3E08A

H55s mutant xanthomonas campestris tryptophan 2,3-dioxygenase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
b'LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
molecule tags Oxidoreductase
source organism Xanthomonas campestris pv. campestris
publication title Histidine 55 of tryptophan 2,3-dioxygenase is not an active site base but regulates catalysis by controlling substrate binding
pubmed doi rcsb
total genus 108
structure length 280
sequence length 280
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3e08A00
2X68A 4PK6A 2V7IA 3BK9A 2X67A 2V7LA 2V7KA 2NOXA 5EK3A 2NWBA 2V7JA 1ZEEA 2D0TA 2NW8A 4HKAA 2NW7A 5EK4A 2D0UA 2NW9A 2V7MA 3E08A 5ETWA 2X66A 4PW8A 1YW0A 4U74A 4U72A 4PK5A 5EK2A
chains in the Genus database with same CATH superfamily
4HFCA 2N1GA 2P9BA 4PFOA 2BVLA 4DUYT 4PK6A 2CXDA 2V8SV 3RYHE 2LRKA 4TNWA 4C91A 1NEKA 3UU5A 4YT0A 2D2SA 3LSVA 4MFRA 1XDPA 2IUBA 5C8YE 4PJMA 3PUVF 4CN1A 4B6XA 4UELA 3SRZA 2JIWA 2WWVA 2KZ7B 4AQFA 4G63A 4ZI2C 5AQMB 4NXMT 1Z0PA 2BS2A 2ES0A 2LJLA 2WY2A 3FZKB 3MK7C 2WB5A 1WR6A 4FI5A 4M1PA 4ZS2A 4E7ZA 1W9RA 4ZI7E 3KV9A 5HEJA 5JR9B 3T1YT 2MOZA 1HG2A 2XASB 4CXYA 4UF0B 1MIWA 3CQCB 5F8PA 3A8YC 3FXEB 3UUNA 3KV4A 2CXLA 2CHNA 2XQAA 5BMVE 2R6GF 4LF9T 3DJBA 1UGOA 2V1DB 2NR4A 1D1AA 4IT4A 4ISTA 2NP9A 1W0BA 3AE7A 3Q5XA 4A98A 5EK2A 4YHJA 1UURA 2WCAA 4QX8B 3BK9A 2D9DA 4AQGA 3ZT5A 3FZLB 3CKDA 2CPTA 2QGSA 2JJ9A 3RYIE 1YQ3A 4EB6E 4B3MT 2LSYA 3LK2B 2VASA 4DMVA 5AQTB 1ZEEA 2RP4A 1E1HB 3R84B 3AA6B 3OVUA 3ZLIA 4AIUA 3NZQA 4CN4A 1E2AA 5CA1E 4XBFB 2XZEA 4IDNA 4HFDA 4CI1B 3LDQB 3GWHA 5JR9A 3KV6A 4BJNA 4QHOA 3O1HA 5LG3A 4JV5T 4TX5A 4U33A 2Y8DA 1IZNB 5AQNB 4I0UA 4EEBA 4EOZB 3MJXA 2Q9QB 2IHR1 4H9PC 3AE2A 4PW8A 5JREA 4CI3B 3O1JA 4TZ4C 4NIQA 4DV4T 3UU6A 2IIUA 2DL1A 2XHEB 3ZEFB 4KI0F 5KXJA 2V26A 4U7IA 5LJNA 5ABGA 1I6ZA 4MBQA 4IE7A 4TUYE 2LRLA 4COFA 1ZOYA 5JDFA 3C51A 3C98B 2I0MA 4FJOA 3RIUC 2KWHA 4YSYA 2DNXA 4YXDA 4AKIA 2CLYB 3I9YA 2VB6A 4A97A 5J2TE 3QB5A 5EK3A 4TV8E 4WW0A 3M65A 1ZV4X 3QB5K 1KNZA 3ZJ2A 2YU2A 4IHJE 1YXRA 4I55E 2D0TA 3QUJA 3N2OA 5L3BB 2NW7A 2VURA 3LK3B 3RIUA 2W66A 2JQ9A 2YKSA 2A2FX 1VRBA 4GYRA 3RLFF 5FL1A 4DBRA 2WU5A 1DU2A 1FEWA 4A56A 3N2GE 4IDPA 4X1KE 5JDHA 2V6YA 2Q9QA 5LHIB 1N33T 3LBXA 3RQWA 4LF4T 2WMOA 2WP9A 1D1CA 4ZI3D 2X9XA 2CWYA 4YJ2E 2YOEA 4WBOA 4B3RT 3EVYA 1MNEA 1M62A 3D0TA 3HKDE 4YTMA 5C2TA 4DR2T 1WLXA 5FVKA 5FY1A 5TAOA 2CM0A 4TWHA 2X67A 3K8PC 2XQ8A 3ZYMA 4ZOLE 2YEVC 3PE0A 3O1IA 3RIFA 4H9OC 4EYYR 5L2LA 3JC6C 2KLQA 2UUBT 4ANJA 3AB3B 2WDRA 3MA9A 4UVAB 2XTLA 5GONE 2X51A 2F4VT 1HX8A 2UXCT 1D0XA 2KNDA 4XZCA 1I94T 3RHWA 1ZHCA 2YDRA 3FZHB 2LEHA 3PU3A 3UQ4A 3ANWB 2YINA 5EZYE 2G0UA 2UXNB 2Y48B 3LG7A 3MKDA 4NUVA 2FBWA 5DABA 5FXVA 2IW5B 1WR0A 4O4HE 3UUXB 2E9XC 2W67A 4IREA 3ZC1A 4QXCB 4JUYA 2YU1A 1Z8UA 3PU8A 2VQET 4UXNB 2M67A 5ADXL 1HFAA 2W0GA 4O8SA 4AISA 3RC8A 2JQHA 3UU4A 1WFDA 3C4ZA 3ZMZB 2UXXB 3EAMA 4QH1A 2XAFB 1OXZA 2LSJA 5CFBA 2IC6A 4PAGA 1SA0E 3FB2A 1XDOA 3WAJA 3VKGA 4BA9A 2C5IT 2NWBA 5J1GA 2ZLYA 3ZCIA 3HA4A 4Q25A 5J2UE 3CX8B 3ABVA 3ONJA 3NRYA 3C64A 3PUSA 2I6HA 1J5WA 4HWIB 4ERRA 4DV2T 5ABFB 3VRAA 1UX5A 4MLKA 4I50E 5AQLB 2V5CA 2LSKA 4GOUA 3FBLA 3PUGA 2BBHA 2KMFA 2CWOA 2VKDA 3UT5E 2VKJA 4H63V 3B57A 2LT3A 3AE1A 4JEHB 3V5SA 3VR9A 5AQKB 4DV1T 2H88A 3BQIA 2GK9A 2W63A 3K3QC 3RH3A 3NKZA 2JMHA 4U72A 2BBJA 5IYZE 1XNRT 1BR0A 2AE9A 2LSIA 4OK0A 3AEFA 4IIJE 4PJLA 4OX9T 2A3DA 3UFGA 4BAYB 1JNZA 2ACZA 3P7IA 5FXWA 5FXZA 5LMUT 4AKHA 4AKGA 5L3EB 1X9BA 4L9IA 4EYUA 4JI0T 2MBGA 1XWMA 2H7OA 3ZSSA 2V7LA 1M7KA 3AA0B 2ZMAA 4GK5E 4P0BA 4JI6T 1G73A 4ILAA 2K9AA 2VL8A 3RPUA 5L3DB 2XQ6A 3UU3A 5IHYA 2HN1A 5LA6E 3ZPOA 2KSRA 2LOPA 3EUHA 3NBXX 2IAKA 1UUSA 2VK9A 4CXXA 5L4EA 4Z8XA 2LM9A 2LKGA 3MZKB 4U2YA 1O3XA 2I59A 2KT9A 3ZYKA 3JAFA 1KK7A 1WRDA 2K3WA 3FXDB 1KNPA 3QK6A 1S35A 1XZYA 1HNZT 3EI0A 4TNVA 3ZSTA 1AJ3A 1T7SA 3V5UA 4OYJA 4UV9B 4I4TE 4DIDB 3PURA 1MIVA 1U4QA 3AVRA 3OYZA 4YTPA 5L3GB 2W2UA 3A5XA 4YHHT 1WYCA 2HN2A 4UVBB 2QVAA 3KBUA 4KX6A 2HPJA 1L0VA 4UV8B 3ZMTB 3PTRB 5HXSA 3NWIA 3AVSA 4NUUA 4F8HA 4HEAA 2RA1A 5JRCB 1YQ4A 5FY0A 3AE5A 1WYBA 4OHFA 5FYMA 4ADZA 5L3CB 2HHHT 3UQ7A 2XQ4A 4Z91A 5HWXA 4ILCA 3AE6A 5HXCA 5A1LA 1G8XA 5L3FB 1OEDB 3Q5WA 2BG9B 2H89A 5LGTB 4EGWA 1N34T 4KP3C 4N78D 4KHPT 4AQFC 2EHOB 5HEOA 3HI2A 2XQYA 2WZIA 2LM2A 1E7PA 3ETUA 3JCFA 2B1EA 2EHOA 2MYSA 1US7B 5KDMC 2J62A 1QUUA 5ETWA 4WYVA 3SWHA 3TLSA 5LCYA 4DR3T 3L8RA 5AQQB 4GYSA 2WDQA 4HWCA 4Z90A 3RIAA 3ZMVB 4HGAA 3VR8A 2LSGA 4DUZT 3GMIA 3F31A 2FJDA 3ZCJA 4E7SA 4OYKA 2UU9T 4XAXB 5LOVE 3OKQA 3PUWF 1JNRA 2LHRA 3CX6B 1V9DA 1KEYA 2PG8A 3PV0F 1GQEA 4IL9A 1R8IA 5JDNA 4ZZBA 3OJAA 3RC3A 2J1DG 3CMLA 2V7IA 1J5ET 1LVFA 4U31A 3P50A 2YN6A 3AEBA 4U2ZA 5AQPB 4HWFA 3P8CD 2E9XD 4H9RC 4J2CA 3RKGA 3JADA 4DV0T 2XQ9A 3KV5A 3P4RA 3B5MA 4C90A 4ZI2D 4CI2B 5IWAT 5LYJE 3BQKA 4LF7T 5CA0E 4DMWA 2H7VC 5AQSB 1XMOT 1UK5A 5LP6E 4O2AE 5AFUL 3ONXA 4IE4A 3K3NA 2DHRA 3OTOT 2PTFA 2CBJA 3RQUA 1KF6A 4ASKA 4CXWA 4JI4T 4ISSA 3AE4A 1HCIA 3BQLA 4GIWA 2C5KT 4QXHB 5LJMA 4X64T 4QWNB 3T1HT 1UX4A 2BG9C 1OWAA 3UFEA 3N9OA 3K3OA 3ESLA 5AQVB 3JAEA 5C3JA 5FY7A 2WQYA 4L0RA 3UU8A 4DR6T 1S94A 4QX7B 2X0YA 3C50A 4PNIA 4QH4A 2CEAA 3FZMB 2ZM2A 2Q9QC 1MMAA 2XSAA 2BS4A 3ZMUB 2FJEA 2VKOA 4QH5A 4GKKT 3R6NA 2CCQA 1U5PA 5DQWA 4YLHA 5AQOB 3G06A 5FL0A 4WBNE 3ZN0B 1LRZA 2B76A 3KINB 1IBLT 4HFHA 3I0QA 5EK4A 4YTNA 2D0UA 2PJQA 5HAXA 4P1NA 4O4LE 2KWIB 2XQ7A 5LBMA 4HN9A 3DP7A 2V5DA 4DR5T 2ZM8A 1OEDC 4UVCB 4DV6T 3IBPA 2W4XA 3N5LA 2JMKA 3N9NA 1HTJF 3HKEE 1KFYA 3KFWX 5HCMA 3AAIA 3ZMSB 2BG9E 5HXHA 1D0ZA 4GK0E 4KBMB 4KMCA 5E0OA 5L47A 2YDQA 2XJ7A 3Q2MA 2PBIA 4JI2T 3SFDA 4CN6A 1W0AA 1D1BA 2E9XA 4EZHA 4AKRB 1T98A 3FZFB 4PJJA 4TN7B 4X66T 2WBLA 4NXNT 4DR4T 1BR2A 1NAFA 2L9QA 1LVKA 4K0UA 3PUXF 5FKYA 5AQGB 2NW8A 4ZI3C 2WM9A 4HFEA 4B3ST 3PJAA 4TWDA 2Z6EA 2DCFA 3LK42 2Q9QD 2XPKA 4O4JE 4P0AA 2BZBA 1WCRA 3VHLA 1OEDE 4I43B 2V6XA 1NENA 1YD8G 4HFIA 5FP3A 3E08A 4BJMA 4YY3T 3H3MA 2W61A 3RX6A 5CJ5A 1MMGA 4TWFA 2K48A 5CGMA 4A5XA 3EHZA 3PDYA 2KXPB 3AE3A 2DLRA 2FJAA 3AECA 3KVAA 4JBWF 3AE9A 2JPFA 3ETVA 2LKHA 4UEMA 3TLUA 5LBQB 3TLTA 3RF1A 3P4QA 4PK5A 4IDOA 1SHZC 4HFVA 1Y01A 2DI4A 2FJBA 2J47A 3CK6A 1CHUA 3EDUA 4JLEA 4LFBT 2AXDS 2MTQA 3C4XA 2VVNA 1HNXT 1T72A 2JRKA 3PUYF 5LGUB 4B3TT 3ZC0A 2ODVA 2N2NA 2CE7A 1X79A 3U3IA 5JR9C 2H3RA 1LKXA 3AEGA 3EDVA 3CIRA 1Y64B 3NVOA 3PUAA 4IL4A 1FIOA 3ZKRA 5ABHA 3IHRA 4ZEYA 5KX5E 4JI8T 4MALA 4TV9E 2YDSA 4QKNA 3AEEA 4O4IE 3ZYLA 3B13A 2NTXA 3H37A 5JTGA 1J1JA 3P4SA 2KINB 2LOSA 1BR4A 4DV7T 4LF6T 5AQIB 3M3ZB 3QNUA 5FNVE 3W15B 1YW0A 4ZHQE 5JRCA 2UXBT 5AQJB 5LGNB 1VCSA 4PK4A 2IMLA 2WU2A 1IJ5A 2XAHB 4EAHA 2D5UA 3E0ZA 3NZPA 5AQHB 5JDLA 3C4WA 4JYAT 3ZT7A 3N9QA 1UCUA 3K1SA 1HF8A 2WS3A 4U7YA 5LNKA 3CX7B 2CXFA 2E5VA 4YSXA 3S4UA 3AXJB 4HWHA 4U3CA 4DNDA 1QSDA 2UXDT 5DJQC 2QRXA 3O4XE 4HFBA 2VQFT 2K24A 2BS3A 3DTOA 3MACA 3L39A 4ILUA 5HXEA 4X20E 2PFVA 3MXZA 1NWMX 1ZKEA 1VOMA 2HPLA 5HYAA 2WMNA 1T8BA 5HEUA 3RKOA 1HX1B 4DV5T 2A9UA 2WWUA 3F2EA 4ILBA 2Y6XA 2WAUA 2WZHA 3EABA 4G2AA 2XM2A 2OLTA 3OYXA 4KUMB 5AQFB 4AI6A 3N9PA 3RRWA 3SS1A 4JI3T 3Q5EA 1SUMB 3HKCE 2XSBA 2WSSV 5HEGA 1SE7A 3T8OA 3LJCA 3ZN1B 5HXRA 5JQGE 4LF5T 1QLBA 4P09A 2V7KA 5L4HA 2C5JA 3N2KE 2NTYA 4LMLA 2X0LB 4X1YE 4CQIA 5KMGP 4H9QC 3TKLB 4AXPA 4LMJA 2XAJB 2LE8A 3SFEA 4EEDA 3UUBA 2ZM6T 2IDOB 3O9XA 4YFSA 4V1Av 2E5LT 1XNQT 5HEHA 3I0OA 4YSZA 2XAGB 5JDMA 4UF0A 1YKEB 2V7MA 3CVRA 4X1IE 5LHGB 4X62T 1HR0T 3J7Yq 3OPCA 4PJNA 2OA5A 2OV9A 4LFCT 1YKHB 3IEEA 1FJGT 4MHCA 4DO0A 4K0KT 3FHNA 4NPPA 2DWGA 1OEDA 2JQQA 2QA7A 2EHOC 5JH7E 4UIGA 3FBZA 2CLYC 4HTEA 1HG5A 2CRBA 2ODUA 1W09A 5M4YA 5IUXA 3J9X1 3AE8A 4HWDA 3P4PA 4EZ4A 2NOXA 2XM1A 4CZZB 3WAKA 5LMNT 4LFAT 2BKPA 1HNWT 3Q9DA 2V7JA 4GKJT 2MAWA 2L3LA 3P4WA 2ACXA 1FMVA 2WDVA 5ABEA 3VU7H 4ZZCA 4JI7T 2MPKA 3GA8A 3L09A 4L5GA 3F57A 4IE0A 4DVDA 1IAPA 3RYCE 3RGLA 2UUAT 5HCJA 5FMNA 4H9NC 5LHHB 2UUCT 2L8KA 2N9DA 3CPZA 3X1DA 5JDQA 3KDSE 1MNDA 3KVBA 4H63H 5AQUB 3UUMA 3GN5A 3N9MA 3VRBA 2JQKA 3OBVE 2X0HA 2K5BB 5H6QB 4DV3T 2BG9A 3NRXA 1D0YA 2J4GA 3I9WA 4AKLA 4EV6A 5LXTE 4O2BE 3SOLA 1N36T 3LBXB 3VKHA 2DWKA 3CQXC 1MMDA 2V6YB 2XQ5A 3JC6D 4DBQA 3L3PA 4JI5T 1IBKT 1N32T 1HS7A 5JVDE 3N9LA 2VVSA 4QXBB 5JDGA 3RRCA 2SPCA 4X5TA 4H9SE 3KBTA 2XAQB 3ANWA 2CHOA 4DR1T 2XY8B 3PUZF 3LFMA 3WI3A 1B7TA 3AA1B 3I1AA 3ZT6A 2X9HA 4OFZA 4ZXLA 2X66A 2QYWA 3IA3A 5DQVA 4PFPA 4F6RC 3AAAB 2LLYA 4EXTA 5LG4A 4U74A 4AQYT 2E2AA 3IF8B 3UTKA 5F5WA 3HKBE 2IC9A 2X9WA 4ZS3A 3RI5A 1MMNA 1EZ3A 2EHOD 3AEDA 3Q5DA 3AAEB 4IE6A 4WZXA 5ABFA 2XQ3A 2X68A 5H6RB 5LB7B 2E9XB 3ONLC 3A7MA 2BDEA 3TLWA 3UULA 5BR8T 2YK0A 2LHNA 3PJAJ 2X9YA 1IBMT 3CWZB 5CB4E 2W00A 2CBIA 1KNRA 4IDQA 2FUPA 3HR0A 2M6IA 2E8IA 3GN5B 4IE5A 4DR7T 2BKNA 4WNKA 4EIWA 4JI1T 4IDZA 3AA7B 4UR9A 2VWAA 3AEAA 2HH7A 4HKAA 2BVMA 5HWYA 2CA5A 1ZP0A 3H3AA 3RYFE 4IGUA 1CUNA 3U78A 4X65T 2BKOA 5FVLA 3ZJ1A 2RPAA 1H7CA 1VCTA 4LF8T 1BR1A 3AXJA 2NW9A 2CMRA 1FMWA 3QC9A 4HE8A 2A72A 2W62A 4JEUB 3PUQA 2XUEA 3TLVA 2ZM0A 5F3JA 2VKHA 3QOFA 5FXXA 3CQGB 5AQRB 2C0SA 3E22E 4YJ3E 1IJ6A 1MIYA 2M6BA 1XMQT 4LMKA 4KHZF 2VL0A 5J0ZA 3HL6A
chains in the Genus database with same CATH topology
4PFOA 2N1GA 2P9BA 2BVLA 4PK6A 2CXDA 3RYHE 4C91A 2D2SA 4MFRA 5C8YE 4PJMA 4B6XA 4UELA 3SRZA 4ZI2C 2KZ7B 4AQFA 4G63A 1Z0PA 2ES0A 3MK7C 2LJLA 4Z8XA 4FI5A 4M1PA 4E7ZA 1WR6A 4ZS2A 4ZI7E 5JR9B 3KV9A 2MOZA 1HG2A 2XASB 4CXYA 4UF0B 1MIWA 3CQCB 5F8PA 3FXEB 3UUNA 3KV4A 2CXLA 5BMVE 3DJBA 2V1DB 4ISTA 1D1AA 2NP9A 3Q5XA 5EK2A 4YHJA 4QX8B 3BK9A 4AQGA 3CKDA 2QGSA 2JJ9A 3RYIE 4EB6E 2LSYA 3LK2B 2VASA 4DMVA 1ZEEA 2RP4A 1E1HB 3R84B 3AA6B 3ZLIA 5CA1E 4XBFB 3NZQA 4CI1B 3GWHA 5JR9A 3KV6A 4BJNA 4QHOA 3O1HA 4TX5A 2Y8DA 1IZNB 4EOZB 5JREA 3MJXA 2Q9QB 4H9PC 4PW8A 4CI3B 3O1JA 4TZ4C 2XHEB 3ZEFB 2V26A 5LJNA 4MBQA 4IE7A 4TUYE 5JDFA 3C51A 3C98B 4FJOA 4AKIA 2KWHA 2DNXA 2CLYB 3I9YA 2VB6A 5J2TE 5EK3A 4TV8E 4WW0A 3M65A 1ZV4X 1KNZA 3ZJ2A 2YU2A 4IHJE 4I55E 2D0TA 3QUJA 3N2OA 5L3BB 2NW7A 3LK3B 4GYRA 2A2FX 1VRBA 4DBRA 1FEWA 4A56A 3N2GE 4X1KE 5JDHA 2Q9QA 5LHIB 3LBXA 2WMOA 1D1CA 4ZI3D 2X9XA 2CWYA 4YJ2E 4WBOA 3EVYA 1MNEA 3HKDE 3D0TA 1WLXA 5FY1A 5TAOA 2CM0A 3ZYMA 2X67A 3K8PC 4ZOLE 2YEVC 3PE0A 3O1IA 4EYYR 4H9OC 5L2LA 3JC6C 2KLQA 4ANJA 3AB3B 3MA9A 4UVAB 2XTLA 5GONE 2X51A 1HX8A 1D0XA 2KNDA 4XZCA 1ZHCA 2LEHA 3PU3A 3ANWB 2YINA 5EZYE 2G0UA 2UXNB 2Y48B 3LG7A 3MKDA 4NUVA 5DABA 5FXVA 2IW5B 3ZC1A 4O4HE 3UUXB 2E9XC 4QXCB 4JUYA 2YU1A 3PU8A 4UXNB 2M67A 5ADXL 1HFAA 2W0GA 4O8SA 3RC8A 3C4ZA 3ZMZB 2UXXB 2XAFB 1OXZA 2LSJA 2IC6A 4PAGA 1SA0E 3FB2A 3VKGA 3WAJA 4BA9A 2C5IT 2NWBA 5J1GA 2ZLYA 3ZCIA 3HA4A 5J2UE 3CX8B 3NRYA 3C64A 3PUSA 4ERRA 1UX5A 4MLKA 4I50E 4GOUA 2LSKA 3FBLA 3PUGA 2KMFA 2CWOA 2VKDA 3UT5E 2VKJA 4H63V 3B57A 2LT3A 4JEHB 3V5SA 3BQIA 2GK9A 2W63A 3K3QC 3RH3A 2JMHA 4U72A 1BR0A 5IYZE 2LSIA 4OK0A 4IIJE 4PJLA 2A3DA 4BAYB 3P7IA 5FXWA 5FXZA 4AKGA 4AKHA 5L3EB 4L9IA 4EYUA 2MBGA 2H7OA 2V7LA 3AA0B 2ZMAA 4GK5E 4P0BA 1G73A 2K9AA 2VL8A 3RPUA 5L3DB 5IHYA 5LA6E 3ZPOA 2LOPA 3EUHA 3NBXX 2IAKA 2VK9A 4CXXA 2LM9A 3MZKB 1O3XA 2I59A 2KT9A 3ZYKA 1KK7A 1WRDA 3FXDB 3QK6A 1S35A 1AJ3A 3V5UA 4OYJA 4UV9B 4I4TE 3PURA 1MIVA 1U4QA 3AVRA 3OYZA 5L3GB 3A5XA 1WYCA 4UVBB 3ZMTB 3KBUA 2HPJA 4UV8B 3PTRB 5HXSA 3AVSA 4NUUA 4HEAA 2RA1A 5JRCB 5FY0A 4OHFA 1WYBA 5FYMA 4ADZA 5L3CB 5HWXA 5L3FB 5HXCA 5A1LA 1G8XA 3Q5WA 5LGTB 4KP3C 4N78D 4AQFC 2EHOB 3HI2A 2XQYA 3ETUA 5KDMC 2B1EA 2EHOA 2MYSA 1US7B 5ETWA 1QUUA 3SWHA 5LCYA 4GYSA 3ZMVB 4HGAA 2LSGA 3GMIA 3F31A 4E7SA 3ZCJA 4OYKA 4XAXB 5LOVE 3OKQA 2LHRA 3CX6B 1V9DA 2PG8A 5JDNA 3OJAA 3RC3A 2J1DG 3CMLA 2V7IA 1LVFA 3P8CD 2E9XD 4H9RC 4J2CA 3KV5A 4C90A 4ZI2D 4CI2B 5LYJE 3BQKA 5CA0E 4DMWA 2H7VC 5LP6E 4O2AE 5AFUL 3ONXA 4IE4A 3K3NA 2DHRA 4ASKA 4CXWA 4ISSA 1HCIA 3BQLA 4GIWA 2C5KT 4QXHB 5LJMA 4QWNB 1UX4A 1OWAA 3UFEA 3N9OA 3K3OA 3ESLA 5FY7A 4L0RA 1S94A 4QX7B 4PNIA 3C50A 2CEAA 2ZM2A 2Q9QC 1MMAA 3ZMUB 2VKOA 3R6NA 2CCQA 1U5PA 5DQWA 4YLHA 4WBNE 3ZN0B 1LRZA 3KINB 3I0QA 5EK4A 2D0UA 2PJQA 5HAXA 4O4LE 2KWIB 5LBMA 4HN9A 3DP7A 2ZM8A 4UVCB 3IBPA 3N5LA 2JMKA 3N9NA 1HTJF 3HKEE 3KFWX 3AAIA 3ZMSB 5HXHA 1D0ZA 4GK0E 4KBMB 4KMCA 5E0OA 3Q2MA 2PBIA 4EZHA 2E9XA 1D1BA 4AKRB 1T98A 4PJJA 4TN7B 2WBLA 1BR2A 1NAFA 2L9QA 1LVKA 4K0UA 2NW8A 4ZI3C 2WM9A 2Z6EA 2DCFA 3LK42 2Q9QD 4O4JE 4P0AA 2BZBA 3VHLA 4AKLA 4I43B 4BJMA 1YD8G 5FP3A 3E08A 3RX6A 2W61A 1MMGA 2K48A 3PDYA 2KXPB 2DLRA 5HXEA 3KVAA 2JPFA 3ETVA 4UEMA 5LBQB 4PK5A 1SHZC 4HFVA 2DI4A 3EDUA 4JLEA 2MTQA 3C4XA 2JRKA 5LGUB 3ZC0A 2ODVA 2N2NA 2CE7A 1X79A 3U3IA 5JR9C 2H3RA 1LKXA 3EDVA 3PUAA 1Y64B 5LXTE 1FIOA 5KX5E 3IHRA 4MALA 4TV9E 4QKNA 4O4IE 3ZYLA 3B13A 2NTXA 3H37A 2KINB 2LOSA 1BR4A 5FNVE 3W15B 1YW0A 4ZHQE 5JRCA 5LGNB 4PK4A 2XAHB 1IJ5A 4EAHA 2D5UA 3E0ZA 3NZPA 5JDLA 3C4WA 3N9QA 1UCUA 1HF8A 5LNKA 3CX7B 2CXFA 3S4UA 4DNDA 1QSDA 5DJQC 3O4XE 2K24A 3DTOA 3MACA 4ILUA 4X20E 2PFVA 3MXZA 1ZKEA 1NWMX 1VOMA 2HPLA 5HYAA 2WMNA 3RKOA 2WWUA 3F2EA 2Y6XA 2WAUA 4G2AA 3OYXA 4KUMB 4AI6A 3N9PA 3RRWA 3SS1A 3HKCE 3T8OA 2WSSV 3LJCA 3ZN1B 5HXRA 5JQGE 4P09A 2V7KA 4CQIA 2C5JA 3N2KE 2NTYA 4X1YE 2X0LB 5KMGP 4H9QC 3TKLB 4AXPA 2XAJB 2LE8A 3O9XA 4YFSA 4V1Av 3I0OA 2XAGB 5JDMA 4UF0A 1YKEB 2V7MA 3CVRA 4X1IE 5LHGB 3J7Yq 4PJNA 2OA5A 1YKHB 3IEEA 4MHCA 4DO0A 3FHNA 2DWGA 2JQQA 2QA7A 5JH7E 2EHOC 4UIGA 3FBZA 2CLYC 4HTEA 1HG5A 2ODUA 5M4YA 3J9X1 4EZ4A 2NOXA 4CZZB 3WAKA 3Q9DA 2V7JA 2L3LA 2ACXA 1FMVA 3VU7H 3GA8A 3L09A 4L5GA 3F57A 4IE0A 1IAPA 3RYCE 5FMNA 4H9NC 5LHHB 2L8KA 2N9DA 3CPZA 5JDQA 3KDSE 1MNDA 3KVBA 4H63H 3UUMA 3GN5A 3N9MA 3OBVE 2K5BB 5H6QB 3NRXA 1D0YA 3I9WA 4O2BE 3SOLA 3LBXB 3VKHA 2DWKA 3CQXC 1MMDA 4DBQA 3JC6D 1HS7A 3L3PA 5JVDE 3N9LA 4QXBB 5JDGA 2SPCA 4H9SE 3KBTA 2XAQB 3ANWA 3LFMA 3WI3A 1B7TA 3AA1B 3I1AA 2X9HA 4OFZA 2X66A 5DQVA 4PFPA 4F6RC 3AAAB 4EXTA 5LG4A 4U74A 3IF8B 3UTKA 3HKBE 2IC9A 2X9WA 4ZS3A 1MMNA 1EZ3A 2EHOD 4IE6A 3AAEB 5H6RB 2X68A 2E9XB 2BDEA 3UULA 2YK0A 2LHNA 2X9YA 3CWZB 5CB4E 2W00A 3HR0A 2E8IA 3GN5B 4IE5A 4WNKA 4EIWA 4IDZA 3AA7B 5HWYA 2VWAA 3RRCA 2HH7A 4HKAA 2BVMA 4DVDA 2CA5A 3H3AA 3RYFE 4IGUA 1CUNA 3U78A 3ZJ1A 1H7CA 1BR1A 2NW9A 2CMRA 1FMWA 3QC9A 4HE8A 2A72A 2W62A 4JEUB 3PUQA 2XUEA 2ZM0A 5F3JA 2VKHA 5FXXA 3CQGB 2C0SA 3E22E 4YJ3E 1IJ6A 1MIYA 3HL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X68 A;  4PK6 A;  2V7I A;  3BK9 A;  2X67 A;  2V7L A;  2V7K A;  2NOX A;  5EK3 A;  2NWB A;  2V7J A;  1ZEE A;  2D0T A;  2NW8 A;  4HKA A;  2NW7 A;  5EK4 A;  2D0U A;  2NW9 A;  2V7M A;  3E08 A;  5ETW A;  2X66 A;  4PW8 A;  1YW0 A;  4U74 A;  4U72 A;  4PK5 A;  5EK2 A; 
#chains in the Genus database with same CATH topology
 4HFC A;  2N1G A;  2P9B A;  4PFO A;  2BVL A;  4DUY T;  4PK6 A;  2CXD A;  2V8S V;  3RYH E;  2LRK A;  4TNW A;  4C91 A;  1NEK A;  3UU5 A;  4YT0 A;  2D2S A;  3LSV A;  4MFR A;  1XDP A;  2IUB A;  5C8Y E;  4PJM A;  3PUV F;  4CN1 A;  4B6X A;  4UEL A;  3SRZ A;  2JIW A;  2WWV A;  2KZ7 B;  4AQF A;  4G63 A;  4ZI2 C;  5AQM B;  4NXM T;  1Z0P A;  2BS2 A;  2ES0 A;  2LJL A;  2WY2 A;  3FZK B;  3MK7 C;  2WB5 A;  1WR6 A;  4FI5 A;  4M1P A;  4ZS2 A;  4E7Z A;  1W9R A;  4ZI7 E;  3KV9 A;  5HEJ A;  5JR9 B;  3T1Y T;  2MOZ A;  1HG2 A;  2XAS B;  4CXY A;  4UF0 B;  1MIW A;  3CQC B;  5F8P A;  3A8Y C;  3FXE B;  3UUN A;  3KV4 A;  2CXL A;  2CHN A;  2XQA A;  5BMV E;  2R6G F;  4LF9 T;  3DJB A;  1UGO A;  2V1D B;  2NR4 A;  1D1A A;  4IT4 A;  4IST A;  2NP9 A;  1W0B A;  3AE7 A;  3Q5X A;  4A98 A;  5EK2 A;  4YHJ A;  1UUR A;  2WCA A;  4QX8 B;  3BK9 A;  2D9D A;  4AQG A;  3ZT5 A;  3FZL B;  3CKD A;  2CPT A;  2QGS A;  2JJ9 A;  3RYI E;  1YQ3 A;  4EB6 E;  4B3M T;  2LSY A;  3LK2 B;  2VAS A;  4DMV A;  5AQT B;  1ZEE A;  2RP4 A;  1E1H B;  3R84 B;  3AA6 B;  3OVU A;  3ZLI A;  4AIU A;  3NZQ A;  4CN4 A;  1E2A A;  5CA1 E;  4XBF B;  2XZE A;  4IDN A;  4HFD A;  4CI1 B;  3LDQ B;  3GWH A;  5JR9 A;  3KV6 A;  4BJN A;  4QHO A;  3O1H A;  5LG3 A;  4JV5 T;  4TX5 A;  4U33 A;  2Y8D A;  1IZN B;  5AQN B;  4I0U A;  4EEB A;  4EOZ B;  3MJX A;  2Q9Q B;  2IHR 1;  4H9P C;  3AE2 A;  4PW8 A;  5JRE A;  4CI3 B;  3O1J A;  4TZ4 C;  4NIQ A;  4DV4 T;  3UU6 A;  2IIU A;  2DL1 A;  2XHE B;  3ZEF B;  4KI0 F;  5KXJ A;  2V26 A;  4U7I A;  5LJN A;  5ABG A;  1I6Z A;  4MBQ A;  4IE7 A;  4TUY E;  2LRL A;  4COF A;  1ZOY A;  5JDF A;  3C51 A;  3C98 B;  2I0M A;  4FJO A;  3RIU C;  2KWH A;  4YSY A;  2DNX A;  4YXD A;  4AKI A;  2CLY B;  3I9Y A;  2VB6 A;  4A97 A;  5J2T E;  3QB5 A;  5EK3 A;  4TV8 E;  4WW0 A;  3M65 A;  1ZV4 X;  3QB5 K;  1KNZ A;  3ZJ2 A;  2YU2 A;  4IHJ E;  1YXR A;  4I55 E;  2D0T A;  3QUJ A;  3N2O A;  5L3B B;  2NW7 A;  2VUR A;  3LK3 B;  3RIU A;  2W66 A;  2JQ9 A;  2YKS A;  2A2F X;  1VRB A;  4GYR A;  3RLF F;  5FL1 A;  4DBR A;  2WU5 A;  1DU2 A;  1FEW A;  4A56 A;  3N2G E;  4IDP A;  4X1K E;  5JDH A;  2V6Y A;  2Q9Q A;  5LHI B;  1N33 T;  3LBX A;  3RQW A;  4LF4 T;  2WMO A;  2WP9 A;  1D1C A;  4ZI3 D;  2X9X A;  2CWY A;  4YJ2 E;  2YOE A;  4WBO A;  4B3R T;  3EVY A;  1MNE A;  1M62 A;  3D0T A;  3HKD E;  4YTM A;  5C2T A;  4DR2 T;  1WLX A;  5FVK A;  5FY1 A;  5TAO A;  2CM0 A;  4TWH A;  2X67 A;  3K8P C;  2XQ8 A;  3ZYM A;  4ZOL E;  2YEV C;  3PE0 A;  3O1I A;  3RIF A;  4H9O C;  4EYY R;  5L2L A;  3JC6 C;  2KLQ A;  2UUB T;  4ANJ A;  3AB3 B;  2WDR A;  3MA9 A;  4UVA B;  2XTL A;  5GON E;  2X51 A;  2F4V T;  1HX8 A;  2UXC T;  1D0X A;  2KND A;  4XZC A;  1I94 T;  3RHW A;  1ZHC A;  2YDR A;  3FZH B;  2LEH A;  3PU3 A;  3UQ4 A;  3ANW B;  2YIN A;  5EZY E;  2G0U A;  2UXN B;  2Y48 B;  3LG7 A;  3MKD A;  4NUV A;  2FBW A;  5DAB A;  5FXV A;  2IW5 B;  1WR0 A;  4O4H E;  3UUX B;  2E9X C;  2W67 A;  4IRE A;  3ZC1 A;  4QXC B;  4JUY A;  2YU1 A;  1Z8U A;  3PU8 A;  2VQE T;  4UXN B;  2M67 A;  5ADX L;  1HFA A;  2W0G A;  4O8S A;  4AIS A;  3RC8 A;  2JQH A;  3UU4 A;  1WFD A;  3C4Z A;  3ZMZ B;  2UXX B;  3EAM A;  4QH1 A;  2XAF B;  1OXZ A;  2LSJ A;  5CFB A;  2IC6 A;  4PAG A;  1SA0 E;  3FB2 A;  1XDO A;  3WAJ A;  3VKG A;  4BA9 A;  2C5I T;  2NWB A;  5J1G A;  2ZLY A;  3ZCI A;  3HA4 A;  4Q25 A;  5J2U E;  3CX8 B;  3ABV A;  3ONJ A;  3NRY A;  3C64 A;  3PUS A;  2I6H A;  1J5W A;  4HWI B;  4ERR A;  4DV2 T;  5ABF B;  3VRA A;  1UX5 A;  4MLK A;  4I50 E;  5AQL B;  2V5C A;  2LSK A;  4GOU A;  3FBL A;  3PUG A;  2BBH A;  2KMF A;  2CWO A;  2VKD A;  3UT5 E;  2VKJ A;  4H63 V;  3B57 A;  2LT3 A;  3AE1 A;  4JEH B;  3V5S A;  3VR9 A;  5AQK B;  4DV1 T;  2H88 A;  3BQI A;  2GK9 A;  2W63 A;  3K3Q C;  3RH3 A;  3NKZ A;  2JMH A;  4U72 A;  2BBJ A;  5IYZ E;  1XNR T;  1BR0 A;  2AE9 A;  2LSI A;  4OK0 A;  3AEF A;  4IIJ E;  4PJL A;  4OX9 T;  2A3D A;  3UFG A;  4BAY B;  1JNZ A;  2ACZ A;  3P7I A;  5FXW A;  5FXZ A;  5LMU T;  4AKH A;  4AKG A;  5L3E B;  1X9B A;  4L9I A;  4EYU A;  4JI0 T;  2MBG A;  1XWM A;  2H7O A;  3ZSS A;  2V7L A;  1M7K A;  3AA0 B;  2ZMA A;  4GK5 E;  4P0B A;  4JI6 T;  1G73 A;  4ILA A;  2K9A A;  2VL8 A;  3RPU A;  5L3D B;  2XQ6 A;  3UU3 A;  5IHY A;  2HN1 A;  5LA6 E;  3ZPO A;  2KSR A;  2LOP A;  3EUH A;  3NBX X;  2IAK A;  1UUS A;  2VK9 A;  4CXX A;  5L4E A;  4Z8X A;  2LM9 A;  2LKG A;  3MZK B;  4U2Y A;  1O3X A;  2I59 A;  2KT9 A;  3ZYK A;  3JAF A;  1KK7 A;  1WRD A;  2K3W A;  3FXD B;  1KNP A;  3QK6 A;  1S35 A;  1XZY A;  1HNZ T;  3EI0 A;  4TNV A;  3ZST A;  1AJ3 A;  1T7S A;  3V5U A;  4OYJ A;  4UV9 B;  4I4T E;  4DID B;  3PUR A;  1MIV A;  1U4Q A;  3AVR A;  3OYZ A;  4YTP A;  5L3G B;  2W2U A;  3A5X A;  4YHH T;  1WYC A;  2HN2 A;  4UVB B;  2QVA A;  3KBU A;  4KX6 A;  2HPJ A;  1L0V A;  4UV8 B;  3ZMT B;  3PTR B;  5HXS A;  3NWI A;  3AVS A;  4NUU A;  4F8H A;  4HEA A;  2RA1 A;  5JRC B;  1YQ4 A;  5FY0 A;  3AE5 A;  1WYB A;  4OHF A;  5FYM A;  4ADZ A;  5L3C B;  2HHH T;  3UQ7 A;  2XQ4 A;  4Z91 A;  5HWX A;  4ILC A;  3AE6 A;  5HXC A;  5A1L A;  1G8X A;  5L3F B;  1OED B;  3Q5W A;  2BG9 B;  2H89 A;  5LGT B;  4EGW A;  1N34 T;  4KP3 C;  4N78 D;  4KHP T;  4AQF C;  2EHO B;  5HEO A;  3HI2 A;  2XQY A;  2WZI A;  2LM2 A;  1E7P A;  3ETU A;  3JCF A;  2B1E A;  2EHO A;  2MYS A;  1US7 B;  5KDM C;  2J62 A;  1QUU A;  5ETW A;  4WYV A;  3SWH A;  3TLS A;  5LCY A;  4DR3 T;  3L8R A;  5AQQ B;  4GYS A;  2WDQ A;  4HWC A;  4Z90 A;  3RIA A;  3ZMV B;  4HGA A;  3VR8 A;  2LSG A;  4DUZ T;  3GMI A;  3F31 A;  2FJD A;  3ZCJ A;  4E7S A;  4OYK A;  2UU9 T;  4XAX B;  5LOV E;  3OKQ A;  3PUW F;  1JNR A;  2LHR A;  3CX6 B;  1V9D A;  1KEY A;  2PG8 A;  3PV0 F;  1GQE A;  4IL9 A;  1R8I A;  5JDN A;  4ZZB A;  3OJA A;  3RC3 A;  2J1D G;  3CML A;  2V7I A;  1J5E T;  1LVF A;  4U31 A;  3P50 A;  2YN6 A;  3AEB A;  4U2Z A;  5AQP B;  4HWF A;  3P8C D;  2E9X D;  4H9R C;  4J2C A;  3RKG A;  3JAD A;  4DV0 T;  2XQ9 A;  3KV5 A;  3P4R A;  3B5M A;  4C90 A;  4ZI2 D;  4CI2 B;  5IWA T;  5LYJ E;  3BQK A;  4LF7 T;  5CA0 E;  4DMW A;  2H7V C;  5AQS B;  1XMO T;  1UK5 A;  5LP6 E;  4O2A E;  5AFU L;  3ONX A;  4IE4 A;  3K3N A;  2DHR A;  3OTO T;  2PTF A;  2CBJ A;  3RQU A;  1KF6 A;  4ASK A;  4CXW A;  4JI4 T;  4ISS A;  3AE4 A;  1HCI A;  3BQL A;  4GIW A;  2C5K T;  4QXH B;  5LJM A;  4X64 T;  4QWN B;  3T1H T;  1UX4 A;  2BG9 C;  1OWA A;  3UFE A;  3N9O A;  3K3O A;  3ESL A;  5AQV B;  3JAE A;  5C3J A;  5FY7 A;  2WQY A;  4L0R A;  3UU8 A;  4DR6 T;  1S94 A;  4QX7 B;  2X0Y A;  3C50 A;  4PNI A;  4QH4 A;  2CEA A;  3FZM B;  2ZM2 A;  2Q9Q C;  1MMA A;  2XSA A;  2BS4 A;  3ZMU B;  2FJE A;  2VKO A;  4QH5 A;  4GKK T;  3R6N A;  2CCQ A;  1U5P A;  5DQW A;  4YLH A;  5AQO B;  3G06 A;  5FL0 A;  4WBN E;  3ZN0 B;  1LRZ A;  2B76 A;  3KIN B;  1IBL T;  4HFH A;  3I0Q A;  5EK4 A;  4YTN A;  2D0U A;  2PJQ A;  5HAX A;  4P1N A;  4O4L E;  2KWI B;  2XQ7 A;  5LBM A;  4HN9 A;  3DP7 A;  2V5D A;  4DR5 T;  2ZM8 A;  1OED C;  4UVC B;  4DV6 T;  3IBP A;  2W4X A;  3N5L A;  2JMK A;  3N9N A;  1HTJ F;  3HKE E;  1KFY A;  3KFW X;  5HCM A;  3AAI A;  3ZMS B;  2BG9 E;  5HXH A;  1D0Z A;  4GK0 E;  4KBM B;  4KMC A;  5E0O A;  5L47 A;  2YDQ A;  2XJ7 A;  3Q2M A;  2PBI A;  4JI2 T;  3SFD A;  4CN6 A;  1W0A A;  1D1B A;  2E9X A;  4EZH A;  4AKR B;  1T98 A;  3FZF B;  4PJJ A;  4TN7 B;  4X66 T;  2WBL A;  4NXN T;  4DR4 T;  1BR2 A;  1NAF A;  2L9Q A;  1LVK A;  4K0U A;  3PUX F;  5FKY A;  5AQG B;  2NW8 A;  4ZI3 C;  2WM9 A;  4HFE A;  4B3S T;  3PJA A;  4TWD A;  2Z6E A;  2DCF A;  3LK4 2;  2Q9Q D;  2XPK A;  4O4J E;  4P0A A;  2BZB A;  1WCR A;  3VHL A;  1OED E;  4I43 B;  2V6X A;  1NEN A;  1YD8 G;  4HFI A;  5FP3 A;  3E08 A;  4BJM A;  4YY3 T;  3H3M A;  2W61 A;  3RX6 A;  5CJ5 A;  1MMG A;  4TWF A;  2K48 A;  5CGM A;  4A5X A;  3EHZ A;  3PDY A;  2KXP B;  3AE3 A;  2DLR A;  2FJA A;  3AEC A;  3KVA A;  4JBW F;  3AE9 A;  2JPF A;  3ETV A;  2LKH A;  4UEM A;  3TLU A;  5LBQ B;  3TLT A;  3RF1 A;  3P4Q A;  4PK5 A;  4IDO A;  1SHZ C;  4HFV A;  1Y01 A;  2DI4 A;  2FJB A;  2J47 A;  3CK6 A;  1CHU A;  3EDU A;  4JLE A;  4LFB T;  2AXD S;  2MTQ A;  3C4X A;  2VVN A;  1HNX T;  1T72 A;  2JRK A;  3PUY F;  5LGU B;  4B3T T;  3ZC0 A;  2ODV A;  2N2N A;  2CE7 A;  1X79 A;  3U3I A;  5JR9 C;  2H3R A;  1LKX A;  3AEG A;  3EDV A;  3CIR A;  1Y64 B;  3NVO A;  3PUA A;  4IL4 A;  1FIO A;  3ZKR A;  5ABH A;  3IHR A;  4ZEY A;  5KX5 E;  4JI8 T;  4MAL A;  4TV9 E;  2YDS A;  4QKN A;  3AEE A;  4O4I E;  3ZYL A;  3B13 A;  2NTX A;  3H37 A;  5JTG A;  1J1J A;  3P4S A;  2KIN B;  2LOS A;  1BR4 A;  4DV7 T;  4LF6 T;  5AQI B;  3M3Z B;  3QNU A;  5FNV E;  3W15 B;  1YW0 A;  4ZHQ E;  5JRC A;  2UXB T;  5AQJ B;  5LGN B;  1VCS A;  4PK4 A;  2IML A;  2WU2 A;  1IJ5 A;  2XAH B;  4EAH A;  2D5U A;  3E0Z A;  3NZP A;  5AQH B;  5JDL A;  3C4W A;  4JYA T;  3ZT7 A;  3N9Q A;  1UCU A;  3K1S A;  1HF8 A;  2WS3 A;  4U7Y A;  5LNK A;  3CX7 B;  2CXF A;  2E5V A;  4YSX A;  3S4U A;  3AXJ B;  4HWH A;  4U3C A;  4DND A;  1QSD A;  2UXD T;  5DJQ C;  2QRX A;  3O4X E;  4HFB A;  2VQF T;  2K24 A;  2BS3 A;  3DTO A;  3MAC A;  3L39 A;  4ILU A;  5HXE A;  4X20 E;  2PFV A;  3MXZ A;  1NWM X;  1ZKE A;  1VOM A;  2HPL A;  5HYA A;  2WMN A;  1T8B A;  5HEU A;  3RKO A;  1HX1 B;  4DV5 T;  2A9U A;  2WWU A;  3F2E A;  4ILB A;  2Y6X A;  2WAU A;  2WZH A;  3EAB A;  4G2A A;  2XM2 A;  2OLT A;  3OYX A;  4KUM B;  5AQF B;  4AI6 A;  3N9P A;  3RRW A;  3SS1 A;  4JI3 T;  3Q5E A;  1SUM B;  3HKC E;  2XSB A;  2WSS V;  5HEG A;  1SE7 A;  3T8O A;  3LJC A;  3ZN1 B;  5HXR A;  5JQG E;  4LF5 T;  1QLB A;  4P09 A;  2V7K A;  5L4H A;  2C5J A;  3N2K E;  2NTY A;  4LML A;  2X0L B;  4X1Y E;  4CQI A;  5KMG P;  4H9Q C;  3TKL B;  4AXP A;  4LMJ A;  2XAJ B;  2LE8 A;  3SFE A;  4EED A;  3UUB A;  2ZM6 T;  2IDO B;  3O9X A;  4YFS A;  4V1A v;  2E5L T;  1XNQ T;  5HEH A;  3I0O A;  4YSZ A;  2XAG B;  5JDM A;  4UF0 A;  1YKE B;  2V7M A;  3CVR A;  4X1I E;  5LHG B;  4X62 T;  1HR0 T;  3J7Y q;  3OPC A;  4PJN A;  2OA5 A;  2OV9 A;  4LFC T;  1YKH B;  3IEE A;  1FJG T;  4MHC A;  4DO0 A;  4K0K T;  3FHN A;  4NPP A;  2DWG A;  1OED A;  2JQQ A;  2QA7 A;  2EHO C;  5JH7 E;  4UIG A;  3FBZ A;  2CLY C;  4HTE A;  1HG5 A;  2CRB A;  2ODU A;  1W09 A;  5M4Y A;  5IUX A;  3J9X 1;  3AE8 A;  4HWD A;  3P4P A;  4EZ4 A;  2NOX A;  2XM1 A;  4CZZ B;  3WAK A;  5LMN T;  4LFA T;  2BKP A;  1HNW T;  3Q9D A;  2V7J A;  4GKJ T;  2MAW A;  2L3L A;  3P4W A;  2ACX A;  1FMV A;  2WDV A;  5ABE A;  3VU7 H;  4ZZC A;  4JI7 T;  2MPK A;  3GA8 A;  3L09 A;  4L5G A;  3F57 A;  4IE0 A;  4DVD A;  1IAP A;  3RYC E;  3RGL A;  2UUA T;  5HCJ A;  5FMN A;  4H9N C;  5LHH B;  2UUC T;  2L8K A;  2N9D A;  3CPZ A;  3X1D A;  5JDQ A;  3KDS E;  1MND A;  3KVB A;  4H63 H;  5AQU B;  3UUM A;  3GN5 A;  3N9M A;  3VRB A;  2JQK A;  3OBV E;  2X0H A;  2K5B B;  5H6Q B;  4DV3 T;  2BG9 A;  3NRX A;  1D0Y A;  2J4G A;  3I9W A;  4AKL A;  4EV6 A;  5LXT E;  4O2B E;  3SOL A;  1N36 T;  3LBX B;  3VKH A;  2DWK A;  3CQX C;  1MMD A;  2V6Y B;  2XQ5 A;  3JC6 D;  4DBQ A;  3L3P A;  4JI5 T;  1IBK T;  1N32 T;  1HS7 A;  5JVD E;  3N9L A;  2VVS A;  4QXB B;  5JDG A;  3RRC A;  2SPC A;  4X5T A;  4H9S E;  3KBT A;  2XAQ B;  3ANW A;  2CHO A;  4DR1 T;  2XY8 B;  3PUZ F;  3LFM A;  3WI3 A;  1B7T A;  3AA1 B;  3I1A A;  3ZT6 A;  2X9H A;  4OFZ A;  4ZXL A;  2X66 A;  2QYW A;  3IA3 A;  5DQV A;  4PFP A;  4F6R C;  3AAA B;  2LLY A;  4EXT A;  5LG4 A;  4U74 A;  4AQY T;  2E2A A;  3IF8 B;  3UTK A;  5F5W A;  3HKB E;  2IC9 A;  2X9W A;  4ZS3 A;  3RI5 A;  1MMN A;  1EZ3 A;  2EHO D;  3AED A;  3Q5D A;  3AAE B;  4IE6 A;  4WZX A;  5ABF A;  2XQ3 A;  2X68 A;  5H6R B;  5LB7 B;  2E9X B;  3ONL C;  3A7M A;  2BDE A;  3TLW A;  3UUL A;  5BR8 T;  2YK0 A;  2LHN A;  3PJA J;  2X9Y A;  1IBM T;  3CWZ B;  5CB4 E;  2W00 A;  2CBI A;  1KNR A;  4IDQ A;  2FUP A;  3HR0 A;  2M6I A;  2E8I A;  3GN5 B;  4IE5 A;  4DR7 T;  2BKN A;  4WNK A;  4EIW A;  4JI1 T;  4IDZ A;  3AA7 B;  4UR9 A;  2VWA A;  3AEA A;  2HH7 A;  4HKA A;  2BVM A;  5HWY A;  2CA5 A;  1ZP0 A;  3H3A A;  3RYF E;  4IGU A;  1CUN A;  3U78 A;  4X65 T;  2BKO A;  5FVL A;  3ZJ1 A;  2RPA A;  1H7C A;  1VCT A;  4LF8 T;  1BR1 A;  3AXJ A;  2NW9 A;  2CMR A;  1FMW A;  3QC9 A;  4HE8 A;  2A72 A;  2W62 A;  4JEU B;  3PUQ A;  2XUE A;  3TLV A;  2ZM0 A;  5F3J A;  2VKH A;  3QOF A;  5FXX A;  3CQG B;  5AQR B;  2C0S A;  3E22 E;  4YJ3 E;  1IJ6 A;  1MIY A;  2M6B A;  1XMQ T;  4LMK A;  4KHZ F;  2VL0 A;  5J0Z A;  3HL6 A; 
#chains in the Genus database with same CATH homology
 4PFO A;  2N1G A;  2P9B A;  2BVL A;  4PK6 A;  2CXD A;  3RYH E;  4C91 A;  2D2S A;  4MFR A;  5C8Y E;  4PJM A;  4B6X A;  4UEL A;  3SRZ A;  4ZI2 C;  2KZ7 B;  4AQF A;  4G63 A;  1Z0P A;  2ES0 A;  3MK7 C;  2LJL A;  4Z8X A;  4FI5 A;  4M1P A;  4E7Z A;  1WR6 A;  4ZS2 A;  4ZI7 E;  5JR9 B;  3KV9 A;  2MOZ A;  1HG2 A;  2XAS B;  4CXY A;  4UF0 B;  1MIW A;  3CQC B;  5F8P A;  3FXE B;  3UUN A;  3KV4 A;  2CXL A;  5BMV E;  3DJB A;  2V1D B;  4IST A;  1D1A A;  2NP9 A;  3Q5X A;  5EK2 A;  4YHJ A;  4QX8 B;  3BK9 A;  4AQG A;  3CKD A;  2QGS A;  2JJ9 A;  3RYI E;  4EB6 E;  2LSY A;  3LK2 B;  2VAS A;  4DMV A;  1ZEE A;  2RP4 A;  1E1H B;  3R84 B;  3AA6 B;  3ZLI A;  5CA1 E;  4XBF B;  3NZQ A;  4CI1 B;  3GWH A;  5JR9 A;  3KV6 A;  4BJN A;  4QHO A;  3O1H A;  4TX5 A;  2Y8D A;  1IZN B;  4EOZ B;  5JRE A;  3MJX A;  2Q9Q B;  4H9P C;  4PW8 A;  4CI3 B;  3O1J A;  4TZ4 C;  2XHE B;  3ZEF B;  2V26 A;  5LJN A;  4MBQ A;  4IE7 A;  4TUY E;  5JDF A;  3C51 A;  3C98 B;  4FJO A;  4AKI A;  2KWH A;  2DNX A;  2CLY B;  3I9Y A;  2VB6 A;  5J2T E;  5EK3 A;  4TV8 E;  4WW0 A;  3M65 A;  1ZV4 X;  1KNZ A;  3ZJ2 A;  2YU2 A;  4IHJ E;  4I55 E;  2D0T A;  3QUJ A;  3N2O A;  5L3B B;  2NW7 A;  3LK3 B;  4GYR A;  2A2F X;  1VRB A;  4DBR A;  1FEW A;  4A56 A;  3N2G E;  4X1K E;  5JDH A;  2Q9Q A;  5LHI B;  3LBX A;  2WMO A;  1D1C A;  4ZI3 D;  2X9X A;  2CWY A;  4YJ2 E;  4WBO A;  3EVY A;  1MNE A;  3HKD E;  3D0T A;  1WLX A;  5FY1 A;  5TAO A;  2CM0 A;  3ZYM A;  2X67 A;  3K8P C;  4ZOL E;  2YEV C;  3PE0 A;  3O1I A;  4EYY R;  4H9O C;  5L2L A;  3JC6 C;  2KLQ A;  4ANJ A;  3AB3 B;  3MA9 A;  4UVA B;  2XTL A;  5GON E;  2X51 A;  1HX8 A;  1D0X A;  2KND A;  4XZC A;  1ZHC A;  2LEH A;  3PU3 A;  3ANW B;  2YIN A;  5EZY E;  2G0U A;  2UXN B;  2Y48 B;  3LG7 A;  3MKD A;  4NUV A;  5DAB A;  5FXV A;  2IW5 B;  3ZC1 A;  4O4H E;  3UUX B;  2E9X C;  4QXC B;  4JUY A;  2YU1 A;  3PU8 A;  4UXN B;  2M67 A;  5ADX L;  1HFA A;  2W0G A;  4O8S A;  3RC8 A;  3C4Z A;  3ZMZ B;  2UXX B;  2XAF B;  1OXZ A;  2LSJ A;  2IC6 A;  4PAG A;  1SA0 E;  3FB2 A;  3VKG A;  3WAJ A;  4BA9 A;  2C5I T;  2NWB A;  5J1G A;  2ZLY A;  3ZCI A;  3HA4 A;  5J2U E;  3CX8 B;  3NRY A;  3C64 A;  3PUS A;  4ERR A;  1UX5 A;  4MLK A;  4I50 E;  4GOU A;  2LSK A;  3FBL A;  3PUG A;  2KMF A;  2CWO A;  2VKD A;  3UT5 E;  2VKJ A;  4H63 V;  3B57 A;  2LT3 A;  4JEH B;  3V5S A;  3BQI A;  2GK9 A;  2W63 A;  3K3Q C;  3RH3 A;  2JMH A;  4U72 A;  1BR0 A;  5IYZ E;  2LSI A;  4OK0 A;  4IIJ E;  4PJL A;  2A3D A;  4BAY B;  3P7I A;  5FXW A;  5FXZ A;  4AKG A;  4AKH A;  5L3E B;  4L9I A;  4EYU A;  2MBG A;  2H7O A;  2V7L A;  3AA0 B;  2ZMA A;  4GK5 E;  4P0B A;  1G73 A;  2K9A A;  2VL8 A;  3RPU A;  5L3D B;  5IHY A;  5LA6 E;  3ZPO A;  2LOP A;  3EUH A;  3NBX X;  2IAK A;  2VK9 A;  4CXX A;  2LM9 A;  3MZK B;  1O3X A;  2I59 A;  2KT9 A;  3ZYK A;  1KK7 A;  1WRD A;  3FXD B;  3QK6 A;  1S35 A;  1AJ3 A;  3V5U A;  4OYJ A;  4UV9 B;  4I4T E;  3PUR A;  1MIV A;  1U4Q A;  3AVR A;  3OYZ A;  5L3G B;  3A5X A;  1WYC A;  4UVB B;  3ZMT B;  3KBU A;  2HPJ A;  4UV8 B;  3PTR B;  5HXS A;  3AVS A;  4NUU A;  4HEA A;  2RA1 A;  5JRC B;  5FY0 A;  4OHF A;  1WYB A;  5FYM A;  4ADZ A;  5L3C B;  5HWX A;  5L3F B;  5HXC A;  5A1L A;  1G8X A;  3Q5W A;  5LGT B;  4KP3 C;  4N78 D;  4AQF C;  2EHO B;  3HI2 A;  2XQY A;  3ETU A;  5KDM C;  2B1E A;  2EHO A;  2MYS A;  1US7 B;  5ETW A;  1QUU A;  3SWH A;  5LCY A;  4GYS A;  3ZMV B;  4HGA A;  2LSG A;  3GMI A;  3F31 A;  4E7S A;  3ZCJ A;  4OYK A;  4XAX B;  5LOV E;  3OKQ A;  2LHR A;  3CX6 B;  1V9D A;  2PG8 A;  5JDN A;  3OJA A;  3RC3 A;  2J1D G;  3CML A;  2V7I A;  1LVF A;  3P8C D;  2E9X D;  4H9R C;  4J2C A;  3KV5 A;  4C90 A;  4ZI2 D;  4CI2 B;  5LYJ E;  3BQK A;  5CA0 E;  4DMW A;  2H7V C;  5LP6 E;  4O2A E;  5AFU L;  3ONX A;  4IE4 A;  3K3N A;  2DHR A;  4ASK A;  4CXW A;  4ISS A;  1HCI A;  3BQL A;  4GIW A;  2C5K T;  4QXH B;  5LJM A;  4QWN B;  1UX4 A;  1OWA A;  3UFE A;  3N9O A;  3K3O A;  3ESL A;  5FY7 A;  4L0R A;  1S94 A;  4QX7 B;  4PNI A;  3C50 A;  2CEA A;  2ZM2 A;  2Q9Q C;  1MMA A;  3ZMU B;  2VKO A;  3R6N A;  2CCQ A;  1U5P A;  5DQW A;  4YLH A;  4WBN E;  3ZN0 B;  1LRZ A;  3KIN B;  3I0Q A;  5EK4 A;  2D0U A;  2PJQ A;  5HAX A;  4O4L E;  2KWI B;  5LBM A;  4HN9 A;  3DP7 A;  2ZM8 A;  4UVC B;  3IBP A;  3N5L A;  2JMK A;  3N9N A;  1HTJ F;  3HKE E;  3KFW X;  3AAI A;  3ZMS B;  5HXH A;  1D0Z A;  4GK0 E;  4KBM B;  4KMC A;  5E0O A;  3Q2M A;  2PBI A;  4EZH A;  2E9X A;  1D1B A;  4AKR B;  1T98 A;  4PJJ A;  4TN7 B;  2WBL A;  1BR2 A;  1NAF A;  2L9Q A;  1LVK A;  4K0U A;  2NW8 A;  4ZI3 C;  2WM9 A;  2Z6E A;  2DCF A;  3LK4 2;  2Q9Q D;  4O4J E;  4P0A A;  2BZB A;  3VHL A;  4AKL A;  4I43 B;  4BJM A;  1YD8 G;  5FP3 A;  3E08 A;  3RX6 A;  2W61 A;  1MMG A;  2K48 A;  3PDY A;  2KXP B;  2DLR A;  5HXE A;  3KVA A;  2JPF A;  3ETV A;  4UEM A;  5LBQ B;  4PK5 A;  1SHZ C;  4HFV A;  2DI4 A;  3EDU A;  4JLE A;  2MTQ A;  3C4X A;  2JRK A;  5LGU B;  3ZC0 A;  2ODV A;  2N2N A;  2CE7 A;  1X79 A;  3U3I A;  5JR9 C;  2H3R A;  1LKX A;  3EDV A;  3PUA A;  1Y64 B;  5LXT E;  1FIO A;  5KX5 E;  3IHR A;  4MAL A;  4TV9 E;  4QKN A;  4O4I E;  3ZYL A;  3B13 A;  2NTX A;  3H37 A;  2KIN B;  2LOS A;  1BR4 A;  5FNV E;  3W15 B;  1YW0 A;  4ZHQ E;  5JRC A;  5LGN B;  4PK4 A;  2XAH B;  1IJ5 A;  4EAH A;  2D5U A;  3E0Z A;  3NZP A;  5JDL A;  3C4W A;  3N9Q A;  1UCU A;  1HF8 A;  5LNK A;  3CX7 B;  2CXF A;  3S4U A;  4DND A;  1QSD A;  5DJQ C;  3O4X E;  2K24 A;  3DTO A;  3MAC A;  4ILU A;  4X20 E;  2PFV A;  3MXZ A;  1ZKE A;  1NWM X;  1VOM A;  2HPL A;  5HYA A;  2WMN A;  3RKO A;  2WWU A;  3F2E A;  2Y6X A;  2WAU A;  4G2A A;  3OYX A;  4KUM B;  4AI6 A;  3N9P A;  3RRW A;  3SS1 A;  3HKC E;  3T8O A;  2WSS V;  3LJC A;  3ZN1 B;  5HXR A;  5JQG E;  4P09 A;  2V7K A;  4CQI A;  2C5J A;  3N2K E;  2NTY A;  4X1Y E;  2X0L B;  5KMG P;  4H9Q C;  3TKL B;  4AXP A;  2XAJ B;  2LE8 A;  3O9X A;  4YFS A;  4V1A v;  3I0O A;  2XAG B;  5JDM A;  4UF0 A;  1YKE B;  2V7M A;  3CVR A;  4X1I E;  5LHG B;  3J7Y q;  4PJN A;  2OA5 A;  1YKH B;  3IEE A;  4MHC A;  4DO0 A;  3FHN A;  2DWG A;  2JQQ A;  2QA7 A;  5JH7 E;  2EHO C;  4UIG A;  3FBZ A;  2CLY C;  4HTE A;  1HG5 A;  2ODU A;  5M4Y A;  3J9X 1;  4EZ4 A;  2NOX A;  4CZZ B;  3WAK A;  3Q9D A;  2V7J A;  2L3L A;  2ACX A;  1FMV A;  3VU7 H;  3GA8 A;  3L09 A;  4L5G A;  3F57 A;  4IE0 A;  1IAP A;  3RYC E;  5FMN A;  4H9N C;  5LHH B;  2L8K A;  2N9D A;  3CPZ A;  5JDQ A;  3KDS E;  1MND A;  3KVB A;  4H63 H;  3UUM A;  3GN5 A;  3N9M A;  3OBV E;  2K5B B;  5H6Q B;  3NRX A;  1D0Y A;  3I9W A;  4O2B E;  3SOL A;  3LBX B;  3VKH A;  2DWK A;  3CQX C;  1MMD A;  4DBQ A;  3JC6 D;  1HS7 A;  3L3P A;  5JVD E;  3N9L A;  4QXB B;  5JDG A;  2SPC A;  4H9S E;  3KBT A;  2XAQ B;  3ANW A;  3LFM A;  3WI3 A;  1B7T A;  3AA1 B;  3I1A A;  2X9H A;  4OFZ A;  2X66 A;  5DQV A;  4PFP A;  4F6R C;  3AAA B;  4EXT A;  5LG4 A;  4U74 A;  3IF8 B;  3UTK A;  3HKB E;  2IC9 A;  2X9W A;  4ZS3 A;  1MMN A;  1EZ3 A;  2EHO D;  4IE6 A;  3AAE B;  5H6R B;  2X68 A;  2E9X B;  2BDE A;  3UUL A;  2YK0 A;  2LHN A;  2X9Y A;  3CWZ B;  5CB4 E;  2W00 A;  3HR0 A;  2E8I A;  3GN5 B;  4IE5 A;  4WNK A;  4EIW A;  4IDZ A;  3AA7 B;  5HWY A;  2VWA A;  3RRC A;  2HH7 A;  4HKA A;  2BVM A;  4DVD A;  2CA5 A;  3H3A A;  3RYF E;  4IGU A;  1CUN A;  3U78 A;  3ZJ1 A;  1H7C A;  1BR1 A;  2NW9 A;  2CMR A;  1FMW A;  3QC9 A;  4HE8 A;  2A72 A;  2W62 A;  4JEU B;  3PUQ A;  2XUE A;  2ZM0 A;  5F3J A;  2VKH A;  5FXX A;  3CQG B;  2C0S A;  3E22 E;  4YJ3 E;  1IJ6 A;  1MIY A;  3HL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...