4PAGA

Abc transporter solute binding protein from sulfurospirillum deleyianum dsm 6946
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
323
Chain Sequence
ESRTFLDVSNKPIVLPEHITRIYGSAPPISFMIYVIDDTPLIGVNSPQTNKDNNNGEKFLSKHFMELPILGGWHGNNIPNLEAILAAKPDVIITWDTPLLNEKTAKDLARISIPALKVNIDDSQNYPEVFRYLGRVMQKEERANALANMAQTYLDELKTFVASIPEKERTKVYYAEGDFGLQTECDRSFHSEPLALAGGNLVHKCVQNSVVGLQEVSFEQIILYDPEVIIVQNPTFYKTVFREKKWAVLKAVQNKKVYLVPKSPFNWTDRPPSFMRILGAHWIASKLYPTRYPYKIEDKVKAFYQLFFGVELSNEDLKTYFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein
publication title Crystal structure of ABC transporter solute binding protein from Sulfurospirillum deleyianum DSM 6946
rcsb
source organism Sulfurospirillum deleyianum
molecule tags Transport protein
total genus 105
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4pagA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA03
3TEFA 5FLYA 1QH8A 2M6LA 5M3BA 2X4LA 2OV1A 2Q8PA 4OVKA 3NU1A 4ND8B 5KOJA 4ND8A 1L5HA 1M1NB 4DBLE 1M1NA 3AESB 3R5SA 3LHSA 4LJSA 4M7OA 3AESA 2AFHB 4INPA 4WN9B 2YNMC 2AFHA 4UTOA 4WN9A 4IRMA 4G07A 1KAHA 5M2QA 5JG7A 2WI8A 4HN9A 3LI2A 4MX8A 4WZAB 4NNOA 4WZAA 2R7AA 3AEKB 4UDOA 4FKMA 5M29A 2OGWA 3HH8A 4FILA 1M34A 5GGYA 3ZKAA 2Q8QA 2PS3A 5KOHB 1G20B 4UDNA 5KOHA 5B58T 1N4AA 2MINB 1KAEA 2MINA 3AERB 5CR9A 3G9QA 4MO9A 4CL2A 5I4KA 3PDIB 3AERA 4G09A 5M34A 4FI3F 4LS3A 3PDIA 4OXRA 3U7QB 3MFQA 4HMOA 1KARA 3MD9A 3ZK7A 3AETB 4XPIB 1ESZA 3AETA 4GICA 4XPIA 5JJ5A 5CX1B 2XQVA 4TKVB 3AEQB 2OV3A 3HJTA 4UTPA 3AEKA 2R79A 3AEQA 4TKVA 4WESB 5JOQA 4H59A 4WESA 1K2VN 1G20A 2XV1A 2OSVA 1EFDN 1H1LB 4NNPA 2XDQB 4HMQA 1H1LA 1N2CB 2XDQA 3AEUB 2ETVA 1N2CA 5KHLB 1XVLA 3ZK8A 4MLZA 1K75A 2XUZA 4WZBB 4MDYA 4WZBA 3U7QA 1PSZA 1N4DA 2O1EA 1TOAA 3MINB 1QH8B 3K1AB 3MINA 5HX7A 3K1AA 4H0FA 2WHYA 1G21B 1K7SN 3EIXA 4FNAA 3BE6A 4TKUB 5CX1A 1G21A 4TKUA 3PSAA 5JPDA 5AFSA 2XY4A 5KOJB 1L5HB 2PRSA 5GGXA 1QH1B 4PAGA 1PQ4A 2M6KA 2PHZA 1QH1A 1QGUB 4OXQA 1N2ZA 3MWGA 4BBPA 3CX3A 1QGUA 3ZTTA 1MIOB 3MWFA 4K3VA 4B8YA 5BVHB 1MIOA 3TLKA 3TNYA 5BVHA 4HMPA 3UJPA 3AEUA 3GI1A 3BE5A 3EIWA 1FP4B 2QI9F 2XH8A 5HDQA 1K0FA 5BVGB 1FP4A 4WNAB 2YNMD 3R5TA 4WNAA 5BVGA 1M1YB 3HXPA 4PM4A 2PS0A 4INOA 2AFIB 4N01A 1M34B 1M1YA 3ZK9A 2RG7A 2PS9A 2AFIA 3PSHA
chains in the Genus database with same CATH superfamily
2FQ1A 4N5IX 3TZEA 1Y6ZA 2ZM6T 1F2VA 1WDWB 3FIJA 2Y1DA 1GQSA 4G1EB 4KPGA 3I6ZA 3GN5A 1XMOT 3QBDA 1RYMA 2OO5A 3FDZA 1T10A 2KHZA 2ZTSA 4GXNA 1QYWA 1M2FA 4CMAA 1P7PA 3AEYA 3D2AA 2DETA 2NACA 1ISSA 2VUIB 2WMNA 4CKXA 4DYHA 2X4IA 1XI2A 2GHTA 3O92A 1UFVA 3QNMA 4H0CA 5ARCA 5FI1B 1XDUA 4Z4QA 4LOKA 2CHGA 3TR0A 5DCWA 1G5QA 1TOAA 1NWCA 1B1AA 4GKJT 2P9JA 2X0KA 1HV8A 2EIHA 4H3VA 4B6JA 2IDZA 3B48A 1RBMA 1OLSA 2OCGA 2V6IA 1J00A 1AV7A 3EPHA 3EDQA 1LDMA 4MGKR 4AQYT 2ZVDA 2HU8A 4RD2A 1OFIA 3C24A 5JW6A 4RTSA 3SJAA 3MACA 1WRDA 2C04A 3JY6A 3IVAA 1CRZA 3RRWA 1JDJA 4XVUA 2RDMA 3P32A 5C9ZA 4IVPA 3JV7A 4Y9DA 2H4HA 4AKLA 3BIFA 3IIMA 4CM3A 3VR6H 2HSJA 4CM9D 4Z4IA 1C8LA 2WF9A 2F8LA 1AA6A 1Q1QA 3GLGA 3PDIA 4PRLA 4X1YA 2JZCA 4HK4A 4RSRA 2QNRA 3K2EA 1QLWA 2GF2A 1V11B 4P4GA 4HDSA 3ZE0B 5HYVA 3K3PA 1YCHA 2GN1A 4HX9A 4U00A 5EIXA 4DC1A 1PZXA 5EIOA 1TJ5A 2JAHA 1SELA 5C53B 2QG4A 3PBKA 2MOZA 4YIHA 2XGJA 1NVKA 4IJMA 4R0NA 3EZYA 1E63A 3TDMA 3UJBA 3PDJA 3SQXA 4WVLA 5BV8A 2WNIA 2VATA 4X8OA 1SG9A 5K0TA 1XEXA 2A58A 4UNPA 4EZBA 2ENUA 2VPIA 4FUTA 1EVQA 3O74A 3WIBA 4OUDA 2W2PA 3KVNA 4LECA 1P9LA 5KQGA 1UURA 2IGBA 4EQ6B 1GM5A 1U0LA 3VV2A 3I28A 3PNKA 4UNNA 1QP7A 1TAHA 1Q21A 3PJDA 3FUTA 4NOJA 2CHVA 4CLEA 1MQAA 4MFRA 2ZYRA 2BPOA 4YNBA 3RRYA 2AEFA 3N8KA 3GYBA 3FZMB 3WA6A 1H1TA 4ZI2C 4UU1A 3OE1A 3T7KA 1FFXB 3RYFE 4C08A 3N87A 1SB8A 5DHTA 3QE3A 3ECSA 3C5CA 4PNIA 6CHYA 3QQ5A 1HNZB 2JAQA 2QG9A 3HMQA 2XUZA 4PF1A 1CSEE 3DFFA 4YAJA 3B5EA 2DSNA 1M0EA 3S6JA 3EXHC 2JI4A 4MV1A 2Y6XA 2JASA 4BBPA 2Z3VA 4NU0A 1RI3A 3LQYA 4BQQA 1DZ3A 5JAHA 3HB4X 4C7BA 4EHIA 4BA9A 3BWCA 5DN9A 3OURA 4JFRA 2AC2A 4BMDA 3HO8A 2WTEA 1RKVA 5CW2A 1LX7A 1M62A 4EHHA 5FL1A 4JEUB 1T9GS 4Z53A 1KVUA 1HZZC 5CVTA 4R9VA 1KI1A 1ZXBA 3IAHA 3TG2A 1VI2A 4B3DA 3WK5A 1V35A 1R3UA 2TYSB 3BAZA 1QXSA 4C5AA 2GUWA 4FW8A 2CYCA 3JATB 2DFNA 3LNCA 4NEQA 3ZWOA 4NNJA 5AJHA 1HUQA 3HL4A 4RZIA 4EZIA 1Q44A 1FJ2A 2DPHA 5F3JA 1THTA 3IP1A 1E32A 4R8LA 1HYBA 4K28A 4BNHA 3I1AA 4YAUA 3GJRA 1R16A 4P08A 3KL4A 1DV2A 5K8UA 1MB4A 4TMVA 4DMKA 1JSLA 2HM7A 3B1KA 3MF4A 2OPBA 2O2XA 2O19A 2XZLA 3UJ7A 4HUTA 3NKLA 4ZVMA 1YL5A 5FOQA 1J9GA 3QY9A 3DFMA 2C94A 2WU1A 4G1BA 1NSYA 1E2LA 1Z38A 4MV7A 4BXOB 1GZHB 3AXJA 3MB8A 3RO7A 3D7MA 3VR5H 3LHSA 1Y3BE 5FKYA 4M22A 1JT9A 4D6YA 2YYYA 5EE0A 2XYRA 1W93A 4DCOA 1S94A 3Q5XA 2CVHA 1V9DA 2XOKD 2HQBA 1S3GA 3M5PA 2P1DA 2UXDB 4BLUA 5JVDA 2WHQA 1VYTA 5JY6A 1DIAA 4OXRA 4U3CA 3D4LA 4MA0A 4ZCTA 4EKDA 4DILA 3P19A 1A9YA 1F12A 5D1HA 4EPTA 5I7EA 4OREX 4M6WB 4HAIA 2O07A 2EX1A 2ZIZA 1MMFB 2AQHA 2L2QA 3M82A 1R8JA 2QPTA 5KWSA 2FQYA 4O8ZA 1QVRA 1N0UA 4G4IA 2VF5X 1YQEA 3VUFA 5TS2A 1N2XA 3JSXA 2Q1UA 1IQRA 3KFWX 2A9UA 2VP0A 1GVHA 2NO4A 3HKEE 3QSGA 2FJAA 4RTRA 3FH0A 1PVDA 4BJNA 1BROA 2HD4A 2QDKA 5DTRA 3A9RA 2MSNA 4DZTA 3UUXB 1A4XA 2QNIA 3HJUA 5KCMA 5JHHB 2Z08A 2O14A 3IP7A 5BPFA 3NTRA 1EP1B 4HUQB 1Z35A 4E07A 3IXQA 4E2FA 5MGNA 1TQ4A 4KMCA 4A8PA 4R54A 2DWKA 3UB4A 4ZO8A 3VI3B 4FE7A 3THWA 3T7JA 5K8VA 1D9ZA 2ZBEA 2YJZA 1HC7A 4PG6A 2BFOA 4L27A 4MV0A 3ELUA 3MGBA 4ZVNA 4X5TA 3AG5A 1YRQA 3BXEA 5F5WA 1U9YA 3RRJA 5FL3A 3FX2A 3F5SA 3ITNA 3DDCA 2A4MA 2A88A 1XEAA 4BEBA 1JDSA 3DDSA 5DRTA 2JIRA 2O54A 3WYFA 2V97A 4PSVA 2PSDA 2E2AA 4HGOA 4OXXA 3TUIC 2I4NA 2ATIA 4ZP1A 4C7OB 4GYKA 2IH4A 5FIUA 3H2BA 4Z51A 1FUUA 1ZL0A 3PHGA 1KVSA 5U1PA 3OZTA 4GMGA 1SJ9A 1UWVA 3VOTA 3D3JA 1Q83A 1V4VA 4OU5A 3QM1A 4M9QA 2D2FA 2P62A 1D4FA 1GLNA 4WZAE 1E2UA 3LZ6A 4RQUA 3A28A 3G5TA 1H3EA 5IZCC 3P7MA 1YZ3A 3WIVA 4OG2A 3B52X 4FJ1A 3FTQA 1IXYA 3LPDA 4TTRA 4MEAA 4EG4A 3RD5A 1G8HA 4CU5A 1WR6A 1DQNA 3VYVA 3UKOA 4H9QC 5I3ZA 621PA 1E2BA 2IYAA 4PWYA 4A82A 5AHWA 1J20A 2VS1A 3HLYA 2VDJA 3AVPA 4LPSA 3CKMA 4NV1A 1MRNA 5LLSA 5CXUA 5D5QA 3UXMA 1AKRA 2IP1A 3MAGA 3P27A 3NWBA 2W2MA 1PJBA 1A7KA 3QTBA 2NTYA 1GPH1 2WS3A 3AMVA 4J1NA 1FBNA 3UQ4A 3UKDA 3E05A 4RKQA 2DWPA 1FQWA 2P0YA 1JWLA 2GESA 2A7QA 3TAUA 1N33T 2PKQO 4CJXA 3WMWA 4OP2A 1F60A 3EC1A 2IYXA 3JR3A 3USES 2GGSA 3R4VA 1N36T 3GLQA 3M6MD 2XQ8A 3GLFA 4P7FA 1AQJA 1QHYA 3G59A 3FUVA 1W4AA 3SYLA 1KEYA 5AXDA 2QBYA 2A33A 4R7GA 1VRBA 3LLSA 3ZMSB 1XROA 2OC9A 3BCSA 2P9BA 2J3HA 4XX0A 1DFHA 1I0ZA 5JNTA 1I2MA 4R8KA 3RVJA 5MFZA 4A1OA 3VPCA 4Q3OA 3PRKE 3VYSB 2NTVA 5CJJA 5AXCA 5CTAA 1WSDA 3EEQA 3CV3A 4TLDA 1YVPA 4OIMA 1XVVA 3WRYA 2D1QA 3HCPA 2XMSA 4GRAA 4FU0A 3W6ZA 3I34X 5BSFA 2WTUA 4XFDA 3GRPA 3II6X 3GARA 1O0CA 2HA0A 1SA0A 4IL9A 3D9QX 4LDJA 2OLJA 4E5NA 2BKVA 4WXEA 1DKLA 4IXTA 4F3NA 1KH2A 1WXHA 4X3PA 3KWJA 5E3HA 2XQFA 1K3UB 4QXOA 1YE3A 1HTTA 2CNOA 4QDTA 5LD2B 3EULA 2GARA 1S5PA 2HMWA 3EF3A 3TLBA 2CHOA 4LJ9A 1DU2A 1VG1A 3PB3A 4MGEA 4XWYA 3INRA 1PWEA 2ZJ1A 4MR7A 3N2GB 4KX5A 2Z8YA 1OXTA 5LCYA 5JRDS 1J1IA 1CS0A 2G9UA 4IQFA 3QKRA 1YR6A 1SVIA 1ZD3A 3WLQA 1B0ZA 1H2BA 2PANA 2YZGA 4QXQA 4Y2SA 1CDDA 1RZRA 5JR3A 1EK2A 5CDFE 4IDZA 2B3TA 4QJIA 4V0LA 1BRTA 1X1TA 3QPWA 2JFHA 3I39X 2JJ2D 4LXGA 3LQKA 2LJLA 4GL2A 1P1CA 1G8FA 3PF8A 4JQOA 4IIYA 5AP9A 2VYND 3VDMA 2REOA 3CN7A 4LSGA 4H6PA 1XXHA 3Q8MA 2I6FA 3OF2A 1FUKA 4U3JB 4FD3A 3GBSA 4DIOA 1IQUA 2OZLA 3H3MA 4KIJA 3RUHA 4JBXA 1HM5A 3UUMA 1YKGA 2XE7A 4LXXA 3VOAA 2LW7A 3SLRA 2EFDB 3UHPA 5LWHA 3H1EA 3OE7D 2FI1A 3CPEA 2VUHB 3NOVA 3IPLA 2DZDA 2YQZA 3AESA 1I5RA 3ZKWB 5HRAA 2IIBA 4H9OC 3AHEA 1ZLYA 1E3EA 5G0SA 5EFZA 4CF3A 2QW8A 5CR9A 4ENVA 3ZYKA 3W5UA 1QORA 2PU5A 4CGYA 2DUNA 2GA9A 4M1QA 4Z1OA 3HDJA 1U7ZA 3AL3A 3V1NA 3LCJA 1QV6A 1HE8B 1D9XA 2L42A 3S1LA 4CMIB 1H6AA 5DW0A 3VRAA 2PL5A 2I6XA 3SYRA 3T1YT 4HQFA 3OPXA 3AIIA 3U44B 3G2JA 1ZI8A 3OZCA 1U2PA 2I7DA 2OCXA 3HVRA 3WS7A 1V8FA 3FYCA 3DMPA 3R7WB 3K9WA 1UMDB 3U7HB 2B7CA 4XDGA 1L7OA 4J1SA 4HCJA 1J0AA 2WU4A 4PG8A 3QVLA 3MJ4A 4AM8A 2PBLA 1E0SA 1HE1C 2PJRA 1GGFA 2JA1A 3ZWCA 1D1TA 2CKMA 4UELA 1DU4A 4UQPA 4XPZA 1TQ8A 1MC8A 1N92A 4RDCA 4E5YA 2P2GA 3VXKA 4RVDA 3A6KA 4B6GA 1WZNA 1Q1GA 2B78A 1VMIA 2G6TA 3C7KA 4V39A 2WQZA 1RYHA 3UT5A 5CA1B 1HG0A 3SHOA 5HX7A 3NM4A 3HXMA 2EHOD 2C99A 2W5UA 2CZQA 1PWHA 3KC2A 4RKWA 1XALA 4WKGA 1MPTA 3WHKA 4C20A 4GW3A 3NDIA 1E64A 3AE5A 5AVXA 4PTYA 3PXXA 1Z7YA 3I6YA 3CH4B 1DARA 5GIOE 1IUOA 4MHTA 2E5LT 2SPCA 1BR1A 3BH7A 4P80A 2PZBA 4XR9A 3U3JA 3A1NA 3WFZA 3KU1A 3ETEA 4FGZA 1I3NA 4ZZBA 1TVEA 2C3MA 1TTTA 1D4OA 4TV8B 5I9IA 4N5DA 4A92A 4Q9JA 4O29A 5JJBA 2OK7A 1COWA 3V5UA 2VKHA 4OAOA 2JFBA 1KFYA 1TXGA 1TTQB 4NICA 2HQOA 3DFIA 2VG8A 6GPBA 1WVGA 5CDYA 1ZQ9A 1UGOA 1XMVA 3K1AB 3CA8A 3C0KA 3JVVA 1BMQA 1QGOA 3PFWO 2FOLA 3ZS8A 1DO2A 2Y3IA 4JQSA 4NQZA 5HDQA 4N01A 1I6ZA 3CO5A 4AYTA 3CMLA 4BE4A 4Z0HO 1NF8A 4B75A 1KMQA 3BGDA 3U3DA 3HJHA 3R6GA 4Q1DA 3TVYA 4W5JA 1A7JA 3P5BA 3UQZA 3F6RA 1Z62A 3LRTA 2NWBA 4G8JA 2NZJA 4PC1A 1OWOA 4L8WB 4JT8A 4MUGA 2PX8A 3FPKA 2O6LA 4GMXA 1FYFA 1A50B 3IE0A 2GHIA 5EPOA 1IXKA 1GKIA 2IBSA 3T1TA 3ESRA 4TOIA 2QUZA 5DTIA 2BVMA 4HRXA 2PO7A 3ADKA 2JD2A 4OQEA 2QL5A 4OGWA 1GFSA 1E2AA 3SR3A 4XCXA 3DZBA 3ONXA 2BEWA 1X7ZB 1SURA 4QQ8A 3ZHTA 1NUUA 1DAMA 3UEOA 1SHKA 2WM9A 4R9NA 1HLGA 4R2KA 2R11A 3EGVA 1YJ5A 2YWDA 2PS9A 3AFOA 3TD6A 2JEYA 2OV1A 2GKOA 3OZSA 4D41A 1QIMA 1NXTA 2IPNA 3KV6A 2FFRA 2F59A 3CNBA 4FK8A 1XP5A 4MQ5A 4F8YA 4GPTA 4ZO6A 2ZAGA 4S12A 4RCVA 2HCFA 1JR6A 2P5YA 1BA2A 1E8NA 3NJRA 4GICA 4EKEA 3FFBA 2HU2A 4TV9E 1C3OA 3BWYA 2EHJA 3GZJA 4QDUA 2JLUA 2FP4B 1JLSA 2ZYTX 3H9JA 5JREA 1DCKA 4UE2A 3RGWS 5KTTA 2G9QA 2DKNA 2J31A 5ELMA 1VLJA 4XZCA 4OHOA 2MAWA 1ZZGA 1W36B 4MQ6A 1T9CA 1ZGAA 4URFA 2LNDA 5TQJA 3QMWA 1OXBB 4LE1A 3V4VB 3A58B 4HTAA 4X1KA 1SHZC 2BWJA 2M1ZA 1KYWA 1U2GA 4GR5A 4IZIA 2HRQA 3T7EA 2WLSA 3IQEA 4RDIA 1ZXLA 4PQYA 5B1IA 1VDZA 1X1EA 3OSUA 1UMCA 3JWHA 2YU2A 5HVNA 3JU3A 2DQZA 2QVXX 5IM4F 1A9RA 4BNUA 3PPWA 1KEEB 3E9YA 3OTGA 4RM3A 3D81A 2C5HA 3UOGA 4YV0A 5FF9A 5M34A 3L49A 1WBBA 2LWIA 1SHUX 4U8HA 1EE2A 5IP5A 1KIAA 3WBFA 4YBZA 1ZHHA 3O8OA 1QH9A 1BGVA 1BJTA 2ZCUA 3U17A 1JKMA 5BQPA 3WL3A 2ZUUA 1PJ2A 4QNNA 1HDEA 1NLUA 1ZITA 2JIMA 4I6GA 3VDQA 1KAQA 5CX4A 2P6UA 4ADZA 2ZAOA 1FJGT 3OAAA 1JTVA 1RKQA 3QEBZ 3ZCSA 5JNUA 3H1BA 1QGUB 1EVYA 5TVKA 3CW2A 1GUBA 3IILA 4MW2A 4B3RT 2D1YA 2G9ZA 4OYYA 2Y1WA 1VSBA 1A9SA 4EECA 2A1UA 1QR6A 3OKCA 2XGMA 3SQMA 3CUTA 1SXJE 3DE5X 2GPJA 2ECQA 4Y67A 1RRMA 2BFMA 2BV3A 5CB4B 4GYJA 3WGOA 5HXHA 4OHXA 8MHTA 2GCNA 1HS7A 3N76A 4JC8A 2ZT5A 1XK6A 2V1UA 1E9SA 3VVMA 4I55B 4EF4A 4DOMA 3TTXA 4A6DA 5HQ3A 3R0JA 4C4SA 4D45A 1H1DA 4EY3A 2Q8NA 1E1CA 1T9HA 4OF4A 3OIGA 4Q1EA 1E3WB 3IDOA 2C92A 4HR7A 1X42A 2XV1A 1MB0A 2GETA 4Y2VA 5KDDA 3ICEA 1LX6A 1RBYA 2CK3D 1JE1A 4DS3A 4BWYA 2CLMB 3PUIA 4C4TA 3R41A 5E3JA 1R9JA 5JSHA 1K6XA 4JB3A 1LLDA 2QB5A 2IEAA 5F76A 5G1OA 5L4LA 3FOZA 4S2UA 5EKSA 4PFSA 3H3JA 5AK3A 4BFVA 3PHBE 2RCYA 1C29B 4EJSB 2OENG 2ZAMA 4EX7A 5DI3A 2BSAA 4DR6B 4NS4A 4Q3CA 8ABPA 2IWRA 5B64A 2TRSB 5B37A 2H1CA 4YT0A 4F60A 4EARA 1YT5A 4UMDA 1BD4A 3Q5WA 4P31A 1GGEA 121PA 4LDNA 3HRKA 4J76A 1YVUA 5LGUB 2VOEA 4R3NA 2C0PA 5HUJA 3WYDA 4KZKA 3LVFO 4KFUA 3WB0A 3ZHOA 1OIVA 2YCLA 5AVWA 4WK6A 5AI0A 4LGMA 4AQGA 3RBAA 4E2XA 1L6IA 5A3SA 2ATVA 4FR2A 2XAHB 4JFAA 2GO1A 5JYEA 3F8TA 4OEHA 4BB9A 2XQIA 1FNDA 2PSFA 5PGMA 4KYIB 2A2FX 1U6JA 5JTGA 2DKFA 3PVSA 2QN6A 2QIPA 2QRNA 1D1CA 4YRKA 4H0NA 2NUPA 4RVOA 2XGSA 5CNMA 5CJPA 3DKRA 4IH4A 4BL5A 4IIJF 3ZWXA 3EG9B 2ON6A 2VDNB 1VIVA 1B41A 4F6RB 1Z0SA 1XU4A 4FBLA 2XB2A 3C3YA 1W5EA 3ZBQA 3HO6A 1G3MA 2Q0XA 4ZVSA 1KDRA 4WNKA 2IF0A 1BJRE 2LKGA 4UBJA 2ZVQX 3L82B 1YASA 5J1GA 2XVXA 1KYVA 1ZGZA 5KINB 4DIDB 3EZ6A 1JLRA 1OX4A 1VKHA 3H16A 3KBBA 1DJLA 1HLDA 1S2NA 2B69A 1RWBA 4CTNA 3V46A 3WLFA 2WJYA 3JQ9A 1EWTA 5J2UF 3NVDA 1HDXA 4II3A 4NQRA 1GTG1 4QARA 5IK2D 1U5BB 4I8XA 4CTKA 4BKPA 4IDFA 4YT4A 3QC9A 3VC2A 4FYXA 2V4MA 3K20A 1L5HA 1CF4A 5ITZA 4XJSA 1YF3A 4L5JA 2G5GX 3ELWA 3O4IA 1NTRA 4P35A 4FKMA 4BQOA 2BF7A 1TZCA 2Y4NA 2BKPA 1VBMA 1USVA 2AK2A 2R8YA 3NWJA 4LYHA 4ZO7A 4FI3F 1IAVA 1E5LA 4E88A 3C3KA 4YMUA 4ZRDA 4ILCA 2ZJ3A 4RK5A 3UW3A 2JEOA 3U2QA 1R50A 3PPVA 3O91A 4K9NA 1TECE 2QD5A 2IJGX 1RHMA 3NEYA 3O95A 1T8TA 4TZ6A 4MMZB 4O4JA 1D0XA 4YJFA 1JXAA 2BMDA 3AVWA 5ITVA 3ABZA 2DH5A 5U4QA 4AUEA 3ENWA 1Y8QB 2N75A 1XR3A 2E9XA 5GP1A 1E2MA 5A06A 5AW8A 5GIPE 3A6PC 3QK7A 5LJNA 4RPJA 4XTRA 2DKOA 3QVJA 4JI2B 1TJNA 2G1JA 2B76A 4ZJPA 3OQIB 4D26A 1TQ2A 2P77A 3HEMA 1A2BA 1JXOA 3KB1A 3JAKB 5JUWA 3CN9A 2CE2X 3QX7A 4JI6B 5F78A 1Y1QA 4PVDA 1VI6A 2YRWA 3KTFA 5AI9A 4F6LA 1QUFA 1MRZA 2Y9PB 2ZRAA 1W36D 1L5WA 2RARA 4ABTA 2IC6A 1DX6A 3KSMA 4OHVA 3Q7SA 2VASA 1N2CA 5BSTA 2VK9A 4F6CA 2YVAA 3GJ8A 5T3UA 1Y9AA 1TU4A 4D5GA 2X67A 3EMVA 1OMOA 4HDOB 2DUJA 4PGMA 1SU6A 4YMSA 4S0ZA 4YJHA 1B2LA 1PQ4A 3W5CA 1KVQA 5C8DA 1TKAA 4KYVA 3WRXC 3RNLA 1ENPA 3MZ0A 2R84A 1PGPA 3P9ZA 2OCLA 5FMNA 2GLTA 1Y6QA 3PTZA 3PXAA 1MQ8B 4CMCA 3WLAA 5LJLA 1QBGA 4D9HA 2WIAA 3PPXA 2FY8A 4YRIA 1PLJA 2OGUA 5L9AA 1N2EA 1KYXA 4NECA 4CMEC 4F21A 2ZXUA 3QNUA 1Z47A 5C46F 2Z1MA 2PKQP 1PGOA 3RTCA 3EB9A 3E58A 4OUKX 3S29A 4IO1A 2F55A 5HIIA 3B8EA 3GC6A 4ZCRA 4OH1A 1RDFA 3VZRA 3G2MA 4LTNA 1RHRA 1HR0B 4DLNA 1OBHA 5LJIA 2G0TA 3U0BA 3SFVA 1NWMX 3HKCB 4KQMA 3IB6A 1ZM7A 3EF0A 2Y48B 4NFLA 2C9OA 4I14A 5ENDA 4L2IB 4MWBA 3IPAA 5LJMA 1P2DA 5EJ7A 3EPJA 4FN5A 4KQIA 2FCAA 4NPCA 1CRWG 4RETA 2OFFA 1UBTS 4B6XA 2QZ9A 1U2SA 4BVHA 2EGGA 1PJ8A 2BVNA 4WNIA 4HAYA 2CXFA 3WNBA 5K8LA 2YQ5A 2DFVA 3ROXA 2XMRA 4RGQA 2R1ZA 1MO4A 3IR7A 4KB5A 1D1SA 1VSQA 1GPKA 1V5FA 3KYCB 3OJWA 3AHGA 4MJ3A 3B3QA 1X7YB 3QXSA 1OPRA 3EH2A 4OKSA 4PCVA 1MF7A 4DXDA 1N77A 2AOXA 4DV4T 2EXXA 1G9TA 4UVBB 3CRZA 1VSVA 1CUHA 5TJ9A 1X3SA 3OOSA 3U4QA 2VO1A 1XN1A 3I73A 3UWOA 2YFQA 5A1LA 3I6QA 5LP6B 4KRYA 2W98A 1LI7A 5EJIA 4CM8A 5EXXA 5FH9A 4ID3A 4ZI5A 2LKDA 3QOXA 4FNGA 4B73A 2ZS8A 3C85A 1CDZA 3QFHA 5IEBA 1FY2A 3K8YA 3VU3A 4IDBA 3DD1A 1SHLA 2WK1A 5DN6D 1J0EA 1AKMA 2QN9A 2PWYA 4M83A 3B1WA 4Q18A 5JRCB 3MMXA 2ET6A 4UTRA 3B3JA 2V58A 1HMYA 1LBSA 4YK7A 5CAEB 5BSGA 4R16A 5C4GB 2AXPA 3GMTA 1Y6GA 1U81A 1PFWA 3L8CA 1HDRA 1J09A 4H9PC 3ZKAA 4WXRA 5C5IA 2FSIA 3ES9A 4LGYA 4MYHA 3WQBA 3QWHA 3MXZA 4X61A 4PYLA 3U37A 1NBHA 3AHJA 2YDQA 5EESA 3RAEC 2O7QA 3BMQA 3G1WA 5IDYA 1VJTA 5AKXA 3DEJA 5IUJC 2IOFK 1SUMB 4BNGA 1MR3F 4P3KA 4BO9A 2P6NA 3JWGA 3G0DA 1J2UA 3ILHA 3D0OA 4OFXA 3ZBTA 2J9RA 1IBMB 4OJNA 1REQB 3QKSA 1N5LA 5JXHA 2XVMA 3BC1A 5HXRA 2JD0A 1DRWA 4JLAA 3EFOA 3PYLA 1ZLXA 3HBNA 4PHHA 1UDRA 3PITA 3V8VA 2PLRA 4ISCA 5A02A 1NBWB 2H52A 1BXGB 3LI2A 4H7JA 2V26A 1B0UA 4D3DA 3T3EA 2PN1A 1ZN2A 3ZH9B 4HYYA 3UIEA 5FL0A 3NYRA 4M1OA 4R9RA 3DULA 2OHJA 1Z4MA 1GPWB 2V0GA 2YEVC 5J2TE 2I4LA 1HDOA 1J70A 4P3OA 3AETA 4ZYTA 4WH0A 1YE8A 1MGOA 5L7TA 3GPIA 3CZ9A 5KSPA 2RFLA 3IJPA 3D4NA 4RJIA 3VNSA 3ACBA 2E5VA 3QFSA 4BNVA 4E46A 5LOVF 3DP7A 2CLEB 2WJWA 4FMPA 5C3UA 4LW8A 4FC7A 3UCEA 1C7QA 1UL1X 1IN8A 5K6RA 4U2KA 1UXHA 2W2QA 2XM2A 3N7AA 1ATIA 3EDYA 1G6KA 3MCWA 3EXEA 3LUGA 3HSYA 3ZNOA 2ZITA 3ZPOA 2V6YB 1F4PA 2DT5A 3O2NA 4NIQA 4ZOCA 2CA5A 1K66A 2GK3A 3DFKA 1PZHA 5IAAA 2OGSA 5H1YA 4MI1A 1B15A 1ISFA 4N65A 3BUSA 1LSJA 4F93B 3GFPA 3IKTA 1QYCA 3NC4A 4AUNA 2R79A 3R09A 2X9YA 3MWDA 5C7IO 1ECLA 1M2JA 3H99A 2OV8A 3OCCA 4N3GA 5LB4A 4HNAA 4NYJQ 4CLHA 4NBNA 4IRXA 4BFSA 2BRUA 3KQVA 4NFYA 1E4EA 4R2XA 1N7HA 1R0RE 3SBXA 1CFJA 4BYGA 2P9QA 4J0CA 3N2OA 4DGQA 3FZKB 5ELLA 2R8XA 4O4IF 1FDOA 1XJQA 4L4XA 5EMKA 2HLNA 3GT4A 1O96B 4LKRA 1WULS 2D7CA 4N03A 5E7IA 4ZI7F 3UTKA 3A3YA 4MYUA 3GFSA 3L7YA 1XTKA 1LNZA 3KU4A 2WHPA 5HK8A 4BLOA 2N2NA 4B45A 2Q1SA 4HF7A 4I2NA 3H1PA 3OG9A 1RPNA 4IUCS 4I9GA 1CV2A 2NUBA 5FULA 3TIGA 4AXBA 3DKVA 3PD1A 3Q7IA 3TD9A 3L77A 1BCRB 1IJBA 4KITB 2FK8A 1HYEA 1GUYA 3NAGA 1MA3A 4I1VA 3CUKA 2XXJA 1WM1A 4P7BA 4FCCA 2I22A 4B46A 3H13A 2WJIA 1X1CA 3A9CA 5F23A 1VE1A 1JU3A 3ZU6A 3QUTA 5EHIA 1OVGA 3GLUA 1HE5A 1ORWA 2H48A 2EFCB 3UT6A 1NUSA 1Q1EA 3NZPA 4FLFA 5JSZB 1LJ8A 4J3FA 3I0OA 4B9AA 1YIOA 1YQTA 5AHKA 4U9HS 2HNBA 1IY0A 1CUIA 4Q47A 5K0JA 5KDMC 1FCJA 3GR6A 3AQIA 3I62A 5IHYA 3L7NA 1Q57A 2V7QA 4WLEA 2GJKA 3I05A 4BO4A 3D5TA 2BG9A 1W8IA 4J6FA 1GDHA 3K09A 5IAKA 4UJ5A 3KTAB 1C7JA 3HJAA 1EVJA 1S01A 5DABA 3LT1A 4I2VA 2GVZC 3FMVA 3DP9A 4MR8B 2X6RA 4A0FA 3VX3A 5BVHB 1MEOA 2QI9F 4J4TA 2G9RA 3W2GA 1BCSA 3VRBA 2HRDA 4E5KA 1SQFA 1IJEA 3DZCA 1ESEA 2IIPA 4RNDB 1F48A 1Z4PX 3DWGA 3H1FA 2B61A 4Q9DA 5IJAA 4CEHB 1FDUA 1H7CA 4F4FA 2X9LA 3FGNA 3D0QA 4J2HA 2H3HA 1FRQA 4LDRA 4R2HA 4AQ7A 3PUWF 4H63H 4GI7A 1RKBA 1SVOA 5LIPA 4G4GA 4E33A 2BS4A 4ZDWA 3O8CA 5I4CA 3T35A 5IJWA 3MA9A 1U6KA 1M0WA 4BNZA 4CKCB 2QUJA 2IA5A 2PBIA 4IDHA 4I5GA 4P3NA 4YV7A 5IVKA 3M4YA 1WXFA 3T4EA 3O9VA 5JAUA 1RJDA 1YE5A 2R7MA 3THOA 2FZ5A 2C0QA 5BWOA 3FRJA 3BL5A 1MJNA 2A4KA 4HB2A 1PK8A 2FPPA 1VDMA 2KI5A 4MV4A 5FOSA 2VBFA 3PKJA 5AHRA 3S2SA 2XB4A 1MABA 1QSGA 4BO1A 1DJQA 4HDRB 4W6QA 3MS2A 4JT2A 3K6SA 1E9RA 5D3MA 2OESA 4FMBB 3FR7A 3PNOA 4CL2A 3K9GA 3L4BA 2J85A 3VNRA 4KGVA 3H4VA 3HWX1 2NT3A 4KLZA 4QGAA 4QQFA 5KX5F 5E6RB 3VZDA 5BOVA 2ZDQA 4NK5A 2Z57A 3CGGA 4DM3A 5IS2A 3RSOA 2XCSB 5E9JA 1JQ5A 4GX0A 3FMGA 5KJFA 3HKEB 5JWOA 2XODA 3UGTA 1O97D 3KEGA 3CF4G 4F8JA 4M87A 1XRNA 3MWGA 4PVCA 5JYBA 2JLWA 4KRFA 3P2OA 3QU5A 3BGVA 3KPVA 1EIWA 2VK8A 3THRA 1WXXA 3WO0A 1TMGE 1XZFA 3VO9A 1Z6GA 3I01A 3A2NA 1ZSVA 2J9XB 2GBPA 1G8KA 4ARAA 1NNSA 5C5EA 1YQ3A 3CWZA 4MX8A 2DLDA 1DEKA 1BVUA 1VJCA 4AURA 5KSWB 4CI2B 1I4EB 4A27A 1XLUA 4NMXB 2P2SA 3A6DA 4MUXA 1R1DA 2BKEA 1K3TA 5CLIA 2MYUA 1TVMA 3OIWA 4P5PA 4PLHA 2XD9A 4JJ7A 3OUZA 2R8EA 2K87A 2PY6A 5HEOA 3QB5A 3CTPA 3AEKA 4DANA 3T1HT 2G1UA 3BILA 2V7KA 2JI7A 3FBZA 4EAQA 1N1GA 2AOUB 3E18A 3T5CA 2C2HA 3DC2A 1VBFA 3OT5A 3PKZA 1F38A 2J4CA 2VH5R 3SAJA 5K03A 2JQQA 1RWMA 4KFRA 5K6AC 1JDBB 4KWIA 4P1NA 1ODFA 1U7WA 3KFLA 2R66A 2Q9BA 2DPXA 1F2TB 3UULA 1VA5A 3Q1KA 3BB3A 5H02A 3B3FA 5ANRB 3FVWA 2OLEA 2ZDHA 4PXSA 5EKTA 4DA0A 3LFUA 4WZAB 3BMXA 2GPTA 5BMVE 3TZKA 4M9SA 1KPIA 4UBIA 4KXWA 4BVFA 1IUKA 2Q7XA 1BN7A 4RAQA 3SNKA 3AI3A 2P3OA 5FWAA 1TEZA 2ADMA 3EHDA 4LHVA 1G66A 1MTZA 3OY2A 4P4SA 1ZNYA 4V2IA 1P80A 2QJOA 3ET4A 3IDQA 2JJ8A 1EVLA 4OATA 3JVUA 3K92A 5CCDA 1GV1A 2GA8A 2N1BA 2PBRA 3GXBA 2CJXA 3V1TC 3EPPA 1OLOA 3RS5A 2YZ7A 5FAKA 1C0PA 2N9DA 3KBUA 5B12A 1SK9A 5AW4A 4YY3B 2WAYA 2B7LA 2GK7A 1SU7A 1NZDA 4XEUA 3LA8A 1ZP0A 2EQ5A 1QS0B 3GI1A 2HBZA 3UC9A 2XOXA 3JPWA 3TEFA 1T4DA 2J8ZA 2HJVA 4J9UE 4OQMA 4TM7A 2ATXA 3FUWA 2NSDA 4NYIQ 4NDAA 4A6XA 4OLAA 3U31A 3PYXA 1E3LA 1YS1X 1VM6A 3WC4A 4M1WA 3PNYA 4MQEA 1D2HA 1H2HA 1T0UA 3AB3B 3UAYA 2ZRDA 1L5GB 2Y1EA 3S8EA 5F12A 2JPDA 7AT1A 1DCFA 4FXOA 4Y1EA 3QYFA 3TOXA 1SEPA 4MKIA 4KLNA 3WNVA 3TRIA 1FQJA 2QT9A 1KDOA 4ROTA 3UQ7A 3CPHA 4IMJB 3ONWA 2GPBA 1QAOA 2WAMA 3K0KA 2AJTA 5SZJA 1X80B 2Q50A 3FHNA 4J0QA 2HMTA 2Z98A 1V16A 4Y6GB 2M6KA 4G8DA 1T34A 2EHOB 1A8IA 1AKVA 3FHCB 1AO3A 3QXCA 3ROQA 1WJGA 2YTZA 3N0XA 2G9NA 1AA9A 3SIWA 2XTNA 5IJZA 4ZU6X 3TQRA 5EMHA 1SKAA 4QECA 6Q21A 2D74A 1ZHOA 4K03A 2JZNA 3KELA 3I6BA 1KAHA 1VA4A 3UGJA 4JLOA 5CCBA 3QEJA 5MDHA 1R64A 1XMQB 1NOJA 2QPAA 3PFFA 4NBLA 2BFCA 2AN4A 3I6MA 3ILYA 3K9HA 4TYPA 4V02A 4HZGA 1C14A 3A0UA 4DMRA 4KR6A 3W3AH 1NMSA 1R6TA 1KS9A 1KP3A 3ROGA 3CQGB 3Q87B 3H3XA 5KYVA 1SGWA 2AHOA 1RCFA 5AVYA 4QRIA 3IP5A 2F8MA 3D8BA 4F8EA 4YB8A 3IRVA 4BJ6A 2B37A 2WWRA 4MQFA 5D01A 4AKTA 4M9UA 1JJAA 2PRZA 4ZOLE 3T0GA 3G0HA 1E59A 3GY0A 2QAGB 2VKJA 5EWJA 4HBZA 1VIMA 3U7GA 5HUHA 3B1ZA 1I5EA 5FUQA 3A4VA 3NI2A 4WADA 3U7IA 4CWAA 1OROA 4MKXA 1Z39A 2BGLA 3S2EA 1T4CB 3ENQA 3V4LA 3LK3B 4FOPA 5JC1A 2C61A 2QM7A 3HFSA 4QIHA 3IT3A 2JB9A 3CLUC 1C1XA 2BMWA 1NW6A 2W93A 4QH1A 3O0TA 4YP9A 1C4WA 3KKLA 2EZ4A 1CUXA 4N8DA 4JC0A 1P2TA 3VMMA 4QOIA 3T12A 1IB6A 3PL1A 2JK0A 3SE0A 1GGNA 4RORA 3WLTA 4AZ3B 2V4UA 3TLKA 4YN3A 2VRWA 4AJJA 4PM4A 1K5HA 4BEVA 2NW7A 2A67A 2Q5QA 1ZK3A 3QVOA 1N2SA 4MCIA 4EYYR 1HEUA 1GG8A 1LSUA 1E0AA 1T72A 3KJGA 3ZUGA 3NEPX 1AS3A 1MFZA 4XWWA 2H2HA 2C00A 2VYQA 4WFJA 4F5ZA 4BAUA 5IXYA 1HRKA 3HRIA 4TZKA 5HP4A 4ZXLA 4RMHA 2ZW9A 5AOCA 4Q00A 1HX8A 1YKHB 4M0PA 1NW3A 4UQLA 2DNXA 4X65B 1WCYA 2ZJBA 1DZIA 4BO2A 2ICAA 2L19A 1XHEA 2ID8A 4FKZA 2H63A 3TLCA 4DAOA 2WM3A 4Q4JA 5FUWA 1G2PA 4WASA 4BFYA 3FYTA 3JWPA 1IZ8A 4HO1X 1MVOA 4K8OA 4OOEA 2QUKA 1J39A 1XCGB 3B6EA 3F4KA 1YDFA 1CEEA 3C8DA 2ZSIA 2Z6EA 3CR8A 1JB1A 3B13A 3GWHA 4DQKA 2WY2D 5LCXA 3L46A 2GYWA 2HIGA 3Q9LA 3ZJYA 1OLXA 5ALTA 4TYMA 2H0QA 4INPA 2EBHX 1GG9A 3A4NA 1VLHA 2R7AA 3WSTA 1FXWA 4LDAA 2DPYA 2QYSA 2XUJA 3QOWA 3JYNA 3OQ1A 2FR8A 4RY9A 2MINA 1LUAA 4RK1A 3ZNPA 1V9CA 3EVBA 3T3GA 1NMQA 1W49A 5AKHA 2CJYA 2OV3A 3SFEA 1CQJB 4NU8X 1YJAA 1CDEA 3AW8A 2HTFA 3RRXA 5BUSA 1A98A 2XYPA 1Z17A 1X39A 1TPYA 1Y7HA 4AYXA 2GN0A 4KQEA 2Q6LA 5BT8A 3K5WA 4YHHB 3ZY2A 3QJ5A 4HDCA 2RONA 1ZV4X 1BA3A 2GCEA 1SOWA 1PEDA 3EAFA 4IVNA 3RCBA 3UXYA 5LD2C 3BDVA 2FVXA 4XSGA 1EI9A 1K5DA 4XH9B 4LFCT 1DAGA 1HFWA 4DQUA 3T0FA 1Y9ZA 3CHYA 3THYA 1K27A 2C4VA 2NQ2C 2QJTA 2YVLA 5C8YB 5DCLA 4RCYA 2C98A 2CXOA 4H4CA 1OGIA 1YK0A 3I09A 1UBOS 4IJKA 2GX6A 1WPGA 1M8PA 2UYGA 4KI0A 4XQ0A 2NU9A 4CL8A 1N34B 3RH0A 2BFDB 2BGRA 1M72A 5G0TA 3SDZA 2Y71A 3TLAA 3PQ8A 3IEKA 3NW9A 4FFVA 3UANA 3PHLA 5LUBA 4F1JA 3FN4A 1AF4A 1AB5A 5JD4A 3NQ41 2RHRA 5KQMA 4Q9NA 2ZQ5A 4Y6SA 4ZCPA 1PCXA 2W6JD 4Z4HA 4MW4A 3VHQA 2HBRA 4Z9FA 4PO8A 4JI8T 4LV8B 1UBCA 1LDBA 3FI0A 5BORA 4PFJA 4FIZA 2W67A 4URVR 3NB0A 1L1EA 3JXEA 1M6YA 4KU4A 3DO6A 1LNQA 3NT2A 1TLLA 4JUYA 2JQ9A 4Q7QA 2MMGA 4CQNA 4CG2A 2ZIAA 2F4VB 5KTSA 4ALKA 4YCAA 3ZU5A 2Q5EA 4FOTA 3C15C 2E37A 4IF6A 3AF3A 1YVRA 4PC6A 4MTLA 3TIXB 4QHYA 3ZQJA 3AR7A 1U1DA 2C4HA 2WFMA 4UUNA 1X6VA 2AN9A 1W0JA 3LRXA 2JBAA 4O08A 3V7UA 2O5RA 3U1BA 3OO1A 2HO4A 4G86A 3U40A 1DXYA 3ZN2A 3LLUA 2ECOA 2QM0A 2EJCA 3RYHB 4XM2A 5H83A 1TO2E 4H4EA 3IVXA 1BEZA 1T2UA 1OHHA 1NXQA 2AOTB 4HEAA 3RYCE 3GW8A 5JFTA 2QLNA 2CXSA 3P4XA 4MS4B 1CY1A 2AFIE 4HN2A 4OGGA 2C3UA 3C7CB 2EV9A 1A2OA 3NGLA 1PTJC 4F96A 2CE7A 4HNGA 4TT3D 1GFWA 1FNBA 5KOHB 3K53A 3ZWPA 1PFGA 2JDIA 4CV2A 1I6LA 2P7HA 4L08A 2K7FA 3QPVA 4EF5A 2X9HA 1JSZA 1SCAA 3BEDA 1TYEB 5I45A 1E69A 2O59A 4C0WA 1JA1A 2Z2XA 3NCHA 3UN1A 4KFSA 1LY1A 4Z3DA 3S40A 3SKXA 3UPTA 3R7AA 1IJ5A 1I32A 1CUZA 4RABA 1O5OA 5FL7D 2EWMA 2QZJA 1RIFA 4PINA 2CKDA 3COPA 1XP8A 5B7NA 3C64A 4TWIA 4C4YA 3BXFA 4UTXA 2WVJA 1DQRA 5EAIA 5A2QA 2D8MA 2OOKA 3RKUA 3UMMA 4M0UA 2OXEA 1XZNA 2WZHA 4BFLA 3NHJA 5AVZA 3IB3A 4XDZA 4LI3X 1NLYA 1XZIA 3E5NA 1QF7A 3E5HA 4J1QA 1S2IA 3GPCA 3CWCA 4NI5A 3LY7A 1SFRA 1UBMS 4MMXB 3EA5A 2I7XA 1DC8A 1IMOA 4LYDA 3UOWA 1THMA 1XFAA 3QY0A 4RUKA 4OHPA 1DTWA 1J2TA 3L39A 2P4UA 2ZIUB 2H1OA 4R8MA 5E4YA 1O6CA 1VIYA 4WBNE 2OO7A 4B79A 4BNIA 4RPCA 1LW7A 2WR8A 1XAIA 4OQQA 1R4AA 4OGFA 4KUGA 1PSWA 4GEKA 4HN4B 1T6XA 4YCCA 2WFLA 1UDWA 3H4IA 2APJA 2NO9A 3DH0A 3MYYA 1CIPA 1HO3A 5EIWA 1CPYA 5CH3A 3ZI4A 3A27A 3GRVA 3ZW9A 4PXAA 2UUPA 3DT8A 3FI9A 4W9NC 4I1YA 1XLTC 4W4TA 3COWA 1EB8A 3EY9A 2GNOA 4L7QA 3UMJA 1JAHA 5H6RB 5FNVA 3OCVA 1DLJA 2GQ0A 4CN4A 2GRAA 4LVOA 3QUQA 2YOHA 1AQ6A 1ESZA 1DJPA 2J9FA 1JDUA 3S28A 4FXPA 3UJ3X 6YASA 1GEGA 3R24A 4QXPA 3SJCA 4JJGA 2IY9A 4HFEA 3MS7A 3F46A 2YW2A 4DJAA 3SOZA 4BVAA 5CBKA 1K9VF 5J5VA 2RGDA 1JQJC 3LWBA 3NWOA 2AJBA 3QE2A 4GT1A 4XRRA 4ZXPA 5I8ZA 3UK1A 4G5SA 3A2KA 4JKOA 4GYYA 1L8XA 4UUPA 3HY3A 1US7B 4YJ2E 4CLRB 1T2EA 5FXVA 1MIVA 2EKLA 3T5PA 1CJKC 4K9KA 5HPYB 2Q46A 3NHLA 1NI4A 2TMKA 4I9NA 3JASB 1H2ZA 1CG6A 4MVJA 4Y2GA 4LS3A 4XD2A 3I83A 3RDPA 1JQKA 3VHLB 2PFGA 4G63A 4G0NA 1RQRA 3ON5A 2FVYA 5FB3A 2BBJA 4CCWA 5CBPA 4URYR 2EKQA 4U7WA 5KC8A 1Y8ZA 3FFXA 2A3DA 2PG3A 2CV2A 2QGZA 1W85A 3UWDA 2HUNA 1LTQA 5AM3A 5DHRA 3SF8B 5G53C 4MB6A 5GONF 1R5OA 1SRQA 3F3YA 1NM5A 4Q82A 2OQ2A 3DE3X 1CUYA 4PPNA 2OEPA 4KYUA 2NUAB 3FFAA 3G13A 3UATA 4O4HB 2IXTA 1VB5A 4EMSA 1YBVA 4QUBA 4EA6A 4FEAA 2P2NA 2VDWB 1M2GA 1K7EB 2FDRA 4U63A 4X6YA 2I29A 4UULA 3EUFA 1WEHA 3UUFA 1US8A 2WINI 2CF6A 1JLKA 3HXTA 1PJZA 3TZLA 1FTQA 1VI5A 1VCIA 4HGRA 3EVFA 5D87A 4K9PA 4YLHA 3QVWA 2X42A 3SJZA 3QLJA 5E6SA 1XXLA 1Z4NA 1K8RA 4XJXA 4R1MA 2IYEA 4KVZA 5DM1A 1AE1A 2V6GA 1K63A 1WUHS 1C30A 1E6WA 3V7YA 1T2VA 3WIEA 3I9MA 2OAP1 4AUKA 1NGSA 4MLKA 3S2FA 2BM0A 5JAIA 2C5FA 3R7LA 4BAYB 1K8QA 3QVTA 3GGSA 4MUFA 5ALYA 2C8LA 1XCBA 2P35A 3PFKA 2WPDD 3A7MA 1E3TA 2DSTA 2K48A 3MJRA 4DSTA 5LZ5A 3H2IA 3I5UA 3STWA 4ETIA 2MYPA 4I50E 3I2JA 4NEHB 1BGXT 4H1WA 1FYXA 4BAGA 2MMCA 3VO8A 4LMRA 2C3OA 1TA0A 2LRHA 4TWJA 3LYUA 2JH9A 3G06A 3OZ7A 1JEQA 5IBQA 2XZOA 1J6UA 3L9XA 2QXTA 4Q1FA 1Q7TA 3C7TA 3EZFA 1IJKA 3H11A 1U4NA 3VAAA 1ZVQA 1WZUA 5KYGA 1JH8A 4FFMA 5T6MA 4P4TA 1FW6A 2CPTA 2IY7A 3JPYA 5ALUA 1T8BA 3GX1A 2B35A 4NONA 3GLVA 2IU4A 1GQEA 2W6MA 1PFKA 3P9NA 1D8TA 3KKEA 5J4KA 4P0AA 3L09A 1GTVA 1NYQA 2R85A 4WD3A 3LF1A 2YJNA 2VZ8A 3DAPA 2WU0A 3KPUA 4EHKA 1YRWA 4CLXA 2FJEA 1YBMA 4RV5A 4G84A 5E4FA 5LBIA 3UCXA 3JQGB 3Q3IA 3FMIA 2DWOA 1AUVA 2GYUA 4I4TA 4M98A 1WHSA 3KCNA 4B3ST 2C96A 1EJ0A 1E7MA 1RM5A 1TQDA 1Y4ZA 4ZTZB 5HSGA 1T9ZA 3K6JA 1BXKA 1XTQA 2O06A 2PGNA 2HCJB 3AA0B 2VHCA 1M2HA 2X9NA 3TPFA 1C7FA 5J47A 1BD3A 1Y4UA 521PA 4JVSB 4CIBA 1U1EA 4PX3A 3O73A 3W15B 4H18A 4HS9A 3Q3GE 3MWEB 5C81A 3ADCA 4CF4A 3IE2A 2OCIA 3PEWA 3PXEA 5AI8A 2R68A 5FI3A 2XBLA 5G0VA 4Y2PA 5A2GA 2JGIA 4A8JA 1DGQA 2DT8A 3ROZA 3T6KA 3ZCQA 4KGXA 3HG7A 4C6SA 3ENVA 4JI6T 3D64A 3E81A 3VA7A 3WK4A 3ICWA 4WCFC 1V6CA 1YA4A 2A86A 3GIDA 3OMXA 3FNHA 3WAJA 3GA7A 4NULA 1LNSA 1RE0A 1O95A 1P1KA 1KC1A 4TWZA 4P22A 2R25B 2H5LA 3GFRA 1A1SA 1CHUA 4UUQA 1KAOA 3O93A 3R3VA 4GUDA 4B85A 1VPEA 1P31A 4EYUA 4H08A 3H97A 3CPJB 4B4DA 4P4UA 4CNQA 4GQAA 2REQB 1KFKB 3EQ7A 2WTMA 1W48A 2OOSA 1M8FA 3AI1A 2OY0A 4HFMA 2VHVA 3R4CA 3B1VA 3HP4A 4MLCA 3AM5A 2UYYA 3BREA 4MQMA 4FOSA 1OGJA 1GU1A 2DLNA 2XI4A 3TQSA 4YTMA 4LWPA 4RSHA 2X8BA 4ZPXA 4YJ3F 2W71A 2ZTHA 5BR1A 1B74A 3F2VA 3STTA 4KR2A 1SB9A 1NF9A 1R3DA 3M3PA 4D42A 1N7JA 4QOFA 3HFGA 2IU3A 1MIOB 2RGEA 2DR2A 3BXGA 3LP8A 1UWCA 2A9VA 2G5CA 2AYYA 1FP4B 1EUCA 2Y9MB 5DBEX 4QUAA 3HJGA 4MI6A 1M2OA 3DW1X 3TPZA 3ASVA 3MHTA 2V6JA 3OICA 1W6UA 2YWEA 4TL7A 5FOWA 4JLSA 3KEFA 3WL8A 5BWNA 5HQTA 3N8HA 3VU9A 5EHQA 5LWQA 4JAVC 3TSAA 2ANCA 2X9GA 2EKDA 4EO9A 5CIQA 1LD3A 3AZPA 4C22A 1Z0IA 1ZAYA 3U13A 3W79A 5EXEA 3GNSA 4CHGA 2XGGA 4O4LA 1NR7A 1JDVA 5D2CA 3DTVD 4IYJA 1QQ7A 5CGMA 4NBRA 3RHZA 3KVRA 4OO3A 3DYBA 2D0PB 1UT8A 4FT4A 2B4YA 5ALXA 4LGVA 3C14C 3UYKA 3ZWMA 4I99A 4UTZA 1OW3B 2CEKA 1MP0A 4WLFA 1I6KA 4K1XA 2FPSA 3EQZA 3WYCA 2HQRA 4D4HA 4QHTA 2I62A 3DMYA 3LT5A 3GZ4A 3OZFA 1RJ9B 5AO9A 1VLQA 3VH4A 1FTWA 1RQNA 2P2LA 2YW9A 3AEFA 1SC6A 4RMNA 1IWOA 4AX4A 1J0BA 1JHPA 3CIRA 3C3EA 2HHJA 3EEIA 2FPLA 2PBFA 3SD7A 4K6MA 8OHMA 3AUAA 4M99A 2DQKA 4K0KB 5DHQA 2EFHB 4ILUA 3N53A 1KK7A 4OB6A 2XHZA 5HFJA 3RRNA 2C59A 3AR2A 3AFNA 2NW6A 3U7QA 2IQ5A 3PUGA 2I59A 1B43A 3EW9A 4RGVA 2B8NA 2QTBA 4JQZA 5JDCA 1RZUA 1X13A 3AUXA 1OWMA 3DAHA 1X1QA 4UD2A 4IGFA 3PHJA 3HCBA 2NW8A 4JUAA 3L40A 2GJ8A 4GK0E 2WTXA 1L4GA 1YZGA 1H0HA 1SA0E 2J33A 1JKJB 4YDSA 3GUYA 3WY9A 3EFEA 3LDHA 1W47A 1G7SA 4UM9B 4BB0A 2OPHA 5J2TB 4IIBA 4N3CA 1WBJB 2R5WA 2BBTA 3RASA 5BT9A 2JJ1D 4P58A 2PVCA 1Z6XA 2ZYAA 1R6VA 1W34A 2V7XA 3ZS9A 4IOLA 3I9NA 1RI4A 3NONA 3RARA 3WJ1A 3DWFA 1FU4A 4AJ1A 1D6JA 2AW5A 3NGMA 4FEEA 3RFTA 5DO9A 2ZULA 2X8AA 3M34A 3BA1A 4QFDA 5KMGA 1CJTC 4EKIA 3GD7A 2V9PA 3W2FA 2XRYA 3KV4A 5I8PA 4I3FA 4OSOA 5BSVA 4DL9A 1DIOB 2WYOA 1X9HA 5AOBA 1U4QA 3F96A 1I01A 4M36A 2X9QA 1XDPA 1GL7A 2IHZA 2IZ7A 2XUHA 4JJ4A 2Z9CA 2O2HA 2GLUA 4O2AA 4CXXA 1YJBA 2B98A 1KYTA 4BGDA 1T9GR 4YCDA 1V6SA 2PJZA 1EX1A 2QLJA 1PWZA 1MUUA 1U28A 4ZICA 2FUKA 1HT0A 3KAQA 2ERYA 3OECA 5L95A 4GBJA 1X74A 4BEJA 3EISA 1VL1A 1KNRA 2J07A 5B7GA 4DV5B 5T41A 4CV3A 5I51A 1ACMA 3SXUB 2GAJA 5CB0A 3OY7A 4PZPA 3ZDAA 2PTHA 1T1JA 4BU0A 1O94A 3FPCA 1O3YA 2AN1A 3O84A 2MSKA 7GPBA 2YYSA 4IGUA 2WAAA 3JTMA 1KEUA 2X7HA 2GEKA 3HNOA 4MXDA 5DMXA 3BRWA 2YHSA 2FQQA 3ZIDA 5EWLA 4YP5A 4W99A 4B6PA 3MCTA 2D4AA 3K0FB 4JEHB 4G5XA 3NATA 3SZGA 5JQGE 1CULC 3X2SA 5CT8A 5FTWA 5HYAA 4GLBA 4MVJH 4F3RA 5IFLA 5AJWA 3CZPA 1NMYA 3RTAA 4BO0A 1T9BA 4MV3A 2M6IA 4O0MA 3UNXA 1Z2AA 5KVSA 4WY8A 1AK1A 2ZUEA 4EHJA 3QWBA 1JEYB 4IIFA 4LF8B 2P91A 3SSNA 3EEBA 1S2LA 1P8JA 1O0SA 1SOUA 4F2PA 4QUGA 3AC0A 2CHEA 3H5TA 1CZUA 1UXIA 4L5AA 3UWKA 1OAOA 4B5LA 2W63A 1QH8B 3Q98A 1EMDA 1XOIA 3Q3HA 1ULSA 3BORA 4I1IA 1AKYA 5AKZA 4UVIA 3FF1A 3ISTA 2QA5A 3E9MA 1YFLA 3AF0A 2JFXA 1AUQA 3PNSA 3EXFB 5EUMA 3AEUA 3WMFA 4P34A 2ACWA 2Y2UA 3OEHD 4KPFC 3WGHA 1FZTA 3PQ3A 3IVMA 4KI7A 5F52A 3A9TA 2ZYUX 1GPYA 3AE7A 4MDHA 2IH2A 3EA4A 4OLJA 4ANFA 3G3EA 3MUEA 1SXQA 3DLAA 1QCDA 3QNWA 5CT5A 4PHGA 3W2HA 3D6JA 5HR5A 4TKLA 2WB4A 3QU7A 5KWJA 5LBMA 2OUIA 5JCOA 4C1BA 1DX9A 3G9QA 5FI0B 1YMUA 4YPOA 3R7BA 2F9MA 2J59A 3VDNB 1G7TA 2ZUTA 1CETA 4U2ZA 2X5KO 3K30A 5DEIA 5C34B 2ODPA 3NTUA 3R3SA 3UU4A 4XIGS 1E1QD 5F1PA 2KSQA 1G20A 2HOQA 5ABHA 2UZ1B 2FZVA 2MR6A 2J9YB 1WLYA 3ZIUA 3TSOA 1WZCA 2VSOA 3NUZA 3D4IA 4Z9XA 1G6Q1 5EY5B 3VU0A 1EXWA 2G4VA 3HU1A 3IAFA 2LSYA 3E22A 4LUCA 3N28A 4TUYE 2XYQA 2D8AA 1JQEA 4DT1B 1G1AA 1KPGA 1NJ2A 3ZDXB 4EGQA 9LDBA 4UVHA 4QELA 1GGMA 3PQDA 4PRYA 3ZDZB 4C01A 1TUGA 4O1IA 4E11A 2O7SA 2F1JA 1JMKC 2GZDA 4CKBB 3OFSA 1QCZA 3FYUC 4XLLA 3CR3C 3U4DA 2E7ZA 2D2SA 4V0SA 3NEJA 3RAJA 1PV2A 2ZVJA 3PGJA 3CVYA 1UKCA 2ABWA 4X8MA 3D7LA 4AW9A 3BQKA 5IULC 1NAIA 1MB3A 4MUYA 3FWHA 5JI2E 1MZVA 3W3ZB 3A05A 5G40A 3FWZA 3FAZA 1KJJA 4I4CA 1IK6A 1YR2A 5T7BA 4AL4A 5KYXA 1HNXB 4WKPA 2GDZA 4X7BA 4BRZA 1AU9A 5ALSA 4WLOA 1EA7A 1YQ4A 3AM1A 3JARA 2PGAA 3HB7A 1WSBA 3RYFB 4MAFA 4DIFA 1M6HA 1YHYA 1M6EX 4R68A 2H1WA 3OT4A 5KOJA 2J08A 1P1FA 3E0ZA 2JAPA 3UPDA 3LC1O 1WU8A 2FRXA 1QG4A 5M2QA 1FA9A 5IC4A 2DJ5A 3MCVA 4BLWA 3T5TA 1TAGA 1NW4A 5G4KB 2XNDD 4MARA 1RADA 1SZCA 5KREA 3MNFA 2WTBA 1DAOA 3H5VA 3OFKA 3B1XA 2QVLA 1RAAA 4RF2A 1EDZA 3VVLA 3ZWNA 5LDDC 1BXRA 3GUCA 4OK6A 1JFSA 3IQXA 2W4IA 1SXPA 3V3TA 5JMPA 1MW9X 1SCIA 1P0CA 3K0CA 3ZHBA 1MNDA 4QVIA 4TL6A 4G1VA 4UM9D 3E7DA 2OM2A 3P26A 4Y3UA 1P4AA 2JJMA 1BOFA 1Z0PA 1O89A 3GNTA 2P69A 4YT5A 1OAAA 2I65A 4O2BF 1Q1BA 3K6RA 2I8AA 1T1SA 2F67A 2V3CC 1HNZT 3AYXB 4HGZA 1RAIA 1MJGA 1RJWA 4MW5A 2JFNA 4AMVA 2W8BA 4IBOA 2H2FA 2BUBA 2Z09A 3MGKA 3ZLIA 2W4MA 2WAOA 2B9VA 3B8HA 3LL7A 5K0CA 3MCUA 2JVJA 2FFHA 3V4PB 3CNOA 5FBVB 2WWHA 1O6GA 1O57A 2EJWA 4X1KE 3EBPA 4KR3A 2FWAA 3T54A 2Z3WA 5A9TA 2CFSA 5KYWB 4G0UA 1LSSA 4Q37A 3DXYA 2W90A 3H9EO 1EP9A 1MAHA 4BN5A 5DX1A 2H51A 3ZSSA 1ZIYA 1N0WA 2REBA 4PIVA 3HGQA 5FI5A 2RH9B 4KUMB 5DM2A 1KDPA 4WA7A 1THGA 3WQRA 5REQB 3KSAC 4M0DA 3VR8A 3CS3A 4BHTA 1UDCA 2VKTA 2YDXA 3H42B 5BMVB 3U19A 4LWOA 5JH7E 5JR9A 3WSWA 3FNQA 2OVFA 2TMYA 4GPAA 3ADOA 1HT3A 3EGIA 3C8UA 2P6PA 4CIWA 1SCUB 4MUEA 2JGLA 3L04A 3M4ZA 3ANWA 4EEXA 3OQJA 1A04A 1HORA 4U0KA 3D7RA 3SWHA 4W7SA 1FB5A 2I1LA 4HWHA 7MDHA 1OH8A 3FCXA 3C41J 3GCXA 1PWXA 1ULTA 4NBUA 3FXEB 4YTEA 1MH9A 2IRWA 4YRAA 4JI7B 1JXQA 2PGIA 3QQPA 3WLPA 2UXDT 4MNTA 4FZRA 4B3GA 1SY7A 1QF6A 2XPKA 3LUKA 3L5KA 4EMUA 2D5AA 1UZAA 1MEEA 4W1SA 4LVNA 4BNTA 2C3YA 2H7VC 4UXJA 1M1NB 2OAGA 1CQZA 1WYBA 3ZZMA 1YH3A 1LVHA 1KTVA 5L7WA 2XY8B 1OF1A 4QPNA 3UMFA 3TLUA 3RK4A 2KX7A 4EY7A 1V8BA 2VP5A 3ZXYA 2DF8A 3R84B 1XKLA 4TXJA 2DLRA 1WX1A 2QVBA 3G1TA 3R74A 2NOAA 3X1ZA 3MTDA 4L78A 4IJQA 5FAXA 5ADHA 4QVKA 4YY3T 3QV1A 5EA2A 1Z5UA 3O4RA 4CL0A 3OIDA 4HXEB 1JILA 3L8EA 4AJOA 4HDQB 1SKUA 1YS6A 5FWNA 1KR2A 2BEVB 5KKCA 2Y1GA 3GJ6A 5CUQA 4OMUA 2J4FA 1DKMA 4BGUA 3P4WA 1CUBA 1OKKA 2PZGA 1GA4A 1M76A 1ABBA 1PT8A 1BX0A 2C4NA 1EH5A 3LDGA 3ZHSA 4AO6A 5E6UA 1DI0A 2YN2A 1U8TA 1AQUA 2BAGA 3CX7A 1FIOA 3QLVC 3V7WA 1ZIDA 4W5NA 2FEXA 3HA4A 5EJAA 2WD9A 2HSEA 4Q4LA 5LZ2A 1YBAA 4EG0A 3H87A 4BFZA 5I9LA 2B94A 5JADA 1MC1A 4OJMX 1CRLA 2ZIWB 3AEAA 1KSFX 2HA7A 3N6XA 3SX2A 2ZUSA 3NRYA 4MIKA 1Q3HA 2FNAA 5MGBA 2QGFA 4J1TA 4IY1A 1NW8A 1LKXA 4JP1A 3C48A 2YZMA 5FY1A 2Q4EA 4UEMA 1VHTA 1STOA 1K3FA 3AHIA 5BRAA 1A5SB 3T9CA 2GFQA 3K4QA 4RY8A 4YJGB 2MBGA 2ZRIA 4EA8A 2JMKA 1SQ5A 2LHNA 4Y2TA 2IZZA 1EA5A 3N8DA 3BXHA 1HLPA 1TLFA 2GJ4A 3S1AB 1XMQT 1RT9A 2R6HA 1XGKA 3HVHA 3Q5EA 3PWKA 1R8SA 1QF9A 4QGGA 3G6WA 3WGJA 3ZWYA 4L8VA 3NYQA 2DULA 1CRQA 1M5TA 1N6LA 2VSQA 1IDOA 1ZCFA 2VA9A 2ZAYA 1ISJA 1P8AA 3AKEA 1M67A 4JCCA 4X97A 1LI5A 3K8OE 2EP8A 2FZCA 1Y89A 4DNPA 4GOUA 1CE8B 2ZIXA 5TJHA 5CA0A 3ESLA 1R10A 3U0VA 3PCRB 2PUCA 3QVUA 3TN7A 4LSMA 1W5FA 3L5OA 5H8WA 3RWBA 2Z0MA 1ULAA 2R1TB 2WYVA 3Q0EA 5CFMA 1MOPA 2H1IA 4XVQA 3H2SA 1TZBA 4GOJA 3D54D 1YQ9A 3RANA 5AUPB 1V0JA 2QUIA 4EG7A 4JU9A 2DLCX 3AA7B 3AJ9A 3BMOB 1A9ZA 2ORYA 4A4DA 1DEOA 3R40A 3QOYA 3RYTC 3ILSA 1QOPB 3RX6A 2BF4A 5I9MA 2Z4RA 4CKZA 2WB5A 1FZQA 3DM5A 1TIKA 3OFND 3ZGNA 3LJCA 3L3BA 3UM9A 3TVDA 2XA2A 2J3LA 3GVCA 3MTGA 2J5XA 1WXWA 3L6UA 4C0SA 1Z36A 3CYFA 3FCYA 2I4TA 3P9RA 1NFQA 3DBRA 4DVGA 2B1RA 5LB2A 3AEGA 1J7JA 3MKDA 2EHOC 3MWLA 3UCFA 2PCLA 2H2IA 3GJ4A 4HFNA 2BTQA 1XZGA 5TSDA 2DL1A 4H7KA 3I72A 2I3GA 1RIIA 2AK3A 2XMQA 3GU3A 1ULHA 3KB6A 2XHEA 4FYJA 1GCOA 1PL0A 4AK9A 5KQLA 1Y7LA 4OXNA 5I8WA 3AI2A 1XWFA 3SYNA 3TCXB 3F8WA 4RZ3A 1Y1PA 4V2UA 1W2WB 2VTEA 3VM6A 2FG6C 4IE4A 4GP6A 4NPHA 3ZWKA 3DB1A 1KZ1A 2CLKB 4P3XA 5E0OA 4WFKA 1YJCA 2EVWX 3LLCA 4H3HB 3DHEA 3DV0A 1KOLA 2ZR7A 1V3QE 1FVOA 3STVA 2VVSA 1I4OA 1P5RA 3ICOA 4QFMA 3HM2A 3ZDEA 4Q01A 4FWIB 4C0KA 4L16A 7ABPA 1HZJA 2IV2X 2P2ZA 2XSZA 1G5TA 3ITKA 4CM1A 2AYXA 1TW3A 4QATA 3WNCA 3A4YA 3EWAA 3KSZO 1E58A 4NIMA 4QYXA 4R83A 1OH7A 4F84A 1NBAA 1MORA 5HF9A 2JIDA 4ZJUA 3KJQA 3ILVA 2AD1A 4UTNA 2Q3LA 2I71A 2KWIB 2JLVA 2JF0A 4HWSA 1N2OA 1NXOA 1OBOA 4QBFA 1OI4A 2WG1A 3E3MA 1QIHA 3JQEA 3FZLB 3LXXA 3RSLA 1N3BA 4FYIA 4NE2A 1W4ZA 4QWMA 2ES0A 3TLGB 3U61B 2ZTUA 1VKRA 4C03A 1B3BA 2QM3A 1CZNA 4NMHA 2OORA 3D2CA 2A5LA 1UH5A 3EZ9A 4AZ0B 3GJTA 2PGOA 2C5SA 1E62A 5JAMA 2W0MA 4LX8A 3N05A 1P1IA 2SICE 5FWYA 3NBXX 1DHTA 4J16C 5LMNB 4MVXA 3BF7A 5A9SB 4GDFA 4U7IA 3HRHA 4RHUA 2QXYA 4QYMA 1JR3E 2QYOA 1MG5A 3HZOA 4BCBA 4AT1A 1N34T 2MTBA 2D00A 2FZKA 2OGWA 2VZEA 1I3CA 3NVAA 4QEZA 2XKKA 2BDUA 3RF7A 3R0IA 4MYTA 4DLYA 1GHTA 2XQ6A 1YC2A 3R9IA 4OK5A 1Z73A 5L51A 3I9YA 3FFTA 3VR1A 3RQUA 4RE6A 2Q2QA 3D6MA 1KI4A 5SYMA 2PGXA 3E3LA 3HACA 4B74A 3PU8A 3AINA 4ZC1A 2J3JA 3NXSA 3A1WA 3LFMA 4UTVA 3LK42 4UCXA 3R0VA 5KX5A 2FW1A 2FUG1 1U04A 2XUQA 4LNHA 3RREA 1M7HA 4RA6A 3KQYA 1A5BB 4JMLA 1UK7A 3TAXA 3VTKA 3AVXA 5JMOA 1YZNA 2AFIB 1YA6A 3TM4A 2EF1A 2PMKA 1Y3AA 2JI9A 1Q7CA 1IYZA 1HF8A 1DBRA 2FZLA 5L3SB 2F4VT 1HOXA 4LCEA 2OZVA 4V0OA 5A7GA 3X44A 1P0FA 4Y8VA 5L3DB 2JFFA 1L7QA 1CR4A 5CNKA 2L3LA 3PT9A 4R40A 1PFQA 4NZ9A 2ZS7A 3VR2D 2OCPA 2JGNA 2JA2A 2R1VB 1NN5A 3LW7A 2FPIA 3U4HA 3WIDA 4TYQA 4F72A 1G3QA 2NIPA 1XDGA 3BFXA 3AEQB 1PG5A 4CF5A 4AG6A 3F9IA 5BWMA 5LLDA 1N5OX 4L5GA 3KLNA 4ICIA 4M89A 1ISMA 3RJMA 4B80A 4DPMA 1DIBA 4GWKA 2QU7A 3EGDA 3HA3A 3D3KA 3DUFB 3AVVA 5KNBA 3WWYA 1CUJA 3E23A 3E15A 3A9UA 3D4PA 4F9GA 4ZGWA 2GDJA 1J5PA 2ZIFA 1V1JA 5LQNA 3W5DA 2OCYC 1N2ZA 2IYWA 2A2ZA 2VXBA 2Y0BA 4WX2B 1DTEA 1E18A 3T7CA 1YR1A 1L3CA 2P8JA 3M3DA 4MJLA 4PYNA 1W73A 2BFNA 2W62A 2O2SA 5AVRA 2IUFA 1QMGA 4IFEA 2IUUA 4EGJA 2LGJA 4RANA 1ZUIA 4KXVA 4YO8A 3PUVF 4P5EA 1V5WA 1RFGE 1XIVA 3VPBA 1KSJA 3L8ZA 3HKBA 4RL4A 3DVSX 3SCZA 3LOQA 5GPBA 4L4UA 1M73E 3C4QA 3HDTA 1VHWA 1IM8A 4IIHA 3TSWA 2XXBA 1WB6A 4FE4A 5FOUA 4WBNB 3NUGA 4RU1A 5E38A 3ZQ6A 3FOWA 5KQPA 1D2CA 1ML3A 2CWYA 4M7RA 3PQ4A 1SBZA 2VNHA 1IUNA 1JZTA 3ONFA 5IMSA 2O4CA 2R8ZA 1WD7A 4K9SA 2WKWA 2ZSAA 1RBQA 3HCWA 3KD2A 5E7JA 4PC7A 4J7CA 1N3LA 1W4RA 2GXQA 4YR7A 4HB0A 5KTMA 4Y1RA 2CV1A 3DR5A 4XEHA 3A6ZA 5LC1A 4L95C 3L7IA 2MIIA 2XDYA 1TK2A 1IQ0A 5FYDA 4CN8A 4TV9B 4ND6A 4LYAA 1MOSA 1MXHA 3S7ZA 2G25A 3WV4A 3VR5D 2C5KT 1QHFA 1VG9B 4J0FA 1UODA 3IDSA 1B7GO 4OAPA 4LHWA 3OM0A 2E6KA 1UJBA 4R2LA 4ITUA 1P72A 3IEIA 4EG3A 1NLMA 3ESBA 2X51A 1Q3TA 1Q91A 2IHR1 1U3WA 4DLSA 3EE6A 3LDAA 3ABSB 3KDAA 1WDTA 5CDTA 2DBVO 1KYQA 2Z6QA 4KC0A 1JFFB 1K6JA 4HGYA 5F9FA 4BIIA 3TSCA 3AEBA 1WZIA 1SAYA 1QDUA 1EXNA 1TCUA 4G0YA 2A0WA 2XIJA 3VKHA 1P4GA 1H66A 1HQYE 3T7SA 4TXHA 2Z8YM 3DVRX 3KEQA 4EIWA 4IJVA 4YJ2B 5L3QA 3OFVA 1Z0FA 3TBHA 4OL0A 3LLVA 2ZUFA 3TDKA 4MBQA 2NU6B 4R1LA 4YMWA 1IG3A 1YR7A 2Q7DA 3I2YX 3OJ0A 1FDVA 4E14A 2VHQA 3DQZA 2XUGA 1E2NA 3I4CA 3MMNA 2PX4A 1OPXA 4ZVQA 1LFAA 2B99A 3QA9A 3FMFA 4PNEA 1A4IA 2OFPA 3DMGA 5JXJA 4PIPA 5EYPA 4QE3A 3CFYA 4F45A 2YNMA 3PGXA 1SZJG 1ISRA 2WSMA 3DXZA 3AE4A 4ERRA 1XYYA 2HXGA 4B81A 1N7GA 1HTBA 1H0RA 3UFXB 2A0XA 5C1IA 2IC9A 3ZZ0A 5EJ5A 1SXJB 4Q7LA 3B9PA 3T0IA 1HETA 5CW1A 3V2GA 4W8GA 2Q7OE 5GV7A 2BR3A 2Z5VA 4FN4A 1LW6E 1DVRA 5DMHA 3N3BC 2CXTA 2GK9A 4RC9A 4ZEWA 1XSEA 2IHKA 1G5FA 5LDGA 4ATNA 1P2BA 1EHCA 3QH4A 1A69A 3MXTA 4DLTA 3O26A 1UOOA 4OHYA 4YLEA 4OBWA 4FDAA 5DSTA 3KR1A 3R7SA 3E7WA 4RD3A 3R3ZA 3HVKA 1U4SA 1WA5A 5IBRA 1LLFA 2DBQA 4G4JA 1HX7A 1SEVA 3I92A 3KXIA 2W6PA 1W46A 3LYHA 3ZYZA 3ZD9A 1XVTA 1A2KC 1A95A 4FZJA 5EQTA 4I1RA 4NJOA 4TVOA 4YUAA 4H7FA 5A3QA 1RAEA 3QTLA 5CG1A 1ND5A 2QD2A 5HQJA 3S0JA 4U2CA 2B0CA 3TLWA 3GLGE 1T15A 2AJCA 4X1YE 2B7BA 2V7WA 5EL0A 3ZOKA 4ZCLA 2IV7A 3VQTA 2HT1A 5D00A 1UBRS 4PGHA 3DTVB 1K5GA 3DNFA 4MZXA 1DFIA 4P81A 1Y9JA 2W2KB 5GINE 2E3JA 3QX3A 4C4XA 4QEKA 4MAAA 4R05A 5DOZA 3HCFA 4I50B 2C5IT 3FMPB 3DPSA 3IPCA 5J4YA 1NVVQ 4MVJG 1FLNA 1A2QA 5TPZD 4NZZA 5IX8A 1UFKA 2WJPA 4PIMA 1NNUA 3OJLA 3KPWA 2P6RA 4QM7A 1VCSA 4YRPA 4FILA 1JDZA 4MWZA 2Q8QA 2WQ7A 4YCNA 2R48A 4UU8A 2WFZA 5HEHA 3AHHA 3Q12A 5BW8A 4DN6A 3DL4A 4KUEA 2JJQA 5KJCA 4NR0A 2WICA 1ZEEA 5LQSA 2V4ZA 1QGYA 4QYSA 5I7VA 4OHRA 4DR6T 1EGAA 5CDUA 4EG5A 3RODA 3SVLA 4KTTE 2G1KA 3DMDA 5F21A 4G97A 5AMXA 1W36C 3BFVA 5KYNA 4P84A 2X22A 2IS4A 1TC1A 1NVDA 3U56A 1N5RA 1QO0A 2C7RA 4D8YA 1G73A 2V3VA 5C7LO 1L9KA 4OSEA 4S1VA 3FSGA 4CZ2A 5LBTA 3BE5A 3LTEA 2W22A 1SVUA 3RUFA 4JQCA 3LDQB 1V9LA 1S1CA 4L6IA 3AOEA 4DNOA 4C2AA 2Z4TA 3IUYA 3FM9A 4PX5A 2DCUA 1GPLA 5M29A 3IUSA 4O3FA 1XX6A 3BJRA 2WF8A 3PRYA 2YQ4A 4ZWNA 2ZJZA 3EGOA 2Q1TA 1UKEA 1PFUA 3R9WA 1G0NA 2BGUA 2HR1A 1X7WB 2NX2A 5IWAB 1C7IA 4BKQA 2IDKA 4K88A 3OOWA 2ZT7A 3HYLA 5AVTA 5BN4A 4NZYA 1Q7GA 1XCPA 1T5BA 3GJSA 2IYRA 2V7JA 4KWEA 2UDPA 4PWZA 1IRXA 1IN5A 2B8JA 2O05A 1O4VA 3IXMA 2HWYA 3CNEA 3E35A 4DUGA 1ZIPA 5KQSA 4J2OA 3KETA 1YC5A 1PNRA 3WE7A 1HFAA 4LHXA 2XWBF 4YLGA 3M6UA 1HX1B 2X3YA 5EJ6A 1H8HD 3GEBA 2A9KA 5EEGA 1KMHB 3HU2A 3SNHA 1LI4A 1YB1A 2I8CA 4ZJYA 3ZJ2A 3BFKA 3OLZA 2C31A 4CCYA 4UHHA 2MT9A 4YDRA 1G7CA 4GX2A 3GFOA 4U7JA 1IE3A 1I0IA 3TGLA 3JQCA 1J1ZA 4XFKA 1VCHA 2CLDX 1T3LA 3PNLA 3LPCA 3AV3A 4EENA 1U9IA 4EKNB 4PLFA 3GYGA 3CXRA 4HFDA 2VHWA 5HJEA 5JVDE 4EGCB 4DSUA 2ETVA 1PSZA 2CUKA 3KQPA 2WJVA 4GGPA 1N6HA 4CKYA 3E9ZA 5GMOA 4HRAA 3WQHA 4DARA 4PYKA 1VE3A 4CKWA 5FYMA 4EJSC 1BKSB 4GM4A 5BN5A 4KE9A 3VISA 3T9AA 4HN9A 3KSDO 1E3DA 3BM5A 3GGCA 4QLBA 4IDOA 1FSZA 2YN4A 1LRLA 3C8MA 4A2QA 3HMKA 1R37A 4A56A 3BMNB 3CUEF 5T6BA 2C2GA 5CVCA 1OYVA 3CISA 4Q19A 3KQMA 2PNFA 4TMZA 4DM4A 1Q1NA 3PFNA 4X44A 1ICIA 4LRSB 5CD9A 2QENA 3PQFA 1QK4A 4JI2T 2P3QA 4UE6A 2GPSA 4WESB 1Z6QA 2QTAA 1W0KD 4JI0B 3DVAB 2XDQA 3ZQ4A 1IHUA 2NZVG 3DL2A 2EIXA 3P0RA 1YIAA 4Q4AB 1ULUA 2HYIC 3LKVA 2PIDA 3IAAA 3JAFA 4P92A 1YUBA 4E12A 1KE1A 3LLMA 3L18A 1AHHA 4F6RC 3SN6A 4P0BA 1TC2A 7MHTA 4COKA 3HSSA 4DDMA 1E4VA 5H3LA 1NJFA 2WSSD 3LCUA 3RC9A 4DEYA 1KMMA 4KW7A 3I5YA 1CVRA 1SXJD 2X0LB 4ZPJA 1ZIXA 2J6CA 3N0VA 4Q4HA 4KMMA 2YHIA 3T7TA 2P9HA 5GAJA 3KKMA 2JIBA 4M1KA 3BSFA 3ESQA 3G17A 1X0VA 5JJKA 2XUKA 4E4RA 1FTSA 2FK7A 2K2QB 2NYRA 4H7HA 5KNBH 2VJMB 4JC5A 2VYVA 1IULA 4MALA 5ULLA 1W9HA 4KK4A 4HMQA 3QPBA 9ABPA 2GAFA 5DW3A 1E0JA 2V3WA 5G4LA 5BWLA 1FUEA 1NVMB 2Y2VA 2EYUA 4JA2A 4EI2A 4G1UC 1BEUB 5JCJA 1JWAB 5J9FA 3TFOA 2CLOB 1Q19A 2ZOSA 1MT3A 2QU8A 4J7UA 2PZJA 1HR0T 2P68A 3C3PA 3ND9A 3MRTA 4DMMA 5ADXL 5JE8A 1WMSA 4XLTA 2YL2A 1K92A 1NKTA 3PVZA 1FXSA 4CDMA 4EB3A 6AT1A 1X8KA 2B5WA 5AKJA 4DBLC 3H17A 5ERYA 4UBMA 4I5DA 4RL6A 3DWEX 1NXXA 4MMYB 2W2LD 1HE2A 4QOSA 4I4LA 2IU6A 3BJIC 4ZQHA 4G5RA 2C5GA 3REGA 3K72B 4S1TA 3MJCA 1LF5A 4DY6A 3HUEA 3H4MA 3QBJA 3JD4A 4BEWA 3IFSA 3QG5A 3FRHA 2RH5A 3JD2A 5A5DA 3DC7A 1P1JA 2JJYA 3GLFE 3HP7A 1CJUC 1E1LA 1Z22A 3BZUA 1ITZA 2N46A 1G41A 3R23A 4CLOA 3K94A 2B1IA 2VZ0A 2WJ4A 5B7QA 1T1GA 3X2FA 2P9FA 3L1VA 1JJBA 4D8TA 4GFDA 3NG1A 5EQFA 4J4BA 3ICQB 2QVAA 2HPVA 4HMOA 4CFYA 4KNYA 3E1GA 1SU8A 3W1WA 1NATA 3CR7A 3K2QA 3H2YA 1C4KA 2WF7A 4DDUA 4HQRA 3C3AA 1NXSA 1YTLA 1GAXA 1U1GA 2D0TA 4IT4A 5JDHA 4EW2A 2YIDA 1GRQA 3WFIA 1NT2A 1Z2DA 5CEFA 4HPWA 3LSYA 5JYCA 3GP8A 5JQGB 3PX2A 5LYJF 4ZQGA 1MDFA 3W5AA 3MTQA 2WM8A 1IZ0A 5IVDA 4YROA 1Y7PA 1QG6A 4TRJA 3CVRA 4ASUA 2MTQA 4AKIA 1JHXA 3BHJA 2DUMA 4DV5T 3P0EA 1NQTA 2OWDA 3OA0A 2XVAA 5IH7A 1U2DA 1PR1A 5BV2P 1ZKEA 1HPLA 5IM4A 4I36A 2BC9A 3F7MA 4BNDB 4OHUA 2FJDA 4LOAA 1D7AA 1GAQA 3NHUA 5ALRA 3NHFA 3GJYA 1ZBDA 1IBMT 4C1NA 4CF7A 4YAFA 1E20A 3F9RA 3E84A 1FF9A 3ZV7A 4BWGA 2VP6A 3QHAA 4CI1B 5FO1A 1FFYA 2FX5A 2HHHB 2EKZA 4BZXA 3R5KA 4QYWA 2EL7A 1RAHA 4HFRA 2I76A 3E3OA 2N1MA 4PAMA 4B09A 1QIDA 1YXRA 1LPPA 1H1LA 2GMWA 2O48X 1TZJA 4K86A 1YCGA 2EDAA 1BHSA 4ZT2A 1PS8A 4ZJZA 1NYLA 1QQ6A 1IB0A 4DEXA 2WIKA 2IS1A 1ZU5A 1TM5E 5DYGA 3KV9A 2ZKLA 1G2QA 4PZYA 3AUSA 4IQ4A 3REQB 4RXTA 1WW3A 4ZI3A 1OR8A 1XXHE 1LJUA 4QVGA 2EEZA 2W7TA 1YKFA 2W58A 3MUNA 1EJ2A 1WMDA 3BIJA 5H5JA 4UXHA 1FMCA 2FHPA 4R1SA 1KQ3A 6REQB 3DONA 4ZZ0A 1SBQA 5HF5A 1AQIA 1WW8A 4J2CA 1Q17A 1N3IA 3KHSA 1UKZA 3FLAA 5LP6C 1TEXA 5LNK1 1ZK0A 1MRSA 2PZKA 2CHUA 3PCXA 3QBTA 1C7ZA 2YR0A 4RFSB 4YXWD 1TU0A 3E2IA 3KT6A 5AQRB 3DT9A 2NSJA