4FJOA

Structure of the rev1 ctd-rev3/7-pol kappa rir complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'AAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title Structural basis of Rev1-mediated assembly of a quaternary vertebrate translesion polymerase complex consisting of Rev1, heterodimeric Pol zeta and Pol kappa
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/dna binding protein
total genus 32
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4fjoA00
4FJOA 2N1GA 4EXTA 2LSIA 4GK0E 2LSGA 2LSKA 4BA9A 3VU7H 4GK5E 2LSYA 2LSJA
chains in the Genus database with same CATH superfamily
2NW9A 4EB6E 3T1HT 2LSKA 4P09A 4ISTA 1D0ZA 5CB4E 3EDUA 4DUYT 3F2EA 3ANWB 3CKDA 5HAXA 5FVLA 2ZLYA 2Q9QC 1X9BA 2XSBA 3N5LA 3OJAA 3ZEFB 3AE7A 5HEOA 4MBQA 3Q5DA 3WI3A 4I43B 2J1DG 5LGNB 1NEKA 5JDQA 2V6YA 4JI7T 2V7JA 4ILAA 4UVAB 5HXRA 4WYVA 3UU4A 2G0UA 5FY1A 3N2OA 3ZMZB 5HEGA 2JQQA 3N9QA 4EYUA 3AEBA 1U5PA 3RQUA 2J4GA 5FYMA 2XQ5A 2WS3A 1D1CA 4EIWA 2WZHA 4M1PA 4DV3T 3C64A 3MZKB 4A98A 5AQJB 1UX4A 3AAIA 2NTYA 3PE0A 2JMKA 5AQSB 4COFA 1X79A 4IL9A 3KVAA 3AA0B 4O8SA 5KDMC 4MFRA 2B1EA 4CI3B 4OYKA 1I94T 2YU2A 1OEDE 3ZKRA 1T98A 3T1YT 4E7SA 1DU2A 2K48A 1SHZC 1JNZA 3I1AA 4JV5T 1GQEA 2JQHA 5ABFB 1IAPA 4NIQA 3LK42 2M67A 4X20E 3SFEA 2EHOD 2WP9A 3FZHB 2XM1A 5LG4A 1H7CA 2CPTA 4JEUB 4GOUA 5HCJA 2IIUA 2LE8A 4GK0E 2AXDS 5CFBA 3ZMVB 2PJQA 4TWFA 3EABA 2W62A 4TX5A 4QH1A 3UFGA 4LMJA 3FZLB 2LM2A 4JI4T 4CN4A 5FXXA 2E9XD 2E2AA 3ZT7A 3AXJA 2LSIA 2IHR1 5C8YE 1ZOYA 2LSGA 2NOXA 3UUNA 3P4SA 1ZP0A 5EK2A 4DIDB 4ANJA 1NWMX 4DUZT 3FHNA 4U74A 4IDZA 2QYWA 1YQ3A 4Q25A 4G63A 4YHJA 4LF6T 1MNDA 4CN6A 4LF9T 3TLUA 4DV7T 4KMCA 3AA1B 5M4YA 1D1AA 3KBTA 3TLWA 2X0HA 2CXLA 1YD8G 1WRDA 2C0SA 4NXMT 3AE3A 3UQ4A 4AKLA 3VR9A 2CM0A 3SOLA 4UR9A 2IMLA 2I6HA 1ZEEA 2EHOC 1KFYA 5AQGB 3ZCIA 3JAFA 1XNRT 3P4WA 4ZS3A 4TWDA 2K3WA 3KV6A 3PJAJ 5IHYA 2LOSA 3AAAB 4IT4A 2DNXA 2W2UA 3RYCE 3LBXA 3FXDB 2V5CA 1B7TA 2UXDT 4BA9A 2E9XC 4HFBA 5JDNA 2LSJA 3UU8A 4UVCB 2W66A 1LKXA 5FL1A 5JRCA 5AQFB 4U3CA 3RC8A 4UF0A 4LMKA 1NENA 4YJ3E 1J5ET 4TWHA 5L4HA 4A56A 4U31A 5CA0E 5IYZE 2XAGB 4QX7B 3UULA 2LHRA 3MK7C 3ETVA 2XHEB 4U2YA 3KINB 3JC6D 4IE5A 5DQWA 4KHZF 5L3BB 3M65A 1XDPA 5LGUB 3RRWA 5HCMA 2BKNA 3C4ZA 2QVAA 4CI1B 3IHRA 2E5VA 3LK2B 5JR9A 1CHUA 4LFAT 3UFEA 4H9NC 4QH5A 5J2UE 1R8IA 4UV9B 3ZT5A 2ZM0A 3IF8B 4KUMB 3PUWF 2D9DA 1W0AA 3F31A 2ACZA 2IC9A 2VKJA 3ZJ1A 2BG9C 2YINA 3J9X1 5ABGA 2V7MA 4BJMA 2V1DB 2MYSA 4YTMA 1MMAA 3BQIA 4F8HA 4ZEYA 2AE9A 2YDRA 2Z6EA 3CX7B 5L3GB 3A5XA 3B5MA 4ERRA 2CBJA 1KK7A 2FUPA 3FZMB 1IBLT 1MIYA 4Z8XA 3Q9DA 2LM9A 5LA6E 3F57A 2V7KA 1N32T 3VR8A 3CWZB 2I0MA 5LHIB 5LB7B 2BS3A 3HKDE 2VASA 3UU6A 3QB5A 2PBIA 3JC6C 1LVFA 2M6BA 2WWUA 1Y01A 2MTQA 3AE8A 2DI4A 4DNDA 3DJBA 2LT3A 4DR6T 2H7VC 5KXJA 2YDSA 2ACXA 3RIUA 4HFDA 3P8CD 1G73A 2WU2A 3ZMSB 2ZM6T 4JI1T 3ZN1B 3W15B 5J2TE 5ABHA 3ONXA 4HFVA 3O1IA 5E0OA 4TUYE 1KNRA 3AEEA 3RI5A 4JI3T 2N2NA 4TNVA 4Z91A 2NP9A 3EDVA 3FXEB 3AE9A 3RQWA 4CN1A 3ESLA 3BQLA 5JH7E 3IBPA 3OKQA 2KMFA 4DMVA 4LFBT 5AFUL 3DP7A 5JR9B 2NR4A 2C5JA 2K5BB 1OXZA 3S4UA 4ZI7E 3AECA 3PURA 3Q2MA 3K1SA 4OX9T 2NTXA 4ZI2D 4B3TT 3MKDA 4DV6T 3ONLC 4H9QC 2DWKA 4P0AA 3RH3A 3H3AA 3RF1A 4DR7T 4AQFC 3C50A 3EVYA 3VRAA 3ZN0B 2HH7A 3RKOA 4DR2T 3PUYF 3UU3A 2DWGA 4AISA 2DCFA 2W0GA 3H3MA 2CBIA 3CVRA 3K3QC 1MMNA 3RC3A 3WAKA 4ZOLE 3TLVA 1XMQT 4DR5T 1L0VA 4ISSA 4NPPA 3SFDA 4WBNE 2BZBA 2UXXB 4FI5A 4IREA 2X9XA 2FJDA 4AXPA 2RA1A 5EK4A 2ZMAA 4YSZA 3LSVA 1XMOT 4LF5T 4X62T 3EHZA 4HWFA 2H89A 1HG2A 3N9MA 3QUJA 2BKOA 2V7LA 3HKEE 5JVDE 2HHHT 4ZI3D 4PJMA 5LBQB 4IDOA 3PUSA 3RLFF 4QXBB 3PU8A 5HXEA 4U72A 4I0UA 4PJJA 4HKAA 2LSYA 3O4XE 4WW0A 5AQOB 4EOZB 5CGMA 3JCFA 5FVKA 3AE5A 2W67A 2A9UA 2VQFT 5LG3A 4DR3T 4KBMB 3NZQA 4EXTA 4HE8A 4CXYA 2L9QA 3DTOA 4N78D 3U3IA 2W63A 2CLYC 2XTLA 3ABVA 2CXDA 5LGTB 4XBFB 5L2LA 4JLEA 2LLYA 2BDEA 4DBRA 1OEDC 2CMRA 2WDRA 5LCYA 1YW0A 2HN1A 1QSDA 2WY2A 3ZT6A 3ZLIA 3RYIE 3AAEB 4HEAA 2UUAT 2BVLA 4O4HE 2D5UA 3L39A 3CIRA 3CK6A 4CXXA 5JDLA 3JADA 5GONE 4DVDA 2BBJA 3ZC1A 5F5WA 4CI2B 3QOFA 2XQ6A 3GN5A 5DQVA 4QWNB 2NWBA 4O4IE 4LF8T 4PFPA 3CPZA 2H3RA 3VKHA 3AE6A 3WAJA 4ZI3C 4CZZB 4B6XA 2XAFB 4H63V 2KWIB 1KF6A 1HX8A 3ZC0A 3CQGB 3UQ7A 2YN6A 2XM2A 4YLHA 2PG8A 3FZFB 4MHCA 2KLQA 1IJ5A 2Q9QA 2IUBA 2CRBA 3KV5A 1UCUA 3LG7A 1FJGT 1XNQT 3HA4A 3A7MA 4PJLA 1JNRA 2J47A 5BMVE 1HCIA 4KX6A 3CQXC 1T8BA 4AQYT 4GK5E 3ETUA 2VURA 2V6YB 4X1IE 1N33T 5LHHB 2XQ8A 4GKJT 3QC9A 2CA5A 3MXZA 4YHHT 3L09A 1U4QA 3HI2A 5FXVA 4X65T 2FJEA 3GWHA 2UUBT 4PAGA 1SA0E 4H9OC 4H9RC 3B13A 2P9BA 5C2TA 3KV9A 3N9PA 3AE4A 5IUXA 1XDOA 4U7YA 2UXNB 3LDQB 5AQNB 1FIOA 4X1YE 2ZM2A 2A3DA 3LFMA 1MIVA 5HXSA 5AQVB 4IGUA 5LBMA 4JI8T 4XAXB 5LYJE 1QUUA 4G2AA 4B3ST 4HFIA 2VKOA 4F6RC 3RGLA 2BS4A 1FMVA 3B57A 4QXHB 3D0TA 3HL6A 2UXCT 4TZ4C 4NUUA 2X9YA 5FY7A 3MACA 1YXRA 2CWOA 4UV8B 3OYZA 3X1DA 2XQ9A 2ZM8A 1D0YA 3PUZF 3PUGA 3C98B 2HPLA 3ZYKA 5AQIB 1XZYA 1US7B 1MNEA 5JQGE 3GN5B 2XJ7A 5FL0A 3ZSTA 3RX6A 2A72A 3CX6B 2WWVA 3ZYMA 5F3JA 4IL4A 5AQLB 4EEBA 4NUVA 3KBUA 2X67A 2OA5A 1N36T 2CXFA 4L0RA 3AXJB 4I4TE 3L3PA 3AA6B 5LJNA 3BQKA 2MOZA 1UGOA 2H7OA 1E2AA 2V5DA 4O4JE 5HYAA 4L5GA 2Q9QB 3QNUA 5BR8T 1WR0A 5DABA 4FJOA 4PK5A 4AKRB 2VKHA 1WYCA 2VWAA 1V9DA 4ILUA 5L3CB 1SUMB 5HEUA 2JRKA 4CQIA 1HTJF 2MBGA 3PUVF 2DHRA 2XAQB 3M3ZB 3ZMUB 3ONJA 3HR0A 2YKSA 5L47A 1T7SA 2EHOA 1D1BA 4DBQA 3EAMA 3ZYLA 1ZKEA 4TNWA 4PK4A 5LXTE 4AKIA 1HX1B 2WCAA 5KMGP 2N9DA 1YKEB 2RPAA 3LBXB 5AQRB 3HKBE 1W09A 4PNIA 4QKNA 2V6XA 4UEMA 3O9XA 2ES0A 2BVMA 1G8XA 4TV9E 4ZXLA 2X68A 3P4QA 4JBWF 4TV8E 2E9XA 4L9IA 1HNWT 3VRBA 2XQAA 5JRCB 4U2ZA 4K0KT 3VU7H 3SRZA 4UF0B 3AE2A 4OHFA 2X66A 4AQGA 2FJAA 1UURA 5ETWA 2WSSV 3RIFA 3P4PA 1CUNA 4IIJE 1VCTA 3GMIA 5AQHB 2X9HA 5AQMB 1HF8A 3FZKB 2CHNA 2LHNA 4EZ4A 1HG5A 2CHOA 3PUXF 1M62A 3PV0F 1S35A 4A97A 5LMUT 5FXWA 2XQ4A 2PTFA 2KINB 3KVBA 1WFDA 4YT0A 3MJXA 3OTOT 2KNDA 4ILCA 1BR2A 5IWAT 3R84B 5HXHA 4PJNA 4O4LE 5CJ5A 1VOMA 4O2BE 2HN2A 2X0LB 4EAHA 5ABFA 2X51A 1MMGA 2FJBA 3UT5E 4DR4T 2ODVA 2X9WA 4GYRA 4LMLA 4JUYA 3OVUA 5ADXL 2UXBT 3ZCJA 2BG9A 1YKHB 3MA9A 4P0BA 3VHLA 2I59A 1HNXT 4P1NA 5JTGA 3AEGA 3I0QA 4YSXA 2IDOB 4HWHA 2E5LT 1XWMA 3CMLA 5FXZA 4PK6A 2M6IA 4WBOA 1KEYA 3TLSA 5JDGA 3AA7B 2L8KA 2VL8A 2LRLA 2D0UA 3P4RA 4UVBB 2WMNA 2EHOB 1N34T 2JIWA 5H6RB 3KV4A 4JI5T 3OBVE 3C4WA 4DV0T 2JMHA 3I9WA 5L3DB 2E8IA 4YSYA 2VVSA 2LRKA 1IJ6A 2BBHA 2KSRA 2QGSA 4HGAA 1D0XA 2E9XB 4WNKA 3QK6A 5JDMA 2JPFA 1WLXA 2LEHA 4DR1T 2MAWA 2V26A 5JDHA 4EZHA 5A1LA 1BR1A 2WQYA 2WM9A 4ZI2C 2JQ9A 4X64T 2CE7A 1I6ZA 1FMWA 2MPKA 2N1GA 2F4VT 2NW7A 4YJ2E 2IAKA 3UUMA 4ADZA 3Q5EA 3N9NA 3CX8B 4UELA 2VK9A 4X5TA 3LK3B 2LOPA 3I0OA 1OWAA 5ABEA 3BK9A 4ILBA 1J5WA 4WZXA 5AQPB 3E22E 3TLTA 2A2FX 4KHPT 3SS1A 4ZS2A 4ZZCA 3OPCA 5HEHA 2KT9A 3JAEA 5LMNT 4AIUA 4AQFA 3NRYA 2QA7A 2BG9B 2LKHA 2XZEA 2GK9A 4HWCA 1J1JA 4KP3C 5L3FB 2VL0A 2CCQA 2YU1A 4J2CA 3K3NA 3RPUA 2IW5B 3FB2A 5HWYA 3FBZA 4JI0T 1WCRA 2XQ7A 5JR9C 4IDNA 2QRXA 5L3EB 4PW8A 4C91A 4ASKA 2C5IT 1HFAA 2DL1A 2XASB 4JI6T 1FEWA 2XPKA 4IE4A 4IDPA 2XAHB 2YEVC 4HFEA 2KZ7B 3K3OA 4IHJE 3K8PC 2R6GF 4GIWA 5FMNA 5LJMA 2YDQA 3RYFE 4B3RT 3V5UA 4LFCT 5JDFA 4UIGA 1IBMT 3NRXA 2XQYA 4DV4T 4X1KE 1E1HB 4QHOA 2RP4A 1UK5A 2K24A 3IA3A 3CQCB 3KFWX 2WAUA 4PFOA 2OV9A 1LVKA 5HWXA 4UXNB 3NZPA 3HKCE 5AQQB 4H9PC 3NVOA 3Q5XA 2XSAA 1BR0A 4EYYR 1VCSA 3J7Yq 3AE1A 2DLRA 2WB5A 2YOEA 4YTNA 1OEDA 5LOVE 1MIWA 1ZV4X 5CA1E 3AEFA 3NBXX 3C4XA 3PDYA 4I55E 2LJLA 2WBLA 3UUXB 1W0BA 1T72A 2OLTA 4DV1T 2LKGA 4ZZBA 2K9AA 3FBLA 4XZCA 4U33A 1VRBA 5LP6E 3I9YA 3IEEA 5J1GA 1HS7A 1Z0PA 3RIUC 4DO0A 1YQ4A 4EV6A 2VVNA 3PUAA 3N2GE 1AJ3A 5AQTB 4A5XA 5HEJA 2VB6A 2YK0A 4CXWA 5C3JA 3P50A 1W9RA 1HR0T 3RKGA 4U7IA 2V8SV 2KXPB 3C51A 3LJCA 3ZSSA 2W61A 1SE7A 3RYHE 3EUHA 5TAOA 4LF7T 1BR4A 1Z8UA 2D2SA 1ZHCA 3NWIA 2XY8B 2FBWA 2XQ3A 2JQKA 2X0YA 4AKGA 3O1JA 1KNPA 5HXCA 2JJ9A 2B76A 2VQET 2IC6A 4OFZA 5H6QB 2BS2A 4H9SE 1IBKT 3VKGA 3G06A 2KWHA 2W00A 4HFHA 3PTRB 4QXCB 4MALA 5FNVE 1UX5A 3E08A 5EK3A 3R6NA 1UUSA 3SWHA 3AEAA 3ZPOA 1O3XA 2PFVA 2BG9E 3AVSA 4HWDA 4QH4A 4DMWA 3P7IA 3NKZA 3PU3A 3EI0A 1NAFA 5KX5E 3H37A 5F8PA 2H88A 5EZYE 5FP3A 4YFSA 4O2AE 5FKYA 3U78A 3N2KE 2W4XA 2XAJB 4BJNA 3ZMTB 4OYJA 3UTKA 2CLYB 2C5KT 2NW8A 4HFCA 4I50E 2ODUA 2WZIA 2L3LA 3A8YC 3ANWA 4AI6A 3Q5WA 1WYBA 3GA8A 4LF4T 5AQUB 3UUBA 1OEDB 3KDSE 3AB3B 3N9LA 5LHGB 1EZ3A 4TN7B 1MMDA 2WMOA 2D0TA 2CWYA 4EGWA 4IDQA 4KI0F 2SPCA 2Y48B 5DJQC 4HTEA 1Y64B 4E7ZA 1KNZA 3PUQA 1M7KA 2UUCT 3N9OA 3V5SA 4ZHQE 2XUEA 4Z90A 1WR6A 4EEDA 4DV5T 3AVRA 5J0ZA 3O1HA 2Q9QD 3ZJ2A 4DV2T 4IE7A 4JEHB 4IE0A 4BAYB 4H63H 3UU5A 1HNZT 4YY3T 3PJAA 3QB5K 5AQKB 5JREA 2WDQA 4AKHA 2V7IA 4JI2T 1IZNB 3E0ZA 2HPJA 4MLKA 2VKDA 5FY0A 4C90A 4YTPA 3RRCA 2Y6XA 1LRZA 3AEDA 2WU5A 2UU9T 4HN9A 3OYXA 5LNKA 4QX8B 2CEAA 1E7PA 4NXNT 2J62A 4GYSA 3RIAA 3L8RA 1QLBA 4B3MT 3T8OA 4V1Av 4IE6A 2Y8DA 2WDVA 4GKKT 4HWIB 3RHWA 2BKPA 5L4EA 4JYAT 3TKLB 4K0UA 4OK0A 1S94A 4YXDA 4X66T
chains in the Genus database with same CATH topology
3MACA 5LHIB 2CWOA 2NW9A 3HKDE 4UV8B 2GK9A 4EB6E 2VASA 4KP3C 5L3FB 2CCQA 2LSKA 2PBIA 3OYZA 3JC6C 2ZM8A 1LVFA 2WWUA 2YU1A 1D0YA 4P09A 4J2CA 2MTQA 4ISTA 3K3NA 3PUGA 3RPUA 1D0ZA 2IW5B 2DI4A 5CB4E 4DNDA 3C98B 3EDUA 3DJBA 3FB2A 2LT3A 2HPLA 3F2EA 3ZYKA 5HWYA 3ANWB 3CKDA 3FBZA 5HAXA 2H7VC 2ZLYA 2Q9QC 1US7B 1MNEA 5L3DB 5JQGE 2ACXA 3N5LA 3GN5B 3OJAA 3ZEFB 3P8CD 1G73A 5JR9C 3RX6A 2A72A 3CX6B 3ZMSB 3ZN1B 3ZYMA 5F3JA 3W15B 5J2TE 4MBQA 4NUVA 3ONXA 4HFVA 4PW8A 5L3EB 3O1IA 3KBUA 4C91A 2X67A 3WI3A 4I43B 5E0OA 4ASKA 2J1DG 4TUYE 2OA5A 2C5IT 2CXFA 5LGNB 1HFAA 2XASB 4L0RA 1FEWA 4IE4A 2XAHB 2YEVC 5JDQA 4I4TE 3L3PA 3AA6B 2KZ7B 2N2NA 5LJNA 3BQKA 2MOZA 2NP9A 2V7JA 3EDVA 4UVAB 2H7OA 3K3OA 5HXRA 3FXEB 4IHJE 3K8PC 4O4JE 2G0UA 3ESLA 3BQLA 5FY1A 3N2OA 3ZMZB 5HYAA 3IBPA 5JH7E 2JQQA 3N9QA 3OKQA 4GIWA 5FMNA 4L5GA 5LJMA 3RYFE 4EYUA 2Q9QB 3V5UA 2KMFA 1U5PA 4DMVA 5JDFA 4UIGA 5FYMA 5AFUL 1D1CA 3NRXA 2XQYA 3DP7A 4EIWA 5JR9B 4M1PA 4X1KE 3C64A 3MZKB 1E1HB 2C5JA 2K5BB 5DABA 4FJOA 4QHOA 1OXZA 2RP4A 3S4UA 4PK5A 1UX4A 4AKRB 3AAIA 4ZI7E 2NTYA 2VKHA 1WYCA 2K24A 2VWAA 1V9DA 3PE0A 3PURA 3Q2MA 2JMKA 4ILUA 3CQCB 3KFWX 2NTXA 1X79A 4ZI2D 5L3CB 3KVAA 2WAUA 3AA0B 4PFOA 3MKDA 4O8SA 5KDMC 2JRKA 4CQIA 1HTJF 4H9QC 4MFRA 1LVKA 2MBGA 5HWXA 4UXNB 2B1EA 2DWKA 3NZPA 4CI3B 4P0AA 4OYKA 3HKCE 3RH3A 2DHRA 2YU2A 3H3AA 4H9PC 2XAQB 1T98A 3Q5XA 4E7SA 2K48A 1SHZC 1BR0A 4EYYR 3I1AA 3J7Yq 4AQFC 1IAPA 3C50A 2DLRA 3ZMUB 3LK42 2M67A 3EVYA 3HR0A 4X20E 3ZN0B 2EHOA 1D1BA 2HH7A 3RKOA 2EHOD 4DBQA 5LOVE 1MIWA 1ZV4X 5LG4A 1H7CA 5CA1E 3ZYLA 2DWGA 3NBXX 4JEUB 1ZKEA 3C4XA 3PDYA 4GOUA 4I55E 2LJLA 2WBLA 2DCFA 2W0GA 3UUXB 4PK4A 5LXTE 2LE8A 4GK0E 4AKIA 3CVRA 3K3QC 1MMNA 3RC3A 3ZMVB 5KMGP 4ZOLE 2N9DA 2PJQA 3WAKA 1YKEB 2K9AA 3FBLA 4XZCA 3LBXB 1VRBA 5LP6E 3HKBE 3I9YA 3IEEA 4PNIA 4ISSA 5J1GA 2W62A 4QKNA 4WBNE 1HS7A 4TX5A 1Z0PA 4DO0A 2BZBA 2UXXB 3PUAA 4UEMA 3O9XA 3N2GE 1AJ3A 4FI5A 2ES0A 2X9XA 2BVMA 1G8XA 4AXPA 2RA1A 2VB6A 2YK0A 4TV9E 5FXXA 2X68A 4CXWA 4TV8E 5EK4A 2E9XA 2ZMAA 2E9XD 4L9IA 5JRCB 2KXPB 3C51A 3VU7H 3SRZA 1HG2A 3N9MA 4UF0B 3LJCA 2LSIA 4OHFA 2X66A 2W61A 4AQGA 3RYHE 3QUJA 3EUHA 5TAOA 5C8YE 5ETWA 2NOXA 2LSGA 2WSSV 2V7LA 3HKEE 5JVDE 3UUNA 1CUNA 4IIJE 4ZI3D 4PJMA 1BR4A 3GMIA 5LBQB 5EK2A 2D2SA 3PUSA 2X9HA 4ANJA 1NWMX 1ZHCA 1HF8A 3FHNA 4U74A 2LHNA 4IDZA 4QXBB 4EZ4A 1HG5A 3PU8A 5HXEA 4AKGA 3O1JA 4U72A 4G63A 4YHJA 4PJJA 4HKAA 1MNDA 1S35A 2JJ9A 2IC6A 2LSYA 3O4XE 4WW0A 5HXCA 4EOZB 5FXWA 4OFZA 5H6QB 2KINB 3KVBA 4H9SE 4KMCA 3VKGA 2KWHA 2W00A 3AA1B 4KBMB 3NZQA 4EXTA 4HE8A 4CXYA 2L9QA 3DTOA 3PTRB 4N78D 3U3IA 1D1AA 5M4YA 4QXCB 3MJXA 4MALA 2KNDA 2W63A 3KBTA 5FNVE 4CZZB 1UX5A 2CLYC 3E08A 5EK3A 2CXLA 1BR2A 3R6NA 1YD8G 2XTLA 3R84B 3SWHA 5HXHA 4PJNA 4O4LE 1WRDA 2C0SA 1VOMA 4O2BE 3ZPOA 1O3XA 2PFVA 2CXDA 4AKLA 5LGTB 3AVSA 2CM0A 4XBFB 2X0LB 3SOLA 5L2LA 4EAHA 4JLEA 2X51A 1MMGA 2BDEA 3UT5E 4DMWA 1ZEEA 2EHOC 2ODVA 3P7IA 4DBRA 2X9WA 3PU3A 4GYRA 3ZCIA 2CMRA 4JUYA 5ADXL 4ZS3A 1NAFA 5KX5E 3KV6A 3H37A 5F8PA 5LCYA 3ZCJA 1YW0A 5IHYA 5EZYE 1YKHB 1QSDA 2LOSA 5FP3A 4YFSA 3MA9A 4O2AE 4P0BA 3AAAB 2I59A 3VHLA 3ZLIA 3RYIE 3U78A 3AAEB 3N2KE 4HEAA 2BVLA 3I0QA 2DNXA 2XAJB 4BJNA 3ZMTB 4O4HE 2D5UA 3RYCE 3CMLA 4OYJA 3UTKA 3LBXA 5FXZA 4PK6A 2CLYB 2C5KT 2NW8A 4WBOA 3FXDB 5JDGA 3AA7B 4I50E 2L8KA 2VL8A 2ODUA 1B7TA 4BA9A 4CXXA 5JDLA 2L3LA 2D0UA 2E9XC 3ANWA 5GONE 4DVDA 4UVBB 4AI6A 2WMNA 3Q5WA 5JDNA 1WYBA 3ZC1A 2LSJA 3GA8A 2EHOB 4CI2B 3GN5A 5DQVA 4QWNB 3KDSE 4UVCB 3AB3B 2NWBA 3N9LA 1LKXA 4O4IE 4PFPA 5LHGB 5H6RB 5JRCA 1EZ3A 4TN7B 3KV4A 3CPZA 1MMDA 3OBVE 3RC8A 4UF0A 2H3RA 4YJ3E 2WMOA 3VKHA 2D0TA 2CWYA 4A56A 3C4WA 3WAJA 5CA0E 5IYZE 2SPCA 4ZI3C 2JMHA 2XAGB 2Y48B 3I9WA 4QX7B 5DJQC 3UULA 2E8IA 4B6XA 2XAFB 2LHRA 1Y64B 2KWIB 3MK7C 4H63V 4HTEA 4E7ZA 3ETVA 1KNZA 3PUQA 1HX8A 2XHEB 3ZC0A 3N9OA 3V5SA 4ZHQE 3CQGB 3KINB 3JC6D 1IJ6A 4IE5A 2XUEA 5DQWA 1WR6A 4YLHA 5L3BB 3M65A 2QGSA 3AVRA 5LGUB 2PG8A 4HGAA 4MHCA 1D0XA 2E9XB 3RRWA 4WNKA 3QK6A 5JDMA 2KLQA 1IJ5A 2JPFA 3O1HA 3C4ZA 2Q9QA 1WLXA 2Q9QD 2LEHA 3ZJ2A 4CI1B 3IHRA 3KV5A 4IE7A 1UCUA 3LG7A 3LK2B 5JR9A 2V26A 5JDHA 4JEHB 4IE0A 4BAYB 3HA4A 4PJLA 4EZHA 5BMVE 1HCIA 5A1LA 1BR1A 3CQXC 4GK5E 3UFEA 4H9NC 2WM9A 3ETUA 4ZI2C 4H63H 4X1IE 5LHHB 5J2UE 2CE7A 5JREA 3QC9A 4UV9B 2CA5A 4AKHA 1FMWA 2V7IA 3MXZA 1IZNB 3E0ZA 2N1GA 2HPJA 3L09A 2VKDA 4MLKA 1U4QA 3HI2A 2NW7A 5FXVA 4YJ2E 2ZM0A 5FY0A 2IAKA 3IF8B 4KUMB 3UUMA 4C90A 4ADZA 3F31A 3RRCA 3N9NA 2Y6XA 2IC9A 3CX8B 1LRZA 4UELA 2VK9A 3GWHA 2VKJA 3ZJ1A 3LK3B 4HN9A 3OYXA 2YINA 4PAGA 5LNKA 4QX8B 3J9X1 1SA0E 4H9OC 4H9RC 2LOPA 3I0OA 3B13A 1OWAA 2P9BA 3BK9A 2V7MA 3KV9A 4BJMA 3E22E 2V1DB 2CEAA 2A2FX 3N9PA 3SS1A 2UXNB 1FIOA 2MYSA 4GYSA 4X1YE 2ZM2A 1MMAA 2A3DA 3LFMA 1MIVA 3BQIA 4ZS2A 5HXSA 4IGUA 5LBMA 2Z6EA 3CX7B 4XAXB 5L3GB 2KT9A 3A5XA 4ERRA 5LYJE 1QUUA 4G2AA 1KK7A 3T8OA 2VKOA 4V1Av 4IE6A 1MIYA 4F6RC 2Y8DA 3B57A 1FMVA 4QXHB 3D0TA 4Z8XA 4AQFA 3TKLB 3HL6A 3NRYA 2QA7A 2LM9A 3Q9DA 4K0UA 4OK0A 5LA6E 3F57A 2V7KA 1S94A 4TZ4C 3CWZB 4NUUA 2X9YA 5FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJO A;  2N1G A;  4EXT A;  2LSI A;  4GK0 E;  2LSG A;  2LSK A;  4BA9 A;  3VU7 H;  4GK5 E;  2LSY A;  2LSJ A; 
#chains in the Genus database with same CATH topology
 2NW9 A;  4EB6 E;  3T1H T;  2LSK A;  4P09 A;  4IST A;  1D0Z A;  5CB4 E;  3EDU A;  4DUY T;  3F2E A;  3ANW B;  3CKD A;  5HAX A;  5FVL A;  2ZLY A;  2Q9Q C;  1X9B A;  2XSB A;  3N5L A;  3OJA A;  3ZEF B;  3AE7 A;  5HEO A;  4MBQ A;  3Q5D A;  3WI3 A;  4I43 B;  2J1D G;  5LGN B;  1NEK A;  5JDQ A;  2V6Y A;  4JI7 T;  2V7J A;  4ILA A;  4UVA B;  5HXR A;  4WYV A;  3UU4 A;  2G0U A;  5FY1 A;  3N2O A;  3ZMZ B;  5HEG A;  2JQQ A;  3N9Q A;  4EYU A;  3AEB A;  1U5P A;  3RQU A;  2J4G A;  5FYM A;  2XQ5 A;  2WS3 A;  1D1C A;  4EIW A;  2WZH A;  4M1P A;  4DV3 T;  3C64 A;  3MZK B;  4A98 A;  5AQJ B;  1UX4 A;  3AAI A;  2NTY A;  3PE0 A;  2JMK A;  5AQS B;  4COF A;  1X79 A;  4IL9 A;  3KVA A;  3AA0 B;  4O8S A;  5KDM C;  4MFR A;  2B1E A;  4CI3 B;  4OYK A;  1I94 T;  2YU2 A;  1OED E;  3ZKR A;  1T98 A;  3T1Y T;  4E7S A;  1DU2 A;  2K48 A;  1SHZ C;  1JNZ A;  3I1A A;  4JV5 T;  1GQE A;  2JQH A;  5ABF B;  1IAP A;  4NIQ A;  3LK4 2;  2M67 A;  4X20 E;  3SFE A;  2EHO D;  2WP9 A;  3FZH B;  2XM1 A;  5LG4 A;  1H7C A;  2CPT A;  4JEU B;  4GOU A;  5HCJ A;  2IIU A;  2LE8 A;  4GK0 E;  2AXD S;  5CFB A;  3ZMV B;  2PJQ A;  4TWF A;  3EAB A;  2W62 A;  4TX5 A;  4QH1 A;  3UFG A;  4LMJ A;  3FZL B;  2LM2 A;  4JI4 T;  4CN4 A;  5FXX A;  2E9X D;  2E2A A;  3ZT7 A;  3AXJ A;  2LSI A;  2IHR 1;  5C8Y E;  1ZOY A;  2LSG A;  2NOX A;  3UUN A;  3P4S A;  1ZP0 A;  5EK2 A;  4DID B;  4ANJ A;  1NWM X;  4DUZ T;  3FHN A;  4U74 A;  4IDZ A;  2QYW A;  1YQ3 A;  4Q25 A;  4G63 A;  4YHJ A;  4LF6 T;  1MND A;  4CN6 A;  4LF9 T;  3TLU A;  4DV7 T;  4KMC A;  3AA1 B;  5M4Y A;  1D1A A;  3KBT A;  3TLW A;  2X0H A;  2CXL A;  1YD8 G;  1WRD A;  2C0S A;  4NXM T;  3AE3 A;  3UQ4 A;  4AKL A;  3VR9 A;  2CM0 A;  3SOL A;  4UR9 A;  2IML A;  2I6H A;  1ZEE A;  2EHO C;  1KFY A;  5AQG B;  3ZCI A;  3JAF A;  1XNR T;  3P4W A;  4ZS3 A;  4TWD A;  2K3W A;  3KV6 A;  3PJA J;  5IHY A;  2LOS A;  3AAA B;  4IT4 A;  2DNX A;  2W2U A;  3RYC E;  3LBX A;  3FXD B;  2V5C A;  1B7T A;  2UXD T;  4BA9 A;  2E9X C;  4HFB A;  5JDN A;  2LSJ A;  3UU8 A;  4UVC B;  2W66 A;  1LKX A;  5FL1 A;  5JRC A;  5AQF B;  4U3C A;  3RC8 A;  4UF0 A;  4LMK A;  1NEN A;  4YJ3 E;  1J5E T;  4TWH A;  5L4H A;  4A56 A;  4U31 A;  5CA0 E;  5IYZ E;  2XAG B;  4QX7 B;  3UUL A;  2LHR A;  3MK7 C;  3ETV A;  2XHE B;  4U2Y A;  3KIN B;  3JC6 D;  4IE5 A;  5DQW A;  4KHZ F;  5L3B B;  3M65 A;  1XDP A;  5LGU B;  3RRW A;  5HCM A;  2BKN A;  3C4Z A;  2QVA A;  4CI1 B;  3IHR A;  2E5V A;  3LK2 B;  5JR9 A;  1CHU A;  4LFA T;  3UFE A;  4H9N C;  4QH5 A;  5J2U E;  1R8I A;  4UV9 B;  3ZT5 A;  2ZM0 A;  3IF8 B;  4KUM B;  3PUW F;  2D9D A;  1W0A A;  3F31 A;  2ACZ A;  2IC9 A;  2VKJ A;  3ZJ1 A;  2BG9 C;  2YIN A;  3J9X 1;  5ABG A;  2V7M A;  4BJM A;  2V1D B;  2MYS A;  4YTM A;  1MMA A;  3BQI A;  4F8H A;  4ZEY A;  2AE9 A;  2YDR A;  2Z6E A;  3CX7 B;  5L3G B;  3A5X A;  3B5M A;  4ERR A;  2CBJ A;  1KK7 A;  2FUP A;  3FZM B;  1IBL T;  1MIY A;  4Z8X A;  3Q9D A;  2LM9 A;  5LA6 E;  3F57 A;  2V7K A;  1N32 T;  3VR8 A;  3CWZ B;  2I0M A;  5LHI B;  5LB7 B;  2BS3 A;  3HKD E;  2VAS A;  3UU6 A;  3QB5 A;  2PBI A;  3JC6 C;  1LVF A;  2M6B A;  2WWU A;  1Y01 A;  2MTQ A;  3AE8 A;  2DI4 A;  4DND A;  3DJB A;  2LT3 A;  4DR6 T;  2H7V C;  5KXJ A;  2YDS A;  2ACX A;  3RIU A;  4HFD A;  3P8C D;  1G73 A;  2WU2 A;  3ZMS B;  2ZM6 T;  4JI1 T;  3ZN1 B;  3W15 B;  5J2T E;  5ABH A;  3ONX A;  4HFV A;  3O1I A;  5E0O A;  4TUY E;  1KNR A;  3AEE A;  3RI5 A;  4JI3 T;  2N2N A;  4TNV A;  4Z91 A;  2NP9 A;  3EDV A;  3FXE B;  3AE9 A;  3RQW A;  4CN1 A;  3ESL A;  3BQL A;  5JH7 E;  3IBP A;  3OKQ A;  2KMF A;  4DMV A;  4LFB T;  5AFU L;  3DP7 A;  5JR9 B;  2NR4 A;  2C5J A;  2K5B B;  1OXZ A;  3S4U A;  4ZI7 E;  3AEC A;  3PUR A;  3Q2M A;  3K1S A;  4OX9 T;  2NTX A;  4ZI2 D;  4B3T T;  3MKD A;  4DV6 T;  3ONL C;  4H9Q C;  2DWK A;  4P0A A;  3RH3 A;  3H3A A;  3RF1 A;  4DR7 T;  4AQF C;  3C50 A;  3EVY A;  3VRA A;  3ZN0 B;  2HH7 A;  3RKO A;  4DR2 T;  3PUY F;  3UU3 A;  2DWG A;  4AIS A;  2DCF A;  2W0G A;  3H3M A;  2CBI A;  3CVR A;  3K3Q C;  1MMN A;  3RC3 A;  3WAK A;  4ZOL E;  3TLV A;  1XMQ T;  4DR5 T;  1L0V A;  4ISS A;  4NPP A;  3SFD A;  4WBN E;  2BZB A;  2UXX B;  4FI5 A;  4IRE A;  2X9X A;  2FJD A;  4AXP A;  2RA1 A;  5EK4 A;  2ZMA A;  4YSZ A;  3LSV A;  1XMO T;  4LF5 T;  4X62 T;  3EHZ A;  4HWF A;  2H89 A;  1HG2 A;  3N9M A;  3QUJ A;  2BKO A;  2V7L A;  3HKE E;  5JVD E;  2HHH T;  4ZI3 D;  4PJM A;  5LBQ B;  4IDO A;  3PUS A;  3RLF F;  4QXB B;  3PU8 A;  5HXE A;  4U72 A;  4I0U A;  4PJJ A;  4HKA A;  2LSY A;  3O4X E;  4WW0 A;  5AQO B;  4EOZ B;  5CGM A;  3JCF A;  5FVK A;  3AE5 A;  2W67 A;  2A9U A;  2VQF T;  5LG3 A;  4DR3 T;  4KBM B;  3NZQ A;  4EXT A;  4HE8 A;  4CXY A;  2L9Q A;  3DTO A;  4N78 D;  3U3I A;  2W63 A;  2CLY C;  2XTL A;  3ABV A;  2CXD A;  5LGT B;  4XBF B;  5L2L A;  4JLE A;  2LLY A;  2BDE A;  4DBR A;  1OED C;  2CMR A;  2WDR A;  5LCY A;  1YW0 A;  2HN1 A;  1QSD A;  2WY2 A;  3ZT6 A;  3ZLI A;  3RYI E;  3AAE B;  4HEA A;  2UUA T;  2BVL A;  4O4H E;  2D5U A;  3L39 A;  3CIR A;  3CK6 A;  4CXX A;  5JDL A;  3JAD A;  5GON E;  4DVD A;  2BBJ A;  3ZC1 A;  5F5W A;  4CI2 B;  3QOF A;  2XQ6 A;  3GN5 A;  5DQV A;  4QWN B;  2NWB A;  4O4I E;  4LF8 T;  4PFP A;  3CPZ A;  2H3R A;  3VKH A;  3AE6 A;  3WAJ A;  4ZI3 C;  4CZZ B;  4B6X A;  2XAF B;  4H63 V;  2KWI B;  1KF6 A;  1HX8 A;  3ZC0 A;  3CQG B;  3UQ7 A;  2YN6 A;  2XM2 A;  4YLH A;  2PG8 A;  3FZF B;  4MHC A;  2KLQ A;  1IJ5 A;  2Q9Q A;  2IUB A;  2CRB A;  3KV5 A;  1UCU A;  3LG7 A;  1FJG T;  1XNQ T;  3HA4 A;  3A7M A;  4PJL A;  1JNR A;  2J47 A;  5BMV E;  1HCI A;  4KX6 A;  3CQX C;  1T8B A;  4AQY T;  4GK5 E;  3ETU A;  2VUR A;  2V6Y B;  4X1I E;  1N33 T;  5LHH B;  2XQ8 A;  4GKJ T;  3QC9 A;  2CA5 A;  3MXZ A;  4YHH T;  3L09 A;  1U4Q A;  3HI2 A;  5FXV A;  4X65 T;  2FJE A;  3GWH A;  2UUB T;  4PAG A;  1SA0 E;  4H9O C;  4H9R C;  3B13 A;  2P9B A;  5C2T A;  3KV9 A;  3N9P A;  3AE4 A;  5IUX A;  1XDO A;  4U7Y A;  2UXN B;  3LDQ B;  5AQN B;  1FIO A;  4X1Y E;  2ZM2 A;  2A3D A;  3LFM A;  1MIV A;  5HXS A;  5AQV B;  4IGU A;  5LBM A;  4JI8 T;  4XAX B;  5LYJ E;  1QUU A;  4G2A A;  4B3S T;  4HFI A;  2VKO A;  4F6R C;  3RGL A;  2BS4 A;  1FMV A;  3B57 A;  4QXH B;  3D0T A;  3HL6 A;  2UXC T;  4TZ4 C;  4NUU A;  2X9Y A;  5FY7 A;  3MAC A;  1YXR A;  2CWO A;  4UV8 B;  3OYZ A;  3X1D A;  2XQ9 A;  2ZM8 A;  1D0Y A;  3PUZ F;  3PUG A;  3C98 B;  2HPL A;  3ZYK A;  5AQI B;  1XZY A;  1US7 B;  1MNE A;  5JQG E;  3GN5 B;  2XJ7 A;  5FL0 A;  3ZST A;  3RX6 A;  2A72 A;  3CX6 B;  2WWV A;  3ZYM A;  5F3J A;  4IL4 A;  5AQL B;  4EEB A;  4NUV A;  3KBU A;  2X67 A;  2OA5 A;  1N36 T;  2CXF A;  4L0R A;  3AXJ B;  4I4T E;  3L3P A;  3AA6 B;  5LJN A;  3BQK A;  2MOZ A;  1UGO A;  2H7O A;  1E2A A;  2V5D A;  4O4J E;  5HYA A;  4L5G A;  2Q9Q B;  3QNU A;  5BR8 T;  1WR0 A;  5DAB A;  4FJO A;  4PK5 A;  4AKR B;  2VKH A;  1WYC A;  2VWA A;  1V9D A;  4ILU A;  5L3C B;  1SUM B;  5HEU A;  2JRK A;  4CQI A;  1HTJ F;  2MBG A;  3PUV F;  2DHR A;  2XAQ B;  3M3Z B;  3ZMU B;  3ONJ A;  3HR0 A;  2YKS A;  5L47 A;  1T7S A;  2EHO A;  1D1B A;  4DBQ A;  3EAM A;  3ZYL A;  1ZKE A;  4TNW A;  4PK4 A;  5LXT E;  4AKI A;  1HX1 B;  2WCA A;  5KMG P;  2N9D A;  1YKE B;  2RPA A;  3LBX B;  5AQR B;  3HKB E;  1W09 A;  4PNI A;  4QKN A;  2V6X A;  4UEM A;  3O9X A;  2ES0 A;  2BVM A;  1G8X A;  4TV9 E;  4ZXL A;  2X68 A;  3P4Q A;  4JBW F;  4TV8 E;  2E9X A;  4L9I A;  1HNW T;  3VRB A;  2XQA A;  5JRC B;  4U2Z A;  4K0K T;  3VU7 H;  3SRZ A;  4UF0 B;  3AE2 A;  4OHF A;  2X66 A;  4AQG A;  2FJA A;  1UUR A;  5ETW A;  2WSS V;  3RIF A;  3P4P A;  1CUN A;  4IIJ E;  1VCT A;  3GMI A;  5AQH B;  2X9H A;  5AQM B;  1HF8 A;  3FZK B;  2CHN A;  2LHN A;  4EZ4 A;  1HG5 A;  2CHO A;  3PUX F;  1M62 A;  3PV0 F;  1S35 A;  4A97 A;  5LMU T;  5FXW A;  2XQ4 A;  2PTF A;  2KIN B;  3KVB A;  1WFD A;  4YT0 A;  3MJX A;  3OTO T;  2KND A;  4ILC A;  1BR2 A;  5IWA T;  3R84 B;  5HXH A;  4PJN A;  4O4L E;  5CJ5 A;  1VOM A;  4O2B E;  2HN2 A;  2X0L B;  4EAH A;  5ABF A;  2X51 A;  1MMG A;  2FJB A;  3UT5 E;  4DR4 T;  2ODV A;  2X9W A;  4GYR A;  4LML A;  4JUY A;  3OVU A;  5ADX L;  2UXB T;  3ZCJ A;  2BG9 A;  1YKH B;  3MA9 A;  4P0B A;  3VHL A;  2I59 A;  1HNX T;  4P1N A;  5JTG A;  3AEG A;  3I0Q A;  4YSX A;  2IDO B;  4HWH A;  2E5L T;  1XWM A;  3CML A;  5FXZ A;  4PK6 A;  2M6I A;  4WBO A;  1KEY A;  3TLS A;  5JDG A;  3AA7 B;  2L8K A;  2VL8 A;  2LRL A;  2D0U A;  3P4R A;  4UVB B;  2WMN A;  2EHO B;  1N34 T;  2JIW A;  5H6R B;  3KV4 A;  4JI5 T;  3OBV E;  3C4W A;  4DV0 T;  2JMH A;  3I9W A;  5L3D B;  2E8I A;  4YSY A;  2VVS A;  2LRK A;  1IJ6 A;  2BBH A;  2KSR A;  2QGS A;  4HGA A;  1D0X A;  2E9X B;  4WNK A;  3QK6 A;  5JDM A;  2JPF A;  1WLX A;  2LEH A;  4DR1 T;  2MAW A;  2V26 A;  5JDH A;  4EZH A;  5A1L A;  1BR1 A;  2WQY A;  2WM9 A;  4ZI2 C;  2JQ9 A;  4X64 T;  2CE7 A;  1I6Z A;  1FMW A;  2MPK A;  2N1G A;  2F4V T;  2NW7 A;  4YJ2 E;  2IAK A;  3UUM A;  4ADZ A;  3Q5E A;  3N9N A;  3CX8 B;  4UEL A;  2VK9 A;  4X5T A;  3LK3 B;  2LOP A;  3I0O A;  1OWA A;  5ABE A;  3BK9 A;  4ILB A;  1J5W A;  4WZX A;  5AQP B;  3E22 E;  3TLT A;  2A2F X;  4KHP T;  3SS1 A;  4ZS2 A;  4ZZC A;  3OPC A;  5HEH A;  2KT9 A;  3JAE A;  5LMN T;  4AIU A;  4AQF A;  3NRY A;  2QA7 A;  2BG9 B;  2LKH A;  2XZE A;  2GK9 A;  4HWC A;  1J1J A;  4KP3 C;  5L3F B;  2VL0 A;  2CCQ A;  2YU1 A;  4J2C A;  3K3N A;  3RPU A;  2IW5 B;  3FB2 A;  5HWY A;  3FBZ A;  4JI0 T;  1WCR A;  2XQ7 A;  5JR9 C;  4IDN A;  2QRX A;  5L3E B;  4PW8 A;  4C91 A;  4ASK A;  2C5I T;  1HFA A;  2DL1 A;  2XAS B;  4JI6 T;  1FEW A;  2XPK A;  4IE4 A;  4IDP A;  2XAH B;  2YEV C;  4HFE A;  2KZ7 B;  3K3O A;  4IHJ E;  3K8P C;  2R6G F;  4GIW A;  5FMN A;  5LJM A;  2YDQ A;  3RYF E;  4B3R T;  3V5U A;  4LFC T;  5JDF A;  4UIG A;  1IBM T;  3NRX A;  2XQY A;  4DV4 T;  4X1K E;  1E1H B;  4QHO A;  2RP4 A;  1UK5 A;  2K24 A;  3IA3 A;  3CQC B;  3KFW X;  2WAU A;  4PFO A;  2OV9 A;  1LVK A;  5HWX A;  4UXN B;  3NZP A;  3HKC E;  5AQQ B;  4H9P C;  3NVO A;  3Q5X A;  2XSA A;  1BR0 A;  4EYY R;  1VCS A;  3J7Y q;  3AE1 A;  2DLR A;  2WB5 A;  2YOE A;  4YTN A;  1OED A;  5LOV E;  1MIW A;  1ZV4 X;  5CA1 E;  3AEF A;  3NBX X;  3C4X A;  3PDY A;  4I55 E;  2LJL A;  2WBL A;  3UUX B;  1W0B A;  1T72 A;  2OLT A;  4DV1 T;  2LKG A;  4ZZB A;  2K9A A;  3FBL A;  4XZC A;  4U33 A;  1VRB A;  5LP6 E;  3I9Y A;  3IEE A;  5J1G A;  1HS7 A;  1Z0P A;  3RIU C;  4DO0 A;  1YQ4 A;  4EV6 A;  2VVN A;  3PUA A;  3N2G E;  1AJ3 A;  5AQT B;  4A5X A;  5HEJ A;  2VB6 A;  2YK0 A;  4CXW A;  5C3J A;  3P50 A;  1W9R A;  1HR0 T;  3RKG A;  4U7I A;  2V8S V;  2KXP B;  3C51 A;  3LJC A;  3ZSS A;  2W61 A;  1SE7 A;  3RYH E;  3EUH A;  5TAO A;  4LF7 T;  1BR4 A;  1Z8U A;  2D2S A;  1ZHC A;  3NWI A;  2XY8 B;  2FBW A;  2XQ3 A;  2JQK A;  2X0Y A;  4AKG A;  3O1J A;  1KNP A;  5HXC A;  2JJ9 A;  2B76 A;  2VQE T;  2IC6 A;  4OFZ A;  5H6Q B;  2BS2 A;  4H9S E;  1IBK T;  3VKG A;  3G06 A;  2KWH A;  2W00 A;  4HFH A;  3PTR B;  4QXC B;  4MAL A;  5FNV E;  1UX5 A;  3E08 A;  5EK3 A;  3R6N A;  1UUS A;  3SWH A;  3AEA A;  3ZPO A;  1O3X A;  2PFV A;  2BG9 E;  3AVS A;  4HWD A;  4QH4 A;  4DMW A;  3P7I A;  3NKZ A;  3PU3 A;  3EI0 A;  1NAF A;  5KX5 E;  3H37 A;  5F8P A;  2H88 A;  5EZY E;  5FP3 A;  4YFS A;  4O2A E;  5FKY A;  3U78 A;  3N2K E;  2W4X A;  2XAJ B;  4BJN A;  3ZMT B;  4OYJ A;  3UTK A;  2CLY B;  2C5K T;  2NW8 A;  4HFC A;  4I50 E;  2ODU A;  2WZI A;  2L3L A;  3A8Y C;  3ANW A;  4AI6 A;  3Q5W A;  1WYB A;  3GA8 A;  4LF4 T;  5AQU B;  3UUB A;  1OED B;  3KDS E;  3AB3 B;  3N9L A;  5LHG B;  1EZ3 A;  4TN7 B;  1MMD A;  2WMO A;  2D0T A;  2CWY A;  4EGW A;  4IDQ A;  4KI0 F;  2SPC A;  2Y48 B;  5DJQ C;  4HTE A;  1Y64 B;  4E7Z A;  1KNZ A;  3PUQ A;  1M7K A;  2UUC T;  3N9O A;  3V5S A;  4ZHQ E;  2XUE A;  4Z90 A;  1WR6 A;  4EED A;  4DV5 T;  3AVR A;  5J0Z A;  3O1H A;  2Q9Q D;  3ZJ2 A;  4DV2 T;  4IE7 A;  4JEH B;  4IE0 A;  4BAY B;  4H63 H;  3UU5 A;  1HNZ T;  4YY3 T;  3PJA A;  3QB5 K;  5AQK B;  5JRE A;  2WDQ A;  4AKH A;  2V7I A;  4JI2 T;  1IZN B;  3E0Z A;  2HPJ A;  4MLK A;  2VKD A;  5FY0 A;  4C90 A;  4YTP A;  3RRC A;  2Y6X A;  1LRZ A;  3AED A;  2WU5 A;  2UU9 T;  4HN9 A;  3OYX A;  5LNK A;  4QX8 B;  2CEA A;  1E7P A;  4NXN T;  2J62 A;  4GYS A;  3RIA A;  3L8R A;  1QLB A;  4B3M T;  3T8O A;  4V1A v;  4IE6 A;  2Y8D A;  2WDV A;  4GKK T;  4HWI B;  3RHW A;  2BKP A;  5L4E A;  4JYA T;  3TKL B;  4K0U A;  4OK0 A;  1S94 A;  4YXD A;  4X66 T; 
#chains in the Genus database with same CATH homology
 3MAC A;  5LHI B;  2CWO A;  2NW9 A;  3HKD E;  4UV8 B;  2GK9 A;  4EB6 E;  2VAS A;  4KP3 C;  5L3F B;  2CCQ A;  2LSK A;  2PBI A;  3OYZ A;  3JC6 C;  2ZM8 A;  1LVF A;  2WWU A;  2YU1 A;  1D0Y A;  4P09 A;  4J2C A;  2MTQ A;  4IST A;  3K3N A;  3PUG A;  3RPU A;  1D0Z A;  2IW5 B;  2DI4 A;  5CB4 E;  4DND A;  3C98 B;  3EDU A;  3DJB A;  3FB2 A;  2LT3 A;  2HPL A;  3F2E A;  3ZYK A;  5HWY A;  3ANW B;  3CKD A;  3FBZ A;  5HAX A;  2H7V C;  2ZLY A;  2Q9Q C;  1US7 B;  1MNE A;  5L3D B;  5JQG E;  2ACX A;  3N5L A;  3GN5 B;  3OJA A;  3ZEF B;  3P8C D;  1G73 A;  5JR9 C;  3RX6 A;  2A72 A;  3CX6 B;  3ZMS B;  3ZN1 B;  3ZYM A;  5F3J A;  3W15 B;  5J2T E;  4MBQ A;  4NUV A;  3ONX A;  4HFV A;  4PW8 A;  5L3E B;  3O1I A;  3KBU A;  4C91 A;  2X67 A;  3WI3 A;  4I43 B;  5E0O A;  4ASK A;  2J1D G;  4TUY E;  2OA5 A;  2C5I T;  2CXF A;  5LGN B;  1HFA A;  2XAS B;  4L0R A;  1FEW A;  4IE4 A;  2XAH B;  2YEV C;  5JDQ A;  4I4T E;  3L3P A;  3AA6 B;  2KZ7 B;  2N2N A;  5LJN A;  3BQK A;  2MOZ A;  2NP9 A;  2V7J A;  3EDV A;  4UVA B;  2H7O A;  3K3O A;  5HXR A;  3FXE B;  4IHJ E;  3K8P C;  4O4J E;  2G0U A;  3ESL A;  3BQL A;  5FY1 A;  3N2O A;  3ZMZ B;  5HYA A;  3IBP A;  5JH7 E;  2JQQ A;  3N9Q A;  3OKQ A;  4GIW A;  5FMN A;  4L5G A;  5LJM A;  3RYF E;  4EYU A;  2Q9Q B;  3V5U A;  2KMF A;  1U5P A;  4DMV A;  5JDF A;  4UIG A;  5FYM A;  5AFU L;  1D1C A;  3NRX A;  2XQY A;  3DP7 A;  4EIW A;  5JR9 B;  4M1P A;  4X1K E;  3C64 A;  3MZK B;  1E1H B;  2C5J A;  2K5B B;  5DAB A;  4FJO A;  4QHO A;  1OXZ A;  2RP4 A;  3S4U A;  4PK5 A;  1UX4 A;  4AKR B;  3AAI A;  4ZI7 E;  2NTY A;  2VKH A;  1WYC A;  2K24 A;  2VWA A;  1V9D A;  3PE0 A;  3PUR A;  3Q2M A;  2JMK A;  4ILU A;  3CQC B;  3KFW X;  2NTX A;  1X79 A;  4ZI2 D;  5L3C B;  3KVA A;  2WAU A;  3AA0 B;  4PFO A;  3MKD A;  4O8S A;  5KDM C;  2JRK A;  4CQI A;  1HTJ F;  4H9Q C;  4MFR A;  1LVK A;  2MBG A;  5HWX A;  4UXN B;  2B1E A;  2DWK A;  3NZP A;  4CI3 B;  4P0A A;  4OYK A;  3HKC E;  3RH3 A;  2DHR A;  2YU2 A;  3H3A A;  4H9P C;  2XAQ B;  1T98 A;  3Q5X A;  4E7S A;  2K48 A;  1SHZ C;  1BR0 A;  4EYY R;  3I1A A;  3J7Y q;  4AQF C;  1IAP A;  3C50 A;  2DLR A;  3ZMU B;  3LK4 2;  2M67 A;  3EVY A;  3HR0 A;  4X20 E;  3ZN0 B;  2EHO A;  1D1B A;  2HH7 A;  3RKO A;  2EHO D;  4DBQ A;  5LOV E;  1MIW A;  1ZV4 X;  5LG4 A;  1H7C A;  5CA1 E;  3ZYL A;  2DWG A;  3NBX X;  4JEU B;  1ZKE A;  3C4X A;  3PDY A;  4GOU A;  4I55 E;  2LJL A;  2WBL A;  2DCF A;  2W0G A;  3UUX B;  4PK4 A;  5LXT E;  2LE8 A;  4GK0 E;  4AKI A;  3CVR A;  3K3Q C;  1MMN A;  3RC3 A;  3ZMV B;  5KMG P;  4ZOL E;  2N9D A;  2PJQ A;  3WAK A;  1YKE B;  2K9A A;  3FBL A;  4XZC A;  3LBX B;  1VRB A;  5LP6 E;  3HKB E;  3I9Y A;  3IEE A;  4PNI A;  4ISS A;  5J1G A;  2W62 A;  4QKN A;  4WBN E;  1HS7 A;  4TX5 A;  1Z0P A;  4DO0 A;  2BZB A;  2UXX B;  3PUA A;  4UEM A;  3O9X A;  3N2G E;  1AJ3 A;  4FI5 A;  2ES0 A;  2X9X A;  2BVM A;  1G8X A;  4AXP A;  2RA1 A;  2VB6 A;  2YK0 A;  4TV9 E;  5FXX A;  2X68 A;  4CXW A;  4TV8 E;  5EK4 A;  2E9X A;  2ZMA A;  2E9X D;  4L9I A;  5JRC B;  2KXP B;  3C51 A;  3VU7 H;  3SRZ A;  1HG2 A;  3N9M A;  4UF0 B;  3LJC A;  2LSI A;  4OHF A;  2X66 A;  2W61 A;  4AQG A;  3RYH E;  3QUJ A;  3EUH A;  5TAO A;  5C8Y E;  5ETW A;  2NOX A;  2LSG A;  2WSS V;  2V7L A;  3HKE E;  5JVD E;  3UUN A;  1CUN A;  4IIJ E;  4ZI3 D;  4PJM A;  1BR4 A;  3GMI A;  5LBQ B;  5EK2 A;  2D2S A;  3PUS A;  2X9H A;  4ANJ A;  1NWM X;  1ZHC A;  1HF8 A;  3FHN A;  4U74 A;  2LHN A;  4IDZ A;  4QXB B;  4EZ4 A;  1HG5 A;  3PU8 A;  5HXE A;  4AKG A;  3O1J A;  4U72 A;  4G63 A;  4YHJ A;  4PJJ A;  4HKA A;  1MND A;  1S35 A;  2JJ9 A;  2IC6 A;  2LSY A;  3O4X E;  4WW0 A;  5HXC A;  4EOZ B;  5FXW A;  4OFZ A;  5H6Q B;  2KIN B;  3KVB A;  4H9S E;  4KMC A;  3VKG A;  2KWH A;  2W00 A;  3AA1 B;  4KBM B;  3NZQ A;  4EXT A;  4HE8 A;  4CXY A;  2L9Q A;  3DTO A;  3PTR B;  4N78 D;  3U3I A;  1D1A A;  5M4Y A;  4QXC B;  3MJX A;  4MAL A;  2KND A;  2W63 A;  3KBT A;  5FNV E;  4CZZ B;  1UX5 A;  2CLY C;  3E08 A;  5EK3 A;  2CXL A;  1BR2 A;  3R6N A;  1YD8 G;  2XTL A;  3R84 B;  3SWH A;  5HXH A;  4PJN A;  4O4L E;  1WRD A;  2C0S A;  1VOM A;  4O2B E;  3ZPO A;  1O3X A;  2PFV A;  2CXD A;  4AKL A;  5LGT B;  3AVS A;  2CM0 A;  4XBF B;  2X0L B;  3SOL A;  5L2L A;  4EAH A;  4JLE A;  2X51 A;  1MMG A;  2BDE A;  3UT5 E;  4DMW A;  1ZEE A;  2EHO C;  2ODV A;  3P7I A;  4DBR A;  2X9W A;  3PU3 A;  4GYR A;  3ZCI A;  2CMR A;  4JUY A;  5ADX L;  4ZS3 A;  1NAF A;  5KX5 E;  3KV6 A;  3H37 A;  5F8P A;  5LCY A;  3ZCJ A;  1YW0 A;  5IHY A;  5EZY E;  1YKH B;  1QSD A;  2LOS A;  5FP3 A;  4YFS A;  3MA9 A;  4O2A E;  4P0B A;  3AAA B;  2I59 A;  3VHL A;  3ZLI A;  3RYI E;  3U78 A;  3AAE B;  3N2K E;  4HEA A;  2BVL A;  3I0Q A;  2DNX A;  2XAJ B;  4BJN A;  3ZMT B;  4O4H E;  2D5U A;  3RYC E;  3CML A;  4OYJ A;  3UTK A;  3LBX A;  5FXZ A;  4PK6 A;  2CLY B;  2C5K T;  2NW8 A;  4WBO A;  3FXD B;  5JDG A;  3AA7 B;  4I50 E;  2L8K A;  2VL8 A;  2ODU A;  1B7T A;  4BA9 A;  4CXX A;  5JDL A;  2L3L A;  2D0U A;  2E9X C;  3ANW A;  5GON E;  4DVD A;  4UVB B;  4AI6 A;  2WMN A;  3Q5W A;  5JDN A;  1WYB A;  3ZC1 A;  2LSJ A;  3GA8 A;  2EHO B;  4CI2 B;  3GN5 A;  5DQV A;  4QWN B;  3KDS E;  4UVC B;  3AB3 B;  2NWB A;  3N9L A;  1LKX A;  4O4I E;  4PFP A;  5LHG B;  5H6R B;  5JRC A;  1EZ3 A;  4TN7 B;  3KV4 A;  3CPZ A;  1MMD A;  3OBV E;  3RC8 A;  4UF0 A;  2H3R A;  4YJ3 E;  2WMO A;  3VKH A;  2D0T A;  2CWY A;  4A56 A;  3C4W A;  3WAJ A;  5CA0 E;  5IYZ E;  2SPC A;  4ZI3 C;  2JMH A;  2XAG B;  2Y48 B;  3I9W A;  4QX7 B;  5DJQ C;  3UUL A;  2E8I A;  4B6X A;  2XAF B;  2LHR A;  1Y64 B;  2KWI B;  3MK7 C;  4H63 V;  4HTE A;  4E7Z A;  3ETV A;  1KNZ A;  3PUQ A;  1HX8 A;  2XHE B;  3ZC0 A;  3N9O A;  3V5S A;  4ZHQ E;  3CQG B;  3KIN B;  3JC6 D;  1IJ6 A;  4IE5 A;  2XUE A;  5DQW A;  1WR6 A;  4YLH A;  5L3B B;  3M65 A;  2QGS A;  3AVR A;  5LGU B;  2PG8 A;  4HGA A;  4MHC A;  1D0X A;  2E9X B;  3RRW A;  4WNK A;  3QK6 A;  5JDM A;  2KLQ A;  1IJ5 A;  2JPF A;  3O1H A;  3C4Z A;  2Q9Q A;  1WLX A;  2Q9Q D;  2LEH A;  3ZJ2 A;  4CI1 B;  3IHR A;  3KV5 A;  4IE7 A;  1UCU A;  3LG7 A;  3LK2 B;  5JR9 A;  2V26 A;  5JDH A;  4JEH B;  4IE0 A;  4BAY B;  3HA4 A;  4PJL A;  4EZH A;  5BMV E;  1HCI A;  5A1L A;  1BR1 A;  3CQX C;  4GK5 E;  3UFE A;  4H9N C;  2WM9 A;  3ETU A;  4ZI2 C;  4H63 H;  4X1I E;  5LHH B;  5J2U E;  2CE7 A;  5JRE A;  3QC9 A;  4UV9 B;  2CA5 A;  4AKH A;  1FMW A;  2V7I A;  3MXZ A;  1IZN B;  3E0Z A;  2N1G A;  2HPJ A;  3L09 A;  2VKD A;  4MLK A;  1U4Q A;  3HI2 A;  2NW7 A;  5FXV A;  4YJ2 E;  2ZM0 A;  5FY0 A;  2IAK A;  3IF8 B;  4KUM B;  3UUM A;  4C90 A;  4ADZ A;  3F31 A;  3RRC A;  3N9N A;  2Y6X A;  2IC9 A;  3CX8 B;  1LRZ A;  4UEL A;  2VK9 A;  3GWH A;  2VKJ A;  3ZJ1 A;  3LK3 B;  4HN9 A;  3OYX A;  2YIN A;  4PAG A;  5LNK A;  4QX8 B;  3J9X 1;  1SA0 E;  4H9O C;  4H9R C;  2LOP A;  3I0O A;  3B13 A;  1OWA A;  2P9B A;  3BK9 A;  2V7M A;  3KV9 A;  4BJM A;  3E22 E;  2V1D B;  2CEA A;  2A2F X;  3N9P A;  3SS1 A;  2UXN B;  1FIO A;  2MYS A;  4GYS A;  4X1Y E;  2ZM2 A;  1MMA A;  2A3D A;  3LFM A;  1MIV A;  3BQI A;  4ZS2 A;  5HXS A;  4IGU A;  5LBM A;  2Z6E A;  3CX7 B;  4XAX B;  5L3G B;  2KT9 A;  3A5X A;  4ERR A;  5LYJ E;  1QUU A;  4G2A A;  1KK7 A;  3T8O A;  2VKO A;  4V1A v;  4IE6 A;  1MIY A;  4F6R C;  2Y8D A;  3B57 A;  1FMV A;  4QXH B;  3D0T A;  4Z8X A;  4AQF A;  3TKL B;  3HL6 A;  3NRY A;  2QA7 A;  2LM9 A;  3Q9D A;  4K0U A;  4OK0 A;  5LA6 E;  3F57 A;  2V7K A;  1S94 A;  4TZ4 C;  3CWZ B;  4NUU A;  2X9Y A;  5FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...