2JPFA

Bpp3783_115-220
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
b'KQQLQEHAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHGTPPTASDVVGMPQWQEYTAMLRERFAGLDTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Bpp3783_115-220
rcsb
source organism Bordetella parapertussis
molecule tags Structural genomics
total genus 19
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11516 DUF3220 Protein of unknown function (DUF3120)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.960 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jpfA01
2JPFA
chains in the Genus database with same CATH superfamily
4UELA 2IUBA 3P8CD 4KBMB 4QH1A 4AQYT 3AE6A 2LOSA 5AQFB 2I59A 2ODVA 2K48A 4LMLA 2NTXA 5LNKA 4OK0A 4UV9B 4EZHA 5L3GB 5FL1A 2CXLA 3R84B 1HNXT 3CVRA 2CLYB 4ZZBA 1FMWA 2HHHT 3OTOT 4FJOA 4UEMA 4NPPA 5L2LA 1HNZT 2E9XA 2X0LB 1VCTA 5JRCA 4IE7A 1M7KA 2HN1A 5L3FB 4AKLA 4I55E 1L0VA 3UQ4A 3JC6C 4NUVA 3FB2A 3JCFA 2LSYA 3RIUC 2A3DA 4PW8A 2V7KA 4JI6T 4AI6A 1Y64B 1M62A 2X9HA 3CX6B 4H9RC 3EUHA 4WBOA 5FP3A 2YU1A 5LYJE 4LF4T 4MHCA 3S4UA 3EVYA 4XBFB 5JDNA 3PUAA 3VRBA 3PJAJ 3PUQA 4LF9T 3QOFA 4N78D 3I1AA 1LVKA 4H63V 1WYCA 4YHJA 3IEEA 3RYIE 2W62A 3L39A 2VB6A 2LT3A 3QNUA 4UV8B 1YW0A 2Y48B 2VQFT 3FZLB 2X9WA 5DABA 1ZV4X 1KNRA 3UFGA 4X20E 4KP3C 4O4HE 3OKQA 3J9X1 4HFBA 4YSXA 2LM9A 4U33A 3AEFA 5EK2A 2H3RA 1OEDC 2YOEA 2BG9E 4TNWA 3RRCA 4A56A 5GONE 3N5LA 4ZEYA 2FBWA 5HCJA 4YTNA 3WI3A 4X64T 1IZNB 3KDSE 5HEOA 4IDOA 5F8PA 3SFDA 5C3JA 3X1DA 4YSYA 3OBVE 2IC6A 3L09A 2XQ8A 2LEHA 2IW5B 2QRXA 3O1JA 2RP4A 4EZ4A 4QX7B 5AQIB 4HKAA 3VR9A 1U4QA 4NXNT 2Q9QA 2E8IA 3MJXA 2BS4A 3AVSA 3AAEB 4OYKA 1XWMA 5FVLA 4YTPA 4UF0B 2B76A 5AQKB 5FKYA 4O4JE 3IBPA 4TUYE 4AKRB 5AQSB 2WDQA 5H6RB 1QUUA 1ZP0A 5J2TE 2Z6EA 2BVLA 2LJLA 2XZEA 3JADA 1MIVA 2MYSA 3ONJA 4AKHA 4YHHT 2JMHA 4L0RA 3AEBA 4F6RC 2WU2A 3VKGA 4JBWF 3SOLA 2QYWA 2J47A 2DLRA 3CWZB 2NP9A 2WM9A 4PJNA 4GKJT 2JQHA 3IHRA 1OXZA 2P9BA 4TX5A 4Z90A 4ZS2A 4HFEA 4YFSA 4OHFA 3ZPOA 1UUSA 4L9IA 3K3QC 4ERRA 3RIUA 1X79A 3ZCIA 3ZC0A 3V5UA 2M6BA 4IDZA 4YT0A 2F4VT 2C5KT 4I50E 2XQAA 3MA9A 5CA1E 3RI5A 4AQGA 4EEDA 2WQYA 3PV0F 3ZMUB 3UU4A 2YEVC 3AXJB 4H9PC 4CZZB 2XY8B 2KT9A 3TLUA 4OYJA 1N32T 3LBXA 1KF6A 1WYBA 1Y01A 4DR7T 4DV6T 1N36T 5LHGB 1MMNA 3CX7B 2UXXB 4AXPA 3F57A 2YKSA 3MZKB 4GYRA 1ZEEA 2CXFA 4HGAA 4K0KT 3AECA 3M3ZB 4O4IE 2LHNA 2BKOA 2LSJA 3BQKA 3ZCJA 2BG9B 1UURA 3HA4A 1OEDA 2M67A 3RC3A 3KV4A 4EIWA 2CLYC 5AQMB 4PNIA 5HXSA 1AJ3A 4TWHA 2VURA 3N2KE 4M1PA 2IAKA 4P0AA 2LHRA 1FIOA 2DHRA 5TAOA 4IDQA 2WU5A 3ZN0B 4UR9A 2XQ9A 1XDPA 3Q2MA 2JQQA 3CPZA 4WBNE 5BR8T 4DNDA 2UXNB 1ZHCA 4H63H 5FYMA 3UU3A 4BA9A 5IWAT 1Z0PA 1X9BA 3RYHE 1KFYA 1H7CA 4CQIA 4HWFA 1KNPA 4PJJA 1KNZA 4UVAB 5AQJB 3L3PA 4TV9E 4COFA 2UU9T 1CHUA 3K1SA 5L4EA 3D0TA 3CQGB 3PUSA 5FNVE 5LOVE 3G06A 4EYUA 2XPKA 4TWDA 1VCSA 4WZXA 1QSDA 3UQ7A 2XTLA 3IA3A 2CRBA 4LFCT 2ES0A 1YQ3A 1B7TA 2IHR1 2VL0A 5LP6E 1IBMT 2K3WA 3DJBA 3ZC1A 1N33T 3GA8A 4FI5A 3TLWA 3RYCE 1IJ5A 1YQ4A 3C4XA 3PUVF 2LLYA 4HE8A 3OJAA 2E2AA 2D9DA 1W0AA 3C98B 3AEGA 5FXXA 3OVUA 4IREA 1HG2A 2X9YA 2OLTA 4DR2T 3FBZA 2CEAA 4LFAT 2J4GA 1ZKEA 3TLTA 4AIUA 1V9DA 3JAEA 2ZM2A 3ZJ2A 4U72A 3AA7B 2H89A 1T72A 3H3MA 3C64A 4QXCB 3N9OA 4C90A 5JTGA 3PTRB 2WY2A 2NTYA 4JLEA 5AQQB 3N9QA 2WS3A 4HFCA 2W4XA 2CBIA 4JI2T 1D1BA 5IUXA 1US7B 2XAFB 1NWMX 1QLBA 2CBJA 3KV9A 4EYYR 3HR0A 4EAHA 3BK9A 3M65A 2LKHA 2RPAA 4PJLA 1W9RA 4LF7T 4X62T 4DR4T 1MNDA 3ANWB 4IL4A 2HN2A 4QKNA 1XZYA 2H88A 2WWUA 3AA0B 3O1HA 2V7JA 3BQIA 5FXVA 4GK5E 5C8YE 2WDVA 1E7PA 2XQ5A 3VKHA 5HWYA 2N1GA 3UFEA 5E0OA 3H3AA 5JDMA 4IE4A 5JREA 4BJNA 2H7VC 1GQEA 1FEWA 3P4QA 4X5TA 2CCQA 2ACXA 2JMKA 3UUMA 4J2CA 5JDGA 2NW7A 3PUZF 2E9XB 5ABHA 2CHNA 3ZMVB 1MNEA 1KK7A 5IYZE 4L5GA 3U3IA 3ONLC 5ADXL 2CE7A 2FJAA 4HWIB 4ASKA 2X0HA 4PFOA 3UULA 2JPFA 1HG5A 4JEHB 2BBHA 2BG9C 3RGLA 3MACA 4EB6E 5JDFA 3LJCA 4O4LE 5JQGE 5AQRB 1MIYA 4QXHB 2JQKA 4LF8T 1UX5A 5HYAA 2BVMA 3FZFB 3NZQA 3FBLA 4IE0A 4U2ZA 1N34T 5LG3A 2KXPB 1HCIA 5JDQA 3CK6A 2C5IT 1SHZC 2J1DG 4JI4T 3NVOA 4DV4T 2N2NA 2FUPA 5HCMA 2NW9A 1LKXA 5FY1A 4ILAA 1WCRA 5EK4A 4JEUB 2A9UA 1HS7A 2CM0A 1EZ3A 5HXCA 3E22E 3RHWA 2WSSV 4DV7T 4UF0A 2X9XA 3W15B 5LXTE 3V5SA 3AAIA 3Q9DA 2XHEB 4GOUA 4CI3B 2LM2A 3O9XA 4IL9A 5A1LA 3NBXX 4H9NC 2W63A 5LGNB 5ABFB 5HEUA 4ZXLA 3SRZA 1XMQT 3AE1A 4JYAT 3B5MA 1E2AA 4YLHA 1SE7A 3AEDA 3PUWF 3HKBE 2VK9A 4GK0E 2NR4A 4ADZA 1D0ZA 3HKEE 3FZHB 4U7YA 5L3DB 4WW0A 5AQLB 4B6XA 5LGTB 3KV6A 5JH7E 4JI5T 3TLVA 4YSZA 4ZI2D 1DU2A 4B3TT 2MAWA 2V26A 2V7IA 4G63A 2Y6XA 3IF8B 2LKGA 5J0ZA 2I0MA 3I9WA 3AXJA 2HH7A 3DTOA 3NWIA 4U2YA 5JVDE 2IC9A 3KBTA 4DV1T 1UK5A 3LK42 3SWHA 4DO0A 2OA5A 4F8HA 4O2BE 5LGUB 1OWAA 1SA0E 3RH3A 3SS1A 4DVDA 4U7IA 5AQPB 3AE7A 4XZCA 2EHOD 1S94A 2BZBA 3NRXA 2PG8A 5DQWA 2LOPA 3RIFA 2KNDA 4O2AE 2BKPA 1JNRA 4EGWA 1BR0A 1J1JA 3Q5DA 3C50A 4PAGA 2YK0A 2XQ7A 2GK9A 2XAQB 4IGUA 4P09A 1UGOA 2BG9A 2CPTA 3R6NA 2WP9A 3UT5E 4IE5A 4WYVA 3UU5A 4B3MT 4I43B 3RX6A 4ZHQE 5LCYA 4YJ2E 5M4YA 3MKDA 2X67A 3GN5B 2UUBT 1UCUA 4IDPA 2PTFA 3P4RA 4ZI7E 4P0BA 2KLQA 5AQNB 3P4WA 2KWIB 5LG4A 3N9PA 3NRYA 2V6YB 4QH5A 3ABVA 4KUMB 2VKHA 3J7Yq 2ZMAA 4E7SA 2VKOA 1WFDA 4JI8T 3A5XA 3ZEFB 2K24A 3UU6A 5JDLA 1WR6A 3SFEA 2E9XC 3MXZA 2D0UA 2DCFA 2V6XA 2LSGA 2WDRA 1T8BA 2YDQA 2SPCA 2HPLA 3AE8A 4LMKA 2DL1A 2DWKA 4ZOLE 2WWVA 3GMIA 2EHOB 3WAJA 3KV5A 4QX8B 4K0UA 4GIWA 1XMOT 5KMGP 2W0GA 1D1AA 1HFAA 3ESLA 3CKDA 5AFUL 2WB5A 3ZMSB 3RKGA 2L8KA 2WCAA 3NZPA 2WMOA 2PJQA 5JDHA 2PFVA 3Q5EA 2C5JA 4EXTA 4ZI3D 3C4ZA 5HXEA 3PDYA 2E5VA 3AE3A 4GKKT 2YN6A 2L3LA 3KVBA 3FXEB 4DMVA 2WZIA 2JIWA 4CN6A 3EDUA 3RPUA 4DR5T 4DUZT 2VWAA 1HNWT 3O1IA 3B13A 2D5UA 2I6HA 2RA1A 2YU2A 4IE6A 5L3EB 2YDSA 4ISSA 4G2AA 1HTJF 1J5ET 4GYSA 2E5LT 4E7ZA 2E9XD 3ZYKA 5FY7A 2CA5A 4ILUA 4H9OC 2XM1A 3PJAA 2KWHA 4EV6A 2WAUA 2FJEA 2XQYA 2W00A 3JAFA 3HKDE 2MBGA 3ZT6A 5L3BB 1BR1A 2V7LA 4DV5T 1HR0T 3LK2B 2WBLA 3RLFF 2BDEA 5C2TA 3F2EA 2IIUA 4YXDA 1VOMA 3ANWA 4U74A 2XQ4A 1IBLT 2W2UA 5JR9B 1MMDA 3HI2A 5LMNT 2H7OA 2MPKA 1T98A 3QK6A 1Z8UA 3AE5A 1YD8G 2XAJB 2W61A 1IAPA 1MMGA 2IMLA 1MIWA 3CQXC 3KBUA 2CWYA 1G73A 4DUYT 4QWNB 3PUXF 3QB5K 5FXWA 5LMUT 2IDOB 5LJMA 5F5WA 4Z8XA 1XNQT 2CWOA 3ZMTB 4DV3T 5AQHB 2NWBA 2LSIA 3A7MA 3N9MA 4X1KE 1W0BA 2VKDA 4HTEA 2X51A 4AKIA 4CXYA 3T8OA 1WR0A 5JRCB 2BS3A 2DWGA 4JI0T 3I0QA 3T1YT 3RC8A 4ILBA 3ETVA 3RKOA 2J62A 5LBQB 3LSVA 2WMNA 4DMWA 3O4XE 1R8IA 4WNKA 3L8RA 2XSAA 3ONXA 3CQCB 3ZSSA 5HEHA 3ZKRA 2Q9QD 4X1IE 3E0ZA 4HFHA 2C0SA 3N9LA 4DBRA 3U78A 2VVNA 4HFDA 4TN7B 3OYXA 3N9NA 5L47A 2A72A 1D1CA 3CIRA 2VVSA 3AA6B 2XAGB 3I9YA 3FHNA 5HEGA 3UUBA 1BR4A 4AISA 4ZI2C 5LA6E 1J5WA 4AQFC 3ZJ1A 2BS2A 4KMCA 3ZT7A 3LDQB 4A97A 4X65T 5AQTB 4IDNA 4CXWA 2XJ7A 4UVBB 5FY0A 5AQOB 3ZN1B 4PFPA 4NXMT 4YTMA 3HL6A 4Q25A 4HWCA 4TNVA 3QB5A 4TV8E 2ODUA 3JC6D 2LRKA 5ABFA 1U5PA 4LF5T 3K3OA 4KHPT 4ZS3A 2EHOC 5IHYA 3UUXB 4UVCB 1OEDE 4IT4A 5EZYE 3MK7C 2FJBA 3AAAB 1I6ZA 3EDVA 5ABGA 4V1Av 1D0YA 5LHIB 3PUGA 3AE4A 4HWDA 2A2FX 3WAKA 2XAHB 2VKJA 4LF6T 4ANJA 4TWFA 4O8SA 4X1YE 4KHZF 2DI4A 2JQ9A 3QC9A 2DNXA 3P7IA 4DBQA 2KSRA 3ZT5A 4JI1T 2X66A 4QH4A 5LJNA 2B1EA 3GWHA 2L9QA 2W67A 3B57A 5ABEA 2Q9QB 5ETWA 5FXZA 4HEAA 2W66A 4NIQA 4OFZA 2KZ7B 2VASA 3ZYMA 2ZM8A 4JV5T 1YKEB 2V5DA 5FL0A 3A8YC 1WLXA 3VR8A 2AE9A 3AVRA 2KINB 4QXBB 2M6IA 2KMFA 4Z91A 2ZM6T 2Y8DA 4OX9T 2UXDT 3TKLB 3ZYLA 2XASB 3UTKA 1T7SA 5CA0E 2BKNA 4JI3T 4CN4A 2VQET 5F3JA 5DQVA 5LHHB 4UXNB 1NEKA 2QA7A 4HN9A 5HXRA 2HPJA 4DV0T 5CGMA 3KINB 1LVFA 1I94T 3Q5WA 1XDOA 1G8XA 1IBKT 3QUJA 5KX5E 2XQ6A 5AQGB 4U31A 5FVKA 4TZ4C 3N2OA 4I4TE 4PJMA 4DV2T 3RIAA 3RQUA 3NKZA 4EEBA 5HAXA 1ZOYA 2V7MA 3VRAA 3RQWA 3HKCE 1FMVA 4IIJE 3CX8B 3GN5A 5HXHA 3E08A 5L3CB 2UUCT 3UUNA 3LK3B 3N2GE 2CHOA 4NUUA 5JR9C 5AQUB 1VRBA 3PE0A 3AEEA 4HFVA 4BJMA 4CI1B 2NW8A 3LBXB 3PUYF 5LB7B 3C51A 4ZZCA 4AKGA 3DP7A 2YINA 2BBJA 2V6YA 2XSBA 1W09A 2X0YA 4JI7T 2QGSA 2FJDA 4AQFA 1NAFA 4ZI3C 5AQVB 3K8PC 4B3ST 2ACZA 2JJ9A 2XUEA 3P4SA 3F31A 5H6QB 3KVAA 4QHOA 3EAMA 3UU8A 4DR6T 4CN1A 5KXJA 2MOZA 3PU3A 3T1HT 3AB3B 4JUYA 3RYFE 2N9DA 3ZMZB 3I0OA 4A5XA 4CI2B 4A98A 3H37A 1OEDB 1YKHB 5FMNA 5L4HA 1HX1B 2CMRA 2EHOA 4XAXB 5EK3A 4UIGA 4I0UA 4MALA 1JNZA 4PK5A 4YJ3E 4MBQA 1YXRA 3PU8A 2LRLA 3AEAA 4HWHA 1IJ6A 2XM2A 4X66T 3AE9A 4U3CA 2PBIA 2MTQA 4EOZB 5DJQC 2ZM0A 1WRDA 2UUAT 1BR2A 1MMAA 2YDRA 3OYZA 5J1GA 2UXCT 4DR1T 4CXXA 3ZSTA 4ILCA 3VHLA 1UX4A 2AXDS 3P4PA 1FJGT 3OPCA 2D2SA 1LRZA 3FXDB 1HF8A 3EHZA 5HWXA 4PK4A 2QVAA 3TLSA 1O3XA 2V1DB 1S35A 2ZLYA 5CJ5A 4IHJE 3ZLIA 4DR3T 2NOXA 3AE2A 2V8SV 4BAYB 4HFIA 2K5BB 5CFBA 2OV9A 3K3NA 2LE8A 3CMLA 2D0TA 1SUMB 1XNRT 4PK6A 3P50A 3BQLA 5BMVE 3ETUA 3Q5XA 4KI0F 2K9AA 5CB4E 3VU7H 1CUNA 3KFWX 4H9QC 3EI0A 4MFRA 2UXBT 2R6GF 2X68A 4KX6A 1E1HB 4LMJA 2WZHA 5LBMA 1HX8A 1KEYA 3FZMB 3LG7A 2G0UA 3AA1B 2LSKA 2V5CA 2VL8A 3LFMA 4H9SE 4YY3T 5JR9A 1NENA 3PURA 1D0XA 4B3RT 4LFBT 3C4WA 5KDMC 2XQ3A 3EABA 3RF1A 2CXDA 4C91A 5HEJA 4DIDB 2Q9QC 3FZKB 4P1NA 4ISTA 3RRWA 4MLKA 5J2UE 2JRKA
chains in the Genus database with same CATH topology
4UELA 3ZJ1A 4CQIA 4KMCA 1SA0E 3RH3A 4PJJA 3SS1A 3P8CD 4DVDA 1KNZA 4CXWA 4XZCA 2EHOD 4UVBB 5FY0A 4KBMB 1S94A 4UVAB 2BZBA 3NRXA 2PG8A 5DQWA 2LOPA 3L3PA 3ZN1B 4TV9E 4PFPA 2KNDA 2LOSA 4O2AE 2I59A 2ODVA 3HL6A 3D0TA 2K48A 1BR0A 2NTXA 3CQGB 5LNKA 4TV8E 2ODUA 4OK0A 4UV9B 3JC6D 4EZHA 5L3GB 3C50A 4PAGA 3PUSA 2YK0A 2CXLA 3R84B 2GK9A 2XAQB 5FNVE 1U5PA 5LOVE 3CVRA 2CLYB 4IGUA 1FMWA 4EYUA 3K3OA 4P09A 4FJOA 4ZS3A 2EHOC 4UEMA 5IHYA 3UUXB 5L2LA 2E9XA 4UVCB 2X0LB 3R6NA 3UT5E 1QSDA 5EZYE 4IE5A 5JRCA 2XTLA 3MK7C 4IE7A 3AAAB 2ES0A 5L3FB 4AKLA 4I43B 3RX6A 3EDVA 4I55E 1B7TA 3JC6C 4ZHQE 4NUVA 4V1Av 5LP6E 1D0YA 3FB2A 5LHIB 2LSYA 5LCYA 3PUGA 4YJ2E 5M4YA 2A3DA 3DJBA 2A2FX 3MKDA 4PW8A 3WAKA 3ZC1A 2X67A 2XAHB 2VKJA 3GN5B 1UCUA 4ANJA 2V7KA 4O8SA 4X1YE 4AI6A 1Y64B 3GA8A 2DI4A 3QC9A 4FI5A 2X9HA 3CX6B 2DNXA 3RYCE 1IJ5A 4H9RC 3EUHA 4WBOA 5FP3A 3P7IA 4DBQA 4ZI7E 2YU1A 3C4XA 5LYJE 2X66A 4P0BA 4MHCA 5LJNA 2B1EA 3S4UA 3EVYA 3GWHA 4XBFB 5JDNA 2L9QA 2KLQA 4HE8A 3OJAA 2KWIB 3PUAA 5LG4A 3B57A 3PUQA 2Q9QB 3N9PA 4N78D 3NRYA 5ETWA 3C98B 3I1AA 1LVKA 2VKHA 4KUMB 5FXZA 3J7Yq 4HEAA 4H63V 1WYCA 2ZMAA 4YHJA 4OFZA 5FXXA 2KZ7B 4E7SA 2VASA 3IEEA 3ZYMA 2ZM8A 3RYIE 2VKOA 1HG2A 2W62A 1YKEB 2X9YA 3FBZA 2VB6A 3A5XA 2LT3A 2CEAA 4UV8B 1YW0A 1ZKEA 2Y48B 2X9WA 3ZEFB 2K24A 1V9DA 5DABA 1ZV4X 5JDLA 1WLXA 2ZM2A 3ZJ2A 3AVRA 2KINB 4QXBB 2KMFA 4X20E 1WR6A 4U72A 2E9XC 3AA7B 3MXZA 2Y8DA 2D0UA 2DCFA 3C64A 4QXCB 3TKLB 3N9OA 2LSGA 4C90A 2SPCA 4KP3C 3ZYLA 3PTRB 2XASB 3UTKA 2HPLA 4O4HE 2NTYA 5CA0E 4JLEA 3OKQA 3J9X1 2DWKA 4ZOLE 3GMIA 3N9QA 2EHOB 3WAJA 2LM9A 3KV5A 4QX8B 5F3JA 4K0UA 5DQVA 5LHHB 4UXNB 4GIWA 1D1BA 2QA7A 1US7B 5EK2A 4HN9A 2XAFB 5HXRA 2HPJA 2H3RA 1NWMX 3KINB 3RRCA 1LVFA 4A56A 3Q5WA 3KV9A 1G8XA 4EYYR 5KMGP 3HR0A 3QUJA 4EAHA 2W0GA 3BK9A 5KX5E 5GONE 3M65A 3N5LA 1D1AA 1HFAA 3ESLA 3CKDA 4PJLA 3WI3A 5AFUL 3ZMSB 1IZNB 1MNDA 4TZ4C 3N2OA 3KDSE 2L8KA 4I4TE 3NZPA 4PJMA 3ANWB 2WMOA 2PJQA 4QKNA 5HAXA 2V7MA 5F8PA 5JDHA 2WWUA 3AA0B 3HKCE 1FMVA 2PFVA 3O1HA 4IIJE 2V7JA 2C5JA 4EXTA 3CX8B 3BQIA 5FXVA 3GN5A 4GK5E 5HXHA 3OBVE 4ZI3D 2IC6A 3E08A 3C4ZA 5C8YE 5L3CB 3L09A 2LEHA 5HXEA 2IW5B 3VKHA 5HWYA 3PDYA 3O1JA 3UUNA 3LK3B 3N2GE 2N1GA 2RP4A 3UFEA 4NUUA 2L3LA 5JR9C 3KVBA 4EZ4A 5E0OA 1VRBA 3H3AA 3PE0A 4QX7B 4HKAA 4HFVA 3FXEB 4BJMA 4DMVA 4CI1B 1U4QA 2NW8A 5JDMA 3LBXB 4IE4A 5JREA 3EDUA 3RPUA 3C51A 4BJNA 2Q9QA 2E8IA 3DP7A 4AKGA 2YINA 2H7VC 3MJXA 2VWAA 2QGSA 3AVSA 3AAEB 4OYKA 4AQFA 1NAFA 4ZI3C 3O1IA 3B13A 1FEWA 2D5UA 4UF0B 3K8PC 2RA1A 2CCQA 2YU2A 4IE6A 2ACXA 4O4JE 2JMKA 3UUMA 5L3EB 3IBPA 4J2CA 2NW7A 4TUYE 4AKRB 4ISSA 5JDGA 2E9XB 4G2AA 3ZMVB 1HTJF 2JJ9A 2XUEA 1MNEA 5H6RB 1KK7A 4GYSA 1QUUA 5IYZE 5J2TE 4E7ZA 4L5GA 2Z6EA 2E9XD 3F31A 2BVLA 3U3IA 3ZYKA 5H6QB 5FY7A 3KVAA 2LJLA 4QHOA 2CA5A 4ILUA 2CE7A 5ADXL 4H9OC 1MIVA 2MYSA 4AKHA 4ASKA 2MOZA 3PU3A 3AB3B 4JUYA 3RYFE 2JMHA 4L0RA 2N9DA 3ZMZB 3I0OA 2KWHA 4CI2B 4PFOA 4F6RC 3H37A 2WAUA 3UULA 1YKHB 5FMNA 3VKGA 2XQYA 2JPFA 2W00A 1HG5A 2CMRA 2EHOA 4JEHB 3SOLA 4XAXB 3HKDE 2MBGA 5EK3A 4UIGA 3MACA 2DLRA 3CWZB 4EB6E 5L3BB 1BR1A 2NP9A 2WM9A 2V7LA 5JDFA 4MALA 4PJNA 3LJCA 3IHRA 1OXZA 2P9BA 3LK2B 4PK5A 4YJ3E 4TX5A 4ZS2A 4O4LE 2WBLA 4MBQA 5JQGE 4YFSA 3PU8A 4OHFA 3ZPOA 1MIYA 2BDEA 4L9IA 3K3QC 4QXHB 4ERRA 1IJ6A 1X79A 1UX5A 3ZCIA 3F2EA 3ZC0A 3V5UA 5HYAA 4IDZA 2BVMA 2C5KT 4I50E 1VOMA 2PBIA 3MA9A 5CA1E 3NZQA 2MTQA 3FBLA 4IE0A 3ANWA 4EOZB 5DJQC 2ZM0A 4U74A 1WRDA 4AQGA 1BR2A 1MMAA 3OYZA 5JR9B 1MMDA 2KXPB 3ZMUB 1HCIA 3HI2A 2H7OA 5J1GA 5JDQA 1T98A 2YEVC 3QK6A 4H9PC 4CXXA 1YD8G 2C5IT 4CZZB 3VHLA 1UX4A 1SHZC 2KT9A 2XAJB 2J1DG 2W61A 1IAPA 1MMGA 4OYJA 2D2SA 1LRZA 3FXDB 2N2NA 1HF8A 3LBXA 2NW9A 1MIWA 1LKXA 1WYBA 5FY1A 5HWXA 3CQXC 3KBUA 4PK4A 2CWYA 1O3XA 5EK4A 1G73A 4JEUB 5LHGB 1MMNA 1HS7A 3CX7B 2CM0A 4QWNB 2V1DB 1EZ3A 5HXCA 3E22E 2UXXB 4AXPA 5FXWA 2WSSV 3F57A 1S35A 4UF0A 2X9XA 3MZKB 2ZLYA 3W15B 5LXTE 3V5SA 5LJMA 3AAIA 3Q9DA 4GYRA 2XHEB 4Z8XA 1ZEEA 4IHJE 2CWOA 2CXFA 4GOUA 3ZLIA 3ZMTB 4CI3B 3O9XA 2NOXA 4HGAA 4BAYB 4O4IE 2K5BB 5A1LA 2LHNA 2NWBA 3NBXX 2LSJA 4H9NC 2W63A 5LGNB 3K3NA 2LSIA 2LE8A 3N9MA 3SRZA 4X1KE 2VKDA 3CMLA 4HTEA 2D0TA 2X51A 3BQKA 3ZCJA 4YLHA 3HA4A 4AKIA 4CXYA 4PK6A 3T8OA 5JRCB 2M67A 3RC3A 3BQLA 3KV4A 4EIWA 5BMVE 3ETUA 2CLYC 3Q5XA 3HKBE 2VK9A 2DWGA 3I0QA 4GK0E 4ADZA 3RC8A 2K9AA 1D0ZA 5CB4E 3ETVA 3RKOA 4PNIA 5LBQB 2WMNA 3VU7H 1CUNA 3KFWX 3HKEE 5HXSA 4DMWA 4H9QC 4MFRA 3O4XE 1AJ3A 4WNKA 5L3DB 2X68A 4WW0A 3ONXA 4B6XA 1E1HB 3CQCB 3N2KE 4M1PA 5LBMA 5LGTB 1HX8A 3KV6A 2IAKA 5JH7E 3LG7A 4P0AA 2Q9QD 4X1IE 2LHRA 3E0ZA 1FIOA 4ZI2D 2G0UA 2C0SA 3N9LA 3AA1B 2DHRA 2LSKA 2V26A 3U78A 4DBRA 2V7IA 2VL8A 4G63A 3LFMA 5TAOA 2Y6XA 3IF8B 3ZN0B 4H9SE 4TN7B 3OYXA 5JR9A 3N9NA 3PURA 3Q2MA 1D0XA 2A72A 3CPZA 2JQQA 3I9WA 4WBNE 1D1CA 3C4WA 2UXNB 1ZHCA 4H63H 2HH7A 3DTOA 5FYMA 4DNDA 5KDMC 3AA6B 5JVDE 4BA9A 2CXDA 2IC9A 2XAGB 3I9YA 4C91A 1Z0PA 3FHNA 3KBTA 1BR4A 2Q9QC 3LK42 3SWHA 4DO0A 4ZI2C 2OA5A 3RYHE 5LA6E 4ISTA 1H7CA 4O2BE 3RRWA 4MLKA 5J2UE 4AQFC 5LGUB 2JRKA 1OWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPF A; 
#chains in the Genus database with same CATH topology
 4UEL A;  2IUB A;  3P8C D;  4KBM B;  4QH1 A;  4AQY T;  3AE6 A;  2LOS A;  5AQF B;  2I59 A;  2ODV A;  2K48 A;  4LML A;  2NTX A;  5LNK A;  4OK0 A;  4UV9 B;  4EZH A;  5L3G B;  5FL1 A;  2CXL A;  3R84 B;  1HNX T;  3CVR A;  2CLY B;  4ZZB A;  1FMW A;  2HHH T;  3OTO T;  4FJO A;  4UEM A;  4NPP A;  5L2L A;  1HNZ T;  2E9X A;  2X0L B;  1VCT A;  5JRC A;  4IE7 A;  1M7K A;  2HN1 A;  5L3F B;  4AKL A;  4I55 E;  1L0V A;  3UQ4 A;  3JC6 C;  4NUV A;  3FB2 A;  3JCF A;  2LSY A;  3RIU C;  2A3D A;  4PW8 A;  2V7K A;  4JI6 T;  4AI6 A;  1Y64 B;  1M62 A;  2X9H A;  3CX6 B;  4H9R C;  3EUH A;  4WBO A;  5FP3 A;  2YU1 A;  5LYJ E;  4LF4 T;  4MHC A;  3S4U A;  3EVY A;  4XBF B;  5JDN A;  3PUA A;  3VRB A;  3PJA J;  3PUQ A;  4LF9 T;  3QOF A;  4N78 D;  3I1A A;  1LVK A;  4H63 V;  1WYC A;  4YHJ A;  3IEE A;  3RYI E;  2W62 A;  3L39 A;  2VB6 A;  2LT3 A;  3QNU A;  4UV8 B;  1YW0 A;  2Y48 B;  2VQF T;  3FZL B;  2X9W A;  5DAB A;  1ZV4 X;  1KNR A;  3UFG A;  4X20 E;  4KP3 C;  4O4H E;  3OKQ A;  3J9X 1;  4HFB A;  4YSX A;  2LM9 A;  4U33 A;  3AEF A;  5EK2 A;  2H3R A;  1OED C;  2YOE A;  2BG9 E;  4TNW A;  3RRC A;  4A56 A;  5GON E;  3N5L A;  4ZEY A;  2FBW A;  5HCJ A;  4YTN A;  3WI3 A;  4X64 T;  1IZN B;  3KDS E;  5HEO A;  4IDO A;  5F8P A;  3SFD A;  5C3J A;  3X1D A;  4YSY A;  3OBV E;  2IC6 A;  3L09 A;  2XQ8 A;  2LEH A;  2IW5 B;  2QRX A;  3O1J A;  2RP4 A;  4EZ4 A;  4QX7 B;  5AQI B;  4HKA A;  3VR9 A;  1U4Q A;  4NXN T;  2Q9Q A;  2E8I A;  3MJX A;  2BS4 A;  3AVS A;  3AAE B;  4OYK A;  1XWM A;  5FVL A;  4YTP A;  4UF0 B;  2B76 A;  5AQK B;  5FKY A;  4O4J E;  3IBP A;  4TUY E;  4AKR B;  5AQS B;  2WDQ A;  5H6R B;  1QUU A;  1ZP0 A;  5J2T E;  2Z6E A;  2BVL A;  2LJL A;  2XZE A;  3JAD A;  1MIV A;  2MYS A;  3ONJ A;  4AKH A;  4YHH T;  2JMH A;  4L0R A;  3AEB A;  4F6R C;  2WU2 A;  3VKG A;  4JBW F;  3SOL A;  2QYW A;  2J47 A;  2DLR A;  3CWZ B;  2NP9 A;  2WM9 A;  4PJN A;  4GKJ T;  2JQH A;  3IHR A;  1OXZ A;  2P9B A;  4TX5 A;  4Z90 A;  4ZS2 A;  4HFE A;  4YFS A;  4OHF A;  3ZPO A;  1UUS A;  4L9I A;  3K3Q C;  4ERR A;  3RIU A;  1X79 A;  3ZCI A;  3ZC0 A;  3V5U A;  2M6B A;  4IDZ A;  4YT0 A;  2F4V T;  2C5K T;  4I50 E;  2XQA A;  3MA9 A;  5CA1 E;  3RI5 A;  4AQG A;  4EED A;  2WQY A;  3PV0 F;  3ZMU B;  3UU4 A;  2YEV C;  3AXJ B;  4H9P C;  4CZZ B;  2XY8 B;  2KT9 A;  3TLU A;  4OYJ A;  1N32 T;  3LBX A;  1KF6 A;  1WYB A;  1Y01 A;  4DR7 T;  4DV6 T;  1N36 T;  5LHG B;  1MMN A;  3CX7 B;  2UXX B;  4AXP A;  3F57 A;  2YKS A;  3MZK B;  4GYR A;  1ZEE A;  2CXF A;  4HGA A;  4K0K T;  3AEC A;  3M3Z B;  4O4I E;  2LHN A;  2BKO A;  2LSJ A;  3BQK A;  3ZCJ A;  2BG9 B;  1UUR A;  3HA4 A;  1OED A;  2M67 A;  3RC3 A;  3KV4 A;  4EIW A;  2CLY C;  5AQM B;  4PNI A;  5HXS A;  1AJ3 A;  4TWH A;  2VUR A;  3N2K E;  4M1P A;  2IAK A;  4P0A A;  2LHR A;  1FIO A;  2DHR A;  5TAO A;  4IDQ A;  2WU5 A;  3ZN0 B;  4UR9 A;  2XQ9 A;  1XDP A;  3Q2M A;  2JQQ A;  3CPZ A;  4WBN E;  5BR8 T;  4DND A;  2UXN B;  1ZHC A;  4H63 H;  5FYM A;  3UU3 A;  4BA9 A;  5IWA T;  1Z0P A;  1X9B A;  3RYH E;  1KFY A;  1H7C A;  4CQI A;  4HWF A;  1KNP A;  4PJJ A;  1KNZ A;  4UVA B;  5AQJ B;  3L3P A;  4TV9 E;  4COF A;  2UU9 T;  1CHU A;  3K1S A;  5L4E A;  3D0T A;  3CQG B;  3PUS A;  5FNV E;  5LOV E;  3G06 A;  4EYU A;  2XPK A;  4TWD A;  1VCS A;  4WZX A;  1QSD A;  3UQ7 A;  2XTL A;  3IA3 A;  2CRB A;  4LFC T;  2ES0 A;  1YQ3 A;  1B7T A;  2IHR 1;  2VL0 A;  5LP6 E;  1IBM T;  2K3W A;  3DJB A;  3ZC1 A;  1N33 T;  3GA8 A;  4FI5 A;  3TLW A;  3RYC E;  1IJ5 A;  1YQ4 A;  3C4X A;  3PUV F;  2LLY A;  4HE8 A;  3OJA A;  2E2A A;  2D9D A;  1W0A A;  3C98 B;  3AEG A;  5FXX A;  3OVU A;  4IRE A;  1HG2 A;  2X9Y A;  2OLT A;  4DR2 T;  3FBZ A;  2CEA A;  4LFA T;  2J4G A;  1ZKE A;  3TLT A;  4AIU A;  1V9D A;  3JAE A;  2ZM2 A;  3ZJ2 A;  4U72 A;  3AA7 B;  2H89 A;  1T72 A;  3H3M A;  3C64 A;  4QXC B;  3N9O A;  4C90 A;  5JTG A;  3PTR B;  2WY2 A;  2NTY A;  4JLE A;  5AQQ B;  3N9Q A;  2WS3 A;  4HFC A;  2W4X A;  2CBI A;  4JI2 T;  1D1B A;  5IUX A;  1US7 B;  2XAF B;  1NWM X;  1QLB A;  2CBJ A;  3KV9 A;  4EYY R;  3HR0 A;  4EAH A;  3BK9 A;  3M65 A;  2LKH A;  2RPA A;  4PJL A;  1W9R A;  4LF7 T;  4X62 T;  4DR4 T;  1MND A;  3ANW B;  4IL4 A;  2HN2 A;  4QKN A;  1XZY A;  2H88 A;  2WWU A;  3AA0 B;  3O1H A;  2V7J A;  3BQI A;  5FXV A;  4GK5 E;  5C8Y E;  2WDV A;  1E7P A;  2XQ5 A;  3VKH A;  5HWY A;  2N1G A;  3UFE A;  5E0O A;  3H3A A;  5JDM A;  4IE4 A;  5JRE A;  4BJN A;  2H7V C;  1GQE A;  1FEW A;  3P4Q A;  4X5T A;  2CCQ A;  2ACX A;  2JMK A;  3UUM A;  4J2C A;  5JDG A;  2NW7 A;  3PUZ F;  2E9X B;  5ABH A;  2CHN A;  3ZMV B;  1MNE A;  1KK7 A;  5IYZ E;  4L5G A;  3U3I A;  3ONL C;  5ADX L;  2CE7 A;  2FJA A;  4HWI B;  4ASK A;  2X0H A;  4PFO A;  3UUL A;  2JPF A;  1HG5 A;  4JEH B;  2BBH A;  2BG9 C;  3RGL A;  3MAC A;  4EB6 E;  5JDF A;  3LJC A;  4O4L E;  5JQG E;  5AQR B;  1MIY A;  4QXH B;  2JQK A;  4LF8 T;  1UX5 A;  5HYA A;  2BVM A;  3FZF B;  3NZQ A;  3FBL A;  4IE0 A;  4U2Z A;  1N34 T;  5LG3 A;  2KXP B;  1HCI A;  5JDQ A;  3CK6 A;  2C5I T;  1SHZ C;  2J1D G;  4JI4 T;  3NVO A;  4DV4 T;  2N2N A;  2FUP A;  5HCM A;  2NW9 A;  1LKX A;  5FY1 A;  4ILA A;  1WCR A;  5EK4 A;  4JEU B;  2A9U A;  1HS7 A;  2CM0 A;  1EZ3 A;  5HXC A;  3E22 E;  3RHW A;  2WSS V;  4DV7 T;  4UF0 A;  2X9X A;  3W15 B;  5LXT E;  3V5S A;  3AAI A;  3Q9D A;  2XHE B;  4GOU A;  4CI3 B;  2LM2 A;  3O9X A;  4IL9 A;  5A1L A;  3NBX X;  4H9N C;  2W63 A;  5LGN B;  5ABF B;  5HEU A;  4ZXL A;  3SRZ A;  1XMQ T;  3AE1 A;  4JYA T;  3B5M A;  1E2A A;  4YLH A;  1SE7 A;  3AED A;  3PUW F;  3HKB E;  2VK9 A;  4GK0 E;  2NR4 A;  4ADZ A;  1D0Z A;  3HKE E;  3FZH B;  4U7Y A;  5L3D B;  4WW0 A;  5AQL B;  4B6X A;  5LGT B;  3KV6 A;  5JH7 E;  4JI5 T;  3TLV A;  4YSZ A;  4ZI2 D;  1DU2 A;  4B3T T;  2MAW A;  2V26 A;  2V7I A;  4G63 A;  2Y6X A;  3IF8 B;  2LKG A;  5J0Z A;  2I0M A;  3I9W A;  3AXJ A;  2HH7 A;  3DTO A;  3NWI A;  4U2Y A;  5JVD E;  2IC9 A;  3KBT A;  4DV1 T;  1UK5 A;  3LK4 2;  3SWH A;  4DO0 A;  2OA5 A;  4F8H A;  4O2B E;  5LGU B;  1OWA A;  1SA0 E;  3RH3 A;  3SS1 A;  4DVD A;  4U7I A;  5AQP B;  3AE7 A;  4XZC A;  2EHO D;  1S94 A;  2BZB A;  3NRX A;  2PG8 A;  5DQW A;  2LOP A;  3RIF A;  2KND A;  4O2A E;  2BKP A;  1JNR A;  4EGW A;  1BR0 A;  1J1J A;  3Q5D A;  3C50 A;  4PAG A;  2YK0 A;  2XQ7 A;  2GK9 A;  2XAQ B;  4IGU A;  4P09 A;  1UGO A;  2BG9 A;  2CPT A;  3R6N A;  2WP9 A;  3UT5 E;  4IE5 A;  4WYV A;  3UU5 A;  4B3M T;  4I43 B;  3RX6 A;  4ZHQ E;  5LCY A;  4YJ2 E;  5M4Y A;  3MKD A;  2X67 A;  3GN5 B;  2UUB T;  1UCU A;  4IDP A;  2PTF A;  3P4R A;  4ZI7 E;  4P0B A;  2KLQ A;  5AQN B;  3P4W A;  2KWI B;  5LG4 A;  3N9P A;  3NRY A;  2V6Y B;  4QH5 A;  3ABV A;  4KUM B;  2VKH A;  3J7Y q;  2ZMA A;  4E7S A;  2VKO A;  1WFD A;  4JI8 T;  3A5X A;  3ZEF B;  2K24 A;  3UU6 A;  5JDL A;  1WR6 A;  3SFE A;  2E9X C;  3MXZ A;  2D0U A;  2DCF A;  2V6X A;  2LSG A;  2WDR A;  1T8B A;  2YDQ A;  2SPC A;  2HPL A;  3AE8 A;  4LMK A;  2DL1 A;  2DWK A;  4ZOL E;  2WWV A;  3GMI A;  2EHO B;  3WAJ A;  3KV5 A;  4QX8 B;  4K0U A;  4GIW A;  1XMO T;  5KMG P;  2W0G A;  1D1A A;  1HFA A;  3ESL A;  3CKD A;  5AFU L;  2WB5 A;  3ZMS B;  3RKG A;  2L8K A;  2WCA A;  3NZP A;  2WMO A;  2PJQ A;  5JDH A;  2PFV A;  3Q5E A;  2C5J A;  4EXT A;  4ZI3 D;  3C4Z A;  5HXE A;  3PDY A;  2E5V A;  3AE3 A;  4GKK T;  2YN6 A;  2L3L A;  3KVB A;  3FXE B;  4DMV A;  2WZI A;  2JIW A;  4CN6 A;  3EDU A;  3RPU A;  4DR5 T;  4DUZ T;  2VWA A;  1HNW T;  3O1I A;  3B13 A;  2D5U A;  2I6H A;  2RA1 A;  2YU2 A;  4IE6 A;  5L3E B;  2YDS A;  4ISS A;  4G2A A;  1HTJ F;  1J5E T;  4GYS A;  2E5L T;  4E7Z A;  2E9X D;  3ZYK A;  5FY7 A;  2CA5 A;  4ILU A;  4H9O C;  2XM1 A;  3PJA A;  2KWH A;  4EV6 A;  2WAU A;  2FJE A;  2XQY A;  2W00 A;  3JAF A;  3HKD E;  2MBG A;  3ZT6 A;  5L3B B;  1BR1 A;  2V7L A;  4DV5 T;  1HR0 T;  3LK2 B;  2WBL A;  3RLF F;  2BDE A;  5C2T A;  3F2E A;  2IIU A;  4YXD A;  1VOM A;  3ANW A;  4U74 A;  2XQ4 A;  1IBL T;  2W2U A;  5JR9 B;  1MMD A;  3HI2 A;  5LMN T;  2H7O A;  2MPK A;  1T98 A;  3QK6 A;  1Z8U A;  3AE5 A;  1YD8 G;  2XAJ B;  2W61 A;  1IAP A;  1MMG A;  2IML A;  1MIW A;  3CQX C;  3KBU A;  2CWY A;  1G73 A;  4DUY T;  4QWN B;  3PUX F;  3QB5 K;  5FXW A;  5LMU T;  2IDO B;  5LJM A;  5F5W A;  4Z8X A;  1XNQ T;  2CWO A;  3ZMT B;  4DV3 T;  5AQH B;  2NWB A;  2LSI A;  3A7M A;  3N9M A;  4X1K E;  1W0B A;  2VKD A;  4HTE A;  2X51 A;  4AKI A;  4CXY A;  3T8O A;  1WR0 A;  5JRC B;  2BS3 A;  2DWG A;  4JI0 T;  3I0Q A;  3T1Y T;  3RC8 A;  4ILB A;  3ETV A;  3RKO A;  2J62 A;  5LBQ B;  3LSV A;  2WMN A;  4DMW A;  3O4X E;  1R8I A;  4WNK A;  3L8R A;  2XSA A;  3ONX A;  3CQC B;  3ZSS A;  5HEH A;  3ZKR A;  2Q9Q D;  4X1I E;  3E0Z A;  4HFH A;  2C0S A;  3N9L A;  4DBR A;  3U78 A;  2VVN A;  4HFD A;  4TN7 B;  3OYX A;  3N9N A;  5L47 A;  2A72 A;  1D1C A;  3CIR A;  2VVS A;  3AA6 B;  2XAG B;  3I9Y A;  3FHN A;  5HEG A;  3UUB A;  1BR4 A;  4AIS A;  4ZI2 C;  5LA6 E;  1J5W A;  4AQF C;  3ZJ1 A;  2BS2 A;  4KMC A;  3ZT7 A;  3LDQ B;  4A97 A;  4X65 T;  5AQT B;  4IDN A;  4CXW A;  2XJ7 A;  4UVB B;  5FY0 A;  5AQO B;  3ZN1 B;  4PFP A;  4NXM T;  4YTM A;  3HL6 A;  4Q25 A;  4HWC A;  4TNV A;  3QB5 A;  4TV8 E;  2ODU A;  3JC6 D;  2LRK A;  5ABF A;  1U5P A;  4LF5 T;  3K3O A;  4KHP T;  4ZS3 A;  2EHO C;  5IHY A;  3UUX B;  4UVC B;  1OED E;  4IT4 A;  5EZY E;  3MK7 C;  2FJB A;  3AAA B;  1I6Z A;  3EDV A;  5ABG A;  4V1A v;  1D0Y A;  5LHI B;  3PUG A;  3AE4 A;  4HWD A;  2A2F X;  3WAK A;  2XAH B;  2VKJ A;  4LF6 T;  4ANJ A;  4TWF A;  4O8S A;  4X1Y E;  4KHZ F;  2DI4 A;  2JQ9 A;  3QC9 A;  2DNX A;  3P7I A;  4DBQ A;  2KSR A;  3ZT5 A;  4JI1 T;  2X66 A;  4QH4 A;  5LJN A;  2B1E A;  3GWH A;  2L9Q A;  2W67 A;  3B57 A;  5ABE A;  2Q9Q B;  5ETW A;  5FXZ A;  4HEA A;  2W66 A;  4NIQ A;  4OFZ A;  2KZ7 B;  2VAS A;  3ZYM A;  2ZM8 A;  4JV5 T;  1YKE B;  2V5D A;  5FL0 A;  3A8Y C;  1WLX A;  3VR8 A;  2AE9 A;  3AVR A;  2KIN B;  4QXB B;  2M6I A;  2KMF A;  4Z91 A;  2ZM6 T;  2Y8D A;  4OX9 T;  2UXD T;  3TKL B;  3ZYL A;  2XAS B;  3UTK A;  1T7S A;  5CA0 E;  2BKN A;  4JI3 T;  4CN4 A;  2VQE T;  5F3J A;  5DQV A;  5LHH B;  4UXN B;  1NEK A;  2QA7 A;  4HN9 A;  5HXR A;  2HPJ A;  4DV0 T;  5CGM A;  3KIN B;  1LVF A;  1I94 T;  3Q5W A;  1XDO A;  1G8X A;  1IBK T;  3QUJ A;  5KX5 E;  2XQ6 A;  5AQG B;  4U31 A;  5FVK A;  4TZ4 C;  3N2O A;  4I4T E;  4PJM A;  4DV2 T;  3RIA A;  3RQU A;  3NKZ A;  4EEB A;  5HAX A;  1ZOY A;  2V7M A;  3VRA A;  3RQW A;  3HKC E;  1FMV A;  4IIJ E;  3CX8 B;  3GN5 A;  5HXH A;  3E08 A;  5L3C B;  2UUC T;  3UUN A;  3LK3 B;  3N2G E;  2CHO A;  4NUU A;  5JR9 C;  5AQU B;  1VRB A;  3PE0 A;  3AEE A;  4HFV A;  4BJM A;  4CI1 B;  2NW8 A;  3LBX B;  3PUY F;  5LB7 B;  3C51 A;  4ZZC A;  4AKG A;  3DP7 A;  2YIN A;  2BBJ A;  2V6Y A;  2XSB A;  1W09 A;  2X0Y A;  4JI7 T;  2QGS A;  2FJD A;  4AQF A;  1NAF A;  4ZI3 C;  5AQV B;  3K8P C;  4B3S T;  2ACZ A;  2JJ9 A;  2XUE A;  3P4S A;  3F31 A;  5H6Q B;  3KVA A;  4QHO A;  3EAM A;  3UU8 A;  4DR6 T;  4CN1 A;  5KXJ A;  2MOZ A;  3PU3 A;  3T1H T;  3AB3 B;  4JUY A;  3RYF E;  2N9D A;  3ZMZ B;  3I0O A;  4A5X A;  4CI2 B;  4A98 A;  3H37 A;  1OED B;  1YKH B;  5FMN A;  5L4H A;  1HX1 B;  2CMR A;  2EHO A;  4XAX B;  5EK3 A;  4UIG A;  4I0U A;  4MAL A;  1JNZ A;  4PK5 A;  4YJ3 E;  4MBQ A;  1YXR A;  3PU8 A;  2LRL A;  3AEA A;  4HWH A;  1IJ6 A;  2XM2 A;  4X66 T;  3AE9 A;  4U3C A;  2PBI A;  2MTQ A;  4EOZ B;  5DJQ C;  2ZM0 A;  1WRD A;  2UUA T;  1BR2 A;  1MMA A;  2YDR A;  3OYZ A;  5J1G A;  2UXC T;  4DR1 T;  4CXX A;  3ZST A;  4ILC A;  3VHL A;  1UX4 A;  2AXD S;  3P4P A;  1FJG T;  3OPC A;  2D2S A;  1LRZ A;  3FXD B;  1HF8 A;  3EHZ A;  5HWX A;  4PK4 A;  2QVA A;  3TLS A;  1O3X A;  2V1D B;  1S35 A;  2ZLY A;  5CJ5 A;  4IHJ E;  3ZLI A;  4DR3 T;  2NOX A;  3AE2 A;  2V8S V;  4BAY B;  4HFI A;  2K5B B;  5CFB A;  2OV9 A;  3K3N A;  2LE8 A;  3CML A;  2D0T A;  1SUM B;  1XNR T;  4PK6 A;  3P50 A;  3BQL A;  5BMV E;  3ETU A;  3Q5X A;  4KI0 F;  2K9A A;  5CB4 E;  3VU7 H;  1CUN A;  3KFW X;  4H9Q C;  3EI0 A;  4MFR A;  2UXB T;  2R6G F;  2X68 A;  4KX6 A;  1E1H B;  4LMJ A;  2WZH A;  5LBM A;  1HX8 A;  1KEY A;  3FZM B;  3LG7 A;  2G0U A;  3AA1 B;  2LSK A;  2V5C A;  2VL8 A;  3LFM A;  4H9S E;  4YY3 T;  5JR9 A;  1NEN A;  3PUR A;  1D0X A;  4B3R T;  4LFB T;  3C4W A;  5KDM C;  2XQ3 A;  3EAB A;  3RF1 A;  2CXD A;  4C91 A;  5HEJ A;  4DID B;  2Q9Q C;  3FZK B;  4P1N A;  4IST A;  3RRW A;  4MLK A;  5J2U E;  2JRK A; 
#chains in the Genus database with same CATH homology
 4UEL A;  3ZJ1 A;  4CQI A;  4KMC A;  1SA0 E;  3RH3 A;  4PJJ A;  3SS1 A;  3P8C D;  4DVD A;  1KNZ A;  4CXW A;  4XZC A;  2EHO D;  4UVB B;  5FY0 A;  4KBM B;  1S94 A;  4UVA B;  2BZB A;  3NRX A;  2PG8 A;  5DQW A;  2LOP A;  3L3P A;  3ZN1 B;  4TV9 E;  4PFP A;  2KND A;  2LOS A;  4O2A E;  2I59 A;  2ODV A;  3HL6 A;  3D0T A;  2K48 A;  1BR0 A;  2NTX A;  3CQG B;  5LNK A;  4TV8 E;  2ODU A;  4OK0 A;  4UV9 B;  3JC6 D;  4EZH A;  5L3G B;  3C50 A;  4PAG A;  3PUS A;  2YK0 A;  2CXL A;  3R84 B;  2GK9 A;  2XAQ B;  5FNV E;  1U5P A;  5LOV E;  3CVR A;  2CLY B;  4IGU A;  1FMW A;  4EYU A;  3K3O A;  4P09 A;  4FJO A;  4ZS3 A;  2EHO C;  4UEM A;  5IHY A;  3UUX B;  5L2L A;  2E9X A;  4UVC B;  2X0L B;  3R6N A;  3UT5 E;  1QSD A;  5EZY E;  4IE5 A;  5JRC A;  2XTL A;  3MK7 C;  4IE7 A;  3AAA B;  2ES0 A;  5L3F B;  4AKL A;  4I43 B;  3RX6 A;  3EDV A;  4I55 E;  1B7T A;  3JC6 C;  4ZHQ E;  4NUV A;  4V1A v;  5LP6 E;  1D0Y A;  3FB2 A;  5LHI B;  2LSY A;  5LCY A;  3PUG A;  4YJ2 E;  5M4Y A;  2A3D A;  3DJB A;  2A2F X;  3MKD A;  4PW8 A;  3WAK A;  3ZC1 A;  2X67 A;  2XAH B;  2VKJ A;  3GN5 B;  1UCU A;  4ANJ A;  2V7K A;  4O8S A;  4X1Y E;  4AI6 A;  1Y64 B;  3GA8 A;  2DI4 A;  3QC9 A;  4FI5 A;  2X9H A;  3CX6 B;  2DNX A;  3RYC E;  1IJ5 A;  4H9R C;  3EUH A;  4WBO A;  5FP3 A;  3P7I A;  4DBQ A;  4ZI7 E;  2YU1 A;  3C4X A;  5LYJ E;  2X66 A;  4P0B A;  4MHC A;  5LJN A;  2B1E A;  3S4U A;  3EVY A;  3GWH A;  4XBF B;  5JDN A;  2L9Q A;  2KLQ A;  4HE8 A;  3OJA A;  2KWI B;  3PUA A;  5LG4 A;  3B57 A;  3PUQ A;  2Q9Q B;  3N9P A;  4N78 D;  3NRY A;  5ETW A;  3C98 B;  3I1A A;  1LVK A;  2VKH A;  4KUM B;  5FXZ A;  3J7Y q;  4HEA A;  4H63 V;  1WYC A;  2ZMA A;  4YHJ A;  4OFZ A;  5FXX A;  2KZ7 B;  4E7S A;  2VAS A;  3IEE A;  3ZYM A;  2ZM8 A;  3RYI E;  2VKO A;  1HG2 A;  2W62 A;  1YKE B;  2X9Y A;  3FBZ A;  2VB6 A;  3A5X A;  2LT3 A;  2CEA A;  4UV8 B;  1YW0 A;  1ZKE A;  2Y48 B;  2X9W A;  3ZEF B;  2K24 A;  1V9D A;  5DAB A;  1ZV4 X;  5JDL A;  1WLX A;  2ZM2 A;  3ZJ2 A;  3AVR A;  2KIN B;  4QXB B;  2KMF A;  4X20 E;  1WR6 A;  4U72 A;  2E9X C;  3AA7 B;  3MXZ A;  2Y8D A;  2D0U A;  2DCF A;  3C64 A;  4QXC B;  3TKL B;  3N9O A;  2LSG A;  4C90 A;  2SPC A;  4KP3 C;  3ZYL A;  3PTR B;  2XAS B;  3UTK A;  2HPL A;  4O4H E;  2NTY A;  5CA0 E;  4JLE A;  3OKQ A;  3J9X 1;  2DWK A;  4ZOL E;  3GMI A;  3N9Q A;  2EHO B;  3WAJ A;  2LM9 A;  3KV5 A;  4QX8 B;  5F3J A;  4K0U A;  5DQV A;  5LHH B;  4UXN B;  4GIW A;  1D1B A;  2QA7 A;  1US7 B;  5EK2 A;  4HN9 A;  2XAF B;  5HXR A;  2HPJ A;  2H3R A;  1NWM X;  3KIN B;  3RRC A;  1LVF A;  4A56 A;  3Q5W A;  3KV9 A;  1G8X A;  4EYY R;  5KMG P;  3HR0 A;  3QUJ A;  4EAH A;  2W0G A;  3BK9 A;  5KX5 E;  5GON E;  3M65 A;  3N5L A;  1D1A A;  1HFA A;  3ESL A;  3CKD A;  4PJL A;  3WI3 A;  5AFU L;  3ZMS B;  1IZN B;  1MND A;  4TZ4 C;  3N2O A;  3KDS E;  2L8K A;  4I4T E;  3NZP A;  4PJM A;  3ANW B;  2WMO A;  2PJQ A;  4QKN A;  5HAX A;  2V7M A;  5F8P A;  5JDH A;  2WWU A;  3AA0 B;  3HKC E;  1FMV A;  2PFV A;  3O1H A;  4IIJ E;  2V7J A;  2C5J A;  4EXT A;  3CX8 B;  3BQI A;  5FXV A;  3GN5 A;  4GK5 E;  5HXH A;  3OBV E;  4ZI3 D;  2IC6 A;  3E08 A;  3C4Z A;  5C8Y E;  5L3C B;  3L09 A;  2LEH A;  5HXE A;  2IW5 B;  3VKH A;  5HWY A;  3PDY A;  3O1J A;  3UUN A;  3LK3 B;  3N2G E;  2N1G A;  2RP4 A;  3UFE A;  4NUU A;  2L3L A;  5JR9 C;  3KVB A;  4EZ4 A;  5E0O A;  1VRB A;  3H3A A;  3PE0 A;  4QX7 B;  4HKA A;  4HFV A;  3FXE B;  4BJM A;  4DMV A;  4CI1 B;  1U4Q A;  2NW8 A;  5JDM A;  3LBX B;  4IE4 A;  5JRE A;  3EDU A;  3RPU A;  3C51 A;  4BJN A;  2Q9Q A;  2E8I A;  3DP7 A;  4AKG A;  2YIN A;  2H7V C;  3MJX A;  2VWA A;  2QGS A;  3AVS A;  3AAE B;  4OYK A;  4AQF A;  1NAF A;  4ZI3 C;  3O1I A;  3B13 A;  1FEW A;  2D5U A;  4UF0 B;  3K8P C;  2RA1 A;  2CCQ A;  2YU2 A;  4IE6 A;  2ACX A;  4O4J E;  2JMK A;  3UUM A;  5L3E B;  3IBP A;  4J2C A;  2NW7 A;  4TUY E;  4AKR B;  4ISS A;  5JDG A;  2E9X B;  4G2A A;  3ZMV B;  1HTJ F;  2JJ9 A;  2XUE A;  1MNE A;  5H6R B;  1KK7 A;  4GYS A;  1QUU A;  5IYZ E;  5J2T E;  4E7Z A;  4L5G A;  2Z6E A;  2E9X D;  3F31 A;  2BVL A;  3U3I A;  3ZYK A;  5H6Q B;  5FY7 A;  3KVA A;  2LJL A;  4QHO A;  2CA5 A;  4ILU A;  2CE7 A;  5ADX L;  4H9O C;  1MIV A;  2MYS A;  4AKH A;  4ASK A;  2MOZ A;  3PU3 A;  3AB3 B;  4JUY A;  3RYF E;  2JMH A;  4L0R A;  2N9D A;  3ZMZ B;  3I0O A;  2KWH A;  4CI2 B;  4PFO A;  4F6R C;  3H37 A;  2WAU A;  3UUL A;  1YKH B;  5FMN A;  3VKG A;  2XQY A;  2JPF A;  2W00 A;  1HG5 A;  2CMR A;  2EHO A;  4JEH B;  3SOL A;  4XAX B;  3HKD E;  2MBG A;  5EK3 A;  4UIG A;  3MAC A;  2DLR A;  3CWZ B;  4EB6 E;  5L3B B;  1BR1 A;  2NP9 A;  2WM9 A;  2V7L A;  5JDF A;  4MAL A;  4PJN A;  3LJC A;  3IHR A;  1OXZ A;  2P9B A;  3LK2 B;  4PK5 A;  4YJ3 E;  4TX5 A;  4ZS2 A;  4O4L E;  2WBL A;  4MBQ A;  5JQG E;  4YFS A;  3PU8 A;  4OHF A;  3ZPO A;  1MIY A;  2BDE A;  4L9I A;  3K3Q C;  4QXH B;  4ERR A;  1IJ6 A;  1X79 A;  1UX5 A;  3ZCI A;  3F2E A;  3ZC0 A;  3V5U A;  5HYA A;  4IDZ A;  2BVM A;  2C5K T;  4I50 E;  1VOM A;  2PBI A;  3MA9 A;  5CA1 E;  3NZQ A;  2MTQ A;  3FBL A;  4IE0 A;  3ANW A;  4EOZ B;  5DJQ C;  2ZM0 A;  4U74 A;  1WRD A;  4AQG A;  1BR2 A;  1MMA A;  3OYZ A;  5JR9 B;  1MMD A;  2KXP B;  3ZMU B;  1HCI A;  3HI2 A;  2H7O A;  5J1G A;  5JDQ A;  1T98 A;  2YEV C;  3QK6 A;  4H9P C;  4CXX A;  1YD8 G;  2C5I T;  4CZZ B;  3VHL A;  1UX4 A;  1SHZ C;  2KT9 A;  2XAJ B;  2J1D G;  2W61 A;  1IAP A;  1MMG A;  4OYJ A;  2D2S A;  1LRZ A;  3FXD B;  2N2N A;  1HF8 A;  3LBX A;  2NW9 A;  1MIW A;  1LKX A;  1WYB A;  5FY1 A;  5HWX A;  3CQX C;  3KBU A;  4PK4 A;  2CWY A;  1O3X A;  5EK4 A;  1G73 A;  4JEU B;  5LHG B;  1MMN A;  1HS7 A;  3CX7 B;  2CM0 A;  4QWN B;  2V1D B;  1EZ3 A;  5HXC A;  3E22 E;  2UXX B;  4AXP A;  5FXW A;  2WSS V;  3F57 A;  1S35 A;  4UF0 A;  2X9X A;  3MZK B;  2ZLY A;  3W15 B;  5LXT E;  3V5S A;  5LJM A;  3AAI A;  3Q9D A;  4GYR A;  2XHE B;  4Z8X A;  1ZEE A;  4IHJ E;  2CWO A;  2CXF A;  4GOU A;  3ZLI A;  3ZMT B;  4CI3 B;  3O9X A;  2NOX A;  4HGA A;  4BAY B;  4O4I E;  2K5B B;  5A1L A;  2LHN A;  2NWB A;  3NBX X;  2LSJ A;  4H9N C;  2W63 A;  5LGN B;  3K3N A;  2LSI A;  2LE8 A;  3N9M A;  3SRZ A;  4X1K E;  2VKD A;  3CML A;  4HTE A;  2D0T A;  2X51 A;  3BQK A;  3ZCJ A;  4YLH A;  3HA4 A;  4AKI A;  4CXY A;  4PK6 A;  3T8O A;  5JRC B;  2M67 A;  3RC3 A;  3BQL A;  3KV4 A;  4EIW A;  5BMV E;  3ETU A;  2CLY C;  3Q5X A;  3HKB E;  2VK9 A;  2DWG A;  3I0Q A;  4GK0 E;  4ADZ A;  3RC8 A;  2K9A A;  1D0Z A;  5CB4 E;  3ETV A;  3RKO A;  4PNI A;  5LBQ B;  2WMN A;  3VU7 H;  1CUN A;  3KFW X;  3HKE E;  5HXS A;  4DMW A;  4H9Q C;  4MFR A;  3O4X E;  1AJ3 A;  4WNK A;  5L3D B;  2X68 A;  4WW0 A;  3ONX A;  4B6X A;  1E1H B;  3CQC B;  3N2K E;  4M1P A;  5LBM A;  5LGT B;  1HX8 A;  3KV6 A;  2IAK A;  5JH7 E;  3LG7 A;  4P0A A;  2Q9Q D;  4X1I E;  2LHR A;  3E0Z A;  1FIO A;  4ZI2 D;  2G0U A;  2C0S A;  3N9L A;  3AA1 B;  2DHR A;  2LSK A;  2V26 A;  3U78 A;  4DBR A;  2V7I A;  2VL8 A;  4G63 A;  3LFM A;  5TAO A;  2Y6X A;  3IF8 B;  3ZN0 B;  4H9S E;  4TN7 B;  3OYX A;  5JR9 A;  3N9N A;  3PUR A;  3Q2M A;  1D0X A;  2A72 A;  3CPZ A;  2JQQ A;  3I9W A;  4WBN E;  1D1C A;  3C4W A;  2UXN B;  1ZHC A;  4H63 H;  2HH7 A;  3DTO A;  5FYM A;  4DND A;  5KDM C;  3AA6 B;  5JVD E;  4BA9 A;  2CXD A;  2IC9 A;  2XAG B;  3I9Y A;  4C91 A;  1Z0P A;  3FHN A;  3KBT A;  1BR4 A;  2Q9Q C;  3LK4 2;  3SWH A;  4DO0 A;  4ZI2 C;  2OA5 A;  3RYH E;  5LA6 E;  4IST A;  1H7C A;  4O2B E;  3RRW A;  4MLK A;  5J2U E;  4AQF C;  5LGU B;  2JRK A;  1OWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...