3E08A

H55s mutant xanthomonas campestris tryptophan 2,3-dioxygenase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Tryptophan 2,3-dioxygenase
publication title Histidine 55 of tryptophan 2,3-dioxygenase is not an active site base but regulates catalysis by controlling substrate binding
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 108
structure length 280
sequence length 280
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3e08A00
2X67A 2NWBA 5EK3A 2D0UA 5EK2A 5EK4A 2X66A 4HKAA 2V7KA 2D0TA 4PK5A 2NW8A 2X68A 4U74A 2NW9A 1YW0A 2NW7A 2V7JA 3BK9A 5ETWA 4PW8A 3E08A 4PK6A 2V7MA 2NOXA 1ZEEA 2V7IA 2V7LA 4U72A
chains in the Genus database with same CATH superfamily
4QHOA 5JDLA 3RLFF 2UU9T 4ZZBA 5FP3A 2IW5B 2VWAA 4HWFA 1YKHB 2MTQA 3MK7C 1R8IA 4PK5A 1HR0T 4LF8T 5L47A 3NKZA 1NWMX 2ZM0A 2D9DA 5FVKA 2LSIA 3RYIE 2XZEA 3KV9A 1T7SA 1MIVA 2XTLA 4H9NC 4ZI2C 5JDHA 5LG4A 2YU1A 4I4TE 3AE8A 4YJ3E 1HCIA 4O2AE 4A5XA 4OYKA 3AXJB 4X1IE 4Q25A 1W9RA 3AA7B 2L3LA 3WAKA 4IDOA 2LEHA 3Q5XA 3FZFB 1I6ZA 1KNRA 3ZT5A 3FZKB 5HEUA 5LBQB 4O4LE 3RF1A 2A72A 4U7IA 4GK5E 3QK6A 2XSAA 2C5IT 3PDYA 4CXWA 4O8SA 4J2CA 3UUNA 2W62A 2NR4A 4HKAA 5E0OA 2EHOD 2E9XB 1Z8UA 2RP4A 3CIRA 2EHOA 5AQGB 3T1YT 5F3JA 1CHUA 3PUZF 2ODUA 5DQVA 3QOFA 3P4RA 2KINB 2P9BA 2UXXB 1LKXA 2VK9A 4I43B 5IYZE 3EI0A 3LBXB 1HG2A 2QRXA 3I9WA 4KI0F 3S4UA 4GYSA 2VKJA 2OLTA 3ZCJA 3ZPOA 2YU2A 2V7IA 4YTMA 4HE8A 4HWDA 3L3PA 3R6NA 3FZLB 1OWAA 2KWIB 4B6XA 1JNZA 3UUXB 2N1GA 3NBXX 4GIWA 3CKDA 2VL8A 4JEUB 3RQWA 1N34T 2W66A 3IEEA 3RC3A 1B7TA 4OFZA 3ZCIA 2PBIA 2XQ3A 2IIUA 2LJLA 2E8IA 3FBLA 4JI7T 2BKPA 3UTKA 4NXNT 1AJ3A 3ZC0A 4DV3T 2CLYC 2W00A 2H3RA 4IL9A 1MIWA 3WI3A 4OHFA 2K5BB 3PJAJ 2X9XA 2DNXA 3AEDA 3HI2A 1UURA 4DV7T 2I0MA 4P0AA 4X1KE 4HEAA 5ADXL 2EHOC 2XUEA 3ZEFB 1KFYA 3L39A 2QA7A 5F5WA 5ABGA 2FJDA 3Q5WA 2XJ7A 3RKOA 5LJMA 4P09A 4ILAA 4JI6T 1CUNA 5L3GB 4ILBA 2V6YB 1W09A 5AQTB 2CEAA 2JMKA 3SFDA 4DV6T 4QXCB 4IREA 5HXEA 3AE1A 2MAWA 5KX5E 4MBQA 1E1HB 4PFPA 4DV2T 4IDQA 3AA6B 2YKSA 4NXMT 3EABA 4LF4T 2V7JA 5CB4E 3E08A 2BG9A 2QGSA 2BZBA 5ABEA 3UU3A 3KBTA 4EOZB 3RYCE 5AQQB 3N2KE 4GYRA 3CX7B 3UQ7A 5IHYA 1HG5A 1IZNB 3C98B 2XM1A 4IGUA 4B3TT 2V5CA 2LE8A 2VURA 4UR9A 2KT9A 3OYXA 2XQ7A 2BS4A 2YDRA 3AEFA 4HTEA 4E7ZA 1WLXA 5EK4A 3H3AA 1MNDA 2XSBA 4MHCA 4JBWF 2IC9A 3SFEA 4AQGA 3MZKB 3K3NA 4NUVA 4PJLA 5FL0A 1IBLT 2XQ8A 3FBZA 3AEGA 4H9OC 3ZC1A 2JIWA 5JRCA 4BJMA 5AQOB 3ZMVB 4YJ2E 3EAMA 3Q2MA 3UQ4A 4F8HA 2L9QA 3C4WA 3DP7A 4KMCA 5LHGB 4CXXA 5LOVE 2UXBT 5FY7A 4DV5T 3FB2A 4TWFA 5F8PA 2XPKA 4U72A 2X67A 2JQ9A 1H7CA 4X64T 5LYJE 1UCUA 2LRLA 4COFA 2GK9A 4IE4A 4ERRA 4IE0A 4HFIA 3I9YA 2BG9C 1N32T 3JAEA 1WR0A 5CFBA 3UFGA 4BA9A 4DVDA 3M65A 3AE5A 3L09A 4IDPA 1YQ3A 2LKHA 5LHHB 4F6RC 1ZKEA 4MFRA 3ONXA 4LF7T 4O2BE 2KZ7B 1YKEB 4L0RA 1KNZA 4A98A 1ZEEA 2WBLA 3AB3B 2HN2A 1UUSA 2W2UA 3AE6A 5IWAT 5JDFA 3RYFE 3FXEB 4KUMB 2LSJA 3FHNA 3ABVA 4BAYB 1MNEA 1XDOA 5FXVA 4TNWA 5J2TE 3RGLA 4HFVA 2LHRA 3OVUA 3PUQA 2D0TA 4DV0T 3BK9A 3O1IA 4HWHA 2X0YA 4B3RT 2E9XD 5AQLB 1HFAA 4OYJA 2E9XA 4TWHA 1IAPA 1J1JA 3VHLA 2D2SA 5C2TA 1NEKA 5FXWA 4PNIA 4ZS2A 4P0BA 3N9LA 4L9IA 3AEBA 3I0OA 3N9MA 2HPJA 3ZYKA 4PW8A 3CQGB 1MMNA 2H88A 4O4IE 2A3DA 1QSDA 4LMJA 4C91A 2VB6A 3AE3A 2KMFA 3H37A 1FMWA 2VKHA 3KBUA 3AA0B 4YTNA 2BG9E 5EK2A 2FJAA 3OJAA 3OKQA 1UX4A 2VASA 4OX9T 2WDRA 4CI3B 3TLVA 3U3IA 2X9YA 1J5WA 4M1PA 2NW9A 2FJBA 3R84B 4X62T 4LFBT 2BBJA 2A9UA 4A56A 2IUBA 3CQCB 2CA5A 2Y8DA 4AQFC 5JDGA 1V9DA 4KHZF 2LKGA 2E5LT 4IE6A 3A8YC 4IHJE 2CCQA 2FBWA 4PJJA 2BS3A 4HFBA 4YT0A 5HXCA 3FZMB 2E9XC 5HCJA 1IJ6A 3BQLA 1MIYA 2B76A 3GN5B 2V7KA 1HX8A 1YXRA 2WAUA 2VKOA 2UXCT 2MYSA 4LF6T 2CWYA 3MKDA 4B3ST 5DQWA 4UF0A 4QX8B 4E7SA 5KDMC 3CK6A 4P1NA 5H6QB 3PE0A 5LNKA 1XWMA 4BJNA 5FY0A 4ZI7E 4IE5A 4EZHA 3ZMTB 1M7KA 3QB5A 4DUZT 2K48A 2XQ4A 2YEVC 3SWHA 1HNZT 3UFEA 5L2LA 3CPZA 2A2FX 5L3CB 5J0ZA 4DV1T 4WW0A 5L4EA 3VKHA 2XQ6A 4LMKA 5AFUL 3N9QA 2VQET 1MMGA 4KBMB 3ZN0B 2DWGA 3CWZB 2H7OA 4ZI3D 4AI6A 2HH7A 4QXHB 1SE7A 2E2AA 3GWHA 2WS3A 4A97A 1ZV4X 3BQIA 4NIQA 1I94T 3ZMZB 3MJXA 2M6IA 1WFDA 5FNVE 2W4XA 3AAIA 3G06A 4X66T 2G0UA 5CGMA 5JVDE 4FJOA 4OK0A 3OPCA 3IA3A 2WQYA 2Q9QB 3ZMSB 1NAFA 1VRBA 1ZP0A 1W0AA 2C5KT 2X68A 4EB6E 2H89A 2YDSA 2D0UA 3IBPA 2LLYA 1L0VA 4AKIA 3J9X1 4ZS3A 4HFHA 4UVAB 1OXZA 3C4XA 4GOUA 2SPCA 2CHOA 3KFWX 2UUBT 1XNRT 5ABHA 2WP9A 5HEGA 3O4XE 2JPFA 3HKCE 4ZI3C 2CMRA 5BMVE 1FEWA 3NZQA 1Z0PA 2N2NA 3N5LA 2K24A 1HNWT 2XAJB 2WY2A 1G73A 4YY3T 5J2UE 3PU8A 4UXNB 4C90A 4JYAT 3NWIA 4QXBB 1U5PA 1E7PA 3A5XA 5JDMA 4GKKT 2X9HA 4KHPT 2WMNA 1Y01A 1VCTA 4PAGA 4MALA 3CX8B 3AVSA 4UEMA 3UUMA 5A1LA 2RPAA 3JADA 4EIWA 1YQ4A 2IHR1 2IDOB 1VCSA 4JEHB 4IDNA 3DJBA 4U74A 4XZCA 3QNUA 3ZSSA 3UU6A 4WNKA 2XAHB 2KWHA 3WAJA 5CA1E 3BQKA 5JDQA 2YK0A 4U31A 2XQAA 4ZXLA 5JH7E 4B3MT 4I55E 2VL0A 4ASKA 2XY8B 4HWIB 3RHWA 2CLYB 4O4JE 4TV9E 2ZM2A 3RH3A 4ZHQE 2J47A 3X1DA 3LFMA 5HXSA 1YW0A 1FJGT 3ONLC 2VVNA 4L5GA 4EYUA 1WCRA 2DL1A 5LA6E 2EHOB 5L3FB 2IC6A 3Q5DA 2BS2A 3MACA 2DI4A 4YFSA 1T8BA 4H9QC 3ANWA 1XMQT 3KVBA 4U2YA 5LXTE 3ZYMA 2E5VA 2M6BA 3PUXF 4AIUA 3PUWF 5AQMB 2XAGB 4DNDA 3M3ZB 4DR5T 4QWNB 2K3WA 3FZHB 3UUBA 1BR2A 3GN5A 4HFCA 5JTGA 4DBRA 4KP3C 2KXPB 4YLHA 5L3EB 1WRDA 1KNPA 1UX5A 4H63V 2ODVA 3UULA 2OV9A 4YXDA 5C3JA 1KEYA 3UU5A 5HEOA 4CN4A 4YSYA 5HCMA 3HKDE 4HGAA 2JRKA 4NUUA 2NP9A 3AXJA 3K8PC 2YINA 1MMDA 2W63A 5FXZA 4I50E 5LCYA 1Y64B 4TUYE 3RRWA 3PV0F 4QX7B 4CN6A 2NTXA 2PTFA 3ZN1B 2JQQA 3E22E 4AQFA 2WU5A 2ZMAA 5FVLA 5HEHA 2CBIA 4WYVA 3VRBA 4CI2B 3P4PA 3VR9A 5LMNT 5H6RB 3PTRB 4DV4T 2HN1A 4N78D 2ES0A 4G63A 2XAFB 4Z8XA 3EVYA 5J1GA 2JJ9A 3T8OA 2UUCT 5JREA 5FMNA 2V8SV 2N9DA 3TLTA 2BDEA 3PUAA 4JI5T 3NRXA 3LBXA 3OBVE 2V6XA 3W15B 2BG9B 4QKNA 3QC9A 4DR1T 2Q9QD 2F4VT 3AE7A 3GA8A 2VQFT 2Q9QA 1HS7A 4U33A 2IAKA 2NW7A 1FMVA 5LJNA 1N33T 5LMUT 3K1SA 1OEDB 2DLRA 3SRZA 4H9RC 3ZJ2A 3LDQB 2LM9A 3AE9A 5EZYE 4U3CA 4AKHA 4K0KT 4HFEA 3LSVA 3DTOA 4ILCA 1X9BA 2QYWA 2VVSA 2DHRA 5LG3A 4DUYT 2H7VC 1J5ET 1JNRA 3F57A 2XAQB 3I0QA 3P4QA 3C4ZA 3VKGA 2W67A 3RYHE 5AQHB 2WCAA 4WBNE 2MOZA 2X9WA 1D0ZA 3P4WA 4Z90A 4LMLA 1S35A 3B5MA 3H3MA 4CQIA 1DU2A 3LK42 2JQKA 4EXTA 2MPKA 4IE7A 3AEAA 1UGOA 2PFVA 3N9OA 3HR0A 4TNVA 5ABFB 5CA0E 5AQKB 2XQ5A 3LG7A 3CVRA 4EGWA 1IJ5A 3JC6D 4UV8B 4H9SE 3AAAB 1N36T 5CJ5A 2W61A 3MXZA 3AE4A 2YDQA 4QH5A 3N9PA 2V6YA 2LOSA 3F2EA 3RIFA 3PU3A 5JR9B 4PJNA 2ZM8A 2Q9QC 3PUSA 2XASB 5JQGE 3RIUA 3RIAA 3HKEE 4V1Av 3RX6A 5KXJA 3RRCA 4HWCA 3LK3B 4TZ4C 2PJQA 3O1JA 3D0TA 3IF8B 3Q9DA 2KNDA 3Q5EA 5IUXA 3UT5E 5L4HA 5LGUB 4DO0A 3TLWA 2Y6XA 3C64A 4IIJE 4JUYA 4YSXA 2DWKA 4YHJA 1BR1A 3MA9A 4IL4A 3OYZA 1HF8A 1HTJF 3PJAA 4PK6A 2CXFA 2ACXA 5LP6E 3SOLA 4FI5A 2VKDA 1E2AA 2L8KA 5HYAA 3C50A 2KSRA 5AQNB 3AVRA 5L3DB 3P8CD 3O9XA 3PUGA 5LB7B 4GKJT 4ZZCA 5ETWA 1MMAA 2V7MA 4DBQA 3JC6C 3ZKRA 4PFOA 2IMLA 5DABA 1D0XA 3B57A 4I0UA 3JAFA 3PUYF 3AEEA 1G8XA 5AQJB 4QH1A 3RIUC 4NPPA 4AXPA 4U7YA 4CN1A 3QUJA 1KF6A 3P7IA 3PUVF 4XBFB 2UXDT 4CI1B 3UU8A 3AA1B 1QLBA 3VU7H 2BBHA 3EDUA 4TN7B 1VOMA 3EDVA 2PG8A 1XDPA 3L8RA 3N2OA 3A7MA 5HEJA 3NVOA 4DMWA 1W0BA 2WZIA 2FUPA 4PJMA 4LFCT 1NENA 4DR4T 1IBKT 5AQRB 5M4YA 3CQXC 2WMOA 3ZMUB 4JI4T 3VRAA 4YHHT 5KMGP 2J62A 2BKNA 5AQUB 2WM9A 4Z91A 1XMOT 2CPTA 3KINB 1QUUA 4QH4A 1ZOYA 4UELA 1M62A 3RKGA 3I1AA 3N2GE 2QVAA 5TAOA 4AKLA 2LSKA 3J7Yq 2CE7A 1S94A 4X1YE 4HFDA 3KV5A 4UVBB 4DR2T 1D1AA 5LBMA 4JV5T 3P4SA 1US7B 1XZYA 2LSGA 4UF0B 3ZJ1A 2UXNB 4ISSA 3OTOT 4LF9T 2YOEA 2X66A 4DR3T 3N9NA 4DR6T 2CRBA 4HN9A 1BR0A 4DIDB 4AKGA 3KV4A 1O3XA 2AE9A 1BR4A 1WR6A 2FJEA 2J4GA 4JI3T 4EAHA 1KK7A 3AAEB 4TV8E 4DR7T 4EYYR 3ETVA 1UK5A 2Z6EA 4JI2T 1OEDA 4CXYA 3KDSE 2XHEB 2NWBA 2WB5A 3RQUA 2JQHA 2V26A 3GMIA 2OA5A 3CMLA 4TX5A 5FL1A 2YN6A 5FY1A 4X5TA 3V5SA 5HXHA 5GONE 3ZT6A 1SA0E 5JDNA 2BVMA 2V7LA 4CZZB 4UV9B 5EK3A 2WWVA 4ILUA 1SHZC 3ZLIA 4AISA 2CM0A 5FKYA 5HAXA 3F31A 4EEBA 2K9AA 4XAXB 1T72A 5C8YE 1FIOA 4ZOLE 5ABFA 2LRKA 3NRYA 4O4HE 3AE2A 1YD8G 2I6HA 5AQPB 4K0UA 3PURA 4WBOA 1U4QA 4H63H 2AXDS 2D5UA 5LHIB 2V5DA 2X0HA 4IT4A 3K3OA 1T98A 2WWUA 2WDVA 2X0LB 2ACZA 5AQSB 5JR9A 3C51A 1HNXT 2HHHT 2B1EA 3RC8A 4X20E 4UIGA 4WZXA 2NTYA 5AQVB 4U2ZA 3RPUA 4GK0E 1LRZA 1HX1B 4LFAT 3TLSA 2XM2A 5AQFB 3IHRA 2NOXA 4ADZA 1OEDC 5FXXA 2BVLA 4MLKA 2HPLA 2CBJA 2CWOA 3EHZA 3VR8A 3FXDB 3HL6A 2NW8A 3CX6B 2I59A 5HWYA 2WSSV 2XQ9A 2ZM6T 1LVFA 2MBGA 4ZEYA 2Y48B 3ZYLA 3JCFA 3V5UA 4EEDA 3LJCA 5L3BB 2JMHA 1GQEA 4X65T 2CHNA 4AQYT 4ISTA 4AKRB 3ZSTA 4PK4A 4JLEA 3AECA 5FYMA 4JI1T 2WU2A 2R6GF 1IBMT 3SS1A 1LVKA 4YSZA 1D1BA 4DMVA 2J1DG 2M67A 5HXRA 3U78A 4G2AA 2WZHA 2LSYA 2KLQA 3RI5A 5JR9C 5BR8T 3KV6A 4LF5T 3EUHA 4ZI2D 3T1HT 4UVCB 3E0ZA 3TKLB 1SUMB 3ZT7A 2C5JA 2W0GA 5HWXA 2XQYA 2UUAT 2C0SA 3TLUA 4IDZA 3LK2B 2LHNA 2DCFA 4EZ4A 5AQIB 4JI0T 1WYBA 3QB5K 2LT3A 3O1HA 1XNQT 5DJQC 2BKOA 2CXDA 3NZPA 3HKBE 3K3QC 2X51A 3P50A 5JRCB 3B13A 1ZHCA 2ZLYA 4H9PC 1D1CA 2V1DB 3ONJA 4JI8T 4YTPA 1WYCA 4EV6A 2WDQA 3UU4A 3KVAA 3ANWB 1OEDE 4TWDA 2LM2A 4KX6A 4ANJA 2CXLA 3ETUA 1X79A 2LOPA 1EZ3A 5LGNB 3ESLA 5LGTB 1D0YA 3HA4A 2RA1A
chains in the Genus database with same CATH topology
4QHOA 5J2TE 5JDLA 2CLYB 3P7IA 4O4JE 4TV9E 4HFVA 4XBFB 4CI1B 5FP3A 2IW5B 2LHRA 2VWAA 2ZM2A 3RH3A 4ZHQE 1YKHB 2MTQA 3PUQA 3AA1B 3VU7H 3MK7C 2D0TA 4PK5A 3LFMA 3EDUA 4TN7B 1VOMA 5HXSA 3EDVA 2PG8A 1NWMX 1YW0A 3BK9A 3O1IA 3N2OA 2ZM0A 4L5GA 4EYUA 2E9XD 2LSIA 3RYIE 4DMWA 3KV9A 1HFAA 4OYJA 5LA6E 2E9XA 1MIVA 2EHOB 1IAPA 2XTLA 3VHLA 5L3FB 4H9NC 4PJMA 2D2SA 2IC6A 4ZI2C 5FXWA 4PNIA 5JDHA 4ZS2A 5LG4A 2YU1A 4I4TE 4P0BA 5M4YA 3CQXC 4YJ3E 1HCIA 3N9LA 4O2AE 3MACA 2DI4A 2WMOA 4L9IA 3ZMUB 3I0OA 4OYKA 3N9MA 2HPJA 4X1IE 5KMGP 3ZYKA 4PW8A 4YFSA 4H9QC 3CQGB 3ANWA 1MMNA 3KVBA 5LXTE 4O4IE 3ZYMA 2A3DA 1QSDA 3AA7B 2WM9A 2L3LA 3WAKA 4C91A 3KINB 1QUUA 2LEHA 3Q5XA 2VB6A 4UELA 2KMFA 2XAGB 3I1AA 3H37A 4DNDA 3N2GE 5LBQB 5TAOA 4AKLA 2LSKA 1FMWA 4O4LE 4QWNB 3J7Yq 2CE7A 2A72A 1BR2A 4GK5E 3QK6A 3GN5A 1S94A 2VKHA 4X1YE 4DBRA 4KP3C 3KBUA 3AA0B 2C5IT 2KXPB 3PDYA 4YLHA 4CXWA 1WRDA 5L3EB 5EK2A 3OJAA 1UX5A 3KV5A 3OKQA 4H63V 2ODVA 4J2CA 1UX4A 2VASA 4O8SA 3UUNA 3UULA 2W62A 4UVBB 4HKAA 5E0OA 4CI3B 3U3IA 2X9YA 1D1AA 2EHOD 2E9XB 5LBMA 2RP4A 4M1PA 2EHOA 2NW9A 1US7B 3R84B 5F3JA 2ODUA 5DQVA 2LSGA 4UF0B 3ZJ1A 3HKDE 4HGAA 2UXNB 2JRKA 4ISSA 2KINB 4NUUA 2P9BA 2UXXB 1LKXA 4A56A 3CQCB 2CA5A 2Y8DA 2VK9A 4AQFC 2NP9A 4I43B 5JDGA 2X66A 3K8PC 1V9DA 5IYZE 3LBXB 2YINA 1HG2A 4IE6A 3N9NA 1MMDA 4HN9A 3I9WA 2W63A 1BR0A 4IHJE 4AKGA 2CCQA 3KV4A 5FXZA 4I50E 1O3XA 5LCYA 4PJJA 3S4UA 1Y64B 4TUYE 4GYSA 2VKJA 5HXCA 3RRWA 3ZCJA 1BR4A 3ZPOA 2YU2A 2V7IA 4HE8A 4QX7B 2E9XC 1WR6A 2NTXA 3L3PA 1IJ6A 3R6NA 3ZN1B 1OWAA 2KWIB 2JQQA 4B6XA 3UUXB 4EAHA 1KK7A 1MIYA 3BQLA 3E22E 4AQFA 2N1GA 3NBXX 4GIWA 2ZMAA 3GN5B 2V7KA 3AAEB 3CKDA 2VL8A 4JEUB 4TV8E 4CI2B 1HX8A 3IEEA 4EYYR 3RC3A 3ETVA 5H6RB 2WAUA 1B7TA 2Z6EA 3PTRB 2VKOA 4OFZA 3ZCIA 2PBIA 4CXYA 2MYSA 4N78D 2ES0A 3KDSE 2XHEB 4G63A 2XAFB 2NWBA 3EVYA 4Z8XA 5J1GA 2CWYA 2LJLA 2JJ9A 3T8OA 3MKDA 5JREA 2E8IA 3FBLA 5FMNA 5DQWA 2V26A 3GMIA 3UTKA 2OA5A 3CMLA 2N9DA 4UF0A 4QX8B 4TX5A 1AJ3A 4E7SA 5KDMC 3ZC0A 2BDEA 5H6QB 5FY1A 3PUAA 3PE0A 2CLYC 2W00A 5LNKA 2H3RA 3V5SA 4BJNA 5FY0A 4ZI7E 3NRXA 4IE5A 5HXHA 4EZHA 5GONE 1MIWA 3LBXA 3WI3A 3ZMTB 1SA0E 4OHFA 5JDNA 2BVMA 2K48A 2K5BB 2V7LA 4UV9B 4CZZB 2X9XA 2DNXA 3OBVE 2YEVC 5EK3A 3SWHA 3W15B 3UFEA 5L2LA 3HI2A 4ILUA 3CPZA 4QKNA 3QC9A 2A2FX 1SHZC 5L3CB 3ZLIA 4P0AA 2Q9QD 2CM0A 4X1KE 4HEAA 2EHOC 2Q9QA 3GA8A 4WW0A 5HAXA 5ADXL 3F31A 2IAKA 1HS7A 2NW7A 2XUEA 3ZEFB 3VKHA 2K9AA 5AFUL 2QA7A 3N9QA 1FMVA 4XAXB 1MMGA 4KBMB 3ZN0B 5LJNA 2DWGA 5C8YE 1FIOA 4ZOLE 3CWZB 2H7OA 3NRYA 4ZI3D 4O4HE 3Q5WA 1YD8G 4AI6A 3RKOA 2HH7A 4K0UA 5LJMA 3PURA 4P09A 4WBOA 1U4QA 4QXHB 2DLRA 4H63H 2D5UA 1CUNA 5L3GB 3SRZA 5LHIB 3K3OA 2CEAA 2JMKA 4H9RC 1T98A 2WWUA 3GWHA 4QXCB 2X0LB 3ZJ2A 5HXEA 5JR9A 2LM9A 3C51A 1ZV4X 3BQIA 5KX5E 4MBQA 5EZYE 4AKHA 1E1HB 3ZMZB 2B1EA 4PFPA 4X20E 3MJXA 3RC8A 4UIGA 2NTYA 3RPUA 3DTOA 5FNVE 3AA6B 4GK0E 3AAIA 1LRZA 2DHRA 2H7VC 2G0UA 3F57A 2V7JA 2XAQB 3I0QA 3C4ZA 3VKGA 5JVDE 4FJOA 3E08A 3IHRA 5CB4E 2QGSA 2NOXA 3RYHE 4ADZA 4OK0A 4WBNE 2MOZA 2X9WA 1D0ZA 5FXXA 2BZBA 2BVLA 4MLKA 1S35A 2Q9QB 2HPLA 3KBTA 2CWOA 3ZMSB 4CQIA 1NAFA 3LK42 4EOZB 1VRBA 4EXTA 3RYCE 4IE7A 3FXDB 3N2KE 3HL6A 2PFVA 3N9OA 4GYRA 2NW8A 2C5KT 2X68A 4EB6E 3HR0A 3CX6B 2I59A 3CX7B 5IHYA 1HG5A 5CA0E 1IZNB 3C98B 3LG7A 4IGUA 3CVRA 5HWYA 1IJ5A 2WSSV 3JC6D 4UV8B 4H9SE 3AAAB 1LVFA 2MBGA 2LE8A 2W61A 2Y48B 3MXZA 3ZYLA 2KT9A 3OYXA 3N9PA 2D0UA 3IBPA 3V5UA 4HTEA 3LJCA 4E7ZA 1WLXA 5L3BB 5EK4A 3H3AA 1MNDA 2JMHA 2LOSA 3F2EA 4ISTA 3PU3A 5JR9B 4AKIA 4AKRB 3J9X1 4PJNA 4MHCA 4ZS3A 2IC9A 4PK4A 1OXZA 2Q9QC 2ZM8A 3MZKB 4UVAB 4AQGA 3K3NA 4JLEA 3C4XA 3PUSA 2XASB 4NUVA 5JQGE 4GOUA 2SPCA 4PJLA 3HKEE 4V1Av 3RX6A 5FYMA 4H9OC 3FBZA 3KFWX 5JRCA 3ZC1A 3RRCA 3SS1A 4BJMA 3O4XE 2JPFA 1LVKA 3ZMVB 3HKCE 4ZI3C 4YJ2E 2CMRA 3LK3B 4TZ4C 2PJQA 3O1JA 3Q2MA 5BMVE 1FEWA 1D1BA 1Z0PA 2L9QA 2N2NA 3D0TA 3NZQA 4DMVA 2J1DG 3C4WA 2M67A 3IF8B 3Q9DA 5HXRA 3DP7A 4KMCA 3U78A 3N5LA 5LHGB 2K24A 2KNDA 4G2AA 4CXXA 2LSYA 3UT5E 2XAJB 5LOVE 2KLQA 1G73A 5FY7A 5LGUB 5JR9C 5J2UE 3FB2A 3PU8A 3KV6A 4UXNB 5F8PA 4DO0A 4U72A 2X67A 4C90A 1H7CA 3EUHA 4ZI2D 4UVCB 4QXBB 2Y6XA 1U5PA 3E0ZA 3TKLB 3C64A 5LYJE 3A5XA 1UCUA 4IIJE 4JUYA 2C5JA 5JDMA 4ERRA 2GK9A 2W0GA 4IE4A 5HWXA 2XQYA 2DWKA 2C0SA 4IE0A 4YHJA 2X9HA 1BR1A 3MA9A 2WMNA 3OYZA 3I9YA 4IDZA 3LK2B 1HF8A 2LHNA 2DCFA 1HTJF 4EZ4A 4PK6A 4PAGA 1WYBA 4MALA 3CX8B 3AVSA 4UEMA 4BA9A 2CXFA 3UUMA 2ACXA 5A1LA 2LT3A 4DVDA 3M65A 4EIWA 3O1HA 3L09A 5LP6E 3SOLA 5DJQC 4FI5A 2CXDA 2VKDA 4JEHB 5LHHB 2L8KA 3NZPA 3C50A 3HKBE 5HYAA 3K3QC 2X51A 5JRCB 4F6RC 1ZKEA 3AVRA 3B13A 1ZHCA 3ONXA 4MFRA 3DJBA 5L3DB 2ZLYA 4H9PC 4U74A 1D1CA 3P8CD 2V1DB 4XZCA 3O9XA 3PUGA 4O2BE 2KZ7B 1YKEB 4L0RA 5ETWA 1MMAA 1KNZA 2V7MA 4DBQA 1WYCA 1ZEEA 3JC6C 4PFOA 2WBLA 2XAHB 4WNKA 2KWHA 3AB3B 5DABA 1D0XA 3B57A 3KVAA 3ANWB 3WAJA 5CA1E 4ANJA 2CXLA 5JDFA 3BQKA 3ETUA 3RYFE 5JDQA 1G8XA 1X79A 3FXEB 2LOPA 1EZ3A 5LGNB 2YK0A 4KUMB 2LSJA 3ESLA 4AXPA 3FHNA 5JH7E 4BAYB 3QUJA 5LGTB 1MNEA 1D0YA 4I55E 3HA4A 5FXVA 4ASKA 2RA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X67 A;  2NWB A;  5EK3 A;  2D0U A;  5EK2 A;  5EK4 A;  2X66 A;  4HKA A;  2V7K A;  2D0T A;  4PK5 A;  2NW8 A;  2X68 A;  4U74 A;  2NW9 A;  1YW0 A;  2NW7 A;  2V7J A;  3BK9 A;  5ETW A;  4PW8 A;  3E08 A;  4PK6 A;  2V7M A;  2NOX A;  1ZEE A;  2V7I A;  2V7L A;  4U72 A; 
#chains in the Genus database with same CATH topology
 4QHO A;  5JDL A;  3RLF F;  2UU9 T;  4ZZB A;  5FP3 A;  2IW5 B;  2VWA A;  4HWF A;  1YKH B;  2MTQ A;  3MK7 C;  1R8I A;  4PK5 A;  1HR0 T;  4LF8 T;  5L47 A;  3NKZ A;  1NWM X;  2ZM0 A;  2D9D A;  5FVK A;  2LSI A;  3RYI E;  2XZE A;  3KV9 A;  1T7S A;  1MIV A;  2XTL A;  4H9N C;  4ZI2 C;  5JDH A;  5LG4 A;  2YU1 A;  4I4T E;  3AE8 A;  4YJ3 E;  1HCI A;  4O2A E;  4A5X A;  4OYK A;  3AXJ B;  4X1I E;  4Q25 A;  1W9R A;  3AA7 B;  2L3L A;  3WAK A;  4IDO A;  2LEH A;  3Q5X A;  3FZF B;  1I6Z A;  1KNR A;  3ZT5 A;  3FZK B;  5HEU A;  5LBQ B;  4O4L E;  3RF1 A;  2A72 A;  4U7I A;  4GK5 E;  3QK6 A;  2XSA A;  2C5I T;  3PDY A;  4CXW A;  4O8S A;  4J2C A;  3UUN A;  2W62 A;  2NR4 A;  4HKA A;  5E0O A;  2EHO D;  2E9X B;  1Z8U A;  2RP4 A;  3CIR A;  2EHO A;  5AQG B;  3T1Y T;  5F3J A;  1CHU A;  3PUZ F;  2ODU A;  5DQV A;  3QOF A;  3P4R A;  2KIN B;  2P9B A;  2UXX B;  1LKX A;  2VK9 A;  4I43 B;  5IYZ E;  3EI0 A;  3LBX B;  1HG2 A;  2QRX A;  3I9W A;  4KI0 F;  3S4U A;  4GYS A;  2VKJ A;  2OLT A;  3ZCJ A;  3ZPO A;  2YU2 A;  2V7I A;  4YTM A;  4HE8 A;  4HWD A;  3L3P A;  3R6N A;  3FZL B;  1OWA A;  2KWI B;  4B6X A;  1JNZ A;  3UUX B;  2N1G A;  3NBX X;  4GIW A;  3CKD A;  2VL8 A;  4JEU B;  3RQW A;  1N34 T;  2W66 A;  3IEE A;  3RC3 A;  1B7T A;  4OFZ A;  3ZCI A;  2PBI A;  2XQ3 A;  2IIU A;  2LJL A;  2E8I A;  3FBL A;  4JI7 T;  2BKP A;  3UTK A;  4NXN T;  1AJ3 A;  3ZC0 A;  4DV3 T;  2CLY C;  2W00 A;  2H3R A;  4IL9 A;  1MIW A;  3WI3 A;  4OHF A;  2K5B B;  3PJA J;  2X9X A;  2DNX A;  3AED A;  3HI2 A;  1UUR A;  4DV7 T;  2I0M A;  4P0A A;  4X1K E;  4HEA A;  5ADX L;  2EHO C;  2XUE A;  3ZEF B;  1KFY A;  3L39 A;  2QA7 A;  5F5W A;  5ABG A;  2FJD A;  3Q5W A;  2XJ7 A;  3RKO A;  5LJM A;  4P09 A;  4ILA A;  4JI6 T;  1CUN A;  5L3G B;  4ILB A;  2V6Y B;  1W09 A;  5AQT B;  2CEA A;  2JMK A;  3SFD A;  4DV6 T;  4QXC B;  4IRE A;  5HXE A;  3AE1 A;  2MAW A;  5KX5 E;  4MBQ A;  1E1H B;  4PFP A;  4DV2 T;  4IDQ A;  3AA6 B;  2YKS A;  4NXM T;  3EAB A;  4LF4 T;  2V7J A;  5CB4 E;  3E08 A;  2BG9 A;  2QGS A;  2BZB A;  5ABE A;  3UU3 A;  3KBT A;  4EOZ B;  3RYC E;  5AQQ B;  3N2K E;  4GYR A;  3CX7 B;  3UQ7 A;  5IHY A;  1HG5 A;  1IZN B;  3C98 B;  2XM1 A;  4IGU A;  4B3T T;  2V5C A;  2LE8 A;  2VUR A;  4UR9 A;  2KT9 A;  3OYX A;  2XQ7 A;  2BS4 A;  2YDR A;  3AEF A;  4HTE A;  4E7Z A;  1WLX A;  5EK4 A;  3H3A A;  1MND A;  2XSB A;  4MHC A;  4JBW F;  2IC9 A;  3SFE A;  4AQG A;  3MZK B;  3K3N A;  4NUV A;  4PJL A;  5FL0 A;  1IBL T;  2XQ8 A;  3FBZ A;  3AEG A;  4H9O C;  3ZC1 A;  2JIW A;  5JRC A;  4BJM A;  5AQO B;  3ZMV B;  4YJ2 E;  3EAM A;  3Q2M A;  3UQ4 A;  4F8H A;  2L9Q A;  3C4W A;  3DP7 A;  4KMC A;  5LHG B;  4CXX A;  5LOV E;  2UXB T;  5FY7 A;  4DV5 T;  3FB2 A;  4TWF A;  5F8P A;  2XPK A;  4U72 A;  2X67 A;  2JQ9 A;  1H7C A;  4X64 T;  5LYJ E;  1UCU A;  2LRL A;  4COF A;  2GK9 A;  4IE4 A;  4ERR A;  4IE0 A;  4HFI A;  3I9Y A;  2BG9 C;  1N32 T;  3JAE A;  1WR0 A;  5CFB A;  3UFG A;  4BA9 A;  4DVD A;  3M65 A;  3AE5 A;  3L09 A;  4IDP A;  1YQ3 A;  2LKH A;  5LHH B;  4F6R C;  1ZKE A;  4MFR A;  3ONX A;  4LF7 T;  4O2B E;  2KZ7 B;  1YKE B;  4L0R A;  1KNZ A;  4A98 A;  1ZEE A;  2WBL A;  3AB3 B;  2HN2 A;  1UUS A;  2W2U A;  3AE6 A;  5IWA T;  5JDF A;  3RYF E;  3FXE B;  4KUM B;  2LSJ A;  3FHN A;  3ABV A;  4BAY B;  1MNE A;  1XDO A;  5FXV A;  4TNW A;  5J2T E;  3RGL A;  4HFV A;  2LHR A;  3OVU A;  3PUQ A;  2D0T A;  4DV0 T;  3BK9 A;  3O1I A;  4HWH A;  2X0Y A;  4B3R T;  2E9X D;  5AQL B;  1HFA A;  4OYJ A;  2E9X A;  4TWH A;  1IAP A;  1J1J A;  3VHL A;  2D2S A;  5C2T A;  1NEK A;  5FXW A;  4PNI A;  4ZS2 A;  4P0B A;  3N9L A;  4L9I A;  3AEB A;  3I0O A;  3N9M A;  2HPJ A;  3ZYK A;  4PW8 A;  3CQG B;  1MMN A;  2H88 A;  4O4I E;  2A3D A;  1QSD A;  4LMJ A;  4C91 A;  2VB6 A;  3AE3 A;  2KMF A;  3H37 A;  1FMW A;  2VKH A;  3KBU A;  3AA0 B;  4YTN A;  2BG9 E;  5EK2 A;  2FJA A;  3OJA A;  3OKQ A;  1UX4 A;  2VAS A;  4OX9 T;  2WDR A;  4CI3 B;  3TLV A;  3U3I A;  2X9Y A;  1J5W A;  4M1P A;  2NW9 A;  2FJB A;  3R84 B;  4X62 T;  4LFB T;  2BBJ A;  2A9U A;  4A56 A;  2IUB A;  3CQC B;  2CA5 A;  2Y8D A;  4AQF C;  5JDG A;  1V9D A;  4KHZ F;  2LKG A;  2E5L T;  4IE6 A;  3A8Y C;  4IHJ E;  2CCQ A;  2FBW A;  4PJJ A;  2BS3 A;  4HFB A;  4YT0 A;  5HXC A;  3FZM B;  2E9X C;  5HCJ A;  1IJ6 A;  3BQL A;  1MIY A;  2B76 A;  3GN5 B;  2V7K A;  1HX8 A;  1YXR A;  2WAU A;  2VKO A;  2UXC T;  2MYS A;  4LF6 T;  2CWY A;  3MKD A;  4B3S T;  5DQW A;  4UF0 A;  4QX8 B;  4E7S A;  5KDM C;  3CK6 A;  4P1N A;  5H6Q B;  3PE0 A;  5LNK A;  1XWM A;  4BJN A;  5FY0 A;  4ZI7 E;  4IE5 A;  4EZH A;  3ZMT B;  1M7K A;  3QB5 A;  4DUZ T;  2K48 A;  2XQ4 A;  2YEV C;  3SWH A;  1HNZ T;  3UFE A;  5L2L A;  3CPZ A;  2A2F X;  5L3C B;  5J0Z A;  4DV1 T;  4WW0 A;  5L4E A;  3VKH A;  2XQ6 A;  4LMK A;  5AFU L;  3N9Q A;  2VQE T;  1MMG A;  4KBM B;  3ZN0 B;  2DWG A;  3CWZ B;  2H7O A;  4ZI3 D;  4AI6 A;  2HH7 A;  4QXH B;  1SE7 A;  2E2A A;  3GWH A;  2WS3 A;  4A97 A;  1ZV4 X;  3BQI A;  4NIQ A;  1I94 T;  3ZMZ B;  3MJX A;  2M6I A;  1WFD A;  5FNV E;  2W4X A;  3AAI A;  3G06 A;  4X66 T;  2G0U A;  5CGM A;  5JVD E;  4FJO A;  4OK0 A;  3OPC A;  3IA3 A;  2WQY A;  2Q9Q B;  3ZMS B;  1NAF A;  1VRB A;  1ZP0 A;  1W0A A;  2C5K T;  2X68 A;  4EB6 E;  2H89 A;  2YDS A;  2D0U A;  3IBP A;  2LLY A;  1L0V A;  4AKI A;  3J9X 1;  4ZS3 A;  4HFH A;  4UVA B;  1OXZ A;  3C4X A;  4GOU A;  2SPC A;  2CHO A;  3KFW X;  2UUB T;  1XNR T;  5ABH A;  2WP9 A;  5HEG A;  3O4X E;  2JPF A;  3HKC E;  4ZI3 C;  2CMR A;  5BMV E;  1FEW A;  3NZQ A;  1Z0P A;  2N2N A;  3N5L A;  2K24 A;  1HNW T;  2XAJ B;  2WY2 A;  1G73 A;  4YY3 T;  5J2U E;  3PU8 A;  4UXN B;  4C90 A;  4JYA T;  3NWI A;  4QXB B;  1U5P A;  1E7P A;  3A5X A;  5JDM A;  4GKK T;  2X9H A;  4KHP T;  2WMN A;  1Y01 A;  1VCT A;  4PAG A;  4MAL A;  3CX8 B;  3AVS A;  4UEM A;  3UUM A;  5A1L A;  2RPA A;  3JAD A;  4EIW A;  1YQ4 A;  2IHR 1;  2IDO B;  1VCS A;  4JEH B;  4IDN A;  3DJB A;  4U74 A;  4XZC A;  3QNU A;  3ZSS A;  3UU6 A;  4WNK A;  2XAH B;  2KWH A;  3WAJ A;  5CA1 E;  3BQK A;  5JDQ A;  2YK0 A;  4U31 A;  2XQA A;  4ZXL A;  5JH7 E;  4B3M T;  4I55 E;  2VL0 A;  4ASK A;  2XY8 B;  4HWI B;  3RHW A;  2CLY B;  4O4J E;  4TV9 E;  2ZM2 A;  3RH3 A;  4ZHQ E;  2J47 A;  3X1D A;  3LFM A;  5HXS A;  1YW0 A;  1FJG T;  3ONL C;  2VVN A;  4L5G A;  4EYU A;  1WCR A;  2DL1 A;  5LA6 E;  2EHO B;  5L3F B;  2IC6 A;  3Q5D A;  2BS2 A;  3MAC A;  2DI4 A;  4YFS A;  1T8B A;  4H9Q C;  3ANW A;  1XMQ T;  3KVB A;  4U2Y A;  5LXT E;  3ZYM A;  2E5V A;  2M6B A;  3PUX F;  4AIU A;  3PUW F;  5AQM B;  2XAG B;  4DND A;  3M3Z B;  4DR5 T;  4QWN B;  2K3W A;  3FZH B;  3UUB A;  1BR2 A;  3GN5 A;  4HFC A;  5JTG A;  4DBR A;  4KP3 C;  2KXP B;  4YLH A;  5L3E B;  1WRD A;  1KNP A;  1UX5 A;  4H63 V;  2ODV A;  3UUL A;  2OV9 A;  4YXD A;  5C3J A;  1KEY A;  3UU5 A;  5HEO A;  4CN4 A;  4YSY A;  5HCM A;  3HKD E;  4HGA A;  2JRK A;  4NUU A;  2NP9 A;  3AXJ A;  3K8P C;  2YIN A;  1MMD A;  2W63 A;  5FXZ A;  4I50 E;  5LCY A;  1Y64 B;  4TUY E;  3RRW A;  3PV0 F;  4QX7 B;  4CN6 A;  2NTX A;  2PTF A;  3ZN1 B;  2JQQ A;  3E22 E;  4AQF A;  2WU5 A;  2ZMA A;  5FVL A;  5HEH A;  2CBI A;  4WYV A;  3VRB A;  4CI2 B;  3P4P A;  3VR9 A;  5LMN T;  5H6R B;  3PTR B;  4DV4 T;  2HN1 A;  4N78 D;  2ES0 A;  4G63 A;  2XAF B;  4Z8X A;  3EVY A;  5J1G A;  2JJ9 A;  3T8O A;  2UUC T;  5JRE A;  5FMN A;  2V8S V;  2N9D A;  3TLT A;  2BDE A;  3PUA A;  4JI5 T;  3NRX A;  3LBX A;  3OBV E;  2V6X A;  3W15 B;  2BG9 B;  4QKN A;  3QC9 A;  4DR1 T;  2Q9Q D;  2F4V T;  3AE7 A;  3GA8 A;  2VQF T;  2Q9Q A;  1HS7 A;  4U33 A;  2IAK A;  2NW7 A;  1FMV A;  5LJN A;  1N33 T;  5LMU T;  3K1S A;  1OED B;  2DLR A;  3SRZ A;  4H9R C;  3ZJ2 A;  3LDQ B;  2LM9 A;  3AE9 A;  5EZY E;  4U3C A;  4AKH A;  4K0K T;  4HFE A;  3LSV A;  3DTO A;  4ILC A;  1X9B A;  2QYW A;  2VVS A;  2DHR A;  5LG3 A;  4DUY T;  2H7V C;  1J5E T;  1JNR A;  3F57 A;  2XAQ B;  3I0Q A;  3P4Q A;  3C4Z A;  3VKG A;  2W67 A;  3RYH E;  5AQH B;  2WCA A;  4WBN E;  2MOZ A;  2X9W A;  1D0Z A;  3P4W A;  4Z90 A;  4LML A;  1S35 A;  3B5M A;  3H3M A;  4CQI A;  1DU2 A;  3LK4 2;  2JQK A;  4EXT A;  2MPK A;  4IE7 A;  3AEA A;  1UGO A;  2PFV A;  3N9O A;  3HR0 A;  4TNV A;  5ABF B;  5CA0 E;  5AQK B;  2XQ5 A;  3LG7 A;  3CVR A;  4EGW A;  1IJ5 A;  3JC6 D;  4UV8 B;  4H9S E;  3AAA B;  1N36 T;  5CJ5 A;  2W61 A;  3MXZ A;  3AE4 A;  2YDQ A;  4QH5 A;  3N9P A;  2V6Y A;  2LOS A;  3F2E A;  3RIF A;  3PU3 A;  5JR9 B;  4PJN A;  2ZM8 A;  2Q9Q C;  3PUS A;  2XAS B;  5JQG E;  3RIU A;  3RIA A;  3HKE E;  4V1A v;  3RX6 A;  5KXJ A;  3RRC A;  4HWC A;  3LK3 B;  4TZ4 C;  2PJQ A;  3O1J A;  3D0T A;  3IF8 B;  3Q9D A;  2KND A;  3Q5E A;  5IUX A;  3UT5 E;  5L4H A;  5LGU B;  4DO0 A;  3TLW A;  2Y6X A;  3C64 A;  4IIJ E;  4JUY A;  4YSX A;  2DWK A;  4YHJ A;  1BR1 A;  3MA9 A;  4IL4 A;  3OYZ A;  1HF8 A;  1HTJ F;  3PJA A;  4PK6 A;  2CXF A;  2ACX A;  5LP6 E;  3SOL A;  4FI5 A;  2VKD A;  1E2A A;  2L8K A;  5HYA A;  3C50 A;  2KSR A;  5AQN B;  3AVR A;  5L3D B;  3P8C D;  3O9X A;  3PUG A;  5LB7 B;  4GKJ T;  4ZZC A;  5ETW A;  1MMA A;  2V7M A;  4DBQ A;  3JC6 C;  3ZKR A;  4PFO A;  2IML A;  5DAB A;  1D0X A;  3B57 A;  4I0U A;  3JAF A;  3PUY F;  3AEE A;  1G8X A;  5AQJ B;  4QH1 A;  3RIU C;  4NPP A;  4AXP A;  4U7Y A;  4CN1 A;  3QUJ A;  1KF6 A;  3P7I A;  3PUV F;  4XBF B;  2UXD T;  4CI1 B;  3UU8 A;  3AA1 B;  1QLB A;  3VU7 H;  2BBH A;  3EDU A;  4TN7 B;  1VOM A;  3EDV A;  2PG8 A;  1XDP A;  3L8R A;  3N2O A;  3A7M A;  5HEJ A;  3NVO A;  4DMW A;  1W0B A;  2WZI A;  2FUP A;  4PJM A;  4LFC T;  1NEN A;  4DR4 T;  1IBK T;  5AQR B;  5M4Y A;  3CQX C;  2WMO A;  3ZMU B;  4JI4 T;  3VRA A;  4YHH T;  5KMG P;  2J62 A;  2BKN A;  5AQU B;  2WM9 A;  4Z91 A;  1XMO T;  2CPT A;  3KIN B;  1QUU A;  4QH4 A;  1ZOY A;  4UEL A;  1M62 A;  3RKG A;  3I1A A;  3N2G E;  2QVA A;  5TAO A;  4AKL A;  2LSK A;  3J7Y q;  2CE7 A;  1S94 A;  4X1Y E;  4HFD A;  3KV5 A;  4UVB B;  4DR2 T;  1D1A A;  5LBM A;  4JV5 T;  3P4S A;  1US7 B;  1XZY A;  2LSG A;  4UF0 B;  3ZJ1 A;  2UXN B;  4ISS A;  3OTO T;  4LF9 T;  2YOE A;  2X66 A;  4DR3 T;  3N9N A;  4DR6 T;  2CRB A;  4HN9 A;  1BR0 A;  4DID B;  4AKG A;  3KV4 A;  1O3X A;  2AE9 A;  1BR4 A;  1WR6 A;  2FJE A;  2J4G A;  4JI3 T;  4EAH A;  1KK7 A;  3AAE B;  4TV8 E;  4DR7 T;  4EYY R;  3ETV A;  1UK5 A;  2Z6E A;  4JI2 T;  1OED A;  4CXY A;  3KDS E;  2XHE B;  2NWB A;  2WB5 A;  3RQU A;  2JQH A;  2V26 A;  3GMI A;  2OA5 A;  3CML A;  4TX5 A;  5FL1 A;  2YN6 A;  5FY1 A;  4X5T A;  3V5S A;  5HXH A;  5GON E;  3ZT6 A;  1SA0 E;  5JDN A;  2BVM A;  2V7L A;  4CZZ B;  4UV9 B;  5EK3 A;  2WWV A;  4ILU A;  1SHZ C;  3ZLI A;  4AIS A;  2CM0 A;  5FKY A;  5HAX A;  3F31 A;  4EEB A;  2K9A A;  4XAX B;  1T72 A;  5C8Y E;  1FIO A;  4ZOL E;  5ABF A;  2LRK A;  3NRY A;  4O4H E;  3AE2 A;  1YD8 G;  2I6H A;  5AQP B;  4K0U A;  3PUR A;  4WBO A;  1U4Q A;  4H63 H;  2AXD S;  2D5U A;  5LHI B;  2V5D A;  2X0H A;  4IT4 A;  3K3O A;  1T98 A;  2WWU A;  2WDV A;  2X0L B;  2ACZ A;  5AQS B;  5JR9 A;  3C51 A;  1HNX T;  2HHH T;  2B1E A;  3RC8 A;  4X20 E;  4UIG A;  4WZX A;  2NTY A;  5AQV B;  4U2Z A;  3RPU A;  4GK0 E;  1LRZ A;  1HX1 B;  4LFA T;  3TLS A;  2XM2 A;  5AQF B;  3IHR A;  2NOX A;  4ADZ A;  1OED C;  5FXX A;  2BVL A;  4MLK A;  2HPL A;  2CBJ A;  2CWO A;  3EHZ A;  3VR8 A;  3FXD B;  3HL6 A;  2NW8 A;  3CX6 B;  2I59 A;  5HWY A;  2WSS V;  2XQ9 A;  2ZM6 T;  1LVF A;  2MBG A;  4ZEY A;  2Y48 B;  3ZYL A;  3JCF A;  3V5U A;  4EED A;  3LJC A;  5L3B B;  2JMH A;  1GQE A;  4X65 T;  2CHN A;  4AQY T;  4IST A;  4AKR B;  3ZST A;  4PK4 A;  4JLE A;  3AEC A;  5FYM A;  4JI1 T;  2WU2 A;  2R6G F;  1IBM T;  3SS1 A;  1LVK A;  4YSZ A;  1D1B A;  4DMV A;  2J1D G;  2M67 A;  5HXR A;  3U78 A;  4G2A A;  2WZH A;  2LSY A;  2KLQ A;  3RI5 A;  5JR9 C;  5BR8 T;  3KV6 A;  4LF5 T;  3EUH A;  4ZI2 D;  3T1H T;  4UVC B;  3E0Z A;  3TKL B;  1SUM B;  3ZT7 A;  2C5J A;  2W0G A;  5HWX A;  2XQY A;  2UUA T;  2C0S A;  3TLU A;  4IDZ A;  3LK2 B;  2LHN A;  2DCF A;  4EZ4 A;  5AQI B;  4JI0 T;  1WYB A;  3QB5 K;  2LT3 A;  3O1H A;  1XNQ T;  5DJQ C;  2BKO A;  2CXD A;  3NZP A;  3HKB E;  3K3Q C;  2X51 A;  3P50 A;  5JRC B;  3B13 A;  1ZHC A;  2ZLY A;  4H9P C;  1D1C A;  2V1D B;  3ONJ A;  4JI8 T;  4YTP A;  1WYC A;  4EV6 A;  2WDQ A;  3UU4 A;  3KVA A;  3ANW B;  1OED E;  4TWD A;  2LM2 A;  4KX6 A;  4ANJ A;  2CXL A;  3ETU A;  1X79 A;  2LOP A;  1EZ3 A;  5LGN B;  3ESL A;  5LGT B;  1D0Y A;  3HA4 A;  2RA1 A; 
#chains in the Genus database with same CATH homology
 4QHO A;  5J2T E;  5JDL A;  2CLY B;  3P7I A;  4O4J E;  4TV9 E;  4HFV A;  4XBF B;  4CI1 B;  5FP3 A;  2IW5 B;  2LHR A;  2VWA A;  2ZM2 A;  3RH3 A;  4ZHQ E;  1YKH B;  2MTQ A;  3PUQ A;  3AA1 B;  3VU7 H;  3MK7 C;  2D0T A;  4PK5 A;  3LFM A;  3EDU A;  4TN7 B;  1VOM A;  5HXS A;  3EDV A;  2PG8 A;  1NWM X;  1YW0 A;  3BK9 A;  3O1I A;  3N2O A;  2ZM0 A;  4L5G A;  4EYU A;  2E9X D;  2LSI A;  3RYI E;  4DMW A;  3KV9 A;  1HFA A;  4OYJ A;  5LA6 E;  2E9X A;  1MIV A;  2EHO B;  1IAP A;  2XTL A;  3VHL A;  5L3F B;  4H9N C;  4PJM A;  2D2S A;  2IC6 A;  4ZI2 C;  5FXW A;  4PNI A;  5JDH A;  4ZS2 A;  5LG4 A;  2YU1 A;  4I4T E;  4P0B A;  5M4Y A;  3CQX C;  4YJ3 E;  1HCI A;  3N9L A;  4O2A E;  3MAC A;  2DI4 A;  2WMO A;  4L9I A;  3ZMU B;  3I0O A;  4OYK A;  3N9M A;  2HPJ A;  4X1I E;  5KMG P;  3ZYK A;  4PW8 A;  4YFS A;  4H9Q C;  3CQG B;  3ANW A;  1MMN A;  3KVB A;  5LXT E;  4O4I E;  3ZYM A;  2A3D A;  1QSD A;  3AA7 B;  2WM9 A;  2L3L A;  3WAK A;  4C91 A;  3KIN B;  1QUU A;  2LEH A;  3Q5X A;  2VB6 A;  4UEL A;  2KMF A;  2XAG B;  3I1A A;  3H37 A;  4DND A;  3N2G E;  5LBQ B;  5TAO A;  4AKL A;  2LSK A;  1FMW A;  4O4L E;  4QWN B;  3J7Y q;  2CE7 A;  2A72 A;  1BR2 A;  4GK5 E;  3QK6 A;  3GN5 A;  1S94 A;  2VKH A;  4X1Y E;  4DBR A;  4KP3 C;  3KBU A;  3AA0 B;  2C5I T;  2KXP B;  3PDY A;  4YLH A;  4CXW A;  1WRD A;  5L3E B;  5EK2 A;  3OJA A;  1UX5 A;  3KV5 A;  3OKQ A;  4H63 V;  2ODV A;  4J2C A;  1UX4 A;  2VAS A;  4O8S A;  3UUN A;  3UUL A;  2W62 A;  4UVB B;  4HKA A;  5E0O A;  4CI3 B;  3U3I A;  2X9Y A;  1D1A A;  2EHO D;  2E9X B;  5LBM A;  2RP4 A;  4M1P A;  2EHO A;  2NW9 A;  1US7 B;  3R84 B;  5F3J A;  2ODU A;  5DQV A;  2LSG A;  4UF0 B;  3ZJ1 A;  3HKD E;  4HGA A;  2UXN B;  2JRK A;  4ISS A;  2KIN B;  4NUU A;  2P9B A;  2UXX B;  1LKX A;  4A56 A;  3CQC B;  2CA5 A;  2Y8D A;  2VK9 A;  4AQF C;  2NP9 A;  4I43 B;  5JDG A;  2X66 A;  3K8P C;  1V9D A;  5IYZ E;  3LBX B;  2YIN A;  1HG2 A;  4IE6 A;  3N9N A;  1MMD A;  4HN9 A;  3I9W A;  2W63 A;  1BR0 A;  4IHJ E;  4AKG A;  2CCQ A;  3KV4 A;  5FXZ A;  4I50 E;  1O3X A;  5LCY A;  4PJJ A;  3S4U A;  1Y64 B;  4TUY E;  4GYS A;  2VKJ A;  5HXC A;  3RRW A;  3ZCJ A;  1BR4 A;  3ZPO A;  2YU2 A;  2V7I A;  4HE8 A;  4QX7 B;  2E9X C;  1WR6 A;  2NTX A;  3L3P A;  1IJ6 A;  3R6N A;  3ZN1 B;  1OWA A;  2KWI B;  2JQQ A;  4B6X A;  3UUX B;  4EAH A;  1KK7 A;  1MIY A;  3BQL A;  3E22 E;  4AQF A;  2N1G A;  3NBX X;  4GIW A;  2ZMA A;  3GN5 B;  2V7K A;  3AAE B;  3CKD A;  2VL8 A;  4JEU B;  4TV8 E;  4CI2 B;  1HX8 A;  3IEE A;  4EYY R;  3RC3 A;  3ETV A;  5H6R B;  2WAU A;  1B7T A;  2Z6E A;  3PTR B;  2VKO A;  4OFZ A;  3ZCI A;  2PBI A;  4CXY A;  2MYS A;  4N78 D;  2ES0 A;  3KDS E;  2XHE B;  4G63 A;  2XAF B;  2NWB A;  3EVY A;  4Z8X A;  5J1G A;  2CWY A;  2LJL A;  2JJ9 A;  3T8O A;  3MKD A;  5JRE A;  2E8I A;  3FBL A;  5FMN A;  5DQW A;  2V26 A;  3GMI A;  3UTK A;  2OA5 A;  3CML A;  2N9D A;  4UF0 A;  4QX8 B;  4TX5 A;  1AJ3 A;  4E7S A;  5KDM C;  3ZC0 A;  2BDE A;  5H6Q B;  5FY1 A;  3PUA A;  3PE0 A;  2CLY C;  2W00 A;  5LNK A;  2H3R A;  3V5S A;  4BJN A;  5FY0 A;  4ZI7 E;  3NRX A;  4IE5 A;  5HXH A;  4EZH A;  5GON E;  1MIW A;  3LBX A;  3WI3 A;  3ZMT B;  1SA0 E;  4OHF A;  5JDN A;  2BVM A;  2K48 A;  2K5B B;  2V7L A;  4UV9 B;  4CZZ B;  2X9X A;  2DNX A;  3OBV E;  2YEV C;  5EK3 A;  3SWH A;  3W15 B;  3UFE A;  5L2L A;  3HI2 A;  4ILU A;  3CPZ A;  4QKN A;  3QC9 A;  2A2F X;  1SHZ C;  5L3C B;  3ZLI A;  4P0A A;  2Q9Q D;  2CM0 A;  4X1K E;  4HEA A;  2EHO C;  2Q9Q A;  3GA8 A;  4WW0 A;  5HAX A;  5ADX L;  3F31 A;  2IAK A;  1HS7 A;  2NW7 A;  2XUE A;  3ZEF B;  3VKH A;  2K9A A;  5AFU L;  2QA7 A;  3N9Q A;  1FMV A;  4XAX B;  1MMG A;  4KBM B;  3ZN0 B;  5LJN A;  2DWG A;  5C8Y E;  1FIO A;  4ZOL E;  3CWZ B;  2H7O A;  3NRY A;  4ZI3 D;  4O4H E;  3Q5W A;  1YD8 G;  4AI6 A;  3RKO A;  2HH7 A;  4K0U A;  5LJM A;  3PUR A;  4P09 A;  4WBO A;  1U4Q A;  4QXH B;  2DLR A;  4H63 H;  2D5U A;  1CUN A;  5L3G B;  3SRZ A;  5LHI B;  3K3O A;  2CEA A;  2JMK A;  4H9R C;  1T98 A;  2WWU A;  3GWH A;  4QXC B;  2X0L B;  3ZJ2 A;  5HXE A;  5JR9 A;  2LM9 A;  3C51 A;  1ZV4 X;  3BQI A;  5KX5 E;  4MBQ A;  5EZY E;  4AKH A;  1E1H B;  3ZMZ B;  2B1E A;  4PFP A;  4X20 E;  3MJX A;  3RC8 A;  4UIG A;  2NTY A;  3RPU A;  3DTO A;  5FNV E;  3AA6 B;  4GK0 E;  3AAI A;  1LRZ A;  2DHR A;  2H7V C;  2G0U A;  3F57 A;  2V7J A;  2XAQ B;  3I0Q A;  3C4Z A;  3VKG A;  5JVD E;  4FJO A;  3E08 A;  3IHR A;  5CB4 E;  2QGS A;  2NOX A;  3RYH E;  4ADZ A;  4OK0 A;  4WBN E;  2MOZ A;  2X9W A;  1D0Z A;  5FXX A;  2BZB A;  2BVL A;  4MLK A;  1S35 A;  2Q9Q B;  2HPL A;  3KBT A;  2CWO A;  3ZMS B;  4CQI A;  1NAF A;  3LK4 2;  4EOZ B;  1VRB A;  4EXT A;  3RYC E;  4IE7 A;  3FXD B;  3N2K E;  3HL6 A;  2PFV A;  3N9O A;  4GYR A;  2NW8 A;  2C5K T;  2X68 A;  4EB6 E;  3HR0 A;  3CX6 B;  2I59 A;  3CX7 B;  5IHY A;  1HG5 A;  5CA0 E;  1IZN B;  3C98 B;  3LG7 A;  4IGU A;  3CVR A;  5HWY A;  1IJ5 A;  2WSS V;  3JC6 D;  4UV8 B;  4H9S E;  3AAA B;  1LVF A;  2MBG A;  2LE8 A;  2W61 A;  2Y48 B;  3MXZ A;  3ZYL A;  2KT9 A;  3OYX A;  3N9P A;  2D0U A;  3IBP A;  3V5U A;  4HTE A;  3LJC A;  4E7Z A;  1WLX A;  5L3B B;  5EK4 A;  3H3A A;  1MND A;  2JMH A;  2LOS A;  3F2E A;  4IST A;  3PU3 A;  5JR9 B;  4AKI A;  4AKR B;  3J9X 1;  4PJN A;  4MHC A;  4ZS3 A;  2IC9 A;  4PK4 A;  1OXZ A;  2Q9Q C;  2ZM8 A;  3MZK B;  4UVA B;  4AQG A;  3K3N A;  4JLE A;  3C4X A;  3PUS A;  2XAS B;  4NUV A;  5JQG E;  4GOU A;  2SPC A;  4PJL A;  3HKE E;  4V1A v;  3RX6 A;  5FYM A;  4H9O C;  3FBZ A;  3KFW X;  5JRC A;  3ZC1 A;  3RRC A;  3SS1 A;  4BJM A;  3O4X E;  2JPF A;  1LVK A;  3ZMV B;  3HKC E;  4ZI3 C;  4YJ2 E;  2CMR A;  3LK3 B;  4TZ4 C;  2PJQ A;  3O1J A;  3Q2M A;  5BMV E;  1FEW A;  1D1B A;  1Z0P A;  2L9Q A;  2N2N A;  3D0T A;  3NZQ A;  4DMV A;  2J1D G;  3C4W A;  2M67 A;  3IF8 B;  3Q9D A;  5HXR A;  3DP7 A;  4KMC A;  3U78 A;  3N5L A;  5LHG B;  2K24 A;  2KND A;  4G2A A;  4CXX A;  2LSY A;  3UT5 E;  2XAJ B;  5LOV E;  2KLQ A;  1G73 A;  5FY7 A;  5LGU B;  5JR9 C;  5J2U E;  3FB2 A;  3PU8 A;  3KV6 A;  4UXN B;  5F8P A;  4DO0 A;  4U72 A;  2X67 A;  4C90 A;  1H7C A;  3EUH A;  4ZI2 D;  4UVC B;  4QXB B;  2Y6X A;  1U5P A;  3E0Z A;  3TKL B;  3C64 A;  5LYJ E;  3A5X A;  1UCU A;  4IIJ E;  4JUY A;  2C5J A;  5JDM A;  4ERR A;  2GK9 A;  2W0G A;  4IE4 A;  5HWX A;  2XQY A;  2DWK A;  2C0S A;  4IE0 A;  4YHJ A;  2X9H A;  1BR1 A;  3MA9 A;  2WMN A;  3OYZ A;  3I9Y A;  4IDZ A;  3LK2 B;  1HF8 A;  2LHN A;  2DCF A;  1HTJ F;  4EZ4 A;  4PK6 A;  4PAG A;  1WYB A;  4MAL A;  3CX8 B;  3AVS A;  4UEM A;  4BA9 A;  2CXF A;  3UUM A;  2ACX A;  5A1L A;  2LT3 A;  4DVD A;  3M65 A;  4EIW A;  3O1H A;  3L09 A;  5LP6 E;  3SOL A;  5DJQ C;  4FI5 A;  2CXD A;  2VKD A;  4JEH B;  5LHH B;  2L8K A;  3NZP A;  3C50 A;  3HKB E;  5HYA A;  3K3Q C;  2X51 A;  5JRC B;  4F6R C;  1ZKE A;  3AVR A;  3B13 A;  1ZHC A;  3ONX A;  4MFR A;  3DJB A;  5L3D B;  2ZLY A;  4H9P C;  4U74 A;  1D1C A;  3P8C D;  2V1D B;  4XZC A;  3O9X A;  3PUG A;  4O2B E;  2KZ7 B;  1YKE B;  4L0R A;  5ETW A;  1MMA A;  1KNZ A;  2V7M A;  4DBQ A;  1WYC A;  1ZEE A;  3JC6 C;  4PFO A;  2WBL A;  2XAH B;  4WNK A;  2KWH A;  3AB3 B;  5DAB A;  1D0X A;  3B57 A;  3KVA A;  3ANW B;  3WAJ A;  5CA1 E;  4ANJ A;  2CXL A;  5JDF A;  3BQK A;  3ETU A;  3RYF E;  5JDQ A;  1G8X A;  1X79 A;  3FXE B;  2LOP A;  1EZ3 A;  5LGN B;  2YK0 A;  4KUM B;  2LSJ A;  3ESL A;  4AXP A;  3FHN A;  5JH7 E;  4BAY B;  3QUJ A;  5LGT B;  1MNE A;  1D0Y A;  4I55 E;  3HA4 A;  5FXV A;  4ASK A;  2RA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...