4PAGA

Abc transporter solute binding protein from sulfurospirillum deleyianum dsm 6946
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
323
Chain Sequence
ESRTFLDVSNKPIVLPEHITRIYGSAPPISFMIYVIDDTPLIGVNSPQTNKDNNNGEKFLSKHFMELPILGGWHGNNIPNLEAILAAKPDVIITWDTPLLNEKTAKDLARISIPALKVNIDDSQNYPEVFRYLGRVMQKEERANALANMAQTYLDELKTFVASIPEKERTKVYYAEGDFGLQTECDRSFHSEPLALAGGNLVHKCVQNSVVGLQEVSFEQIILYDPEVIIVQNPTFYKTVFREKKWAVLKAVQNKKVYLVPKSPFNWTDRPPSFMRILGAHWIASKLYPTRYPYKIEDKVKAFYQLFFGVELSNEDLKTYFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein
publication title Crystal structure of ABC transporter solute binding protein from Sulfurospirillum deleyianum DSM 6946
rcsb
source organism Sulfurospirillum deleyianum
molecule tags Transport protein
total genus 105
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4pagA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA03
3MFQA 3K1AA 3HH8A 4UTPA 1G20A 2YNMC 1H1LA 1N2CA 4IRMA 2XDQB 3AERA 3AEKB 5CX1A 4WZBB 1M34B 5JJ5A 5JOQA 1M1NB 2XUZA 3CX3A 2XDQA 4DBLE 1QH8B 3MWFA 3EIXA 5I4KA 3AEKA 1KARA 4WZBA 5BVHB 1M34A 2AFIB 2O1EA 3TNYA 1M1NA 1PQ4A 3LI2A 1QH8A 3PSHA 4MX8A 1G20B 2PS0A 5BVHA 3UJPA 4INOA 2AFIA 1KAEA 2PS3A 3HJTA 4WZAB 4G07A 1M1YB 5CX1B 4NNPA 3MD9A 2XV1A 5B58T 4WN9B 4UTOA 1FP4A 2OGWA 3LHSA 4N01A 5AFSA 4HMOA 4UDNA 4WZAA 3TEFA 4LS3A 1M1YA 3ZK9A 1TOAA 5CR9A 3HXPA 5BVGB 4WN9A 1MIOA 1G21B 2RG7A 3GI1A 4M7OA 4ND8B 1KAHA 5JPDA 5BVGA 2PRSA 3AETB 3G9QA 1G21A 4INPA 5M3BA 2XH8A 1L5HB 3AESB 3NU1A 5HDQA 3BE6A 3TLKA 1QH1B 3ZK7A 1N2ZA 3EIWA 4ND8A 4OXRA 5GGYA 4G09A 2M6LA 3ZK8A 4WNAB 4FILA 2YNMD 2R79A 1FP4B 2MINB 3AETA 2OSVA 4MLZA 4XPIA 3BE5A 3AESA 1K75A 4FI3F 1K2VN 4HMQA 1L5HA 1QH1A 3ZKAA 3R5TA 3AEQB 3PDIB 2Q8QA 4UDOA 5KOJB 1MIOB 4WNAA 2XY4A 2MINA 4B8YA 4MO9A 5KHLB 3U7QB 2QI9F 4PM4A 3AEQA 3PDIA 3R5SA 5JG7A 2ETVA 5KOJA 5M29A 3PSAA 1PSZA 4FKMA 2X4LA 5HX7A 3U7QA 4LJSA 4XPIB 5KOHB 1XVLA 4CL2A 4K3VA 1ESZA 1K7SN 4TKVA 1N4DA 2AFHB 4NNOA 5KOHA 2Q8PA 3MINB 4H0FA 4H59A 1N4AA 2PS9A 1QGUB 2OV1A 1K0FA 4GICA 4FNAA 2R7AA 4WESB 4TKUB 2AFHA 3ZTTA 5M2QA 2OV3A 3MINA 5FLYA 1EFDN 1QGUA 2XQVA 4OVKA 4HN9A 3AEUB 2WI8A 4WESA 4PAGA 4TKUA 2PHZA 2WHYA 4OXQA 3MWGA 3K1AB 4MDYA 5M34A 1H1LB 1N2CB 4TKVB 3AEUA 3AERB 4HMPA 4BBPA 5GGXA 2M6KA
chains in the Genus database with same CATH superfamily
2WIDA 1DJQA 3ZPOA 4GP7A 1IN7A 2KQUA 2C88A 4YMTA 1TM5E 2WJJA 1UT6A 3NH6A 4M76B 2RGDA 4BGIA 3OY7A 5KJEA 4U02A 3L5OA 4IGEA 2IYYA 1L4UA 5EIXA 1YQXA 1GNPA 4QELA 1SXJC 3WKCA 2YS7A 1M76A 3U3KA 2YN0A 1JKIA 4LY6A 3DMPA 1K2VN 1O8CA 3R0ZA 2ZWVA 3OMXA 2NUPA 1FMVA 1LS6A 2YHBA 1OXXK 3LQ2A 1IG3A 3SC2A 3EQZA 3K0FB 2PX5A 4KK3A 1C8KA 1P7WA 1U8YA 3CVVA 3I72A 2IDOB 3MJXA 5DZSA 4HAUA 3G89A 2D2XA 1PTKA 1UT8A 4H2DA 4P0QB 2G9RA 4C06A 5EMHA 1VCOA 2WQYA 3QLVA 4LTDA 1G41A 5K0TA 5KYYB 4DC1A 4XARA 2FBWA 2RHHA 1ZM3A 2YEVC 2EKLA 1R8IA 1VJ0A 5U4QA 3PUXF 4NPCA 5JWOA 4XBFB 3K8YA 1BXGA 3SC3A 3ICQB 2FMHA 3V00A 2HQRA 2VJBA 1OFGA 1SHKA 2P41A 3BRQA 4O4IA 2C5LA 1V96A 3BT7A 3D5TA 2C7BA 5AQQB 1I3CA 3HKDA 4GOKA 5TQVA 5FWYA 4N8SA 3GDGA 1T9HA 3FAZA 2P1ZA 2YDRA 4X90A 3NQ41 4D4IA 4RHXA 5JWHA 2H1SA 4B33A 2CCKA 2YCLA 1WJGA 2PS1A 4JODA 2WHPA 1KAQA 3SX4A 3FOCA 3ZCSA 3QC9A 2V6MA 2A78A 2PL3A 4XR9A 4U0KA 1SU8A 2XNDD 4UTVA 3LDQB 4F1WA 4F96A 1QIMA 3ADKA 3GJXC 3IURA 3F4LA 5DHPA 4ZRDA 2EHOD 3H3AA 1QIKA 1REQA 5FA5A 4DV1B 1L4EA 1NNEA 1U31A 4M9ZA 3QV1A 3UY4A 1ONOA 5AQIB 3E84A 3PE6A 2H0QA 4L74A 5CR9A 4JVSB 3FN4A 2WM8A 4C0KA 3ZU5A 5AI0A 5BW8A 5KTSA 3KKZA 2PMKA 2PSFA 3FTNA 3RHTA 4U2GA 1TGVA 5B3JA 3I05A 4BS9A 2YRFA 3OURA 2C9DA 2ZJAA 3F5MA 3FCUB 3EIFA 4PCAA 4IYRA 4FHFA 3JCFA 1TA0A 3NETA 2BKLA 4REMA 4BY9E 1FXWF 2JEZA 3PCXA 3EWSA 1HMYA 3KQTA 4N82A 3KM0A 4EJMA 3Q5GA 3M6MD 3DV2A 2DTEA 2VA9A 1RD4A 2QR3A 2XMGA 2IY8A 1GGFA 1N6RA 1XLVA 5FPPA 4PGAA 3SC6A 3N8DA 4TSKA 4NU0A 1D6SA 1K6XA 4JJ7A 2EP5A 4YXDA 3NG1A 2Q0HA 2XGMA 4GZ6A 1PR0A 4RGBA 4L15A 3F2VA 3JAEA 3LK6A 1VKZA 3EZXA 1NBHA 4RS3A 4ZFNA 5LZ5A 3NWPA 5C0OE 2V7PA 3CPEA 4YMVA 4DLXA 3C15C 5CT9A 4CEIA 3SQMA 3EEQA 4AUNA 1VLLA 4RMHA 3ZBQA 3QI2A 2DUJA 4RACA 3KJIA 2E5LT 1B16A 2REOA 421PA 3C7DB 1BVHA 1PLLA 4X1YA 1CYDA 5LYJB 2CJFA 4QOSA 4ZC1A 1FLAA 1ML4A 3HRIA 1XIVA 2Y8DA 3K5HA 3D6HA 1QPBA 5DO9A 4TV8A 3KPJA 3T4EA 5KCZA 1SIUA 3ZJ4A 2MIIA 4BVEA 4J6EA 1K08A 3OUUA 5JW6A 4BNNA 1KHTA 4HMOA 3T1NA 4H0CA 1BS1A 2Z5VA 4J75A 4E08A 2WZQA 3NBZC 3A26A 3Q4GA 4OUKX 2AWOA 4FILA 3NM5A 4YCAA 2C7VA 4IT4A 2O2SA 1UK8A 5D3MA 5AM4A 4H9GA 3NH9A 3E05A 4W9RA 2CMRA 5AVXA 4K26A 5BN1A 1JT9A 2Z5LA 1SKYE 3CVOA 4X63A 3D0OA 3OT4A 1KIMA 2VJDA 3FTDA 5JD3A 1IDN1 1SVKA 2Q46A 3AJDA 3OLQA 2Q3HA 2AK2A 5A0VA 4GPEA 4URZR 4UVIA 1N5OX 2VRBA 2WSSD 1JHOA 1BGVA 2HA6A 1R6DA 2LV8A 4BKPA 1X8XA 4DWOA 5T4BA 2VDOB 4YJ2F 4ETWA 5AYVA 1YR7A 3N86A 1DBPA 5KZMB 4Z2YA 2QX7A 1LCIA 5IXYA 2VQEB 2OPHA 1G7TA 4FEAA 4OLHA 4A6XA 1NOKA 3HKEB 3CWCA 1TT5B 2OQIA 4G25A 1DHTA 4TZKA 4TKZA 1HFJA 5ELMA 2JA1A 4MYDA 1UM8A 1WUJS 1CJKC 4M37A 3L8EA 3JD1A 4TKMA 2YDSA 4FK8A 2B83A 4CF3A 5DM2A 1H66A 1EGMB 1W44A 5CYFA 2ZVJA 2VRWA 3DFIA 3LKBA 1UBMS 1UXKA 3PQCA 1EX7A 1KYQA 3JZAA 2AE1A 1D4AA 4RDIA 2PZKA 4XCQA 1ZXLA 4YAJA 4FVTA 3OQMA 3MTBA 2WYHA 4N0PA 2IAKA 2JLQA 3L0BA 3JR7A 4PK5A 1AGRA 4EFNA 3RG8A 3BK2A 4W8OA 2V26A 2I3DA 1WMAA 1DXHA 1Q0TA 3ITDA 1YC5A 2BR4A 1XQ6A 1HG5A 5LOVE 3K30A 2PKQP 1EFRD 3ADDA 4PCVA 3M34A 3B3AA 2NP6A 1VYTA 4FD3A 2NUTA 3BDIA 4IXMA 1R0SA 3DOCA 3G2MA 1RAGA 5FO0A 2M6IA 2FJPA 4P1ZA 4RZSA 2IMLA 1LI4A 3VMFA 3TIGA 1T98A 1UC5B 5FUQA 1CDOA 4HDCA 4YPFA 4ND6A 2P3QA 2EL9A 2R6FA 3V97A 4AZ0B 3RVNA 1JR3D 5TS3A 4CQLB 4EG4A 2PWYA 1PG0A 4M9XA 3MJEA 3QVWA 5FP3A 1X1SA 5H6RB 4TUYE 1C50A 2WJWA 4BFXA 4HRVA 1LVHA 2OORA 3C6XA 3PF8A 5ITVA 2JLUA 1QV7A 2A5FA 4UTZA 2GHTA 3VTAA 2VJYA 1H5UA 4MVJF 2J45A 4OBXA 3B20A 3GVXA 1CUVA 3W79A 5I7WA 4J7XA 2AXQA 4NENB 1VZ3A 3HA2A 5EI5A 1J0DA 2FJUA 4E31A 2VWPA 3M6FA 2HB6A 2FRVA 4KQ6A 1KI1A 3PC8A 4UEJA 2CNBA 2PXCA 4NIQA 3N9QA 1HS7A 1JFFB 2JFQA 3QWHA 4J2TA 1U0OC 5LP1A 3M4XA 3OQJA 4BCBA 2I78A 3OE5A 5AIAA 1Q1NA 2VQ6A 4FB4A 2RI1A 2XTMA 1R12A 1GQEA 3BJMA 4Y18A 2BHLA 2B1IA 5LG3A 3EPJA 4LVOA 1QCZA 4GT1A 1KKMA 4AXPA 2C59A 2YIVX 2H4WA 1U3TA 3P2MA 2RI0A 4WBNF 3I0QA 5JMWA 4CV2A 2CV1A 4O4LB 3HJBA 4I4LA 1Y3IA 5D86A 3MUEA 2GLUA 2V7MA 2XPKA 3T8OA 2IPOA 4GBMA 1TYDE 3AE5A 1QFSA 2CFOA 4CM9A 4K2AA 5EE3A 2PS3A 2Z8YA 1GNLA 4ITUA 3A8YC 1RI2A 1C1DA 3WB2A 4QT4A 3B60A 2OY0A 3DZFA 4BC1A 5AVKA 1KWKA 4OB6A 3ZGZA 3QJYA 5ES4B 3OCUA 1E3EA 5JPIA 2FUPA 4QDJA 4DIKA 5A4FS 3LP6A 1KPHA 3UB3A 1CRZA 5E6SA 2AQIA 3AAEB 5EJAA 1ZJ5A 3SQNA 3CLTC 1H3NA 3WIBA 3MBKA 4CTJA 5JY1A 4KCGA 4NP6A 3PDUA 2F55A 2D6FA 1K9VF 2QX6A 4HPJB 4HMPA 1KHHA 2WP9A 5DWDA 4D3XA 3DBLB 2AN9A 2PMCA 4TL8A 1IDOA 1UDWA 2OQ2A 5AKYA 1TQ6A 3LAWA 1LBHA 4D43A 4MRRA 4DR3T 2BG9B 1O4WA 4CF6A 1PW5A 1UXGA 2PKXA 2XQ3A 2R6GA 1DADA 4ZQFA 1ZONA 4Y6SA 3OZBA 3MILA 4W1PA 2X86A 3MN1A 1M66A 4D57A 4LF5T 4HH1A 1ACMA 5GONE 5BUCA 3VYVA 1L3BA 2P5UA 4QDXA 2ZIVB 3ZI7A 2JVJA 3KWFA 4B8YA 2HIMA 4LVNA 2IZ0A 4DLSA 4RVGA 2AUMA 4DA7A 3ECSA 2H7YA 4PIVA 4CEHB 1GTSA 2JI8A 5L8VA 5BRNA 2B9VA 4FMCB 1RKVA 2NQ8A 1B6RA 1DQSA 1OROA 4IIJB 4MUEA 1C0IA 4EY3A 3LNTA 3LX8A 1HM5A 2QTLA 1IUKA 2W2PA 1JFRA 3AZPA 2DWQA 4Q3NA 5SYNA 4IS2A 4J0GA 1YZHA 5AUPB 3RREA 3CZMA 5JH7E 1ECBA 2ECQA 2D00A 4N0MA 3V4VB 2H1VA 3HK2A 1LW7A 1ATZA 2REQB 1UBNA 3HV2A 4C7VA 1KYTA 2VKJA 2X5OA 3L1KA 2EHDA 4LNUB 3Q8KA 2AFHE 1E3MA 3V1MA 3ZHQA 2DFLA 2QVBA 3D4NA 3K3QC 4C7OA 2WWYA 1E4EB 2X6RA 2YNMD 2JJQA 1YD8G 4IL5A 2XTAA 2Z4RA 3FOZA 1ADYA 2KB0A 2X77A 1BWSA 5HQTA 3V33A 3NLLA 3KLOA 1BFUA 1Z6TA 1M2HA 2Z6VA 2IL1A 4MUJA 4PG8A 4RS4A 1L5VA 5FI1B 4MKFA 4F5ZA 4MCAA 2G63A 1ZICA 2RHDA 3D3QA 5BN3A 4IXNA 5JC1A 1PT8A 4D8WA 2WAXA 1YVDA 1JLMA 3PNQA 4Y6PA 3WKBA 1QE3A 1RVV1 2Z56A 4X54A 5AKHA 4X1IB 4XH9B 4KP3C 4WXRA 4QJIA 2QLMA 4YWJA 4JHLA 5KQRA 4ALJA 3MAJA 3NORA 3HKCA 2EEZA 2IYVA 1RMQA 4O2BA 1Q92A 3IA2A 5FPQA 4Y2UA 3O82A 4DQKA 3KR2A 1EK0A 2C9CA 1FXUA 1GPAA 2AUTA 3H2SA 2IEZA 2L69A 2C7PA 2VHQA 4FWIB 4DIDA 3VNVA 3PJRA 4M7WA 3P2YA 3MJRA 2IU4A 1U0SY 5J2TE 2JQKA 4OI2A 1E3IA 3P1JA 5L2LA 2FOLA 4HUQA 5HS6A 1MG0A 4X64T 2G5CA 3HL0A 1TK9A 3OE4A 2XPCA 3BB1A 4URYR 3QBTA 2VUSA 2J3JA 4GAEA 5FWNA 4XX1A 4Z6KA 1MO2A 3TH5A 3HH8A 3TDMA 5KMGA 2F1RA 2VWAA 1NTRA 2HLNA 2OGUA 1DAIA 3U4MA 1WKCA 3KSAC 3ECAA 3WDKA 4Y0NA 4N48A 4FOLA 2P6RA 1ZIPA 5CA1B 2XT6A 2FZWA 3M7IA 3M3HA 3CLHA 2BDUA 3E61A 4DT1A 3R6TA 2IY9A 5JSYA 3C2QA 1ZIXA 2BMWA 4DA6A 1ZKDA 3UBTA 3B82A 4E4TA 4UEOA 2QVGA 1GTJ1 3D3EA 4UDXX 3CHYA 4N5HX 5J47A 1NW4A 2Q1YA 2GYWA 1Z6ZA 3EXIB 5HAXA 2DY0A 1JEQB 1YIDA 2WDPA 3VH3A 4F7DA 2W2LD 4S1WA 3TIXB 2EVWX 4KNYA 3WOVA 2UYCA 1SVOA 5B4TA 1WM1A 3EH1A 3ZOKA 1VL1A 3BMNA 3QOWA 3O8CA 2Y66A 2P9TA 1N7JA 2RMKA 3MCZA 4PZ9A 1RRVA 2GGSA 3JQ6A 3OPYI 3QXJA 1E7QA 1HPLA 1FMFA 3N87A 1RJWA 4N5MA 4BA9A 4DMCA 3JC6C 2VAXA 1OLSB 4K9LA 1VIAA 4JDUA 1NW8A 4YMIA 4JGGA 3QA9A 1QIGA 4HDKB 1AZTA 1R6VA 1DMSA 1YI0A 3AHHA 5EC8A 5JDCA 4Z54A 1Y6ZA 2X2EA 5FBWB 5ECWA 1MO5A 2R44A 3X2FA 2W2QA 3MCWA 3ZEAA 3OEEA 2F2TA 4BFZA 3IUYA 4XXHA 5COBA 2DBVO 1Z5OA 4AIRA 4M46A 3RB8A 5DI3B 3QUAA 3HL4A 2Z5GA 4IBOA 1JR4A 4KAJA 1VSQA 3AK4A 1K86A 3ZIAD 5J4KA 2GNPA 4TNVA 2ZBPA 4W5TA 3KEOA 3K73O 5F98A 3GAZA 3R76A 2ZU6A 4FDVA 1TD1A 3ZV4A 2JHGA 4YRRA 1E20A 2HWYA 4PLHA 2BL4A 2X5KO 3ZC1A 5H16A 3HDTA 3RIFA 3CNBA 2GLTA 3SKXA 3LL4A 4FGSA 4GSYA 1G3QA 3C3CA 1W0JA 1PL0A 4Y6RA 5EUMA 5EXPA 5HEUA 3HP1A 3V48A 5JO0A 3NKZA 5KYUB 3C50A 3GPDG 3PVCA 4DLWA 1YZVA 1QX4A 3WYEA 3WNDA 1WVIA 3KT8A 1KE1A 1USWA 3FCAA 4O63O 2IHKA 3OEWA 4WN3A 1S02A 4DN6A 3FD8A 2QMZA 2AK3A 3ONFA 4B31A 2JAWA 2R5NA 3B9PA 1WNTA 2B78A 5P8WA 2G1AA 1XVTA 2HA4A 1YOVA 5LDHA 3C70A 4AUKA 4B5LA 3MOGA 2PX8A 3IBFA 5E9QA 3Q7QA 1QM5A 1GG8A 1KZ4A 4CCAA 3KQYA 1M75A 2RGUA 1SCDA 2C9BA 3WRYA 4NJEA 2O5VA 4DILA 1DO8A 1JZQA 2UU9T 1FQOA 2VH5R 3K7EA 4JU9A 4ZEMA 3WLFA 1SH7A 4N01A 2IYRA 2YIJA 2YZ2A 2XCTB 1MIOA 2O9JA 4HNVA 4PPNA 2KX7A 2ZUSA 3RSGA 4I50F 3TLZA 1B15A 4PEVA 4NH4A 1FP4B 4PONA 2ADMA 1TZBA 4F97A 2ZBQA 4NMWA 1NWHA 1F2VA 1W52X 3SYMA 4XUEA 2E49A 1S1CA 4OAOA 2YW9A 4TN1A 1ESCA 2J33A 1GAQA 5ITZA 2RK4A 1AD2A 1QKJA 3KR1A 1TF2A 1T0JB 3OESA 4DCSA 5HJEA 4KQWA 2CWDA 2VVNA 1GCAA 3QZUA 5TQ0B 1ZQ1A 4UHDA 3I34X 3OG9A 3FBGA 3P4WA 1GITA 2CBIA 1NF3A 1WRBA 4RSGA 2JFYA 1MAAA 1W4ZA 5K4AA 3ZHSA 1M6EX 3MT0A 3LIIA 4Y2XA 5IAJA 3X1YA 3LI2A 1KJZA 4DR4T 3A1DA 1VL6A 2F00A 5AM3A 2Z3VA 3KYDA 1S94A 5LM3A 4ZGBA 4US0R 2COKA 1SC3A 4AKGA 5FYMA 4EHFA 1XAJA 5JY6A 5KINB 4TV9A 1VE7A 3V5SA 3QE0A 5IKOA 5FBRB 4K6GA 2E4ZA 3MA0A 4LZLA 4DCCA 2IH4A 3LP8A 4S1NA 1NSYA 2EQBA 4WLEA 1XVLA 4HTAA 1KFCB 4QXRA 3NZQA 3CKYA 1NDHA 4DY4A 4FDLA 1G5QA 1PEAA 4F4HA 2Y92A 2ZRQA 3CRQA 2WIJA 2XAGB 3LFMA 1DTEA 1GYRA 3HQ4O 4M86A 4JFAA 4FCVA 2ECFA 3EFEA 4ARUA 1KI6B 3X1WA 1G55A 2NU9A 1LPSA 2X0HA 4XOUA 1HE8B 2I6TA 3O8LA 4MCJA 5I01A 3A06A 4J9UE 3OIYA 3HB1A 1W73A 1RC1A 4GKBA 2VRCD 2IH5A 4BQSA 3I39X 1V7PC 3T6KA 3PD7A 5F51A 4YRPA 4BAUA 4YYEA 2X1MA 1P1JA 4IDGA 4P0TA 5LMCA 3GQBB 1R16A 3PB3A 5ECGC 5A9RA 1JXOA 1BFKA 5BR8T 2MSKA 4O2AB 2FZLA 4FYKA 3KV9A 2YX1A 4K2HA 2XQJA 1U5PA 3GJ7A 2G70A 1O89A 5F9FA 2JLRA 3P9KA 3ACCA 3COYA 4XZCA 3X43A 1K92A 2C4KA 4PZLA 1ODTC 2OV4A 4AMVA 3TD2A 4Z51A 3DTOA 1T36B 3CVJA 1XCOA 1Y5NA 3LBIA 4MQ4A 3SEAA 3K31A 1YU9A 5A7HA 1JG1A 3VZPA 5AMXA 4BLVA 3O4JA 3V1TC 4A73A 4HGNA 1J00A 4DF3A 2VAPA 5I51A 3H0CA 3KB6A 2VF2A 5FOUA 3A0UA 3SZMA 5J2UE 4HDQB 3HI2A 1TYBE 1JEJA 4XASA 3EISA 3E9CA 5FFMA 2ZS8A 2ENUA 4QSHA 4E4YA 5BMVB 4WAUA 4ZA2A 5KVSA 4DMMA 4XX0A 4GQIA 3N5LA 2MINA 1DELA 3RYCE 2HQBA 4PZYA 4AJPA 1J07A 3EBLA 5HZHA 5J40A 1V9CA 4ZZCA 3VVCA 3EA4A 1RYHA 4HF7A 1DOAA 4HP8A 1OBCA 2GUGA 3CJTA 5LBMA 4JBYA 2HYIC 4JOCA 4JC4A 1U2PA 4JYAB 1BHQ1 1E7RA 4GLJA 2Y48B 4PYMA 1BFDA 2ZETA 3TQSA 1NZFA 4FX2A 2H2HA 1JZSA 3R3HA 4QBTA 5EXTA 2QPTA 1VRWA 3ZHZA 5K05A 3H2ZA 1IJ5A 2VK8A 2ZFUA 4URUR 4ZZ3A 4BNWA 3SDBA 5LQCA 3PDWA 3A4YA 3ASYA 1AN0A 1C3OB 1U7UA 3P4YA 2W4QA 3BFPA 3W5IA 5F7XA 1V8FA 5F76A 2ASEA 2MR6A 1K8ZB 1G63A 3GLSA 3VNQA 1QG2A 2XYRA 4M1YA 3EMKA 3P0IA 4LISA 3VYSB 3T7JA 4U2FA 2AOVA 2C7OA 3IEMA 5KU7A 3ER8A 3PU6A 2AG5A 1YO6A 1ZOYA 4EG6A 2H06A 3JQBA 2XRMA 3I0NA 2BMEA 3WWDA 3OWXA 4Q9AA 1T5TA 1FZTA 2ZBVA 1OXKB 2GSDA 4Q3EA 4M8IA 3TL6A 4F6CA 1BD4A 3NUQA 1T8UA 5CB6A 3HBJA 1K4MA 1OXBB 4P80A 5BSKA 4JI6B 2HA7A 4RY8A 4EDFA 4EUHA 5GADl 4ZZ1A 1K3FA 2PZFA 3FUWA 4ZVNA 3EVBA 1GZ6A 2H08A 2RGBA 4NYIQ 2BMFA 3COSA 3BL5A 2PN1A 3GZNA 1Y80A 1EWTA 3EC1A 1JHUA 5J58A 4TX1A 3L4KA 1EJ0A 3O0TA 2HRBA 4YV0A 1S0UA 5ALDA 1A5TA 4X60A 3ZY5A 16PKA 1JHDA 1C80A 3U62A 4ZO7A 2F8SA 1VHQA 4GXTA 3FLEA 3VUFA 4OSPA 4LOHA 1YU6A 1JFTA 4YXFA 2A67A 4YLGA 5EIEA 4MQLA 4P7BA 1C9KA 1J24A 4D98A 3IDSA 1E4OA 1Y5RA 2D9DA 1E1QA 1GT6A 2ONJA 1ZITA 4IFEA 3KR9A 4DBLC 3HGTA 1RP1A 2XSBA 3NPMA 4UTOA 1XNRT 4EGFA 1RHMA 2PSSA 5CG2A 4J1TC 2NU8A 3HKBE 1Q11A 2BE7A 4YECA 3KQKA 3SS1A 4ZDWA 4PNEA 3EGCA 2H5LA 3HWRA 1OCEA 1ZHFA 4YASA 3PWTA 1G8MA 1F4VA 4L8WB 3ZTYA 3DO6A 4LJ4A 4MKZA 5GV7A 5HWSA 1UC9A 3S81A 2C42A 5BSRA 2GPNA 4I55A 2XT9A 3DV0A 1GU1A 3M9WA 4JYMA 5L3FB 1H8ED 3NTXA 5B57C 1MO6A 2ATCA 1AVTA 2FW0A 5EJFA 4R16A 1KPGA 2IELA 4YPOA 2C5HA 3H1EA 3B3GA 2PT7A 1D2GA 3OIVA 3PYLA 4C4AA 3R75A 3ZU4A 4DDKA 5H8WA 2KHZA 3BGWA 2EGGA 5AVZA 4HAXA 5JFGA 4WBOA 1BEEA 2OZLB 4QX7B 3KLBA 2XUEA 3MK7C 1GAJA 1NZJA 2BP7A 3TOZA 5FP0A 3Q5DA 3NBMA 3C14C 5E6UB 4HNGA 2AF4C 3ZX4A 3EMBA 1I2BA 4QAQA 2R5FA 4I5GA 2EAUA 5BWOA 5JPCA 1KNQA 4JWKA 4M98A 1Z25A 3S27A 1ECJA 4II2A 2CFIA 4DFDA 4RF4A 5IBQA 2EKBA 1YUMA 2OXEA 2VPWA 3N7AA 1GT91 1G8GA 4YTNA 1KSJA 3INTA 1U2SA 2VK1A 2WOJA 3EDMA 3H05A 3UOGA 1TO1E 1H1DA 4HI0E 1APBA 4MA4A 3SBEA 4MQMA 4RM3A 3WK6A 3IT0A 1JEYB 2YXBA 3PHHA 3CMLA 3AHDA 1BTOA 3THXA 3LOPA 4BN4A 2HO5A 2DCFA 4F71A 3RBAA 5TVKA 1EK1A 1Z6PA 4PO9A 3B5JA 2I03A 3ZD6A 3R7WB 4NZNA 2AIRA 3IEPA 3QYPA 1IRIA 1JU4A 2XVAA 1MX3A 1NVBA 2HN2A 3IAEA 5DM4A 1LPNA 4NC9A 1WKBA 3UPUA 2YDYA 5HFAA 2P40A 2ZBRA 4R9UC 2OAQ1 3MQ2A 1BR0A 1I7PA 2PWAA 2MT9A 2PNFA 5LUAA 3ZE6A 2VIIA 2YR0A 1LXCA 1T13A 3AJEA 4H7JA 1YVEI 3BTSA 1NVUQ 3RYTC 3NDJA 3I2KA 3GFRA 5A4JA 4BNVA 4B8WA 4D3SA 1BROA 1CY1A 2IIBA 1V43A 2R7KA 3CRW1 4HAYA 3KBTA 3BDVA 4HQLA 2Q0QA 2WY2A 2WLTA 2BGNA 4XQEA 2E1PA 2R7NA 4OI0A 2H31A 1BCRB 2IU0A 4RH1A 2B7CA 2GPTA 2X0DA 3FYUC 3ZCIA 2X5XA 3UG7A 4O4HA 3W5HA 2AN5A 5F7JA 4LYGA 4JT9A 4QGGA 2Z3WA 4EA7A 2O0JA 2BZGA 4EVSA 5AW2A 3R24A 2LSIA 3L39A 4Q39A 4PX5A 3HU2A 1XCPA 2PANA 2CWWA 4PNZA 5ALHA 4LX8A 2DT8A 4WCDA 3FZMB 3K72B 2ZYAA 5EXDA 3UATA 1OJ7A 1RZUA 1DDIA 2IKSA 3DXYA 4HB0A 3S40A 4UD6A 2AZDA 4BC0A 2F1IA 2HQOA 3UJ3X 2ZM5A 1ZH0A 5JSHA 3REFA 3R4CA 5C1PA 2D62A 3BM5A 1ZGGA 5GJVC 1L9KA 2IXTA 4H16A 2YL2A 3UT5B 4WESA 5THQA 4DRXA 4TSFA 3DCJA 4DZZA 4C01A 4BHTA 4JP3A 2V65A 5DTMA 3PKJA 3S0JA 1HH4A 1CUDA 2WJGA 5HEOA 1J8YF 5JDIC 4YROA 4CPDA 2QZSA 3RR2A 4FYXA 4GOJA 4NRDA 4YONB 4UBNA 1ZRSA 1JQDA 2VDNB 3HXLA 4NAUA 3UXHA 2AI1A 4EJSA 3DVQX 1GDHA 1M1YA 1NP6A 3GGSA 1BR4A 1BWQA 1Q7GA 3GROA 2YIDA 1LLCA 5F2OA 4LFAT 1E3WB 3L01A 1YVRA 1OA1A 4Y6OA 1IK4A 2O7SA 4COKA 3DPUA 1Z74A 2XVMA 1N36T 2QJOA 2J3KA 3IE1A 1QIJA 4R0NA 3GLFE 5CAEB 1Z33A 1MR3F 4DEXA 2CUTA 5DTQA 3MTIA 1ECFA 3GLHB 3WWCA 1YWGO 3NZPA 4ROTA 3P9SA 3FNGA 3GHYA 1TLLA 2OBFA 4ZZ2A 2O50A 2FSVA 2Z6AA 2QL7A 4P0AA 3VPSA 4E1VA 1IQPA 4NLLA 3LQ1A 2BS4A 1EX1A 4CR6A 4NJMA 3VOSA 1D04A 4WCFA 1KR2A 4D5GA 4RFVA 1MMGA 5I9MA 2DR2A 1FP7A 4B6SA 3JYHA 1W34A 1BEZA 3BMCB 1AKYA 4ZTZB 1P4AA 3TZCA 4B4WA 2GN8A 4XM0A 2CY0A 1NR7A 2FJEA 4I8DA 3BQKA 1RYMA 3B6KA 1PVVA 4KUGA 4PG6A 4LJRA 1P1RA 4ZIRA 5DN6A 4YCCA 3QFCA 5DKFA 2X4LA 2ZCVA 1RKUA 2B1QA 4MBQA 4B3HA 2X9YA 1EPUA 4CKEB 4OKIA 4QA9A 3QP9A 3ODGA 1CF9A 2GX6A 3UF0A 2P3LA 3K1AB 2OO5C 1YDFA 3SR3A 1E63A 4BMCA 3H5WA 3ADPA 3GO4A 4A1FA 3AERA 2IYLD 1CVRA 3AMVA 4C14A 3QPVA 3TO5A 4GNKA 1K8RA 1TUIA 1WUIS 2WRZA 4FYJA 4R9RA 4HEA6 5BR1A 1ADFA 4NY1A 4JUBA 3GPBA 1H0RA 2GR9A 4E5YA 5EZYF 2BFBB 3SSNA 3LT0A 3A1FA 4DTCA 4HRXA 3SSAA 2LTAA 5I7EA 4TRNA 4XSHA 3EVTA 3L6EA 3L9XA 4EUSA 4G1BA 3V4SA 1WDKA 1RXSA 4Y9TA 3TZ6A 4YAEA 1MBZA 3CUSA 4A0FA 4CTKA 1VE6A 1HG2A 1V3QE 4LYAA 5EZ5A 4F6RA 1NE2A 1E1CA 4FIZA 3AWDA 2IDKA 3ZLUA 2V7QD 2Q4BA 1E6LA 2O1SA 4CHGA 5DHQA 4B6XA 2IP2A 5FPSA 5JYEA 2HSEA 2ZWAA 4PTZA 1Q50A 4KQXA 1II8B 4CLRA 1Y4ZA 1ZLXA 3C4QA 4GIWA 1OKKA 2QQGA 2H8GA 4IFIA 2W6PA 3RGLA 4QHSA 2RBGA 2WDQA 1X80B 4QH4A 2PTHA 2P27A 5CA0B 2WIAA 5JE8A 3ZNPA 3CSSA 3GEPA 3FJYA 4DW8A 5DNCA 3CSUA 2R3SA 2I6UA 1XK6A 1OX4A 2O2XA 4YQZA 1I2AA 1I01A 1GRCA 4CG0A 1TIBA 1EGHA 3UTKA 3ROZA 5CNMA 2ABWA 2C4HA 4P98A 5LQRA 1B0PA 4NU6A 1BVUA 3P52A 1AMUA 3WWOA 1P0FA 1QP7A 1WHTB 1ITZA 1NI3A 5HMLA 3W9BA 1XVIA 5DNUA 1D07A 3A3YA 2GRJA 4OQ4A 3NXKA 4AN0A 4XIGS 3Q7SA 3JD0A 3BK1A 1C1YA 3INRA 1IN6A 4KFSA 3LUCA 4YIHA 3PGLA 2VT2A 3BWVA 2ON6A 2CJWB 2YWDA 5IF9A 3QUCA 5AVTA 5F1PA 1O95D 2PX0A 1N8KA 3QHQA 2WZHA 4OHPA 3EDUA 4OH1A 3TI7A 2YZNA 3Q11A 3I45A 3K1TA 1AUOA 1F8GA 4EFDA 4L4YA 1Z47A 2DLRA 4ITRC 3PPYA 2JFXA 1GILA 2P6MA 3JCZA 4WLUA 4KITB 4UXHA 2ERXA 3CG0A 1JPNA 2EZ8A 4OF4A 3UMBA 2XQ9A 2WSIA 2O8CB 4CXWA 2OBNA 3OFNA 2F3PA 4X7MA 3N8HA 1RAFA 2CA5A 1YL5A 1IJ6A 2GFHA 3M89A 1RJ9A 4NBTA 2ZJZA 3H9UA 4YAUA 1TAGA 3ILSA 2IHUA 2H51A 2YZGA 4JS0A 2C4TA 3PLNA 2K9AA 4DJEC 3MZKB 3P2EA 1DOHA 3CE6A 3DDWA 3G02A 2G4CA 5BT9A 3O1HA 4ILKA 2UV8A 4KHPB 5SYMA 1DAOA 4N3BA 5LP6F 1T4GA 2FA9A 3K16A 3QEMB 1XZDA 4OHZA 9MHTA 1PP4A 1QTQA 2V7XA 4IWXA 4Q0MA 4JEHB 1RJFA 1CDZA 1PKEA 3ETJA 2HT1A 3ZZMA 4PLFA 1D1TA 1SA0E 2RAUA 3LNCA 1XTIA 2N46A 4IUBS 3ONVA 3QNUA 1WXXA 2C2BA 3JQEA 4J8PA 1ZG3A 2GD2A 4WECA 2OFXA 1RHJA 4O1IA 3RVRA 4RL4A 2C2YA 4FI3F 3L4BC 4H4DA 5JVDB 1NXQA 2XY4A 1ZYUA 1T8BA 1SIOA 1AXRA 5HXHA 1C0EA 4GO1A 3OCZA 1R74A 4A91A 4Z0HO 3T3IA 2DJIA 4AURA 1PFVA 2WWWA 4JQCA 2Q07A 4DJJA 1XMVA 4JI1T 4IJUA 3C5WP 4N5LA 3RT9A 5GZ1A 3VPDA 2VHVA 3ROEA 1ZD5A 1EE1A 4OEHA 2I3AA 4L8FA 4LFCT 3FGZA 2LZ0A 4CLHA 5L3EB 3QU7A 2F59A 3AG6A 5AW7A 3MA9A 4A92A 4OTZA 3NOVA 2I99A 4I8XA 5LR6A 1KAHA 3MWDB 1U2GA 3ZWAA 3EIWA 2GBFA 4CCSA 5A7FA 2VRNA 1ORIA 1PL7A 1U7OA 3S1AB 1ZH2A 4Q03A 4UVGA 3K0CA 3K4PA 5JXGA 4IY1A 4KUMB 4NV3A 4B76A 4LE1A 3GZTB 2K3WA 3OM0A 1AOXA 1IWOA 2XQ8A 2NN3C 3ZV6A 3G1TA 4J0EA 1MAVA 3JX9A 3C3XA 1KZGB 1T9CA 2MSNA 3FNRA 4RVDA 2HWKA 3HR4A 4WUTA 3QUQA 2JFOA 2PZJA 3A6GA 2BCEA 4D6PA 4CM1A 3MB5A 4BRZA 3W1EA 1GFZA 1QVWA 3TM4A 1DTSA 2QJRA 4UHCA 3NTRA 3MGGA 4DR6B 2Z2KA 2ZM6T 1UKBA 1SOWA 3IHWA 4M3NA 5TT1A 4UMDA 1UUSA 2V5CA 1F0KA 4UM5A 3CN7A 3LBXB 2X4DA 1IQ0A 4M60A 5DBGA 4QYMA 4IH9A 3RRMA 3RF1A 1EK2A 4Q3CA 4PZ0A 4KWTA 1QJCA 4KOEC 3PDHA 3AL2A 1IY0A 4YA6A 2I67A 1BXZA 3P45A 2OBYA 3U1BA 3OPYB 5KX5B 3FWKA 3PRKE 2Y1FA 3ZNOA 4EB6E 1S4MA 5G0TA 4IQGA 1R37A 1ZMOA 4QYTA 2FN3A 4JUCA 5ALFA 1KARA 3RC2A 4AXBA 5BVHB 4MRVA 4CF4A 4NNJA 4GBED 2FQYA 4N5NA 4KAFA 3VQTA 4EKYA 1RHKA 3EMVA 4RVHA 5DTRA 3M83A 3OT1A 3N2GA 1ZISA 5FPKA 3K0AB 5H3HA 4LMJA 3Q9NA 3D8HA 5CLIA 2QYOA 3Q3JB 3UU3A 3SK0A 2PUEA 1HYGA 2XWBF 1EFUA 3CO0S 3RE1A 2VEOA 1MB3A 4RJLA 4NU5A 5K0CA 3U44A 1DC7A 1OFUA 1K6JA 1X13A 3V2GA 1J1ZA 4LF4B 1CCWA 4CIBA 3U4CA 1RPNA 3TM5A 2GK9A 5SZIA 3UENA 5SICE 5CNKA 4YTEA 2O23A 1WBJB 1F14A 4NXNB 3A3PA 2BGRA 2QTMA 4EEBA 1VHTA 1M0SA 5HNKA 2HPZA 4KRYA 3JASB 3NCTA 1P2BA 2IDJA 2I6FA 1M34B 3EVZA 2J1DG 2PGDA 1WE2A 2CDCA 3LECA 1ZCFA 3L4JA 4TM8A 3SFVA 3L8CA 4TXNA 1HLPA 1U99A 4C3VA 3I9YA 2C0PA 5T5QA 1RW4A 2DHCA 1UJ6A 2LEHA 1ZPDA 4MV0A 3S2ZA 4RFSB 2X8WA 3TWOA 5DGCA 1WCIB 4YSXA 4HDSA 5DNDA 3TLTA 4L72A 3ANLA 3KUXA 1TUGA 5EJEA 1KPIA 4O4JB 2G9VA 1C2YA 3IXQA 5IAEA 4ZV4A 1BMTA 1U8FO 4MVXA 5AFUL 3GLIE 4DLKA 4HH4A 5F73A 5CFMA 1NHWA 3MF4A 1UWCA 4YBZA 3PZBA 3A7DA 2OV1A 3HADA 3E8SA 1F0NA 1Z12A 1P4GA 1K5DA 1J09A 4UV8B 4JLOA 1XE3A 3G0DA 2O8BB 2EHOA 1KF6A 3DLHA 4RMJA 1N2CB 4IREA 4QGFA 1X0XA 1I2ZA 1FPMA 2B2XA 2CNNA 2GZHA 4PFOA 4LSGA 2FJ0A 2IKQA 2WP0A 4J2CA 3L8DA 3DT8A 4L28A 4CODB 3EQ9A 8ABPA 1JDJA 2ZZNA 2FPGB 1CU1A 2AA3A 4UMFA 4ALIA 3IODA 1LNSA 5DNWA 3IULA 3HN2A 2XSAA 1EJ2A 3KQWA 1VE3A 1L5HB 2Y1EA 4YGXB 1Y5IA 5ISMA 3GJ3A 1I8TA 5A2GA 1XRJA 1RBYA 5FY7A 4FFNA 3O21A 4WLFA 1YQ9A 3DR3A 4BB9A 1L5QA 1VE9A 3EDRA 3U0VA 5FUXA 1KOJA 4XUDA 5JDQA 4C0BA 2QD3A 1ORRA 3UA3A 3UANA 5A5FA 5J1GA 1I0LA 4FNAA 4RF5A 1A2OA 1CR2A 4QGBA 4OQXA 2OZKA 2D1FA 4YRIA 1WU8A 4R3NA 3B3FA 3KZ1E 4QG3A 3O5AA 5JRJA 2RARA 5A1JA 1UXIA 4A8JC 1GYPA 2XYQA 2PZGA 3UK1A 3FAKA 2Q4EA 5E7MA 4IYJA 2NVWA 4MNTA 3B9BA 3L7DA 2BZ0A 4WN9B 1AGYA 2P30A 2OFWA 2XQGA 4I4IA 4NG5A 3AUTA 1YZNA 4HMQA 2OK8A 1SKAA 2OWEA 1OXZA 1F7UA 3P4PA 3K2EA 1FMTA 4P09A 5HX7A 4M1TA 4BNDA 4AY2A 3OF2A 4MEBA 3BTOA 4TRJA 1AKTA 3OD5A 2FKNA 4P32A 4KIUA 3N8GA 4B71A 2AMFA 1Z5UA 1KO7A 3LPNA 1CVIA 2BWJA 3IB3A 2JFWA 5IBPA 1Q22A 2W90A 3H2YA 3WR5A 2O59A 1Y3FE 3WY9A 3F3SA 3EBPA 2C3PA 4UZFA 3NP9A 2B1RA 5E7JA 1ETUA 4HWRA 1ODSA 2UUBT 4FFLA 3H97A 1EIZA 2NYUA 4OAQA 2JFVA 4ILBA 4EHJA 3FDIA 4XM1A 5JZVA 2FZCA 1OU4A 1NM5C 3AHFA 4JC0A 3TRFA 2GZRA 2DFPA 1KO4A 2R9VA 1ZD2P 4D4HA 1DTWA 4ARZA 4M4SA 2GF9A 5IWCA 3CT4A 1I9CA 3KIPA 2GXUA 1V7CA 1NX9A 2H88A 1BOOA 3F2IA 5C80A 2UKDA 1QGUB 4PQRA 1MC4A 2WSSA 4HNRA 2FFJA 1ZEEA 3Q5EA 4WXEA 2IEGA 2WB4A 2BS2A 2K24A 4LYYA 1HLDA 3GN2A 2WF5A 4WZXA 4PV7A 2CFRA 4LF6B 3RLFA 1U4QA 3H5VA 3AY6A 4ZVSA 4LYFA 4MZDA 1GAXA 3IO5A 1UH5A 1GL9B 4LNHA 3BL8A 1QAMA 2FLVA 3ZXSA 5ADHA 2Y67A 3BE8A 3WLRA 4OM8A 1Y8ZA 2YFKA 3ZQUA 1PG2A 1IVYA 2NTYC 4MW5A 2JCXA 4H3SA 2Z98A 3KSMA 3ZDDA 5AFSA 3DFMA 2PZLA 3U3IA 1OI3A 4Z4GA 2NTEA 1OWPA 1SC6A 5A06A 4N12A 4BO7A 3NUZA 4CCYA 2XADA 3M2TA 3I6BA 1AKMA 3WKAA 1X9IA 2X58A 3LCMA 4YCSA 5KYWA 1DV2A 1LJLA 1XF1A 4ATNA 4ID3A 1PFQA 2X19A 4BQOA 4NXMT 2V6GA 5J59A 3AVPA 2ZR8A 1D1PA 4YIKA 1FTSA 3BQMB 2BMJA 3PX2A 3V7UA 1OFIA 1CR6A 4ZDJA 3RWMB 1Y8QA 3LYUA 4FBGA 2J0QA 4Q82A 1E2IA 2Y0PA 5K3FB 1B74A 3CBQA 2FQQA 4AJOA 1AQJA 2AFIB 1C3XA 2PLAA 1M2JA 1G5PA 4GI5A 3NHSA 3A6ZA 2W42A 3ILYA 1PAUA 3TVYA 1V25A 1VL5A 1FDVA 3L7BA 2CL0X 3LBAA 4IDBA 3GMSA 4LY3A 4GI3A 4R9SA 1VMAA 3N76A 2IZ6A 4DLBA 5AJYA 3C1OA 2XUFA 1IBCA 1GA1A 2V4MA 4F91B 4IHQA 1DRVA 4ZXFA 2R8BA 1MT3A 2IYZA 1KZHA 5BY2A 2ZRNA 4YMUA 4H63H 5G0UA 4M38A 5B58C 4X84A 4IKPA 3DOUA 1PR2A 5JH7B 1H85A 3U1VA 4MPPA 4RSRA 1MA0A 1U7XA 4HLCA 4TLMB 2E4WA 2BRUA 2DERA 1PJ3A 1UBLS 2H17A 1ETHA 1FJHA 3CNNA 1I3LA 4RIGA 5KYYA 2JIZD 4PHCA 4R01A 1B8NA 1SUFA 5DYGA 2HTFA 4RLHA 1MVOA 4I5EA 4BLWA 4K8RB 3THOA 3PZRA 4ETMA 4WZAB 5EIBC 1XO1A 1J0EA 2B2NA 3RSCA 1M3SA 2DZDA 2BD0A 2IHTA 3TRHA 1JVSA 3W0LB 3EPHA 2H29A 1TYEB 3AI3A 1VIMA 1G21B 8GPBA 1XCBA 2WVAA 1QR6A 3UOWA 3WHPA 1VL0A 1EUYA 2FWAA 3ETNA 3GCDA 3GNSA 1JI3A 4UXIA 1N8NA 4G5QA 3WSTA 4NI5A 2LCFA 1G8HA 3QLVC 3CLSC 3PICA 3Q8MA 2CVFA 2TRSB 3X1MA 5C81A 1PV1A 5KTNA 3OBIA 1SHZA 5CVEA 1BKYA 5EUQB 3DDNA 3I1FA 4BJ6A 2IYEA 3A9VA 2PA3A 4DKJA 1YDHA 4W5RA 4UM7A 3PQ2A 3RYHB 3DDSA 2PZMA 2AYXA 4RA6B 1CNFA 5GV8A 1N78A 4PO1A 1RQ2A 3IB6A 4NESA 3N70A 4OHBA 4AMYA 1R4MB 5BQOA 1VSTA 4GKKB 2WU0A 13PKA 2ZRIA 4I81A 1YHZA 1YRLA 3VAYA 4HN4B 5CB4E 4Y2YA 1D2CA 3C3EA 3WE7A 2ZJ7A 5KAPA 3QKWA 4INPA 4FS8A 5KJCA 3UUFA 5K8TA 5JHGB 1IFXA 5EMMA 4F56A 5DLYA 2PUJA 1A8UA 1SCQA 1SOMA 4AROA 3E7DA 3FZHB 2LE0A 3IOYA 4WGFA 3L8YA 4R51A 1XDUA 5JAQA 2WLSA 5EE1A 5LA6B 3CUKA 1XTUA 1YCDA 5DWVA 1E2GA 1T8TA 1NPTO 1C9DB 3TX6A 1ZHCA 5T8KA 3JD3A 3GBVA 3RIMA 2IUFA 4NYMQ 1CF4A 5LQKA 3S5JA 3K9BA 3QVLA 3CX3A 5CJJA 3PPXA 3QUTA 2ZE6A 3C98B 5KAMA 5CH8A 5PGMA 5B3JC 3ON5A 3JRWA 4UUMA 2A9UA 2E9XB 4QYXA 1I94B 2ZE8A 4E14A 2IPXA 5FIUA 4FLMA 1TADA 4EQZA 1W9RA 2UUPA 5FADA 3V1NA 3U4QB 5LCXA 3RUDA 2IFTA 4IDQA 4X62B 2P0YA 2O2DA 1WPRA 3RSFA 4IF4A 3TLAA 3GEGA 2FV8A 3L4SO 2JGLA 2B3TA 4JUDX 4EW6A 3G49A 3O26A 3R9WA 1QAOA 4FT2A 5IMSA 3V8MA 1S9DA 3WO0A 4C0HA 1W0AA 1L3IA 3U26A 4WK6A 1XZGA 1SRQA 2XCUA 5LYJA 1US8B 3HJUA 3AYZB 3U6BA 5EP3A 5IDXA 3UFBA 2AW3A 4FFDA 3ZN1B 1KKUA 4EELA 2XQYA 4KBYA 1QYIA 3THSA 4KLZA 4UBIA 2ZRCA 1Q91A 5F77A 3PC3A 4M1SA 2WOOA 2IPLA 4XRGA 1JJIA 5CLJA 1N5IA 2C03A 2YNMA 1O5IA 1L1RA 3BIFA 1GCIA 1T3LA 3ZIDA 3PFCA 1GAEO 3D8UA 5K2MA 3KELA 4DC0A 4S0ZA 3O2JA 1Z0UA 1MDFA 4Y7CA 2ZAIA 1LNQA 1FSFA 4BX9A 2G6TA 1E3SA 1II9A 3P2KA 2WJVA 2OD7A 4V38A 3L4EA 3AVUA 5IYZB 4Z1MD 5CTAA 2XHEA 1OWAA 1Y1TA 1E6UA 3QEKA 3KQLA 4PQYA 4EARA 4LBWA 1UOQA 3P2IA 2E5FA 1PN3A 2OHIA 4LMBA 2W2OA 1RSZA 3COZA 3IQGX 3AP2A 3H2KA 3MC1A 3F31A 3L41A 3HRKA 4J0CA 3ORSA 3CVWA 2WCAA 1KRHA 2H2DA 5FAKA 1JEOA 1VJ5A 3FCOA 2IS4A 1XJCA 2J5KA 5AKGA 3ZC0A 1P6UA 5AUOB 2I4NA 3V8PA 1DC5A 2NTVA 4ZEWA 3ZBUA 3GXOA 2XRFA 1CHDA 5L51A 1YL6A 5KVVA 4MSUA 1A8HA 4WK4B 3WMXA 4G5SA 3AGQA 5G4LA 3IKMB 5E38A 3KUUA 1A4XA 2DWKA 1QZXA 2QTBA 4BGDA 4LGYA 2WJAA 4LN1A 3OZUA 4YP5A 4B87A 2OXRA 2ZBGA 3MWLA 1UDAA 3Q1KA 3KVRA 4PHGA 1M1UA 2W2KB 3OAAD 4HEA1 2D1TA 4QWWA 3S8YA 5JCJD 4FN5A 1O94D 4AKTA 1I7SB 4XWYA 4ED9A 1SMKA 3WV5A 2P5SA 1XTJA 3H5LA 4YHHT 1ZMRA 2WJZB 1P60A 2EFYA 3SLRA 3UTCA 2R7LA 1B93A 1QZ3A 1ZH6A 5I4CA 5C7IO 4Q3KA 3AILA 2FRDA 4KO4S 1MOQA 4JEUB 3CF4A 2ZYVX 2P11A 4CV3A 5HG0A 1AV7A 4EHHA 4JLPA 3LDHA 4WOPA 4Y8VA 8AT1A 1TZCA 2BFAA 4P93A 2GETA 2YOHA 3LL7A 3W5CA 1NQOA 4G9GA 1XLUA 1OT3A 3G6WA 2WEKA 1LBEA 1DKUA 4A36A 4B47A 5FBZA 3DAHA 5D1NA 2H5IA 4WY8A 2JAOA 1GHTA 3UUEA 4EEKA 2QKYA 1XEWY 1IVNA 1QHEA 1VKRA 5LXTF 2NPOA 1PZFA 1H4VB 2W2LA 1F8YA 4LZPA 4CIXA 3RX6A 4RV9A 3E7XA 1AH2A 4AZ0A 5HK8A 1PDOA 4CQLA 1YDWA 3GG9A 2ID9A 5C8YB 3TECE 1DJOA 2GPSA 2QTWB 2YVKA 4TVKA 2WTEA 3BULA 1N2HA 3GDFA 5E2IA 3IDFA 2V0GA 1ATIA 3DEAA 1YL7A 3EWNA 4MGEA 4H08A 1OGYA 3CKMA 3K1SA 4IIBA 1G0NA 5JYCA 5AQVB 4AJLA 3IP1A 4NENA 2QRPA 4QHOA 2YV4A 2AZ4A 3WK9A 3CJRA 1VTKA 2BJHA 4YQFA 4MPRA 1Y4DE 2FMKA 2A1TS 1E9SA 1E4VA 1DRKA 3F5DA 1V1MA 2JASA 4RQAA 4YP9A 1A2BA 3VPFA 3CX8B 3GEEA 1YKGA 4BV9A 2OORC 1JFFA 4F2WA 5JYBA 4JKOA 2IZ5A 2C2ZA 3RF6A 2GN0A 3JQ9A 1ZP0A 1SKBA 1QRAA 3V42A 3ZIAA 4TOIA 2XUGA 1VGQA 4KPYA 1EVIA 1UKAA 4O4LA 3ZMZB 3W04A 5AT1A 1FFAA 1UF9A 3T38A 3PC8C 1M7KA 4P3YA 3FKJA 3IPRA 4INOA 3FF4A 4KE7A 4C08A 2HGSA 3IAUA 4NNPA 4YPVA 4MLCA 2Q62A 2ZM8A 2YZ7A 4HVCA 1A8SA 1XU4A 4JENA 1HTWA 1MKYA 1RCFA 4KDRA 4Z7JA 2FMUA 1KK0A 1NSFA 4XTRA 1WWKA 4INJA 1EESA 3U7EB 3WLJA 2O3UA 4PHFA 2Q99A 2YV3A 3MK31 3S29A 2B4TO 3ZY6A 5K4GA 2QMUA 2FPIB 2ZYSA 4HS9A 4OLFA 1KORA 3LBNA 4JI8T 4YJ2E 4UATA 4ZCRA 3TTVA 4D92A 4UE2A 4DDVA 8LDHA 5EP1A 3DEJA 2V7BA 1N4DA 1MENA 2DQZA 4ZHQF 1GPLA 2P5YA 2DY1A 4RGVA 3PPWA 5CVDA 1VJDA 2J9GA 3R3VA 1LEHA 2PVSA 3ZWWA 1Q14A 1ZUD1 1MPXA 3NHAA 3CCCA 5J2UB 3ZCTA 3DBLA 3OQIB 2CK3D 1D8TA 3VMMA 4GX1A 2XNJA 1QHSA 2JIWA 4FCWA 5FYDA 2QPAA 2C2XA 2BG9A 3AVSA 2H48A 2BELA 1ZM2A 3N3AC 5J63A 1D5WA 5ECYA 4L6AA 1O9HA 4XYLA 3H9BA 4PZPA 3OA0A 2E9XD 3P96A 1F5NA 3K4HA 5ALIA 4W8GA 3JATB 2FN9A 4BO3A 4OHRA 1KBOA 4JMPA 3GCXA 1E5QA 2FPLA 1I7QB 4CEHA 1G8KA 4ZVRA 3HEAA 2Z5FA 3EHDA 3Q0EA 3DL0A 4IIJA 5JDGA 1XZEA 3JQAB 4TKVB 1PJ8A 2OAP1 4PGFA 2H4ZA 3G2NA 3NGMA 3MS7A 5IEBA 4OI4A 4I5DA 5CB8A 1PFGA 3RBXA 4NKRA 2X9GA 3JZMA 1HF3A 2OC4A 4D1YA 3G8YA 2ZI7A 3P19A 4K9PA 4AJ2A 3AEFA 4BGEA 2K7FA 2WW8A 3HBNA 3I92A 1T2EA 4B43A 4JL8A 2REQA 1USGA 2O06A 4ZI2D 1BC5A 4AX8A 2CHQA 4IMJB 4LNUA 4L4RA 2B6HA 3PGXA 1HF8A 5DGXA 2X0RA 2GK4A 4JLEA 1E4EA 3DC2A 4YP1A 2EZ4A 4MITA 2QL5A 5MDHA 4WERA 3RIXA 1K8XB 4HXEB 4K9NA 1G1MA 4MVJE 3ECCA 4K28A 4KNVA 5BRAA 1FL9A 4JVNA 4K6FA 2AW5A 1E18A 4RK7A 3A2LA 2VNHA 4ES6A 4GR4A 4AQYT 4GPAA 2I71A 1HUQA 4OJMX 5D7NA 1BIFA 1OEDE 3FA2A 3ETVA 3ZYCA 4UFPA 5FBKA 2JRCA 4G6ZA 1RLIA 3C6KA 4X1IA 4RVNA 2EZUA 4PGHA 5ALNA 2VRCA 3AR5A 3UMJA 4CM4B 2Q27A 4JR2A 4B44A 4B7CA 1BMFD 3T3DA 4UMEA 3WIUA 1FNSA 3ZN2A 4WBNE 4ZZBA 4DAOA 1A3CA 5AM0A 1XLWA 2PLRA 5C7YA 4N54A 3C5CA 4U2CA 1ZRMA 1WMDA 4DDHA 4J0HA 4YT0A 1ZHOA 4MWBA 4L9RA 3EGDB 3UWSA 3TN7A 1ISMA 1EFHA 4Q21A 5I7HA 4B80A 5EHXA 3U13A 3B1KA 3UH1A 4DIOA 1S2DA 3MMXA 2CLSA 1TTPB 4QDOA 4BMZA 4U63A 1U81A 2K2WA 4YLYA 2ZK7A 4RENA 5HIMA 5I6DA 2YKGA 2QGFA 5JJKA 1DMRA 1IYZA 2I76A 4XKJA 2DXIA 3WMEA 4ECAA 2EG9A 4ZRMA 1ST2A 4FYIA 1G38A 2ICAA 2OO3A 3BCRA 2QG6A 1GSOA 2NZJA 2HM7A 3HUEA 4ZVUA 5KO2A 1SM4A 4DA8A 5CM2Z 4KQJA 2XYVA 3DAGA 3QG1A 4ESEA 2YVQA 5IJZA 1NXWA 2QDKA 4LZZA 1E9VA 2ZTLA 1PGNA 4LRWA 4GG1A 4C04A 3O2SB 5LQJA 1YRQA 1WULS 2H7CA 3OU2A 1P9LA 4TM7A 3DL7A 5F5NA 2PS9A 3EXIA 1R50A 4M22A 3MTQA 2DC1A 3DXZA 1JEQA 2CLLB 2Q6KA 3F6PA 4Q24A 4NMLA 4AKEA 1L4NA 3BXPA 2VYND 4D45A 4N5IX 3SBDA 4JYPA 3C48A 3CVXA 4X91A 4CMBA 1P31A 1YB1A 1S3GA 1ZEJA 3BC1A 1L4HA 1OT5A 2K6GA 2OLKA 2C5GA 2OGZA 4D44A 1YBHA 1ZFNA 1OI2A 3ZQKA 1HNNA 4WOBA 4CLEA 2ZCUA 4YDHB 2R8XA 1Z38A 4TS4A 1OLSA 5B7QA 1GRVA 2XAQB 3LOUA 3DM9B 4EPTA 4OA8A 4BVJA 3VOBA 2ATEA 4HDKA 1JNXX 3QUSA 1VMEA 2M6RA 2CZCA 5EHIA 2V0CA 1XWIA 3ZY2A 5A5EA 3V8EA 2ATIA 1T6YA 2P4UA 4NFSA 1LBTA 2QXTA 1FMJA 1PCXA 4QNMA 1J1JA 4G84A 3NGLA 3LO5A 3G5TA 1TXGA 5DI3A 1F0YA 1DU2A 5EYPB 1UKEA 4WOCA 1Y63A 3TPZA 3RVLA 1UPCA 2DTDA 3O3MB 4GWKA 2XUZA 1GV0A 4LZJA 5BNFA 1V9DA 1V3UA 3A1SA 1Y7TA 1TK2A 3RPEA 1BJRE 3KFWX 4MA5A 3E7WA 2R1TA 5JDCC 1MAHA 2L17A 4PW8A 4GDFA 2GF2A 3MUNA 2XBMA 3H37A 1THTA 2W4XA 4MRAA 3AKZA 4C0JA 1B3RA 2PQ6A 1M83A 2DLCX 1PX0A 4LC1A 3UMYA 4G09A 2GBLA 3C74A 2C84A 1WCYA 4NARA 1HE3A 3C45A 3PUZF 5KYUA 1F4LA 1XXHA 1D0ZA 1RKXA 1S4QA 1UT5A 5FAXA 4XPZA 3N9IA 4FINA 4XVQA 5CMLA 2OENG 3LXXA 3F74A 1JXAA 4GRAA 5KQLA 4Q00A 4KAXA 4Q5IA 1ZA1A 3A7MA 4M1MA 5DXAA 3ZE1B 2RK6A 1NQUA 1M2KA 5MGBA 4YREA 1R4NB 4OKNA 4AS1A 5JS6A 1SHUX 4JCCA 2CLYC 5TXGA 3HYLA 1D1CA 2DHDA 1DWOA 2GT1A 1NVGA 1HFEL 2PUHA 3ZDYB 2V98A 3RJMA 2HMUA 2BJWA 2H7XA 4B2PA 1JH9A 1GQYA 4E5MA 3TZKA 1BX1A 4TTSA 4U74A 2G9QA 3AE8A 3DKIA 2DCMA 3R2JA 2R6AA 4BP1A 3F6RA 1Y9ZA 3K6JA 4II3A 4PFJA 1S9HA 3ZDRA 1JA0A 1F06A 1F6WA 2AJTA 3I37X 1PS8A 3ER6A 5F21A 2HMWA 3TQQA 2A9JA 4OU5A 1CK4A 2FX2A 3TLCA 5E0OA 1V9LA 2Y1DA 4UVHA 4V0RA 3OMWA 1Y3DE 5L3BB 3U4GA 1DFGA 5TQ0A 1XR3A 4JELA 1T29A 1W5SA 1NQ5A 3IAXA 4IRMA 5JBIA 4JBHA 3FUXA 4C0SA 3LC1O 2XXBA 1E7PA 1ODLA 2PT9A 2PGJA 3JYLA 3JQAD 2BKUA 1CZOA 4TQ9A 1RYZA 2BFFB 1GGHA 1PQWA 3E3LA 4YY3B 4L50A 4NOJA 1WW3A 3R0JA 1XZKA 3TRDA 2Z43A 4FI5A 3O4IA 1X3LA 1AHHA 1CYEA 5IAAA 1D9ZA 4GXRA 5JDLA 1Z8NA 1TB4A 4L9SA 2OCDA 3PI7A 1E1HB 2O3QA 3EDCA 4ZOLA 4UFNA 3VNUA 4A5OA 3EF1A 4G0ZA 2VR1A 2DBZA 5AVYA 5IM4F 4O3MA 3MJCA 4D4MA 5HQ3A 2ZQZA 4O1HA 4JB2A 2H7OA 2X0LB 5ETJA 1B26A 1EU1A 2REXB 1EINA 1WB5A 1I80A 5KMGP 3AY7A 3JARB 4ITVA 1Z34A 1NOIA 3FRJA 3OKCA 4AB1A 4MV1A 3IP6A 1IULA 2BM9A 1XC7A 2WG2A 5CG1A 3SDZA 1V35A 1DCKA 4G65A 4HG2A 2Y2VA 1W36D 5B4VA 3ROGA 3ZSTA 3LLUA 2EIXA 1KI6A 2X68A 1NYRA 3ZWYA 1GFIA 3W2TA 1KJIA 1Q1ZA 5A03A 2AG6A 3ZI0A 3UAWA 4DV2B 1IEWA 2CXFA 1O0CA 4I46A 5DVZA 5HVNA 3MEQA 1YTUA 1BQ4A 3GHHA 3TFWA 3WBKA 4MP6A 1EZ1A 1XJQA 2ZBUA 2ZYGA 4HPXB 4LJSA 1RRFA 4MPTA 3GQBA 3ZG6A 5JQGF 4F4FA 1Z0FA 1KFBB 3ZJVA 3FVVA 4IDCA 2DB3A 4LRSB 4W4TA 3OPXA 2K4MA 3ZHVA 5LB7B 3ROXA 3W4JA 2XQ4A 4O2AA 3BH7A 4MPJA 1MCZA 4CIAA 1MJ5A 2L3LA 5TF4A 4Q48A 4HWHA 4MYSA 4MUMA 3RYIE 3C0KA 3AW9A 3G17A 1KJNA 3K5WA 1RM3A 3VR2D 2G6BA 2P9GA 4BX2A 5ENVA 3GMTA 3FWPA 2F4NA 3MJDA 3Q5XA 3F7NA 5BQPA 4LYEA 4V0KA 4JBGA 1T36A 4UE6A 1EUZA 3TZQA 3PNLA 2P6UA 1GVNB 3E22E 4LF7T 3ABQB 2NSYA 5K0GA 4RCZA 1N57A 4MEJA 2BCGY 5AKZA 3W3AD 1Q20A 1J90A 3HP4A 1VPVA 4AP6A 1I2MA 2WM9B 3MT7A 1G1AA 1PR6A 3MCVA 1GA6A 3R6LA 2LNDA 3AQIA 4BP9A 1U1GA 5KQMA 3AFMA 4F92B 1I2DA 4R1QA 5DOVA 2GVZC 4IDHA 5KHOC 4CQNA 1MXHA 4PYIA 3V80A 1JSCA 3KLNA 2OXTA 1OH8A 4I50E 2AHOA 5JSUA 2AF3C 4A4DA 3PNSA 1GN9A 2KPOA 2ZTMA 4F38A 1GAWA 1U65A 3NTOA 1L4MA 2EJBA 3FZGA 5FEUA 2Y9MB 3BXGA 3IBTA 5ADVA 3PU3A 5DYNA 5DHSA 5EPOA 1N77A 3I1YA 1ZMBA 3H1GA 3DEKA 5DXJA 4EUEA 3M3PA 1OX6A 1C3OA 4QKNA 3D59A 3LV8A 5DT9A 1HEUA 3RJ9A 2GPWA 1U0JA 2ZJBA 2RGAA 3A6HA 1YK0A 1KJ8A 4DV6B 2C3UA 3WNCA 2CF5A 3RAGA 1G2IA 2UZ3A 3UEOA 4ESOA 3COVA 1SU6A 4TTPA 3LHIA 3ZCPA 1QYXA 3F96A 1OHHA 2PRYA 4LEIA 1E98A 1A8IA 3MWYW 3CF2A 4KI7A 1YOBA 1GG5A 2X8LA 3NR2A 1W8DA 2YMQA 4QC2A 4C7BA 4EO9A 2O19A 4KJZA 3P4SA 2REBA 3EASA 2CVHA 3B9QA 3ANTA 1VM6A 3SRZA 4Z90A 5C18A 1R9NA 3NHMA 5EZ6B 1W0KD 3AFHA 2X7HA 2CEAA 2K87A 3L1IA 2B0JA 3T7EA 1WDTA 3M6WA 3NONA 5B7GA 5K3DA 3H4IA 1BW9A 3G9QA 2D0IA 4US1R 2R97A 1NN3A 1NXXA 1U8EA 1VJTA 2GHRA 3JQBC 4OGFA 1UEIA 3GCGA 1BRMA 4E5SA 2P2SA 1R6TA 4XPIB 1GP2A 3I64A 3LW8A 3NDBB 2YV1A 1ZIYA 2H4JA 3FXEB 3RTCA 6YASA 3TCNA 2B7BA 2XCSB 3ZZ1A 3WC4A 4H6PA 5J23A 3QXGA 4MTCA 1Q6ZA 4GYYA 4LX0A 2YFQA 4F04A 4NONA 5D7BA 3MERA 5F52A 3GJ8A 1OLUB 3BERA 2VT7A 2X66A 1CUGA 4UJ3A 4YH1A 4NBNA 3QM1A 4HEJA 5TF0A 4I5IA 1AGNA 1FVFA 3KFLA 1WG8A 4MK4A 4ZGGA 1SK9A 1L2TA 2FX5A 4RD6A 2OAEA 2ST1A 4Y2RA 4XZ3A 2NX2A 4M6WB 5FV4A 1JHQA 1WSBA 1XA0A 4DQXA 3P5SA 4KGVA 1YZQA 4U6NA 3ESQA 4A15A 2QP4A 3OOHA 3JYQA 3O2QB 3IDZA 4HZUB 4GPTA 4C1NA 3L2OB 2GEJA 2WK1A 2V7QA 3D0TA 3WLIA 4Z86A 4S0XA 1N1EA 2HKIA 3RRWA 5L3QB 4LIPD 4O29A 1GKYA 3A11A 1YGPA 3RRYA 4FB5A 1JTEA 3LU1A 4OVKA 3WICA 3MKDA 1OJLA 4EAHA 2G36A 2ZBDA 3FGNA 5T57A 4NYJR 1SKYB 1SUCA 3OOEA 5EY5B 1M6VB 3AE3A 1YE8A 5CCBA 2DUNA 2I4OA 1JWLA 5TJ9A 2PBLA 3CZ4A 5A2QA 4LS3A 1KDPA 1AUXA 3DE4X 5FVKA 2AFRA 1RE0A 1H4TA 1O7JA 1V5IA 4KWEA 4QXQA 2PR2A 1UJ2A 5LC1A 2NW8A 1XZJA 2XNDA 1SKMA 4NF2A 4LG1A 5A0TA 1Y7PA 2QX8A 3OZIA 1I4WA 4CMIA 3QLTA 1VLZA 5HM8A 3PFNA 4RULA 3DULA 1SEVA 2I22A 4LJ8A 3B7GA 1XTVA 2F3UA 3OCYA 3UMSA 5AP9A 3I42A 1JE0A 3IVAA 3WGUA 1SHJA 4ODIA 2O8FB 4ZQHA 2P1RA 1H9AA 3O8NA 4OX9T 2P9BA 2W6JD 2KMFA 1RLOA 4KPUA 4UPVA 5ALTA 2R7MA 2NSLA 3OTWA 3OT5A 3IHLA 2GILA 5BMOA 1FQKA 1XNGA 5JAMA 5HBRA 2GMWA 4P33A 3F7OA 1SFRA 1HSOA 5K20A 2JJYA 2CDNA 4X94A 1JEYA 2BFCB 4CN6A 1LNZA 5C32A 1ES9A 4E11A 2QN9A 3FR8A 3AA7B 2W0MA 3QPCA 2ZB2A 3DF9A 3SHVA 4DQDA 2AYYA 4MGHA 5AW3A 4C07A 3C16C 2HPJA 4RC9A 2O05A 1RQ7A 3R7WA 3V4RA 3O4RA 1YKSA 4MVJG 1NDQA 3L92A 2R79A 2INGX 3N0WA 1LPMA 4ZYWA 3H99A 2ZRGA 1SBIA 4UEWA 3SXUA 3DE7X 3SI7A 3N5CA 1FFBA 4QARA 1U7ZA 1YS9A 5LOVB 2XA9A 2FMXA 1YS2X 2W0GA 3VHLB 2NXWA 4NABA 5GAJA 2V97A 2BV3A 2IF2A 1R6AA 2QY9A 3QLJA 4B8ZA 4G4GA 3TOVA 1GGVA 4OK0A 5DBOA 3F7TA 4V0ME 2ZCJA 5IVPA 1BCRA 3OTGA 1T0BA 3IXLA 3I9JA 4JSTA 2X9HA 4MA0A 1GUYA 3QITA 2OMKA 1YAJA 2ZPTX 4Y2VA 3I9MA 3TSAA 2IK8A 4TUYB 3NX4A 4JMLA 5HQJA 3CT6A 5JSQA 4AG5A 1E7WA 3A6KA 2RCYA 1DIRA 4ZS3A 1Z2CA 1YRBA 4UTNA 5DGHA 5DXFA 5D6OA 1H22A 1J42A 3FH0A 4FYYA 2GCNA 1KEUA 4I99A 4IJ6A 2PQ0A 4EHDA 4R2IA 1U2QA 4XGKA 3ZGXA 1WUTA 3I8OA 3TR5A 1IBKT 1EWRA 2IQIA 1CEEA 2P4HX 3UQZA 3KPWA 2VLBA 2N3ZA 1G2PA 2JLWA 5DASA 1RRKA 1WYBA 3ESRA 1V6CA 3KQNA 4F3KA 1O4VA 4QU0A 4NS4A 3UT5A 2HI0A 1U8XX 2I2WA 4M9RA 3E8MA 3L5KA 5EXXA 1UAAA 1A1SA 2QM7A 2J31A 3PRHA 1NXTA 1DVRA 2X6TA 4WJZA 1IVSA 2X40A 4E6PA 2BDEA 3ABIA 2ZSIA 2C9OA 3DZIA 3RQIA 5DHAA 3M49A 4ESHA 1G5TA 3GOHA 3DE1X 2ZYUX 3WQQA 4BBJA 3PTZA 1TU4A 3T0GA 3PTRB 2D5UA 4YUWA 2YJNA 4LW8A 4LWZA 2YRXA 3SVTA 5AWFC 2NW7A 3AEQB 1E3WA 4F5YA 2W83A 5IBRA 2FDRA 5T67A 4PM4A 4DKXA 2QA7A 3S1LA 4JVOA 1LI7A 1AZSC 4PLWA 1IBLB 2GF0A 2WM2A 4U7YA 1JPVA 2UXCT 4EYSA 2C7RA 3RWOA 5CAEA 2CHFA 3GDWA 2XAHB 4MRNA 3FPGA 3IF8B 1YQ3A 3E7FA 3GRFA 3FHNA 4RMNA 3PQ4A 1N32T 4ZVMA 4EJSC 3SWHA 3B3QA 2M6BA 2C5BA 3BF7A 4TYNA 4R9VA 2LIPA 3SF8B 3K9LA 1C81A 3T7TA 3N2KE 2WV7A 1I5RA 1CFJA 1LWOA 4HB3A 2FP3A 4ZPJA 1YC2A 1T4CB 3W5BA 2E5WA 3RRFA 3KQOA 5HPYB 3O2NA 3E9YA 3FTPA 3GEIA 5C4MA 4J90A 3IALA 4L7VA 1FJ2A 1CZKA 1A0OA 1EWQA 3CZ9A 3CUWA 3MTEA 2OESA 4ME6A 1I6WA 3IIMA 3DUFB 3O1IA 1J5PA 2ZB4A 4PJLA 2CL6X 4FFPA 4GPD1 2WJ4A 1OZAA 3N75A 2FSVC 3SYKA 4CQMB 1E9CA 2DBQA 3ZYLA 2WNHA 4DPLA 4PZUA 1P6QA 1ELOA 2DULA 1N6NA 4CKEA 3AFIA 1Z0IA 2YBDA 4JY7A 5GONB 2HLDD 3FCYA 5DDIP 3EOBI 2ZWOA 4DCMA 3L7AA 4B3DA 1NVDA 2A0XA 1U5AA 4ZJYA 1DJLA 1M2OB 4QFDA 1EFRA 3K1AA 5EIOA 3AUUA 3T0FA 1R10A 1BX0A 1YVUA 4EW1A 4C6SA 3VAZA 5IU6A 5JEDA 2C96A 1XMQB 3TZHA 2L42A 1G6OA 1KMIY 2FZVA 4RD3A 3WAGA 2R6HA 1YS1X 1E3LA 4BL5A 3VISA 3HUFA 5F3RA 3VZQA 2H4HA 1MF7A 5G40A 5EWLB 1JR3A 1YRWA 2OP1A 5K8LA 2ZT7A 3K0FA 4HB4A 4MUYA 4KEAA 1JR2A 1OZFA 3QVXA 5LQAA 4BWGA 2R85A 4ZVQA 1NC1A 4QODA 1NJ5A 3K2IA 3ZKRA 4LSMA 1WB4A 4EB0A 3TFOA 4NV0A 3PEWA 1N0HA 2YN6A 2VH1A 3FCSB 3T5BA 3SF0A 4F21A 2IODA 4UTXA 2OK7A 3PUIA 2UUCT 1ZVJA 2AFHB 4YNBA 3ROQA 3AT1A 4X65T 1CERA 1DC6A 5AW1A 4JP1A 1H0HA 5LWHA 5KBYA 1LY1A 1Z68A 4URFA 2BVMA 4X3OA 4GL4A 4F84A 1KOLA 5JHHB 1EZ4A 1X80A 1I3KA 4RAOA 3AY0A 3NYIA 3GFFA 2ZJ6A 3ABOB 2YASA 3FPBA 1TLTA 3DYIA 1PGPA 1X1QA 3QB5A 5JU6A 2CHEA 4HFJA 4F6RC 1Z4MA 1T9KA 5A3RA 2VP5A 4RVSA 2JL1A 3CTMA 4QOJA 2WAOA 1I1OA 3OZRA 5BN4B 1OD6A 4G63A 1YQTA 3F0TA 2DP4E 2HSDA 3HY6A 5JT1A 5F1KA 4ZO8A 1WHTA 1VP9A 4HY3A 5AI8A 4TMFA 4L3WA 3G1UA 5AQEA 2JZNA 4WK2B 1EVQA 2QLTA 4B3IA 2RHMA 5A9SB 1I30A 4BXOB 1QR2A 5EK3A 1OC4A 2F17A 3FTCA 1ZGAA 4O2RA 2YHAA 4GRIA 2FZEA 1MQSA 2VDJA 2CLFB 2CJWA 1CUFA 4OBWA 1XG5A 5HHTA 5J2TB 1V26A 3AR9A 1HNZB 3GDHA 2CHNA 1ZC3A 1U9IA 3LXRA 2VP2A 2PRKA 3I83A 4GWLA 2A0KA 1G5HA 4RKRA 2WYUA 4XM2A 2X1HA 5ILQA 4B83A 3JZIA 1P1BA 4HWCA 4AKIA 2O8CA 2ZBFA 3A6FA 3CWQA 1VPWA 3J80A 3DAYA 3GFVA 2J3MA 4ZN6A 5MN6A 4JT2A 4JUAA 5H81A 3OYXA 1AO0A 3TAUA 1K06A 3KG2A 1C7FA 2E87A 4MW0A 4X8LA 4AZ3B 4B40A 4PAOA 2YFHA 3GA5A 2L9QA 5LB4A 4CIVA 1N5MA 4FCTA 1MMAA 3QEMA 3A6JA 2NZYA 4LSWA 4GYKA 4C4OA 5EJ6A 3L79A 1IE3A 2LRKA 4DARA 3A3OA 3QEBZ 1JF8A 1G5FA 3CCBA 3K3NA 1RAEA 2WJYA 4YMWA 4D4GA 3NVOA 1KVQA 2PS0A 3IO3A 1FSZA 4KX6A 4EUFA 4DADA 2ECKA 2WJHA 4H9QC 2SPCA 4ZMBA 3I1IA 4ERXA 1M5UA 3VNBA 3VSCA 1OB2A 1S3FA 4FNOA 3TGWA 2PJZA 2XXJA 1NN1A 1XZBA 2HD4A 2P7IA 3E1GA 1VJGA 1GQ2A 5DEIA 3A70A 3ILVA 2Q3LA 1I2CA 5IDWA 2X7XA 1DEXA 3OCWA 3BWDD 4YT5A 4IG9A 1DO0A 2NPFA 5JVDA 3DT6A 4Z1OA 2Y4NA 3UUGA 5KWEA 3M3ZB 4XD2A 3S2GA 1TCVA 3N9MA 2AJCA 5A3SA 4UNRA 1VLJA 4ZI3D 5EZYE 1M7GA 3RK4A 4B7XA 4AMBA 3QHAA 2YUTA 1C2TA 5ALJA 3JALB 1R15A 3RAFC 3U1TA 1QLBA 3QRWA 1X94A 2RDMA 4KZKA 5LZ4A 2ZTSA 2QTAA 3MJTA 4E70A 4O5AA 5C1BA 2KI5A 5A6VA 4QOIA 3ACBA 2PU5A 3D7LA 1TVEA 3C7CB 4RGYA 3BWEA 5AOAA 4C7KA 2JJ9A 4FEEA 4R69A 5SY6A 4JP5A 1VMKA 3CSDA 3TAXA 4XYEA 3TKYA 4ZARA 3SBXA 1WRDA 1U94A 2CBZA 4YQYA 4GXQA 4NEQA 3L49A 4R98A 4AF7A 3T54A 4EQ6B 3DOOA 3R3YA 1X6VA 1VL8A 2CBXA 3NC4A 1P3JA 1P33A 3MWDA 4GL2A 4AZWA 4EYOA 2Q6OA 2B5WA 2WYWA 1IOLA 4BJ5A 4AJEA 2Z57A 4LHZA 2CXPA 2DAPA 3LOQA 2F4VT 2FXVA 3I3SR 2HRRA 2IIPA 1LRZA 1QRSA 1FYEA 1UC4B 3HMKA 3NTUA 1U0NA 5KWJA 3PUYF 2WZCA 2ZRAA 1V8PA 1NRWA 2QYSA 2G0UA 1XDPA 1NY5A 4EIWA 1UOEA 4EAAA 3BN3A 3AX6A 1QK3A 2D1YA 4MALA 4F2PA 1TJ3A 1U2GC 3ICEA 9ABPA 2W6NA 4I9FA 4DWWA 1WXIA 4RLSA 5BV2P 1CUHA 4EBFA 5JANA 3I4LA 3HKEA 2OZEA 1RMYA 4DWJA 2I8CA 5FLEX 1TT5A 4QOHA 3K0CC 4C0XA 4CKBB 1VPEA 1K3TA 4GYWA 2RPAA 3VJRA 1UP6A 1R5OA 2FUG6 1JG2A 5CXUA 1QO7A 3S8EA 5M29A 1ZD4A 5L3DB 1EM8B 1YIOA 1C3EA 3IUEA 1HQYE 4D5EA 3LBXA 1SVUA 2ZSBA 3LUFA 4JBWA 2CCGA 5MFPA 4EOGA 1ULAA 4TWHA 4LZNA 1NJFA 5HF9A 4N8EA 3AIKA 2QZPA 1NUUA 3IAAA 2IVFA 2IYOA 4N03A 4E30A 2YVAA 1VJRA 1NTOA 1VHLA 3INYA 4CQMD 5JSZB 3OPYA 3H65A 3I9V6 4GKJT 1ZH4A 3F6BX 3KE8A 3FPSA 4QM6A 2HOQA 1UINA 1WL8A 3PL5A 1GQQA 1IBSA 3Q87B 4RHYA 4RHEA 2ZRMA 2I62A 1CIVA 1LQ2A 5BVHA 2YMLA 4AUEA 3TQTA 4B74A 4EEZA 1L5OA 1MLDA 3DCYA 4BKQA 1JLRA 3W5VA 2FN8A 2N2NA 5LP6E 2ZROA 3K8OE 1P29A 3K0AA 4F86A 4H9RC 3CLRC 1JIVA 1FIUA 4GLLA 1VGVA 3LCRA 3UHJA 1MRNA 3D5QA 3FVRA 3AFOA 3ZCJA 1EG2A 2DT5A 4KQKA 3IPLA 1X1DA 1U3CA 2ZRKA 5BP7A 2OFPA 3BGOS 1AZWA 4ENQA 2IU6A 2JD1A 3PJAA 4BTVA 1G8SA 1MZPA 2FF5A 1YJQA 2VSOA 3JRXA 4HDMB 2D3WA 1JI0A 1FX1A 2ONZA 3RFFA 4WOJA 4IQFA 2JIZA 5ARCA 3R6GA 1KEKA 4CI1B 2EKZA 2E21A 2UZAA 1MOSA 2VJOA 5BXYA 3WLEA 1M34A 3S6JA 1LKZA 5B3KA 3O9VA 2ZSJA 5A4IS 1GADO 3MRVA 4KQFA 3CCFA 5IULC 5ILGA 4FGLA 1T0PA 2OCBA 2FFBA 4QIHA 5C51B 1UK6A 3HB5X 4GZLA 4D9FA 2B92A 4RFSA 3Q3GE 3F9RA 1JKJB 1WCIA 4DIEA 2E5LB 3O3CA 4ZEVA 5FJIA 1XFDA 1XU7A 1PV2A 3SBOA 3HDYA 4O4JA 1Q3TA 3AJAA 5KDMC 4G56A 1WXHA 4ZOAA 2XZOA 5JNWA 2A9OA 3CXRA 1U8UA 2OV3A 1VL2A 1EFCA 4H1WA 1LTHR 3RH3A 3LA6A 4WXPA 3EPKA 1QQAA 4JV5T 3UAOA 1DLJA 1NG9A 3WFZA 2NLOA 1ADJA 1CUBA 1JKMA 4PYOA 4HFCA 2O8BA 5TS2A 1N2CA 4J7UA 1IY1A 5HZKA 4Z3OA 3RCBA 4RY0A 4BVAA 2RGCA 4ENUA 1C4OA 5EA2A 1PQYA 2GVDC 4LRTB 4QTTB 2WINI 1IOZA 2DUMA 2HU8A 1UJMA 4AG6A 1NF9A 4F2GA 2PZAA 4YEDA 2C29D 4CTNA 2GN9A 2FPGA 4HD8A 3NM4A 3TJZA 2FF7A 3VKFA 1HL7A 2QUBA 1UDRA 3NTLA 5DNAA 3UK7A 1C29B 1OH7A 1V45E 3IV9A 1XI2A 4ISTA 2BBJA 2W2UA 3HR8A 3KBBA 1RM5A 1L5HA 3WGJA 1Q12A 2OHXA 3DWIA 3ED1A 2EHOC 4MUGA 4B45A 2GM5A 4KIWA 4Q7QA 4K3VA 3MXOA 5GJCA 2X9VA 4QICA 4BE7B 1HFKA 5HDBB 4BO9A 3A14A 3QV2A 2PZEA 4KYIB 3EAMA 4YFSA 4YTPA 3RYCB 2UXBT 2XIQA 5FOTA 1J21A 4RZ2A 1P0MA 3AR2A 3CG4A 1ODJA 4JT8A 3N9PA 2MYNA 2NU7B 4KMRA 4NBRA 1CUUA 2VQFT 1RXEA 5EFOA 1SCAA 2IHVA 3OHSX 4KHZF 3AV0B 4X44A 3CEAA 4WN9A 3ML1A 5LBUA 4BE9A 3KXLA 1U3GA 3M1AA 2KXPB 3TBHA 4ZYYA 4UXJA 1BZYA 2Q5EA 4N8DA 3PBKA 4ERNA 4C6RA 3HJAA 4ENSA 4DCTA 4ZVTA 1JGTA 4K46A 1DXYA 4QBHA 3N28A 5K3SA 2QPOA 1IXYA 4IOKA 1UZLA 3X0DA 1PWYE 4ZU3A 1K6MA 5A3JA 2C8KA 2JGDB 3D0KA 2I3BA 3T7AA 3CA8A 4YACA 5DCLA 1O0SA 2X13A 4I4NA 3EA0A 2XSZD 4QYWA 5FL1A 4N18A 4RTQA 4WPGA 3UU5A 2PKRA 4CRWB 4R54A 4L3OA 2O6LA 3KSBC 3KZMA 2ZVPX 3IGFA 4A10A 2I8LA 2BMAA 3D7KA 4AYXA 3L6BA 4Q1VA 2ZSDA 2JAHA 4LRXA 4PYJA 4PG4A 2FYTA 3FLAA 2IEDA 2EFEB 5KYTA 4CUKA 4Z1MA 3VHQA 4JL6A 1Z8HA 4J3JA 2XMZA 4EF5A 3J7TA 2A5JA 1JG6A 3HBAA 1MHTA 5I47A 1Y9AA 2BTOA 4B3RT 4XW2A 1FIOA 4AQGA 1YF3A 1W36B 5AQUB 2O8VA 2AL7A 4AS3A 1Z0AA 2KLBA 3V7FA 1QGUA 3KUDA 3TLJA 2YY7A 2VKHA 3H1FA 2ZE7A 5F5LA 3ITEA 1IZ7A 4GPBA 4X8OA 3SOPA 4A16A 4DGQA 2GK6A 5HCJA 2H16A 3NS7A 4MUFA 5FBLB 2AHRA 5K8IA 1AB6A 2H1HA 1JAIA 5K7SA 2PJUA 3IILA 3GP3A 3U7HB 2P9CA 4COFA 1HDRA 5HKKD 2YYYA 3D4LA 1D0IA 2WC1A 2YC4C 4DDMA 2VNSA