4FJOA

Structure of the rev1 ctd-rev3/7-pol kappa rir complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
AAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Rev1-mediated assembly of a quaternary vertebrate translesion polymerase complex consisting of Rev1, heterodimeric Pol zeta and Pol kappa
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/dna binding protein
molecule keywords DNA repair protein REV1
total genus 32
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4fjoA00
4FJOA 4GK5E 4EXTA 2LSKA 2LSGA 3VU7H 2LSJA 4GK0E 2N1GA 2LSIA 4BA9A 2LSYA
chains in the Genus database with same CATH superfamily
3RH3A 3CQCB 3L3PA 1W9RA 3EVYA 3T8OA 3PURA 4UV9B 4IL4A 3F31A 4P0BA 3FB2A 1MMDA 2W00A 2XJ7A 5C2TA 5LJNA 1G8XA 4B3ST 1XNRT 4EYUA 5AQNB 4HFIA 3AVSA 3JC6C 2KNDA 1T8BA 3ZLIA 1HTJF 5FL1A 3FZFB 5JDHA 4DV0T 3AEEA 1NEKA 5AQFB 4O4IE 3C51A 4AIUA 1MMAA 1N32T 5JDGA 5TAOA 1XMQT 3JAEA 2CHOA 3RF1A 4ZHQE 4HFBA 4AI6A 2LSGA 4HGAA 4X64T 2Y6XA 4WBNE 4X5TA 4IDPA 4TZ4C 3ZSSA 1IBKT 1UCUA 3R6NA 3UUMA 1HNWT 3PUSA 1HF8A 1H7CA 3MJXA 3UQ4A 2X0YA 2D0UA 4YY3T 4PNIA 3NWIA 2JQQA 4DBRA 4EXTA 2MYSA 5LHIB 2W61A 2WZHA 5LBQB 2RA1A 2NW7A 2VL0A 2XUEA 3K1SA 4YHHT 3ANWA 2XY8B 1MIYA 1OWAA 2WDVA 3UU8A 5JRCB 2V26A 2LHNA 3R84B 1OXZA 3S4UA 2N2NA 3L8RA 4HTEA 5LNKA 2LM2A 3P7IA 3RYFE 3HL6A 3VU7H 4DR1T 5JDFA 4PK6A 1WLXA 3QB5K 2FBWA 3HI2A 4TV8E 2E2AA 3KFWX 4DR7T 5ADXL 4IDOA 5AQQB 4UF0A 4JI5T 3EDVA 5EK4A 4UXNB 3AEAA 1N33T 2LE8A 4H9RC 1WR0A 2ACZA 2YU2A 3ABVA 4H9PC 4NPPA 5L3FB 1XNQT 1MMNA 3UFGA 2WU5A 1E2AA 2PTFA 4DVDA 4ZZBA 1MMGA 4UEMA 2VQFT 2YU1A 2X0LB 2D0TA 3KBTA 3VKHA 2MTQA 4DR4T 4HEAA 3RQUA 5HWXA 4U31A 5EK3A 4IDNA 5JDQA 1EZ3A 2IC9A 2IUBA 1HX1B 1LVKA 2L8KA 2CWYA 2X68A 2SPCA 4KP3C 4QHOA 5ABHA 1QUUA 2VKOA 4IL9A 2FJAA 4U2YA 3ZYKA 4A56A 3QUJA 3ZSTA 2V7IA 3N2OA 4KUMB 1I94T 4G2AA 3AA1B 4IDZA 1IBMT 2XM2A 4UVAB 1D1BA 3AEFA 3CMLA 3G06A 4X1IE 1WCRA 2XQ7A 2IW5B 5JTGA 3CQGB 3LK2B 5LGNB 4LMJA 2M6BA 3AB3B 3EDUA 3I9YA 2DHRA 3GWHA 5J1GA 3K3QC 4YJ3E 3UQ7A 3RC3A 3PUGA 3H37A 1FIOA 2CWOA 4DUYT 2VKHA 4CXYA 1BR1A 4GIWA 4EEBA 4DV3T 2BG9B 3SFEA 4PK4A 1LRZA 3UU4A 2W62A 2KT9A 4LF9T 1WYBA 3I0QA 4NIQA 1MNDA 2XQ6A 2BKPA 2LSJA 3AE3A 2X9XA 3KV4A 3BQKA 4P09A 3LK3B 3PTRB 2K24A 1ZEEA 4HFHA 1YD8G 5DJQC 2XQ9A 4ILUA 3RIAA 5CA0E 5L3EB 4LFAT 1IBLT 2CHNA 2XAHB 3RKGA 2HN2A 4IIJE 4YSZA 3T1YT 4E7SA 3Q9DA 4ZOLE 4XBFB 3L09A 2VVNA 4UVCB 1Z8UA 4EAHA 1JNRA 1B7TA 4PJJA 3OBVE 5KXJA 4LF7T 2Q9QC 4L9IA 1KFYA 2W2UA 1IJ5A 5AQUB 5A1LA 4Q25A 1MNEA 2XSAA 2X67A 3KV5A 5L4EA 4ZZCA 1T72A 2YDRA 2GK9A 4I50E 2E8IA 2XQ5A 4FJOA 4CN4A 5JDMA 3P4RA 1KF6A 2WDRA 3JCFA 4MFRA 2ZM0A 1D0XA 4LF5T 2CXLA 1BR4A 3ZPOA 4HN9A 3UU6A 3Q5DA 3AXJB 3IHRA 3ONJA 2KZ7B 3B13A 3F2EA 4IE7A 4L5GA 5FXZA 5LBMA 5L4HA 3I9WA 2ZM6T 4LFBT 1JNZA 4C90A 2F4VT 3IA3A 1U5PA 3SWHA 3E22E 3J7Yq 1CUNA 2MAWA 2Q9QB 2KINB 1N34T 1ZOYA 2CM0A 2JQHA 2NW9A 4Z8XA 1HS7A 3ZC0A 3PUYF 4XZCA 3I1AA 3ZT7A 4EGWA 4U2ZA 4ZI3C 3ZYLA 2NW8A 3LBXB 3L39A 4YHJA 5J2TE 3WAJA 2DWKA 2IAKA 2W0GA 2WB5A 3BQLA 4GOUA 3RC8A 1BR2A 4M1PA 4MALA 3O9XA 3ZMVB 4AISA 1YW0A 5IWAT 2UUCT 1X9BA 2NR4A 2X0HA 5HEHA 5F8PA 4U74A 3VRBA 5JRCA 3OVUA 3PUXF 3ANWB 2A72A 3HR0A 5H6QB 2UU9T 1UUSA 3OTOT 2LJLA 3DP7A 4IE4A 3KBUA 2JMHA 1IAPA 3VRAA 5CA1E 3KINB 1UURA 3TLWA 1I6ZA 3ZKRA 1MIWA 4JI0T 3JC6D 1R8IA 2YK0A 3E08A 1KNPA 3VKGA 2BG9A 3PU3A 4QH1A 2V1DB 2VASA 3AECA 3AE7A 2C5KT 2HHHT 3SFDA 2JJ9A 2DL1A 3ZC1A 5LYJE 3AXJA 3ZJ2A 4OX9T 2D5UA 2CXFA 4O4JE 2BG9C 2YOEA 1XZYA 4EEDA 4TWHA 4ZI3D 4CI1B 3QC9A 2VK9A 3M3ZB 4CQIA 5L2LA 4LFCT 1UX5A 5HCMA 4H9NC 3A8YC 3MXZA 3N2KE 3UU3A 3N9MA 3MZKB 5HYAA 2NTYA 4LMKA 4BAYB 4EZHA 2XTLA 3K8PC 3ESLA 2ACXA 4CN1A 5JR9C 3KV9A 5FVLA 2W67A 2LM9A 3LG7A 5FVKA 5LOVE 1ZKEA 4ADZA 1QLBA 4AKIA 2JMKA 1XWMA 2LEHA 3ONLC 4FI5A 1KNRA 2XQYA 2K9AA 4O8SA 2WP9A 3N5LA 4UELA 5AQHB 2CPTA 5AQPB 3OKQA 3N9QA 2CLYC 4I4TE 4CI2B 4CZZB 2E5LT 2XM1A 4DV1T 2IDOB 2JRKA 4PJNA 5H6RB 5LXTE 1WRDA 1X79A 2V7MA 3TKLB 4DBQA 3RLFF 3RGLA 1HNXT 5FYMA 1NWMX 1SE7A 2K3WA 2LT3A 2NTXA 2YN6A 3C4WA 3N2GE 4ISSA 4N78D 2C5JA 3CKDA 4JEUB 4KHZF 3QB5A 3IF8B 4O4HE 5FL0A 5L3CB 4DV6T 3LSVA 3OPCA 4TWDA 2MOZA 4U7YA 3RRWA 2N1GA 1ZHCA 4P1NA 4I0UA 4EB6E 2I6HA 4IE0A 4MLKA 1N36T 2YDQA 1VCSA 4O4LE 4AKHA 2YKSA 2ZLYA 3VR9A 2I59A 2A2FX 4KMCA 2WZIA 4IREA 1UK5A 1V9DA 3IBPA 2NP9A 3OJAA 4H63H 4WBOA 2LSYA 2LHRA 3A5XA 4YFSA 5AQJB 2CLYB 3RIUC 4JLEA 5BMVE 1G73A 2WMNA 3PDYA 4OYJA 2CCQA 2RPAA 4UV8B 5AQMB 5FXXA 2VURA 2WQYA 4EIWA 2DLRA 2MPKA 2WWUA 5LG3A 4YTNA 3K3NA 4IE5A 3N9OA 5CGMA 4U3CA 1ZP0A 4J2CA 2KMFA 4AQFC 2BS4A 1D0ZA 2XSBA 4TNWA 4I55E 5CB4E 4DUZT 1J5ET 2DI4A 2E5VA 3CX6B 2Y8DA 2VKJA 3HKBE 2LKHA 4H63V 5AQTB 5FY7A 2ODVA 3ZMUB 4UIGA 2UXXB 4AXPA 4YXDA 3QOFA 4XAXB 1W0BA 3LJCA 5E0OA 4DNDA 1WR6A 3DJBA 3H3AA 3LK42 4QX8B 2IIUA 1J5WA 4QWNB 4A98A 3ZYMA 2UXCT 4TN7B 3N9LA 4DMVA 2QVAA 3FZMB 4BA9A 4ASKA 2FJDA 2BKNA 4C91A 1SHZC 2WAUA 2ZMAA 2KWIB 2OLTA 2CXDA 3B57A 3PUVF 5DABA 3NRYA 4O2AE 2Q9QD 5JDNA 2LSIA 4TV9E 3MK7C 2MBGA 3RHWA 2E9XB 4AQFA 2HPLA 3BQIA 3N9NA 2B1EA 3AAEB 4AKRB 4BJMA 4X62T 2V5DA 3AE5A 2J1DG 4B3RT 3TLUA 3P50A 2E9XC 2UXNB 3UTKA 5JREA 2BBJA 3EHZA 1J1JA 2XAJB 2BDEA 3HKEE 4ZS2A 1KNZA 4PJLA 2X9WA 3ZN1B 2LRKA 1YXRA 5L3GB 3RIUA 2LKGA 3C4ZA 3TLSA 5BR8T 4DV4T 3F57A 4AQYT 1M7KA 1Y64B 2H88A 2XPKA 3H3MA 4F8HA 3OYXA 3Q5XA 1L0VA 3RYCE 4HWIB 4JI8T 3C98B 2M67A 2V7JA 4DR2T 3LDQB 3K3OA 3NKZA 3O1HA 4HFCA 3TLTA 3FBLA 2M6IA 4ILBA 1HG2A 1OEDB 5AQKB 3UUNA 2D9DA 1ZV4X 1D1CA 2OA5A 2XQAA 4PJMA 2LLYA 3JADA 5IHYA 4COFA 1XMOT 2D2SA 3RYHE 1GQEA 5JDLA 1O3XA 2BZBA 1US7B 2EHOD 2KSRA 3U3IA 1OEDC 1IJ6A 4JBWF 4OYKA 4KBMB 3KVBA 4YTMA 4EZ4A 4JUYA 2RP4A 2WCAA 2C0SA 3FXDB 1XDOA 5AQGB 1M62A 1YQ4A 2H3RA 4V1Av 2V6XA 2A9UA 4TWFA 2WU2A 3A7MA 4X20E 2Y48B 2KXPB 1YKHB 4QH5A 5LMUT 4KHPT 4WYVA 5LA6E 5LCYA 5LB7B 3WI3A 4B3MT 3I0OA 3JAFA 5ABFA 3NZPA 3O4XE 3AE8A 3U78A 4HWDA 5JR9A 4HFDA 4YTPA 5CJ5A 4NXMT 1OEDE 4LMLA 4TNVA 5FKYA 3EI0A 1E1HB 2VVSA 5AQSB 4IGUA 4OFZA 2YDSA 5HEOA 4HKAA 2BS3A 5HXSA 3ZT5A 3N9PA 3LBXA 2CBIA 2X9YA 5AQIB 5AQLB 3NZQA 4K0KT 1DU2A 2V7LA 4GK0E 2ZM2A 4HFEA 2IMLA 4NUVA 2VB6A 4QKNA 3AA6B 4B3TT 1D0YA 2HPJA 4ILAA 3AE2A 4H9OC 4YSXA 4ZS3A 2NOXA 4ILCA 3RYIE 4AKLA 2BBHA 2CMRA 1SUMB 4HWCA 2WY2A 3BK9A 4PAGA 4QX7B 4WNKA 4JI4T 5FY1A 4L0RA 2JQKA 4JEHB 4F6RC 5CFBA 3FZKB 4LF4T 4JI7T 2BKOA 2A3DA 5FY0A 3V5UA 1IZNB 5IYZE 2W66A 3AE1A 5IUXA 2I0MA 2J47A 1S94A 1VRBA 1T7SA 1NENA 3FBZA 2P9BA 2XASB 3RQWA 4P0AA 3AAAB 2XAFB 5JVDE 3RRCA 4NXNT 4GK5E 4PK5A 3ZEFB 4LF6T 3P4SA 2XHEB 3PE0A 1HG5A 3T1HT 5FMNA 4U7IA 5FXVA 5HXEA 5LG4A 3NBXX 2FJEA 5LP6E 1VCTA 3AEBA 5ABFB 3AE9A 3CX8B 1MIVA 3PUAA 3X1DA 4CXWA 4H9SE 4JI2T 1YQ3A 5JQGE 2UUBT 2L3LA 4H9QC 2WM9A 2LOSA 2KLQA 3B5MA 2OV9A 4QXHB 1OEDA 2BS2A 4ZXLA 3ZN0B 4ERRA 3P4PA 5HAXA 1VOMA 2BVMA 3CX7B 4EYYR 3FXEB 4GYSA 5HWYA 2ZM8A 3LFMA 3O1IA 4QXCB 3FZHB 2Z6EA 2LSKA 5DQWA 4UVBB 2PFVA 2JPFA 3AA7B 4KX6A 2UXBT 4LF8T 3VR8A 4JI3T 2LOPA 3RKOA 5HCJA 3QNUA 3E0ZA 3KV6A 2IC6A 5KMGP 4A5XA 2ODUA 3PJAA 4MHCA 3FZLB 5L3BB 2W63A 3AVRA 2XQ8A 3CPZA 5HXHA 3PU8A 2Q9QA 3AEDA 1NAFA 2XAQB 5JR9B 2E9XA 4HFVA 3UT5E 2BG9E 2PBIA 2WBLA 2J4GA 4KI0F 5AQRB 5LGUB 5LJMA 1QSDA 4DO0A 3MA9A 5AFUL 4HE8A 2H7VC 5HEGA 2V7KA 2YEVC 3C64A 2L9QA 3KDSE 2J62A 1YKEB 3KVAA 3GA8A 5ABGA 2G0UA 2DCFA 2JIWA 4DR5T 1Z0PA 1D1AA 4X66T 2QRXA 4CXXA 3HKDE 1HFAA 4DR6T 1FEWA 4ANJA 3EUHA 3P4WA 3RPUA 4E7ZA 3AAIA 4MBQA 3Q2MA 4DV2T 5ETWA 2ES0A 2WSSV 3UU5A 4PW8A 2V6YB 5LMNT 1E7PA 2NWBA 2V6YA 3SOLA 3CWZB 4X1KE 3CK6A 3ONXA 1LKXA 1W09A 3J9X1 3IEEA 4WZXA 4JYAT 1FMVA 1T98A 3NVOA 2X9HA 3CQXC 5HEUA 1SA0E 3PUZF 3RI5A 3UFEA 1BR0A 2FUPA 5M4YA 1LVFA 4B6XA 4X65T 4QH4A 4X1YE 1Y01A 2EHOA 3PUWF 4AQGA 2EHOB 4Z91A 3AA0B 3QK6A 4EOZB 5L3DB 3C50A 5LGTB 4JI6T 2KWHA 2H7OA 3MACA 4TX5A 4EV6A 2PJQA 3CIRA 4UF0B 1S35A 4YJ2E 4NUUA 1WYCA 2EHOC 3HKCE 4IT4A 4QXBB 4YT0A 2W4XA 2R6GF 5J0ZA 3FHNA 3PUQA 4ZI2C 3O1JA 5AQOB 3NRXA 4JV5T 4IE6A 4DIDB 2N9DA 2AE9A 1W0AA 1U4QA 3ZMZB 4OHFA 2PG8A 5J2UE 2V8SV 4AKGA 3Q5WA 3VHLA 3ZMSB 2WMOA 3AE4A 3PJAJ 4HWFA 4YSYA 2HH7A 5LHHB 2WDQA 2X66A 3AEGA 4Z90A 4BJNA 2FJBA 3GN5A 3GMIA 2AXDS 2QYWA 3ETUA 4OK0A 4WW0A 5FP3A 3V5SA 4A97A 5EZYE 4GKJT 3HA4A 3UUXB 3AE6A 2WS3A 3WAKA 3SS1A 4UR9A 1UGOA 5HXRA 4ISTA 4PFPA 3ZJ1A 3ZCJA 2QA7A 1WFDA 4IHJE 1KK7A 3CVRA 2JQ9A 5F5WA 4YLHA 4JI1T 3RX6A 5HEJA 2CEAA 2CA5A 5FXWA 5JH7E 2CRBA 5GONE 2B76A 2BVLA 3M65A 3RIFA 1HNZT 1AJ3A 5KDMC 5HXCA 1UX4A 4O2BE 2X51A 4I43B 4ZI7E 4ZI2D 2UUAT 4GKKT 2VL8A 5C8YE 2LRLA 2YINA 1KEYA 2WWVA 5C3JA 3ETVA 3P8CD 2K5BB 2XZEA 4G63A 4ZEYA 4PFOA 2XAGB 2K48A 2C5IT 2XQ3A 3UULA 1XDPA 4IDQA 3ZT6A 3EABA 4DMWA 2VQET 2VKDA 2IHR1 4DR3T 2UXDT 5LHGB 2DWGA 3Q5EA 2HN1A 4K0UA 4U33A 5EK2A 5L47A 2V5CA 5KX5E 1HX8A 3P4QA 3SRZA 5F3JA 4U72A 2CE7A 1FJGT 3D0TA 4DV7T 2H89A 5ABEA 3TLVA 2CBJA 4HWHA 4DV5T 4CI3B 3PV0F 2VWAA 3EAMA 4CN6A 3DTOA 3C4XA 3UUBA 1FMWA 3OYZA 2XQ4A 2DNXA 4TUYE 3MKDA 5DQVA 3GN5B 1HCIA 4GYRA 3W15B 1HR0T 5AQVB 3ZCIA 1CHUA 5FNVE 2QGSA 2E9XD 3ZMTB
chains in the Genus database with same CATH topology
3RH3A 3CQCB 3L3PA 3T8OA 3EVYA 3PURA 4UV9B 3F31A 4P0BA 3FB2A 1MMDA 2W00A 5LJNA 1G8XA 4EYUA 3AVSA 3JC6C 2KNDA 3ZLIA 1HTJF 5JDHA 4O4IE 3C51A 1MMAA 5JDGA 5TAOA 4ZHQE 4AI6A 2LSGA 4HGAA 2Y6XA 4WBNE 4TZ4C 1UCUA 3R6NA 3UUMA 3PUSA 1HF8A 1H7CA 3MJXA 2D0UA 4PNIA 2JQQA 4DBRA 4EXTA 2MYSA 5LHIB 2W61A 5LBQB 2RA1A 2NW7A 2XUEA 3ANWA 1MIYA 1OWAA 5JRCB 2V26A 2LHNA 3R84B 1OXZA 3S4UA 2N2NA 4HTEA 5LNKA 3P7IA 3RYFE 3HL6A 3VU7H 5JDFA 4PK6A 1WLXA 3HI2A 4TV8E 3KFWX 5ADXL 4UF0A 3EDVA 5EK4A 4UXNB 2LE8A 4H9RC 2YU2A 4H9PC 5L3FB 1MMNA 4DVDA 1MMGA 4UEMA 2YU1A 2X0LB 2D0TA 3KBTA 3VKHA 2MTQA 4HEAA 5EK3A 5JDQA 1EZ3A 2IC9A 1LVKA 2L8KA 2X68A 2CWYA 4KP3C 2SPCA 4QHOA 1QUUA 2VKOA 4A56A 5LGTB 3ZYKA 3QUJA 2V7IA 3N2OA 4KUMB 4G2AA 3AA1B 4IDZA 4UVAB 1D1BA 3CMLA 4X1IE 2IW5B 3CQGB 3LK2B 5LGNB 3AB3B 3EDUA 3I9YA 5J1GA 2DHRA 3GWHA 3K3QC 4YJ3E 3PUGA 3H37A 1FIOA 2CWOA 2VKHA 4CXYA 1BR1A 4GIWA 4PK4A 1LRZA 2W62A 2KT9A 1WYBA 3I0QA 1MNDA 2LSJA 2X9XA 3KV4A 3BQKA 4P09A 3LK3B 3PTRB 2K24A 1ZEEA 4UVCB 1YD8G 5DJQC 5CA0E 4ILUA 5L3EB 2XAHB 4IIJE 4E7SA 3Q9DA 4ZOLE 4XBFB 3L09A 4EAHA 1B7TA 4PJJA 3OBVE 2Q9QC 4L9IA 1IJ5A 5A1LA 1MNEA 2X67A 3KV5A 2GK9A 4I50E 2E8IA 5JDMA 4FJOA 4MFRA 2ZM0A 1D0XA 2CXLA 1BR4A 3ZPOA 4HN9A 3IHRA 4IE7A 2KZ7B 3B13A 3F2EA 4L5GA 5FXZA 5LBMA 3I9WA 1U5PA 3SWHA 3E22E 3J7Yq 1CUNA 2Q9QB 2KINB 2CM0A 2NW9A 4Z8XA 1HS7A 3ZC0A 4XZCA 3I1AA 3ZYLA 4ZI3C 2NW8A 3LBXB 4YHJA 5J2TE 3WAJA 2DWKA 2IAKA 2W0GA 3BQLA 4GOUA 3RC8A 1BR2A 4M1PA 4MALA 3O9XA 3ZMVB 1YW0A 5F8PA 4U74A 5JRCA 3ANWB 2A72A 3HR0A 5H6QB 2LJLA 3DP7A 4IE4A 3KBUA 2JMHA 1IAPA 5CA1E 3KINB 1MIWA 3JC6D 2YK0A 3E08A 3VKGA 3PU3A 2V1DB 2VASA 2C5KT 2JJ9A 3ZC1A 5LYJE 3ZJ2A 2D5UA 2CXFA 4O4JE 4ZI3D 4CI1B 3QC9A 2VK9A 4CQIA 5L2LA 1UX5A 4H9NC 3MXZA 3N2KE 3N9MA 3MZKB 5HYAA 2NTYA 4BAYB 4EZHA 2XTLA 3K8PC 3ESLA 2ACXA 5JR9C 3KV9A 2LM9A 3LG7A 5LOVE 1ZKEA 4ADZA 4AKIA 2JMKA 2LEHA 4FI5A 4O8SA 2XQYA 4ERRA 2K9AA 4UELA 3V5UA 3N5LA 4CZZB 3OKQA 3N9QA 2CLYC 4I4TE 4CI2B 2JRKA 4PJNA 5H6RB 5LXTE 1WRDA 1X79A 2V7MA 3TKLB 4DBQA 5FYMA 1NWMX 2NTXA 4N78D 2LT3A 3C4WA 3N2GE 4ISSA 3RC3A 2C5JA 3CKDA 4JEUB 3IF8B 4O4HE 5L3CB 2MOZA 3RRWA 2N1GA 1ZHCA 4EB6E 4IE0A 4MLKA 4O4LE 4AKHA 2ZLYA 2I59A 2A2FX 4KMCA 1V9DA 3IBPA 2NP9A 3OJAA 4H63H 4WBOA 2LSYA 2LHRA 3A5XA 4YFSA 4C90A 2CLYB 4C91A 4JLEA 1G73A 2WMNA 3PDYA 4OYJA 2CCQA 4UV8B 4EIWA 5BMVE 5FXXA 2DLRA 2WWUA 3K3NA 4IE5A 3N9OA 4J2CA 2KMFA 4AQFC 5CB4E 1D0ZA 4I55E 2DI4A 3CX6B 4H63V 2Y8DA 2VKJA 3HKBE 3ZMUB 5FY7A 4AXPA 5HWXA 2ODVA 4UIGA 2UXXB 4XAXB 3LJCA 5E0OA 4DNDA 3H3AA 3DJBA 1WR6A 3LK42 4QX8B 4QWNB 3ZYMA 4TN7B 3N9LA 4DMVA 4BA9A 4ASKA 1SHZC 2WAUA 2ZMAA 2KWIB 3B57A 2CXDA 4ANJA 5DABA 3NRYA 4O2AE 2Q9QD 5JDNA 2LSIA 4TV9E 3MK7C 2MBGA 2E9XB 4AQFA 2HPLA 3BQIA 3N9NA 2B1EA 3AAEB 4AKRB 4BJMA 2J1DG 2E9XC 2UXNB 3UTKA 5JREA 3HKEE 2XAJB 2BDEA 4ZS2A 1KNZA 4PJLA 2X9WA 3ZN1B 5L3GB 3C4ZA 3F57A 1Y64B 3OYXA 3Q5XA 3RYCE 3C98B 2M67A 2V7JA 3K3OA 3O1HA 3FBLA 3ZMSB 1HG2A 3UUNA 1ZV4X 1D1CA 2OA5A 4PJMA 5IHYA 2D2SA 3RYHE 5JDLA 1O3XA 2BZBA 1US7B 2EHOD 3U3IA 4EZ4A 1IJ6A 4OYKA 4KBMB 3KVBA 4JUYA 2RP4A 3ZN0B 2C0SA 3FXDB 5LG4A 2H3RA 4V1Av 4X20E 2Y48B 2KXPB 1YKHB 5LA6E 5LCYA 3WI3A 3I0OA 3NZPA 3O4XE 3U78A 5JR9A 1E1HB 4IGUA 4OFZA 4HKAA 5HXSA 3N9PA 3LBXA 2X9YA 3NZQA 2V7LA 4GK0E 2ZM2A 4NUVA 2VB6A 4QKNA 3AA6B 1D0YA 2HPJA 4H9OC 4ZS3A 2NOXA 3RYIE 4AKLA 2CMRA 4QX7B 3BK9A 4PAGA 4WNKA 5FY1A 4L0RA 4JEHB 4F6RC 2A3DA 5FY0A 1IZNB 5IYZE 1S94A 1VRBA 3FBZA 2P9BA 2XASB 4P0AA 3AAAB 2XAFB 5JVDE 3RRCA 4GK5E 4PK5A 3ZEFB 2XHEB 3PE0A 1HG5A 5FMNA 5FXVA 5HXEA 3NBXX 5LP6E 3CX8B 1MIVA 3PUAA 4CXWA 4H9SE 5JQGE 2L3LA 4H9QC 2WM9A 2LOSA 2KLQA 4QXHB 5HAXA 1VOMA 2BVMA 3CX7B 4EYYR 3FXEB 4GYSA 5HWYA 2ZM8A 3LFMA 3O1IA 4QXCB 2Z6EA 2LSKA 5DQWA 4UVBB 2PFVA 2JPFA 3AA7B 2LOPA 3RKOA 3E0ZA 3KV6A 2IC6A 5KMGP 2ODUA 4MHCA 5L3BB 2W63A 3AVRA 3CPZA 5HXHA 3PU8A 2Q9QA 1NAFA 2XAQB 5JR9B 2E9XA 4HFVA 3UT5E 2PBIA 2WBLA 5LJMA 1QSDA 4DO0A 3MA9A 5AFUL 4HE8A 2H7VC 2V7KA 2YEVC 3C64A 2L9QA 3KDSE 1YKEB 3KVAA 3GA8A 2G0UA 2DCFA 1Z0PA 1D1AA 4CXXA 3HKDE 1HFAA 1FEWA 3EUHA 3RPUA 4E7ZA 3AAIA 4MBQA 3Q2MA 5ETWA 2ES0A 2WSSV 4PW8A 2NWBA 3SOLA 3CWZB 4X1KE 3ONXA 1LKXA 3J9X1 3IEEA 1FMVA 1T98A 2X9HA 3CQXC 3UFEA 1SA0E 1BR0A 5M4YA 1LVFA 4B6XA 4X1YE 2EHOA 4AQGA 2EHOB 3AA0B 3QK6A 4EOZB 5L3DB 3C50A 2KWHA 2H7OA 3MACA 4TX5A 2PJQA 4UF0B 1S35A 4YJ2E 4NUUA 1WYCA 2EHOC 3HKCE 4QXBB 3FHNA 3PUQA 4ZI2C 3O1JA 3NRXA 4IE6A 2N9DA 1U4QA 3ZMZB 4OHFA 2PG8A 5J2UE 4AKGA 3Q5WA 3VHLA 2WMOA 2HH7A 5LHHB 2X66A 4BJNA 5FP3A 3GN5A 3GMIA 3ETUA 4OK0A 4WW0A 3V5SA 5EZYE 3HA4A 3UUXB 3WAKA 3SS1A 3ZJ1A 5HXRA 4ISTA 4PFPA 3ZCJA 2QA7A 4IHJE 1KK7A 3CVRA 4YLHA 3RX6A 2CEAA 2CA5A 5FXWA 5JH7E 5GONE 2BVLA 3M65A 1AJ3A 5KDMC 5HXCA 1UX4A 4O2BE 2X51A 4I43B 4ZI7E 4ZI2D 2VL8A 5C8YE 2YINA 3ETVA 3P8CD 2K5BB 4G63A 4PFOA 2XAGB 2K48A 2C5IT 3UULA 4DMWA 2VKDA 5LHGB 2DWGA 4K0UA 5EK2A 5KX5E 1HX8A 3SRZA 5F3JA 4U72A 2CE7A 3D0TA 4CI3B 2VWAA 3DTOA 3C4XA 1FMWA 3OYZA 4TUYE 2DNXA 5DQVA 3MKDA 3W15B 3GN5B 1HCIA 4GYRA 5LGUB 3ZCIA 5FNVE 2QGSA 2E9XD 3ZMTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJO A;  4GK5 E;  4EXT A;  2LSK A;  2LSG A;  3VU7 H;  2LSJ A;  4GK0 E;  2N1G A;  2LSI A;  4BA9 A;  2LSY A; 
#chains in the Genus database with same CATH topology
 3RH3 A;  3CQC B;  3L3P A;  1W9R A;  3EVY A;  3T8O A;  3PUR A;  4UV9 B;  4IL4 A;  3F31 A;  4P0B A;  3FB2 A;  1MMD A;  2W00 A;  2XJ7 A;  5C2T A;  5LJN A;  1G8X A;  4B3S T;  1XNR T;  4EYU A;  5AQN B;  4HFI A;  3AVS A;  3JC6 C;  2KND A;  1T8B A;  3ZLI A;  1HTJ F;  5FL1 A;  3FZF B;  5JDH A;  4DV0 T;  3AEE A;  1NEK A;  5AQF B;  4O4I E;  3C51 A;  4AIU A;  1MMA A;  1N32 T;  5JDG A;  5TAO A;  1XMQ T;  3JAE A;  2CHO A;  3RF1 A;  4ZHQ E;  4HFB A;  4AI6 A;  2LSG A;  4HGA A;  4X64 T;  2Y6X A;  4WBN E;  4X5T A;  4IDP A;  4TZ4 C;  3ZSS A;  1IBK T;  1UCU A;  3R6N A;  3UUM A;  1HNW T;  3PUS A;  1HF8 A;  1H7C A;  3MJX A;  3UQ4 A;  2X0Y A;  2D0U A;  4YY3 T;  4PNI A;  3NWI A;  2JQQ A;  4DBR A;  4EXT A;  2MYS A;  5LHI B;  2W61 A;  2WZH A;  5LBQ B;  2RA1 A;  2NW7 A;  2VL0 A;  2XUE A;  3K1S A;  4YHH T;  3ANW A;  2XY8 B;  1MIY A;  1OWA A;  2WDV A;  3UU8 A;  5JRC B;  2V26 A;  2LHN A;  3R84 B;  1OXZ A;  3S4U A;  2N2N A;  3L8R A;  4HTE A;  5LNK A;  2LM2 A;  3P7I A;  3RYF E;  3HL6 A;  3VU7 H;  4DR1 T;  5JDF A;  4PK6 A;  1WLX A;  3QB5 K;  2FBW A;  3HI2 A;  4TV8 E;  2E2A A;  3KFW X;  4DR7 T;  5ADX L;  4IDO A;  5AQQ B;  4UF0 A;  4JI5 T;  3EDV A;  5EK4 A;  4UXN B;  3AEA A;  1N33 T;  2LE8 A;  4H9R C;  1WR0 A;  2ACZ A;  2YU2 A;  3ABV A;  4H9P C;  4NPP A;  5L3F B;  1XNQ T;  1MMN A;  3UFG A;  2WU5 A;  1E2A A;  2PTF A;  4DVD A;  4ZZB A;  1MMG A;  4UEM A;  2VQF T;  2YU1 A;  2X0L B;  2D0T A;  3KBT A;  3VKH A;  2MTQ A;  4DR4 T;  4HEA A;  3RQU A;  5HWX A;  4U31 A;  5EK3 A;  4IDN A;  5JDQ A;  1EZ3 A;  2IC9 A;  2IUB A;  1HX1 B;  1LVK A;  2L8K A;  2CWY A;  2X68 A;  2SPC A;  4KP3 C;  4QHO A;  5ABH A;  1QUU A;  2VKO A;  4IL9 A;  2FJA A;  4U2Y A;  3ZYK A;  4A56 A;  3QUJ A;  3ZST A;  2V7I A;  3N2O A;  4KUM B;  1I94 T;  4G2A A;  3AA1 B;  4IDZ A;  1IBM T;  2XM2 A;  4UVA B;  1D1B A;  3AEF A;  3CML A;  3G06 A;  4X1I E;  1WCR A;  2XQ7 A;  2IW5 B;  5JTG A;  3CQG B;  3LK2 B;  5LGN B;  4LMJ A;  2M6B A;  3AB3 B;  3EDU A;  3I9Y A;  2DHR A;  3GWH A;  5J1G A;  3K3Q C;  4YJ3 E;  3UQ7 A;  3RC3 A;  3PUG A;  3H37 A;  1FIO A;  2CWO A;  4DUY T;  2VKH A;  4CXY A;  1BR1 A;  4GIW A;  4EEB A;  4DV3 T;  2BG9 B;  3SFE A;  4PK4 A;  1LRZ A;  3UU4 A;  2W62 A;  2KT9 A;  4LF9 T;  1WYB A;  3I0Q A;  4NIQ A;  1MND A;  2XQ6 A;  2BKP A;  2LSJ A;  3AE3 A;  2X9X A;  3KV4 A;  3BQK A;  4P09 A;  3LK3 B;  3PTR B;  2K24 A;  1ZEE A;  4HFH A;  1YD8 G;  5DJQ C;  2XQ9 A;  4ILU A;  3RIA A;  5CA0 E;  5L3E B;  4LFA T;  1IBL T;  2CHN A;  2XAH B;  3RKG A;  2HN2 A;  4IIJ E;  4YSZ A;  3T1Y T;  4E7S A;  3Q9D A;  4ZOL E;  4XBF B;  3L09 A;  2VVN A;  4UVC B;  1Z8U A;  4EAH A;  1JNR A;  1B7T A;  4PJJ A;  3OBV E;  5KXJ A;  4LF7 T;  2Q9Q C;  4L9I A;  1KFY A;  2W2U A;  1IJ5 A;  5AQU B;  5A1L A;  4Q25 A;  1MNE A;  2XSA A;  2X67 A;  3KV5 A;  5L4E A;  4ZZC A;  1T72 A;  2YDR A;  2GK9 A;  4I50 E;  2E8I A;  2XQ5 A;  4FJO A;  4CN4 A;  5JDM A;  3P4R A;  1KF6 A;  2WDR A;  3JCF A;  4MFR A;  2ZM0 A;  1D0X A;  4LF5 T;  2CXL A;  1BR4 A;  3ZPO A;  4HN9 A;  3UU6 A;  3Q5D A;  3AXJ B;  3IHR A;  3ONJ A;  2KZ7 B;  3B13 A;  3F2E A;  4IE7 A;  4L5G A;  5FXZ A;  5LBM A;  5L4H A;  3I9W A;  2ZM6 T;  4LFB T;  1JNZ A;  4C90 A;  2F4V T;  3IA3 A;  1U5P A;  3SWH A;  3E22 E;  3J7Y q;  1CUN A;  2MAW A;  2Q9Q B;  2KIN B;  1N34 T;  1ZOY A;  2CM0 A;  2JQH A;  2NW9 A;  4Z8X A;  1HS7 A;  3ZC0 A;  3PUY F;  4XZC A;  3I1A A;  3ZT7 A;  4EGW A;  4U2Z A;  4ZI3 C;  3ZYL A;  2NW8 A;  3LBX B;  3L39 A;  4YHJ A;  5J2T E;  3WAJ A;  2DWK A;  2IAK A;  2W0G A;  2WB5 A;  3BQL A;  4GOU A;  3RC8 A;  1BR2 A;  4M1P A;  4MAL A;  3O9X A;  3ZMV B;  4AIS A;  1YW0 A;  5IWA T;  2UUC T;  1X9B A;  2NR4 A;  2X0H A;  5HEH A;  5F8P A;  4U74 A;  3VRB A;  5JRC A;  3OVU A;  3PUX F;  3ANW B;  2A72 A;  3HR0 A;  5H6Q B;  2UU9 T;  1UUS A;  3OTO T;  2LJL A;  3DP7 A;  4IE4 A;  3KBU A;  2JMH A;  1IAP A;  3VRA A;  5CA1 E;  3KIN B;  1UUR A;  3TLW A;  1I6Z A;  3ZKR A;  1MIW A;  4JI0 T;  3JC6 D;  1R8I A;  2YK0 A;  3E08 A;  1KNP A;  3VKG A;  2BG9 A;  3PU3 A;  4QH1 A;  2V1D B;  2VAS A;  3AEC A;  3AE7 A;  2C5K T;  2HHH T;  3SFD A;  2JJ9 A;  2DL1 A;  3ZC1 A;  5LYJ E;  3AXJ A;  3ZJ2 A;  4OX9 T;  2D5U A;  2CXF A;  4O4J E;  2BG9 C;  2YOE A;  1XZY A;  4EED A;  4TWH A;  4ZI3 D;  4CI1 B;  3QC9 A;  2VK9 A;  3M3Z B;  4CQI A;  5L2L A;  4LFC T;  1UX5 A;  5HCM A;  4H9N C;  3A8Y C;  3MXZ A;  3N2K E;  3UU3 A;  3N9M A;  3MZK B;  5HYA A;  2NTY A;  4LMK A;  4BAY B;  4EZH A;  2XTL A;  3K8P C;  3ESL A;  2ACX A;  4CN1 A;  5JR9 C;  3KV9 A;  5FVL A;  2W67 A;  2LM9 A;  3LG7 A;  5FVK A;  5LOV E;  1ZKE A;  4ADZ A;  1QLB A;  4AKI A;  2JMK A;  1XWM A;  2LEH A;  3ONL C;  4FI5 A;  1KNR A;  2XQY A;  2K9A A;  4O8S A;  2WP9 A;  3N5L A;  4UEL A;  5AQH B;  2CPT A;  5AQP B;  3OKQ A;  3N9Q A;  2CLY C;  4I4T E;  4CI2 B;  4CZZ B;  2E5L T;  2XM1 A;  4DV1 T;  2IDO B;  2JRK A;  4PJN A;  5H6R B;  5LXT E;  1WRD A;  1X79 A;  2V7M A;  3TKL B;  4DBQ A;  3RLF F;  3RGL A;  1HNX T;  5FYM A;  1NWM X;  1SE7 A;  2K3W A;  2LT3 A;  2NTX A;  2YN6 A;  3C4W A;  3N2G E;  4ISS A;  4N78 D;  2C5J A;  3CKD A;  4JEU B;  4KHZ F;  3QB5 A;  3IF8 B;  4O4H E;  5FL0 A;  5L3C B;  4DV6 T;  3LSV A;  3OPC A;  4TWD A;  2MOZ A;  4U7Y A;  3RRW A;  2N1G A;  1ZHC A;  4P1N A;  4I0U A;  4EB6 E;  2I6H A;  4IE0 A;  4MLK A;  1N36 T;  2YDQ A;  1VCS A;  4O4L E;  4AKH A;  2YKS A;  2ZLY A;  3VR9 A;  2I59 A;  2A2F X;  4KMC A;  2WZI A;  4IRE A;  1UK5 A;  1V9D A;  3IBP A;  2NP9 A;  3OJA A;  4H63 H;  4WBO A;  2LSY A;  2LHR A;  3A5X A;  4YFS A;  5AQJ B;  2CLY B;  3RIU C;  4JLE A;  5BMV E;  1G73 A;  2WMN A;  3PDY A;  4OYJ A;  2CCQ A;  2RPA A;  4UV8 B;  5AQM B;  5FXX A;  2VUR A;  2WQY A;  4EIW A;  2DLR A;  2MPK A;  2WWU A;  5LG3 A;  4YTN A;  3K3N A;  4IE5 A;  3N9O A;  5CGM A;  4U3C A;  1ZP0 A;  4J2C A;  2KMF A;  4AQF C;  2BS4 A;  1D0Z A;  2XSB A;  4TNW A;  4I55 E;  5CB4 E;  4DUZ T;  1J5E T;  2DI4 A;  2E5V A;  3CX6 B;  2Y8D A;  2VKJ A;  3HKB E;  2LKH A;  4H63 V;  5AQT B;  5FY7 A;  2ODV A;  3ZMU B;  4UIG A;  2UXX B;  4AXP A;  4YXD A;  3QOF A;  4XAX B;  1W0B A;  3LJC A;  5E0O A;  4DND A;  1WR6 A;  3DJB A;  3H3A A;  3LK4 2;  4QX8 B;  2IIU A;  1J5W A;  4QWN B;  4A98 A;  3ZYM A;  2UXC T;  4TN7 B;  3N9L A;  4DMV A;  2QVA A;  3FZM B;  4BA9 A;  4ASK A;  2FJD A;  2BKN A;  4C91 A;  1SHZ C;  2WAU A;  2ZMA A;  2KWI B;  2OLT A;  2CXD A;  3B57 A;  3PUV F;  5DAB A;  3NRY A;  4O2A E;  2Q9Q D;  5JDN A;  2LSI A;  4TV9 E;  3MK7 C;  2MBG A;  3RHW A;  2E9X B;  4AQF A;  2HPL A;  3BQI A;  3N9N A;  2B1E A;  3AAE B;  4AKR B;  4BJM A;  4X62 T;  2V5D A;  3AE5 A;  2J1D G;  4B3R T;  3TLU A;  3P50 A;  2E9X C;  2UXN B;  3UTK A;  5JRE A;  2BBJ A;  3EHZ A;  1J1J A;  2XAJ B;  2BDE A;  3HKE E;  4ZS2 A;  1KNZ A;  4PJL A;  2X9W A;  3ZN1 B;  2LRK A;  1YXR A;  5L3G B;  3RIU A;  2LKG A;  3C4Z A;  3TLS A;  5BR8 T;  4DV4 T;  3F57 A;  4AQY T;  1M7K A;  1Y64 B;  2H88 A;  2XPK A;  3H3M A;  4F8H A;  3OYX A;  3Q5X A;  1L0V A;  3RYC E;  4HWI B;  4JI8 T;  3C98 B;  2M67 A;  2V7J A;  4DR2 T;  3LDQ B;  3K3O A;  3NKZ A;  3O1H A;  4HFC A;  3TLT A;  3FBL A;  2M6I A;  4ILB A;  1HG2 A;  1OED B;  5AQK B;  3UUN A;  2D9D A;  1ZV4 X;  1D1C A;  2OA5 A;  2XQA A;  4PJM A;  2LLY A;  3JAD A;  5IHY A;  4COF A;  1XMO T;  2D2S A;  3RYH E;  1GQE A;  5JDL A;  1O3X A;  2BZB A;  1US7 B;  2EHO D;  2KSR A;  3U3I A;  1OED C;  1IJ6 A;  4JBW F;  4OYK A;  4KBM B;  3KVB A;  4YTM A;  4EZ4 A;  4JUY A;  2RP4 A;  2WCA A;  2C0S A;  3FXD B;  1XDO A;  5AQG B;  1M62 A;  1YQ4 A;  2H3R A;  4V1A v;  2V6X A;  2A9U A;  4TWF A;  2WU2 A;  3A7M A;  4X20 E;  2Y48 B;  2KXP B;  1YKH B;  4QH5 A;  5LMU T;  4KHP T;  4WYV A;  5LA6 E;  5LCY A;  5LB7 B;  3WI3 A;  4B3M T;  3I0O A;  3JAF A;  5ABF A;  3NZP A;  3O4X E;  3AE8 A;  3U78 A;  4HWD A;  5JR9 A;  4HFD A;  4YTP A;  5CJ5 A;  4NXM T;  1OED E;  4LML A;  4TNV A;  5FKY A;  3EI0 A;  1E1H B;  2VVS A;  5AQS B;  4IGU A;  4OFZ A;  2YDS A;  5HEO A;  4HKA A;  2BS3 A;  5HXS A;  3ZT5 A;  3N9P A;  3LBX A;  2CBI A;  2X9Y A;  5AQI B;  5AQL B;  3NZQ A;  4K0K T;  1DU2 A;  2V7L A;  4GK0 E;  2ZM2 A;  4HFE A;  2IML A;  4NUV A;  2VB6 A;  4QKN A;  3AA6 B;  4B3T T;  1D0Y A;  2HPJ A;  4ILA A;  3AE2 A;  4H9O C;  4YSX A;  4ZS3 A;  2NOX A;  4ILC A;  3RYI E;  4AKL A;  2BBH A;  2CMR A;  1SUM B;  4HWC A;  2WY2 A;  3BK9 A;  4PAG A;  4QX7 B;  4WNK A;  4JI4 T;  5FY1 A;  4L0R A;  2JQK A;  4JEH B;  4F6R C;  5CFB A;  3FZK B;  4LF4 T;  4JI7 T;  2BKO A;  2A3D A;  5FY0 A;  3V5U A;  1IZN B;  5IYZ E;  2W66 A;  3AE1 A;  5IUX A;  2I0M A;  2J47 A;  1S94 A;  1VRB A;  1T7S A;  1NEN A;  3FBZ A;  2P9B A;  2XAS B;  3RQW A;  4P0A A;  3AAA B;  2XAF B;  5JVD E;  3RRC A;  4NXN T;  4GK5 E;  4PK5 A;  3ZEF B;  4LF6 T;  3P4S A;  2XHE B;  3PE0 A;  1HG5 A;  3T1H T;  5FMN A;  4U7I A;  5FXV A;  5HXE A;  5LG4 A;  3NBX X;  2FJE A;  5LP6 E;  1VCT A;  3AEB A;  5ABF B;  3AE9 A;  3CX8 B;  1MIV A;  3PUA A;  3X1D A;  4CXW A;  4H9S E;  4JI2 T;  1YQ3 A;  5JQG E;  2UUB T;  2L3L A;  4H9Q C;  2WM9 A;  2LOS A;  2KLQ A;  3B5M A;  2OV9 A;  4QXH B;  1OED A;  2BS2 A;  4ZXL A;  3ZN0 B;  4ERR A;  3P4P A;  5HAX A;  1VOM A;  2BVM A;  3CX7 B;  4EYY R;  3FXE B;  4GYS A;  5HWY A;  2ZM8 A;  3LFM A;  3O1I A;  4QXC B;  3FZH B;  2Z6E A;  2LSK A;  5DQW A;  4UVB B;  2PFV A;  2JPF A;  3AA7 B;  4KX6 A;  2UXB T;  4LF8 T;  3VR8 A;  4JI3 T;  2LOP A;  3RKO A;  5HCJ A;  3QNU A;  3E0Z A;  3KV6 A;  2IC6 A;  5KMG P;  4A5X A;  2ODU A;  3PJA A;  4MHC A;  3FZL B;  5L3B B;  2W63 A;  3AVR A;  2XQ8 A;  3CPZ A;  5HXH A;  3PU8 A;  2Q9Q A;  3AED A;  1NAF A;  2XAQ B;  5JR9 B;  2E9X A;  4HFV A;  3UT5 E;  2BG9 E;  2PBI A;  2WBL A;  2J4G A;  4KI0 F;  5AQR B;  5LGU B;  5LJM A;  1QSD A;  4DO0 A;  3MA9 A;  5AFU L;  4HE8 A;  2H7V C;  5HEG A;  2V7K A;  2YEV C;  3C64 A;  2L9Q A;  3KDS E;  2J62 A;  1YKE B;  3KVA A;  3GA8 A;  5ABG A;  2G0U A;  2DCF A;  2JIW A;  4DR5 T;  1Z0P A;  1D1A A;  4X66 T;  2QRX A;  4CXX A;  3HKD E;  1HFA A;  4DR6 T;  1FEW A;  4ANJ A;  3EUH A;  3P4W A;  3RPU A;  4E7Z A;  3AAI A;  4MBQ A;  3Q2M A;  4DV2 T;  5ETW A;  2ES0 A;  2WSS V;  3UU5 A;  4PW8 A;  2V6Y B;  5LMN T;  1E7P A;  2NWB A;  2V6Y A;  3SOL A;  3CWZ B;  4X1K E;  3CK6 A;  3ONX A;  1LKX A;  1W09 A;  3J9X 1;  3IEE A;  4WZX A;  4JYA T;  1FMV A;  1T98 A;  3NVO A;  2X9H A;  3CQX C;  5HEU A;  1SA0 E;  3PUZ F;  3RI5 A;  3UFE A;  1BR0 A;  2FUP A;  5M4Y A;  1LVF A;  4B6X A;  4X65 T;  4QH4 A;  4X1Y E;  1Y01 A;  2EHO A;  3PUW F;  4AQG A;  2EHO B;  4Z91 A;  3AA0 B;  3QK6 A;  4EOZ B;  5L3D B;  3C50 A;  5LGT B;  4JI6 T;  2KWH A;  2H7O A;  3MAC A;  4TX5 A;  4EV6 A;  2PJQ A;  3CIR A;  4UF0 B;  1S35 A;  4YJ2 E;  4NUU A;  1WYC A;  2EHO C;  3HKC E;  4IT4 A;  4QXB B;  4YT0 A;  2W4X A;  2R6G F;  5J0Z A;  3FHN A;  3PUQ A;  4ZI2 C;  3O1J A;  5AQO B;  3NRX A;  4JV5 T;  4IE6 A;  4DID B;  2N9D A;  2AE9 A;  1W0A A;  1U4Q A;  3ZMZ B;  4OHF A;  2PG8 A;  5J2U E;  2V8S V;  4AKG A;  3Q5W A;  3VHL A;  3ZMS B;  2WMO A;  3AE4 A;  3PJA J;  4HWF A;  4YSY A;  2HH7 A;  5LHH B;  2WDQ A;  2X66 A;  3AEG A;  4Z90 A;  4BJN A;  2FJB A;  3GN5 A;  3GMI A;  2AXD S;  2QYW A;  3ETU A;  4OK0 A;  4WW0 A;  5FP3 A;  3V5S A;  4A97 A;  5EZY E;  4GKJ T;  3HA4 A;  3UUX B;  3AE6 A;  2WS3 A;  3WAK A;  3SS1 A;  4UR9 A;  1UGO A;  5HXR A;  4IST A;  4PFP A;  3ZJ1 A;  3ZCJ A;  2QA7 A;  1WFD A;  4IHJ E;  1KK7 A;  3CVR A;  2JQ9 A;  5F5W A;  4YLH A;  4JI1 T;  3RX6 A;  5HEJ A;  2CEA A;  2CA5 A;  5FXW A;  5JH7 E;  2CRB A;  5GON E;  2B76 A;  2BVL A;  3M65 A;  3RIF A;  1HNZ T;  1AJ3 A;  5KDM C;  5HXC A;  1UX4 A;  4O2B E;  2X51 A;  4I43 B;  4ZI7 E;  4ZI2 D;  2UUA T;  4GKK T;  2VL8 A;  5C8Y E;  2LRL A;  2YIN A;  1KEY A;  2WWV A;  5C3J A;  3ETV A;  3P8C D;  2K5B B;  2XZE A;  4G63 A;  4ZEY A;  4PFO A;  2XAG B;  2K48 A;  2C5I T;  2XQ3 A;  3UUL A;  1XDP A;  4IDQ A;  3ZT6 A;  3EAB A;  4DMW A;  2VQE T;  2VKD A;  2IHR 1;  4DR3 T;  2UXD T;  5LHG B;  2DWG A;  3Q5E A;  2HN1 A;  4K0U A;  4U33 A;  5EK2 A;  5L47 A;  2V5C A;  5KX5 E;  1HX8 A;  3P4Q A;  3SRZ A;  5F3J A;  4U72 A;  2CE7 A;  1FJG T;  3D0T A;  4DV7 T;  2H89 A;  5ABE A;  3TLV A;  2CBJ A;  4HWH A;  4DV5 T;  4CI3 B;  3PV0 F;  2VWA A;  3EAM A;  4CN6 A;  3DTO A;  3C4X A;  3UUB A;  1FMW A;  3OYZ A;  2XQ4 A;  2DNX A;  4TUY E;  3MKD A;  5DQV A;  3GN5 B;  1HCI A;  4GYR A;  3W15 B;  1HR0 T;  5AQV B;  3ZCI A;  1CHU A;  5FNV E;  2QGS A;  2E9X D;  3ZMT B; 
#chains in the Genus database with same CATH homology
 3RH3 A;  3CQC B;  3L3P A;  3T8O A;  3EVY A;  3PUR A;  4UV9 B;  3F31 A;  4P0B A;  3FB2 A;  1MMD A;  2W00 A;  5LJN A;  1G8X A;  4EYU A;  3AVS A;  3JC6 C;  2KND A;  3ZLI A;  1HTJ F;  5JDH A;  4O4I E;  3C51 A;  1MMA A;  5JDG A;  5TAO A;  4ZHQ E;  4AI6 A;  2LSG A;  4HGA A;  2Y6X A;  4WBN E;  4TZ4 C;  1UCU A;  3R6N A;  3UUM A;  3PUS A;  1HF8 A;  1H7C A;  3MJX A;  2D0U A;  4PNI A;  2JQQ A;  4DBR A;  4EXT A;  2MYS A;  5LHI B;  2W61 A;  5LBQ B;  2RA1 A;  2NW7 A;  2XUE A;  3ANW A;  1MIY A;  1OWA A;  5JRC B;  2V26 A;  2LHN A;  3R84 B;  1OXZ A;  3S4U A;  2N2N A;  4HTE A;  5LNK A;  3P7I A;  3RYF E;  3HL6 A;  3VU7 H;  5JDF A;  4PK6 A;  1WLX A;  3HI2 A;  4TV8 E;  3KFW X;  5ADX L;  4UF0 A;  3EDV A;  5EK4 A;  4UXN B;  2LE8 A;  4H9R C;  2YU2 A;  4H9P C;  5L3F B;  1MMN A;  4DVD A;  1MMG A;  4UEM A;  2YU1 A;  2X0L B;  2D0T A;  3KBT A;  3VKH A;  2MTQ A;  4HEA A;  5EK3 A;  5JDQ A;  1EZ3 A;  2IC9 A;  1LVK A;  2L8K A;  2X68 A;  2CWY A;  4KP3 C;  2SPC A;  4QHO A;  1QUU A;  2VKO A;  4A56 A;  5LGT B;  3ZYK A;  3QUJ A;  2V7I A;  3N2O A;  4KUM B;  4G2A A;  3AA1 B;  4IDZ A;  4UVA B;  1D1B A;  3CML A;  4X1I E;  2IW5 B;  3CQG B;  3LK2 B;  5LGN B;  3AB3 B;  3EDU A;  3I9Y A;  5J1G A;  2DHR A;  3GWH A;  3K3Q C;  4YJ3 E;  3PUG A;  3H37 A;  1FIO A;  2CWO A;  2VKH A;  4CXY A;  1BR1 A;  4GIW A;  4PK4 A;  1LRZ A;  2W62 A;  2KT9 A;  1WYB A;  3I0Q A;  1MND A;  2LSJ A;  2X9X A;  3KV4 A;  3BQK A;  4P09 A;  3LK3 B;  3PTR B;  2K24 A;  1ZEE A;  4UVC B;  1YD8 G;  5DJQ C;  5CA0 E;  4ILU A;  5L3E B;  2XAH B;  4IIJ E;  4E7S A;  3Q9D A;  4ZOL E;  4XBF B;  3L09 A;  4EAH A;  1B7T A;  4PJJ A;  3OBV E;  2Q9Q C;  4L9I A;  1IJ5 A;  5A1L A;  1MNE A;  2X67 A;  3KV5 A;  2GK9 A;  4I50 E;  2E8I A;  5JDM A;  4FJO A;  4MFR A;  2ZM0 A;  1D0X A;  2CXL A;  1BR4 A;  3ZPO A;  4HN9 A;  3IHR A;  4IE7 A;  2KZ7 B;  3B13 A;  3F2E A;  4L5G A;  5FXZ A;  5LBM A;  3I9W A;  1U5P A;  3SWH A;  3E22 E;  3J7Y q;  1CUN A;  2Q9Q B;  2KIN B;  2CM0 A;  2NW9 A;  4Z8X A;  1HS7 A;  3ZC0 A;  4XZC A;  3I1A A;  3ZYL A;  4ZI3 C;  2NW8 A;  3LBX B;  4YHJ A;  5J2T E;  3WAJ A;  2DWK A;  2IAK A;  2W0G A;  3BQL A;  4GOU A;  3RC8 A;  1BR2 A;  4M1P A;  4MAL A;  3O9X A;  3ZMV B;  1YW0 A;  5F8P A;  4U74 A;  5JRC A;  3ANW B;  2A72 A;  3HR0 A;  5H6Q B;  2LJL A;  3DP7 A;  4IE4 A;  3KBU A;  2JMH A;  1IAP A;  5CA1 E;  3KIN B;  1MIW A;  3JC6 D;  2YK0 A;  3E08 A;  3VKG A;  3PU3 A;  2V1D B;  2VAS A;  2C5K T;  2JJ9 A;  3ZC1 A;  5LYJ E;  3ZJ2 A;  2D5U A;  2CXF A;  4O4J E;  4ZI3 D;  4CI1 B;  3QC9 A;  2VK9 A;  4CQI A;  5L2L A;  1UX5 A;  4H9N C;  3MXZ A;  3N2K E;  3N9M A;  3MZK B;  5HYA A;  2NTY A;  4BAY B;  4EZH A;  2XTL A;  3K8P C;  3ESL A;  2ACX A;  5JR9 C;  3KV9 A;  2LM9 A;  3LG7 A;  5LOV E;  1ZKE A;  4ADZ A;  4AKI A;  2JMK A;  2LEH A;  4FI5 A;  4O8S A;  2XQY A;  4ERR A;  2K9A A;  4UEL A;  3V5U A;  3N5L A;  4CZZ B;  3OKQ A;  3N9Q A;  2CLY C;  4I4T E;  4CI2 B;  2JRK A;  4PJN A;  5H6R B;  5LXT E;  1WRD A;  1X79 A;  2V7M A;  3TKL B;  4DBQ A;  5FYM A;  1NWM X;  2NTX A;  4N78 D;  2LT3 A;  3C4W A;  3N2G E;  4ISS A;  3RC3 A;  2C5J A;  3CKD A;  4JEU B;  3IF8 B;  4O4H E;  5L3C B;  2MOZ A;  3RRW A;  2N1G A;  1ZHC A;  4EB6 E;  4IE0 A;  4MLK A;  4O4L E;  4AKH A;  2ZLY A;  2I59 A;  2A2F X;  4KMC A;  1V9D A;  3IBP A;  2NP9 A;  3OJA A;  4H63 H;  4WBO A;  2LSY A;  2LHR A;  3A5X A;  4YFS A;  4C90 A;  2CLY B;  4C91 A;  4JLE A;  1G73 A;  2WMN A;  3PDY A;  4OYJ A;  2CCQ A;  4UV8 B;  4EIW A;  5BMV E;  5FXX A;  2DLR A;  2WWU A;  3K3N A;  4IE5 A;  3N9O A;  4J2C A;  2KMF A;  4AQF C;  5CB4 E;  1D0Z A;  4I55 E;  2DI4 A;  3CX6 B;  4H63 V;  2Y8D A;  2VKJ A;  3HKB E;  3ZMU B;  5FY7 A;  4AXP A;  5HWX A;  2ODV A;  4UIG A;  2UXX B;  4XAX B;  3LJC A;  5E0O A;  4DND A;  3H3A A;  3DJB A;  1WR6 A;  3LK4 2;  4QX8 B;  4QWN B;  3ZYM A;  4TN7 B;  3N9L A;  4DMV A;  4BA9 A;  4ASK A;  1SHZ C;  2WAU A;  2ZMA A;  2KWI B;  3B57 A;  2CXD A;  4ANJ A;  5DAB A;  3NRY A;  4O2A E;  2Q9Q D;  5JDN A;  2LSI A;  4TV9 E;  3MK7 C;  2MBG A;  2E9X B;  4AQF A;  2HPL A;  3BQI A;  3N9N A;  2B1E A;  3AAE B;  4AKR B;  4BJM A;  2J1D G;  2E9X C;  2UXN B;  3UTK A;  5JRE A;  3HKE E;  2XAJ B;  2BDE A;  4ZS2 A;  1KNZ A;  4PJL A;  2X9W A;  3ZN1 B;  5L3G B;  3C4Z A;  3F57 A;  1Y64 B;  3OYX A;  3Q5X A;  3RYC E;  3C98 B;  2M67 A;  2V7J A;  3K3O A;  3O1H A;  3FBL A;  3ZMS B;  1HG2 A;  3UUN A;  1ZV4 X;  1D1C A;  2OA5 A;  4PJM A;  5IHY A;  2D2S A;  3RYH E;  5JDL A;  1O3X A;  2BZB A;  1US7 B;  2EHO D;  3U3I A;  4EZ4 A;  1IJ6 A;  4OYK A;  4KBM B;  3KVB A;  4JUY A;  2RP4 A;  3ZN0 B;  2C0S A;  3FXD B;  5LG4 A;  2H3R A;  4V1A v;  4X20 E;  2Y48 B;  2KXP B;  1YKH B;  5LA6 E;  5LCY A;  3WI3 A;  3I0O A;  3NZP A;  3O4X E;  3U78 A;  5JR9 A;  1E1H B;  4IGU A;  4OFZ A;  4HKA A;  5HXS A;  3N9P A;  3LBX A;  2X9Y A;  3NZQ A;  2V7L A;  4GK0 E;  2ZM2 A;  4NUV A;  2VB6 A;  4QKN A;  3AA6 B;  1D0Y A;  2HPJ A;  4H9O C;  4ZS3 A;  2NOX A;  3RYI E;  4AKL A;  2CMR A;  4QX7 B;  3BK9 A;  4PAG A;  4WNK A;  5FY1 A;  4L0R A;  4JEH B;  4F6R C;  2A3D A;  5FY0 A;  1IZN B;  5IYZ E;  1S94 A;  1VRB A;  3FBZ A;  2P9B A;  2XAS B;  4P0A A;  3AAA B;  2XAF B;  5JVD E;  3RRC A;  4GK5 E;  4PK5 A;  3ZEF B;  2XHE B;  3PE0 A;  1HG5 A;  5FMN A;  5FXV A;  5HXE A;  3NBX X;  5LP6 E;  3CX8 B;  1MIV A;  3PUA A;  4CXW A;  4H9S E;  5JQG E;  2L3L A;  4H9Q C;  2WM9 A;  2LOS A;  2KLQ A;  4QXH B;  5HAX A;  1VOM A;  2BVM A;  3CX7 B;  4EYY R;  3FXE B;  4GYS A;  5HWY A;  2ZM8 A;  3LFM A;  3O1I A;  4QXC B;  2Z6E A;  2LSK A;  5DQW A;  4UVB B;  2PFV A;  2JPF A;  3AA7 B;  2LOP A;  3RKO A;  3E0Z A;  3KV6 A;  2IC6 A;  5KMG P;  2ODU A;  4MHC A;  5L3B B;  2W63 A;  3AVR A;  3CPZ A;  5HXH A;  3PU8 A;  2Q9Q A;  1NAF A;  2XAQ B;  5JR9 B;  2E9X A;  4HFV A;  3UT5 E;  2PBI A;  2WBL A;  5LJM A;  1QSD A;  4DO0 A;  3MA9 A;  5AFU L;  4HE8 A;  2H7V C;  2V7K A;  2YEV C;  3C64 A;  2L9Q A;  3KDS E;  1YKE B;  3KVA A;  3GA8 A;  2G0U A;  2DCF A;  1Z0P A;  1D1A A;  4CXX A;  3HKD E;  1HFA A;  1FEW A;  3EUH A;  3RPU A;  4E7Z A;  3AAI A;  4MBQ A;  3Q2M A;  5ETW A;  2ES0 A;  2WSS V;  4PW8 A;  2NWB A;  3SOL A;  3CWZ B;  4X1K E;  3ONX A;  1LKX A;  3J9X 1;  3IEE A;  1FMV A;  1T98 A;  2X9H A;  3CQX C;  3UFE A;  1SA0 E;  1BR0 A;  5M4Y A;  1LVF A;  4B6X A;  4X1Y E;  2EHO A;  4AQG A;  2EHO B;  3AA0 B;  3QK6 A;  4EOZ B;  5L3D B;  3C50 A;  2KWH A;  2H7O A;  3MAC A;  4TX5 A;  2PJQ A;  4UF0 B;  1S35 A;  4YJ2 E;  4NUU A;  1WYC A;  2EHO C;  3HKC E;  4QXB B;  3FHN A;  3PUQ A;  4ZI2 C;  3O1J A;  3NRX A;  4IE6 A;  2N9D A;  1U4Q A;  3ZMZ B;  4OHF A;  2PG8 A;  5J2U E;  4AKG A;  3Q5W A;  3VHL A;  2WMO A;  2HH7 A;  5LHH B;  2X66 A;  4BJN A;  5FP3 A;  3GN5 A;  3GMI A;  3ETU A;  4OK0 A;  4WW0 A;  3V5S A;  5EZY E;  3HA4 A;  3UUX B;  3WAK A;  3SS1 A;  3ZJ1 A;  5HXR A;  4IST A;  4PFP A;  3ZCJ A;  2QA7 A;  4IHJ E;  1KK7 A;  3CVR A;  4YLH A;  3RX6 A;  2CEA A;  2CA5 A;  5FXW A;  5JH7 E;  5GON E;  2BVL A;  3M65 A;  1AJ3 A;  5KDM C;  5HXC A;  1UX4 A;  4O2B E;  2X51 A;  4I43 B;  4ZI7 E;  4ZI2 D;  2VL8 A;  5C8Y E;  2YIN A;  3ETV A;  3P8C D;  2K5B B;  4G63 A;  4PFO A;  2XAG B;  2K48 A;  2C5I T;  3UUL A;  4DMW A;  2VKD A;  5LHG B;  2DWG A;  4K0U A;  5EK2 A;  5KX5 E;  1HX8 A;  3SRZ A;  5F3J A;  4U72 A;  2CE7 A;  3D0T A;  4CI3 B;  2VWA A;  3DTO A;  3C4X A;  1FMW A;  3OYZ A;  4TUY E;  2DNX A;  5DQV A;  3MKD A;  3W15 B;  3GN5 B;  1HCI A;  4GYR A;  5LGU B;  3ZCI A;  5FNV E;  2QGS A;  2E9X D;  3ZMT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...