O4L E;  5LNK A;  2X0H A;  4L0R A;  4WNK A;  4EGW A;  4WW0 A;  2IHR 1;  4QXH B;  1IJ5 A;  1D1B A;  3EAM A;  5FXV A;  5LCY A;  3HKC E;  3R6N A;  3TLT A;  4JI3 T;  2WQY A;  2I0M A;  2J4G A;  3P4Q A;  1IAP A;  2X9X A;  3F2E A;  5HCM A;  2XQ9 A;  2YU1 A;  3EDU A;  4H9P C;  3AAA B;  5AQR B;  1QSD A;  1KNP A;  2W0G A;  2UXB T;  1QUU A;  4CN1 A;  1LVK A;  1N36 T;  5JDL A;  3AEF A;  1WR6 A;  3EHZ A;  5L4H A;  3MJX A;  5L3G B;  1MND A;  2MAW A;  2AE9 A;  4GKK T;  4YJ2 E;  4PJM A;  3KBU A;  4C90 A;  3EVY A;  4DR2 T;  5HEJ A;  2WZH A;  1MIY A;  2DCF A;  2E5V A;  4HGA A;  3DTO A;  1WYC A;  3J7Y q;  3UU6 A;  4L5G A;  2ZM6 T;  4U7Y A;  4YHH T;  2NTY A;  2XSB A;  3RX6 A;  3AE9 A;  5L47 A;  4O4I E;  1ZKE A;  5AQS B;  2MBG A;  4DV3 T;  4CI1 B;  3S4U A;  2PBI A;  3FXD B;  3LFM A;  2ZM8 A;  2FJD A;  4XZC A;  2LJL A;  3GN5 B;  4HWC A;  2V7K A;  4U2Z A;  2XHE B;  3FZL B;  5BR8 T;  3ANW A;  4PJJ A;  5AQH B;  3VR8 A;  3LBX A;  2BZB A;  4YLH A;  3SWH A;  2GK9 A;  5FNV E;  3LDQ B;  4HWF A;  1LKX A;  5F3J A;  4PNI A;  2RP4 A;  3HL6 A;  2LSI A;  3AA1 B;  2OA5 A;  2LOP A;  2H89 A;  3AEE A;  2WP9 A;  2IIU A;  4ZI3 D;  4JI0 T;  3RKG A;  2IDO B;  5HEG A;  2E9X D;  4I0U A;  4KBM B;  1U4Q A;  4EOZ B;  3IBP A;  4XAX B;  3CX6 B;  3RKO A;  1JNZ A;  4DR7 T;  3K3N A;  1MMG A;  4GIW A;  4OYJ A;  2A9U A;  4YTN A;  5ABF B;  5FY7 A;  2BS3 A;  4YTP A;  3CML A;  1FMV A;  4DMW A;  3O1I A;  2E5L T;  2XQ5 A;  3BQI A;  1O3X A;  3JCF A;  3O4X E;  2WZI A;  1T8B A;  2XTL A;  4X62 T;  4DR6 T;  4AQF C;  3AE8 A;  2E9X C;  3VKH A;  5JDH A;  4PK5 A;  4MAL A;  4LFA T;  1ZEE A;  2CXD A;  2DLR A;  2LT3 A;  1KNZ A;  4DBQ A;  1OXZ A;  3AA7 B;  4U7I A;  4X5T A;  5JDM A;  4MHC A;  2XAH B;  4P0A A;  3VRA A;  3ZLI A;  2HN2 A;  3CIR A;  3P4W A;  2LLY A;  3M3Z B;  4HEA A;  1YKE B;  2XUE A;  2V8S V;  2H3R A;  3PUZ F;  3DP7 A;  1Z0P A;  1SHZ C;  2CHN A;  3RPU A;  5EZY E;  1BR1 A;  2A72 A;  4A56 A;  5KXJ A;  4K0U A;  3KV4 A;  3UU8 A;  5EK4 A;  2WWV A;  3PU3 A;  5DJQ C;  4A5X A;  4ZOL E;  4IST A;  5JVD E;  2OLT A;  4EEB A;  5L3D B;  4IGU A;  2VK9 A;  4O2B E;  4QX8 B;  5FXZ A;  2I59 A;  4COF A;  2IC6 A;  2QA7 A;  3O1H A;  2UUA T;  2QVA A;  4IDP A;  3RYH E;  2C5I T;  2PG8 A;  3AEG A;  1L0V A;  4YSZ A;  2LRK A;  3NZP A;  4IDO A;  2M67 A;  2Y8D A;  2H7O A;  2WM9 A;  3ZT5 A;  2HHH T;  3IF8 B;  4QXC B;  2XM1 A;  4HFE A;  3GWH A;  4EED A;  1B7T A;  3I9W A;  3X1D A;  2NOX A;  3A7M A;  2Y48 B;  4H9S E;  2F4V T;  4EYU A;  4UVA B;  3TLS A;  3PUX F;  1HG2 A;  3OVU A;  4LF9 T;  1UX5 A;  2ZMA A;  3N9L A;  3U78 A;  3UQ7 A;  3AAI A;  3H3M A;  2PTF A;  3Q5W A;  5LP6 E;  2WWU A;  3RIF A;  4CI3 B;  4CXX A;  4NXN T;  2NP9 A;  3CQG B;  3NBX X;  3ZMV B;  2X51 A;  1UUR A;  1XWM A;  2V6X A;  4GK5 E;  3VU7 H;  2HN1 A;  3L8R A;  3ZCJ A;  1MMD A;  3N9O A;  1NEK A;  3E08 A;  4EZ4 A;  4LF6 T;  1HX1 B;  4ZI2 D;  2QGS A;  4P09 A;  3PJA J;  4AQY T;  4DR5 T;  4U3C A;  4BJM A;  2DWG A;  3IEE A;  4DR4 T;  5HEO A;  5LJN A;  4KHZ F;  3Q5D A;  2CBI A;  2ODV A;  2MYS A;  2YN6 A;  3K3Q C;  5HXR A;  3E0Z A;  4ZXL A;  3C64 A;  2E9X B;  1X9B A;  4G63 A;  2VVS A;  2XAG B;  2BS2 A;  5JDQ A;  4MBQ A;  5L3C B;  1VOM A;  4IDZ A;  3KV6 A;  4PJN A;  2KLQ A;  3HKB E;  2XJ7 A;  4DR1 T;  2IW5 B;  1BR0 A;  1HNZ T;  3AEB A;  3MKD A;  3AXJ A;  5F5W A;  4GK0 E;  2UUC T;  4ZI7 E;  4UV9 B;  3H37 A;  4I4T E;  2P9B A;  2EHO A;  4H9R C;  3ZSS A;  2WMN A;  4UVC B;  4DV4 T;  1D1C A;  1V9D A;  5H6R B;  3IHR A;  1D1A A;  4TWH A;  1W0A A;  2VWA A;  4YT0 A;  4JUY A;  2K3W A;  4PK4 A;  4IDQ A;  4QKN A;  3UT5 E;  2L3L A;  3ZYK A;  2XAF B;  2ES0 A;  3CQC B;  4ISS A;  3RF1 A;  3ONJ A;  4HFD A;  2WSS V;  5EK3 A;  5JRC A;  4ERR A;  4EIW A;  2DI4 A;  3C4X A;  2B1E A;  2JQ9 A;  4JI4 T;  4UIG A;  3M65 A;  5AQI B;  3ABV A;  3NKZ A;  3NZQ A;  5AFU L;  3RQU A;  2VVN A;  1W9R A;  3C4W A;  4DUY T;  3AED A;  3N9M A;  2Q9Q A;  3R84 B;  5L3F B;  2X67 A;  3K8P C;  3TLV A;  3ZEF B;  5HCJ A;  1US7 B;  3RQW A;  1MNE A;  3NVO A;  5FMN A;  4QH1 A;  2LKH A;  5LG4 A;  3PUQ A;  3HKE E;  5ABH A; 
#chains in the Genus database with same CATH homology
 3Q5X A;  1LKX A;  2K9A A;  1E1H B;  5F3J A;  2G0U A;  2RP4 A;  3H3A A;  3HL6 A;  2Q9Q B;  4PNI A;  4ADZ A;  3ANW B;  3C4Z A;  2LSI A;  3NRY A;  3AA1 B;  3LK2 B;  2VB6 A;  4X1K E;  3WI3 A;  4CXY A;  2W00 A;  2CA5 A;  2N2N A;  2VKJ A;  2OA5 A;  3N9Q A;  3FBZ A;  2LOP A;  3CX7 B;  3VHL A;  3N2G E;  2JMK A;  4ZI3 D;  3MA9 A;  4EZH A;  3ZMU B;  5JQG E;  1S35 A;  4X20 E;  4H9N C;  1LRZ A;  2L9Q A;  3PUG A;  3UUN A;  5ADX L;  3KBT A;  2E9X D;  4JEU B;  4KBM B;  1U4Q A;  1HFA A;  4EOZ B;  4ZI2 C;  1D0Z A;  4BA9 A;  3IBP A;  4XAX B;  3CX6 B;  3MZK B;  3RC3 A;  3LK3 B;  2ACX A;  3N5L A;  3I9Y A;  3RYI E;  5HXH A;  2V7J A;  3RKO A;  4P0B A;  5GON E;  5A1L A;  4ANJ A;  4EYY R;  2LHN A;  3K3N A;  3GMI A;  1MMG A;  5DAB A;  4GIW A;  4OYJ A;  1Y64 B;  4V1A v;  3GA8 A;  1IZN B;  1EZ3 A;  2Z6E A;  3MXZ A;  4C91 A;  2CXF A;  2KMF A;  5FY7 A;  3ZYL A;  3MK7 C;  3PU8 A;  3NRX A;  4ZS2 A;  2V7L A;  4AQG A;  1AJ3 A;  2LSG A;  3EUH A;  3N9P A;  3CML A;  3ZJ1 A;  1FMV A;  2A3D A;  4DMW A;  3O1I A;  3BQI A;  1O3X A;  3O4X E;  4QX7 B;  3ZCI A;  4DMV A;  5HAX A;  2K5B B;  4U72 A;  2XTL A;  5LHG B;  3SRZ A;  1YW0 A;  4AQF C;  4H63 H;  3V5S A;  4IE4 A;  3N2O A;  1CUN A;  4JEH B;  5LHI B;  3I1A A;  2E9X C;  2Y6X A;  4UEL A;  2CE7 A;  3K3O A;  5L2L A;  2CLY B;  3SOL A;  1WLX A;  3VKH A;  2EHO B;  3L09 A;  3UUM A;  2NTX A;  4QWN B;  4AKR B;  4YJ3 E;  4G2A A;  5F8P A;  5JDH A;  4PK5 A;  4MAL A;  4I43 B;  4TV9 E;  3RYF E;  3V5U A;  5L3E B;  3UFE A;  3QC9 A;  3WAJ A;  3DJB A;  1ZEE A;  2CXD A;  4DVD A;  5HXS A;  2DLR A;  3RH3 A;  5LGT B;  2KWH A;  5LGU B;  4HE8 A;  2LT3 A;  1KNZ A;  3BQK A;  4DBQ A;  1OXZ A;  3AA7 B;  4KP3 C;  5JDM A;  2E8I A;  4MHC A;  2XAH B;  4P0A A;  1FMW A;  3ZMZ B;  3ZLI A;  3JC6 D;  5FY1 A;  5LOV E;  2NW9 A;  4UVB B;  2C5J A;  2LOS A;  4PAG A;  4AKH A;  4ILU A;  2KZ7 B;  2W61 A;  4HFV A;  4HEA A;  5DQW A;  1HG5 A;  5HWY A;  3RC8 A;  1YKE B;  2C0S A;  2XUE A;  3B57 A;  4QXB B;  2H3R A;  4QHO A;  5LA6 E;  2PJQ A;  5JRC B;  4PW8 A;  3DP7 A;  1Z0P A;  4J2C A;  1SHZ C;  2HPJ A;  2CEA A;  3CPZ A;  3P7I A;  5DQV A;  3RPU A;  5EZY E;  1S94 A;  2LE8 A;  1D0Y A;  2HPL A;  1BR1 A;  2A72 A;  2X66 A;  2X9W A;  4A56 A;  3HKD E;  5JR9 C;  1BR2 A;  2JRK A;  2KT9 A;  1UCU A;  3F57 A;  4KMC A;  2V7M A;  4K0U A;  3KV4 A;  1SA0 E;  5KMG P;  5EK4 A;  2D0U A;  4I50 E;  3PU3 A;  5DJQ C;  3FXE B;  4AKI A;  1MMN A;  4ZOL E;  2VKO A;  5JDF A;  2C5K T;  4IST A;  2H7V C;  5HXC A;  5JVD E;  2KWI B;  1WYB A;  2V1D B;  4N78 D;  3D0T A;  4TX5 A;  3ETU A;  3KFW X;  5L3D B;  2VKD A;  4IGU A;  4CZZ B;  2VK9 A;  1WRD A;  4O2B E;  3LBX B;  4NUU A;  4AQF A;  3ZYM A;  4QX8 B;  3JC6 C;  2XAQ B;  5FXZ A;  2W62 A;  2KXP B;  2E9X A;  4KUM B;  2BVL A;  2ZM0 A;  3LJC A;  2IC9 A;  3AA6 B;  1MMA A;  2I59 A;  2IC6 A;  2Q9Q D;  3N9N A;  3ZN1 B;  2QA7 A;  2A2F X;  3O1H A;  3E22 E;  4IIJ E;  2N1G A;  5FY0 A;  3UUX B;  3RYH E;  2VAS A;  4OYK A;  2C5I T;  4EAH A;  3KDS E;  3CKD A;  5LGN B;  1YKH B;  5ETW A;  2PG8 A;  4HTE A;  3C98 B;  2D5U A;  3F31 A;  3AA0 B;  2LSK A;  2XQY A;  3NZP A;  2IAK A;  4AKL A;  3KV9 A;  3FHN A;  1OWA A;  2CWO A;  5J2T E;  2XAS B;  2NW7 A;  4AXP A;  2M67 A;  4GOU A;  5FP3 A;  1UX4 A;  2Y8D A;  2H7O A;  2WM9 A;  3KVB A;  3IF8 B;  4WBN E;  4QXC B;  2V7I A;  5H6Q B;  3GWH A;  2JQQ A;  3PUA A;  1B7T A;  3I9W A;  4OK0 A;  1HF8 A;  1NAF A;  2CXL A;  2NOX A;  3RYC E;  1FIO A;  1VRB A;  2LSY A;  2Y48 B;  2K24 A;  3P8C D;  4CI2 B;  3PE0 A;  3WAK A;  4UXN B;  3OYX A;  4YHJ A;  3CWZ B;  2UXN B;  4ZI3 C;  2X9H A;  3Q9D A;  4TV8 E;  2MOZ A;  4BAY B;  3TKL B;  3KVA A;  4H9S E;  4EYU A;  5LHH B;  2LEH A;  2BDE A;  2CWY A;  2VKH A;  4UVA B;  1U5P A;  2DNX A;  4PJL A;  4WBO A;  3RRC A;  5JH7 E;  1H7C A;  3AB3 B;  3OJA A;  1HTJ F;  5IHY A;  3L3P A;  2UXX B;  5L3B B;  4JLE A;  4AKG A;  3ESL A;  4UEM A;  2N9D A;  3ZPO A;  5BMV E;  2PFV A;  5FXX A;  4E7Z A;  5TAO A;  2X9Y A;  1HG2 A;  5C8Y E;  2JMH A;  1UX5 A;  1HS7 A;  4TUY E;  3PTR B;  2ZMA A;  3C50 A;  2EHO D;  3N9L A;  3U78 A;  3AAI A;  4DBR A;  3FB2 A;  5HWX A;  3CX8 B;  3QUJ A;  3Q5W A;  2JJ9 A;  5CB4 E;  3ZMT B;  5KDM C;  2WWU A;  4IE7 A;  4IHJ E;  4OHF A;  5LP6 E;  4XBF B;  3U3I A;  3Q2M A;  4CI3 B;  4HKA A;  4CXX A;  1MIW A;  4ZHQ E;  1T98 A;  2X68 A;  4HN9 A;  2YIN A;  3UUL A;  2NP9 A;  5LBQ B;  3VKG A;  5FXW A;  3CQG B;  3NBX X;  4F6R C;  3ZMV B;  3SS1 A;  4O4J E;  2X51 A;  4IE0 A;  1X79 A;  5E0O A;  5LYJ E;  3ONX A;  1NWM X;  3OKQ A;  4PFO A;  4O4H E;  4UV8 B;  4CXW A;  5LXT E;  4AI6 A;  5HXE A;  3PUS A;  4GK5 E;  1FEW A;  4X1I E;  4I55 E;  2NWB A;  2V26 A;  3VU7 H;  1ZV4 X;  3BK9 A;  3ZC1 A;  2CMR A;  2D2S A;  3ZCJ A;  1MMD A;  2NW8 A;  4NUV A;  3N9O A;  2KIN B;  2CLY C;  2W63 A;  2EHO C;  1MIV A;  3E08 A;  4EZ4 A;  3ZC0 A;  5JDG A;  4H63 V;  3J9X 1;  4DND A;  4IE5 A;  4GYS A;  4ASK A;  4ZI2 D;  2QGS A;  4OFZ A;  2LHR A;  4O4L E;  4B6X A;  4P09 A;  4Z8X A;  5LNK A;  3B13 A;  2DHR A;  2ZM2 A;  3I0Q A;  4L0R A;  4IE6 A;  4WNK A;  2DWG A;  4BJM A;  3IEE A;  3OBV E;  5IYZ E;  3KIN B;  3RRW A;  3BQL A;  3O1J A;  4WW0 A;  5LJN A;  4QXH B;  1IJ5 A;  4FJO A;  5LJM A;  1G8X A;  3O9X A;  4GYR A;  3I0O A;  1D1B A;  2ODV A;  3K3Q C;  2MYS A;  3LG7 A;  5HXR A;  5KX5 E;  5LBM A;  3E0Z A;  4E7S A;  3C64 A;  2YEV C;  2E9X B;  4TZ4 C;  5FXV A;  4O8S A;  3HR0 A;  5LCY A;  3HKC E;  3R6N A;  5JDN A;  2J1D G;  4G63 A;  2XAG B;  3HA4 A;  4EXT A;  5JDQ A;  5L3C B;  4MBQ A;  2WMO A;  1IAP A;  3AVS A;  2X9X A;  1VOM A;  3F2E A;  4IDZ A;  3KV6 A;  4PJN A;  2KLQ A;  3HKB E;  2YU1 A;  3EDV A;  1YD8 G;  3EDU A;  2IW5 B;  1BR0 A;  5JR9 A;  4H9P C;  1ZHC A;  3AAA B;  3UTK A;  4M1P A;  2Q9Q C;  3MKD A;  1QSD A;  4GK0 E;  1IJ6 A;  2W0G A;  3MAC A;  1QUU A;  1LVK A;  5CA0 E;  5HYA A;  2BVM A;  4ZI7 E;  5JDL A;  4UV9 B;  3H37 A;  4I4T E;  1WR6 A;  2L8K A;  1G73 A;  4MFR A;  2P9B A;  3LK4 2;  4DO0 A;  2EHO A;  4H9R C;  2YU2 A;  3MJX A;  5L3G B;  2WMN A;  4UVC B;  3W15 B;  2KND A;  1D1C A;  1MND A;  2HH7 A;  1V9D A;  5H6R B;  4YJ2 E;  4PJM A;  3KBU A;  2RA1 A;  3IHR A;  4C90 A;  1D1A A;  5JR9 B;  3EVY A;  5J1G A;  5CA1 E;  2VWA A;  2CM0 A;  1MIY A;  4MLK A;  2VL8 A;  2WAU A;  3AVR A;  2DCF A;  3ZN0 B;  4HGA A;  4JUY A;  3C51 A;  3DTO A;  4PK4 A;  2K48 A;  1WYC A;  3N2K E;  4QKN A;  3CQX C;  3UT5 E;  2L3L A;  3ZYK A;  2LSJ A;  2XAF B;  2ES0 A;  4BJN A;  3J7Y q;  4YFS A;  3CQC B;  4ISS A;  4L5G A;  3AAE B;  4FI5 A;  2D0T A;  2NTY A;  3GN5 A;  3RX6 A;  4O2A E;  4O4I E;  1LVF A;  4ZS3 A;  2WSS V;  5EK3 A;  1ZKE A;  3CVR A;  5JRC A;  4ERR A;  4EIW A;  2DI4 A;  3C4X A;  2B1E A;  2ODU A;  5FYM A;  2XAJ B;  2MBG A;  4CI1 B;  4UIG A;  3M65 A;  3S4U A;  2PBI A;  4UF0 A;  3FXD B;  3ETV A;  3LFM A;  2ZM8 A;  3NZQ A;  1HX8 A;  5J2U E;  5AFU L;  4XZC A;  1BR4 A;  2LJL A;  3GN5 B;  3OYZ A;  4U74 A;  3ZMS B;  1D0X A;  5EK2 A;  3KV5 A;  3C4W A;  2ZLY A;  3T8O A;  3QK6 A;  3ZJ2 A;  2V7K A;  3N9M A;  2XHE B;  1KK7 A;  2Q9Q A;  3R84 B;  2CCQ A;  2X67 A;  3ANW A;  3K8P C;  4PJJ A;  4PFP A;  5L3F B;  3LBX A;  2BZB A;  4TN7 B;  4YLH A;  2X0L B;  3ZEF B;  4H9O C;  4UF0 B;  3PDY A;  2JPF A;  1US7 B;  3HI2 A;  3SWH A;  2YK0 A;  1HCI A;  2DWK A;  1MNE A;  3PUR A;  4H9Q C;  2LM9 A;  2WBL A;  5FMN A;  2GK9 A;  2SPC A;  3FBL A;  5FNV E;  4X1Y E;  5JRE A;  2MTQ A;  4CQI A;  3A5X A;  5LG4 A;  5M4Y A;  3PUQ A;  4PK6 A;  3HKE E;  4L9I A;  4EB6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...