4PAGA

Abc transporter solute binding protein from sulfurospirillum deleyianum dsm 6946
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
323
Chain Sequence
ESRTFLDVSNKPIVLPEHITRIYGSAPPISFMIYVIDDTPLIGVNSPQTNKDNNNGEKFLSKHFMELPILGGWHGNNIPNLEAILAAKPDVIITWDTPLLNEKTAKDLARISIPALKVNIDDSQNYPEVFRYLGRVMQKEERANALANMAQTYLDELKTFVASIPEKERTKVYYAEGDFGLQTECDRSFHSEPLALAGGNLVHKCVQNSVVGLQEVSFEQIILYDPEVIIVQNPTFYKTVFREKKWAVLKAVQNKKVYLVPKSPFNWTDRPPSFMRILGAHWIASKLYPTRYPYKIEDKVKAFYQLFFGVELSNEDLKTYFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ABC transporter solute binding protein from Sulfurospirillum deleyianum DSM 6946
rcsb
source organism Sulfurospirillum deleyianum
molecule tags Transport protein
molecule keywords Periplasmic binding protein
total genus 105
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4pagA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4pagA03
4XPIA 4H0FA 2AFIA 4WN9B 5JPDA 1QH8B 5M2QA 4FNAA 2AFIB 4WN9A 2PS0A 1N4AA 4UTOA 5BVGA 5JG7A 3R5TA 4OXQA 1ESZA 2OV1A 3ZK7A 3MFQA 3MWFA 2ETVA 4G07A 2OSVA 2QI9F 3NU1A 4LS3A 1FP4A 2YNMD 4N01A 1KAEA 1K75A 3TEFA 3ZK8A 4BBPA 4WZAA 5B58T 2M6LA 2AFHB 3AEKA 5CR9A 2XDQB 3AETB 4PAGA 5KOHB 4INOA 4HMQA 3MINB 3EIWA 5M29A 1K2VN 1KARA 4G09A 2XY4A 4TKVA 5I4KA 4CL2A 1MIOB 2XQVA 2MINB 3AERB 4MO9A 3AEUA 3BE6A 2PRSA 4UDNA 5KOJB 5CX1A 3U7QA 4OXRA 3GI1A 1G21B 3K1AA 3LHSA 3AEKB 4HMOA 5JJ5A 4WZAB 5GGXA 4INPA 1N2CA 4OVKA 4XPIB 1QH1A 2RG7A 4MX8A 4NNOA 1TOAA 3TLKA 2WHYA 3HH8A 5BVGB 1QH1B 4ND8B 1L5HA 5CX1B 2XH8A 1L5HB 4ND8A 4WESB 1PSZA 1M1NA 1PQ4A 2R79A 1M1YB 2Q8QA 4GICA 1M1NB 1N4DA 1EFDN 3AEQA 4FI3F 4IRMA 5KOJA 3ZTTA 3K1AB 4DBLE 3PDIB 4WZBA 4B8YA 2XV1A 4HMPA 4MDYA 2Q8PA 4PM4A 5FLYA 3ZK9A 4TKUB 1M34A 3G9QA 2OGWA 3LI2A 3MINA 3TNYA 3AERA 1QGUB 3MWGA 1KAHA 4K3VA 4MLZA 4UTPA 4TKVB 1XVLA 5HX7A 3AEUB 5KHLB 3U7QB 1MIOA 2PS9A 4HN9A 1K7SN 3HXPA 4FILA 3CX3A 1H1LA 3AESA 2MINA 3PDIA 4WZBB 1H1LB 3AESB 3HJTA 4FKMA 3R5SA 2XUZA 2X4LA 1G20B 2AFHA 4M7OA 5M34A 3UJPA 1G20A 5KOHA 4LJSA 4H59A 2XDQA 1N2ZA 1M34B 3AETA 1QGUA 2M6KA 3PSAA 1QH8A 2PHZA 4TKUA 4UDOA 4NNPA 3BE5A 3EIXA 1K0FA 2O1EA 3AEQB 5M3BA 2WI8A 3PSHA 3ZKAA 1FP4B 3MD9A 5AFSA 2R7AA 5HDQA 2OV3A 5JOQA 1N2CB 4WNAB 4WESA 5BVHA 2YNMC 4WNAA 2PS3A 5BVHB 1M1YA 5GGYA 1G21A
chains in the Genus database with same CATH superfamily
2J4GA 2WFLA 1VJDA 4MEBA 5DTMA 4KOEC 3VKVA 3VYRB 1Z5NA 3UWSA 3DLHA 5FPYA 4BJ3A 4DG8A 3EI0A 1XMQB 4H4CA 4U2ZA 5JRCA 3MFQA 4XCQA 4DA8A 3G02A 4Q3AA 3HRHA 1AKVA 2J5BA 1KMIY 2PYIA 2W90A 2XASB 4BAYB 5DK6A 3U39A 3GJSA 4CFYA 1G20E 3HEAA 3UJ8A 4AKTA 1K75A 3TGLA 2EJUA 1XG5A 1QTQA 4TL6A 4JAVC 4BBPA 1FEWA 1NN0A 3HP7A 5AI5A 3ZCPA 2WKWA 3KHKA 5A5GA 3IB3A 2I4TA 3FSRA 1W29A 3MMNA 1F8YA 4LNUB 2GBIA 3R7WB 2H07A 3WIVA 4BJ6A 5JTUA 1TCAA 1XZMA 2IXTA 3RYIE 3MCVA 4M0KA 1BCSA 5IBPA 2O4CA 1FDOA 1FPMA 1IHPA 4C2TA 3P9PA 4FFWA 2V6IA 3N1UA 1UZMA 2B30A 3W05A 5C8VA 1XCJA 1OJ7A 2ABWA 2ICAA 4C20A 4DYVA 4Q1EA 3ZX5A 5I6DA 1FMFA 1ZJ5A 2V58A 4GMDA 1P74A 2PX5A 3PQ4A 1G6KA 3NVAA 5FPPA 2UAGA 2F59A 2FAXA 5F64A 2BELA 4RKQA 4ZOQI 3HR0A 3UUMA 4XRGA 1QIFA 3C3PA 1NE2A 3UHAA 1S2NA 2EHOA 2AFHE 1NC3A 4EG3A 1TZCA 3BAZA 1SPXA 4XPIB 4WBNF 4G9GA 4DMRA 1T13A 221PA 4UCQA 5ILQA 2OHVA 2A9FA 3IA7A 3S8YA 1NA5A 2RJOA 4EY7A 2J7PD 1G1MA 2E4YA 3T1OA 4J0CA 4RFSA 1PR3A 2A5FA 3GLGA 3K70D 2YDQA 1I94B 4AI6A 2XRMA 4FC6A 3H99A 3MBIA 4BV9A 3MHTA 5CD9A 3BGIA 5GZ3A 4PJLA 1AQIA 2R4UA 1HNXB 3UBMA 3QPBA 5BP7A 2F43A 3LH5A 3T5TA 1ZGCA 5L7TA 2VOJA 5H83A 5HX7A 1KK7A 1HXHA 4GQAA 1W581 4Q7MB 4OP3A 1GG2A 3BH7A 2BGJA 1U2DA 3NVMB 1OE0A 4EZHA 1Q15A 2OCDA 1SIOA 1HF8A 2CLIB 3JX9A 4MCHA 1CQWA 1O94A 1RHRA 3NALA 5K3FA 1NYQA 3HVUA 3QF7A 3RVNA 1A8IA 1SHTX 4E12A 5K0CA 3BQKA 3LC1O 1AT1A 3P97A 2FXIA 2BV3A 2JCYA 3WV4A 3UXHA 1OREA 4ENRA 2BG9C 1PTKA 4ZI2A 2XMRA 4V0MA 5LOVF 4RA6B 2W6OA 1UK5A 2IGBA 4OJMX 1M2VB 3DL7A 1Q3HA 2NYRA 2Q3CA 2OQRA 1T43A 2FPUA 4D8WA 4ITRC 2QKYA 4EKYA 2Y1CA 5AHXA 2HZ7A 2MSWA 4FDTA 1RC8A 1HMYA 3OZRA 1Z2PX 3R9XA 5SZKB 2IDZA 1T26A 2RKWA 1UCUA 4ZZBA 1D5WA 1P0CA 2LPMA 2PR7A 4HDNA 4XIIA 3SG0A 2VXYA 4BVHA 1OQAA 4QXQA 5IH7A 4RTPA 2CJFA 2WZIA 3I2GA 2SCUB 2QGSA 3WLSA 2HU7A 4HGNA 1PL0A 4I9NA 4Q4LA 1WMAA 3RQWA 4NZMA 1ZH4A 1NKVA 3AUTA 4J91A 4KBFA 3MWJA 4G5YA 4EX7A 5LNKA 4OX9Y 3FYHA 4R6WA 4U6NA 1U1CA 1CEEA 1T0JB 3KAKA 3JD3A 3PUZF 2W66A 1D6JA 3JCFA 3VR3D 4LJKA 4UQLA 1CVLA 3IBSA 5FLXA 3D6UA 3N9QA 2R6DA 3QOXA 4K88A 1E89A 4WJKB 3THWB 1BE6A 3GEHA 5A3QA 1GNVA 2B1IA 2FLKA 2GAFA 4INOA 1ZC3A 2A7QA 1OEDC 3C51A 2IT1A 2F67A 2W2MA 3EGCA 1RWMA 2XODA 3IIKA 3UBTA 1OFIA 1LH0A 2DWOA 1NUQA 4NQZA 4XW2A 1A5BB 4TWDA 4P35A 2IOYA 5H80A 3BT7A 2Y8EA 3EZ6A 1H65A 1OU4A 4F84A 1D3AA 2IUUA 3ACBA 3FPFA 1YB2A 5CLFA 1CF9A 1WZEA 2GO7A 2JA2A 4JCOA 5A1JA 3MT8A 3RYCE 3I01M 4NDAA 3OH8A 4WT7A 4AUNA 4GR4A 3GN5B 1CQJA 2CZQA 4P32A 3RK0A 1YRYE 2FA9A 4ZOLA 2OQVA 3SXUA 1QOQB 2A9RA 4ARBA 1W36D 3CCFA 1VZ2A 2I2XB 4GKJB 5TMDA 2VP0A 3QH4A 1U6IA 1OILA 1T5OA 3PC7A 1KU0A 1COZA 2DFTA 1VMAA 3SJBA 1ZONA 1W75A 2HHJA 3G1UA 2GRJA 2JFBA 3DW3X 4INJA 2CL6X 3TQHA 4JUYA 3UV3A 2FGJA 3W2TA 4AZSA 2WU0A 2H1RA 2WMOB 4CQMB 3CGWA 2HPZA 3WDSA 1WW8A 2PWAA 4EKEA 4DE5A 4TYYA 4BXOB 3UKDA 1PV1A 1NE7A 4MYSA 2HQRA 1AU9A 3B5EA 4BNYA 4HMPA 1WXIA 2YN2A 4GMGA 1QC5A 4KYVA 3OT5A 4AQFA 3E5MA 4N65A 2YMLA 2XQ6A 3EXG1 3NHMA 4Z9BA 4ZYVA 4RANA 1E3IA 3LI2A 2ASEA 3I45A 4D9KA 5C4IA 1M6VA 2H2AA 4N6NA 4C6SA 2ZKIA 4B46A 1NG9A 4LOIA 5JDQA 1I30A 1KAHA 5CEFA 3KQVA 3RIUC 4ZI7A 2MSLA 4YALA 3I6MA 3GNQA 5EY5B 5F9MA 3S1AA 5H4GA 3IQZA 3UGJA 1NAHA 4WCFA 3D1LA 5D3MA 3V4OA 1H1LA 1LI5A 5LBTA 3AI7A 4I5EA 3AILA 2H8GA 1GFSA 2IQIA 3BTOA 3A9CA 1U8UA 3EDQA 3MNFA 4XQ0A 3OCVA 4B48A 2VKHA 1ISIA 2AFHA 3AE5A 3A2NA 4WCDA 3R7AA 5KTTA 1XCLA 3SVLA 4PLYA 4AYXA 5ALXA 4H1TA 1CNEA 1KC3A 1V4VA 2KS6A 3CCBA 4DUZT 4DSZA 2ZUFA 3PICA 5COQA 5B37A 4LY3A 1CCWA 2H4YA 1KFEB 1VJ5A 3KG2A 1KWKA 1QXSA 3CVVA 2QHXA 3HZOA 5DCLA 4YN3A 1Q0LA 3IHLA 1VHDA 1ZUNB 4RCZA 2O23A 2PL9A 2QXTA 3E3NA 5K6AA 1YQQA 4IUYA 2AG6A 3BJIC 2BZ1A 1QHHA 4QU8A 4HR7A 1NT2A 2V5VA 4BZPA 3GDOA 1RXIA 2UZ0A 1SVNA 2A72A 1IL0A 3GNLA 1GTRA 3R23A 3VAAA 2C7VA 3T0FA 2W2OA 1KH3A 1P7PA 2H65A 5L3CB 2P3OA 3LQKA 3QVOA 3TKAA 5F7OA 2QPAA 3OT4A 4NZZA 3ZVLA 5KYWB 1TB4A 2PKWA 3QLEA 4N40A 4URUR 2QTZA 3BWXA 4YUWA 5EMHA 4C91A 1FZTA 1ZCAA 5JG7A 3F2VA 5DGCA 4KPUB 4RD4A 3NIBA 1A4RA 3FPKA 4DCNA 2F6RA 2WTBA 4DWVA 2IHVA 5MN6A 3RLFF 3ETGA 4GI1A 1PE0A 3DEAA 4Q7JB 4CG0A 1V1JA 2I87A 4IZIA 1YC5A 2AC4A 2R1VA 1AN0A 2HMVA 3QLTA 4H4DA 3NDJA 1MGPA 4CEJB 2GYYA 1FSPA 4LQDA 4EG1A 3ZWMA 3QU5A 2QYHA 3AW9A 1LNSA 3H97A 4V0SA 4X63A 4JUFA 1M8PA 5DXAA 4BVGA 2GK6A 1V8OA 1XAIA 2KMLA 3H2ZA 3RK4A 4F38A 3LFUA 1U80A 2W7TA 3L8YA 2ERCA 3D8TA 1HT0A 3A10A 4G89A 4IV8A 4UNPA 4HGAA 4ZI7F 1LV7A 3KYCB 3WLRA 2Q9QC 4ITUA 4BO3A 1JKMA 2LM9A 2A5YB 4BB6A 5LG4A 1GRCA 4CWAA 4Z51A 4GC9A 4PX5A 3ILVA 3F7TA 1JHOA 2G63A 2RGNA 3KB2A 3E22A 3WGHA 4L1KA 1IY9A 2P3SA 2BBSA 2WILA 4R2HA 2HRRA 4EB6E 4H9OC 1CR4A 1ZCZA 3T5PA 1QTNA 2D62A 2E87A 2FH5B 4DC0A 1LBIA 4F5EA 3EAFA 4EG6A 1M1UA 3QUCA 5HG0A 2E4VA 4Q3DA 2FKNA 2IE8A 5BPFA 2WS3A 3C50A 4LV5B 4EY4A 5CM8B 1HETA 1XA4A 3DZKA 3ENVA 3N70A 5DQWA 2NIPA 3EVYA 2RHRA 2Z9DA 3OM8A 2UXBT 4KI0A 2A4KA 3W4KA 2DT5A 3AOEC 2JVKA 4M9SA 3VR2D 5EPOA 4ENVA 2J33A 3J9X1 3CPSA 5EFOA 3O1IA 1XAGA 3QW2A 4JB8A 1ZK0A 4NY1A 1I4OA 2JD0A 4NU8X 4ZZCA 4GLBA 1M67A 2R7KA 4FR2A 1GU0A 2FEKA 4TTRA 2ZR7A 1I7QB 4QBFA 1XDZA 2OVFA 3FM9A 1N0WA 1WM1A 3EC2A 4TKZA 3CZ9A 4ZHQB 3VNBA 4TV9E 1LPSA 4Y2PA 2UUAT 1QHSA 2R8BA 3SWWA 1JLRA 4ESVA 4JLSA 1A2BA 2X4LA 2XVYA 4FDUA 2QZPA 4R40A 3RS7A 1D4ZA 1HE2A 1W0CA 3SFEA 1X9GA 3IAEA 4BO5A 5HHTA 5IABA 5KB3A 4LMJA 2SECE 4TS1A 5LXTF 1CUEA 3X0DA 3K9BA 3A4VA 4NS1A 4RYLA 3MK7C 2JLSA 4LGVA 1BDHA 3T7RA 3KWFA 3H37A 1Z16A 2I33A 3DMTA 3ZXXA 4W4TA 4RK4A 1FS6A 4XASA 4KQJA 4OV6B 5AVJA 3AL0C 1UJCA 1XZLA 3EVZA 3G49A 2X86A 2OXRA 1WZCA 5ALNA 1FU7A 1X7XA 3WGGA 2XM1A 1U6JA 2F17A 3V7UA 3WG9A 1KBZA 1T15A 4DPLA 3PZRA 4X66B 3CW8X 2LRLA 4XIFA 1VBFA 4AJKA 5TPWA 1I14A 3KLMX 1RJEA 1QM5A 1HEYA 2IHJA 3PJDA 1ZMXA 1NBIA 4DR7B 2R8XA 2YXBA 3WLEA 2YWBA 3GZ4A 4GKJT 5E7JA 5LQNA 4G37A 5EYPA 4LRTB 5B1HA 3TYXA 4DZRA 4NFYA 1PZGA 2HJGA 1N2IA 2ZT6A 4UTZA 4G5XA 1YC2A 1DC7A 3H3AA 1D0IA 3RYFB 4EEZA 2V6JA 1X9HA 4HQOA 2Y1EA 5FNZA 2FX5A 2JANA 3DKKA 1KFKB 5AVZA 2CLSA 3FPLA 3P2OA 3EXIA 3TSAA 5DP2A 2BEWA 4G1MB 4P38A 5K2OA 3D6JA 2QMZA 3EUFA 2VDWA 2DR0A 1HG2A 2KMFA 3IS3A 4L6CA 1I3MA 2DVMA 1DO0A 5HMLA 4BMNA 5JJIA 2EBWA 2ZSUA 3MVEA 4R1UA 1UDXA 5J9FA 2PSEA 2VR1A 3ZBTA 3LUHA 5AVUA 4R7TA 4TRNA 5HM8A 3THRA 1M73E 4R16A 1XPJA 1OXZA 2PU7A 4R1LA 4F8EA 2OYSA 1LEHA 2JGDB 3FZNA 3DM5A 4K05A 5FRDA 4CLRA 1SHZC 2F62A 4B47A 1ENOA 3K1JA 1OLXA 3QG5A 3I9MA 4DQ0A 1W5TA 2XZLA 5AI0A 5L3SA 1RM4A 3EZYA 1XO1A 2C5AA 2QLLA 3HGQA 3HJAA 3INNA 4JLAA 4K9DA 6REQA 4HH1A 1OB5A 1TTPB 2FSPA 2H08A 3A27A 5HJEA 5IZCC 4Q9AA 3JATB 1T6YA 2AQIA 2OPBA 3SKXA 3ZQJA 1ZJJA 4UUPA 1U0JA 2VLBA 1QFZA 4O2AB 4O25A 4N9WA 3BHIA 1YJQA 1YJBA 1TPYA 2XTAA 4PBTA 2O05A 3L0DA 4NCHA 2JK0A 1JSXA 3ICPA 3I42A 1PLKA 2H4JA 3F7NA 2WHYA 1Y6QA 3FCSB 3GEGA 3MWLA 4X20E 1C5KA 3U3MA 2QPLA 2OAQ1 1Y80A 2OO3A 1UWCA 2X9NA 5HGJA 4NDNE 2K5BB 3MWEB 2UXCT 1CFZA 1RWQA 2Z3WA 3DQPA 3PZBA 4HWSA 1DQZA 1ZM4A 2H7VA 2IXEA 2PUWA 521PA 3ZVRA 1IHDA 3LRTA 3AECA 5ESRA 1VPLA 3TKYA 1OAAA 2EW1A 4FI5A 1V26A 5C3UA 4P2GA 2FWNA 1P2FA 1DIRA 2FZ4A 4JEIA 2C97A 4QSHA 2ZJYA 2VJAA 5K3BA 2O3JA 4XXHA 2X77A 2P1RA 3F47A 1BX3A 3C8HA 3O5AA 3Q7RA 4GR5A 5AOCA 1G0OA 4RK7A 2NMVA 4ZQGA 1SOUA 3UH0A 4EHIA 4J7XA 1SOWA 3PFCA 4FYVA 1DLIA 4JR0A 3UJHA 3LT0A 3E7WA 1T1SA 1UJ4A 1YE8A 2X2EA 4TPKA 5KHAA 5DT9A 4GZ5A 1NXWA 4ZIRB 3BZBA 1XMXA 3FPCA 3GNSA 1Z36A 4KE9A 4ZCTA 1T8YA 2HWUA 4C06A 5L3VA 1SCBA 1VIYA 4U7YA 1PYDA 2UZ3A 5JPIA 3DMTC 5DX1A 5FWXB 4JLDA 2P69A 5KOHA 3CBQA 2VBIA 1OAOA 3AETA 3UU5A 3IDAA 3WO0A 3Q0EA 4EUSA 3DAPA 1YFKA 1XR3A 3H0CA 3RR2A 1L4UA 1B2LA 1J25A 1VJ0A 3WFIA 1HE4A 1AQNA 4B3RB 2DBZA 5FD8A 2E48A 3PENA 4IIEA 4U74A 2QK4A 1TD9A 4PZUA 3JR7A 4AU1A 3R75A 4DT1A 5KHOC 5DLDA 2WI8A 1DDIA 1MB2A 2PFVA 1LWNA 2DWPA 2L2QA 2P2ZA 3RANA 3AI1A 3TE6A 1FFYA 4HAZA 2ZUBA 3M1YA 3Q0TA 3W2HA 2OV3A 4EOZB 3HA5A 4JSRA 1U3FA 4OH7A 1YMUA 1NRXA 1QQ6A 5JO9A 3RBAA 2I1QA 2R6CA 4MIKA 5D00A 4RADA 1M1YA 3GGCA 4PFJA 5EESA 1GD1O 1Z33A 3KLBA 5KKNB 1QIHA 3ROEA 3GROA 1RWKA 2QBYA 1YCGA 2OTCA 3PIIA 4FNAA 2FSGA 4ZT5A 1EVIA 1YA4A 4GI5A 1EUDB 4J6FA 4KQWA 4EHLA 2RHJA 2XZDA 4Q3KA 4WVFA 4OXQA 4CKWB 4DR5B 3GRPA 4LY9A 4QOFA 4UR9A 3ZE6A 2J0VA 1RXYA 2BMWA 2R6R1 3F4LA 3U26A 4P0QB 1PN3A 5E2IA 4OJQA 2MTQA 2YY5A 1V95A 4GPTA 1RACA 3RV3A 5CDYA 4CN1A 1U6KA 3KYCA 4CCYB 2O0MA 1ZQ9A 5CK4A 1TF7A 3GCWA 1ETHA 2O2CA 3L4SO 3OAAA 5BMVA 5EXTA 5LUAA 5REQA 1C2TA 5E9QA 3BGDA 3ZS9A 1PAUA 2AFHB 2IP4A 4AMYA 1XB2A 1FU4A 2NQ8A 2I6FA 2C59A 2PMFA 5LL6P 4KP7A 2OORA 4L8YA 3K5WA 4QKQA 4KWIA 2M9MA 2NVUA 4G3XA 2E7ZA 4KXFB 5T41A 5TQ0B 4J3NA 4H63V 1ZMTA 2WOOA 3OZGA 5CDFA 1NJGA 2EL7A 1HK7A 4N5MA 1P72A 1H2HA 1RXSA 3QE2A 4IRUB 3RYHB 1J2RA 3OMXA 3B8HA 3GB9A 4S3MA 2AGVA 4UULA 4YVFA 4KQMA 2W2NA 4BNVA 3DMYA 4K46A 4AMVA 5I7AA 3PC8C 3RRWA 1EA5A 3PD7A 1Z0SA 4H6VA 4RVUA 3SC6A 3F31A 4FYHA 1Q22A 4LJ8A 3QUSA 4Q37A 1N3BA 2WU1A 1QU2A 2QVGA 3LFTA 1YB5A 3NBYC 4G9EA 1IHXA 1OV4A 1V5FA 2JAOA 3DOFA 3AEGA 3BA6A 3FTFA 4GSLA 3W34A 3PEVA 3KB8A 3D6NB 2A0WA 3VOBA 4PC7A 1OKKD 3L0OA 4NNOA 4O2AF 1T8RA 3KR2A 5JJ5A 3CKMA 3SP1A 1MVLA 2A0UA 1EM8B 1FX0A 1PJ2A 2VQ3A 3Q87B 1QDLB 4CL8A 2IVZA 4LZAA 1TAGA 2J47A 3DLCA 3Q7TA 2IV3A 1C3LA 2OC4A 3LCCA 5GVRA 1XHEA 1F7UA 1W30A 2IPXA 4WFIA 3SQWA 3IAS1 2FRVA 5EE0A 3K0SA 1CIJA 3DGFC 4D1YA 2G9ZA 2EZ4A 3ESXA 1DS6A 3GRKA 2J3JA 5K1ZA 1ZBDA 4DVDA 1SKAA 1UMBA 2CUZA 3RFTA 4QNNA 1NY5A 4KQGA 4O5AA 2DERA 1CK4A 2MR6A 4I1RA 4PLGA 3C6YA 3MYYA 4DCJA 1E79A 4UVAB 3BK2A 3L18A 3HCNA 1ORRA 4BKPA 1E2UA 3GZNB 4LHZA 1W88B 2OG2A 1SUCA 1KAGA 4L95C 2EIXA 3DAHA 3DTVA 4HL6A 4QFDA 2DR2A 5DKFA 2LCIA 5CT6A 1OT5A 4UM9D 4Y2TA 4FB5A 2Y3IA 4Z4QA 4Q4AA 1VSBA 3KKLA 1IFXA 2C0QA 4XDGA 5ADVA 1PNRA 5AVOA 2NTJA 3G89A 3QQ5A 4PR0A 3PNBA 1LGYA 5ISMA 4F7DA 4BO6A 4G26A 4PLTA 4QNMA 3MRTA 1W4ZA 4LIPD 4UJ3A 3BC1A 2FSUA 3NETA 5IKMA 3RYFA 5ALKA 3TZCA 1DBSA 1V9SA 1AMUA 4IGAA 5JCJA 3T3GA 1E8NA 1USVA 2AKAB 4P5DA 3H2HA 4MUBA 2I9PA 3D0RA 4PLFA 4KX3A 2PNJA 3ZW9A 1VBNA 4RVSA 4X00A 5IJ9B 3D0OA 3L8ZA 2QB5A 3IJPA 2IC6A 1JDBB 2Z6QA 1BS9A 4QTXA 2YFKA 4U9IS 4YGXB 4CLHA 3GL9A 4I4LA 3NMUF 3W77A 4INZA 3P96A 1X8JA 3OTOB 4OCZA 3MMXA 4V3CA 5A5EA 4ILCA 4R0VA 4Q7EA 1U1FA 2IEZA 1G4HA 4TLEA 3T9AA 2G6TA 4UBIA 2QRHA 5YASA 5IC4A 1IG0A 1IEVA 2YHBA 3R44A 1R8IA 4IHAA 3WADA 1Y8ZA 3CRZA 4KN8A 4XH9B 3F8WA 2VZ8A 1ZZEA 4H7DA 3FCAA 1TJYA 4YGYA 2A78A 5FWDA 1YGYA 3NBAA 4A6XA 1J33A 4MJXA 1XNQT 4BJMA 2Z2KA 2E5FA 1U5AA 3NGXA 3VJRA 4X7PA 4DSNA 5C53B 1O8BA 4DNDA 1JDJA 1O97D 1EUCB 2I8LA 2DUJA 2ZJ2A 1XVVA 3F96A 1A9SA 4BP9A 4AF7A 4WDRA 3H65A 3OEHA 4DLVA 5IVPA 3PDJA 2VHTA 1T8WA 2MWMA 4F5YA 3R3VA 1SCUB 2OXEA 3GQBA 4N6OA 1DB3A 3GY0A 3F8SA 4J7AA 4RA9B 4RH3A 3NKZA 5JIBA 1RI2A 3NDPA 4ES6A 4V1CI 1FXSA 1DKUA 1HDEA 1DG1G 4CFZA 1SUDA 1KAOA 1XAJA 3GFGA 1W0JD 4R1OA 3I61A 4OX9B 3CWZA 3TR5A 4DAEA 2O50A 4KV9A 3J7AC 1EDZA 2GVZC 3QTLA 4MVJE 3VPSA 1U7TA 3YASA 3CUKA 4ZKDA 3W5SA 5I48A 5DBFA 3LWNA 1AH2A 1VDZA 3QMVA 3IT3A 3X2SA 3P0EA 3O8QB 1HZZC 3N2IA 3GCGA 4DV6B 1UK8A 2ZVDA 3DLBA 4DR2T 3TX6A 3ZDCA 3AFMA 3OX2A 2ASVA 4G0PA 1HI9A 5D5QA 4GYKA 2GN1A 6Q21A 1XU9A 3AJRA 2YOEA 3E58A 3TLTA 3EGVA 4MIEA 3SDBA 2JDIA 5BT8A 4MWZA 4W8GA 1IM2A 1V5IA 5J3JA 5FWXA 3LXXA 2OFFA 4M54A 5BRJA 3FHLA 4ZOAA 5L40A 3E27A 3LE8A 1E1MA 2XXAA 1CR1A 1XN1A 2JHCA 2QRGA 4ZMBA 1EGHA 4JU8A 1QYIA 2OGTA 3TDKA 3ONFA 1DKQA 4CLRB 3II6X 1SBYA 1UBEA 3EVFA 1A2QA 1SHZA 5FTWA 1N36B 2QRKA 2CDBA 4FX2A 5JBIA 2H7VC 5B2FA 1PR9A 4L6AA 3Q5XA 3VZRA 1XNRB 4JV5B 2CVOA 2VAVA 2EG5A 1UADA 3ZQ4A 3OQMA 2ZZMA 2D8MA 2ISCA 1RXEA 1JRLA 2GYUA 3C7KA 1E5QA 1OV6A 4ZZ1A 1B3RA 2CLLB 2ZBDA 3WHLA 1H23A 4OP2A 5HCNA 4DOMA 2VSNA 4C88A 4AQ7A 4A9AA 3P2IA 2PL1A 1SUFA 2GPAA 3UM9A 2G0NA 4ZO8A 3JQBA 2BHNA 1YR6A 4BQSA 3KYDA 3NBKA 4AY3A 2ORVA 3EIXA 4TMKA 1H85A 4AF8A 1KFYA 2FWRA 4JB3A 1EGAA 1RP1A 4ZREA 1J8VA 2O3QA 4HFNA 4G67A 4ZO9A 3B3FA 2HLDD 3R9KA 3IE1A 2FHPA 3WWEA 3IKLA 2YV1A 3JWGA 1IZ9A 2IPNA 2WIBA 4JVSB 5ELLA 4OHXA 1OXUA 1GRNA 4A3SA 3C98A 3RQSA 5IM5A 4EL0A 3IHWA 4CW7A 3K2BA 3R6NA 1LVUA 1N8TA 5HDBB 3M49A 4YRQA 2AFIB 1OHHA 1L9KA 2IKSA 3BN3A 3W04A 3N2KE 3WSWA 4A6EA 1JH8A 3NAGA 4M99A 1PD1A 2XECA 4B4KA 1MD9A 1YU6A 2VYVA 1DCTA 4QX6A 3UGKA 1TFRA 2XKJE 3M5CA 5BUSA 5ITVA 4XFJA 3PKZA 5JAQA 3CLHA 4GPBA 3LUKA 4LBYA 4ZIRA 3KV4A 4HUQA 4GXTA 3E0ZA 3QI7A 1P1CA 3M0EA 4IMJB 4Y1RA 4DDUA 4ZJUA 2ZCJA 3W79A 5F9FA 4IVRA 2W00A 2Z6VA 4KW7A 1K7FB 5JNTA 2WHQA 4BRUA 5CDUA 4YSYA 1SA0E 2QM8A 5KOHB 2C95A 4DUYT 1WDMA 2WDVA 1FFBA 5LGTB 1I01A 3FIJA 4JL8A 1DBWA 1ULAA 3KT8A 2O7QA 3KTOA 4WCFC 3RWMB 3LC0A 2V1UA 1XRNA 1SC4A 4HNSA 5CA1B 3DW1X 2ZRMA 3PE3A 4PXYA 4LK2A 2P3LA 2X1VA 1GGMA 1QG0A 5J0ZA 3LO8A 4J1SA 4UDNA 5T8KA 4TYQA 1BCRB 1FQOA 5HF9A 3R7BA 1DV1A 4AXBA 3WXMA 1XQ6A 2QTGA 5IAKA 3ZJVA 5HS6A 2CDAA 2QUBA 3D3NA 3DEFA 4QDKA 3RRNA 5CLJA 3JR3A 2CKDA 2FYTA 4P7GA 3M6XA 4A8JC 4RDIA 3U3DA 4GP6A 3DHNA 2XITA 1NP6A 4BKRA 4DCSA 3CKLA 2O5EA 3ENNA 2EZ9A 5ALOA 5PGMA 5LXTB 3WWDA 2M67A 2IHBA 2VAPA 1V5EA 4DJFC 3RRYA 4YRNA 1NT4A 5A4FS 2NWQA 5TLSA 2EJBA 3MMPA 4W5NA 2VA9A 4KWTA 2J0UA 3DOJA 4FHEA 1IB6A 3MXZA 1KMCA 1VL6A 2R5WA 3MXOA 4OYJA 4OYYA 4CLOA 4D99A 2OCBA 3O3OB 1XPUA 2IOQA 3CGGA 1PQ4A 3OYZA 2V9CA 4JN6B 4OB7A 1KYIA 2PMDA 2V7XA 5L2LA 3JSXA 2AZTA 4NAHA 3UT6A 5M2QA 3VA7A 5J5AA 3R7LA 3UENA 2NU7A 1M34A 1WYCA 2D0OB 4KIJA 4XJSA 4II3A 4PLCA 4A16A 9ATCA 1FUUA 4YXWA 1K66A 2A59A 1IN8A 2FPSA 2BP7A 1TEVA 4DJAA 4E14A 5TSDA 3E7DA 1W0KD 1EPUA 3F74A 3UUFA 4Z4IA 5DN9A 5ADXL 1BMDA 3FJ1A 2RGGA 1TYCA 1BR0A 4L8WB 4X5OA 2HCJB 4ZGGA 3AKDA 1AZWA 1J06A 3W8NA 3HJTA 2O8DB 1NQXA 2JJMA 2ZZKA 1BQEA 3F0TA 3FCYA 2QP9X 2Q1UA 4QYIA 5FTNA 5IT5A 4EYEA 2N75A 2H2HA 2D2FA 3G68A 3OLVA 1XDPA 3QVWA 4LJSA 2PVSA 4CKEB 2WU8A 2XT0A 4ZCQA 1ZESA 4DR7T 1E1QD 3D4BA 4MW5A 5CA0B 4KE7A 1NOJA 1U04A 1NLMA 1Q84A 2P4UA 4BMOB 4WAUA 2NUPA 3QMMA 3RNOA 1W2HA 3HVHA 4YA6A 2GCPA 5AKZA 3FUUA 4UEOA 1AS2A 3RUEA 3ZV4A 3VHRA 3QP9A 3IT1A 3WGJA 4AO8A 2IEYA 2XNSA 4IZ6A 3WI3A 3TLAA 4Z4EA 2ZIAA 3ZJ5A 4H08A 1E4OA 4UBMA 4F4IA 3GJ4A 4R81A 1Y98A 4CG2A 3JTMA 4RPLA 1W6RA 1EE9A 1EDBA 1TIBA 1IDOA 3G8BA 2CLYB 1IZZA 4WSOA 1HDRA 2D2VA 2DHDA 1T4BA 4L51A 5H9VA 3MCTA 5JATA 2PN1A 4OHVA 1QH8B 1QDEA 2JLWA 3EZLA 3AF4A 3GJ8A 4MUIA 4CGZA 3GLIB 5AW0A 1FRNA 2OY0A 3OJCA 4RXMA 2ZVJA 4JITA 4RHUA 4S1TA 1IXKA 3VHQA 5E1OA 1T4CA 4YHHB 4Z1MA 4ZRNA 2PBIA 3A1TA 5FTMA 1KNRA 5TQ2B 3W2EA 2YNMD 4CM6A 1TW3A 4D9HA 3M5DA 1V11B 2FWAA 1UM9B 1A76A 1C9MA 5AXDA 1V35A 2DAPA 2ZDGA 3ILYA 5E7IA 2QX6A 4KNYA 3D6AA 3AR6A 3LCJA 5LBMA 1QKJA 2QV7A 4M89A 4B7AA 5FY7A 1R6DA 1UAGA 5CH5A 4PCAA 3PGVA 4J0HA 2D1YA 5LP6C 1GPYA 3B60A 1KMMA 5ADHA 1AM4D 2MINB 3IAFA 3JYLA 2RGRA 1JKFA 3RU3A 3B1JA 1QV9A 3C3YA 2BKXA 4HTFA 5CYPA 4C6HA 4JIGA 2CCGA 4JDUA 3ML1A 1Q0UA 2D7DA 1VJGA 5T67A 3RADC 1GAXA 2BE9A 2DFDA 1XZFA 4IHKA 2YTZA 1OUMA 1SNYA 4QYMA 1I6ZA 1X87A 2XUFA 3BL5A 4DJTA 3N2KA 2AL7A 2VJBA 2Q4TA 1G5FA 2AVDA 3RAGA 3UK2A 3GLIE 1AMOA 4BFTA 1GTJ1 2VHJA 3UW1A 2R8PA 3DXYA 3TLGB 3ENQA 1IZ0A 3F3SA 3IERA 5JQGA 2FEAA 1JDTA 2B4KA 4X7MA 1D9ZA 1AUVA 1SCKA 3SE0A 5K4GA 2VUHB 3OE5A 4TLAA 1NAFA 3NLLA 5D6OA 3JWEA 5AVKA 4EW3A 2OZLB 2AJTA 2GPTA 1XRJA 3AY3A 3RYFE 1N4DA 1XMJA 1ZH8A 1ZYUA 2J32A 3EULA 1SXIA 4RK5A 2VFAA 4Y7DA 4Z9YA 3E2PA 3S2GA 5LU9A 4D98A 1FNCA 3AP2A 2W67A 2Q46A 1VLVA 3QHAA 4OOFA 4OQZA 1RBZA 2DHQA 4GLLA 4JGBA 2PIDA 3LSVA 3ZW7A 4CCWA 1WNTA 1NQUA 4BCCA 4BE4A 3MT9A 2OV2A 1JKXA 2QZ9A 3FZEA 1XSEA 3H1BA 3G2HA 3MUFA 4CODB 4D80A 4HAIA 5DCYA 4NPHA 3DNFA 1Q2UA 2BSAA 1CRQA 1YI0A 1IK6A 2D8AA 2LP4Y 2NZVG 2ZMAA 3VI3B 3OQJA 4PLVA 2GBGA 3DC2A 3KOWA 4WWHA 2IOHA 1UH5A 2HIHA 2ODPA 4OD0A 4NPPA 1F06A 2C2YA 3A3PA 4ZYWA 5IN5A 2ZUTA 4R31A 4EVIA 4Q3LA 1HX1B 1Z5UA 1VMDA 4AKSA 5A2QA 4LNUA 2XB6A 1G8XA 3PB3A 4TYPA 1MAAA 4O0LA 4KC0A 2V03A 3O84A 3U3IA 5LGNB 4TM8A 1O8CA 1U2PA 3GMDA 5K0JA 5AJVB 3FHJA 3PJFA 4HYTA 2FX2A 1DO8A 3OLCX 2PLAA 2VO1A 3F7OA 1QKKA 4WOBA 3EXFA 1AKEA 4JP1A 3A4IA 1XJWA 2XUQA 1YQDA 2NG1A 2X8WA 4IQ4A 4KO2S 4RKWA 1IAPA 4B33A 2H1VA 1LSUA 3OIDA 1D1BA 2EF0A 3L2OB 3QEJA 4CI0B 4CKCA 4D5GA 4MYUA 2XCSB 2NZYA 1AG9A 5G40A 5I51A 3Q9LA 2YV5A 2PMEA 2LSKA 4C5BA 2XMQA 3K0FA 1MDBA 2PKQP 1LZKA 2W4QA 3DD5A 5C8XA 3ND7A 1MJGA 4NBWA 3O47A 1GUFA 4H1HA 2XHEB 4OI2A 4J1QA 3N05A 4NU6A 4AZ0A 1IN4A 2YQZA 2NU8A 1AQLA 3K09C 5FUMA 3NVKI 3G8DA 3PJEA 1D6MA 1XF1A 1I2DA 3EW7A 3VPCA 3DVRX 2REXB 2FWMX 3CR3C 4YT2A 5I7WA 3WZ2A 2P9HA 1V5WA 2WJYA 2X5XA 3HCOA 3QPDA 4GFDA 3UW3A 3ZHZA 1JG1A 3IPXA 1P4GA 2H85A 3IO3A 3PGLA 1PP4A 2C42A 1W87A 5KXJA 2OSBA 3GAFA 1FP2A 4GLJA 2PT9A 4H7KA 1M2FA 4KG7A 3MFYA 4R8MA 1EG2A 2GKSA 2QPTA 4YJKA 2XR1A 3AZQA 2KNDA 3SMVA 4DIKA 2J5QA 1YNOA 2I5PO 1KVTA 2P78A 1IEQA 1EP1B 2XXBA 3DKVA 4G09A 4AX8A 2F8TA 4JXZA 1IJKA 3EIOA 3ENKA 4HGYA 1JR2A 4Q1CA 5CT4A 4H18A 1VLZA 1PQUA 4M4SA 5D3QA 1WRDA 4U8HA 4XJVA 1UF9A 1O5IA 3H8JA 1YL7A 5EEHA 2Z1NA 2QLFA 1FRFS 2ZIGA 4XKJA 3D7KA 5LYJB 1H2ZA 1PDOA 3GI1A 4MV6A 2IV7A 3W9BA 1Z08A 2HCFA 5DFAA 2D7JA 2EU8A 2PA0A 2W2KB 3WVNA 2A14A 2TMKA 4AJHA 3Q2KA 4N48A 2DNXA 2BGMA 3O8LA 4RVHA 2L0XA 1N2CA 1L1RA 3KZKA 3T4EA 2B9EA 1WEHA 1TM1E 3GLHA 4TWJA 5E1DA 5IBCA 1EP3B 3N8KA 1JTEA 3JQ8A 1VKNA 4CR8A 2C7QA 1FJXA 4COKA 1OYOA 1IRXA 4N0EA 3IIIA 4PVDA 2TSYB 1MMGA 3JQGA 4GNRA 4CU2A 3OZVA 3DSRA 3W5HA 5BR8B 5AUQA 3ZWXA 4YRAA 1JR3E 2AI2A 2ZG6A 3K8OE 2EX4A 2B2CA 1N0IA 2OOKA 2BSXA 1NMEA 4U7GA 2CNKA 5JVDE 2EP5A 5HF6A 5I9SA 1ESDA 1NW7A 1KRHA 1GPKA 2EFDB 2FMUA 3LPDA 1TEHA 5LIPA 4B3MB 1XZNA 2GN4A 1MQ9A 3NT5A 3ESYA 5DM1A 2GCNA 2IEBA 2QRLA 3AGPA 1X9IA 3LIIA 1KJYA 4GE0A 5HXRA 4TMVA 5AK6A 5FAXA 1NXPA 3FYTA 3PWZA 4TZKA 1II9A 2DFPA 1ECGA 1L2TA 1D0XA 5KSWB 5FTKA 3AL2A 2OEPA 1EBFA 3SQMA 4A2QA 3K9NA 3E6AA 2ORIA 2OXFA 1G9XA 4PIPA 3W5JA 2V98A 2V5DA 1KO8A 3EMKA 1I0ZA 3KCNA 4IOKA 4PZYA 5AW4A 2ZYUX 4WERA 4G4SO 3C39A 2O8CB 2XA1A 3W5CA 1TCVA 1NPDA 3LKBA 6ABPA 1YUBA 1KETA 5D1NA 4CM4A 4UV9B 5FMNA 2EERA 2XE6A 1X8KA 3V80A 2SBTA 2G76A 1XA3A 1ECBA 2AMVA 1J70A 2FSSA 4IJUA 4YMGA 1SCIA 3F98A 4PK6A 1HDZA 4HQ0A 1C8KA 1IC6A 1MPXA 4IIXA 1ANKA 3FROA 5JXJA 2B98A 2I76A 3BPSA 1RYDA 4Q5IA 1TUBB 2Q4OA 2AUNA 3MA0A 5IT4A 2BBTA 4JIMA 4RHFA 4O3MA 2QAIA 3S3TA 1M75A 1Q11A 4QFCA 1MJNA 5HJ2A 1KJWA 4RVCA 1KQFA 1VYHA 3UQ4A 5JCJD 3BXGA 2I0FA 1E77A 2IOFK 3QUTA 4YT0A 3KQSA 1Q16A 2FMIA 3MJVA 4UXJA 4J9UE 4DV5T 3FTEA 3D0KA 4MQEA 1K7YA 5ABEA 2C1XA 1ORVA 3K31A 2FRXA 1SQSA 2JI9A 4Y2VA 2IUEA 3D6VA 4RK1A 3QKRB 4QTUB 1BXRB 1EZZA 1WFDA 2HRCA 3M6VA 4JROA 3OKCA 4N01A 5EWLA 1ZK2A 4KSBA 5JZOA 3NDIA 4RX1A 1PWHA 4EA6A 3UANA 2BFEA 3SVTA 3AEBA 3MTBA 3QV1A 4QICA 3RLIA 4NZOA 2DOKA 4R1SA 1KI8A 2NWBA 2NV6A 4J1TA 3EN0A 4YLGA 3DXFA 1VGVA 1O95D 3S1AB 2OUIA 1E79D 1TEZA 1AY0A 3AP3A 5KVCA 3FWZA 5JD4A 1UINA 1G2IA 3BRCA 1LA2A 2R6AA 5G3YA 3NTUA 3MA9A 5IWCA 5A9TA 2LHNA 5FX2A 1A2OA 1L4GA 2Q07A 2X76A 3QYPA 1H2FA 1HV8A 5TIIA 1CF4A 3ODGA 4E6EA 3OX3A 5CX1A 5CEEA 2JIDA 2Z08A 2QU7A 3JALA 3O8RA 4OXRA 3NONA 2NXJA 3BEDA 4FYIA 1OPXA 3ZE1B 4L0QA 2GJ8A 2MOZA 5IX8A 1BOFA 4KJXA 1YI8A 1I0LA 1QYVA 2J85A 2JGIA 5CYOA 4AJ2A 4EUHA 4URXR 2O5VA 1E3JA 3HBLA 4TXJA 3PJGA 3OZAA 1G8KA 4B3DA 5CB4B 4LXXA 5I9TA 4BECA 4EI2A 4HRYA 2HF7A 1PUXA 1RVV1 3Q5DA 2JMHA 3TW8B 3QFSA 4YC7A 2XOXA 2QGFA 2YICA 1QH1B 1U1GA 1KE1A 3ZHVA 4K6KA 2WHXA 1DWQA 4AYTA 4HDRA 1TL7C 3MJXA 4EHNA 4F4HA 3IAXA 3OZDA 4OEHA 4QUAA 3EVBA 1T3TA 3PHBE 3EDUA 3GCXA 4DLZA 7AT1A 5HR5A 1LDMA 2NNWB 2Q41A 3H5RA 3USES 5DWVA 2TMGA 1SB9A 1RZUA 4EPXA 4NABA 3GVCA 2FUPA 3K16A 5JZSA 5HXAA 3ZLIA 4EDHA 1U7WA 5INTA 3TI7A 2DKNA 1NF3A 2PAAA 2RHLA 2VHUA 2IV2X 1J1JA 1NR1A 3MJSA 1CDZA 2Y1LA 4QRIA 1UP6A 1VCNA 4COFA 4D5EA 1E2EA 5AQGB 3AFIA 3DV2A 3KEOA 3KOUA 5IJWA 4GPEA 1WUHS 2ZB7A 4QHYA 4WK2B 3O3CA 2IP1A 1K7SN 1LVKA 3WNQA 3UT5E 2P6PA 1CZRA 1G7TA 3O8NA 3TIXB 4C3ZA 2W93A 4QJIA 2I2FA 1W0AA 3O90A 3U9LA 1XTRA 4G41A 2RE8A 4DV7T 4I5IA 3S4UA 5KO2A 4E5DA 4WK4B 3IDOA 1ZMRA 2JCBA 2ZP1A 1E1RD 3HCAA 1M83A 1Z5ZA 3FFAA 2J6BA 1T4DA 3HNPA 5E2AA 5HIMA 2BZ0A 4PE5B 3SM9A 4DLTA 2ZE5A 3M1IA 4ENPA 1T9GS 4Z8YA 1ZD1A 3T15A 1M2HA 4NSNA 3TUJC 2GN0A 3LCUA 5A1LA 4ZOLE 4Q18A 4G4GA 3WMRA 1VA4A 3L0YA 1G5TA 1P80A 1V8DA 3S8MA 1K0FA 5ITWA 4AKLA 4LRYA 5JQGB 3V1NA 3D4LA 2Q5EA 2A92A 3N87A 4H1WA 2Y4OA 2IXBA 1ZGHA 3N2LA 4E15A 4TUYA 1TU4A 4YIHA 1Q17A 1IN1A 3WYGA 2R8YA 3CH7A 5F9HA 3FNBA 1ORIA 4NFHA 1AF4A 3HACA 4O0MA 1VLQA 4AJ4A 3P0FA 3HJHA 4FLMA 4YP9A 2D0UA 2A1IA 4C0JA 2NP7A 1TW2A 4PNPA 4B31A 2I3GA 3CX8A 5CBPA 2IXFA 4PLWA 1JLLB 1RQXA 1KSHA 3BQNB 3K0KA 4YJ2B 5EXDA 2VPYA 2K4MA 5DTEA 2PTHA 4IDNA 2B5WA 3IHRA 4PO9A 4F60A 4KXNA 5C3MA 3CVWA 4QLBA 3ANTA 1B6SA 4P6VF 1R2QA 1LW6E 1DEOA 2PRKA 2XAJB 4FKZA 2FR0A 9LDBA 4DEYA 3PX7A 2NNLD 1APBA 3VO9A 3ON5A 4BE7B 1C3XA 1K06A 2QOEA 1DFHA 5FNVA 3RYHE 1HNWT 4FFMA 3RAPR 1P73A 2M98A 1ESEA 3BMCA 1BX1A 4N5HX 4JCCA 4AZTA 1SXPA 4ZQEA 2F9MA 4LI3X 2IBTA 3JQ9A 1YBFA 5J47A 4RJKA 2AOUA 1N3IA 1W35A 5K2MA 2ECOA 2R65A 5LMUT 3W6NA 5CCXA 3ZDDA 2IH4A 3BIFA 3HKBB 2ZRAA 1VI6A 3KLNA 4BP8A 3AVPA 3UK1A 3RJMA 1OBVA 1QBGA 2IELA 4Q47A 5ALJA 1W2GA 5DMXA 3TEJA 2RGUA 1R3UA 3HN7A 4Q4JB 1Y8AA 5H8WA 2VBCA 3N9NA 3KJZA 4F5ZA 1ZVKA 3V2GA 1WCRA 4ER3A 4JJ4A 5JEDA 2PJRA 3UK0A 1BJKA 4GOLD 2R97A 4CIDA 1O94C 4NHOA 3HSKA 2QTAA 4QPZA 4U6QA 4D56A 4NCJA 4P53A 4DV2B 3IEVA 3FCOA 1MB4A 4DV4T 3QUAA 1EWTA 4R1QA 2ACEA 3QU7A 4YI3A 3K7EA 2W6ID 1MW9X 3DEZA 3JQDA 4RGVA 5BYBA 3ZI0A 4NIQA 2V6MA 2BL4A 2JIOA 4QO8A 4AO6A 3DMGA 5C4MA 1SD5A 3PLAE 4F8YA 3RAFC 1R9GA 4HI0E 3IV9A 2VT2A 3Q0IA 5KOJA 1ONPA 4XA8A 3UJ6A 4IXMA 2WSSA 4ARIA 2FMHA 2QJRA 2WAOA 4HBGA 1Z68A 4RF4A 1UKBA 3FI0A 1D8TA 3OUUA 4TV8B 4FGLA 3CO0S 5F4BA 2CYAA 4B6GA 4N0PA 5GY7A 2B2NA 3PFFA 4MQFB 1DIBA 1UWVA 2DJIA 2X5NA 5TQJA 5F7ZA 4D9NA 5IAAA 3C2QA 3R0XA 3ZHSA 1GP2A 1RWBA 3A1VA 3ZGZA 2NTYC 5JSQA 1HR0T 1ZR2A 2GDZA 4HNGA 1OLXB 5C5EA 1W4RA 1C0IA 2DBQA 1A9QA 4IL5A 1TT5A 1U5BB 4G5QA 3RIGA 3Q3EA 4PCVA 5IH3A 4WZ6A 3SY8A 3RS0A 1MJGM 4BATA 4B2PA 4FC7A 4O4IE 4DMCA 4G9BA 4YRDA 1JEJA 4MVCA 1YS2X 1ZD9A 3T99A 3VTAA 3IP7A 1H2RS 4Z0TA 4NMXB 4D8XA 1M6WA 1UBCA 3HYSA 4HH4A 5CM2Z 2D1QA 3KSUA 3O6VA 3SK0A 2ZUUA 3GH1A 3TZLA 3AB7A 3R3ZA 4Q24A 1UJ5A 2C9YA 2D2EA 3T35A 4DYDA 5KWEA 1A9OA 5B1SA 4BMZA 1GZ5A 3WGUA 2ZYTX 2BM1A 1RR6A 3JQGB 1V1RB 1YJXA 4D57A 1C0EA 4GSYA 5F23A 8LDHA 4GOXA 5HEOA 3NHAA 5IPFA 4GE3A 4HDQB 2K48A 4KDFA 2GPNA 4KH1A 5CP8A 4PLZA 2JIZA 1MZPA 2ZB2A 2O4UX 4FPXA 1ZUIA 1C9NA 1KO4A 3E81A 1EFKA 1K9VF 2YDSA 1TYEB 5DWQA 1AUOA 5AJYA 5JADA 1FJGT 4M38A 4ADSG 2Q6OA 3BMOA 2AN9A 3L06A 1NDUA 1OIWA 2FPPB 1FFHA 1GRVA 3ILSA 5CYGA 4KR3A 1HRDA 5ENZA 3LKZA 3ZYKA 1UODA 3AHGA 3DQQA 3FOBA 3PD0A 5ERGB 5A3SA 4ETNA 4H9RC 1FNBA 4XWAA 1HDGO 2GTIA 1MO5A 2XIQA 3HBNA 4FDLA 1QFXA 5DI9A 4O4IA 5JVDA 4Y3UA 3QSYA 2JGDA 3D5QA 5LN1A 3H04A 4GQBA 4YUVA 4FB4A 3HYTA 3OAAD 4N5NA 4IX1A 2OBMA 2BM8A 2CCQA 1PNQA 2PPVA 2XWSA 3GA0A 3L7DA 4HYYA 4OFWA 3T6KA 1XDUA 3RE1A 3HZRA 5BORA 1WX1A 5C4GB 2RH9B 4EWLA 1RFLA 1ZC4A 1E2IA 2HOQA 2QU8A 2PGXA 2RHWA 3G88A 3MQFA 3CX6B 2WY2A 3CXUA 3SYNA 1C8BA 3EQ6A 4UM7A 1D5CA 2X5JO 2H17A 3OPNA 4HXFB 4KXMA 3GAZA 1VSVA 1OHHD 1PDWA 3TQIA 5DHTA 2UU9T 1JHMA 1RYBA 3EG9A 4AQYT 4C4YA 2MBGA 2PX4A 3HDJA 3CIRA 3OZIA 1P9NA 1YBVA 3CX4A 1JDSA 4I7EA 4JASB 2X0JA 3FYUB 4JBXA 4NIMA 2H7XA 4WH0A 4JI7B 1T36B 2Z5FA 3JPWA 4A92A 2PMWB 4PGHA 2Q4BA 2EKPA 3GV0A 2OZPA 4J29A 1CJTC 4WX2B 4YCJA 3ITKA 3MUNA 1PZNA 3MS7A 4UBKA 4B6EA 2VL7A 5IYZE 3VYWA 4BX8A 1M1YB 5IZ4A 1DC3A 1M1YE 1XQYA 3Q15C 5TPZD 1CY1A 5AW3A 4WLEA 5EHXA 3TM5A 3G2JA 3ZPOA 2VQFT 3SIRA 4Y18A 4HFJA 5D85A 1Q1BA 2PXAA 3OQOA 2VF8A 3KQYA 4K6FA 5F1OA 5FJIA 4PNIA 3DHEA 3K2EA 3QE4A 2O1SA 3ZNPA 5IJ0A 3FYUC 1RYEA 2CCJA 3PC3A 1CFJA 1Z6ZA 1SU8A 1E3WB 1ULBA 3H8WA 3D2LA 5ERXA 3OP4A 1SOAA 1UFOA 5BN4A 1E2BA 2ZJ3A 2WA1A 3K70B 4A5SA 3JY6A 4S0XA 3H2YA 3ST7A 1SQ5A 2CK3A 3ZY5A 1OROA 3OOYA 4HPXB 4WHMA 1BMTA 2EWMA 9GPBA 3K09A 1RHJA 1Y1RA 3W9YA 1R4AA 3ICVA 3RRJA 4HWOA 1O3XA 3TAUA 3H11B 1HO3A 1D8AA 2AYXA 2B94A 1QHEA 3AU9A 4JBHA 3TSOA 1X3LA 2ADOA 3EF3A 2WIFA 4JUBA 3PYXA 3UUBA 4URWR 4YAJA 2ZRNA 3SFTA 3AVUA 1DBIA 2XUEA 1U7HA 2ZUDA 4HLNA 4U2FA 2WV7A 3H75A 3TTSA 4JLKA 4KR7A 1F5SA 2C9BA 3GFPA 4TTTS 4TXHA 1WBBA 1AQUA 3PRYA 5GJBA 4IOLA 1QRAA 1N6HA 5GV7A 5LP1A 5ICSA 3Q3JB 2R7AA 3TDMA 2WJJA 3ZCRA 4X1KE 5BXQC 2RI6A 2ERYA 4JYCA 1I4TD 4QIHA 3VMMA 1E1LA 3A36A 2PBFA 4HFBA 3A05A 1UZLA 5P21A 1E9EA 2HQSA 3GT7A 1NEKA 1VYVA 4JOCA 3KV9A 3JYPA 3I1AA 3M3DA 3ZD9A 5HIKA 1N5IA 3KXDA 4CM5A 4PX2A 3Q41A 4UM8B 5ALDA 1AGPA 1P2DA 2Q2QA 3M6WA 5LA6F 1DTEA 2HA2A 3NBZC 2AR9A 3BB3A 4UREA 3HCEA 3TJZA 4RZXA 2E9XA 4PTLA 4X8LA 2O5RA 3CV3A 4KQFA 2WY2D 1Y6ZA 3WIDA 3QUQA 2NOAA 1B0PA 3O82A 3QVVA 4DZZA 3WSVA 1OFVA 4PX9A 2OGUA 3IUJA 2Z3VA 3OCUA 2P2CA 1KVRA 3CQ9A 1NBWB 3DPSA 3DTVB 4PZ0A 3TQRA 4PN7A 4HWKA 3TPCA 1QQAA 1U0FA 4KSYA 1K3FA 5KS2A 4R51A 3LDGA 4CMHA 1WETA 4DLRA 3SM3A 1UBHS 3NS7A 3OLWA 2PBLA 4OUDA 1R0CA 2FFQA 1W0KA 1B6GA 1QYDA 3IO5A 3BDAA 1Y3BE 4N18A 4QDOA 5FOVA 1BFDA 4AYWA 4XM2A 4MO9A 3V9PA 1VCHA 4IHJB 4PXAA 3UHJA 1G3MA 4YJDA 1JN0A 1LZLA 2E4AA 3HK2A 2MYSA 1WCIA 2J8ZA 3KT6A 4BJ5A 3KS9A 4XVUA 1U3UA 4ZFNA 2GBPA 4RNDB 5F51A 3H1TA 3I76A 3NXKA 5LD2C 4WLNA 1X14A 2BG9E 2NYUA 2FSVA 3KFVA 2G1JA 4LZOA 1JJAA 3HDTA 3VNAA 4ZJPA 1P7CA 1RPNA 1GGEA 1UP7A 3A9WA 4URZR 2OKCA 3FDFA 2FTKE 1B8OA 1QB7A 1WP4A 4LMPA 3H7IA 1JFFA 3FRHA 3G2NA 1KY2A 2C7BA 3NT2A 1D0YA 2BLLA 2C3OA 2IYLD 3AZOA 4JC4A 1WSAA 4LHEA 4NYJR 1GN8A 3TLMA 1YJ5A 1KORA 2I6GA 3DOEA 1TZBA 2VPQA 4JJFA 1NTRA 3FPGA 1KDOA 4EI9A 1RJGA 4MUMA 4RZ3A 3FJOA 2QVZX 2YOFA 4FDAA 1WLSA 1Z0AA 5BOSB 3A3KA 4DBLE 5LNK6 4TRMA 1KFBB 1JB1A 3G79A 3PUWA 4K9LA 1SU6A 2GX6A 3V1LA 3FBLA 4BLOA 3U4QA 2HK8A 2XX3A 2ZRQA 2VDUE 4Q4HB 4RK6A 4XJXA 3Q40A 4CIVA 4RJLA 4P0PB 4MGHA 3WNZA 4CRWB 1DMSA 5LKRA 2EHOB 1S2DA 3KKKA 1A2KC 1IU9A 3JQ9C 4UTPA 4BEWA 5AQRB 3ZSSA 2VNSA 2VL0A 2YW2A 1OBOA 3JS5A 4N03A 4WTOA 3VO1A 4EI8A 5A0TA 3EXHA 1QLHA 3EPKA 4RCVA 3J81A 4R9UC 1Z0KA 1SZJG 5BYKA 3FZLB 1UOPA 3VVBA 2QQ5A 1PFWA 4F11A 3NCHA 1ND6A 4B9AA 2ZRKA 1SCAA 3NFRA 5GQSA 2H2WA 4Q3CA 2YNMA 3AE2A 2EIHA 1EUZA 3X44A 1JFSA 5EZSA 3N75A 4XSGA 3ORFA 4JHLA 4H3VA 3ZLVA 3A0RB 1DAFA 1NY6A 4ODIA 1XEFA 3UCEA 1Y5LA 5H9WA 4YP6A 1JTFA 2JAQA 4NHEA 3CLUC 3EISA 4QBGB 1UEIA 2V7PA 4K2HA 3Q3CA 1MXFA 1W76A 4GK5E 1XC7A 4YRLA 2AN3A 4UATA 3AKZA 3BMOB 3TGPA 4BTVA 2YWXA 4WLFA 3Q9UA 1SVWA 5JALA 5KX5F 2VXBA 2HQOA 3N6VA 3PPVA 4G2AA 3GBSA 5D1HA 1A9TA 4TMYA 3W3ZB 3B7GA 4JI2T 4WN9B 1PQPA 4DDKA 3KU1A 3DZIA 2ZRBA 4QJBA 4ZYLA 1BXZA 4OQQA 2ZYHA 3WISA 4YLYA 1CVIA 1ECLA 4ZODA 2H57A 4NH0A 4FBMA 5G1NA 2VK8A 2ZAYA 1N0UA 2FPOA 5G4KA 1N9GB 4OQLA 4M0EA 2XAHB 5DJQC 1IHUA 2WT8A 2VL8A 1J56A 4Q6BA 5CJ2A 3W5BA 1RXUA 1XALA 3COZA 2YY7A 4KAAA 6GPBA 4XZCA 2ETVA 1GR1A 1YE3A 4HWHA 2Y99A 2H4HA 1UQRA 3CF2A 5DIFA 1GG5A 1JEYB 1XN4A 3DZJA 1LXCA 1PHPA 4JBWF 1VPEA 4QU0A 4N7BA 1Z5GA 4K0KT 2FJDA 2RBKA 4U9UA 1HCIA 2OWDA 4RK0A 2NSLA 5HOQA 1O1YA 4MB6A 1CYEA 3K4HA 1XT6A 4OXYA 3L49A 5T64A 3GUZA 3AE7A 1XXHA 2WJZB 1SKBA 4B8WA 2WM3A 3H9JA 2P41A 3ZDEA 2P6RA 1SXJA 3ZY6A 2PH1A 4MO2A 4YP0A 1UUSA 1VB5A 3FLEA 4TL8A 2PUAA 2HHLA 4NBUA 2GPJA 1Z28A 4KX6A 2LR0A 3L40A 1A9YA 1A8UA 2X8LA 4LKOA 1HMPA 2GCGA 3FTQA 4HEHA 1S3FA 4D9BA 4ECAA 3DE5X 1JEOA 4XB2A 3WA6A 3DS8A 1NBAA 4IIFA 4UAGA 1NC1A 3HR4A 2BD0A 3IURA 4M1WA 4UEJA 4D96A 2P9YA 3BRQA 3HMQA 2VRWA 3NWBA 4KQHA 4AMGA 4A0FA 4BJNA 5CNIA 5DP1A 4TMWA 2IMLA 2O0LA 2XW6A 1RWOA 3LP8A 5GM2A 2OCPA 3WTBA 1V0JA 1AV7A 3WK6A 3QOFA 1KI4A 2N1MA 4N3CA 5HILA 2TECE 3LTNC 4ZVUA 4GUAA 3GELA 4KWCA 1C30B 3M7IA 3LAWA 1NMZA 4L9WA 1E9SA 4QPCA 1ORHA 3SZOA 1JIJA 5COBA 1KEEB 3ESBA 4LBWA 1SBCA 5HCIA 2EHOD 5JDGA 4CF5A 1WUYA 5EP2A 3ROKA 3CRNA 1JPUA 2Z04A 4L02A 1SN7A 4UTVA 2P8SA 3FB2A 1KI6B 3P26A 2WYIA 3CO5A 1A04A 4DA7A 5BV1A 3GU3A 2J6IA 3TM4A 4JLWA 3J80A 3I4CA 4HPWA 3TLXA 3SD7A 2Q6KA 3R3XA 4WE3A 2I55A 4D81A 1XOIA 4TUYF 4ZARA 3HDQA 4URYR 3V6MA 1S9DA 1D6NA 3RBXA 2EQBA 3EPPA 2K7ZA 2P8JA 3VJLA 2AUTA 4JXXA 1P9OA 3H3XA 4ENWA 3COSA 1NAIA 1M5UA 4RLHA 3O4FA 3A2LA 1AKMA 4IJVA 5HWSA 1ZM9A 3NC0C 4M9ZA 4WNKA 1YVEI 5FUYA 3SQXA 3ZHQA 1XIVA 5TVKA 4HNHA 3WYNA 3B6IA 1WKBA 3K6JA 3W2IA 1RPAA 1PX2A 3ZYMA 2OMEA 3G7SA 5KYYB 1K8RA 3L0IB 1NRIA 4L8FA 2B8NA 4IFIA 1KTIA 1NNUA 2NLOA 4G0MA 3IPRA 2B82A 3X1WA 2IS1A 1I9CA 1EJ6A 5BUQA 2I6TA 2CXNA 3Q12A 1Y7HA 5FL1A 1T1JA 2CBZA 2CUTA 2H4WA 4QASA 3VOTA 1YDHA 1YH3A 2ZM6T 2PD6A 1A4UA 4D9EA 8OHMA 4JXJA 4S1VA 1OFGA 4MPJA 3ZU5A 3ZDQA 3IAM6 4BO2A 5EJ5A 4IE6A 2AE2A 2RFLA 2GJKA 2YHAA 3A9UA 3B89A 3IVAA 4NCBA 4I66A 1E9DA 2HGSA 2G0AA 4CTKA 2OK7A 1L5LA 1EZ4A 4WY2A 1N4AA 3FXEB 2ZJAA 5LXTE 4M55A 3DBLB 3A4LA 2VHVA 4W6ZA 3DMDA 3VR6A 1LRJA 4FWBA 3ZVMA 2BUBA 3B6ZA 4E94A 1YUNA 4PG6A 4PG8A 4OKSA 1KEPA 2B2XA 3QRWA 5AT1A 5HM6A 3MG9A 4I50E 4CZ2A 4CETA 1K6EA 2PYZA 3Q98A 3ZY3A 5AW1A 4YS6A 3V2IA 2YUTA 3AC0A 4NMLA 4E30A 4FK8A 2CVPA 2BEVA 1MLDA 2P11A 1CHNA 3ACCA 1ZL2A 2RA1A 5FKYA 5AUPB 4CTMA 1CUDA 2DECA 1Y4AE 3IMCA 3SJUA 1L5VA 3K0EA 4KODA 5EIOA 3VR6H 1GG9A 5IZCA 4M86A 1OPRA 4ANJA 4EA8A 4RSRA 5I4IA 2O8BA 1VG8A 1ZJZA 4MJ7A 2X0LB 3SSAA 2KINB 2BR3A 1O0CA 4C7OB 3UTKA 1ILEA 1JYEA 1K86A 3C6ZA 4Y9RA 4B0OA 1UQUA 1P4SA 1A5SB 2OCKA 2L42A 1AB6A 4U3JA 1CUFA 4HT3B 4XEHA 5DTQA 1CR0A 3P2YA 4CU5A 1G2QA 4EJSC 3VUFA 1UUFA 3MACA 3F67A 2DFNA 5ALEA 1HLFA 1NPYA 4KLRA 2J0UB 5GOTA 2XAQB 4BNDA 4H27A 1GV1A 4HOYA 3SHWA 3STHA 2BKVA 1JVNA 1V7CA 4HTEA 3I0OA 2AI3A 4RIGA 1URPA 6LDHA 3T1YT 2FSHA 2BM9A 1CZUA 1J90A 1SCNE 3UOWA 1IHYA 2FUEA 1UXKA 4MBQA 3H0EA 4GX0A 4X84A 3GJTA 2BKAA 3VPHA 3HDYA 4MMXB 4NCXA 3ZHBA 5K0GA 3KE9A 2OYRA 1OZHA 1K5HA 4J03A 4WKOA 4W99A 4TKUB 3WIOA 1UBJS 4N49A 2XKBA 3AHHA 3RS2A 3FF1A 3OCYA 1FSFA 3QU2A 4NF2A 5SZIA 1B74A 2H8KA 3AEEA 3L4BA 5BXYA 4N5LA 1T2VA 1TI7A 3B70A 3ETNA 4YP7A 4BNZA 4F6RA 2TRSB 2ZANA 4OUDB 3ZCQA 1C1DA 4TXNA 5GONE 2XRYA 3PDYA 4YJ3E 4WUVA 3W5VA 5KNBA 5EKTA 4LFCB 4G0QA 1DLJA 3X2FA 1NNSA 1RYFA 3MRXA 4QNRA 4X1YA 3SEFA 1BG6A 2DBYA 3OZTA 2WUFA 1RPJA 4MMYB 5AM5A 4ZU3A 1XTVA 4ZKEA 3LK3B 2P6OA 5BNTA 5J43A 4PJNA 2C0PA 3P27A 4GH5A 4IV0A 4OB6A 1DWPA 4LRSB 5L4LA 3HZZA 3LA6A 3O74A 2G4VA 3L8RA 3UICA 4D9GA 3MILA 1DT3A 3I9NA 3GA7A 3TLGA 1A8HA 3UU3A 5B53A 1VHWA 4AS1A 3TFWA 3VPDA 3D7LA 2IXDA 3RYIA 5AUOB 5I7SA 1PEYA 3RGLA 1IXSB 3CY6A 2QIPA 1FYFA 4YBRA 1B2RA 4I8IA 1AK2A 1XZIA 2G71A 1TAQA 2WM9B 2A3RA 2EEZA 2WYHA 3JZMA 3N2YA 3QGMA 5JOQA 1ZOOA 3D7SA 4XQGA 4JODA 1GNSA 2AEJA 2IA5A 5JUWA 1GQQA 3RC9A 3TB6A 3OIWA 5ALIA 2YL2A 1F7VA 2HBYA 5T6BA 3NXSA 2REQB 1VG0B 3CNNA 2JCVA 2XWJI 4EZEA 4AZWA 3ANSA 4UOEA 2RARA 4MFRA 3NTOA 3H4IA 2BVNA 2BI4A 2C9CA 1TU3A 2W5UA 3O94A 3V4PB 1M34E 1TA0A 5JW6A 4R01A 4RD1A 1MOSA 3BHNA 4PNEA 1QP7A 3A1CA 2WWYA 1D1SA 3HN2A 5FWYB 2C2XA 1CNFA 3SEQA 1DJOA 3ORYA 4MCIA 3D2AA 4MVJP 5E7MA 1X7XB 2B4AA 1M0EA 4UNRA 3EXHC 2G72A 3NHFA 3OBBA 4HUTA 2Y0EA 5F5LA 3GLSA 5U4XA 1GAEO 5DZSA 1SVUA 2VSYA 3DTOA 1TGVA 1ECCA 1JIXA 2H3EA 1NOKA 4JXKA 2Q49A 3K0CC 4BDSA 3FUCA 4Y2UA 4MWDA 4X8MA 5FUBA 5I3CA 3OETA 9ABPA 4W7IA 3CRVA 4AUMA 4MSUA 3LT1A 4IQGA 3UUEA 4E2FA 2VAMA 3FLMA 5AK0A 4KIGA 5CVVA 1EINA 1HG0A 5DBEX 1G8HA 4S04A 2E3JA 3GPLA 2EFJA 1T9AA 3IR6A 4TSRA 4ZXFA 2H00A 4H6PA 2X58A 1MG0A 1U99A 2QVCA 3ECCA 3DA8A 3HKCA 4UBOA 3GMSA 2IPLA 2HA4A 1Q2XA 2R8ZA 3H2JA 5G0SA 1Z26A 1ZJWA 3UO8B 3EZ7A 1EK6A 4BFUA 4H7PA 1YS4A 1GZ7A 1MIWA 1Y34E 3QXSA 3AXJA 2RGCA 5JC1A 3IL2A 3G2QA 3OP1A 1H0RA 2G9UA 3L84A 2DQ4A 3T5BA 1ZXXA 3IBPA 2NTEA 3ZHCA 4L8VA 3RASA 1IBMB 3JAKB 1T8SA 3CE6A 4ND8A 3ZX4A 3MQ4A 1DWOA 2DBVO 2QMOA 2LM2A 2XNKA 1P0QA 1JAIA 2A1TS 5C46F 2PUEA 2L17A 4HDMA 3BF7A 4MXDA 2EFHB 4NUUA 3JYQA 3KJGA 2D9DA 1CY7A 3JATA 3CN7A 4HN4B 4X41A 3EQ7A 5GONB 2FPRA 4OK6A 3C8UA 1Y8QB 1NLZA 4X20B 5AJWA 2FSIA 3IQHX 2HA5A 3OFNA 2ZR9A 3BRWD 4DO0A 1LI4A 4MV8A 1MJ5A 2HZBA 3AHCA 1XLVA 3SS7X 3LS2A 4E7SA 1TIPA 1XYVA 3EH1A 4HDKA 1K6JA 1RFGE 1SKYE 1IJ6A 4FXPA 5AW6A 3ADOA 4IH4A 2WG2A 2BTQA 3S40A 4C22A 3I6QA 4RQBA 1MP0A 1K4KA 1J22A 5G02A 5AHKA 1CQIA 3WLJA 2HSZA 2VDVE 2YOHA 4QM7A 4UHDA 4I3FA 3C8ZA 1XL0A 2X9XA 4IH1A 1QOZA 2RD2A 4BU0A 2YN6A 1GGJA 2ZBQA 4LRUA 4FYWA 5BWBA 1ZXLA 2HK9A 1JX6A 2YJTD 3QA3E 1SG0A 4JC0A 2CBIA 1G64A 1CS0B 2ZJFA 1L3IA 2WZBA 2YW9A 2NO6A 2Q45A 4ME6A 4QRDA 2AZMA 3ER8A 2HHHT 3KKNA 4I5GA 3FF4A 3H0KA 1AC5A 4YY3T 1SOMA 4W8HA 3SMQA 1KI7A 3RVLA 4DDMA 3M4ZA 5A3JA 4LQLA 1E4EA 3F2EA 2FWJA 3ONWA 5HQ3B 1U4QA 2C4UA 4FQ8A 1UBMS 3TLBA 2JAPA 4K6OA 4EA7A 1NZJA 1CUUA 2FUG6 2WPDA 3E3OA 3A32A 1X38A 2GZAA 5DHSA 1NMQA 2CNOA 3PT5A 1EX1A 2DCUA 2VTDA 5ILOA 3KQNA 1ZMBA 2ZI7A 3TQSA 2C04A 5H6RB 5KJEA 1U8AA 4C0AC 3ESCA 1U9ZA 5J5VA 3UXMA 4C4TA 4RESA 2XMBA 3C7DB 1PR6A 4FD3A 3CNHA 4GWKA 3I2FA 5JDHA 2GSWA 2EGUA 4WNYA 1QIMA 4E4TA 3H9CA 3N8IA 3P52A 3FFTA 1NQTA 1O0BA 1ZCBA 1KS9A 2J41A 1TTQB 2H9AA 4MW6A 4MKXA 1VHQA 3HJFA 4NARA 3U44A 4BMSA 2BBOA 2Q1XA 2AD1A 2HU8A 2OD9A 4HWFA 2J46A 3WYAA 1Y9ZA 2YYSA 1NYTA 2EKDA 5JNUA 4KREA 3N9MA 1YI1A 4FZVA 1U2SA 5A04A 3B5JA 4N82A 3BIJA 3VU8A 3QWHA 3PFHA 2M2IA 5FPHA 6CHYA 1L7OA 3CUTA 3ZJTA 5HIJA 3WK9A 1VJRA 2XWQA 3V42A 2OB2A 2UYGA 1EAMA 3V7YA 3VR3A 4I55A 2HH9A 1P5FA 3HA3A 4BWYA 4BFVA 4KFCA 4L7VA 1Y5MA 1HLGA 4ZAVA 4GX1A 5B7PA 3AEKB 3HV2A 2A0KA 3L7KA 2AJDA 3IXQA 3MM4A 1TKCA 2VZ0A 2ZATA 1H3FA 5D01A 5B1DA 2L9QA 3CA8A 5AQQB 1XTQA 1G3RA 1U7XA 1GLNA 1NJ6A 2NVBA 2WF9A 4GHWA 1BQ3A 4KDRA 3AR2A 1E1YA 4MV7A 3W1VA 4YTPA 2E4UA 4N3AA 3T52A 3VZQA 6PFKA 3MJFA 5EFZA 4N39A 4OHKA 4DR6B 3DO8A 4MQEB 3JADA 3L82B 4Z3KA 1PI3A 2PR2A 4TLMB 4H2DA 2NADA 5KYUB 1GA6A 3H3MA 3QC9A 2J7KA 3R6LA 3CEMA 4F85A 5JDIA 1GQRA 4A8PA 1TEXA 3BGWA 4GICA 4AMZA 2CB0A 3AEQA 2W6QA 2BG9B 1I24A 1SWWA 2PVPA 1E1QA 1EBUA 1QFSA 3CHYA 1MOPA 3E9YA 4IDCA 1MB0A 4PTYA 4D8VA 3DFZA 3KEGA 5BMVE 1QOPB 1ZK3A 4HDCA 3NYRA 2YWHA 4HE8A 1XZBA 4H6XA 4BGIA 1YS7A 1NWHA 3MOSA 3BRSA 2FG5A 3KVNA 3LK42 2CPTA 2OV9A 4PS1A 1KI9A 5DN6A 4ZQHA 1MO3A 1O94D 5DW0A 5EWLB 4B87A 4X3OA 5CGZA 3KQLA 5CK5A 4NESA 4W1QA 3QKTA 5BOVA 1XJQA 2A9PA 1BFUA 3GLFA 4G0WA 2PJQA 3DZFA 3QV2A 3B13A 4H0CA 4I50A 1H5NA 1GYQA 2CHQA 2HAEA 2WD7A 2Z1DA 4ER7A 1K7CA 3RUFA 3ZY2A 5A0VA 2FDXA 4ALNA 1KL7A 2J31A 4KK4A 4KMOA 2BKOA 1E5TA 3ISVA 4NENB 2PGJA 4LGMA 1JMVA 2NM0A 1HPLA 2X0FA 1T1IA 3R8XA 3ZOZA 4AN4A 4DR5T 3BKXA 2PZAA 3DE3X 1IOVA 2VKOA 5JRCB 1L4EA 1VJ1A 3N0VA 3T1HB 2XWPA 1UMBB 5KPJA 1RI1A 4LSMA 3UG6A 4HUJA 2CEKA 3C15C 5TPZA 1R4ZA 4JNCA 3RUIA 3ZU2A 1YVRA 3OOWA 1KR2A 3A9TA 1WB5A 2ZTVA 3NW9A 4LDJA 2JCGA 3PHLA 4TYMA 1TZ2A 3DKRA 4YRFA 1CULC 2KPOA 4Z4CA 7REQA 1PRYA 1U0EA 2V8BA 4QDUA 3C4WA 4G8BA 2G08A 3I58A 5MFZA 1KJNA 4KV7A 3T94A 3W1EA 1U9JA 1XMSA 2I3AA 3ZD6A 2IPMA 2V0CA 2IK8A 4YQYA 2WNSA 3VSDA 2IODA 4UAUA 2XTJA 2GEDA 1G1AA 2XSZA 4FXOA 1ZX1A 2B1QA 2PFSA 1K2WA 4ASUD 1UWKA 2QYOA 3L1JA 1NW8A 3CWZB 1YB4A 2VP3A 3QLUC 3FYCA 3AY0A 4W1RA 1ZXBA 5B58C 4H3SA 1GEEA 3MMSA 4KO3S 4ALLA 5ALSA 2WB2A 2QI9F 1BU5A 1M8GA 2WEKA 5FEUA 1NV9A 4NBLA 4DXHA 3SIWA 4ITVA 2JLVA 5F7JA 2UZ4A 1T7SA 2YDRA 2AXPA 4D9CA 4FIZA 2CFOA 1CHDA 1CP3A 2H11A 2ZSHA 3I12A 1BJTA 3NPMA 3PNQA 3NRXA 1AVTA 4IDBA 4LKRA 5H1YA 5JDFA 1I1OA 1ZFNA 1ZOSA 1GARA 2A2ZA 1UFQA 1YBMA 3B2NA 4TTIA 4U2DA 3N28A 3SIPA 5I01A 4RM2A 4EYKA 4K9PA 3I39X 2HADA 2XQFA 3ZN0B 2GD6A 3FKSA 1ZGJA 3TCXB 3LT4A 5ABPA 3RC3A 1SUSA 2P2YA 2R7MA 1DIOB 1XLTC 2Y6VA 3AR9A 3N8DA 2XJ7A 1XRLA 4N0QA 4QGGA 1FMVA 4RZHA 3COVA 3EDOA 4TTPA 1TQDA 5E7QA 4Z86A 4E5KA 1DC8A 2WHRA 1BRMA 3H6HA 3HI2A 4EUNA 4U0KA 1ZW6A 3IE0A 1OI7A 3KAPA 4QAJA 2PSJA 3GJ5A 2JA1A 2KWIB 1KBOA 3DP9A 3MJRA 2L82A 1JPVA 1N3LA 5MHTA 2F9LA 4HGPA 2JZOA 1QH1A 4H9GA 1BNCA 4FJ1A 1YZYA 1VL0A 3N2OA 3IJRA 2XADA 4CUKA 2XZTA 3CLTC 4I14A 5K03A 2MMGA 4OH1A 3U5TA 2R11A 1ZG3A 1ONOA 2MYNA 3FFBA 3RHWA 4M36A 3JZIA 3PEWA 3SNHA 2B8TA 5BV0A 1D2CA 3QFCA 5BR7A 2G09A 4JQCA 4M1EA 4P3NA 2IIPA 3QFFA 4EH1A 2YRFA 1SXQA 1U0TA 4IFBA 4RA9A 2OQ2A 4FCTA 1FDUA 3LHDA 4MDYA 1QQBA 1Q44A 4LOLA 4KNWA 3T4XA 1JBKA 1V2HE 2WUGA 3K4PA 3L8HA 1YZKA 1M9NA 4KI7A 1QR6A 1ZPDA 2CZCA 3ZWAA 2ZM6B 2GJ4A 2REOA 2N3ZA 3V1UA 2IYEA 1PS8A 2Z5GA 4G8DA 5LBQB 3WIEA 4WNIA 1QRTA 1C7QA 2VIIA 3AFNA 1CUSA 3LD9A 4NOLA 4B3TT 2GPWA 3FSEA 2A9JA 1EA7A 3KVAA 1P33A 2RGXA 3OT1A 4LECA 4MUKA 3B85A 5JLJA 1DDGA 1R0SA 1X2EA 3MGGA 4UM9B 3NNSA 1RLJA 4Z91A 2NSDA 2ZAIA 3A0UA 3LGSA 1IUOA 1RKBA 3QXCA 5JAUA 1ZLXA 4G23A 4B71A 4H59A 1XQ1A 1YZUA 3SYKA 2C20A 3SEAA 1NN5A 1RQNA 3H84A 1DKPA 2YCLA 1U8CB 3CMCO 4MV1A 2EYQA 2YIDA 4M6WA 1BA3A 4OHRA 1UT5A 4YUXA 3C7AA 1THZA 2IKQA 2IVFA 2OR3A 3I4FA 1IHOA 2B78A 2PZGA 3G0BA 3PYMA 4YO8A 3VH3A 2DKFA 4RFSB 4CNQA 1NXXA 1JA1A 5ES4B 5LQUA 4EQ6B 2FMTA 3RQUA 1HTTA 3M8KA 3FSGA 2PUTA 5BW8A 1C41A 4US1R 1SMKA 2HTFA 4F86A 1KDRA 1Z2AA 3QEBZ 2VLIA 4WNAB 3D7RA 3JRXA 1WCV1 2X0RA 4HFRA 3T1VA 4ZVPA 1J6UA 1Q92A 3EGDB 4J1NA 2PS3A 1E18A 3LFHA 4EJSA 1FQWA 4GYSA 5K8TA 2UUBB 3CLUD 2BGUA 1E9AA 2G07A 1L4MA 4G36A 1ADYA 3ZCXA 4KYTA 2YJNA 1RS0A 1ZK1A 4EB6B 1BO6A 2O7NA 3L77A 2XBLA 4QXOA 1A7KA 2OQIA 1YRWA 3H17A 4H7IA 5E0KB 4ZC1A 5B57C 4EP1A 2LRKA 3UB2A 2ODQA 3PXAA 2XTMA 2D00A 4AM8A 1P5ZB 1NN1A 3WO1A 4I55B 1M0TA 2LDBA 1CZOA 1H22A 3RO7A 4JP3A 2OCGA 4DM4A 1OXBB 2HGZA 2JLCA 2XUAA 3H1PA 2WRZA 2QTCA 1ISSA 3WOVA 3DHWC 1R1DA 1GZVA 3P20A 1LPNA 4MB2A 1Z6YA 2AOUB 4GGMX 3R0ZA 2XDWA 4P80A 1U5BA 4RULA 1IAQA 3BB4A 2A6PA 2ARKA 2Q27A 3NGMA 3SZUA 1LY1A 4V0NA 4JI1T 1HUQA 5J2TF 1XRPA 1E2JA 4YMLA 4ZVNA 5KTOA 4ROSA 1GUAA 2PKRA 3UJAA 1E1HB 1R12A 3KLPX 5HP4A 2HRZA 4GPAA 3JV7A 1OC4A 2IP2A 4F6RC 3NTVA 4OM7A 1V47A 3S28A 2CNWA 4C3UA 5FY0A 4TNWA 1OSNA 1ODKA 2SCUA 3K72B 3P9NA 3PC2A 4L4RA 1XCMA 4UUMA 3SICE 3T7CA 3X1JA 3AG5A 2A3NA 3GVHA 5B55A 1E0SA 1ST3A 2QJTA 4QUIA 1EVYA 2E9XC 2EX0A 2RHHA 5GGXA 5G0WA 1WHSA 3SX0A 3AVXA 2MAWA 5BR8T 2QD1A 1WXEA 5HPYB 1E9BA 2RG7A 4HJRA 4UPVA 5C8YF 3K8ZA 1NSFA 4EAHA 1YACA 1LLDA 3VKHA 1P6QA 3QKSA 4RAQA 3WWCA 5JRDS 3IH5A 5AVTA 2V7TA 2FUG1 5JSHA 1I33A 1FFEA 2CEAA 2FW7A 2QXUA 1AHHA 1G7RA 3C3WA 4QUGA 5F78A 3M6IA 1TX4B 1Z2NX 4HWDA 1KO7A 3EQ8A 3V4SA 2RI1A 5HVNA 2BKNA 2MSEB 3CZ4A 1JMKC 1DTWA 1GR0A 3ZN1B 1P1KA 3C4JA 4WZBA 1I3OA 4UC0A 4G4IA 4E3WA 3JAMA 4WJZA 3Q6MA 2YFYA 1L5YA 1G55A 4ZQIA 3E7FA 4Z49A 4FCCA 2XAGB 3VYSB 4H63H 4H7JA 1VE9A 4V1Av 2ZB4A 2ZIUB 5ELMA 2V8OA 4C87A 2J9ZB 3MD0A 3AVSA 4LWQA 2HN1A 2I22A 2OK8A 3U4GA 2ZAGA 4D9JA 5JYEA 1QRRA 3DTVD 3BQIA 3OKAA 4QXPA 2W43A 4OJNA 3UPTA 2R7LA 4Y6OA 3LOQA 1A9PA 4AS2A 3IEKA 4EX6A 3ODPA 3RT7A 1FYXA 4M88A 4DLSA 1RRGA 4PHGA 1L1EA 1X94A 3F9CA 2YJ3A 2ZWOA 3BAFA 1DJQA 1XMOT 4D41A 3SZMA 4UEWA 4P34A 3ROXA 3ICCA 4F4CA 1LV8A 1AO0A 3IQDB 4IS2A 4KVAA 3BE8A 4OQPA 2I99A 4H77A 5DHPA 5C1OA 4IO1A 4MQLA 5LZ9A 2GBLA 3ASYA 3OYXA 3RVDA 3VI4B 3ITNA 5FXMA 4IY1A 1SQFA 1QK5A 5EWMB 3BULA 5TVGA 3EODA 2LOPA 1RI3A 3OEED 4WMLA 1KZHA 3HWSA 2KI5A 5CT9A 4BXOA 2IHYA 3C1OA 4MINA 2R84A 1Z0FA 1X0XA 4F2DA 2VPZA 2X8JB 5KYTA 5JDIC 1Y3HA 4B7ZA 5EP1A 4FYMA 5AJTA 3F6SA 2ZIEA 4G24A 2BG9A 1Z4QA 3IP9A 4HGQA 3O75A 4F2PA 4ILUA 2CGEA 2Q28A 2NO7A 2HJSA 1BE0A 1CJUC 3HRKA 3MWKA 1N2CE 2HBQA 1WZUA 2IZ1A 2FZEA 3H9BA 3N2KB 4Y6RA 3GDGA 3REFA 4NAUA 3QUBA 3SC3A 5C8YA 3V8EA 5ERYA 1LDEA 4HATA 5HUHA 5BSHA 3OBVE 1VP9A 3BFPA 4RHEA 4Z0HO 5KVSA 1TZJA 3EVNA 3R84B 1VPWA 5B3KA 1BGXT 1Z8HA 3X3HA 3FMFA 5ILGA 1W85B 1Z34A 2HJRA 2J6CA 4LGYA 4ND3A 1KDVA 2B8EA 3UU6A 2ZM8A 2FW6A 3IDSA 3QBTA 1A72A 4KRXA 4LX8A 2NOXA 3ABRB 3AF6A 3EJWA 2I7DA 4PGM<