4PAGA

Abc transporter solute binding protein from sulfurospirillum deleyianum dsm 6946
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
323
Chain Sequence
ESRTFLDVSNKPIVLPEHITRIYGSAPPISFMIYVIDDTPLIGVNSPQTNKDNNNGEKFLSKHFMELPILGGWHGNNIPNLEAILAAKPDVIITWDTPLLNEKTAKDLARISIPALKVNIDDSQNYPEVFRYLGRVMQKEERANALANMAQTYLDELKTFVASIPEKERTKVYYAEGDFGLQTECDRSFHSEPLALAGGNLVHKCVQNSVVGLQEVSFEQIILYDPEVIIVQNPTFYKTVFREKKWAVLKAVQNKKVYLVPKSPFNWTDRPPSFMRILGAHWIASKLYPTRYPYKIEDKVKAFYQLFFGVELSNEDLKTYFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ABC transporter solute binding protein from Sulfurospirillum deleyianum DSM 6946
rcsb
source organism Sulfurospirillum deleyianum
molecule tags Transport protein
molecule keywords Periplasmic binding protein
total genus 105
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4pagA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA03
3LHSA 1MIOB 2PRSA 4OXRA 3AETB 3MWGA 1M1NB 3AEUA 2AFHA 2OV3A 1H1LB 4WZBA 4NNPA 3AESB 2XQVA 1K2VN 3AEKA 3AEKB 3NU1A 1G20B 3ZKAA 5JOQA 5KOJA 2XDQA 5FLYA 4H59A 4UTOA 4MO9A 2M6LA 5B58T 3AETA 1QH1A 5CX1B 1MIOA 2ETVA 1PSZA 3MD9A 5JG7A 3AEQB 1FP4A 3AEQA 3MINA 2WI8A 3MINB 1M1YB 3GI1A 1ESZA 3HXPA 4OVKA 4UDNA 5CX1A 1QH1B 5JPDA 4FNAA 2MINA 4FKMA 1KAEA 2XDQB 5KOHB 5AFSA 2XH8A 3EIXA 1KARA 1N2ZA 2OSVA 3AERA 4TKUA 3TNYA 3MFQA 1XVLA 4MDYA 3U7QA 3EIWA 4TKVA 1QGUA 3HJTA 2QI9F 3AERB 4GICA 4TKUB 4PM4A 3G9QA 5CR9A 2AFIA 2Q8QA 4WNAB 2X4LA 2WHYA 1M1YA 1PQ4A 1L5HA 5KHLB 4INPA 4G07A 4WZAB 3CX3A 4XPIA 3PSHA 2PS3A 2XY4A 5GGYA 5M2QA 5I4KA 1M34A 4HN9A 1N4DA 2OV1A 5KOJB 2OGWA 3R5SA 5BVHA 4FILA 5JJ5A 4H0FA 3HH8A 1H1LA 2AFHB 4WESB 2R7AA 4UTPA 4WZAA 4OXQA 1G21A 4WN9A 3ZK8A 2O1EA 4MLZA 5M3BA 4CL2A 4NNOA 4UDOA 4HMOA 3BE5A 3PDIA 3K1AA 4ND8B 2XUZA 3K1AB 4ND8A 5BVGA 4B8YA 3MWFA 1N2CA 4INOA 4MX8A 4TKVB 4PAGA 3R5TA 2PS0A 1QH8B 4IRMA 4G09A 4WESA 5M34A 2RG7A 3UJPA 1N2CB 5BVHB 5HX7A 5HDQA 1M34B 4K3VA 5BVGB 2YNMD 2MINB 3ZTTA 3BE6A 1L5HB 2PHZA 2XV1A 4LS3A 4WN9B 1G21B 4DBLE 3TLKA 4FI3F 3LI2A 1K0FA 3ZK9A 2Q8PA 1G20A 3AESA 1EFDN 4WZBB 3PSAA 1QGUB 1M1NA 3AEUB 3TEFA 4HMQA 4LJSA 4XPIB 3U7QB 2YNMC 1QH8A 2R79A 4N01A 1N4AA 5GGXA 4HMPA 2AFIB 4WNAA 1K7SN 2M6KA 5KOHA 1K75A 1KAHA 4M7OA 3PDIB 2PS9A 1FP4B 1TOAA 3ZK7A 5M29A 4BBPA
chains in the Genus database with same CATH superfamily
1IZNB 4MVJH 2FG6C 4OQZA 1DIGA 5LMUB 1D1PA 3UFEA 2O5RA 4H6PA 4IFIA 3Q5WA 3VVCA 1IXKA 2AN3A 4F60A 2PU5A 4XRGA 4NIQA 1RQGA 1YR2A 4MUNA 2M6LA 1GSAA 4JI4B 4Q7MB 3TLSA 3QELB 4RXTA 3IEIA 4D7AA 1QANA 1DAGA 3N5LA 1G7TA 1UBRS 4EJ0A 5GINE 1B14A 3DO5A 1XIVA 2WS3A 1GYRA 3KR1A 3FCXA 1NVWQ 3CX4A 1DC8A 4WUVA 4IDAA 5K2MA 1MV5A 2ZBDA 1VIMA 1ZK4A 2X0LB 5TQ0A 1NW6A 1W35A 1SJ9A 2PLRA 1D3AA 2NTXA 2MJLA 2O2ZA 1EVYA 1THZA 5KAMA 4F38A 1I4DD 3LO8A 3NNSA 4EO7A 3IEMA 4RZHA 1XRNA 2IXTA 3ZY2A 1OASA 4D0SA 1AH2A 2WFLA 3CTPA 5IU6A 5DHRA 5EUMA 4DWJA 4XWKA 3VPHA 1H8EA 3ICOA 4NH4A 2FX2A 2FSVC 3B1VA 3H0KA 2RAVA 1IIBA 1BDBA 2P2LA 1FYWA 1WR0A 4RZQA 1E69A 4I55A 1CG6A 5JANA 4BJMA 4FHEA 5H6RB 3BCSA 4X1YA 1TYDE 3GEPA 3PSHA 2OV9A 3G6WA 5AFUL 1KJQA 2RH5A 2BS2A 2OBYA 2OV1A 3RUDA 3C6YA 4G26A 5JJLA 3CF2A 3ISTA 2DHRA 2JI4A 4MR7A 3FIJA 1EFRA 2GTIA 1I51A 4O4JA 3NVMB 1JT2A 2PH1A 5LG4A 3PFWO 1DAEA 1E1CA 3SXUA 3A7DA 3K2EA 4I99A 1C7IA 1G3MA 4R9SA 5J59A 4CKCB 4GI7A 2IHUA 4MUKA 3WGHA 3W0LB 1G8SA 2D5BA 3OZRA 2ISSD 2R2AA 3FNQA 3TLEA 1W1UA 3EPJA 4MDEA 3ZX5A 4ILKA 1PT6A 3EXEA 4G85A 1Y0BA 3I9FA 3LW8A 1N0IA 1AK2A 3TLBA 4EZIA 2W2MA 2JHPA 2W2XA 2XAHB 2P5TB 3C3JA 4WXHA 2XGGA 5KS2A 1E1CB 5DLQC 3W06A 4C7MA 1ZOSA 1TYEB 3DYIA 4EEZA 5DYIA 1YZGA 5CMLA 3K70D 1QHYA 5AM2A 7YASA 3ICPA 3VBEA 3A2KA 3IQWA 2BKPA 1C3OB 1X13A 2Q3EA 1F5SA 2WSYB 1WEHA 2I5PO 3C4VA 3QPVA 3DS8A 3LF2A 3V7FA 3HV0A 3FHJA 2CLSA 4QYMA 5C32A 1IHYA 2HJSA 3WGKA 1J7KA 3AMVA 2IU0A 3DMYA 3GLHA 3PGJA 2GHIA 4DV0B 1U7DA 3A5XA 2OGUA 3W4JA 4QXHB 2XGMA 3OHPA 1OKKD 3ZE8A 3UOWA 4P4GA 1C8BA 1K7YA 4ZZCA 1HE8B 4I08A 4PPYA 4X1YB 4KR9A 1N6RA 4L5YA 3SN6A 2QT0A 1T1JA 3FZNA 2CJFA 2VQET 1JA9A 1I7PA 1H7CA 1AKQA 1W5TA 3OZVA 4GX1A 2H3EA 4D0RA 3VRAA 3WV4A 4DLYA 3AE2A 5TEWA 5AQSB 4PC6A 4XYLA 3AVWA 5T3YA 2J32A 1XFAA 4I6EA 2IUTA 3V1LA 5FEUA 4ENTA 2GA8A 2JLCA 1T91A 4J7CA 2CZCA 3KLBA 4LDNA 4A10A 1Z2CA 3C1TA 1X9GA 1EB8A 3E03A 3CNEA 1U2GA 1E1QA 1E4VA 3NMUF 1X1CA 2FLVA 2JH9A 2O8DB 4HWRA 1CLEA 1DQRA 1SD1A 2W6NA 2VPZA 4HFDA 2FB9A 3EIHA 3LVRE 4DLXA 4HTFA 5FVLA 1NLYA 5DHUA 4A2PA 1EXVA 5D5QA 4ZCMA 1N5OX 2F1IA 1MJFA 2JFQA 1QV6A 1HT0A 1H5UA 2JF0A 3BK7A 3MGAA 4FNAA 2NVUB 1QKIA 4GOXA 4CMIA 2Y0CA 1JVBA 1L8QA 3P50A 1QIDA 4RQAA 1U2TA 3EJWA 4J1SA 1N5IA 1VFPA 2VDJA 2Z9DA 1EFAA 3MHPA 2FZ4A 5CFPA 2LSYA 3FTCA 1JHRA 4MOWA 4GAEA 1ZJ6A 1Y8RA 1YJ5A 1ZRNA 4NR0A 2A1TR 2XZLA 2JIZD 1JAZA 3C24A 3CH5A 4UAVA 5TB5A 3F73A 5T7BA 1F4PA 2AMFA 1GPDG 1MX9A 4TTRA 2ZUEA 2LE0A 1VLJA 4IF4A 2XQ6A 3LK42 4DV5B 1KC1A 3L41A 4LJRA 4W8OA 2N2NA 1I7QB 4BXOB 1ORHA 1WY5A 4QH5A 4Y8VA 3ZV7A 1Q0SA 3HH8A 4JROA 4R69A 3CQCB 2B4KA 4JYAT 4HGAA 4O5OA 4QSHA 3FGPA 1NJGA 3EQ7A 4TMFA 3ZE9A 4B81A 2WPNA 4JGGA 2R1TA 2YDYA 3D5EA 3S55A 3B70A 3GP5A 1MRSA 3NTLA 3IURA 3TOXA 2K7ZA 2P62A 2A9QA 3G06A 2R65A 4O1HA 5CVTA 2YHIA 1W5FA 1UP7A 1U2DA 2NUPA 4E6PA 1JEQB 5AW3A 1KOGA 4MALA 1QWSA 1RMQA 3CF4A 3FNGA 4HAIA 5J5VA 1QVZA 2J8ZA 5K0NA 4TWAA 1EU1A 2QGZA 1GDTA 5AWFC 1N33B 3B1YA 4BFVA 2GEDA 3FNBA 1QRSA 4YCBA 4PK5A 4EFLA 3TPFA 5I51A 1QTRA 2QAGC 3ZD6A 4K6CA 2B36A 3K96A 3KZOA 3IR5A 4KWHA 4NARA 1VRVA 4CF7A 4PLVA 4UCXA 2QUAA 2IZ7A 3HKCA 4E08A 4QXOA 3GOQA 4MH0R 5IP5A 1DC3A 1I94B 4FONA 4RS3A 5LMUT 5FPHA 3OX1A 3VI3B 5C8YF 1G8AA 5HZHA 3SSOA 3O3CA 3WL3A 3AZPA 1EGMB 1GARA 4PTYA 3LBIA 1ECGA 2ZYVX 3FFTA 1XLTA 3E5MA 3NPMA 4FC6A 4LDAA 4RQTA 1YR7A 4KG7A 4YIHA 5JCPA 2VSQA 1E3LA 1QGUB 2JCYA 1J8QA 1OZFA 4RE5A 3R0ZA 1Y6QA 4C7XA 2DECA 4P7FA 2W2KA 1HDIA 3RS8A 1RP7A 3SMQA 1XVIA 1ZIPA 4EX7A 1I2DA 1KQNA 3U48A 2WHQA 1XNGA 1PTJC 1SFRA 3V7NA 4HQRA 1IK6A 4W1SA 3MSXA 3QUJA 1NXXA 4LGMA 5BWNA 1P7WA 4EYSA 2QRUA 2BGGA 5DSXA 3EXHB 1Q5PA 1DJQA 1H85A 5DTMA 4JI2T 3SBEA 2H7VC 2YJGA 4CMEA 3VPBA 4DIKA 1Q1BA 4YRQA 3RVOA 3SJUA 2YHUA 3HKEA 3W34A 3MIZA 3RRNA 4CLDA 1EX1A 1ZZEA 3QJYA 5TJHA 5J2UA 2R9VA 5ITZA 5E3IA 3H1AA 3MXTA 4AK9A 2LP4Y 1WSAA 3ET4A 4YTEA 1IG3A 3WRVA 2XY8B 4ZS3A 1J0XO 2NTNA 3CB4A 5C35A 3ZJ5A 1JH8A 4YFSA 5FA6A 3V8NA 2YYSA 2XD9A 3DZBA 3HA2A 2JC3A 1I13A 1ODSA 4RKEA 2QVCA 2IZOA 4M38A 4Q9DA 5B1SA 1M75A 4B17A 2ES4A 5KDLA 3LBXB 1CJVC 2A67A 3C3AA 1HFKA 1QGUA 4B3DA 1CJTC 2M6IA 2J9XB 2W71A 5DB4A 1WIWA 1M6VB 1NMXA 1Y1RA 2VYNA 2YBEA 2ZROA 3JXEA 1RLMA 4EF6A 4BLSA 2XUGA 4V1CA 1F4LA 3NT2A 2B69A 2FUCA 4PANA 2GD1O 3GAFA 2UAGA 4H9GA 2ZR8A 5I45A 3EISA 3YASA 1A2QA 3FTPA 5ALQA 3VR6H 1N4DA 1XLUA 3DKPA 1SQ6A 1OROA 2PXXA 5AK6A 1E2KA 5EGNA 1P1RA 3D3JA 3LS2A 5EHQA 3T41A 2WMOA 2VNJA 5AW7A 2G71A 1T0PA 3BMNB 1G8HA 4LYAA 5JNTA 4OXQA 3FF1A 1W0KD 4RY2A 4UOEA 5ALLA 1H2AS 3RYIA 1NXQA 3QW4B 3MTEA 1DZIA 2EKQA 2OVFA 5I9SA 5D01A 1H66A 1LLFA 4FN4A 5ED4A 3EPKA 2KXPB 5K3EA 3Q9DA 3IVRA 2GN1A 5KTPA 2CNOA 1PJ3A 2A9FA 3GEMA 1UPBA 3K1AA 3OA0A 4IJ6A 3VU3A 3HXMA 1G3IA 1QHNA 5CIWA 1CUHA 1P2SA 3A4IA 5DISB 5H82A 1AHPA 1Z0ZA 3ZHYA 1PFKA 1KVTA 3ONFA 4QAJA 4QPCA 4BC1A 1TTHA 2BCJQ 1RM3A 2QP9X 4QJIA 3KV1A 3MIIA 4R6WA 1H3EA 4LF7T 2OOSA 1JI3A 2FAXA 3H86A 4RNCA 3H99A 4LSWA 3T8YA 1PF7E 3FDZA 3W9BA 1WLXA 4F6RA 1X1QA 2RGUA 3M6UA 1M34B 2A59A 4QELA 1JXMA 1QE5A 3WL5A 4QZVA 5GVSA 4NCHA 1IY9A 4F06A 5LBMA 1E1YA 3WIUA 1EVLA 2ZM2A 2OFOA 1D0YA 2OWEA 5IC5A 3W8FA 1ES9A 3O8QB 3VJRA 1A9PA 2IWRA 3T06B 1V5IA 2JJ2A 2NU9B 1EWRA 1WW2A 1D6NA 1EAYA 1SCNE 2QRGA 4L8WB 4IE7A 1WQ3A 3H1GA 5JTGA 2Y1GA 3U09A 4F6RB 2IE8A 3ME5A 1MNAA 1P9RA 1VB3A 1XQXA 1EX6A 4PK4A 1IEWA 2W6MA 3AX6A 4BB6A 4CVNA 3UG7A 5A2GA 1DX6A 2FZKA 1X1BA 4UD6A 2OECA 3VH2A 2QWXA 4P82A 2W83A 2IXAA 4EB6E 2EW8A 3FPJA 2OK7A 3WNBA 1JDZA 1YFLA 4ZN6A 1T1IA 2P9JA 1KAHA 2ZXFA 5FPPA 2DY0A 2WJ6A 4Q1FA 5EEHA 2Q4TA 4JN6B 4MEJA 4TROA 3FRHA 1J2TA 1B0ZA 1MTZA 3PC6A 2OZLA 4WLOA 1M1XB 3JVEA 3SGLA 4MQMA 5JSKA 4B6OA 3IAS1 1AMOA 3DEAA 4Q24A 2JCSA 4MRAA 2CMHA 3O8RA 2R7KA 3PUGA 4Q93A 1DJMA 1M3SA 3CZAA 2ZRGA 3PHJA 3QJ5A 3EY9A 4MWDA 4CMKA 5TVKA 1NVVQ 2L0XA 3QNUA 4DJFC 1K88A 4TTQA 2WAXA 3PNOA 3C43A 3FBLA 1HK7A 2Z8ZA 4IV5A 3R7AA 1XKTA 3MFYA 1U65A 3U0BA 3QPUA 3KETA 2JIDA 1UDWA 1XNQT 1YMQA 4J29A 5IANA 4PZUA 2VTBB 2ZU0C 1M1YB 2B21A 3CWQA 4XARA 1H93A 2HIGA 3IJRA 2ZJ4A 1GCUA 4OKSA 5EN4A 4LMJA 1P2GA 1MJHA 1X7WB 1P4SA 1MOPA 3KJHA 4JQYA 2BIFA 3I4LA 4H0CA 4TX1A 3NKZA 1G9SA 3BTVA 4F71A 1A9RA 1VCIA 2GZSA 2QG9A 2BBOA 1W5SA 3C3PA 4A6PA 5TPZD 1OH5A 4GW3A 4CCAA 1H6DA 2FR8C 2QL9A 5BOSB 4HDOB 2XSZA 4HDQB 4TUYB 4CCSA 3RABA 4WUTA 1FFAA 2WILA 2PN1A 4C7BA 4D2IA 4GX5A 4CL3A 2H11A 1UMDB 4LF8B 4IE0A 1R16A 3LIIA 4UXHA 3L0BA 4B8ZA 2VK9A 3S2UA 5LUAA 4XGQA 1RW4A 1HKHA 2Q29A 3VKUA 2YU1A 3T7KA 3V3TA 1L8XA 4I2VA 1SAYA 3CVYA 3QIAA 3RYFA 2Y66A 1AGYA 1K8ZB 1J24A 1PR0A 3PNKA 3UYKA 1NQAO 1IHOA 2G08A 2E9XA 1WL8A 2I1QA 3A10A 1T1RA 1F5NA 3B2NA 4DJTA 4EPVA 2C8KA 4QEZA 5A3QA 1JEAA 2XNDD 3IMEA 4Q19A 3H2YA 3QTLA 3QVXA 1PR6A 3ZK8A 4X20B 2XQYA 2HA3A 4ZZIA 5I9IA 2OXRA 2FW9A 2QMZA 3IA7A 2W7TA 3AV0B 5I9LA 3LRTA 3CNQS 4RTSA 4YV1A 1ZMOA 2XB4A 4BCBA 1X7HA 1L1FA 1IU9A 3U39A 4E5PA 3O4IA 1YJBA 4ZV9A 1L8AA 1U7XA 2UVPB 5E0KB 1KGDA 1E9CA 1SXQA 1RXVA 4AULA 2W62A 5AHKA 3P52A 3O21A 5KKNB 3BBLA 3F8TA 5LBUA 1YBFA 5CLQA 1EI9A 2ZT8A 4R2LA 4TTJA 4YUWA 3C3DA 2GJ4A 2Q5HA 5TF0A 5EJIA 1YACA 1XE3A 4URVR 3V6MA 3KB1A 3AVVA 5HXCA 5CFRA 4LF6B 5FI3A 4ZT2A 4HEA1 1UDBA 3LT1A 3CUSA 2VQ6A 3D4OA 3L8GA 5MN4A 2FE4A 3BK2A 4HDRA 4IOJA 2OO3A 4FW9A 1CY1A 1G20E 2BR3A 2LZ0A 3MJFA 1U7PA 2M2IA 4A7PA 4I1PA 1PR1A 2IP2A 4FMBB 5DLDA 5HK9A 4HAVA 4ARBA 5BR4A 2LOSA 2CSUA 3NTUA 4QJ5A 3J80A 1N4AA 3OUTA 3WYDA 2RPAA 2FZGA 3BM5A 3DMRA 3JZIA 4Z7NB 4ZJUA 1KWGA 4Q02A 4L0QA 3KKQA 1EQAA 3RLIA 4Y0AA 5F2KA 1M2VB 1L5VA 1F3LA 1VE1A 2XGSA 5F5WA 1DBPA 1OFUA 1NXTA 3RFFA 2LCQA 4BBPA 4C0HA 1U0SY 5CB4A 2DPYA 1DEAA 3VDQA 4TXNA 3ZNOA 4DLUA 4ATNA 4JJ8A 3WBFA 1KKMA 5KQRA 1NVAA 4UTVA 2HJ9A 2W6QA 5DNDA 1HDXA 2PX5A 4FFOA 1TU0A 3RKSA 4EQ6A 3TS1A 1QYRA 4RA6B 1BAPA 2WIDA 4XM2A 5DWVA 3FZFB 1VXOA 1WV0A 1OB5A 2LWIA 5AKZA 4CQMB 2PWPA 2ZYUX 8AT1A 1ONOA 4L50A 1SA0E 4IZOA 1JNZA 3KT3A 3H5LA 2XDQB 4O4HB 5F21A 2C8JA 5K0ZA 1KRXA 1KARA 1ORIA 1RXCA 1WZEA 1DAPA 3GFSA 3O31A 1P7YA 3IVAA 1X1SA 4U7WA 4K5QA 1R74A 1L1RA 2BKXA 2V7QA 2GHQA 5BMVE 1ENOA 3NHMA 3FZGA 3PI6A 1JALA 4OGKA 1QSGA 2BR4A 3M6VA 1P8JA 3AO0B 4HLDA 4NZMA 3VTFA 3TGLA 3FWZA 1GUDA 2F43A 3GH3A 3VKHA 3ORSA 4Z0HO 4FM9A 2RB5A 2RHGB 1T9AA 3GOHA 3L82B 4IYJA 4MW2A 4BP9A 5KMGB 1A8IA 3SEFA 4QNMA 1WRDA 4HFIA 2IDJA 4LRXA 2JGIA 1ZN9A 4I50A 1G8MA 3UW3A 5AQFB 1E0JA 1JVSA 1S3GA 2G17A 4GYJA 1MMDA 5EZYE 1EINA 2WAYA 4J0KA 2OGWA 1SKAA 3HUFA 3DYVA 3WL8A 5DP1A 3CVRA 3SSNA 1LPPA 3CKMA 7ABPA 4G41A 2DWKA 3W3AA 4N5IX 3ZBUA 2GO1A 4X97A 4H35A 1UOOA 2JD1A 3K0FA 1JP7A 2D5UA 4N5DA 1XNRT 1G9XA 5D00A 3B9RA 5CIQA 4BX3A 1VCNA 2LKDA 3EGXB 4CG3A 1TQ2A 1MDBA 2V5UA 3BE5A 3WWZA 3NUQA 4NF2A 3VZQA 1WV1A 4J0EA 3N8GA 3GLIA 1AMNA 5TAOA 2JGLA 2YIMA 3Q5DA 3MYRA 1AQNA 4U8HA 2HMWA 2H29A 3ZHTA 4DY6A 4AY6A 5HWXA 1F4VA 4HDAA 4PYMA 5GADl 4R0VA 1MAAA 3S1LA 3ZDXB 2FX3A 1F8FA 4PZ0A 4WFQA 2OYCA 1A50B 1V8FA 3E35A 4NI5A 3BGVA 3BT7A 1TLTA 2PSJA 5U4XA 1KZ6A 4O8ZA 1T1EA 2Z4RA 3DT9A 3JR7A 2NV0A 2OC4A 5JHHB 4TX5A 4IDNA 1E4EB 3IBGA 4Y0VA 3KQTA 3LBHA 3QQ5A 1LKZA 1X7XB 2OPBA 2X5XA 1AX9A 3C6XA 5JARA 5K8LA 4YEDA 2KYRA 1DKNA 2H8KA 1E6LA 3L79A 2D5IA 4GQBA 2WT8A 3ZHOA 4JITA 2V97A 1HE4A 3JTEA 4CKWA 1NNUA 2D7CA 3RYHE 2P7IA 5DJ5A 2IZ5A 3V8VA 4KVAA 4Y1RA 5JRJA 3D3NA 3AECA 1QP7A 2O1XA 1UQRA 2JCBA 5JI2E 3GA7A 1WZIA 3WFZA 2WV9A 2ZYWX 1BDHA 2W6JA 4I9UA 4RVCA 4UEKA 4P58A 3SQNA 4QDUA 3AIKA 4IKPA 3TRKA 1XZPA 3I05A 3SVTA 3RUCA 1KYQA 1MABA 3MQ4A 1ZM7A 3NHUA 1NQXA 4JASB 2ZM6T 2A0YA 2FLWA 3EGXA 3PEEA 4UXIA 3VO9A 4EJMA 4PSUA 3JY6A 3BA6A 5C5DA 3LUGA 4K6KA 5JCZA 4RZIA 2PIDA 5DT2A 1G4AE 3OKAA 1H22A 2HB6A 5ECWA 5IW8A 3UTCA 3W78A 5K0CA 5K0BA 3JARA 5G2OA 1M6WA 1AY0A 2JLRA 3DAYA 3NAMA 1U6JA 4RUKA 3K72B 2H88A 5SZHB 1KSGA 1ZL2A 3TSZA 2QN7A 2VDUE 1NXWA 4O2AB 1U31A 1TEHA 3G8AA 2F3RA 3OJXA 2CLKB 4M60A 3H4MA 4IWYA 4P3PA 3ADDA 5FLEX 4N8SA 4ED9A 1IXZA 2YWRA 1LJ8A 3RLFF 2FPMA 3UCFA 3WGZA 1TU3A 5IMBA 4G1MB 3N9MA 1UAAA 3FB4A 4D3ZA 3BZUA 4MPTA 3M1IA 2IYAA 1XL1A 3WISA 2JRKA 4C9BA 1A9YA 4EYYR 3RVBA 2EP8A 4HBGA 4UTXA 3TUIC 4QDZA 4ZFNA 5KWSA 3P9CA 1XZCA 2X68A 1OYWA 3CRW1 4YWHA 1SVUA 1B74A 2X4IA 5CA0A 4AU1A 1U7ZA 1PZHA 5TJ9A 1G6Q1 1JEJA 1LGYA 2E4WA 2G09A 4HVCA 3U40A 2FOXA 3H5TA 1U5BB 4NCKA 2WINI 1KP9A 4PM4A 4LXXA 2Y99A 4I66A 1NR5A 1U02A 3LX8A 3SSAA 3C74A 3HBMA 2JGAA 3K70C 2C5AA 2Q2QA 3HNOA 4JKYA 1I6ZA 1OTHA 2QAJA 3FI9A 3MAGA 1A5BB 5FOVA 3D64A 3DXYA 1VPWA 1UWVA 1GQFA 1FF9A 1NI3A 2PS1A 2ZRPA 3CRVA 2A1UB 4WOJA 2X9WA 1RD4A 4QVGA 1K7FB 4RIGA 3C5CA 3KOOA 1TUBB 3Q9LA 3RD5A 4CF6A 4X95A 1RQPA 3HR4A 1WDLA 2JBHA 4LJLA 2V74B 2B9VA 1M2JA 4MUEA 3C6MA 4CTOA 4HT3B 3CIRA 1HMPA 1DIRA 1ZINA 2CYCA 2QP4A 2VVTA 2YX1A 3BHIA 3NLLA 4FGLA 4FYXA 4LC1A 1GGNA 1I3CA 1UJ5A 2B94A 3FLBA 5E4YA 3QLVC 1IUNA 4B6FA 4G8DA 2JGFA 3OLQA 2O5CA 3D1VA 4LIPD 4PZ9A 1QTIA 2G9RA 4ENWA 1NR7A 2L69A 1DAOA 3ICWA 2RGYA 1GNPA 1KH1A 3FXEB 4EZEA 1DIAA 4EP1A 2WZBA 4S24A 3VO8A 3BXPA 2CBXA 4FS3A 2P6OA 3RUEA 3PVCA 2JQQA 1WETA 1WUKS 3ASVA 4DCOA 3C7AA 1F6WA 3ZMVB 1PLLA 2XWBF 3PUWF 1MXFA 1O97D 1E60A 1QDUA 2M32A 3EXG1 4L5AA 3TZQA 2PIAA 1SMKA 4K3VA 1PYOA 5LOVA 2YY5A 3TXYA 4K0UA 3D4PA 4ISSA 4MHCA 1K8XB 3VYVA 3ER9A 1FY2A 4U2KA 4WERA 3WRYA 2H7XA 3H87A 2Z2JA 2ZCUA 4PICA 4UBOA 5FWDA 1B1AA 3O9MA 4ZHQF 3Q88A 5INTA 4DPLA 1I0LA 4IL5A 1NKSA 3W6ZA 1YIOA 5TS3A 3W8RA 3VFDA 3EFOA 5LYJE 3PPVA 2WYIA 1M7HA 2XQIA 1SWWA 2AX3A 5DCLA 2PGAA 1VP9A 3OYZA 2P1RA 3F6YA 1TPYA 4HRAA 4TVOA 4S1TA 5CHEA 3GLFB 3SK0A 3ESYA 3AGPA 1AS2A 1LTKA 3N0RA 3NAZA 4C7KA 2Z09A 3TOCA 1DBSA 4W9NA 3IKLA 3N87A 4FSDA 1IWBB 4AF6A 3E5NA 4IINA 5I7RA 4TZ0A 2PT6A 3HYCA 3N5CA 4XM0A 1QCCA 2X1LA 1U3TA 3HDYA 4NMMA 3MUOA 1JFVA 2NZ2A 4PC7A 4QODA 3DE2X 4WZ6A 5IDVA 4OB8A 4OHMA 3E15A 3T3IA 3I53A 5LNK6 3AVOA 3HLTA 1HI9A 5LZ9A 5CJPA 3X1KA 5HK8A 1ZD2P 1GDHA 3EIOA 4UEOA 2W5UA 4F6LA 3RRWA 2XXBA 4JNCA 3MOGA 1FNCA 1AG9A 1J2EA 3PB3A 1DDGA 2O8CA 4P4SA 5AVVA 4UQLA 4YP1A 1W9HA 1S3IA 4PYKA 2IC6A 4UMFA 1NMZA 4Q21A 3BUSA 3TQOA 1W1IA 4TQUS 5CVVA 4MINA 3NEPX 3V97A 3D6VA 3NV9A 3NANA 3ZJVA 2AGVA 5KNCA 2Q6OA 3D8SA 4LCBA 2CNWA 1RLJA 2GZ3A 2QD4A 3K9NA 1W5BA 4MTLA 4H63V 5CX1A 5AICA 1Z88A 4C87A 5L3SB 2CV0A 3A2MA 2KLQA 3NWEA 4N3NA 1KO8A 4DV0T 1P73A 4QT0A 4CUKA 4DMMA 3MTDA 5EIBC 1YSCA 3NBQA 4YAOA 2Y1OA 2K2QB 3CJTA 5K9ZA 2BGMA 2WE7A 1LZKA 1MAUA 1Z3IX 3CKLA 3FUWA 3H2KA 4J07A 4NPAA 4GMHA 1ZP0A 1J0EA 5H4HA 5A9SA 4IIEA 5HQ3B 4IOMA 2X8JA 4M37A 4GUDA 4KJZA 4CW7A 4YDRA 5KVVA 1SKMA 4YBRA 5H9VA 1DEOA 3EWNA 4DR5T 4K7JA 5BPHA 2NSYA 3JD3A 1SBHA 3ND7A 1M1YA 4HHEA 5LYYA 4Q1DA 1HZZC 3GLSA 2O0KA 4OBWA 1OI3A 4R0NA 4BZXA 2QSUA 3WRXC 3VU1A 3H7AA 4E03A 3E9ZA 4V0NA 5TDHA 2KB0A 2JLBA 2HX1A 1TZ2A 4JJEA 4TVKA 4KH0A 1QIEA 3SVLA 1FTSA 3N2EA 5TT1A 3S1AB 4EMUA 1WR8A 2OCAA 4NMWA 4XOIA 4JYAB 3HE3A 5ITVA 5TGTA 3I0MA 1F2DA 4D9EA 4DAEA 4FZ3A 3VUEA 5KKAA 5F5NA 3QRWA 1OLSA 1ZD5A 4DR2T 2H85A 2GKOA 3HKCB 2IY7A 4JLUA 1KNRA 1G1MA 3KDSE 4ANJA 1AHHA 2B1RA 2G9QA 1OJ7A 3IRUA 2UZ1B 3LHKA 4FIDA 4K9SA 1VSVA 5E3HA 4C1NA 1HR0T 3CPSA 3PX3A 3E3NA 4O4IF 3FROA 4RLSA 5UKDA 1WABA 1OWNA 3V7UA 2NWBA 2CXOA 2Q8NA 1UJCA 4QD3A 4BQQA 3E61A 4QNNA 3V34A 4MCIA 4YQEA 1UURA 5GIOE 2PSSA 3PFFA 2QAGA 4XD7A 3EZXA 3QX3A 3T7RA 4CHTA 5JEDA 4HWKA 2VP2A 4X93A 2P2CA 1ABEA 3K9QO 4ZCSA 4P0TA 2G3YA 5D5HA 4JQCA 2IY8A 1ZEMA 3L46A 1GKUB 3NH9A 5TGZA 2O19A 3JRWA 4XVQA 3HI2A 1N32T 1JHQA 3I6YA 4WKGA 3FLAA 3VISA 2R62A 4A9AA 5F76A 5KEIA 2RI6A 3T5MA 4BNYA 3RIGA 3PS9A 5ICGA 1U1DA 2DTXA 1U7OA 2WVGA 3ETNA 4TLCA 3QLEA 3VR5D 4AZTA 1G0OA 2GRAA 2OP1A 3WQSB 4P0PB 4MP6A 2C95A 4AJKA 3CINA 1PJ8A 3NG1A 2I8LA 2HDHA 2G82A 4MQLA 3L8CA 5L4HA 4MS4A 4XAXB 4RKWA 3BQ9A 2FG5A 1NQVA 4OMFG 3L7OA 5GGXA 5ISMA 1KYXA 1QIFA 5CYGA 3DV2A 4HX9A 2WCAA 1ZBDA 3THRA 4MJLA 5HWYA 1N7GA 3OQBA 3WGLA 4B73A 2QORA 2XZDA 3GN5B 1NOKA 1KZ9A 3M83A 3IUMA 1T36B 4S2UA 3F9RA 2NW9A 4BHTA 4L5GA 4DT1B 4QH4A 3F5FA 3CLSD 3K0KA 4MV9A 4Y7DA 1OWMA 3AF4A 3LOUA 3DV0A 4QWWA 3SLKA 3TE7A 3EDRA 4UVCB 3E8MA 4YRFA 3MC1A 5J43A 3H04A 5LJLA 5GV7A 1EWTA 5T6MA 4A23A 3O4GA 1RZRA 1DIHA 2BRUC 5B30A 5KVQA 1Z06A 1WXEA 4TM8A 3VMFA 2XSZD 5KQPA 1SUBA 2BJVA 1CCWA 4HTFB 4QRIA 4KO3S 4FBLA 1JJBA 2IHBA 1KOLA 3KBUA 1BN6A 3EXIA 2J3HA 2H7OA 1GZDA 4LE0A 5ES4B 3BB4A 3N6VA 1MB0A 3C98B 1SXIA 3FSGA 5C7IO 5E1BA 1M5RA 3KFVA 2HF2A 2XMZA 1G8KA 1UCUA 2AJBA 3HXTA 1TM4E 2ZE7A 1PR4A 3NRBA 1OT5A 4BEWA 3EC1A 1L7MA 3E9YA 3WADA 1R0CA 5CT4A 3OQVA 4AUMA 3ETVA 2WEKA 4RJKA 3ERCA 3MGCA 3MWJA 3CZPA 2ZBVA 2VKTA 3KP1A 1KS9A 2XR1A 1KL7A 2G76A 5JY1A 2X1VA 1HGXA 1ULAA 5CXUA 3NRYA 1SVIA 1CQZA 1UC4B 1Z29A 2QU7A 4Y2UA 3O47A 4XYBA 5KX5A 3HU2A 2C94A 2UXBB 1KJIA 3DOCA 1T3TA 3RHSA 4L9IA 1IN7A 2YWEA 2W6PA 4OA5A 4HQKA 4Z8YA 3RGWS 3AKEA 1GUFA 3C1AA 3ZUPA 4J1QA 3C3EA 2WSBA 3DV0B 4U39A 1SG6A 2Q9UA 1KZ7B 2HTEA 2JCVA 2YV5A 5B7PA 2HCBA 1OOEA 2PY6A 4NZZA 2Q0HA 4PRLA 3AE9A 5AKGA 4CL2A 2FPWA 5FQOA 2CBJA 1AB5A 2I03A 2OORA 1Z0KA 4RPHA 3JATA 4C03A 3IKVA 4OA8A 2WMDA 1U0HC 2ACKA 1FDWA 3G2NA 4KO2S 3S8YA 3GD7A 3UV7A 1ND6A 1N6LA 1SQSA 2VH1A 4DJAA 2ZZNA 4HFVA 4GS5A 2O59A 2IMLA 4JLBA 2F6RA 1PQWA 1WNTA 3WDMA 2ZJ0A 1HZZA 2NO1A 3F6PA 2I59A 4IQ4A 2EWMA 2TS1A 4X3OA 5K0TA 4L9WA 1Y8QB 3U4IA 5FTLA 1N3YA 2EBWA 2ZSAA 3ZT6A 4KX5A 3V4ZA 1KJNA 4ZYYA 5JR9A 1L5HB 2X67A 2FXVA 4B7AA 2ODAA 2QW1A 1FU8A 2IDMA 1L3IA 3KSRA 3AAAB 4ND7A 1ENPA 1DKMA 2V7IA 3OTHA 5EJGA 2BKUA 5F7XA 2QL5A 5I4CA 1OXBB 3RYFE 3BOSA 3GJ6A 1YS9A 3QOXA 2Y9PB 4GEGA 4JJ6A 4K26A 1AK1A 3REQA 2QLFA 2D3WA 2ODVA 3Q10A 1TI7A 1UKZA 1JH9A 4LZAA 4B45A 1ISFA 2YJNA 2OHIA 1NZFA 2ZJ5A 4UV8B 2CDBA 3T38A 4HDMA 1WBDA 4B3GA 1OXMA 3DKRA 3GQBA 3H2SA 4G1EB 4PCVA 5CHYA 3AF6A 2A1TS 1JB9A 3AB3A 2WKWA 3H1PA 2WDRA 2YMQA 1C1YA 2RD2A 5HZMA 1RAFA 3HWWA 2HO4A 4QQNA 4BE4A 4C88A 2VK8A 1EBBA 1V1MB 4LKRA 3OE7D 4AZ0B 2GZ1A 3UPTA 4PRYA 4BX2A 3ZJTA 3HYLA 1H1LB 4AJNA 1L5RA 2AKEA 4ITUA 2QN8A 2FEAA 1Y01A 2OR3A 3EVCA 6YASA 4ZALA 4JUFA 4W1RA 2H1FA 1U8EA 1XPOA 1V16A 2G70A 2NZVG 2RMKA 3VR2D 3PXGA 1N2BA 1NIJA 1PS9A 2IXBA 3KTAB 1R8SA 2VURA 1W36C 3H5IA 1YBMA 3V5NA 3OBIA 3KJZA 2FRDA 4M89A 3EOZA 2QRMA 4Z2AA 4K9DA 3KDAA 2ONKA 2AJTA 1P1FA 3LD9A 2ZJ1A 1YE8A 2POQX 2IUEA 1OX4B 1N6HA 4HB2A 3EVAA 3KZMA 3LZDA 2RA1A 1Y80A 2MAWA 4EWLA 3OZEA 3JAMA 1WYBA 1NDHA 4PZYA 4ONEA 3N9IA 2PT7A 4M9ZA 5LJNA 1P62B 2P4EA 4UNRA 3MMZA 2PUDA 4UF0B 1WHTA 3BGSA 1YJAA 2JEZA 5AM1A 1DFGA 4HXEB 1HA3A 2DFPA 3IAEA 4LYEA 1XEAA 3NW9A 1BHJA 1HDOA 2QTZA 5DKFA 4C4SA 3UYLA 4DCPA 3EVDA 3O2SB 5DHSA 4EW1A 3ETGA 5LZ5A 4DEXA 3AF0A 4GR5A 1E98A 3EDCA 4LHXA 5JXIA 1M7KA 1FW6A 1UKEA 2NSLA 4P4NA 1RU3A 3BA1A 1KJZA 1YZ3A 4MLDA 1ZM4A 3L49A 4FNMA 1FX0B 1E9VA 1OIWA 2VAXA 2VSFA 5KNDD 4HN9A 4EG1A 4JUAA 2ZFUA 2XF8A 2G88A 4BFTA 2ZPTX 1CY7A 3QLTA 4NK4A 1Q7RA 3DMHA 3QXXA 1B15A 1O6BA 3A32A 4EPWA 1V5WA 5CCEA 1E1LA 3FHTA 3R9XB 5AW6A 4ECAA 1Z35A 3WNVA 2FOLA 2BY4A 2JATA 1QWOA 3KRTA 4F8HA 1PEYA 1UKYA 4WK4B 4C4XA 1UEIA 1RBQA 2BE9A 2ZBEA 3DFKA 2C3OA 4LXHA 4BLPA 3FWNA 3AT1A 2CSXA 5FEMA 3EZ2A 4MCHA 2OFPA 2Q27A 4FCCA 4P34A 3UJBA 3DOUA 2PS0A 3NHBA 2G5PA 2JANA 5G3ZA 4WFIA 3MCZA 4N3GA 2KSRA 4UARA 1QTNA 3OMXA 1OYVA 4MRVA 1FIOA 3P26A 4IGFA 1QP8A 4DA4A 1E5TA 4EYKA 5K6AC 1G38A 3ZXYA 2GX6A 1JDVA 3NDRA 2HJHA 4MWGA 2D59A 4IG9A 4NSNA 3V1MA 1EEHA 3KAQA 2G25A 1TRHA 3OSZA 1KTIA 2XOKD 3N2ZB 4REOA 2JLZA 3P4PA 1GSHA 3NNDA 4JOQA 2OO5A 4ZVNA 3HB7A 1L5KA 4DR2B 2GXUA 5IUXA 4N0PA 4V1Av 4MHOA 3HKBA 3RGGA 5JTUA 2DVMA 3PPIA 2ILTA 2QNBA 2BVLA 2XDAA 3MS7A 3M9WA 1QFJA 2N47A 1KSJA 3QEKA 4QGBA 4GP7A 4EUEA 5HM6A 4REQB 1SZCA 1W30A 3V8PA 1J9EA 3U19A 1UFKA 4MXDA 3D1JA 4FMCF 2XVZA 4JLOA 1KEEB 1O77A 2VTDA 4BOYA 4AJOA 1KK3A 3IP6A 5DGHA 5DEIA 1LPMA 2OGSA 3BCRA 3S4YA 1E6KA 1WXIA 3IHKA 2ATCA 4L16A 1K75A 4GPAA 1F2VA 3T61A 3HC7A 2ERCA 4ZK2A 5FX2A 4MI1A 5AQVB 5C7LO 1FMLA 1UPUA 2WF6A 4RMNA 2FPLA 3PX7A 3PQ4A 4NAUA 5HXAA 3MWGA 5KU1A 1RPNA 1QAOA 3SAJA 2E85A 3ZV6A 4OI2A 2B2NA 1YNOA 3JCFA 2D74A 2GESA 2BSQA 2IYOA 1UX5A 4A8PA 2VRBA 5BWLA 4J0FA 2WFMA 2PX2A 4QBKA 3QU5A 2O8EA 5IH7A 2WB2A 2QRZA 4B85A 4WH0A 1GTL1 3D59A 3MEQA 5LA6A 1LBTA 2JI7A 4X60A 3FCUB 5IBRA 3GCGA 3NEJA 3O84A 1H2YA 1N2JA 2PRJA 1GZ5A 3L1VA 4RK1A 4CKEB 5IKXA 3JAKB 1KI8A 3T3MB 5EFZA 3KZNA 4OYHA 1X0XA 1NE7A 4D43A 5H70A 5DTRA 2PDAA 4XQ9A 4CM7A 1E18A 1NF9A 1W2HA 4YDQA 1RYBA 1XYYA 3ANNA 3B57A 4K9NA 4K46A 4YTPA 2PX8A 2WR8A 3CKKA 3P97A 2YJTD 4S04A 5G02A 4IMPA 1X1DA 1ATIA 1T8TA 2J4DA 3EIWA 4LHVA 3OOHA 4P80A 1U2DC 3RBVA 5K0SA 3PP8A 4HC4A 2Q50A 1M7GA 1XDSA 1FRFS 4PWYA 5B1DA 3ZGYA 5K03A 1JJ7A 1GTJ1 2HLPA 3PGXA 4DMVA 1EZZA 1H69A 3G5TA 3OPYA 3QIVA 5BT9A 1MW8X 3Q7QA 3W7AA 1DJLA 4KYVA 1VJ0A 1P5RA 4XPIA 1TQ6A 2C00A 4A03A 4ZWNA 3BE4A 1V2GA 4GSLA 5BSTA 3L0YA 3FDIA 4FOPA 3GRFA 1KIAA 4HQNA 2ZJFA 3T5DA 3IBFA 2HW8A 3WDKA 1AZLA 1A97A 3KQWA 4BQRA 4DC9A 2GNOA 2BEWA 2VQEB 1YULA 1KNXA 2OUKA 4IIDA 2R11A 3C3WA 3PYXA 1OU0A 3CNLA 1EEXB 1F20A 3PCXA 4LOLA 3W7VA 3ZWBA 4YXFA 1MCZA 1Z07A 3RF7A 4HUJA 2R8ZA 5JH7B 5LP6A 1JIQA 3TZ6A 4XEHA 5JLJA 1N9ZA 2FWJA 3H13A 3LT5A 1C30B 1EK2A 1GQYA 2RHBA 4G9BA 4Q7EA 4YJ2F 1B00A 5D1HA 2CEKA 5IBCA 1Z5PA 2VJLA 3SJ7A 1DELA 1QF6A 4BIIA 3O1HB 4MMXB 4FS8A 4BGVA 2ZIAA 2CFTA 3WNZA 3JALB 1XOIA 5H0IA 5KCZA 3VM6A 4BLOA 3CX8B 4CQIA 2CC2A 3ESBA 4L5IA 1CUDA 3H3XA 4JXZA 4KI0A 1WFDA 1M8GA 2ZSFA 5E6SA 2HO5A 4BLQA 3EVYA 5H3HA 4Q1AA 4B6RA 2E55A 4GZLA 2W2UA 2N1BA 2PKQO 2ZRNA 1N5MA 2ZGVA 3LI2A 1EIZA 1I3OA 3R84B 1Y1SA 2A1IA 2OC9A 2Z5GA 1U28C 3PUZA 3M1YA 4UAUA 3MWEB 1Z0IA 1YKGA 3X1MA 2O8EB 3RH0A 1OR8A 4CCYA 2WWYA 4QU5A 2I55A 1LRZA 2OCKA 3AM5A 4MIYA 1S2LA 4OP2A 2GD0A 5CRIA 2QJWA 4KQCA 2EG9A 2FZVA 2WRZA 4RZ3A 4AN0A 3P4XA 2VCHA 4UKDA 4C4OA 4C4PA 1OFUX 3HWX1 3GLGE 3W3AD 5L3EB 3IV7A 5ENZA 1P5FA 2OA5A 5FOTA 3A05A 1MRZA 1NSFA 3VDNB 3LDAA 2AR9A 3AW9A 1VJGA 1RHJA 4H3VA 4XDGA 2CMRA 5C3MA 4LDJA 4DLLA 1CUFA 1T25A 3QXSA 4UM7A 2HQBA 3GHHA 5B4VA 1EDDA 4UVAB 3LX5A 1G59A 4K9LA 4ILBA 4C4TA 1WTAA 3HACA 4D9GA 4DSZA 3H2IA 2XQVA 3UENA 3WRWA 4TWZA 3G0BA 3UUMA 2DRIA 1DBRA 1PLJA 1QDLB 2ARKA 2X22A 2HCFA 1K98A 3B85A 3ZYCA 1ZI6A 1V8DA 4DIBA 1DKLA 1XPUA 4ZOCA 4NE9A 5FLKA 4UDNA 1ZDMA 3QKSA 4EK9A 5HMLA 1Y3FE 2RKOA 5DYWA 4YWJA 1VMEA 2JLQA 3DL2A 4X8MA 4A2CA 1ZK1A 2P67A 2FSSA 2WMNB 3KK0A 4KUHA 3WBKA 1YC2A 1ZUNA 4B71A 4H1WA 1MOZA 3AHDA 2CHNA 1UPFA 3AXJB 2WVJA 2B76A 3VR0A 4AXXA 5LQUA 3KV4A 4TKUB 5L47A 2XADA 2TMYA 3L6EA 1J8DA 3Q41A 2C9MA 3C39A 4FX5A 4POAA 1YI1A 2FY8A 1LC0A 1DQYA 3COZA 3ENQA 3GZJA 2C2MA 4DCMA 4LGVA 2GCPA 2QRXA 1P0IA 5AI4A 1MO2A 5EIHA 4BVHA 1U1EA 5F12A 2DHDA 1AURA 3L7DA 5IJ9B 2FMTA 2B8EA 1CUCA 2F1OA 4HQOA 1BWQA 4UHHA 4B46A 3P27A 5T67A 1EVIA 2PSDA 4BGIA 3NZEA 3UU4A 2I4OA 3QF7A 2PUAA 4L08A 1VBFA 1XTBA 3Q7IA 1BD4A 1YRLA 3TJZA 4OHWA 5ENVA 2J7KA 4Z3OA 2R7AA 4R1SA 3EZ7A 3ZXSA 1XJQA 1P3JA 3V80A 2O9JA 1FTWA 2Q46A 4KU4A 5TMDA 4IE6A 3NC0C 5EVCA 2P11A 1SQFA 5EXEA 3DD5A 5EWJB 4UUBA 1EMDA 2H4YA 2H4JA 1Y81A 3GELA 4AY4A 1PT8A 3K1JA 4EO4A 1GRCA 2JAPA 3BORA 4OU4A 5AUOB 5KJCA 1ENZA 1HF3A 5DM0A 1QHHB 3M6MD 3UBTA 3QKTA 1SUWA 1PX0A 1G5FA 1KAQA 1TT7A 2O3TA 3FRJA 3NEAA 2QNRA 4MX8A 3OQ6A 3R5TA 4TSRA 4CM3A 3ADKA 4F8JA 4KHPT 4N4AA 2PSEA 2Q0XA 1JLKA 1RTKA 2F1RA 3DHVA 3LU1A 2PUHA 2EFCB 5FBQB 5L3RA 5KQMA 1GPBA 1RDFA 4HAYA 5H3CA 3GCXA 2FFAA 2C20A 2GPSA 2V65A 2YJ4A 3O7WA 1QQ5A 1ONNA 1V9SA 2JBWA 2IC9A 3RC8A 2DWQA 2F1HA 4Z8XA 4G37A 3UEOA 4BKPA 4RD2A 2D5CA 3AJRA 1NIPA 3RODA 3THXB 3KKNA 1V6AA 2ZI7A 3E23A 4BBAA 1YJCA 2Z5FA 3WFIA 1Y1QA 1A2KC 4FZRA 2IHZA 3DMDA 3DQPA 6REQA 1K5GA 1R4ZA 1YV9A 5KOIA 1BE6A 4J4BA 2PBIA 5EXDA 1Q92A 1CUJA 4JUBA 2JHFA 2J0EA 4GVXA 4UUAA 4DMRA 3ZG6A 2OHOA 2JLAA 3ZDDA 1Z22A 4I4LA 3H2JA 5CA1A 3VYTB 1KI6B 2XT9A 3NQ41 3TGPA 1TA4A 4R16A 2I1WA 2OL4A 1KVUA 2ACZA 5FR2A 1B41A 1E7YA 1NBWB 3TJRA 4CWAA 4QYTA 1RAIA 5CM8B 2SBTA 3TWOA 4LXUA 4RIEA 3SWHA 2OBNA 2EZTA 4JJZA 4TS4A 3OT5A 3RBZA 2J08A 5HIMA 5KOHA 5LLTA 1CHNA 3F8SA 4M7OA 3SKXA 5YASA 3JQ7A 3W77A 1GCGA 3MMPA 2O4CA 5JWRA 3IP1A 2NYUA 1O54A 4KPUA 2O3SA 1Z7YA 2VDPB 3IKMB 4V0MA 3SXUB 4N41A 1R6VA 3IXQA 5HFJA 5AVZA 2AC4A 3BH6A 3QVKA 3C4QA 2YUIA 5M5BA 3K0AB 4WBNA 1X8LA 2Z56A 2R47A 2WU0A 3A8TA 3UG6A 1GZUA 4BXOA 2CNBA 1YZKA 1L5ZA 2NV2B 3DGFC 1CDDA 3CR3C 2BDEA 1RE1A 4F6CA 1YRBA 1J22A 1D2NA 1EXNA 3TN7A 4BASA 4F5DA 2J5BA 4ENRA 1KEYA 3OM1A 4J6FA 5H59A 1IEXA 1Z7BA 3B9BA 4XASA 1LPNA 2H51A 4DUYT 3PFBA 1E1RA 3EC2A 5ALEA 4UHCA 5KKCA 4ZCQA 3E48A 1KQOA 2ZUUA 2POCA 4BTLA 1UAGA 2HPLA 2FF5A 3AE6A 1U2SA 3WKCA 4Z51A 3OM0A 1QE3A 1G17A 4ZYLA 2RC5A 3EXFB 4CHGA 2ONJA 4AS2A 5JH7F 2DT5A 3I04M 3D2AA 2FRXA 3V7YA 5ELXA 4R1MA 2AHRA 1ORTA 4J1NA 4ZVLA 3M5CA 1ZH8A 3Q11A 3RRXA 2EKZA 1I1QB 1HYQA 2GEJA 1O3YA 1JKMA 3DZJA 1Z0AA 2PX4A 5FO1A 1TE2A 4BVGA 1NC1A 4CT5A 3KJNA 1N77A 1O4WA 1BGXT 1Z25A 4XB2A 2X3YA 2FZLA 1I4LD 2ON6A 9GPBA 1U80A 4G1CA 1C4KA 4QA9A 4IVNA 3ZCVA 4MR9B 3OKFA 3K30A 1UDAA 1AUVA 3H11A 3X1ZA 2ZT6A 1T2FA 2WNIA 2LNDA 1UL1X 2KWIB 1ZD4A 2B30A 2CWWA 2XWSA 3B5JA 3GRUA 4F2DA 4UM9B 3DL4A 2HM7A 1MP0A 2JBAB 2FSFA 3I62A 3LP8A 5KTRA 3T3OA 4MV8A 5EESA 2XKBA 1FVXA 2V6FA 3L6DA 2DU8A 1PZFA 2WJPA 3LMKA 3PRKE 3ZHSA 2A57A 4C04A 3WMWA 2LR0A 4CM5A 2IH2A 1ZK3A 1MB3A 2AJ8A 1T9KA 3SQXA 3FSGD 4D56A 1W29A 5B64A 2P2ZA 2HSWA 4H31A 4L6IA 4NENA 4WLFA 5EFOA 4HKAA 2REOA 3LA6A 3WWCA 3RBAA 4EY5A 4GD3Q 4PAOA 5CM2Z 3HKDB 3DZHA 5GJWC 3ULKA 2AYXA 3LY7A 3ZWVA 4WESA 1FZQA 3AHGA 3E3OA 4AIRA 4E1BA 1ORRA 2GF2A 1CERA 3OP4A 4FJOA 1Y7PA 2GBCA 5DGCA 1HQCA 4MWSA 3RWMB 3BHMA 4GC5A 3I9LA 3S27A 4CMIB 4EFDA 3PFNA 3UCXA 5A7GA 4X5TA 4BUJA 5B12A 3UUXB 4I43B 5F7ZA 2I33A 5J47A 2DHCA 3OM9A 4DLPA 3CPZA 2GWRA 4GU5A 4QXRA 2C4VA 2OQVA 5FBWB 1CZLA 3M3DA 4FGZA 3THYA 3KQOA 3BH7A 3P7IA 1GGFA 1BJKA 1SGWA 5FI0B 3E08A 1PGOA 3R3UA 4AN1A 3ZD7A 3HY3A 4MR9A 3SF8B 4OATA 1GNTA 3UMVA 1ML3A 1XDWA 1P77A 2C9ZA 3GGCA 3ZWQA 4X7BA 4OHFA 1FJHA 1VECA 2F8MA 1VP3A 3E9QA 2ACXA 3MJXA 2J07A 2R8YA 4FHFA 1ADBA 4O6VA 5AW5A 2R751 3PDIB 5JWHA 1XWMA 2XNJA 1VTKA 1GGHA 3WK5A 2F1JA 1XJ5A 2M6SA 4MJXA 4GC9A 2BF7A 3PC4A 3KPVA 4E5SA 3TLCA 2UYHA 5HHTA 2AF4C 3DDUA 5DN9A 4BB0A 1NFQA 2OGZA 4LDRA 3A7MA 3LUPA 3CYFA 5HIIA 4ICIA 2R48A 5CDGA 4NQZA 2CV1A 1K5DA 1OWAA 1WCRA 1NVVR 2V8BA 4TXMA 5FYQA 3V32A 3INNA 1PV1A 3OZBA 4LG1A 2XLBA 4CZZB 3DM9B 2FJUA 4WMLA 1G21E 1NSTA 2ODNA 2ODPA 4RY8A 3VYWA 1OEDE 2H16A 4PNIA 3F97A 3M70A 4BNGA 1DAHA 1OJLA 1SHZA 1XRSB 2YWHA 3HABA 1E0SA 1VKRA 2FCAA 3KO8A 2V7VA 4J43A 4NU5A 2D5AA 4RELA 5IXYA 1F17A 3UB3A 3ZEAA 1E1QD 1PK7A 1YJQA 2FH5B 2WIBA 2Y0BA 4LY6A 1WEKA 1J90A 3DV9A 3H19A 3TR0A 3GLFE 2ATIA 3PQ3A 4BVLA 1V1MA 2DPXA 2JHAA 3LK7A 3JWEA 5EOVA 5JMPA 4E2WA 5JD6A 1LDNA 1Z36A 2JI9A 3VR3D 3FDFA 1ZMBA 4OK6A 1BE0A 3INGA 2OBLA 3MT7A 4NONA 1A9SA 2GCOB 2XQ3A 1GPH1 2HSZA 3S2EA 5DQWA 2C7BA 4IPTA 4V3CA 3EGCA 1FXUA 4EELA 3MKDA 4O1IA 3VTKA 2E8IA 4RHEA 4RLHA 3WWOA 3STUA 4BL5A 5KHLB 3KVBA 1JIVA 1JS1X 4FR0A 3BWVA 3LH5A 4YALA 2Q7DA 4UIGA 4HNGA 3VPXA 1Z8DA 3F3MA 3CX7B 1ZH0A 4TYMA 4ZXFA 4E1VA 3VR5H 1U1CA 2X9NA 2HFJA 2H5LA 3HWRA 4XB1A 3HCPA 2HGSA 4M8IA 5FL7A 1J9GA 3UMRA 4KWCA 4NBKA 2BWJA 1HYGA 1P1IA 5IWAT 3S28A 3X2FA 4OIFA 3ZU2A 2RGGA 3Q3JB 3ELUA 4F8YA 3K0BA 2IXEA 2XTJA 1IE3A 1OVMA 3WGNA 4BEJA 4IX1A 3C7TA 1YE3A 1HT1E 4M3NA 5DCUA 1IHPA 3DE5X 3HGQA 1EDZA 4GT1A 1A4RA 3OFSA 1J4AA 1C9KA 3JZAA 3QW2A 5FUYA 1E77A 4RABA 4EUNA 3W1WA 1OLXA 4FYWA 4WK0B 2R1UA 1UBFA 3U7RA 1P61B 5JNUA 2HOQA 2M6RA 2YJ6A 3ZYMA 3M2PA 4U02A 1W9MA 5F7JA 5FWXA 5G0VA 3WLHA 3U4GA 4YLYA 4X3CA 5BNTA 1UBLS 2H08A 4JT2A 3TNDA 3UGTA 1KAMA 4HYTA 3SC2A 2XTNA 1QG4A 3OURA 3RW9A 3T7SA 5LKRA 3GWHA 1HCIA 1PP4A 1S2NA 2FHPA 2H5JA 2HIAA 3A3KA 3OZGA 4YJ3F 4CKBA 3KQMA 3R9XA 4MSUA 3B53X 2VHUA 1CJBA 2C9CA 4GPIB 4TT3D 1A72A 1Q1QA 3D54D 4RH1A 1A27A 1HH4A 3IPXA 5AM5A 1LVFA 4C14A 4ZAWA 4DPMA 4AMVA 1KDYA 4EATA 1CR1A 1QYVA 1IJKA 2BYTA 3ZI0A 4ENSA 1GU0A 3RUIA 3U7QB 5CD1A 3ZT5A 4N78D 4Y2VA 1TVKB 3QG1A 4KK4A 3QUCA 9ABPA 4DJDC 1KEZA 1EXMA 4EI8A 1MB4A 4GXTA 4NENB 4BN5A 2ACEA 2A86A 1IAVA 5C80A 4JAVC 1U1GA 1CYEA 1ZO8A 4MAAA 4AQFA 1EB9A 2HU5A 3IIMA 4RVDA 4ZEOA 5AVKA 1TO6A 4M0PA 2PS9A 4WW0A 5TXGA 2H2FA 1R6DA 2RGNA 4KN5A 3WYCA 1Y3IA 3MTIA 4FBMA 3KV9A 1SCQA 1YVDA 4R1UA 4W5WA 4MYSA 3ZC3A 3C1UA 3AR3A 1YQ3A 5F51A 4FB4A 3F71A 3LK6A 5EIBD 3RPEA 2X19A 2P6UA 4RZ2A 4CLRA 1BMTA 5IKEA 5J23A 4JBGA 1X8KA 2D2FA 3OOEA 4QL3A 5EKDA 1CULC 2CMFA 3D0OA 5ALOA 3G0DA 4D9JA 3TMYA 1PZXA 1NI4A 3AZQA 3MJDA 4JV5T 3UWDA 2A2ZA 2H7CA 1CVRA 2VF4X 4I8IA 1ND5A 2PEYA 3U7IA 1COZA 2OE2A 2R8RA 5EJ4A 8MHTA 1RCFA 1ISSA 5I4BA 2E48A 5AFSA 1IJFA 5AM3A 3KV6A 2ET6A 2IBSA 3N9LA 1HQDA 4MQEA 1QGOA 5AHRA 3N9PA 4HI0E 3P9QA 1SK9A 3ANWA 2XZTA 5JNSA 1ZAYA 1O6ZA 1OLUA 2X14A 1T0HB 3OBVE 3EVEA 4BWFB 2FR0A 5FH9A 4URWR 3SHOA 2VF5X 1VPLA 3MTJA 3VR4H 1TM7E 2Q8QA 3A9VA 3BB3A 4DV1T 1CUYA 4YMIA 5KC8A 2ZM6B 2XRMA 3A1DA 1Z8UA 5JDNA 4O59O 2BTOA 5GM2A 1IEQA 5LOVF 3LC0A 2FWAA 3CW8X 2CWOA 2YRFA 4HVLA 2EIXA 3SQWA 3KYIB 1AM4D 3U5TA 3PUWA 2D2IA 4M1ZA 1Z5NA 2DL1A 4PTZA 1SC6A 2AE1A 1QHSA 4WZBE 5JJ5A 5DXAA 4M0DA 1H1LA 1DQZA 3AXTA 3O1HA 1GPMA 2O0HA 3ADPA 3RI5A 2ZSJA 2ORED 4LNAA 4YRAA 1QOPB 1RJWA 3CC8A 4X92A 3ZWWA 5B36A 5AYVA 2GXAA 1VSQA 2JS7A 1D07A 1DG1G 2EHDA 4ENPA 2IVZA 3EEIA 4KXLA 4JI8T 5FNVE 2AG1A 5J5AA 3UJ8A 4ZDJA 2QTTA 4C5CA 4TUYE 1N32B 3GFOA 3TRIA 3TECE 1R0XA 2C4MA 3E22B 4KQWA 3RK1A 3F3YA 3BRWA 4P7BA 4YJGA 3AJEA 5KYKA 1W2WB 5JXWA 5KHOC 1ZZGA 2PKYX 3TLJA 4OX9T 4UQPA 2I3ZA 3DO8A 1A2OA 4AO6A 3EARA 3MN1A 3S8EA 2W2NA 1E4OA 3NWPA 4HE8A 2WDPA 2H5IA 1R3DA 1B0UA 4UEJA 3ZLVA 4Z2YA 5IX8A 2BEWB 1CW2B 3NP9A 4YTMA 2VWAA 1VMIA 3IQEA 3NFYA 1DWUA 4FI3F 1SEPA 4NMXB 3VDRA 3WK9A 3OAAA 2FCRA 1AUOA 4X20E 3M1LA 4JU9A 2V5VA 1PT5A 1N2XA 1NBAA 3CLRC 4Z6KA 2G4CA 4LOKA 1OC2A 4P5PA 2Y1WA 5G3YA 4UOZA 2ZREA 5L7YA 3SKYA 5IJZA 4H27A 4QUJA 4LZZA 3RKUA 3NTXA 1EVZA 2ZTUA 2DE0X 1NVBA 5EMJA 1C50A 1FP6A 1UC8A 2BEUB 4IICA 3U9LA 5DYNA 2YFHA 2AFIB 3WVNA 4UV9B 3F9IA 1OPXA 1XXHE 1YZVA 1YRYE 5EZYF 4QTTB 2F43B 4XYMA 5FUBA 3FZHB 1EBFA 4NOMA 2OCPA 2C7VA 3R6DA 3N9OA 1S6YA 4GMFA 4JB0A 4XSHA 5AVOA 5ITZB 3VKFA 2G6BA 3KOYA 2IW1A 2O7VA 4Y0NA 3IHLA 3DOFA 1XCMA 2CLLB 2DULA 3ABVA 3CH6A 3LX4A 4ZHQA 4YUAA 1WPXA 1Q19A 2GN8A 4X6YA 3ZWPA 4GMGA 1KJWA 1SD2A 3HSYA 4MVJI 3ZKAA 5DM70 1N9GB 1KMQA 4IYRA 4FZJA 2WHPB 3PFKA 3V2IA 1PV4A 3HJFA 2Q5LA 1CUNA 4S1VA 5HRAA 1QMGA 2YVAA 3RC3A 1NF3A 1GFIA 4EPXA 2JMHA 1R8YA 1FP4A 4D8UA 1T6BY 3STXA 2G1UA 1G1AA 1ESZA 3GZ4A 4LRWA 4P98A 2IIBA 3IP9A 4M0UA 1M0SA 2BZ1A 3S29A 1EFVA 1L1QA 1QG2A 3U78A 3FSRA 4MUMA 5D7NA 1Y6JA 4UHKA 5T4BA 1N2ZA 3KWFA 4EG7A 4URYR 3MNFA 1NJ2A 3Q15C 1CUGA 3C7CB 3HK2A 3ZV3A 4JEUA 1Z4JA 2XMDA 2PO5A 5CB4B 1IN5A 3K35A 4REQA 4WKNA 4MQBA 5CGQB 1UM8A 1V26A 3GU3A 5LCXA 3ROXA 4BATA 5A0VA 1E1NA 5LPNA 4KQKA 3VOSA 2DCMA 3F67A 1GPJA 5DPMA 1FUEA 3MG9A 3NATA 3LHDA 2PUTA 2BJHA 2WHYA 1R0LA 2VL8A 2OSBA 3VZSA 4D3SA 2NTJA 3ZU3A 2J0SA 2INGX 1CK4A 1D2CA 3PLRA 4YS6A 4YV7A 4IFTA 4OLAA 4BNFA 2JA2A 3IQGX 3QU7A 1VHWA 1ZA2A 1VZ3A 1KMHB 1OXKB 4GWGA 2B3DA 1R5JA 4IQFA 4RJJA 4ZPXA 1DV2A 1ZEJA 4PO3X 3TJMA 4EEKA 3L07A 1SULA 2VJMB 4GKKT 4ZHQB 1C5KA 3B3AA 3K4QA 5IWAB 1RRCA 1GL9B 4LJ8A 4BLRA 4NK5A 2ZJ3A 4I9HA 1IB0A 1J5XA 4EPTA 5HZKA 4COOA 1GL7A 1TM5E 3JQCA 3UUEA 2V3VA 2FUPA 1UT8A 4RU1A 3A9RA 1FDVA 4FWTA 2Y1XA 2P1ZA 4HXFB 1UP6A 3DFFA 2YHSA 5CJJA 1E62A 1G8YA 3DOEA 1QO9A 1SCUA 2JI8A 5CURA 1A8HA 1FQJA 1AZSC 2XUIA 1XMSA 3G8DA 4H7KA 2HTFA 3SEAA 1J1ZA 3OT4A 1PE0A 4ZVSA 5TQJA 5DCWA 3T9BA 5A3JA 5CA1B 3EPLA 1YZLA 2X2PA 2KWIA 3FTDA 4PGHA 5C2TA 1R37A 1IAQA 3TG8A 3VKVA 4WEOA 1HNXB 1G4HA 3TVYA 3AUJB 4FEYA 4GVPA 3ZTTA 2CVHA 4KMSA 4WBNF 3RJTA 2BKVA 1A77A 3AYZB 4PINA 5CDTA 4EKNB 2BELA 4WOCA 3QMMA 5GZ6A 5CEEA 4OO3A 3N0VA 4G0OA 2R5NA 2WHPA 4EZ4A 4JBIA 4Q4AB 3WJ7A 1WPGA 3KEMA 3RRJA 1TK9A 2PUBA 4O29A 4IHJA 5F2EA 5F9HA 1W47A 4DNDA 2JZOA 4IAOA 4LBYA 4YAWA 4X24A 2N9UA 4JLWA 4N47A 1L7EA 1U0LA 1VL0A 3VU9A 4EVSA 1MVNA 2ZAYA 4R68A 3HB9A 3C87A 3JQAA 1H9BA 1T36A 1L7BA 2XPKA 3DJBA 2W0GA 1J42A 1SU8A 3G2MA 4DUGA 4LTNA 5CXQA 5JCJA 2GERA 2CXDA 1J70A 2ZPAA 3IIIA 2DUJA 3MOIA 2XA1A 2FEPA 5ITSA 2VAVA 1K8RA 2BEUA 1RQ7A 1AQJA 1QRTA 3QFSA 4XLTA 5B5SA 1W36D 4FI5A 1GQ2A 5MGBA 1Z4MA 1MNQA 4FNOA 5JBNA 4OQMA 1QRAA 2I6TA 2A58A 2DC1A 1T3ZA 2CNLA 3H8VA 2DJIA 4IMIB 3T3GA 4CKXA 2EU8A 1BMFA 1GZ6A 3D0RA 2OLTA 3NKVA 4FC7A 4C6HA 3LDHA 3GRCA 4EY3A 5C8ZA 3KLNA 3CUTA 4H1VA 5JROA 1OTYA 4FEGA 4HBZA 4JH0A 2NAPA 5EINA 5CAEB 5EKSA 2QBYB 1MOQA 1IRIA 1FLAA 2Q1TA 4CKEA 3HVJA 4ZVMA 1MOSA 4E33A 3VC3A 2AB0A 1V7PC 5CB6A 2MINA 2O2DA 4FGUA 4OOFA 1U81A 5JMWA 5KOHB 4HB0A 4AQFC 1K0UA 2IYTA 3DAPA 3QI7A 1DJPA 3M3ZB 1NPTO 4QUBA 3AZOA 4UUPA 3FKSA 5K51A 4JKOA 5C53B 4J0HA 3CKDA 2BFFB 4DW8A 5CJ2A 4EAAA 1E8DA 3I37X 2HNBA 3ONDA 5DM1A 1ZUD1 3JZDA 4W9MC 2ZI9A 1IPFA 1VIVA 2IEYA 1K5PA 3HVIA 2OMEA 3I45A 2HC9A 4I1OA 3VO1A 2HIMA 4EJFA 3IR6A 4IZIA 4F45A 4EY7A 1WVMA 1FRNA 4D5EA 4X0EA 4LE1A 1PNTA 4F86A 1G16A 3K09C 3LQ1A 1SVSA 1Z2DA 5TNXA 1PQ4A 2ZRQA 5DTJA 4JEMA 1RC1A 3OOJA 3GJQA 1FFGA 1VJDA 1ZU4A 2RHWA 2W2VA 3ORQA 2WWFA 3DHEA 4GGPA 5IUNC 1VMKA 4NYJR 3TB4A 1K9VF 2I29A 4O4LB 3L8DA 4RGBA 3KQNA 3QX8A 5FWYA 1SM4A 5IVIA 4EG3A 4WKBA 4IFEA 2ZQ5A 3E53A 4GSYA 3E0ZA 1QYWA 2GEUA 3AKZA 3L8RA 1VLZA 2CXSA 1VG1A 3BXXA 3GJXC 1NN0A 1QBGA 4P2BA 4G4JA 3EABA 4YYZA 2AXEA 2OCDA 4CV1A 2X41A 1K66A 1Q7EA 3P2KA 1NRIA 5TY0A 5DVZA 3NDPA 5H9WA 3HNRA 4M36A 4P5EA 3ZN2A 3ZC1A 4H3HB 3VAYA 2OCXA 1VPEA 4MWCA 2B0CA 2FEKA 2G9VA 4IIJF 3MJTA 4QU8A 4JUIA 4EKYA 2XE8A 5CYFA 4ZQFA 2ZJAA 1XTVA 3AOEA 3JQ6A 4QDTA 2ZSUA 3O4RA 5JDCC 3PUAA 1Q0RA 2GPAA 5BVGB 1ZH4A 3P9SA 3LUBA 3CA8A 1Z37A 4EHLA 2HK8A 3JAKA 3AA0B 3BMQB 5IYZF 2XRYA 1EFKA 4OHUA 3WGUA 3AA7B 2LRLA 2I4IA 2J48A 2QM8A 3ROFA 2OZEA 3RTAA 1OZHA 3AFGA 4EHKA 2ZYHA 1A7JA 4F5ZA 2HA7A 5IAOA 1ESNA 5IKMA 3EIEA 1BFUA 1V9CA 1ACJA 2ZB8A 2EGGA 1LSSA 3B2EA 4IWNA 3R7WB 3TQCA 4DV6B 3Q2OA 1KO1A 4HN4B 4YQZA 1G8FA 2PBRA 4ADSG 4DDVA 3HKDA 3LL4A 4UBMA 3ANWB 4PX2A 4AKSA 3BMCA 2IEIA 3ESLA 3O8OB 4PJNA 1AUPA 1ZD8A 1NQTA 2GOYA 2JDIA 1TGYA 4DVJA 2EDCA 2DBQA 1T8PA 1XC7A 1YK0A 1TTQB 4NU8X 1T24A 1G41A 4KBMB 4Q47A 1BS1A 2P9HA 3UMGA 4E31A 4CFSA 4LGCA 3C1OA 1AF7A 5I7WA 5G0SA 1JHDA 3DP7A 3EW9A 4CQMA 1FMCA 2CLYB 3HUTA 2OQIA 5BXQC 3KVYA 2DP4E 1X7YB 5B55A 4RFSA 1L5NA 3WLMA 1AHIA 4GQAA 2DERA 2ADMA 2XAQB 4W6QA 4L4SA 3PT5A 4R40A 4RW0A 4LFAB 4DJJA 3W6OA 1QX3A 1XK6A 3QVWA 1VE9A 2BCGY 2NUAB 2R25B 2CE2X 3W9SA 2ETVA 4MMZB 2H1WA 3ED5A 1JYSA 2C1EA 5EP4A 1GKLA 5FBRB 4YYEA 1N6IA 2BP7A 3GAMA 1D1CA 3HBJA 4C2BA 2XQ8A 2QTFA 4CF4A 3UC9A 3PU3A 2VH2A 3UKOA 2Z43A 3O4VA 4Y1EA 4O8SA 5BQ3A 3MD0A 4K9OA 5IC4A 2C2ZA 4DMGA 5HZGA 1JXOA 3HGTA 3GN1A 5BQPA 4KIFA 3DA8A 4EKDA 4PIMA 2P9FA 1AKWA 4RHTA 4X6XA 2A72A 1TVCA 2O8BB 4NZOA 1PK9A 2Q4RA 2R6JA 1YH3A 1Q6YA 4L5BA 1U94A 2ZUDA 2CJPA 1SUPA 3F46A 3G9UA 4RJIA 1CWUA 4Q3AA 1DINA 2AOUA 3AERB 3DNPA 1PBTA 4O4HE 2YCBA 1U8FO 3AVPA 2QRVA 4Q4LA 3NDJA 1N36T 3MCUA 3RS5A 1ZRSA 4OU5A 1I6KA 1YAHA 3B9QA 3GXBA 4LA4A 2OHHA 2KMLA 4LNUB 4R01A 4QDXA 2GAOA 1XVVA 1FNBA 4YLGA 4CI2B 1E3DA 2BM1A 3FM9A 1XX6A 2GK3A 2OY0A 4PQEA 4X1KA 4MRMA 5DHPA 4IXWA 5LKAA 2KNDA 4P83A 1SOMA 4WY5A 1MAWA 3ZE2B 1JEEA 1HOTA 5JZ9A 2CXFA 5AVSA 1G6HA 3FMFA 2QGNA 5FQNA 1MRNA 4QUEA 3RC7A 3KT0A 3FZKB 4M0FA 4M7PA 4HAOA 1G21A 3OQOA 2ZITA 4OF4A 3TLXA 3MRXA 3UQZA 3QFCA 4B7ZA 4GZ5A 4YPFA 3GA5A 2V96A 2X0IA 3HCNA 5JDIA 2ZAOA 5FPQA 3RKOA 1RWOA 4ALKA 3G0GA 3B52X 3SS1A 3F6BX 1BA3A 3NHRA 2VYFA 2PLAA 1G2QA 1VIDA 2NYVA 3FYDA 1VDZA 4QTUB 4ZI2D 1JWAB 2WM9A 2YKSA 1NQUA 4TMVA 2F3QA 4PFKA 5AJHA 2C2XA 4G3XA 5IXJA 2OUIA 4QLAA 4QWNB 2VBCA 2AOVA 3EB9A 4TWJA 2ADOA 4G9GA 4HTAA 3B13B 3EZYA 4KP7A 5FPYA 1E4YA 3K1TA 2I6GA 5AVQA 5L3SA 4JWTA 3E4CA 2M1ZA 4U2YA 2ZJBA 1ZN2A 3HKBB 4PG8A 2DWCA 2Z4TA 3EE6A 1Z56C 1JHUA 1FPMA 1R9GA 4DR7T 3T0FA 3T3PB 5CDUA 2GK7A 4Z4EA 3EDVA 1V11A 2X1HA 1Q20A 2IW5B 2HMSA 1KVSA 1OQAA 3DCIA 3OJWA 3I9V1 3SXPA 3Q8WA 1M2OA 2K4MA 1TYAE 2FMFA 4G5YA 2DQ4A 1F7VA 3ZDAA 4HB3A 1FFXA 3C70A 3FPBA 5H81A 4GKKB 2GBFA 4J3NA 2VZEA 3VVBA 4H18A 1W0JA 2KI5A 4UCWA 3IQFA 3Q3VA 2D0DA 4DLRA 4KC0A 5K3OA 2HWWA 1TYZA 3QYJA 5DYTA 5EPOA 3CVVA 3EASA 3J7TA 1CR6A 1XTRA 1BVUA 3CWCA 5J1SB 2IPMA 5H6QB 2WU1A 1RRKA 4OQFA 3P9NA 3WSTA 2OBBA 5JSQA 5JRZA 3HO1A 1K8YB 3NM6B 1SUIA 4MI3A 1WW8A 2ATXA 1JQAA 3CQXC 1Y4DE 3PWKA 3EN0A 4ZANA 4C0BA 4IE5A 5AKXA 1IBRA 3F5MA 4LHEA 5DE3A 3D4NA 2IEBA 3UGJA 1DHRA 2QJFA 2HFKA 2W22A 1X7ZA 1EBUA 5FY0A 1WQ1R 2QB5A 2NT4A 2SNIE 2EHOA 2R6AA 3HXLA 3ETJA 4I1RA 3U56A 2I7DA 1CE8A 2P35A 4L4YA 2Q49A 1RJDA 1CUIA 2VRCA 1E2QA 1K1EA 3CEMA 1WLSA 3KBBA 4Q03A 3LPDA 2H0RA 4Q9JA 3AVRA 4EDFA 4HDCA 3ZZ1A 1HG0A 3U4MA 4YIKA 4JI2B 1JKXA 1YCDA 1Y98A 3IO3A 3RB8A 2YR0A 1OGJA 2J45A 4QLBA 4YP9A 3TZKA 3PGKA 4LQCA 4FGKA 1W581 1DXOA 3L18A 1N34T 1RR6A 4KLAA 4LOIA 4X54A 2CEAA 1BCRA 4FSXA 4HGZA 4GZ3A 4PQYA 5LP6F 1XPJA 2J6IA 4XGIA 1I30A 3FOZA 1V9LA 2IUYA 3VAAA 1XTTA 4AIIA 4E7OA 2ENUA 5DP2A 3VDMA 1B26A 4K0RA 5LGUB 1KP3A 3R9WA 3ONVA 3JWPA 2K48A 3G2KA 4JQZA 1HS7A 3QK7A 5AI9A 2PUCA 1R8QA 3W8EA 2ZW9A 2Z6EA 1MVOA 2IEDA 3ORRA 3SX2A 3IEKA 4BFWA 4E22A 4YMHA 1PK8A 3L5OA 4Q3KA 3P2OA 4NS1A 1Z6GA 2F9MA 4IIGA 2ALJA 9ATCA 5K0GA 4AKGA 1QR2A 4V0QA 3D0TA 1JN0A 3USZA 3WRXA 4FILA 1HDCA 2ZBRA 1XDDA 2HIHA 4FT4A 4JWKA 4CQLB 3OUZA 3BSSA 5FB3A 4ZICA 5AVXA 3F57A 4RENA 5B6JA 1I14A 2G9UA 2V6JA 2VH5R 4QGGA 3BFJA 4H4CA 5LMZA 3ZKWA 2COEA 3A9TA 5BRAA 1C0PA 1M6HA 1ECLA 2P2NA 2E9XD 3G6KA 1E5LA 3W9YA 2RGXA 2DFTA 2D1QA 3C3XA 3L1HA 3Q9SA 2CXHA 3HFJA 3MWFA 5H68A 4EJSB 5JYCA 4FGSA 1QFMA 4MUFA 4F2WA 4CMBA 3KVNA 3C8MA 3GVIA 4OYLA 2A92A 3AILA 4PSVA 2XWQA 2RI0A 4TL9A 5CM9C 4ER7A 1UBJS 1X39A 3HXKA 1RIFA 2AIRA 4B1FA 4H16A 1FBTA 5K3FA 5JD4A 2H3RA 3SCZA 4E7SA 5HKBA 5HSGA 1G3UA 2BEJA 5EERA 1M2EA 1V37A 4MS1B 4BO6A 5LXTA 5HDQA 3BKWA 3IUQA 5DGXA 1X70A 1R3UA 1KJJA 4UDXX 3FCSB 1ULTA 4M1KA 1GQEA 1J2YA 3PE3A 4R8SA 2DMRA 3FUCA 3RVPA 4BJ6A 1YUMA 3SZRA 3CE9A 1C3LA 2D2VA 1CY0A 2EL7A 1OF1A 1I9GA 5ARCA 1H94A 5FHQA 3TO5A 3P0HA 3FZEA 3D2LA 1DHTA 3G2QA 3ESRA 3CX7A 4Q82A 1VIAA 5LHHB 5DRTA 4DA6A 3E05A 5GMOA 1MV8A 3AFNA 1B42A 2GAJA 2A9KA 2B82A 4UU7A 4NBVA 5FYMA 1UT5A 3UU6A 1LQUA 3RTDA 1GN8A 1T8UA 3CCBA 1U0TA 3TIGA 2BH2A 1L9KA 2E5LT 1RZUA 5HEHA 2W2QA 3EODA 3G49A 3IJ5A 1DUIA 4GGMX 4O8CA 2HA4A 1JA0A 3RF6A 2Q6TA 4XM1A 4AYWA 3QE9Y 4BV2A 4UE2A 3CGWA 3HJBA 5E9QA 4YRTA 4OI1A 5ABGA 3FBWA 2H2IA 3TLUA 5T3UA 4R83A 4D97A 3NETA 2ONCA 4H15A 4IGIA 1P45A 4A27A 4J2TA 3JQRA 5IFLA 4C6TB 5J4YA 1I0IA 4XZCA 3BMXA 4PYQA 5KREA 1OY1A 4BQOA 3F96A 3QPCA 2LM2A 2FN3A 4E12A 5EWMB 1EK5A 2HKIA 2JQ9A 1N3LA 3KFWX 2OBXA 4KBFA 2HRDA 2QUJA 4MO9A 4JVMA 4LPKA 5IAKA 3TI9A 4IJMA 3V2GA 4D4LA 2QVGA 3EPRA 4WNKA 4M6WA 3MD9A 4CEJA 2YXLA 1W4LA 3RQWA 1KI1A 1MBZA 1T2AA 1PKXA 4ALNA 1LRLA 1P29A 3Q1KA 3L04A 1P2TA 2WJ4A 1ANKA 2D0IA 1CVLA 2YVQA 3ISVA 4HVAA 4PZZA 4UNSA 4TRJA 5AJVB 2YOGA 2X8JB 2GN0A 2C0QA 3GQBB 3JALA 3AONB 2VLIA 4FEEA 1RZRD 1IOWA 1F2UA 1GEGA 4TKUA 1XZJA 3IVMA 3A1UA 2A3RA 5ESDA 3T1VA 1U8YA 4JBLA 3RHFA 3ZZTA 4BDSA 1EM8A 5HGXA 4IEEA 3WK8A 3TQIA 4BMPB 4U2BA 3VHRA 2OP0A 2Z8YA 1W93A 2VDRB 4QU0A 5FORA 3WK6A 5CLJA 3MLAA 4CN1A 1F14A 1K92A 1XXHA 2J9GA 2QRHA 1TJNA 3O8NA 3UK2A 3X1WA 4E2FA 4ZGBA 1A71A 1DGQA 4Q3NA 5JH7E 2VSYA 3DR3A 2IFTA 2OA0A 5BORA 2CBZA 5KUTA 4L6CA 4HS9A 1T4CA 1KETA 1ODFA 2CW5A 3RREA 5CT8A 5WRFA 3S81A 1K2WA 2F1KA 1GVHA 3KOXA 3U1TA 4W8HA 4AN4A 4MQFB 4KODA 2BGWA 2NSDA 1JR3D 4EITA 1RYHA 4KSCA 4NU0A 3FYSA 3P71T 3V46A 6CHYA 5EQJB 1UDRA 3BGIA 4CIWA 4FR5A 4A2QA 1KE2A 4D5GA 4WL0A 5C8YB 4B6EA 4AKHA 1ESDA 4BNDB 2XECA 4F2HA 2ZZMA 3EPPA 1PJBA 1LKXA 5JXHA 4Q9LA 4JUDX 3HBNA 1ZJWA 1YKEB 1JVNA 4Q39A 4G5SA 5TR9A 3VNQA 4B9AA 4D6XA 3FTEA 1KY5A 2DUNA 3PUYA 1UBMS 4F46A 2CFCA 1MD9A 2YFYA 2PZLA 3DVAA 4JFRA 3D8NA 3IS3A 1J1IA 4RVHA 2WWVD 4RVUA 4ETWA 2P3LA 5L95A 4DR4B 3FGOA 4DM3A 2WG1A 2J9FA 1JFFA 1M83A 1ORVA 2FSPA 2G4VA 3R1IA 5FFMA 4DNXA 2QLJA 2PMBA 1HT3A 3T1TA 3Q12A 4IWXA 5DX1A 3WTBA 2CF5A 1VSBA 2ZJYA 5AK5A 4AS1A 1VFNA 4ZI7E 2JAXA 4DCCA 1R4MB 4HEAA 4W5HA 1N5DA 1P39A 4RXMA 1Y7TA 4IIYA 2MT9A 3ETCA 3PHBE 4DCSA 4HTEA 1VYHA 4EHBA 4PW8A 2IHR1 1IZYA 1ULSA 1J0DA 3NHSA 4GDMA 4Z0PA 5C8DA 3EUFA 3ZHQA 5D51S 1LX6A 3AUTA 4HFEA 4RL6A 4QFMA 4ZARA 4UVIA 3RUAA 3OWHA 3UMBA 5BN5A 3QLVA 1JMYA 1YD8G 1GPKA 3PV0F 4RA9B 1ICEA 2HEIA 4PG6A 2HPHA 3PC8C 3S2SA 4ARAA 3K6SB 3DXXA 2J0UA 1BEUB 2O2CA 4DT1A 1E2IA 1VLVA 4CUJA 2O8BA 2XNDA 4LRYA 4TZ4C 1LF5A 5FCDA 2H1HA 1FW8A 3MTBA 4GIBA 4FYPA 3BHJA 4WOBA 3A6PC 3P4SA 2RHJA 4HUQA 4NU6A 1OFGA 1CY8A 1XQ6A 1AA9A 4IGEA 4K81B 2ES0A 4G0PA 5L40A 3DMTA 3I34X 2PZEA 3ZJ1A 4H17A 2WLTA 1CXZA 3JQDA 5EIWA 3CLRD 5C5IA 3ZHRA 1AMUA 2OQRA 2B9EA 4OXRA 5MF6A 1LK5A 3PJEA 4JT4A 4WFJA 1HE3A 4B2PA 1WF3A 2JFUA 3WI3A 3TTVA 1KZGB 4MWEA 1SIBE 2AC7A 4KLNA 3W5UA 3KPJA 3JQPA 3PKJA 1GUAA 4KWEA 1TUBA 4KMRA 1W6RA 3HU3A 4ZMSA 5MGNA 2AVDA 1BU8A 4JLEA 2Z3ZA 4UMVA 3WGOA 3Q2IA 1ZGHA 1ID8A 1CT9A 1GZVA 2DQSA 4MVJD 1X79A 3DMNA 2XZOA 1QH9A 5AXCA 5KVSA 3LF1A 1FSPA 4O4IE 2E4UA 3IIJA 4RIHA 5GONF 3ODGA 5LOVB 3OEEA 4LVUA 5BSWA 4LMKA 4WA8A 5FWAA 2VKQA 1R8IA 1CFZA 2JW5A 3GD5A 1ZISA 1O5OA 5BWMA 3DCYA 4GLBA 4B9EA 4DV6T 1UK7A 2O6HA 3M4ZA 3ILYA 4GI5A 1Q7TA 2BS3A 3LECA 4FHCA 3T1YT 3C6ZA 4BBZA 1OH6A 4NFLA 1RABA 5LOVE 2OQ2A 4E14A 2JFZA 4NXMT 3EHDA 1MZPA 1FTNA 2C82A 1K9SA 3R4CA 4G1U<