4PAGA

Abc transporter solute binding protein from sulfurospirillum deleyianum dsm 6946
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
323
Chain Sequence
ESRTFLDVSNKPIVLPEHITRIYGSAPPISFMIYVIDDTPLIGVNSPQTNKDNNNGEKFLSKHFMELPILGGWHGNNIPNLEAILAAKPDVIITWDTPLLNEKTAKDLARISIPALKVNIDDSQNYPEVFRYLGRVMQKEERANALANMAQTYLDELKTFVASIPEKERTKVYYAEGDFGLQTECDRSFHSEPLALAGGNLVHKCVQNSVVGLQEVSFEQIILYDPEVIIVQNPTFYKTVFREKKWAVLKAVQNKKVYLVPKSPFNWTDRPPSFMRILGAHWIASKLYPTRYPYKIEDKVKAFYQLFFGVELSNEDLKTYFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Periplasmic binding protein
publication title Crystal structure of ABC transporter solute binding protein from Sulfurospirillum deleyianum DSM 6946
rcsb
source organism Sulfurospirillum deleyianum
total genus 105
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4pagA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA03
1FP4A 1H1LA 1KARA 2OV1A 3AEKB 4WNAB 2AFIA 4FI3F 4FILA 4CL2A 3ZKAA 3TLKA 1QGUB 2AFHA 3G9QA 2PS9A 2XH8A 3ZK7A 2OSVA 1PSZA 4H0FA 1FP4B 2AFIB 2PHZA 3MFQA 1ESZA 2R79A 4OXQA 4ND8B 3AEQA 5JPDA 5M34A 2AFHB 2PS3A 2XV1A 5B58T 4N01A 3ZK9A 2RG7A 3PSAA 4WNAA 4WN9A 3AETA 2Q8PA 3MD9A 4UDNA 4NNPA 4M7OA 3AERA 3EIWA 1MIOA 3AEQB 2R7AA 2XQVA 4XPIA 5GGXA 4PM4A 5FLYA 3BE5A 4DBLE 3AEUA 4TKVA 2XDQB 3AETB 4LS3A 4WN9B 4HN9A 4LJSA 4HMPA 3AERB 3LHSA 2YNMC 1MIOB 4ND8A 1XVLA 4OXRA 1M1YA 4XPIB 5JJ5A 4HMQA 1G21B 4MX8A 3AEUB 5KOHA 4TKVB 3UJPA 4INPA 4MLZA 2YNMD 3PDIA 3GI1A 3TEFA 3HJTA 1M1YB 4H59A 3AESA 1K0FA 2XDQA 5KOHB 4GICA 5KOJA 5BVHA 1N2ZA 2Q8QA 3MWFA 1M34A 4K3VA 2PS0A 3PDIB 1QH8A 2X4LA 1G21A 1N4DA 3AESB 5HX7A 2WHYA 4WZBA 2WI8A 5KOJB 5BVHB 1N2CB 1M34B 5AFSA 4WZAA 1QH1A 2MINB 3K1AA 1K2VN 1TOAA 2PRSA 2QI9F 1QH8B 3CX3A 5BVGA 3BE6A 2O1EA 5CX1B 5JG7A 4B8YA 5I4KA 4NNOA 2OV3A 1PQ4A 4WZBB 4PAGA 3R5SA 4TKUA 4UDOA 4WZAB 1QH1B 3K1AB 3PSHA 2M6KA 3ZK8A 5BVGB 5M29A 4MDYA 4WESA 3TNYA 2ETVA 4HMOA 1N2CA 4TKUB 1L5HA 3HXPA 1N4AA 2MINA 4FKMA 3U7QA 1EFDN 1K75A 2XY4A 3EIXA 5CX1A 4IRMA 1G20A 4FNAA 4MO9A 4WESB 3MINA 4BBPA 2M6LA 3R5TA 5JOQA 4UTOA 1L5HB 1M1NA 1H1LB 5M2QA 1K7SN 3MWGA 4OVKA 5KHLB 3U7QB 3HH8A 2OGWA 1KAHA 5HDQA 1G20B 5CR9A 3MINB 3NU1A 2XUZA 4INOA 1M1NB 3AEKA 4UTPA 3ZTTA 3LI2A 1QGUA 4G09A 5GGYA 5M3BA 1KAEA 4G07A
chains in the Genus database with same CATH superfamily
1KARA 4G3XA 3JAMA 4MS3B 3EASA 3OQIA 1REQA 5DNYB 4O2RA 2WF8A 4P1ZA 3D2CA 1C3XA 1JHDA 4NNPA 1EX6A 2NO4A 1U28A 4DVGA 4AMYA 4YAKA 1IPHA 3IAFA 1CY4A 3HA5A 3EF0A 4KE9A 3H2KA 2E9XC 5JDCA 4QWMA 1OA0A 3K9CA 1PG2A 3WTCA 1T3SA 1BCSB 3KLOA 3N28A 3AUYA 5KOJA 4N7RA 4MR7A 3LWBA 1CP2A 4GR4A 3FKSD 3RKSA 3X2SA 1XXLA 5CGMA 3R3VA 3KVVA 4F21A 2YFYA 4HGAA 4PQGA 4BNVA 2KPOA 1C7IA 4RZIA 1YE3A 2R6GF 5CNMA 4ZKDA 2YVAA 4C0WA 4IIEA 2C4VA 5LUAA 5ELXA 4UELA 2HMAA 1PU2A 4ZI7A 1B2LA 1V39A 1P7CA 2X9XA 1M2WA 4B3BA 3GOHA 5IULC 4AJJA 3RC3A 1BMDA 1RT9A 1UM9A 3R3ZA 3K20A 4WMLA 2D1YA 121PA 2H57A 2P1RA 3MTGA 2IIQA 1ISSA 4JB2A 4ZV9A 1KDOA 2RHCA 1O95C 1E9RA 4LJ6A 5AYVA 3EDCA 4BIMA 2PH5A 1I10A 2J3EA 3FPCA 3KYBA 3AEXA 5CBPB 2WJIA 5CDGA 2JLWA 1WF3A 4DAOA 3UYKA 2QT0A 1FUIA 2FMXA 5JDMA 3F8SA 2C5EA 5ABFB 3DDZX 2O3TA 3QIVA 4QASA 2DEUA 1YQ9A 2X8LA 3RRNA 1A97A 1AK2A 3T3GA 4Y9SA 4OK5A 3WHIA 3D8RA 1S3FA 1M54A 4EHBA 1FP1D 3A6FA 1FS6A 2CBXA 4TL6A 3K6RA 5IXJA 1E7MA 4RNCA 1K8YB 2C07A 1LDBA 1MNDA 1VSUA 1X7ZA 2PY6A 5DSZA 4JGBA 5DK6A 1MZVA 4TWAA 1II8A 4XA8A 2HRRA 2GD0A 2WWIA 3CG0A 4MPRA 2G0NA 3EY9A 1RBYA 3THOA 4DW8A 4AUKA 3UJ7A 2NX2A 3R0VA 1XVUA 1XU9A 2XGOA 3OP1A 4LBVA 4RVDA 2FW9A 4Y1GA 3OMXA 1VJRA 4MWBA 4KU4A 1P2TA 4HFBA 4FNGA 3C24A 1WR6A 2P4EA 4CV3A 4A8JB 4R1SA 1UBEA 5FTLA 3R8FA 4B6SA 1TZ2A 4ZRMA 4ISBA 3EUWA 4MB6A 1EE2A 4II7A 4IOKA 4J49A 2ZBGA 1P3Y1 2JLVA 2RSLA 3BWDD 4BV8A 3USES 1G3MA 3DE1X 3AJEA 4JUDX 5KNCA 4PG6A 1ZGBA 4HAYA 3RLFA 1CQJB 2HT1A 5COQA 1FIUA 3DEJA 1NQTA 4AXBA 4RA6B 3PFFA 4O1IA 3L5OA 4J0CA 4YH1A 2CXLA 4D9MA 1LD3A 2CHQA 2G71A 4D3XA 2UVPA 3ZQ4A 2YCBA 4G0NA 1Y33E 3RK1A 4W1QA 3I0ZA 1I7DA 4MWCA 4P08A 1MB4A 3C14C 4OQPA 3W2HA 3SR4A 1PV4A 1J97A 1OI4A 2ZVDA 5A4AA 4QOSA 3I8SA 3LBHA 1SKYE 3BXGA 4X41A 2XDQB 1ZUNB 2PQ2A 4TSKA 3AFNA 2CSXA 1DPGA 4IRXA 3BH6A 2YMMA 3COSA 1P7ZA 3ABRB 5AT1A 4IILA 4NQRA 3STWA 1CUZA 2FPIB 1LI5A 1ZITA 3NT5A 1YOVB 3NBKA 4XSHA 4Q9JA 5DNCA 2UUBB 3Q5XA 3M81A 1ZGAA 3LQRA 4I66A 3CXRA 3GN5B 4JB0A 5P21A 4RESA 3HSYA 4B80A 5L3SB 2FCAA 3UQ7A 4UTOA 1IJ5A 4R0MA 2HJRA 3SBEA 2X9NA 5HDQA 4X20A 3PC6A 2VNIA 2ZYAA 2R8EA 2CHFA 2E48A 4Z7QB 5L4HA 3IPAA 3BERA 3LFHA 3O3CA 4EB3A 1Z56C 4L3WA 4MFRA 1UBKS 4JV5B 3PDJA 1O9HA 1FYWA 3F0TA 3ETJA 1BXKA 1ZUWA 1R4ZA 1XZGA 3R3SA 1A8PA 3PGVA 4TRJA 2PLRA 1V47A 5ISMA 3I6IA 4Z8XA 3EC2A 4FZJA 3ZU5A 2C98A 3CSUA 4KSCA 2JANA 1A9OA 1ZCZA 1YQDA 1UJMA 3SX0A 1EGAA 1ST2A 4FHCA 2Z6VA 1GZDA 2X5KO 3W5DA 2VBCA 3AW8A 2D0UA 5KIAA 4ABTA 5JS1A 4IE4A 5BRAA 2RGNA 2OBBA 4U2ZA 2RI0A 1ADJA 4AB1A 2PSEA 1S9HA 4AJ4A 2GRUA 4B8WA 3X1MA 3AO0B 5CJ5A 4LNUA 3KB1A 3AONB 1M33A 2F1IA 5HCUA 5EZ6B 3NH9A 2BKOA 2A30A 4JNCA 5EQJB 3ZCJA 4P83A 1D1TA 4NV1A 2ZULA 2C3YA 5F73A 2X1MA 3GLIE 2YWDA 2I71A 4NYMR 2ECQA 3QLVA 3GPIA 4BNXA 2WHQA 1QOPB 1CUSA 2VQFB 3BX1A 4COFA 1PYOA 3ISTA 1P45A 1PL0A 3IJ5A 3UB3A 2JGNA 4EKGA 4BE4A 4BVAA 3LC2O 2C2HA 3KYDB 3R0ZA 1N2SA 1GGJA 4BJ1A 4EEXA 1R6VA 3D4OA 2V74B 4LXUA 4XD7D 4KUHA 5BPHA 4GOND 5J2UF 5AW9A 3PXBA 3O1HA 3RYFB 1W5BA 2B0JA 1OH8A 2PUDA 3HEBA 2JFWA 3KBUA 4FDMA 4RNDB 2YDRA 2HY7A 3O1JA 5FB3A 1T9ZA 1YRAA 1EWVA 1NUAA 1L7MA 3SQWA 1RMYA 3L7LA 3ZLVA 1M72A 1LPPA 4FXPA 1XTRA 5K3SA 3MERA 4GW3A 5JJIA 2DWQA 1IHPA 2GNAA 3NZPA 3OQPA 5K3BA 3MWFA 4Y1RB 4K0UA 4BV3A 2XXAB 2YMLA 5LHGB 2BELA 3TZKA 2BFFA 1B8OA 1H2ZA 5BR8T 1WDMA 3ZE7A 1T35A 2F1JA 5EJFA 2BS2A 2JH8A 3H13A 1QHIA 1AGNA 1YA6A 3KKLA 3HR7A 1UBFA 4ZHQE 1ZNXA 4CL3A 3SZLA 4TN5A 3AEFA 5I7WA 2PHZA 4B4OA 2UVDA 2XGMA 3DZBA 1XQ9A 1A5BB 4EHLA 4HGOA 1D4ZA 3AB7A 1L4LA 3TW8B 4KLCA 1N78A 4RTRA 4ZP1A 3UPUA 3HXKA 2I91A 2VF8A 4ID3A 4JZKA 4RMHA 3V34A 3UV7A 1O5TA 5MN5A 4TT3D 1L7AA 4KHPT 1BKSB 3G9TA 1DJOA 4EMUA 4ENVA 3IOCA 3CMCO 1QFXA 3H8WA 3QYJA 4DHWA 1KQGA 1FUUA 3I6YA 1XRPA 3DKRA 1S2MA 3V2HA 3TKLB 5IDQA 2LM9A 4GM4A 3RYCE 3SKVA 3BM5A 4HNGA 2HQSA 5AK0A 2IOFK 4G97A 5HK9A 3U4MA 2GCEA 3RB8A 3PIRA 5HVNA 5EIXA 3FBTA 1F17A 3FDZB 3OKAA 4CI1B 5E4FA 4JI5T 3QI2A 1SHZC 4RJTA 5K03A 1ZMOA 3KJFA 2CFIA 4ONEA 2VRNA 4CIVA 1SXJB 4KLZA 1EUDA 2F4NA 2PZBA 1YI8A 1YGPA 3ADCA 5A3JA 3PQ4A 1ZU4A 2VDLB 3OTIA 1TMGE 2OCBA 5DEOA 3QE9Y 1UZUA 3KLMX 3UIEA 2EGGA 2QRGA 2CYAA 1DP4A 3REQB 4OB8A 3UTKA 1CY2A 3SQXA 2J6IA 1UUSA 2XNJA 3NOVA 7YASA 1MRNA 1V1RB 2E9XB 3TSZA 1PGOA 1U0OC 5JDQA 1U3GA 2QSZA 2WOOA 3ABZA 4CEHB 4H15A 4PGMA 4EW1A 3CPSA 5THKA 1RXIA 2PPVA 1A8IA 4BX9A 5KYXA 2P27A 2QLMA 3DH0A 1JXOA 4HZUA 4IR7A 3ZQKA 3ZI7A 2FWJA 5M5BA 5CT8A 1ZUIA 2FE4A 5D3MB 1JNRA 1S3IA 3UFGA 2D5AA 2DQZA 2XUDA 3O4IA 1Q57A 3FWKA 3W2GA 2NP7A 5K0LA 1SHLA 4ZCSA 4J29A 4ZVQA 5J1GA 4COKA 2C58A 5H8WA 2Y1OA 2J8ZA 5HFNA 1E94E 2NUPA 1JFSA 2LLYA 3EIQA 4INAA 4WKCA 3I2HA 3VYUB 1D4FA 4HDOB 3GYBA 2IS6A 3BRWA 3DFIA 1IIRA 1Z0SA 4H4DA 1NN1A 3E0XA 1NQWA 3C70A 4JEHB 2COKA 2K7ZA 4JC5A 3TF5A 4OP1A 4DZTA 1MPXA 2ODBA 2ICAA 4Y6RA 1IJFA 1YBAA 1EVQA 3WAGA 3PXAA 2MTQA 1C8VB 3BGSA 4IFEA 1EBBA 1D0ZA 2H2IA 2Q5JA 2B8JA 4BE7B 2IZ5A 3QVOA 4MK4A 1T98A 2KX7A 3KSAC 4XVUA 2EJCA 3CLTC 3WDKA 4ECEA 2SKCA 4QT4A 3TB6A 2A84A 4EJSB 2Y9PB 4ATNA 3BFXA 4D99A 4BNUA 3RABA 1F2TA 3UMVA 5CIYA 3PEFA 2ZM0A 5DLEA 4W5HA 4XOIA 5BNZA 4D8YA 2C0SA 2H8KA 2Z3ZA 2Q5QA 3BXZA 1MMAA 5IT5A 4G2TA 1Y5IA 1RYFA 4HQRA 2BKNA 3LCUA 4QULA 1ZU5A 2EYQA 4HQKA 3PUAA 5B2EA 1F8UA 1IM5A 2QN1A 2GTHA 2LBPA 4NPCA 2WF7A 1P4RA 2IYRA 1YZ3A 3OTGA 4XWGA 1ONSA 3ZNNA 4IX1A 3MWLA 1AHIA 3UVEA 2QRPA 5KQLA 3EBOA 1GCUA 4Y6SA 1GTL1 2AIRA 1EVZA 4NMWA 4HYYA 3OOYA 3DBRB 2Z5VA 5JCOC 1NVMB 3OVMA 3AM3A 3R4VA 3RRBA 5CAEA 3IVXA 4YTPA 1WKCA 1PWEA 4BO6A 2BI7A 5DLQC 2JIZD 5HWYA 2AEFA 1BROA 3NNDA 2WMOA 1JIXA 2JZNA 2CLDX 2ILTA 2AQKA 2JJ8A 3KR9A 2O3UA 1KGSA 4REOA 2C9CA 1UP6A 3BN3A 3ZC1A 1C3LA 3RG8A 5LZ4A 2EKQA 1DEOA 4XCQA 2IH5A 4Z91A 4YPVA 4F04A 4GKVA 1PW5A 1T4DA 5EZ5A 1WXFA 1QRTA 1O96A 4IRUB 5GGYA 1EZ4A 2WFZA 2N46A 3W9YA 3O1IA 1W7AA 3UPTA 1N7GA 4FGSA 2I54A 3M9LA 4TRMA 3Q1KA 4XLLA 2JAXA 2XSBA 2QLJA 2XODA 4GRDA 2LE8A 3RSQA 2VHEA 3HJBA 3WMWA 4X7BA 2B2XA 5DXJA 3FYSA 2VH1A 1Z6QA 2VP6A 2UYYA 3U6BA 2FX5A 3EPJA 1KK2A 1GZ3A 1GNSA 4TKZA 1A4IA 4BO4A 4RGQA 3RH3A 1TT7A 1C81A 5L3DB 2WA2A 3EDVA 1LRZA 3HR0A 2QBYA 3A7EA 1MMDA 1IN1A 2XVAA 4ZEOA 3U4HA 1A27A 4PONA 3AAIA 1N5DA 2BTQA 4A0RA 3CR3C 5DHPA 1N8SA 2XMGA 4N76A 5SV2A 4TUYB 2F67A 3BIXA 4YQFA 1H6BA 1XAJA 5AW7A 2B8EA 2I03A 4UUPA 1DO2A 3UV3A 4H17A 1TQ2A 5ADWA 4YBRA 5B2FA 1CQWA 2BEKA 4E2ZA 1KC3A 2VP2A 4JP5A 2C1EA 2PJRA 1UBTS 2NO9A 3KAJA 4RVSA 2PYIA 4JI6B 3JWJA 2WJHA 1JKXA 4YT2A 2QD5A 1RJ9B 4QXHB 4UEMA 3ONWA 3QVKA 2IOYA 2ALJA 3AVWA 2WHYA 4PXSA 2FPLA 3I1AA 3H86A 4AJKA 4YHHT 2VJCA 4UD2A 2QL6A 4LOKA 1J5EB 2PL5A 2QUAA 4OKIA 1XVVA 3FNGA 3P5SA 5KHOC 2KSRA 4W6QA 1NIPA 4MQ6A 4M22A 1LRLA 2AEEA 3QPCA 1P8JA 5FPQA 1RYYA 4EYEA 4D9FA 1YKFA 4BRWA 3ENKA 4Z4IA 2D74A 1JTVA 2QRJA 3OCYA 3ZJVA 2WIFA 2OQ2A 4L0CA 1G5RA 4QYXA 1ZXLA 1L8AA 4DLTA 3N8HA 2LHNA 1ND6A 4H16A 1VCMA 1JFVA 1YTUA 3UQZA 1IMOA 3A2MA 3HUFA 3VSEA 4PYKA 2H0RA 3WB2A 2DPXA 5BOVA 1II9A 2VZ8A 3E7XA 2GYVA 4NAHA 9GPBA 3TIFA 1HI9A 3CNHA 4ENRA 3DVQX 1Z0IA 4YTMA 3GUYA 4IJ6A 4GS5A 4QM7A 1IU9A 5IVPA 3URMA 1CW2B 3TLJA 2RFLA 1QYIA 1T15A 2VP5A 3DW3X 1X38A 3EARA 3C85A 1ZK0A 4BZPA 2KZ7B 1ZLYA 1BTOA 4LWOA 5F2OA 1TIBA 1RLMA 1CUWA 3N58A 1AXRA 1MEEA 2B8NA 2P91A 1NM5A 1RHUA 5KJ1A 4MI3A 4DV3B 4JOSA 5CCEA 2CL0X 1M1NB 1EINA 5KNBD 1G0NA 1VLVA 4OJQA 2ERCA 2GJ8A 2GXUA 4GX2A 2YICA 5CFLA 2VJKA 4IZ6A 2B25A 4GOUA 1IY1A 2NO0A 4L76A 3AF6A 5IZCA 3KZMA 1H0SA 3VBCA 3VU7H 3AEQA 3KBTA 3E7FA 3K0FB 2XGSA 1MKYA 4O3MA 4XUDA 3BE5A 2HIMA 1RYBA 4MWZA 1NULA 4RMIA 4FW9A 3V80A 1B76A 5G1OA 3SXUA 3NWBA 1U2DC 4B5KA 3DJBA 2XVYA 4DLUA 3U9LA 1X9IA 5J2UA 4U2DA 4QGGA 3BJIC 5DV9A 1AS0A 1SBQA 4DJDC 2XB9A 5E4JA 4C9BA 4CCSA 5J47A 3P9NA 1O87A 3MOSA 2JB9A 2QVCA 2I65A 3DBHB 5JRDS 2PXXA 5DWDA 5A6SA 1Z88A 4RMJA 5E9WA 2C92A 4FEAA 1B93A 1ZD4A 4I9UA 5KWSA 4YAFA 1F51E 3N9IA 4FR0A 3PXUA 4HL6A 5KNDH 1GO2A 1TMOA 4L0QA 3WRWA 4C3UA 4BU1A 2XASB 4UVHA 3RT9A 2IUSA 1ECBA 5FNVF 4D41A 2ID7A 5GY7A 4A82A 2RHHA 2UUAT 5JY1A 2V7KA 2Q1YA 1U0JA 4LYEA 3PLRA 1KQOA 3LD9A 1QCCA 5FBZA 5EAIA 1CHNA 5KSYA 1OLXB 3GDWA 2IX9A 1C9KA 3C6YA 2I34A 2X8JB 5I5GA 3RHTA 2HN1A 2VT3A 4AP9A 3HJTA 2Z2XA 3S1AA 5I7RA 1C3VA 3CW9A 4QJBA 1Z5OA 5CNKA 5JECA 2FPPB 3Q9LA 1W59A 3LKVA 3GT3A 4QHSA 5BMOA 4E11A 3RAEC 2YV5A 2BBWA 4HRXA 2FR8C 2BDTA 2QUJA 2HDOA 3HGTA 1C0KA 3VKHA 1YQ4A 3DWEX 4YFYA 3KDAA 2FQWA 3ABOB 4DIFA 3PRYA 1E3IA 2ORVA 4D8UA 3SHQA 4DIKA 1FLDA 2YFKA 2PMKA 3VI3B 5PNTA 1Y8CA 5JDGA 1PFKA 3K5PA 3WHKA 4JT9A 2HH7A 2B2CA 4YUWA 4E13A 3CVUA 4BWVA 4BKQA 2HLDA 3KSBC 4MNTA 2EJVA 4ND2A 4G84A 4JOCA 2D1QA 1SUFA 1SXIA 2RHRA 3QFTA 3FMGA 2NYAA 1AQJA 4B0OA 3ZH9B 2Z8YA 2DRIA 2QR3A 2B7BA 4RYDA 4Z0HO 3NTQA 5C52B 2BN4A 4QU5A 2CJXA 1YHYA 2RHOA 4A92A 4O4JF 4LF6B 4B4UA 4H7KA 1BGVA 2QLNA 3UJDA 4E51A 1GKLA 4LJLA 3LUJA 4C1BA 2GN1A 2JASA 1QIKA 5JQGA 3EXFA 1DAOA 4C4TA 5JNRA 1BGWA 2K9AA 3JWGA 3KV5A 3RVPA 1M0EA 3TZEA 4IKPA 3JYPA 1DZ3A 3OI7A 4P1NA 4JJKA 3PIIA 5HXCA 3GAZA 2HPZA 2XLBA 2JIQA 3CGGA 1BKDR 4P86A 1CULC 2IUTA 4YUZA 3WNQA 1EFTA 4AZ0B 3U56A 1EE1A 5A5GA 2H1LA 4MW9A 1L5FA 3T7RA 4R68A 1ZOLA 1ZN7A 3MTIA 1EESA 1UC8A 4LMLA 4JQYA 5ADUS 1JHVA 2VA9A 3EXIB 3D6HA 2VDRB 1RJEA 3PR3A 2ODEA 2BIFA 3IKMB 3LT1A 4OAOA 1VJDA 2D7CA 3LTEA 4MV7A 4QUEA 2QPOA 4ICIA 1ORTA 3D2BA 4PCUA 1M1YA 2VG8A 4MGZR 3AY7A 1U90A 1YVEI 1V5IA 3E1GA 5EWMA 1SURA 3KCNA 3IODA 4OUKX 4R0VA 4PLCA 2V7UA 2BG9C 1G0OA 1L7BA 3DXXA 1LPMA 2C7GA 4IFIA 2DAPA 1QP4A 1ZGGA 3MGGA 2VCYA 5DP2A 4KR9A 5CCXA 2V7PA 4FFMA 5C46F 5GV7A 2XKJE 2JL1A 4QYSA 4JI0T 4R05A 1OI7A 4NCXA 4DMLA 10MHA 2JH9A 1E7WA 3HA7A 4YCAA 3FCSB 2QIOA 1TO6A 1YB2A 2LKHA 1NVUQ 3TXAA 4EX6A 4QG3A 2Q5FA 2QAJA 1VCTA 3S6JA 2WF6A 2I6HA 4DMVA 2C59A 4DMWA 1HOXA 1B8UA 2ZDQA 1DMSA 4D98A 3GNLA 4PM4A 1XPUA 2FJBA 4MBQA 4Z3KA 3QWAA 3WLOA 1W19A 1LBTA 2I8AA 4PHFA 4PNZA 3BZWA 4P4SA 4K6OA 2PBIA 1LPBB 1KH1A 1R4MA 4K9KA 2Q0QA 2JARA 3H2HA 3W5CA 3L1IA 3I6BA 3WIDA 2BKUA 4KQCA 3BTUA 3WK4A 3ZI0A 2KE5A 1K06A 2PYZA 1X9BA 4R3WA 1P2SA 4KLAA 2CNWD 3Q2KA 3H6HA 3SU8A 3RLFF 1H4VB 2RHTA 4FR2A 4X93A 3OTHA 4CKCB 2WG0A 1RAGA 2AJDA 1MC5A 1X13A 4V3BA 2ZUFA 2V1DB 1GAXA 4JQCA 5DX1A 1Y7TA 5F64A 3W4KA 1HQYE 1L7NA 4GKBA 4G0VA 2ZQ5A 1QO7A 3UG7A 4BFXA 3QVXA 2AKYA 4YWHA 1V35A 3HA4A 5B53A 5AOAA 1K6XA 1PWZA 3AHDA 1RLTA 1YOBA 2BDUA 1YS6A 3LUCA 1YQWA 1L7XA 4DLVA 4CKXA 3PVZA 1A8HA 3ZXIA 2XHZA 3HI2A 1DQNA 1XJCA 2OCIA 1LC3A 3V1UA 2OXRA 1JQDA 1Z4LA 2XCQA 2R5FA 1XHFA 3TW4A 2J3HA 2WFLB 4WZ6A 4JLWA 3OZIA 3RJ5A 5A1TA 4JUFA 4MEBA 3VH1A 3S7ZA 3D6NB 3OPVA 1GPUA 3A3KA 1RQPA 2WDQA 2PZEA 2CNOA 2X77A 4W9NC 4X1KB 2PRKA 3V4VB 2ACEA 5ITWA 3MCUA 5FWDA 1WZUA 5JSFA 5C1BA 3EF1A 2BGGA 1X87A 1PZNA 3ST7A 2VWQA 3GGCA 2J6BA 3INTA 2CUTA 3OOEA 5JR9A 5KKAA 2WSYB 2HMTA 4BXOB 3DB2A 1ZCFA 2QP4A 4MRSA 5JQWA 2N9DA 1R50A 3DT9A 3VR2A 3OJLA 3LUBA 1IZ0A 4QVIA 1MO3A 1C1HA 4DYHA 3ZQUA 1YB4A 4F9TA 3SQLA 4N6GA 2VOJA 1W85B 3GH1A 3C1AA 4I3FA 1B7GO 3HL0A 5A4JA 4TXMA 2OYRA 2OZLB 1S1MA 2PLFA 4P93A 3DGFC 2CYCA 3GEBA 1WMSA 3FHOA 2DLNA 2WOJA 2P6MA 2IYFA 1F8YA 3OM9A 3T95A 5GWXA 4GXRA 1H8EA 3KLPX 1GPYA 3TAUA 3AWDA 4XJTA 2QR5A 4R2JA 1IUNA 5HKAA 4R1NA 5A5DA 3O47A 2XQ5A 3E2MA 2UZ0A 2ES0A 2NOXA 1A1VA 4FDTA 1YR9A 5DT2A 4WERA 3MRSA 1YA8A 4DJ5X 1WZCA 1YCDA 2WA1A 1KORA 4A0SA 2Q9QA 3N39C 1ZJWA 1CUDA 2P9BA 1AZWA 1YZUA 3DEIA 5LG3A 4RK5A 2JGLA 4HBZA 3ZWAA 3L4SO 4DIOA 3VNVA 2OHVA 4J1NA 5ED4A 3MYRA 1DC4A 4C4RA 3D6MA 3ZCXA 4PLYA 3PEUA 1D07A 2II6A 4EEZA 3BD7A 2EJTA 5SZHB 1RQGA 2LWIA 2JIRA 1QLHA 3A6DA 4JL6A 2D0IA 1PO7A 2PRSA 4TMVA 2I2FA 1N34T 3JR3A 1E59A 5CM2Z 4RIHA 5AJVB 1WL8A 3A6LA 4X64B 4PX3A 1BH2A 1CJBA 4ZC8A 3Q8KA 1DNPA 5FI0B 2W9XA 2OAQ1 3O93A 1BFDA 5CJJA 1J70A 3JRWA 4PK5A 3ETVA 2I3GA 3ANWA 4H63H 5IDVA 1IBMT 3EYAA 1UMBB 4HGQA 4A5XA 2MYPA 3TB4A 4R1LA 1GG2A 1VG9B 5DQVA 3HU5A 3KUXA 1U7OA 3RSGA 1AB5A 2XBUA 3MSCA 4BB5A 3CO5A 3PF8A 1IXZA 3COZA 4NK5A 3UK1A 3O8RA 3K31A 1ZYUA 2NVUB 2YINC 4Z0TA 2QF7A 4G24A 3AVOA 5EIAA 4FMDF 4TQUS 1LTKA 3L0PA 5KQMA 2ABWA 3ITNA 4GIWA 3ZU2A 1IC6A 2VQ3A 4QNNA 4IYJA 5LVAA 3ZE0B 1VIVA 1QH8B 5JG7A 4BATA 4DJFC 3MVEA 5JIBA 4IE7A 1Z83A 3WK5A 3PF9A 1PGJA 1KDVA 3BXPA 3FFXA 3EXEB 1C9YA 5JAZA 3ZMSB 1INLA 1L5HB 3GR6A 1WUHS 4MI6A 5SYMA 4WBNE 1B0UA 3IUQA 4WQMA 1K97A 1B2RA 4X66T 3AK4A 2NUTA 3JQBA 3S28A 1MW9X 4KMSA 1UK9A 4YPOA 3MFQA 3TEJA 4W1SA 2P9JA 1B6TA 2XWJI 2BS3A 2HQ1A 4KXWA 1X7XA 5DGCA 2PD3A 5EZYA 3OOSA 4ARCA 2FSHA 4YK7A 2VNAA 1C4WA 2HIGA 1I24A 1D5CA 4QVGA 2GFHA 4P84A 1J1IA 3ENVA 1SVKA 2WKRA 2FPXA 1QGDA 1FX1A 3BWVA 3W1VA 2A9KA 2ZSJA 3NWPA 1S1CA 1CUBA 3KQSA 1HH4A 4KKXB 2FMFA 5FBHA 1OTXA 2CRBA 2GN0A 1Z3CA 1E1DA 3B1ZA 1A4UA 5FBRB 4YIHA 2XTJA 2BHLA 3LC1O 1RTTA 1TRKA 3ZWCA 2GK9A 3MUNA 3HXPA 1UBGA 4B5LA 5EWJA 4K40A 4KDRA 2PKXA 1J56A 3ED1A 4G67A 2R6DA 2ZDGA 2ZSIA 3CNOA 2AXEA 3DMDA 4C7OA 2N1BA 2XMBA 3P2KA 4POOA 3HY3A 1SPBS 3ZY2A 3DNPA 2H7CA 4AY3A 2FRVA 5BUZA 1WB5A 1UJNA 1NVEA 2A0UA 1K9VF 1EU1A 3VNAA 1G20E 3HKEE 5K0EA 3BWCA 3QMPA 4C0JA 2OBNA 1ZAKA 3FCXA 1Q7GA 3P0HA 1GTSA 3UT5E 2XCRB 1SXGA 3EIEA 1E3MA 1ZH4A 2YZ2A 2WZHA 3O83A 1M83A 2HEIA 3W5BA 3SIWA 3WB1A 4JMPA 1GGEA 5E6RB 4U7IA 2DT5A 1IY9A 2IHYA 2IA5A 2FETA 3HBLA 1N2BA 2Y27A 4IL4A 3CR8A 2REQA 3L04A 2P65A 1O3YA 4EW3A 4E33A 2FJEA 2E9SA 4X65B 4UMFA 1OZAA 3SIXA 2JHCA 2BONA 2NO7A 1TTQB 2GPSA 1R4NB 4A15A 2FAXA 1PWYE 4AJIA 1U5PA 2OE2A 3EWNA 4F9FA 4TZ4C 3W9BA 4BLOA 4L8VA 3FYDA 1NT4A 1L5KA 5J40A 4YROA 2DFPA 4N7JA 4AECA 2UUOA 3HN6A 1ZOPA 3W1WA 1ULBA 4QDUA 3QVUA 2C4HA 3O5AA 3HXMA 4DLRA 1OAOA 2XQKA 2XIJA 3ZWOA 1I6KA 4OXKA 3FZEA 4AQGA 5EVCA 1XVLA 2JGDB 1M2VB 3RS4A 5G02A 2R7LA 3PCXA 4FQ5A 4N5HX 5KNDD 2ZYUX 3O4HA 5IANA 5LDDC 3HBJA 1NIJA 5E6UB 4GKKB 1NNLA 1VKHA 2ZOSA 4F86A 3AXJA 1UMDB 3KU1A 1LBHA 1SBIA 4XYGA 3DCNA 4M76B 2MHCA 4K6GA 1ISJA 1WJGA 5FLXA 4HYEA 2BG9B 2HXSA 3N9QA 3DZCA 1GUZA 2PGIA 1NR1A 3AE1A 3QX9A 3C4XA 4I4NA 5G53C 7ABPA 4P4LA 1Y4UA 1Q2XA 1I9GA 3AT1A 4LY9A 1LU9A 3KAQA 3ASVA 3Q7QA 1UDWA 1O9BA 4KRXA 1EX7A 2GS9A 3JADA 2QRHA 3IDFA 4O4JA 4ZYVA 4DIUA 1X1EA 1YBMA 1BCRA 3MK7C 4MX8A 4WADA 4AY4A 1L3IA 5CK4A 3FUVA 3C50A 4QX8B 2H17A 2QM0A 5AM1A 4RX1A 3F5FA 3AQ4A 4KFCA 4WZAA 2CEAA 3HPRA 5DTEA 1XTSA 5FBKA 5AVQA 4GVPA 4U7TB 3B2EA 5LXTB 1X8XA 3KWJA 2ZJOA 1NMZA 3VYSB 2H7VC 2PSJA 2IE8A 3G59A 4EI2A 3WXBA 2AOUB 2ODQA 2EFJA 4H9PC 1HC7A 1K86A 4DOMA 3QBDA 4FOTA 2VYFA 5DNDA 3NHMA 5LMZA 3F67A 5BT9A 4A6EA 3SK0A 4YJKA 3LJKA 4WLEA 1Y3HA 1TJ3A 1WZNA 1MHTA 4WKPA 2JGRA 2G77B 3PV0A 5THQA 2QGSA 3CH7A 5FYMA 4WFQA 5COBA 3F6CA 1KH3A 3U7EB 2JLXA 3LAWA 3HCOA 4NCAA 5FPSA 2BSAA 3V1YA 2JHGA 4R2LA 4TMFA 2W00A 3H83A 4WBSA 1JEYA 1NHGA 1I5RA 4OHUA 4LC1A 3BH7A 3DZGA 1D8AA 3WP0A 3DSRA 2I9KA 5J2TB 1WMDA 3J81A 4U5XA 3HKBA 1YS1X 4Q15A 5KYYB 2C9MA 3FZFB 2PZ8A 3G88A 4GBED 5H70A 4ZQFA 4EJSC 4GPZA 1O6FA 1EFCA 3IFSA 4HAZA 1XP8A 3VPSA 1MEJA 1BZYA 3OO0A 4OA8A 5EXPA 3PE3A 4DR2B 3CBGA 3JYNA 4G5RA 4G07A 1JG2A 4QXAA 4CVNA 4EYOA 4HJRA 4AN4A 4WKGA 1MNQA 4I9GA 1K4YA 1UF9A 1GUDA 2AN9A 4E94A 2Z56A 4L6IA 1JRLA 2ZB3A 4II3A 3QVGB 4GPAA 4MAAA 1N6KA 4DILA 3FLAA 1BE8A 3AFIA 5JD5A 4NY1A 1QIIA 4L27A 3EZ6A 3WIUA 3WJ1A 3WWOA 2WU0A 3K71B 5CDTA 4EPTA 1RWVA 2Q27A 1GL7A 1HK7A 1U3UA 2EG9A 2EQAA 1TQ4A 3R9IA 5H6RB 5AVVA 4YXFA 1VYVA 4AZTA 3ORQA 2WM9B 5FL7A 1GSOA 3IQFA 1AHPA 5ALWA 3WADA 1RM4A 2XKBA 2FH5B 3H3AA 4HDAA 4EL5A 4WXHA 2RAUA 4JBIA 3U09A 4RA6A 1EP2B 1LZLA 2OSBA 1OYYA 3CRQA 2QXUA 4DR4B 1XELA 1N2CE 4DR7B 1OXUA 3T5TA 1SG9A 4LJ4A 3OOJA 4HRVA 2Q4DA 5GGXA 4ADZA 2X0HA 2OCGA 5DTQA 2FUG6 1QBKC 5KOHA 4YCNA 3I62A 5FIUA 4D43A 1Y6QA 2FDXA 1DEKA 2XDQA 1LDEA 3NBYC 3AF3A 2J5XA 2Q1SA 1HNZB 2IKSA 3DNFA 3GAFA 5ABEA 4NXNT 4NKRA 4H9GA 4MUIA 4RAOA 4PK4A 1E99A 1JB9A 4CM6A 4A6PA 3LY9A 4R41A 5CA1E 4DWJA 3IBPA 4NMHA 1YOVA 5DISB 2X0IA 2WPNA 2M6LA 2Z1DA 4E5UA 2CMRA 2VOEA 5CVJA 2W93A 3GGSA 1B74A 2ZTLA 4HGRA 5K3CA 3UMBA 2X22A 4LHEA 4F2DA 2V5UA 2Y1KA 2B34A 1WCIA 1B3RA 4KNYA 1ZQ1A 3NHJA 5KMGP 3LKZA 5ALUA 4IAOA 3ZCRA 3I52A 4C3OB 1KZ6A 4IEIA 4K9LA 5E7MA 3EZXA 2HHCA 3PDCA 2R68A 2HWKA 3VHXA 4EW6A 5EWLB 3LT5A 1JJIA 1U8TA 4EG5A 4J16A 4BLQA 3SI7A 2PS0A 4KOEC 4NU8X 3UENA 4ZOQI 3W5HA 1S4MA 3VAAA 3KM0A 3OZBA 2RB4A 4X8MA 3SE7A 5A0VA 2V6XA 3AI1A 5K4HA 1K5GA 3M6VA 3VHLB 2GDZA 3VR5H 4I1RA 5LJMA 2BM9A 3CM0A 1LPAB 1M34E 3MTBA 2JAHA 5JXIA 2IXBA 4FMBB 2PX2A 1SULA 1RVV1 3ZHYA 4LK2A 3E61A 4ILEA 2NWQA 3IDZA 3R3UA 3MBKA 3MMPA 821PA 4ZI2C 3VTKA 2DKNA 5CLLA 5HG0A 4YI3A 4AF6A 1EEXB 3T0IA 1X6VA 4UTXA 4IV8A 3LK42 3KS9A 4FSHA 3QP9A 1G64A 3LIIA 5C32A 1V6CA 3JX9A 4MVCA 3DEHA 3HCRA 2VAXA 4ESHA 5JLAA 4QEKA 8GPBA 1Y1QA 2C20A 1NW7A 4CV2A 3OZSA 1XAGA 4X7RA 5T4FA 4NMMA 2FPKA 1G60A 3QTTA 4F2WA 5EXDA 3RIHA 4LK3A 4EJ6A 1A9PA 2VJLA 4TV9B 4UVIA 2QUZA 2ASVA 4ERRA 2PL9A 3E4DA 2ZLBA 4WVFA 3F8TA 3AYXB 4GFDA 4MLKA 5LZ8A 2IYXA 3IHLA 2H89A 3UOWA 1M3SA 4WW0A 3Q41A 1Z6XA 4FUQA 2IT1A 1VXRA 1LEHA 3TQRA 3FM9A 2OXCA 2JLRA 3RIUA 2DQ4A 2ZT7A 3G0BA 1JIUA 2DKFA 3ITKA 5KTTA 1QOQB 2ZPUA 4B0PA 1N2XA 1RXSA 2HA0A 2LV8A 3U0VA 5DW0A 5LBUA 4EG7A 1WIWA 1G3IA 2JCGA 3NAMA 4G4JA 2UUPA 4L28A 3WGYA 3DTOA 3TSOA 4PLHA 1ODKA 4CCAA 1NVAA 1MHPA 4IHKA 4RD1A 3WQSB 5JS6A 5BYAA 4F4DA 3SOZA 3QY9A 4DDUA 1YXMA 1C0IA 2Z6AA 3IKVA 4GKJT 1ZVJA 1AS2A 1MC1A 2QL9A 1L4UA 4N7MA 4H35A 2V7EA 3IOYA 2JKZA 3N2KB 4PYLA 3T1NA 3FDIA 3M1LA 3ASUA 3OPQA 2ZAMA 2UXBT 2G9NA 1CR6A 2Y4NA 1QGAA 3A4LA 3G9ZA 3LHSA 1C41A 2E18A 4E3ZA 5DGTA 3KSZO 2HO4A 4QARA 3NASA 4P0PB 4BGDA 3AWIA 4RFSB 2IOHA 3MMZA 1SJ9A 3WGLA 1H5NA 2WI8A 4U7GA 5BN3A 4X6UA 5JQGF 6GPBA 1FU7A 1D3AA 2Q3DA 3EHDA 3EVFA 2BH9A 3QU9A 3CV3A 1K08A 1CQXA 5CLFA 5G1NA 3ZZNA 3S8MA 1B6GA 3TKLA 3E0QA 3MMXA 4WLFA 3KXKA 2CB0A 2VI5A 2E4ZA 4H31A 1M2HA 2X6QA 4Z7NB 4KWCA 1KHTA 2R2AA 2F55A 1FUKA 4NDZA 3PZRA 1DT5A 5ITSA 3ZH2A 4D26A 3CH6A 2VVTA 5JNWA 1FDOA 4LJ7A 2BGMA 2P11A 1O97D 3JZFA 4JLAA 4NDNE 5J4HA 3NIDB 3ZHZA 1VRCA 3L5KA 2NNWB 2JIBA 5H59A 3KTDA 4EZ4A 1VBKA 4QT0A 3EEBA 5DMHA 1VJ0A 2UAGA 3ETHA 5AUNB 3EDOA 3THYB 1DG1G 3GEMA 5AVUA 2AX3A 5JATA 2B9EA 3L8EA 2DULA 2DECA 2ZKLA 3B1KA 4N8DA 4C5AA 2C61A 2CD7A 3JZIA 2E9XA 3CF4A 3RG2A 4KQ2A 1ODIA 1JYFA 3FZKB 5DNEA 1T36A 5HQTA 5HBRA 3ZNPA 1RXVA 3KQQA 2EHJA 4Q1FA 4PZEA 3TK1A 3C1UA 4B2YA 1U3TA 4N5NA 2D2XA 5AQKB 3CQCB 4AF8A 5CITA 1W5AA 2QVGA 4M49A 3DR3A 5TGTA 2CHEA 2QZZA 2NW7A 1XYYA 3OQVA 4HQNA 1RQNA 4HT3B 1NY6A 2FW8A 1ZY2A 3UCEA 1SKUA 2KLHA 1GYPA 3ZLTA 5HRCA 1XWIA 1Z75A 5CEEA 1YXRA 2PUBA 1SQSA 2GF0A 3ZG6A 1YK1A 4JY7A 4HTEA 4P35A 5HOEA 2OAGA 3UWPA 3WWEA 1FNNA 1EEHA 2OCYC 2D06A 3D0KA 4BBJA 1O95A 4JJIA 1WNFA 1Y5RA 3OCUA 1RU3A 5LFAA 1IN6A 3RC8A 1E98A 2Q2QA 3LRTA 4TLMB 2WM8A 2GUGA 3JD3A 2V9ZA 3X1ZA 4KFUA 3V4ZA 1N1MA 3A2NA 2PTGA 3QVWA 1JA9A 4ZQEA 1UDBA 1QTRA 2ZAIA 3U7QB 2JQ9A 2C3OA 4KK3A 3V8RA 4B17A 4MUNA 2GKOA 4N48A 3TJMA 1A98A 4DV6T 3EGXB 1OBHA 3IA7A 1KI8A 4P7BA 1E79A 1WHSB 3STUA 2H4JA 4ZGWA 5EPUA 2E4WA 1QYXA 1U1DA 3E48A 2IXEA 2OB2A 2O2YA 2WU2A 4YT8A 1DAMA 5GONF 2XZTA 2ZRAA 4A23A 4Q34A 4LJSA 4LI3X 3KB8A 4KP3C 3U0BA 4U9IS 2WDRA 3RRXA 3L1HA 3WGHA 3TOCA 1QZTA 4BLVA 2ONKA 1W47A 4HKAA 1E6LA 4LYDA 3CNLA 2QQEA 4B4VA 1YIAA 3IQWA 4NAVA 3TZHA 4Q3DA 3HTXA 2YJ6A 4O4LB 4PO3X 1KP2A 2DBZA 1P5JA 3D54D 1G66A 2GPAA 4YRIA 1UBJS 4S0ZA 4EA9A 3E23A 1YFLA 4TVSA 1WXGA 1SUPA 4IE5A 1PZFA 4P7GA 4EITA 4HLUC 2UZ1B 4WZBE 4UF0A 1GG8A 4QUAA 4XGNA 4TXHA 4P4GA 4Q00A 2Q8NA 1T8WA 3OF5A 2HQBA 1VCSA 4KUMB 4DMCA 4S2EA 1YR1A 1G5HA 2EWMA 2XKAA 1HS7A 3MPOA 1UAGA 3HL4A 2C0CA 2YYYA 3Q0EA 3AFHA 2FP3A 3WSVA 2JJ2A 5FOXA 2GNOA 2V45A 1QZXA 4PZZA 3SSNA 1KQ3A 2G4VA 3LPDA 4JQZA 1ZJZA 2B35A 4FGJA 3DVLA 5LCXA 3WRXC 2GZSA 1EA7A 1YQ3A 2QTLA 2GK4A 2HK9A 4CLXA 4OYKA 4OYRA 4QPNA 4B83A 2E4VA 2GEKA 4CN1A 5TEVA 4QDZA 1JA1A 2GAJA 2X8BA 1KAEA 1X1QA 1F48A 3W5JA 3L4BA 5F5LA 2JFNA 3FNRA 5A4IS 4D56A 4A1OA 1DT3A 5E2BA 3BFPA 4WOPA 1Z4NA 1NUQA 3LCMA 5AFUL 3KHUA 2DWUA 4AKEA 1RKXA 5IBRA 2X14A 1C3EA 1X14A 2CXXA 4IDEA 4YVFA 4LJRA 1JQKA 4RPGA 2IC5A 1I7NA 5HFJA 1BDHA 3SFTA 3QHPA 4TZ0A 1IBSA 4YJHA 2P2ZA 2C4UA 1A7AA 4EKDA 1IIBA 3C5WP 2ZYVX 1CE8B 3EF3A 3AR9A 9ABPA 4EABA 3P4PA 2JFQA 2B99A 2OG1A 2CDCA 3CZ9A 3GQVA 1LPOA 5J4YA 1HMPA 4JU8A 4LSGA 3BE8A 4YMLA 4A6DA 2JLAA 1PNOA 3M1YA 4YV2A 1IATA 3EUFA 2WU3A 1NW9B 1RJWA 3T9DA 1QCYA 2V7QA 1IZYA 4RDHA 4IE0A 4NAUA 4ZVUA 1Q1QA 1JP7A 2CUNA 1OHHA 3NBXX 1G6KA 5AK6A 1W52X 4TUYA 5EIOA 2E6KA 5KU7A 2ZSFA 3SSOA 2Q4RA 4CPDA 4MCAA 1Z12A 3NM4A 3PUWF 3IUMA 2REBA 3GZTB 1R1DA 4CYMA 1A95A 1SVUA 4MHSA 4PX9A 1W0AA 1E6MA 1D1PA 3CX3A 3DOFA 3A1UA 2LD4A 3KCQA 3IHWA 4WX2B 1YZFA 3GNTA 1G1MA 3RJMA 3A6HA 1ADYA 3U37A 4IEFB 4YJ2F 2ID8A 1QFJA 1I3NA 1LNQA 2BMFA 2BUCA 4CNBA 3R9KA 2W22A 5L7TA 2WWFA 5E3HA 1GQ2A 4JVNA 3L84A 1XKQA 5DYTA 1T1SA 5E7QA 2XMSA 4URXR 3KKNA 3OG9A 2YN6A 3PUSA 1RHMA 3RVJA 3T7CA 3A3PA 4H6PA 2GZ3A 5EZYF 5HXHA 3COJA 3K2EA 1SD1A 1A71A 3CRW1 3O8BA 3S81A 5A1LA 1BR1A 1D7OA 1SVOA 5JJ5A 2H3EA 1QU3A 5FF9A 5JAOA 2IITA 1XU4A 4EHAA 5C5IA 5I48A 3TTSA 3ND5A 1QH0A 3PDIB 3FWYA 4YDQA 2YDSA 4KFSA 4FU0A 4FFVA 4EPWA 1H2XA 2ZRDA 3M7IA 1KIFA 4DPKA 2XCSB 3V8EA 1T8PA 2Z43A 2ZEJA 4YXWD 1MC8A 4BNDB 1GL3A 4JBWF 3BS4A 1QPBA 3BWMA 3DMPA 2X41A 1JPJA 4BU0A 4DMKA 1OPXA 2WVAA 4J0HA 5DI9A 4MEJA 1BQ3A 4NIMA 2ZRPA 4U2BA 2UU9B 4Z99A 2ZKIA 2RARA 4DQKA 5IBCA 3P0IA 1TM5E 3X1JA 1UPTA 3GJ4A 3OZTA 1NN0A 5HYAA 1UKAA 3FPSA 2XV1A 1VPEA 3GLHE 1T4CB 4UDNA 4D9NA 3TLBA 1XB2A 2R4UA 1KOFA 1Z0KA 2PMCA 4UOQA 1PNRA 2EX4A 3VR5D 4GZ3A 4Q4DA 5L53A 1BR2A 3PNPA 4MMZB 1CIVA 3NEPX 5BQXA 2IEZA 2QT1A 2E37A 5IKOA 3K0BA 2E8IA 2C29D 3PG5A 3KOXA 6LDHA 4C20A 4KZPA 4WXYB 5JJLA 1D6JA 4JB3A 3FW1A 1NXPA 4P3KA 3EZ7A 4RKWA 5TDHA 4BNGA 2F00A 4ZVRA 5C4GB 1KNXA 1NSFA 2Y92A 4D2IA 4MGKR 3FYTA 1IPEA 3QK6A 3AF1A 3PC2A 4EF6A 1RYZA 5L3BB 1RBMA 2F6RA 5KHLB 5KDDA 4XIIA 3KR1A 4GXNA 2V7IA 3KZCA 5SICE 3C4ZA 1WE2A 2ONYA 4R1PA 3PUGA 4E09A 1VHTA 3IKJA 5D84A 1U0TA 2XTNA 4AS1A 5DWQA 2GRJA 5JCPA 1O3XA 1GPAA 1M6YA 5J63A 4F46A 3LQ4A 1X39A 4HX5A 3RC2A 3DLTA 1RWBA 1DBPA 2GK3A 2AYZA 2I4NA 3RFFA 3T6KA 3IIMA 1G21B 3CO0S 3DEZA 5F9FA 5CVUA 3DPSA 5SZIA 4ERXA 1R9GA 5JAMA 1KNPA 2EKZA 1TMYA 2K5UA 1YO6A 3MGKA 3CIFA 3L8CA 4CMKA 5DULA 4P09A 3P2IA 1HO3A 2YWFA 1R0LA 3RUDA 2PZAA 4IFTA 5KNCH 2VDUE 3EZYA 2ODUA 4IUCS 4MVJA 3K0CC 3ZWXA 3Q0IA 1NMQA 5DPMA 2CBJA 1WLXA 2XGGA 2FJDA 3WC4A 1QYCA 4RQUA 3HK2A 1XK7A 2D2FA 2Y0CA 2WE7A 5A7FA 1GCIA 3A4YA 4QELA 1UWKA 1Q74A 2YBDA 4N6NA 1I7PA 2VXYA 2QRNA 4R84A 2D8AA 3H4MA 3V5SA 4MS1B 4I4TE 2HDHA 2JCYA 1J1ZA 2X4LA 1Y1TA 1AKYA 5FI3A 3NHWA 3BE6A 3VPGA 1JFLA 3QJYA 3KQLA 2FWBA 1IQ0A 1ODLA 2I8LA 2WU5A 3HBMA 1XXHE 3CX8B 3QE4A 4KNVA 4BNWA 4JLKA 4JROA 3EHZA 3K6SB 3I2IA 4LVCA 2Q2OA 5KSOA 2WKQA 3D8HA 3LUDA 1K92A 1KY5A 2JLBA 2VCEA 3AEKB 4I50E 1O7JA 1Y3FE 3PV0F 2IDKA 5AKIA 5K3DA 3KJEA 3JQGB 1DRKA 4HFRA 2ZRIA 3FX2A 5EMKA 3NIBA 3ZC3A 1IM2A 2Z58A 4HDKB 2VKTA 3DEYX 3DBLA 4LDPA 1O58A 4N54A 2X5XA 3DBIA 2K4MA 1VGRA 3F6BX 3JS5A 1KAGA 4BLPA 2IYSA 3G9UA 2IHTA 2ZFUA 3X43A 5ALPA 4R1TA 5BQ5A 3H05A 2O0MA 2BEWB 3EFHA 4F38A 3C5EA 4PTLA 5IMBA 3MT7A 1H5UA 1MENA 4EO9A 1E2FA 3AV0B 1L4KA 2GGSA 1GSAA 3EVGA 1WXDA 4HDRB 2Y77A 1MMNA 3N86A 2C04A 4BV9A 2QRVB 2NU6A 4O2LA 3LUFA 1H1TA 2W11A 1X70A 3LT0A 4JI3T 4YDSA 1WO8A 3L02A 5IN5A 4QGAA 4TLEA 4ED9A 3A3OA 4AK9A 2XYQA 3RVDA 4ASUA 1WG8A 3PJDA 1A2OA 2X9LA 3CEJA 3VR6A 3BRSA 5REQB 5LLTA 5FV7A 1OA1A 1FMJA 4AO8A 4DB4A 4B73A 4YT5A 1OC4A 1XNHA 1U04A 3FHNA 1S9DA 4A16A 1XTVA 5TPWA 1B41A 3T5PA 5ENDA 3CX6A 1T2CA 2GZ1A 5EMMA 1E3LA 1S3SA 5NULA 1E1HB 4G23A 4GP7A 2V4ZA 2PEZA 1MBZA 1QONA 2IHBA 4NP6A 2IW5B 1W96A 3RQIA 1US8A 4NATA 3BEOA 5DOZA 4GMKA 1GQFA 2CMHA 3ZDQA 5JCOA 2OM6A 4AMVA 3TLGB 4PICA 1QTIA 4GG1A 1VKZA 1L4YA 3D7NA 4WNCA 5P8WA 3SR0A 4YWJA 4PRKA 2V6GA 3JYLA 2NP6A 1IM8A 5DBGA 4LFCT 1S2OA 4QODA 2O07A 2FWMX 1XDDA 1QK4A 1QH9A 1QWSA 4EZHA 1W1WA 1A9QA 2WUDA 4FFBB 1U7UA 4CKCA 4P32A 5GONA 4HNTA 2AFIA 4NBTA 4Z54A 4QQ8A 2AJCA 5KVQA 4OBWA 3ZLUA 2Q9QD 5ALTA 3WLLA 5U4XA 4EF4A 2WZBA 4OBXA 5ECYA 1G18A 2BE9A 2IUFA 1YAHA 4CTKA 2WTXA 4F9GA 1S02A 2JGJA 4URUR 3D59A 1J0XO 1ICEA 1KDYA 1KO5A 1X1CA 2H1HA 3FNFA 1N5IA 1N5JA 4GZLA 4CF5A 4D80A 1HWYA 4ZGBA 3QX3A 4GI3A 1TVKB 1DJMA 4CUJA 3JCFA 3EPHA 3K70C 4LSWA 1QAMA 4LHVA 2OL4A 5DP1A 5HMLA 5ICSA 1L4MA 3U3DA 1JJBA 2WB2A 1QIJA 5AVKA 1DCTA 1XZEA 4ALNA 1HURA 1NWHA 1NP6A 5CD9A 3AF5A 4H18A 2CJWA 2X2FA 1DEHA 2B1GA 2G5CA 2HYIC 3F7OA 3CC8A 4IHJA 4Y2SA 3TNFA 3TZCA 4YHBA 2JFXA 4MPDA 1AKTA 3CZ4A 4CG3A 2VATA 1SUDA 4IVQA 4P81A 5B1YA 2W2XA 1IN4A 4DREA 4XASA 1TX4B 5LU9A 2ZBVA 1EQ2A 4AUNA 2IELA 5T67A 3Q7TA 5FOUA 1CY8A 3O9ZA 1JDJA 1Z6TA 3EQ7A 3K5WA 3VQTA 4OL9A 3A1TA 2HF2A 4BXOA 2OB1A 3W5AA 3PQ6A 4E32A 1KOLA 4GP9A 4D3YA 2X2PA 3STYA 3TS1A 4HEAA 3Q98A 3DEAA 2XPCA 5BORA 4OPMA 4HE8A 1TL7C 2QB5A 1GZ4A 2A6PA 3CX4A 3RWBA 5KPDA 1CNFA 1NL3A 2CBZA 2PT9A 2HBRA 4ER5A 5K8JB 2YC4C 2A7XA 3W4JA 4IM7A 1MZPA 4RWEA 1ZI9A 2GJKA 2C5SA 3VXKA 2R66A 2FSUA 3K1JA 1GTMA 3UJ9A 1JJVA 2WAAA 5A9SA 2CCJA 2DKOA 1T9DA 1JG6A 3ZZ1A 2Y4OA 3AG5A 3OEYA 5DYGA 2XM2A 2O7RA 1MO6A 3T54A 1F4VA 5AM0A 4AKTA 1LTQA 3VKFA 1YSCA 3B1WA 3SWHA 1GUFA 4R1QA 3NOQA 3KE8A 3GLVA 7GPBA 3UWKA 3OFVA 4NEQA 3ANMA 2WDVA 3KBBA 5EQTA 1A2BA 2X9YA 5ARCA 4MUKA 4D4MA 1C1XB 3HXOA 2L9QA 1J7JA 3V8NA 3WOVA 1R6DA 2O0KA 5E38A 3CKYA 3QKWA 3PGMA 4UMVA 2A8YA 4CLOB 1KVTA 1N5MA 4OUDA 4CI9A 1CC1S 4YP7A 3L92A 2AQIA 3HO6A 3PUIA 4YLHA 1KEEB 1T1EA 2D5UA 3HXTA 2CHNA 1JR3A 5CXQA 4UXIA 1V6AA 3HBAA 1X15A 4DBQA 2HBQA 5FO0A 3PPWA 2QPAA 4HCJA 4U6QA 1Y4AE 3UCXA 1HKUA 4LW8A 4X63A 4FHZA 1I7SB 2PS1A 3QBEA 5JSZA 4ZK2A 3W6PA 1X1AA 4X00A 3PUWA 1H2YA 4R31A 1D4OA 4HH0A 2Q1XA 3OU2A 2Z3WA 2J59A 3BK9A 4DBLE 4XWOA 3ANYB 3A6PC 3ZYCA 3PUKA 4OAQA 1P5ZB 4JLUA 4K9QA 3AVXA 3VZBA 4F3KA 4CIBA 2VXOA 1P1FA 4UW9A 3PLNA 4RMGA 4GBGA 4YJ2A 5CFZA 1N36B 2FP4B 4LYFA 2AN5A 1IY2A 2JNWA 1NP7A 3EG5A 3RUFA 3QVSA 2LSYA 1XA4A 4GZMA 4ENWA 3DFKA 5F1OA 4CN6A 3B85A 5IABA 3GA0A 3OKFA 1QAQA 3JZAA 4ZAZA 3AVPA 5IK2A 2IE0A 4WHMA 5FUWA 5L7WA 2QRMA 5ICCA 1VHJA 2LGJA 4YMHA 5EIBC 4LZOA 2BR3A 1CQPA 4CIDA 1Q14A 1XO1A 2C7QA 4DV2B 5C7YA 3TH5A 3IAS6 2V03A 3IBTA 3C97A 1XE3A 1JWAB 4TN7B 4QHTA 4F4JA 5HQ3B 2FOLA 1R8JA 4M60A 3R74A 4J4TA 1DFGA 4NBWA 4JI2B 1GZSA 2RGBA 3IT0A 4LXYA 4XRGA 1UXKA 5DO9A 2DBRA 4JBWA 1RPAA 1XA3A 3FHJA 2RHBA 5AW1A 5LNKA 4IICA 4XM2A 1I0IA 1FMVA 5KQSA 4R7TA 1FP7A 3Q1LA 4UPDA 4ACBA 1QHGA 1K3TA 1Z63A 4KPUB 1E3QA 2Z2JA 5H9VA 3OCCA 1CS4C 1NUUA 4ZT6A 3HJGA 2VK2A 5LQDA 1ZIOA 4W4TA 5HUJA 1OH7A 4JYBA 1WHTA 2OV1A 5LQCA 4KW7A 1NBIA 2IWHA 5EE5B 3ZK7A 1T1RA 4CKEA 2XZLA 2GBCA 1NVTA 1V71A 1KY4A 4C6HA 3VHQA 2XWPA 4HAUA 2OOSA 3T7IA 2O2IA 3LRXA 2Q4OA 4V0RA 3KG2A 3GAAA 3EHEA 4HQOA 4XD2A 3KKOA 4OATA 1XTTA 5FY7A 3ZOKA 3TQFA 4RQBA 4QG7A 1KJYA 3B89A 4DNDA 3VZPA 3FZQA 3TTVA 4C7JA 4PLWA 1P1IA 3VNRA 1X1BA 4M8SA 3H3XA 2BFAA 1Z7EA 1UJ6A 2XMCA 3F96A 3J7Yq 1GP2A 3QXSA 2PVPA 4MQUA 5AD1A 5LHHB 1NBMA 1VBNA 1KMIY 4ISTA 4UZFA 2M6RA 1NTRA 2EEPA 2ZREA 3IDSA 2QZSA 3VKUA 3WK8A 1MMFB 4LXGA 3RFVA 5F98A 1HG2A 4AJ1A 4R83A 1SVLA 4XSGA 5FD8A 3GL9A 4RDIA 1ZXBA 5IAOA 3WKEA 4EECA 4CMJA 3FOBA 2QZPA 4W8GA 4E21A 3W5UA 1HQKA 2Q8PA 2Q6VA 1EPUA 5IUXA 4CXYA 4EUKA 2EQBA 5FLYA 1U8AA 2XUKA 3NBFA 2SKEA 4ME6A 3UKJA 4ZYWA 3LP8A 3I0NA 1W4BA 2HCRA 2FEPA 3AR6A 2LKCA 1K98A 1TEHA 3VKVA 3P27A 4KI0F 2P6OA 3ZIAA 1W36B 1WVGA 3BSFA 1J9EA 5H3CA 1QKKA 3C8HA 4V0KA 5EHIA 3VU9B 3IVGA 2J9FA 2XPKA 4AJNA 3HU2A 2D5IA 2P0EA 2I3BA 4PJLA 3O9VA 1YJQA 5AI0A 5CVDA 2HA2A 1N33T 4CRWB 1VL5A 3OCJA 4LHSA 4CFZA 3WSWA 2A59A 1R8XA 4WXEA 3QFSA 4MS3A 3D1LA 3I0QA 4M9QA 5T7BA 2Y1XA 4EFNA 4CG2A 3OJ0A 3PJAJ 4BPBA 2I1LA 1O9GA 2JEZA 2J47A 4EZEA 3I04M 1SU7A 4FQ7A 4N18A 4Z2YA 4TTQA 1OWPA 1W5TA 4CQLB 5IXYA 3PWSA 4JT8A 5K8CA 3KKEA 1DUSA 4WN9B 2CLFB 1O8CA 3ABQB 1BCSA 5EESA 1DVRA 5KNCD 1TEVA 4OI2A 4BZXA 3W3ZB 4RSGA 5CPFA 2XQAA 1OWNA 4JVMA 4OOFA 4RK0A 1PI3A 1QUUA 3RFXA 2I7VA 3ZYKA 5TE9A 2Y8DA 4B4WA 2BJVA 4D9HA 4DV0B 5AJHA 4KVGA 3RU2A 1WA5A 3SYTA 2V5DA 5FL7D 2WWRA 3JCZA 3P0EA 1JPNA 2UZIR 1WUKS 1WCRA 4KAFA 4X5TA 5DJQC 5BV1A 5FR1A 1PAUA 5LXTA 2YV3A 2D1SA 1SIOA 4L3OA 5AUPB 2LSJA 3I5AA 3I5YA 2AOUA 2PL1A 1DXQA 5FPYA 3ICCA 3N6RA 1Z2NX 2H0QA 1E0JA 4TKLA 4HH3C 3B12A 3CUVA 3MYYA 1PR3A 4Y6OA 5CBPA 4H1HA 4U9UA 4GOXA 1XOIA 3FNHA 3AIIA 4MYSA 4TZ6A 1AGPA 3PWTA 3DE2X 3SJUA 5ABFA 2DHDA 5IDYA 5TQJA 1ZESA 1Q1AA 4DWWA 2OV4A 3GMDA 1GQOA 2D54A 4TWJA 1MVOA 3ZS8A 1A8SA 2Q9AA 2XCTB 2MINB 4EPVA 5DMXA 1U5BB 1J07A 3OQMA 4I5IA 3O3NB 3BB1A 3NVDA 1JG7A 2VK9A 3RRWA 1FCJA 3B9QA 3E5MA 5JFTA 3IGFA 3C48A 1JIKA 3S70A 3K70B 3IX7A 4XJVA 3MHTA 2A14A 5IEBA 3LMKA 3ELBA 3BKXA 2XT9A 1PJ8A 1DIGA 1AKQA 1QOZA 5KX5E 3NUQA 3M70A 3GUHA 4NZYA 3CUWA 1ONNA 3AQIA 3BQ9A 1UQTA 5BR7A 3OSUA 1SC9A 2ZTHA 3BD9A 1N57A 3U16A 1E8NA 2OCAA 4LYYA 1PDVA 4G56A 2XMRA 4MUJA 1RMTA 1VB3A 4TZKA 1HZJA 4NJEB 4A8JA 1ZMXA 4FKZA 2ZIVB 4HUJA 3EDQA 2VUSA 3NTLA 5HYVA 1ZHFA 3T7TA 5DJ5A 3H9BA 2I7CA 2HHHB 4V1CI 3IQDB 4MJLA 2UYGA 3HUDA 2WILA 1T9HA 2WSSA 4DMUB 3TGWA 3UWOA 3ZUGA 1CQJA 4KQ6A 3LX6A 3F4BA 4RH1A 1KYWA 1QU2A 2G9UA 5G0VA 5EHXA 4QO7A 1XEWY 1K5HA 5T4HA 4D82A 1CETA 1RHQA 2IYYA 3LPAA 2X0FA 2AVNA 3HM9A 2R8RA 5AKXA 3V8PA 1BEZA 4OH1A 2WD9A 2HFKA 2ZJ3A 2B0CA 4EY7A 4OJYA 1DX6A 2C1XA 2PX4A 1EM6A 3PHLA 5AI9A 1SRRA 4IS3A 2NZVG 4TUYF 2AXNA 5JPDA 1TJPB 4CLEA 5F52A 1QS0B 2HWWA 1ZUNA 2AMFA 4RFLA 4IG9A 2VZ9A 1BE0A 3S2SA 1B16A 1WUIS 1EJ6A 2HTEA 3DE7X 3BMXA 1GPBA 5J4VA 2X4IA 2XGJA 5DM70 2FPIA 2QLFA 2FZWA 3CPEA 2A2ZA 2ZJBA 5CT4A 2R97A 1VMKA 1QV6A 4A8TA 5K20A 5IKEA 2F9FA 4N8SA 4M4SA 1JG3A 2PTFA 1NE7A 3AIKA 4LFBT 2PBRA 5HP4A 1A5ZA 1P9NA 4Q19A 3KYJB 3D3EA 1M6HA 3GN5A 4ARSA 3AU9A 5L3SA 4A3SA 1B1CA 2ECKA 4P2BA 5FUVA 2FQYA 3LCJA 5DH9A 1JHXA 3GJYA 2XQYA 3T1TA 1T5DX 3AHHA 3I53A 5CFMA 2B2NA 1CIJA 5C8VA 1HYGA 2XUIA 2V0GA 2GEFA 4JXZA 2NGRA 2ZRMA 2IOFA 2I1VB 3ZHTA 3FTDA 3NTVA 3TLXA 4KO1S 4DCNA 3QK7A 4R5MA 4IDPA 4E2XA 2TECE 1K7XB 2O2EA 1DDGA 4DR5T 4Z4GA 2BGWA 4TLLB 1U6KA 2XQJA 3R6GA 3P71T 1KR2A 1CEQA 5KMGB 3D6VA 4GRAA 1H69A 1H2WA 2X40A 3BMCB 4F6LA 1FTWA 1GD1O 3P96A 2C0PA 4G89A 1FBTA 4BEVA 1LK7A 3M9WA 3GEDA 1CFZA 4J91A 1IULA 2YINA 1KS2A 2X7JA 1AA9A 2HA7A 4C0SA 3CUTA 1Q7TA 4QUKA 2XT6A 4HQFA 3S4YA 1I0LA 2KXPB 2Q6IA 3CRVA 3UB4A 1OR8A 1SQ6A 4QHYA 1T9GS 2BFWA 2HV8A 4CG0A 1WOYA 4UXHA 4L5AA 4IHAA 4PXYA 3F4KA 4CTMA 4PLVA 1TW3A 4W7IA 1IQUA 3JR7A 1WQ1R 3CZCA 3GNQA 4GLLA 1PT5A 4LOIA 5J9FA 5FVLA 4WEOA 4C0QC 3B7GA 2QTFA 2BCGY 3CE6A 5FV4A 1L1RA 3ET4A 2B4KA 5BUQA 1K8ZB 2KWIB 2IZ0A 2JLCA 1EZ1A 4O2AB 3GG9A 1SU6A 2NZJA 4AKIA 2PPLA 2X8AA 3T3OA 1LPSA 2PIDA 4PSVA 5ETWA 5TEWA 3BYZA 1V25A 3KYDA 4OD0A 4BDTA 1PW7A 3RIMA 2ATIA 2H1SA 3GVCA 1L0BA 3HB5X 3ZWDA 2ZJAA 2FN7A 3I6ZA 3LSVA 1P2UA 1Q19A 3TQQA 3RYFA 4Q03A 1XRNA 5IJAA 4B7UA 1V5GA 4U7HA 2V3WA 4QU0A 1G5PA 3G79A 3CVJA 3KB2A 5FEMA 3SKXA 1SUSA 1U7WA 4FGLA 4RCYA 2N47A 2LIPA 2MAWA 1PSDA 3RVKA 4Q12A 3NYWA 3KQTA 3DF7A 3ZU3A 4TTAA 5LQSA 3WXMA 5MGBA 4DG8A 2G1JA 4ACAA 5C0OE 2GZMA 3IMEA 2P2LA 4JWTA 2YYAA 3WFJA 1M1ZA 3E9YA 3PFIA 2WWGA 1XC7A 4HNRA 4Y1RA 4TMTA 4EGJA 5CA0B 5BYKA 3M1AA 5FTNA 2XXAA 3ZCTA 3VR6H 3VZDA 2DUWA 5DHSA 1TAGA 1RJFA 1UKCA 2VPYA 3ENNA 3VYVA 3GP8A 1VI2A 1IOLA 1DV1A 1UP4A 2DCMA 2NW9A 3ILSA 2VYVA 4BX3A 1UBLS 2IY8A 1PT9A 5BT8A 3IMGA 4OOEA 2WEKA 4ZYLA 3GJ0A 2R2GA 4GI7A 2OORC 3CVRA 3EC1A 1Z33A 4IV5A 4J43A 4MVJF 3CLSC 1Q1BA 1WZIA 5DYWA 1XL1A 4OEHA 1C0EA 4J7UA 5F76A 4ZCQA 5FADA 4GWKA 3HDQA 4AJ9A 1PRYA 4IH1A 1USGA 4OLJA 2PN1A 3SYMA 3KUKA 1XR3A 3TW8A 5LJNA 3LHFA 4CL0A 3ZXSA 3ZNOA 4LF5T 3B5JA 1E89A 5EL0A 2JFOA 3BRWD 4FYWA 4HJXA 4TKVB 1BSVA 3U4GA 4BIIA 5GJBA 4JLNA 4EB6B 3S8EA 4MW1A 1Z7YA 2AJBA 1W46A 4K0KT 3WMRA 1ZHCA 5E95A 1JQEA 3VU0A 3KELA 3RUIA 4Z9AA 2EU8A 2XB6A 5LP6E 3GWGA 3B1JA 4ZT7A 3B1YA 1KK7A 2OMKA 4IDCA 5KKNB 4EY4A 2AG5A 2G8LA 1YV9A 3LFMA 4NZZA 2G9RA 3FYCA 3LVBA 4B40A 3HJHA 4Y9RA 4AS3A 2Z0MA 1T3ZA 2VAMA 3L4JA 2LJLA 4DLXA 2NW8A 3FDZA 1E5QA 3MAAC 1Q91A 1ZSYA 1A77A 4WFIA 3AKZA 2QL7A 5C81A 1QCDA 3LGAA 3A5XA 5L4SA 2JIDA 2YWGA 3TSWA 1EFPB 2WJJA 4DQVA 1NLMA 2HRZA 1BOFA 7MHTA 1DKMA 1JT9A 5AQUB 2G82A 4NABA 3W15B 5C8YE 2ON6A 1OX6A 2R85A 5C5CA 4IREA 5ALIA 1SXJA 4WNKA 3KPWA 5DGXA 1KZGB 3E3MA 3I5UA 4RK1A 2O4CA 4MCHA 3H9JA 1JLLB 3REQA 3G13A 3PU8A 1SZDA 1Z0FA 2ZTMA 1P6XA 4K1XA 3KL4A 1V1RA 1BS9A 2C2KA 2H85A 1C7JA 1U98A 3CB2A 3WMEA 1U6JA 1RKVA 3GD5A 4CEHA 4KJZA 4POAA 1WMFA 1C4KA 1NOJA 3THYA 1KJZA 2PBZA 1P61B 4AQFC 3A9VA 4K6CA 4D9GA 3NHAA 4IUDS 4UKDA 1VLHA 2H88A 1AO3A 4HWGA 2DERA 4UM9B 3W04A 1TC2A 1VG0B 5ALVA 4FZ5A 3FSEA 5H1YA 1RP7A 2VL7A 5L3GB 3D0TA 4X1IE 1EWTA 1SELA 2I6XA 3HWWA 4O6VA 5D3MA 3NEYA 2BEJA 3WOHA 1TZBA 2EDCA 221PA 3ELDA 2C5JA 4RD0A 1WWKA 1W0JA 4KI0A 2H7VA 1OJ7A 1TGVA 5IJ9B 3MJCA 4FCCA 1B4DA 3E5HA 4JENA 1B3BA 4HMQA 4O29A 2JJ2D 3JD1A 4C14A 3KQPA 5KOIA 2YBEA 2OBFA 3E82A 2QRZA 1R6AA 1DJQA 3QLTA 5BOSB 2X0NA 1PZEA 1RIIA 5CD1A 1WXEA 1VHQA 2Q9UA 4YYEA 4R7GA 1ZVVA 4JEHA 3UA3A 3D2AA 2P2YA 1MX5A 1KOJA 3ZPXA 3VTAA 1LLCA 3WNVA 2OXFA 1YFKA 1GA1A 5HQJA 3DYBA 5IMSA 2QTWB 1FP2A 4M8IA 4ZWNA 2NZXA 2NU8B 2WS3A 5CB8A 4DV4T 5EE3A 3A1FA 3NC4A 3CN9A 2GPYA 2BR4A 5GQSA 4P5PA 4URFA 2P4SA 2B30A 3ZVMA 2O0LA 1HNWB 2IPOA 1T0HB 4IKOA 3PU6A 1QFSA 3HI6A 4EJSA 2DETA 3MLBA 1GYRA 1U8CB 4QJIA 4K03A 4L6CA 4IV0A 4PANA 1A1SA 4QOFA 3QXHA 5CW1A 4MLZA 4Z2AA 1T3HA 4LDQA 5JWOA 3USCS 1C3OB 1JFTA 1JLSA 3LNCA 5FNZA 4FFPA 4TQAA 1R16A 2HSEA 3ITDA 2YU2A 5GP1A 2XUPA 3ZW9A 4FW8A 5F12A 2AEMA 2LPMA 5F3WB 5I4CA 4FS3A 4PAGA 4UNIA 4IY1A 4NYIQ 2R87A 2J62A 3L9WA 3JPYA 1XJWA 2BCJQ 4QPZA 3GXBA 1PT6A 3NQ41 2ZJ1A 1V2GA 3K3NA 3GFQA 5KVVA 3FCOA 3R3HA 4IHJF 4W5WA 4DFDA 2PE5A 1Z22A 1D6SA 3NBUA 5KU1A 4GE3A 2O0HA 2OILA 2XE4A 1ZXXA 3WMFA 5LMNT 1JTFA 1V8PA 8ADHA 2Q6KA 4HWDA 3DBRA 2PCLA 4RLQA 5CTAA 1RM0A 1OHHD 4HAOA 1JT2A 1FMTA 3E9CA 5MHTA 3ZMTB 3IV7A 4KJXA 1T9GR 3IURA 3JSAA 3BWBA 4A6XA 1DJNA 4D81A 4IIJE 4XGIA 4E6EA 3UJAA 2L69A 5K5EA 5KC9A 1Q7RA 1FRNA 3LNTA 2E4UA 4EYYR 3AERB 4MV1A 1QG2A 5TVKA 5FOSA 4IOMA 4CKYA 1Z6PA 2Q41A 3KFWX 3A1EA 4HWRA 3UANA 4U00A 2GUWA 2DVMA 3R0XA 1U2RA 1XV5A 4BKRA 3OCZA 3V4FA 1WCWA 3GVIA 2EV9A 3N2GE 2LRHA 1IQRA 3KLBA 4LJ9A 3NIFB 2EF1A 4IRMA 4AZ3B 5IDWA 1K5DA 3EULA 3RJ9A 2C5KT 4IVNA 4L5IA 2QRUA 4Q9LA 1VL1A 2F48A 3FTPA 1OT5A 3ZJ1A 4RPJA 2BMDA 1ZIYA 1JI3A 4EFLA 2XB8A 4OJNA 5C3JA 1XDZA 1H0KA 2JA1A 4BMPB 3ABIA 1ENOA 2WAOA 1KI4A 1OFIA 3JPWA 4IF4A 3TG8A 1KVUA 4EELA 4O4IB 3CF6R 1GVHA 2Z4SA 4PZUA 3GDGA 3PFKA 2F2TA 1BC5A 1V7CA 3GUZA 3I9WA 4XQGA 4DCVA 1S01A 4BN4A 3I1FA 2IEYA 1KYQA 1FS5A 3K9FC 5B57C 1E3JA 1C29B 4NICA 3PHCA 4QUBA 4Y9UA 1BXGB 3BXFA 3U7GA 5B55A 4F2HA 3WGQA 4EG0A 3EJWA 4DSZA 3KZKA 4HDCA 3IPCA 3LY8A 2XB2A 1DXOA 1PYGA 3ZSSA 1ZJ6A 3E0ZA 4N82A 4QGBA 1A2QA 1DLJA 1XCLA 2P69A 3HGQA 3IQZA 3BULA 3KC2A 3QJ5A 4Q16A 3WMXA 5HIIA 4HVCA 3D7RA 2F3PA 4WLVA 2HRDA 3UKDA 3SXPA 4Q66C 4MI1A 2O8BB 4J0FA 3ZGLA 5CG1A 2JRLA 3IIKA 5DCUA 5DT9A 5B4UA 4MPTA 2PUTA 4UHDA 3WS7A 3HS3A 4ZU3A 5BRNA 5K8IA 1K6IA 1FZQA 2ZUSA 2NVWA 3TLVA 2H5EA 1LW7A 4GOKA 2FRXA 1YHNA 1RJ9A 3BH0A 1V26A 1CFJA 3FPHA 2JGMA 4OGFA 1NSYA 3PTRB 4ZI2A 4MDHA 1YHZA 5JWHA 5ICGA 4LVOA 5DASA 1RI3A 3RAPR 2A4KA 5L7YA 3N8KA 4M0KA 4FCVA 2WVGA 5K0NA 1E3WB 5J58A 2F1RA 4QU9A 2AB0A 3CLVA 3CISA 4DSOA 4ZEVA 4FDLA 3QKUA 1V5WA 5TRTA 3QVVA 4UQPA 2LW7A 3BBPA 4X0EA 3GJ8A 2WTEA 4DPLA 3I6MA 4S3MA 1SMKA 1IUKA 3VNSA 3I42A 4E1BA 4WKBA 1D0YA 3H75A 3NYQA 1TQDA 2IK8A 2QA7A 5FJIA 4GECA 2VTEA 4KXVA 3FMPB 1GCOA 5BW8A 5TPZA 2XHEB 2V6IA 5L45A 2P5SA 2JLZA 1KI1A 4JOQA 4A0GA 3IRUA 4AU1A 1L1EA 2XMQA 4UJ5A 3V2IA 1GTG1 4ZEYA 4L8YA 4BVKA 4TMKA 5IVHA 3MELA 3FTCA 4XIGS 1Q11A 3L6DA 4U2EA 2PZMA 1X2EA 1YE8A 5CX4A 4KGDA 4RORA 3BXOA 3G2KA 3X1KA 5CX1B 2N0SA 1HEUA 2FJUA 2B61A 3JTEA 2HF9A 4NE2A 3WISA 3GX1A 2HLDD 4GMXA 2OK7A 2XAGB 2QYHA 3AL0C 1JZTA 3SEQA 1AJEA 1M1NA 2PZKA 1ULAA 1Z37A 4Q48A 3KAPA 3G2PA 4Q02A 3P26A 3WGOA 4I1VA 2PX0A 2QX9A 2H7YA 2FNAA 4DBZA 4G0XA 4HV4A 3H5RA 1VCHA 3K0FA 4M88A 3GG2A 3PTZA 2IWRA 1AO0A 4D74A 3EYWA 3ONDA 4CI2B 1HE1C 2A33A 1EBUA 3TXYA 4KRFA 2JFGA 2XZOA 5JBIA 2WV9A 3LQYA 2AR9A 5JTTA 3T94A 2XECA 4Q3LA 1NVDA 1M7KA 5FKYA 4LF9T 4J03A 5FP0A 3MLEA 3ND8A 4X6YA 1KFYA 3QENA 3CRMA 4O3FA 4N3AA 3Q3CA 2A67A 5EZSA 4LRWA 4ER7A 3DBHA 4TVBA 4O25A 1XD2B 5HPYB 5KJCA 3GIDA 3U3ZA 1WDKA 1HNXT 2RG1A 5JDIC 5H3HA 3R0QA 2NADA 3KKMA 2ZB2A 1QRUA 3C1OA 4HFNA 3R3WA 1UZLA 3ME5A 3KOUA 4WNAB 3PC3A 1TTHA 3WO1A 2FZCA 4ZOEA 3GT0A 1Q3KA 1QV7A 4PWZA 1HDZA 1OLXA 3W7BA 4NPHA 1SHZA 3HYLA 2X8JA 4NECA 2QUIA 3OJAA 3BSYA 3IAM6 2HU5A 4JBHA 2ZI5A 4AKGA 2MTBA 1DBSA 2FPPA 4PAOA 3QLEA 5EVJA 5DHFA 4PC2A 2BZ0A 3QWHA 1G21A 5FOWA 2CNNA 4GQBA 1WB6A 4YR7A 4BJ6A 4I4CA 2WVHA 2W83A 1AKNA 4G5SA 2PJUA 3LUKA 3THRA 3CKLA 4BV2A 3R09A 4ZU6X 4RL6A 2LOPA 1N7IA 4BBPA 1JFRA 3FBGA 1AXGA 3B70A 3DOJA 4D5EA 4A03A 2BF7A 1OKKA 3CLRD 5FMNA 1R2QA 3FR8A 1CZLA 2YYSA 2HLHA 4ESOA 1E7QA 3ICQB 1IOWA 4WY5A 1EVYA 4NZMA 1DC6A 3OE1A 4G6ZA 4MWDA 4O08A 4FI5A 4DRZA 2W4QA 1SIBE 2LR0A 3EGWA 4GUAA 3CKKA 2GO1A 1NYTA 3UGKA 1U0LA 4KXUA 2Y6VA 4JSYA 3ZVNA 3FBLA 4OXRA 2P41A 4UXNB 1RCFA 3EMKA 2Z98A 3MEQA 4C0HA 1JDBB 4Q6BA 2TMKA 1EXNA 4G1CA 2Q28A 1UDCA 3L1VA 2RGEA 1ODJA 4XVRA 4UC0A 2NTXA 8ABPA 1XYVA 3GWZA 3GLSA 2WJ6A 5D86A 4FLEA 1MB3A 3GJ6A 2W58A 1UK8A 3KQKA 2AJTA 2J7KA 4D92A 3H0KA 4CXWA 3N0XA 4MS1A 1HE3A 3CEHA 5ALOA 1BHQ1 1GZUA 3UH1A 3RHWA 2OHFA 1YK0A 1IB6A 5TT1A 1NRWA 1KU6A 5LXTF 4LF8B 4WBOA 4AZ0A 5IVKA 3PICA 4KWTA 2XXBA 1W36C 1CUVA 1FQOA 5CVEA 2HGZA 4ZTBA 2MSWA 2Z83A 3HDTA 1JMKC 1F6BA 3TSYA 1R37A 3EXIA 1L4HA 5EJ4A 4HDMB 3IP9A 4DBRA 1XQYA 3RDPA 4PSDA 5AW3A 1VSVA 3GA8A 3K05A 3Q2MA 2CBIA 4QUJA 2LCQA 4FYYA 5G2OA 1VLLA 2H4WA 3RKUA 1TUBB 2Q29A 2VA8A 3KQMA 1EE9A 4KBGA 5AW5A 1AGXA 4WN3A 2OTCA 3VSBA 3CX7B 3FMOB 5LMUB 2IXDA 4DIBA 2A9QA 4MB2A 4LYAA 3W0LB 1FA9A 4U0KA 3V3KA 2PUWA 4DB2A 1XPRA 4LN1A 4AQ7A 4AVYA 1UBRS 3ZVLA 1WYBA 2IW3A 2AOWA 1KBOA 4UHEA 2BEWA 1SHJA 5AXBA 4FFLA 3I6QA 2NUAB 4KSYA 1W4RA 3B6MA 5J2TF 3E03A 1Y1RA 5KSPA 2A7QA 4QDTA 4FE4A 1VKRA 1O1YA 3ER9A 1T5LA 1GDDA 2A1IA 2XCLA 3RHZA 3VR2D 2IZZA 3TLEA 4DMFA 1JR4A 3H9EO 4R2IA 2QTZA 5LBQB 2DT8A 2ZYDA 3RI5A 3LOPA 5HEKA 4DUYB 2VP9A 1F60A 1QJ4A 2WIDA 1JJFA 3KD2A 1ACMA 5JCJA 3DZHA 1CERA 3DDWA 4A0QA 2DHCA 3CE9A 1U7ZA 1V3VA 2DP4E 3N70A 4M9CA 1K2WA 3MN1A 3P0RA 3PURA 2C2YA 4TWIA 2RH9B 5JC8A 4HC4A 1TCUA 3A8TA 3PUXA 1F8FA 1YDHA 3WB0A 2GHRA 1MU0A 4EY5A 2NZ8A 3I9LA 2E89A 1O08A 1H8ED 3SLRA 1Z7BA 4CIAA 5ALEA 3AP1A 1N9GB 1U1EA 3IP3A 1P1RA 2HA5A 3D9QX 3U3KA 1PUXA 5IP5A 1X92A 3VMMA 3QUCA 5B36A 1F2UB 5JBNA 4C5BA 4DV7T 1ZI6A 3IUYA 4EEDA 1AS3A 3PL1A 4B4KA 1XN1A 4B6OA 3ESAA 1T72A 4FFSA 4FFBA 4PLTA 3WRXA 4DV1B 1ZS9A 1ORDA 2QZ9A 5C5EA 1UFVA 3KQOA 3GLFE 2HQOA 3DL2A 3F57A 2WZCA 1EUYA 4QL3A 2WF5A 4ZJZA 4X97A 1ULSA 3FOWA 1V8FA 2ZWIA 4OI1A 3QE3A 1Z34A 2VC2B 2D5LA 3N59A 4MGIR 1VLZA 3T9AA 1UX5A 3ND6A 1HMYA 1MAUA 1W48A 3PX2A 2WFLA 3R7NA 4WYVA 2ZRGA 1LA2A 1EFKA 5JMWA 1UOPA 5E2IA 1GTZA 3HB9A 1UANA 1FOEB 2FCRA 3HMKA 1V8DA 3TAXA 2CXNA 1SCUB 2H00A 1JR3D 4X1KA 2A3DA 2B78A 1TD1A 3IMFA 3GUVA 5DNVA 1KHHA 2ZJ2A 5EIHA 1NVVQ 4UVAB 2FWAA 4U02A 4QOGA 4M0PA 3KEMA 5HF6A 2WF9A 2G6BA 4FHEA 3V4PB 2POQX 3FSJX 3WFIA 3AE8A 3H9UA 4YONB 5AQQB 1EJBA 1TZKA 1B73A 5LUBA 5JSUA 5EJIA 5JZBA 2CK3A 5JXWA 1YJ5A 3NEJA 1W35A 2QXYA 3JWHA 3EWIA 5IAKA 1W85A 3DC7A 5K45A 1QQ5A