2JPFA

Bpp3783_115-220
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
b'KQQLQEHAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHGTPPTASDVVGMPQWQEYTAMLRERFAGLDTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
molecule tags Structural genomics
source organism Bordetella parapertussis
publication title Bpp3783_115-220
rcsb
total genus 19
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11516 DUF3220 Protein of unknown function (DUF3120)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.960 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jpfA01
2JPFA
chains in the Genus database with same CATH superfamily
1JNZA 2DI4A 3CMLA 4YHHT 4DR1T 2WZIA 5JR9A 4X5TA 5CFBA 3CX8B 3L3PA 3BQKA 3NBXX 4GYSA 3RKOA 2H88A 2KINB 4EYUA 4HFCA 4IDZA 2QA7A 5HEJA 4MHCA 4C90A 5HEHA 2VKHA 4O2AE 3RIUA 2FJBA 4B6XA 3KV5A 4FI5A 5EK4A 1KNRA 2QVAA 3CK6A 4TWDA 1I94T 2CA5A 3ZCJA 3ZYLA 4YSXA 3I0OA 3PJAJ 2QGSA 3PU3A 3N9QA 5HWXA 3ZC0A 2LOPA 3KDSE 3CIRA 4BA9A 5LP6E 2V6XA 2XQ4A 2Y6XA 1MMNA 2W00A 3C50A 2BKOA 2UXNB 3F57A 3PUSA 1YW0A 4Z8XA 4ZS2A 3RYIE 2XASB 3QK6A 3V5SA 3JAEA 4V1Av 1J5ET 2X9YA 3S4UA 3LSVA 5HXSA 2KLQA 3AA0B 3ANWB 2A72A 3LBXA 3L39A 2FJDA 1D0YA 2JJ9A 4LMKA 3AECA 4P1NA 1XMOT 3AAEB 4AKGA 2V1DB 3WI3A 3EI0A 2UUBT 2XM2A 5C2TA 4B3TT 1WR6A 5AQOB 1JNRA 4AKHA 2X0LB 3FB2A 4C91A 5TAOA 2VK9A 5LG4A 1HG5A 1D1BA 5ABHA 3ETUA 2CBIA 4X1KE 3UQ4A 4A97A 2XQYA 4YXDA 2VL0A 1VRBA 4LMLA 5LMUT 4ZEYA 4NXNT 1SHZC 3AEBA 4EEDA 5KMGP 5LOVE 3Q5XA 4QXHB 1MIWA 2CXDA 2ZLYA 4MBQA 3RLFF 4WZXA 4DBQA 4DUZT 2I6HA 1IBKT 5AQJB 2CHOA 4NXMT 2CWOA 3OBVE 4QX8B 4UXNB 1NAFA 4L9IA 3AE1A 4NUVA 4UR9A 3D0TA 4JI2T 1ZKEA 4DO0A 4CI1B 4DR2T 3JC6C 3OYZA 2B1EA 2K3WA 1U5PA 4EV6A 4JI1T 2J47A 4MALA 4LMJA 5BR8T 3ZSSA 3VRBA 2LSKA 2QYWA 5LA6E 3O1IA 4TZ4C 2LSYA 4I43B 3NRXA 1T7SA 2WSSV 5FY7A 2BVMA 3AE2A 4IL9A 4DR6T 5AQKB 4XZCA 2L8KA 4HN9A 4DV2T 4H9OC 4DR7T 3Q5DA 2BS4A 5HXCA 4DR3T 3DJBA 3KVBA 5L4EA 5LJMA 4H9PC 2D0TA 3KBTA 3E0ZA 1R8IA 2D5UA 2C5IT 3EUHA 4KBMB 2A9UA 2NTYA 4UV8B 5AQPB 3UUNA 1CUNA 5AQGB 3N9LA 3VR8A 3AE5A 2L3LA 2OLTA 4AIUA 2V7JA 4I55E 3UULA 2ZM8A 4JYAT 3P50A 4Z90A 2IMLA 3QNUA 4YFSA 2X68A 2MYSA 2YOEA 5AQIB 3Q5EA 3FZHB 4X65T 4IDOA 3ZYKA 3K3NA 4ADZA 2X9WA 3OJAA 3ZT7A 4H63V 4PJJA 4EB6E 2ODVA 1QSDA 1SE7A 2V7LA 3AE4A 2E5VA 5CA0E 5BMVE 1IBMT 3DP7A 5JVDE 5JQGE 3AA6B 1Z8UA 3OKQA 3RRWA 3TLTA 1N34T 2CMRA 3AE7A 1UUSA 4HFIA 3P8CD 3VKHA 4ZI3D 5HXEA 2UUAT 5L3EB 2X67A 1HFAA 5FMNA 1LRZA 2MBGA 3SFDA 2CXFA 3AVSA 4LF5T 4OFZA 4IDPA 3I0QA 4MFRA 4CQIA 5CJ5A 3ZN1B 3EHZA 5LYJE 4LF7T 3P7IA 3P4SA 1NENA 2BVLA 2RP4A 3AEAA 3FBZA 4M1PA 3P4WA 4Q25A 5AQVB 2W2UA 3HKBE 2PG8A 1WR0A 3K3QC 4K0UA 4TX5A 5C3JA 4DMVA 1G8XA 2YU2A 5KDMC 2BG9C 4ZZCA 2VURA 3OYXA 3F2EA 4BJMA 3HA4A 4UVAB 1X9BA 2X66A 2WM9A 1D1CA 1ZOYA 3ABVA 2CHNA 4IDNA 1OWAA 5FY0A 2WWVA 3M65A 2BG9E 1V9DA 2K24A 2CE7A 4HE8A 3RYFE 1OEDA 3N9OA 5L4HA 5HAXA 3ZMUB 1WYBA 1VCSA 1GQEA 2DWGA 4ZI2C 4X66T 3AE3A 5LG3A 4LFAT 2P9BA 2YINA 3TLWA 2FBWA 2EHOB 3C64A 2UXXB 2W61A 4QH5A 5FXWA 2YK0A 3Q2MA 3SWHA 5DQWA 2BZBA 4EEBA 3SOLA 2M67A 2LHRA 2ODUA 4KX6A 2E9XD 2PFVA 2ES0A 4IE5A 3K3OA 4NPPA 5LBQB 1IJ5A 3IA3A 4DIDB 3ZLIA 5JDQA 4QKNA 3ZSTA 2IAKA 3RQWA 2IHR1 2YN6A 5FVLA 4QXBB 1L0VA 2CEAA 4L0RA 2XAJB 2PJQA 4X1IE 4L5GA 3RIFA 4EXTA 4B3RT 1CHUA 3FZLB 5ABGA 4GK0E 5LGNB 4Z91A 3RGLA 1J5WA 4X62T 2WMOA 2ZM2A 5IUXA 3UT5E 3QC9A 3KV6A 2UXDT 5AQNB 3SFEA 4DUYT 3LK42 2ZM6T 2H3RA 3AEGA 1WRDA 3BK9A 4CN4A 4H9SE 2JIWA 3CX6B 2IW5B 4CZZB 3C98B 4JI7T 4G2AA 4DR4T 2LEHA 4I4TE 5JDFA 3UUXB 2XSBA 2YDSA 1MNEA 2W66A 2K5BB 4PK6A 3CQGB 4H63H 5J2UE 5FXZA 4P0AA 1HNZT 2YU1A 3AEFA 3JADA 2B76A 1ZHCA 4HKAA 3H37A 4U2ZA 4A56A 3ZT5A 3C4ZA 3FXDB 3QOFA 4YTPA 1E7PA 5ABFB 5ABEA 5J0ZA 2V5DA 4AQFC 3B57A 3RQUA 3ESLA 3LK3B 4UF0A 3FBLA 3VR9A 1WFDA 3Q5WA 5JDMA 2CM0A 3P4QA 3MZKB 4JBWF 4O4LE 4OK0A 5AQTB 2KZ7B 3HI2A 2WQYA 5E0OA 4DV3T 2UXBT 2E9XC 4HGAA 2YDQA 2WBLA 4DV6T 2LM2A 2DL1A 1XDOA 2ZMAA 4HFEA 3IHRA 2VKOA 3I9WA 3QB5K 4IHJE 2HN2A 2D0UA 4U31A 5L47A 2Q9QD 5HCJA 1W0AA 1I6ZA 4DR5T 4CXXA 3AA7B 2WS3A 4YJ2E 1AJ3A 2YEVC 2L9QA 2C5JA 3AXJB 5DQVA 5FP3A 2XQ5A 4H9NC 5LMNT 3C4XA 4ILCA 2DCFA 1N36T 4JUYA 2VL8A 1BR1A 4UVBB 4HWIB 4DVDA 3OTOT 2LKHA 4DV0T 3U78A 5EZYE 5LHHB 5FKYA 3RIUC 4U33A 3AE8A 4IGUA 4UELA 3MK7C 5LNKA 2Q9QB 1E1HB 1HCIA 2MPKA 1XMQT 2IUBA 2LE8A 4IE7A 2VB6A 3PU8A 3PDYA 1D0XA 3LJCA 4OYJA 2NR4A 2E5LT 1YD8G 2A3DA 1IZNB 2XQ9A 2H89A 2WCAA 5JDHA 2W62A 1QUUA 1D1AA 4AQFA 3UUBA 3ZMVB 4H9QC 4EIWA 3K8PC 4PJNA 3PUGA 2LSIA 3O4XE 1NEKA 1EZ3A 3UTKA 4EZ4A 3O9XA 1IJ6A 4I50E 4TV8E 2N9DA 5AQSB 3NKZA 3KFWX 2VQFT 4AQYT 5L3CB 5L3FB 3L8RA 1SA0E 2WAUA 1NWMX 4P0BA 5H6QB 4JLEA 2MTQA 4HWCA 1Y64B 3TKLB 1HR0T 1IAPA 5HYAA 2KWHA 2XY8B 3ZMZB 3N2KE 5HCMA 3UU4A 3GN5A 4ZZBA 2JMHA 4O2BE 1MMAA 3P4RA 5EK3A 2BBJA 1HS7A 4ZOLE 2E2AA 2K48A 4AKRB 4AQGA 1ZV4X 2M6BA 2CXLA 3O1HA 3JAFA 2CRBA 5JDLA 5M4YA 4IL4A 3I9YA 1O3XA 3O1JA 4WBNE 3PUYF 2FJEA 3ZMTB 5FNVE 3EDVA 4LF6T 2JQ9A 2E9XA 4WBOA 3RF1A 5ABFA 5JH7E 5KX5E 2E8IA 2XPKA 3AAIA 1ZP0A 1MMGA 3H3AA 3JC6D 4ILBA 4AISA 4XAXB 3RX6A 4EYYR 5AFUL 5L2LA 1WCRA 3KBUA 2JPFA 2XAFB 4U2YA 2M6IA 2UXCT 3NWIA 4XBFB 4E7SA 2LSJA 2XM1A 2ZM0A 4KUMB 2BDEA 5CA1E 3ETVA 1H7CA 1FMVA 4IIJE 5JR9C 2VKDA 3LK2B 3ONJA 3OPCA 1LVKA 3SRZA 3RIAA 2DWKA 5AQFB 3J7Yq 2I59A 2X9XA 2DLRA 2K9AA 3B5MA 3NRYA 3QB5A 2CWYA 4IE4A 4KI0F 3P4PA 4CI3B 4AXPA 4YT0A 2LJLA 2MAWA 3WAJA 1UX4A 2PBIA 4ZI7E 2WZHA 4X20E 1OEDB 2X9HA 4LF8T 3ZT6A 1HG2A 3GA8A 2FJAA 5FVKA 3KVAA 4OYKA 1T98A 1N32T 2XQ3A 3KV9A 3NVOA 1BR0A 2J1DG 4GOUA 4NIQA 1LKXA 5HEUA 5L3BB 3AA1B 4JEHB 2LHNA 3AB3B 4EAHA 5JDNA 3AVRA 4PNIA 4AKLA 4PFOA 3AXJA 1N33T 2FUPA 4G63A 4JEUB 5HEGA 4X64T 1YQ4A 3VRAA 4QXCB 5GONE 4IE6A 4LF9T 1YKHB 3R6NA 2VKJA 1BR2A 1WYCA 3A8YC 2C5KT 5LGTB 2Z6EA 4WW0A 5C8YE 3HKCE 4GYRA 5LB7B 3FZFB 4O4HE 5F8PA 3ONLC 4EZHA 5HWYA 4QX7B 4JI6T 3N5LA 2V6YA 3PUWF 4PJMA 2C0SA 1SUMB 2V26A 3UU8A 3HKDE 1T8BA 2NW7A 3VHLA 4DV5T 1OEDC 3SS1A 4YSYA 4QHOA 4ZI2D 5KXJA 1MNDA 3PUAA 4ERRA 4JI4T 1M7KA 2NOXA 4KMCA 3ANWA 3LBXB 3RRCA 1W9RA 2KMFA 4MLKA 4TWHA 4CI2B 1OEDE 3J9X1 4A98A 3DTOA 2WY2A 4PAGA 5J1GA 2VVNA 2J4GA 4U3CA 4CN1A 3MA9A 4ANJA 1BR4A 2AXDS 4HFDA 4U72A 4U7YA 3UFEA 3MACA 4CXYA 1VCTA 3UU5A 2J62A 5FL1A 2UU9T 5LJNA 2V8SV 1Y01A 4NUUA 1QLBA 1HNWT 3VKGA 4UVCB 4BJNA 1XZYA 3U3IA 3KINB 4BAYB 3RYCE 3ZPOA 3G06A 4O8SA 5JTGA 4DV1T 4LFCT 2XQ7A 1US7B 2VQET 5F3JA 4JI3T 1KK7A 2AE9A 2XJ7A 3CPZA 1XDPA 2LLYA 2XTLA 3LDQB 3PUVF 5HXHA 2KT9A 3AE9A 3N9PA 2Y8DA 2W4XA 4HFHA 4KHZF 5AQMB 2CPTA 3ZJ1A 1IBLT 2N1GA 5JRCA 4LF4T 4PJLA 2XQ8A 1HTJF 3FHNA 2F4VT 1KEYA 5LBMA 2CCQA 2Q9QA 2WB5A 2D9DA 3IBPA 3PTRB 1E2AA 5IHYA 5LGUB 1XNQT 4UEMA 2WU5A 1XWMA 3GWHA 2D2SA 4FJOA 3ZEFB 3TLUA 4N78D 5AQHB 3UQ7A 2ACXA 1M62A 5FL0A 2DHRA 1YKEB 2LKGA 2RA1A 4ILUA 1X79A 2XSAA 1FIOA 4PK5A 2NW9A 3V5UA 3X1DA 5EK2A 2SPCA 1G73A 1W09A 2HN1A 4F8HA 4JV5T 1ZEEA 5JRCB 2LSGA 2XZEA 4GIWA 3JCFA 3OVUA 2CLYB 3ZC1A 1UGOA 1UURA 3CVRA 3LG7A 2IDOB 2KXPB 5AQQB 2WU2A 5FYMA 5CB4E 2PTFA 4EOZB 5ADXL 2X0HA 2YKSA 5L3DB 4GKJT 3HR0A 3UUMA 4KHPT 1UK5A 3AEDA 2OV9A 3Q9DA 4YLHA 4U7IA 1Z0PA 2XAQB 4YHJA 2HPJA 2V5CA 4E7ZA 3N2OA 2BS2A 5DABA 5JDGA 4GKKT 2IIUA 3TLSA 2QRXA 2G0UA 2Y48B 4PFPA 4O4IE 2NP9A 4QH4A 2HPLA 5CGMA 5LHGB 2VASA 5LCYA 3C4WA 2KNDA 1MIVA 1S35A 5AQUB 2VWAA 3IEEA 2W0GA 3FZMB 2N2NA 2Q9QC 3CX7B 3HL6A 1LVFA 2V7KA 3ZCIA 4HWFA 2NW8A 4JI0T 2VVSA 4JI8T 4O4JE 1YXRA 5HEOA 5JR9B 2CLYC 3N9MA 4YY3T 4UF0B 4DNDA 5IWAT 3CQXC 2BG9A 2X51A 4QWNB 3RH3A 3T8OA 3ZKRA 4ZS3A 3AE6A 4YSZA 5AQRB 4AI6A 5FY1A 2IC9A 2WDRA 4DBRA 3E22E 4HWDA 4B3MT 4PK4A 3QUJA 3UU6A 1D0ZA 1KNPA 5ETWA 2LRLA 2XAGB 3CWZB 4IT4A 1KF6A 1OXZA 2RPAA 3C51A 4PW8A 4U74A 1HNXT 3E08A 3KV4A 3M3ZB 3MKDA 2WMNA 2JQKA 3L09A 5J2TE 3GMIA 1HX1B 2H7OA 2IC6A 1HF8A 2EHOD 3FZKB 4TNVA 4F6RC 3PUQA 1MMDA 3RC3A 4YTNA 4WNKA 4ZXLA 3B13A 5DJQC 3PE0A 3H3MA 4HFBA 4OX9T 1FEWA 2A2FX 2XAHB 3IF8B 1KFYA 2NWBA 3UU3A 3MXZA 1T72A 4HEAA 3CKDA 2BG9B 4OHFA 4P09A 3NZQA 2NTXA 4J2CA 3ZN0B 3TLVA 2XQ6A 3PURA 2WDQA 3T1YT 3ZMSB 3BQIA 3EDUA 2LOSA 5IYZE 5L3GB 2UUCT 1HX8A 2V6YB 2GK9A 5LHIB 4H9RC 4ASKA 3AEEA 4LFBT 4DMWA 4TN7B 3PUXF 4UV9B 2OA5A 1S94A 3A7MA 4YJ3E 3VU7H 4DV4T 2ACZA 3RYHE 5HXRA 4X1YE 3WAKA 2R6GF 1MIYA 2HHHT 4B3ST 2X0YA 1DU2A 2LM9A 4HTEA 3PV0F 5LXTE 4K0KT 2EHOC 2JQQA 3ZJ2A 5FXXA 5JREA 2CBJA 4WYVA 1KNZA 1UCUA 2WDVA 3EAMA 3RI5A 3RKGA 4QH1A 4CXWA 1VOMA 1FMWA 3I1AA 5H6RB 4ZI3C 4JI5T 3UFGA 3HKEE 2JQHA 4ILAA 2W63A 3F31A 1W0BA 2MOZA 4TUYE 4YTMA 3T1HT 4TNWA 3K1SA 2HH7A 1YQ3A 2WWUA 2XHEB 4GK5E 2E9XB 3EABA 3PUZF 4CN6A 5A1LA 2I0MA 2XUEA 4DV7T 2JRKA 4AKIA 3ZYMA 2V7MA 1WLXA 3LFMA 3A5XA 1B7TA 3EVYA 2XQAA 1U4QA 2BS3A 1UX5A 3N2GE 5F5WA 3RHWA 3R84B 1XNRT 4HWHA 4IDQA 4IE0A 4TV9E 4EGWA 4A5XA 1FJGT 3CQCB 1J1JA 3BQLA 3PJAA 4ISTA 4UIGA 2LT3A 2H7VC 2WP9A 2V7IA 3AAAB 3GN5B 3N9NA 3RC8A 2KWIB 2BKNA 4KP3C 5FXVA 2KSRA 4TWFA 4HFVA 2LRKA 4ZHQE 2YDRA 4COFA 3NZPA 3FXEB 3MJXA 3W15B 2W67A 4ISSA 2EHOA 3RPUA 3ONXA 4I0UA 4IREA 2JMKA 2DNXA 2BBHA 5AQLB 2BKPA
chains in the Genus database with same CATH topology
2DI4A 3CMLA 5JR9A 3CX8B 3L3PA 3BQKA 3NBXX 4GYSA 3RKOA 2KINB 4EYUA 4IDZA 2QA7A 4MHCA 4C90A 2VKHA 4O2AE 4B6XA 3KV5A 4FI5A 5EK4A 2CA5A 3ZCJA 3ZYLA 3I0OA 2QGSA 3PU3A 3N9QA 5HWXA 3ZC0A 2LOPA 3KDSE 4BA9A 5LP6E 2Y6XA 1MMNA 2W00A 3C50A 3PUSA 2UXNB 3F57A 4Z8XA 1YW0A 4ZS2A 3RYIE 3UULA 2XASB 3QK6A 3V5SA 4V1Av 2X9YA 3S4UA 5HXSA 2KLQA 3AA0B 3ANWB 2A72A 3LBXA 5JR9C 1D0YA 2JJ9A 4AKGA 3AAEB 2V1DB 3WI3A 1WR6A 4AKHA 2X0LB 3FB2A 4C91A 5TAOA 2VK9A 5LG4A 1HG5A 1D1BA 3ETUA 4X1KE 2XQYA 1VRBA 1SHZC 5KMGP 5LOVE 3Q5XA 4QXHB 1MIWA 2CXDA 2ZLYA 4MBQA 4DBQA 2CWOA 3OBVE 4QX8B 4UXNB 1NAFA 4L9IA 4NUVA 4DO0A 3D0TA 1ZKEA 4CI1B 3JC6C 3OYZA 2B1EA 1U5PA 4MALA 2LSKA 5LA6E 3O1IA 4TZ4C 2LSYA 4I43B 3NRXA 5FY7A 2WSSV 2BVMA 4XZCA 2L8KA 4HN9A 4H9OC 5HXCA 3DJBA 3KVBA 5LJMA 4H9PC 2D0TA 3KBTA 3E0ZA 1HS7A 2D5UA 2C5IT 3EUHA 4KBMB 2NTYA 4UV8B 3UUNA 1CUNA 3N9LA 2L3LA 2V7JA 4I55E 2ZM8A 4YFSA 2X68A 2MYSA 3ZYKA 3K3NA 4ADZA 2X9WA 3OJAA 4EB6E 4H63V 4PJJA 2ODVA 1QSDA 2V7LA 5CA0E 5BMVE 3DP7A 5JVDE 5JQGE 3AA6B 3OKQA 3RRWA 2CMRA 3P8CD 4ZI3D 5HXEA 5L3EB 2X67A 1HFAA 5FMNA 1LRZA 2MBGA 2CXFA 3AVSA 4OFZA 4MFRA 3I0QA 4CQIA 3ZN1B 3P7IA 2BVLA 2RP4A 3FBZA 4M1PA 3HKBE 3K3QC 2PG8A 4K0UA 4TX5A 4DMVA 1G8XA 2YU2A 5KDMC 3OYXA 3F2EA 4BJMA 3HA4A 4UVAB 2X66A 2WM9A 1D1CA 5FY0A 1OWAA 3RYFE 3M65A 4HE8A 1V9DA 2K24A 2CE7A 3N9OA 5HAXA 3ZMUB 1WYBA 2DWGA 4ZI2C 2P9BA 2YINA 3C64A 2EHOB 2UXXB 2W61A 5FXWA 2YK0A 3Q2MA 3SWHA 5DQWA 2BZBA 3SOLA 2M67A 2LHRA 2ODUA 2E9XD 2PFVA 2ES0A 4IE5A 3K3OA 5LBQB 1IJ5A 3ZLIA 5JDQA 4QKNA 2IAKA 4QXBB 4EXTA 2CEAA 4L0RA 2XAJB 2PJQA 4X1IE 4GK0E 5LGNB 2WMOA 2ZM2A 3UT5E 3QC9A 3KV6A 3LK42 2H3RA 1WRDA 3BK9A 4H9SE 2IW5B 3CX6B 4CZZB 3C98B 4G2AA 2LEHA 4I4TE 5JDFA 3UUXB 1MNEA 2K5BB 4PK6A 3CQGB 4H63H 5J2UE 5FXZA 4P0AA 2YU1A 4A56A 1BR0A 1ZHCA 4HKAA 3H37A 3C4ZA 3FXDB 4AQFC 3B57A 5JDMA 3ESLA 3LK3B 4UF0A 3FBLA 5L3GB 5LYJE 3Q5WA 2CM0A 3MZKB 4O4LE 4OK0A 2KZ7B 3HI2A 5E0OA 2E9XC 4HGAA 2WBLA 2ZMAA 3VKHA 4TV8E 3IHRA 2VKOA 3I9WA 4IHJE 2D0UA 2Q9QD 4CXXA 3AA7B 4YJ2E 1AJ3A 2YEVC 2L9QA 2C5JA 5DQVA 5FP3A 4H9NC 3C4XA 2DCFA 4JUYA 2VL8A 1BR1A 4UVBB 4DVDA 3U78A 5EZYE 5LHHB 4UELA 4IGUA 5LNKA 3MK7C 2Q9QB 1E1HB 1HCIA 2LE8A 4IE7A 2VB6A 3PU8A 3PDYA 1D0XA 3LJCA 4OYJA 1YD8G 2A3DA 1IZNB 5JDHA 2W62A 1QUUA 1D1AA 4AQFA 3ZMVB 4H9QC 4EIWA 3K8PC 4PJNA 3PUGA 2LSIA 3O4XE 3UTKA 1EZ3A 4EZ4A 3O9XA 1IJ6A 4I50E 2N9DA 3KFWX 5L3CB 5L3FB 1SA0E 2WAUA 1NWMX 4P0BA 5H6QB 4JLEA 2MTQA 3TKLB 1Y64B 1IAPA 5HYAA 2KWHA 3ZMZB 3N2KE 3GN5A 2JMHA 4O2BE 1MMAA 5EK3A 4ZOLE 2K48A 4AKRB 4AQGA 1ZV4X 2CXLA 3O1HA 5JDLA 3I9YA 1O3XA 3O1JA 4WBNE 3ZMTB 5FNVE 3EDVA 2E9XA 4WBOA 5JH7E 5KX5E 2E8IA 3AAIA 3H3AA 1MMGA 3JC6D 5LHGB 4XAXB 3RX6A 5L2LA 3KBUA 2JPFA 2XAFB 4XBFB 4E7SA 2LSJA 2ZM0A 4KUMB 2BDEA 5CA1E 3ETVA 1H7CA 1FMVA 4IIJE 2VKDA 3LK2B 3SRZA 1LVKA 2DWKA 3J7Yq 2I59A 2X9XA 2DLRA 2K9AA 5LCYA 3NRYA 2CWYA 4IE4A 4CI3B 4AXPA 2LJLA 3WAJA 1UX4A 2PBIA 4ZI7E 4X20E 2X9HA 1HG2A 3GA8A 3KVAA 4OYKA 1T98A 3KV9A 2J1DG 4GOUA 1LKXA 3AA1B 4JEHB 2LHNA 3AB3B 4EAHA 5JDNA 3AVRA 4PNIA 4AKLA 4PFOA 4JEUB 4G63A 4QXCB 5GONE 4IE6A 1YKHB 3R6NA 2VKJA 1BR2A 1WYCA 2C5KT 5LGTB 2Z6EA 4WW0A 5C8YE 3HKCE 4GYRA 5F8PA 4O4HE 4EZHA 5HWYA 4QX7B 3N5LA 4PJMA 2C0SA 2V26A 3HKDE 4AI6A 2NW7A 3VHLA 3SS1A 4ZI2D 4QHOA 1MNDA 3PUAA 4ERRA 2NOXA 4KMCA 3ANWA 3LBXB 3RRCA 2KMFA 4MLKA 4CI2B 3J9X1 3DTOA 4PAGA 5J1GA 3MA9A 4ANJA 1BR4A 4U72A 3UFEA 3MACA 4CXYA 5LJNA 4NUUA 3VKGA 4UVCB 4BJNA 3U3IA 3KINB 4BAYB 3RYCE 3ZPOA 4O8SA 1US7B 5F3JA 1KK7A 3CPZA 2XTLA 5HXHA 2KT9A 3N9PA 2Y8DA 3ZJ1A 2N1GA 5JRCA 4PJLA 1HTJF 3FHNA 5LBMA 2CCQA 2Q9QA 3IBPA 3PTRB 5IHYA 5LGUB 4UEMA 3GWHA 2D2SA 4FJOA 3ZEFB 4N78D 2ACXA 2DHRA 1YKEB 4ILUA 2RA1A 4PK5A 1X79A 5M4YA 1FIOA 2NW9A 3V5UA 5EK2A 2SPCA 1G73A 1ZEEA 5JRCB 2LSGA 4GIWA 2CLYB 3ZC1A 3CVRA 5FYMA 3LG7A 5AFUL 5L3BB 2KXPB 5ADXL 5CB4E 4EOZB 5L3DB 3HR0A 3UUMA 4YLHA 3Q9DA 1Z0PA 2XAQB 4YHJA 2HPJA 4E7ZA 3N2OA 5DABA 5JDGA 2G0UA 2Y48B 4PFPA 4O4IE 2NP9A 2HPLA 2VASA 3C4WA 2KNDA 1MIVA 1S35A 2VWAA 3IEEA 2W0GA 2N2NA 2Q9QC 3CX7B 3HL6A 1LVFA 2V7KA 3ZCIA 2NW8A 4O4JE 5JR9B 2CLYC 3N9MA 4UF0B 4DNDA 3CQXC 2X51A 4QWNB 3RH3A 3T8OA 4ZS3A 5FY1A 2IC9A 4DBRA 3E22E 4PK4A 3QUJA 1D0ZA 5ETWA 2XAGB 3CWZB 4PW8A 1OXZA 3C51A 4U74A 3E08A 3KV4A 3MKDA 5J2TE 2WMNA 3L09A 3GMIA 2IC6A 2H7OA 1HF8A 2EHOD 4F6RC 3PUQA 1MMDA 3RC3A 4WNKA 3B13A 5DJQC 3PE0A 1FEWA 2A2FX 2XAHB 3IF8B 2NWBA 3MXZA 4HEAA 3CKDA 4OHFA 4P09A 3ZN0B 3NZQA 2NTXA 4J2CA 4EYYR 3PURA 3ZMSB 3BQIA 3EDUA 2LOSA 5IYZE 1HX8A 2GK9A 5LHIB 4H9RC 4ASKA 4DMWA 4TN7B 4UV9B 3VU7H 2OA5A 1S94A 4YJ3E 3RYHE 5HXRA 4X1YE 3WAKA 1MIYA 2LM9A 4HTEA 5LXTE 2EHOC 2JQQA 3ZJ2A 5FXXA 5JREA 1KNZA 1UCUA 4CXWA 1VOMA 1FMWA 3I1AA 5H6RB 4ZI3C 3HKEE 2W63A 3F31A 2MOZA 4TUYE 2HH7A 2WWUA 2XHEB 4GK5E 2E9XB 5A1LA 2XUEA 4AKIA 2JRKA 3ZYMA 2V7MA 1WLXA 3LFMA 3A5XA 1B7TA 3EVYA 1U4QA 3N2GE 1UX5A 3R84B 4TV9E 4IE0A 3CQCB 3BQLA 4UIGA 4ISTA 2LT3A 2H7VC 3GN5B 2V7IA 3AAAB 3N9NA 3RC8A 2KWIB 5FXVA 4KP3C 4HFVA 4ZHQE 3NZPA 3FXEB 3MJXA 3W15B 4ISSA 2EHOA 3RPUA 3ONXA 2JMKA 2DNXA 4L5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPF A; 
#chains in the Genus database with same CATH topology
 1JNZ A;  2DI4 A;  3CML A;  4YHH T;  4DR1 T;  2WZI A;  5JR9 A;  4X5T A;  5CFB A;  3CX8 B;  3L3P A;  3BQK A;  3NBX X;  4GYS A;  3RKO A;  2H88 A;  2KIN B;  4EYU A;  4HFC A;  4IDZ A;  2QA7 A;  5HEJ A;  4MHC A;  4C90 A;  5HEH A;  2VKH A;  4O2A E;  3RIU A;  2FJB A;  4B6X A;  3KV5 A;  4FI5 A;  5EK4 A;  1KNR A;  2QVA A;  3CK6 A;  4TWD A;  1I94 T;  2CA5 A;  3ZCJ A;  3ZYL A;  4YSX A;  3I0O A;  3PJA J;  2QGS A;  3PU3 A;  3N9Q A;  5HWX A;  3ZC0 A;  2LOP A;  3KDS E;  3CIR A;  4BA9 A;  5LP6 E;  2V6X A;  2XQ4 A;  2Y6X A;  1MMN A;  2W00 A;  3C50 A;  2BKO A;  2UXN B;  3F57 A;  3PUS A;  1YW0 A;  4Z8X A;  4ZS2 A;  3RYI E;  2XAS B;  3QK6 A;  3V5S A;  3JAE A;  4V1A v;  1J5E T;  2X9Y A;  3S4U A;  3LSV A;  5HXS A;  2KLQ A;  3AA0 B;  3ANW B;  2A72 A;  3LBX A;  3L39 A;  2FJD A;  1D0Y A;  2JJ9 A;  4LMK A;  3AEC A;  4P1N A;  1XMO T;  3AAE B;  4AKG A;  2V1D B;  3WI3 A;  3EI0 A;  2UUB T;  2XM2 A;  5C2T A;  4B3T T;  1WR6 A;  5AQO B;  1JNR A;  4AKH A;  2X0L B;  3FB2 A;  4C91 A;  5TAO A;  2VK9 A;  5LG4 A;  1HG5 A;  1D1B A;  5ABH A;  3ETU A;  2CBI A;  4X1K E;  3UQ4 A;  4A97 A;  2XQY A;  4YXD A;  2VL0 A;  1VRB A;  4LML A;  5LMU T;  4ZEY A;  4NXN T;  1SHZ C;  3AEB A;  4EED A;  5KMG P;  5LOV E;  3Q5X A;  4QXH B;  1MIW A;  2CXD A;  2ZLY A;  4MBQ A;  3RLF F;  4WZX A;  4DBQ A;  4DUZ T;  2I6H A;  1IBK T;  5AQJ B;  2CHO A;  4NXM T;  2CWO A;  3OBV E;  4QX8 B;  4UXN B;  1NAF A;  4L9I A;  3AE1 A;  4NUV A;  4UR9 A;  3D0T A;  4JI2 T;  1ZKE A;  4DO0 A;  4CI1 B;  4DR2 T;  3JC6 C;  3OYZ A;  2B1E A;  2K3W A;  1U5P A;  4EV6 A;  4JI1 T;  2J47 A;  4MAL A;  4LMJ A;  5BR8 T;  3ZSS A;  3VRB A;  2LSK A;  2QYW A;  5LA6 E;  3O1I A;  4TZ4 C;  2LSY A;  4I43 B;  3NRX A;  1T7S A;  2WSS V;  5FY7 A;  2BVM A;  3AE2 A;  4IL9 A;  4DR6 T;  5AQK B;  4XZC A;  2L8K A;  4HN9 A;  4DV2 T;  4H9O C;  4DR7 T;  3Q5D A;  2BS4 A;  5HXC A;  4DR3 T;  3DJB A;  3KVB A;  5L4E A;  5LJM A;  4H9P C;  2D0T A;  3KBT A;  3E0Z A;  1R8I A;  2D5U A;  2C5I T;  3EUH A;  4KBM B;  2A9U A;  2NTY A;  4UV8 B;  5AQP B;  3UUN A;  1CUN A;  5AQG B;  3N9L A;  3VR8 A;  3AE5 A;  2L3L A;  2OLT A;  4AIU A;  2V7J A;  4I55 E;  3UUL A;  2ZM8 A;  4JYA T;  3P50 A;  4Z90 A;  2IML A;  3QNU A;  4YFS A;  2X68 A;  2MYS A;  2YOE A;  5AQI B;  3Q5E A;  3FZH B;  4X65 T;  4IDO A;  3ZYK A;  3K3N A;  4ADZ A;  2X9W A;  3OJA A;  3ZT7 A;  4H63 V;  4PJJ A;  4EB6 E;  2ODV A;  1QSD A;  1SE7 A;  2V7L A;  3AE4 A;  2E5V A;  5CA0 E;  5BMV E;  1IBM T;  3DP7 A;  5JVD E;  5JQG E;  3AA6 B;  1Z8U A;  3OKQ A;  3RRW A;  3TLT A;  1N34 T;  2CMR A;  3AE7 A;  1UUS A;  4HFI A;  3P8C D;  3VKH A;  4ZI3 D;  5HXE A;  2UUA T;  5L3E B;  2X67 A;  1HFA A;  5FMN A;  1LRZ A;  2MBG A;  3SFD A;  2CXF A;  3AVS A;  4LF5 T;  4OFZ A;  4IDP A;  3I0Q A;  4MFR A;  4CQI A;  5CJ5 A;  3ZN1 B;  3EHZ A;  5LYJ E;  4LF7 T;  3P7I A;  3P4S A;  1NEN A;  2BVL A;  2RP4 A;  3AEA A;  3FBZ A;  4M1P A;  3P4W A;  4Q25 A;  5AQV B;  2W2U A;  3HKB E;  2PG8 A;  1WR0 A;  3K3Q C;  4K0U A;  4TX5 A;  5C3J A;  4DMV A;  1G8X A;  2YU2 A;  5KDM C;  2BG9 C;  4ZZC A;  2VUR A;  3OYX A;  3F2E A;  4BJM A;  3HA4 A;  4UVA B;  1X9B A;  2X66 A;  2WM9 A;  1D1C A;  1ZOY A;  3ABV A;  2CHN A;  4IDN A;  1OWA A;  5FY0 A;  2WWV A;  3M65 A;  2BG9 E;  1V9D A;  2K24 A;  2CE7 A;  4HE8 A;  3RYF E;  1OED A;  3N9O A;  5L4H A;  5HAX A;  3ZMU B;  1WYB A;  1VCS A;  1GQE A;  2DWG A;  4ZI2 C;  4X66 T;  3AE3 A;  5LG3 A;  4LFA T;  2P9B A;  2YIN A;  3TLW A;  2FBW A;  2EHO B;  3C64 A;  2UXX B;  2W61 A;  4QH5 A;  5FXW A;  2YK0 A;  3Q2M A;  3SWH A;  5DQW A;  2BZB A;  4EEB A;  3SOL A;  2M67 A;  2LHR A;  2ODU A;  4KX6 A;  2E9X D;  2PFV A;  2ES0 A;  4IE5 A;  3K3O A;  4NPP A;  5LBQ B;  1IJ5 A;  3IA3 A;  4DID B;  3ZLI A;  5JDQ A;  4QKN A;  3ZST A;  2IAK A;  3RQW A;  2IHR 1;  2YN6 A;  5FVL A;  4QXB B;  1L0V A;  2CEA A;  4L0R A;  2XAJ B;  2PJQ A;  4X1I E;  4L5G A;  3RIF A;  4EXT A;  4B3R T;  1CHU A;  3FZL B;  5ABG A;  4GK0 E;  5LGN B;  4Z91 A;  3RGL A;  1J5W A;  4X62 T;  2WMO A;  2ZM2 A;  5IUX A;  3UT5 E;  3QC9 A;  3KV6 A;  2UXD T;  5AQN B;  3SFE A;  4DUY T;  3LK4 2;  2ZM6 T;  2H3R A;  3AEG A;  1WRD A;  3BK9 A;  4CN4 A;  4H9S E;  2JIW A;  3CX6 B;  2IW5 B;  4CZZ B;  3C98 B;  4JI7 T;  4G2A A;  4DR4 T;  2LEH A;  4I4T E;  5JDF A;  3UUX B;  2XSB A;  2YDS A;  1MNE A;  2W66 A;  2K5B B;  4PK6 A;  3CQG B;  4H63 H;  5J2U E;  5FXZ A;  4P0A A;  1HNZ T;  2YU1 A;  3AEF A;  3JAD A;  2B76 A;  1ZHC A;  4HKA A;  3H37 A;  4U2Z A;  4A56 A;  3ZT5 A;  3C4Z A;  3FXD B;  3QOF A;  4YTP A;  1E7P A;  5ABF B;  5ABE A;  5J0Z A;  2V5D A;  4AQF C;  3B57 A;  3RQU A;  3ESL A;  3LK3 B;  4UF0 A;  3FBL A;  3VR9 A;  1WFD A;  3Q5W A;  5JDM A;  2CM0 A;  3P4Q A;  3MZK B;  4JBW F;  4O4L E;  4OK0 A;  5AQT B;  2KZ7 B;  3HI2 A;  2WQY A;  5E0O A;  4DV3 T;  2UXB T;  2E9X C;  4HGA A;  2YDQ A;  2WBL A;  4DV6 T;  2LM2 A;  2DL1 A;  1XDO A;  2ZMA A;  4HFE A;  3IHR A;  2VKO A;  3I9W A;  3QB5 K;  4IHJ E;  2HN2 A;  2D0U A;  4U31 A;  5L47 A;  2Q9Q D;  5HCJ A;  1W0A A;  1I6Z A;  4DR5 T;  4CXX A;  3AA7 B;  2WS3 A;  4YJ2 E;  1AJ3 A;  2YEV C;  2L9Q A;  2C5J A;  3AXJ B;  5DQV A;  5FP3 A;  2XQ5 A;  4H9N C;  5LMN T;  3C4X A;  4ILC A;  2DCF A;  1N36 T;  4JUY A;  2VL8 A;  1BR1 A;  4UVB B;  4HWI B;  4DVD A;  3OTO T;  2LKH A;  4DV0 T;  3U78 A;  5EZY E;  5LHH B;  5FKY A;  3RIU C;  4U33 A;  3AE8 A;  4IGU A;  4UEL A;  3MK7 C;  5LNK A;  2Q9Q B;  1E1H B;  1HCI A;  2MPK A;  1XMQ T;  2IUB A;  2LE8 A;  4IE7 A;  2VB6 A;  3PU8 A;  3PDY A;  1D0X A;  3LJC A;  4OYJ A;  2NR4 A;  2E5L T;  1YD8 G;  2A3D A;  1IZN B;  2XQ9 A;  2H89 A;  2WCA A;  5JDH A;  2W62 A;  1QUU A;  1D1A A;  4AQF A;  3UUB A;  3ZMV B;  4H9Q C;  4EIW A;  3K8P C;  4PJN A;  3PUG A;  2LSI A;  3O4X E;  1NEK A;  1EZ3 A;  3UTK A;  4EZ4 A;  3O9X A;  1IJ6 A;  4I50 E;  4TV8 E;  2N9D A;  5AQS B;  3NKZ A;  3KFW X;  2VQF T;  4AQY T;  5L3C B;  5L3F B;  3L8R A;  1SA0 E;  2WAU A;  1NWM X;  4P0B A;  5H6Q B;  4JLE A;  2MTQ A;  4HWC A;  1Y64 B;  3TKL B;  1HR0 T;  1IAP A;  5HYA A;  2KWH A;  2XY8 B;  3ZMZ B;  3N2K E;  5HCM A;  3UU4 A;  3GN5 A;  4ZZB A;  2JMH A;  4O2B E;  1MMA A;  3P4R A;  5EK3 A;  2BBJ A;  1HS7 A;  4ZOL E;  2E2A A;  2K48 A;  4AKR B;  4AQG A;  1ZV4 X;  2M6B A;  2CXL A;  3O1H A;  3JAF A;  2CRB A;  5JDL A;  5M4Y A;  4IL4 A;  3I9Y A;  1O3X A;  3O1J A;  4WBN E;  3PUY F;  2FJE A;  3ZMT B;  5FNV E;  3EDV A;  4LF6 T;  2JQ9 A;  2E9X A;  4WBO A;  3RF1 A;  5ABF A;  5JH7 E;  5KX5 E;  2E8I A;  2XPK A;  3AAI A;  1ZP0 A;  1MMG A;  3H3A A;  3JC6 D;  4ILB A;  4AIS A;  4XAX B;  3RX6 A;  4EYY R;  5AFU L;  5L2L A;  1WCR A;  3KBU A;  2JPF A;  2XAF B;  4U2Y A;  2M6I A;  2UXC T;  3NWI A;  4XBF B;  4E7S A;  2LSJ A;  2XM1 A;  2ZM0 A;  4KUM B;  2BDE A;  5CA1 E;  3ETV A;  1H7C A;  1FMV A;  4IIJ E;  5JR9 C;  2VKD A;  3LK2 B;  3ONJ A;  3OPC A;  1LVK A;  3SRZ A;  3RIA A;  2DWK A;  5AQF B;  3J7Y q;  2I59 A;  2X9X A;  2DLR A;  2K9A A;  3B5M A;  3NRY A;  3QB5 A;  2CWY A;  4IE4 A;  4KI0 F;  3P4P A;  4CI3 B;  4AXP A;  4YT0 A;  2LJL A;  2MAW A;  3WAJ A;  1UX4 A;  2PBI A;  4ZI7 E;  2WZH A;  4X20 E;  1OED B;  2X9H A;  4LF8 T;  3ZT6 A;  1HG2 A;  3GA8 A;  2FJA A;  5FVK A;  3KVA A;  4OYK A;  1T98 A;  1N32 T;  2XQ3 A;  3KV9 A;  3NVO A;  1BR0 A;  2J1D G;  4GOU A;  4NIQ A;  1LKX A;  5HEU A;  5L3B B;  3AA1 B;  4JEH B;  2LHN A;  3AB3 B;  4EAH A;  5JDN A;  3AVR A;  4PNI A;  4AKL A;  4PFO A;  3AXJ A;  1N33 T;  2FUP A;  4G63 A;  4JEU B;  5HEG A;  4X64 T;  1YQ4 A;  3VRA A;  4QXC B;  5GON E;  4IE6 A;  4LF9 T;  1YKH B;  3R6N A;  2VKJ A;  1BR2 A;  1WYC A;  3A8Y C;  2C5K T;  5LGT B;  2Z6E A;  4WW0 A;  5C8Y E;  3HKC E;  4GYR A;  5LB7 B;  3FZF B;  4O4H E;  5F8P A;  3ONL C;  4EZH A;  5HWY A;  4QX7 B;  4JI6 T;  3N5L A;  2V6Y A;  3PUW F;  4PJM A;  2C0S A;  1SUM B;  2V26 A;  3UU8 A;  3HKD E;  1T8B A;  2NW7 A;  3VHL A;  4DV5 T;  1OED C;  3SS1 A;  4YSY A;  4QHO A;  4ZI2 D;  5KXJ A;  1MND A;  3PUA A;  4ERR A;  4JI4 T;  1M7K A;  2NOX A;  4KMC A;  3ANW A;  3LBX B;  3RRC A;  1W9R A;  2KMF A;  4MLK A;  4TWH A;  4CI2 B;  1OED E;  3J9X 1;  4A98 A;  3DTO A;  2WY2 A;  4PAG A;  5J1G A;  2VVN A;  2J4G A;  4U3C A;  4CN1 A;  3MA9 A;  4ANJ A;  1BR4 A;  2AXD S;  4HFD A;  4U72 A;  4U7Y A;  3UFE A;  3MAC A;  4CXY A;  1VCT A;  3UU5 A;  2J62 A;  5FL1 A;  2UU9 T;  5LJN A;  2V8S V;  1Y01 A;  4NUU A;  1QLB A;  1HNW T;  3VKG A;  4UVC B;  4BJN A;  1XZY A;  3U3I A;  3KIN B;  4BAY B;  3RYC E;  3ZPO A;  3G06 A;  4O8S A;  5JTG A;  4DV1 T;  4LFC T;  2XQ7 A;  1US7 B;  2VQE T;  5F3J A;  4JI3 T;  1KK7 A;  2AE9 A;  2XJ7 A;  3CPZ A;  1XDP A;  2LLY A;  2XTL A;  3LDQ B;  3PUV F;  5HXH A;  2KT9 A;  3AE9 A;  3N9P A;  2Y8D A;  2W4X A;  4HFH A;  4KHZ F;  5AQM B;  2CPT A;  3ZJ1 A;  1IBL T;  2N1G A;  5JRC A;  4LF4 T;  4PJL A;  2XQ8 A;  1HTJ F;  3FHN A;  2F4V T;  1KEY A;  5LBM A;  2CCQ A;  2Q9Q A;  2WB5 A;  2D9D A;  3IBP A;  3PTR B;  1E2A A;  5IHY A;  5LGU B;  1XNQ T;  4UEM A;  2WU5 A;  1XWM A;  3GWH A;  2D2S A;  4FJO A;  3ZEF B;  3TLU A;  4N78 D;  5AQH B;  3UQ7 A;  2ACX A;  1M62 A;  5FL0 A;  2DHR A;  1YKE B;  2LKG A;  2RA1 A;  4ILU A;  1X79 A;  2XSA A;  1FIO A;  4PK5 A;  2NW9 A;  3V5U A;  3X1D A;  5EK2 A;  2SPC A;  1G73 A;  1W09 A;  2HN1 A;  4F8H A;  4JV5 T;  1ZEE A;  5JRC B;  2LSG A;  2XZE A;  4GIW A;  3JCF A;  3OVU A;  2CLY B;  3ZC1 A;  1UGO A;  1UUR A;  3CVR A;  3LG7 A;  2IDO B;  2KXP B;  5AQQ B;  2WU2 A;  5FYM A;  5CB4 E;  2PTF A;  4EOZ B;  5ADX L;  2X0H A;  2YKS A;  5L3D B;  4GKJ T;  3HR0 A;  3UUM A;  4KHP T;  1UK5 A;  3AED A;  2OV9 A;  3Q9D A;  4YLH A;  4U7I A;  1Z0P A;  2XAQ B;  4YHJ A;  2HPJ A;  2V5C A;  4E7Z A;  3N2O A;  2BS2 A;  5DAB A;  5JDG A;  4GKK T;  2IIU A;  3TLS A;  2QRX A;  2G0U A;  2Y48 B;  4PFP A;  4O4I E;  2NP9 A;  4QH4 A;  2HPL A;  5CGM A;  5LHG B;  2VAS A;  5LCY A;  3C4W A;  2KND A;  1MIV A;  1S35 A;  5AQU B;  2VWA A;  3IEE A;  2W0G A;  3FZM B;  2N2N A;  2Q9Q C;  3CX7 B;  3HL6 A;  1LVF A;  2V7K A;  3ZCI A;  4HWF A;  2NW8 A;  4JI0 T;  2VVS A;  4JI8 T;  4O4J E;  1YXR A;  5HEO A;  5JR9 B;  2CLY C;  3N9M A;  4YY3 T;  4UF0 B;  4DND A;  5IWA T;  3CQX C;  2BG9 A;  2X51 A;  4QWN B;  3RH3 A;  3T8O A;  3ZKR A;  4ZS3 A;  3AE6 A;  4YSZ A;  5AQR B;  4AI6 A;  5FY1 A;  2IC9 A;  2WDR A;  4DBR A;  3E22 E;  4HWD A;  4B3M T;  4PK4 A;  3QUJ A;  3UU6 A;  1D0Z A;  1KNP A;  5ETW A;  2LRL A;  2XAG B;  3CWZ B;  4IT4 A;  1KF6 A;  1OXZ A;  2RPA A;  3C51 A;  4PW8 A;  4U74 A;  1HNX T;  3E08 A;  3KV4 A;  3M3Z B;  3MKD A;  2WMN A;  2JQK A;  3L09 A;  5J2T E;  3GMI A;  1HX1 B;  2H7O A;  2IC6 A;  1HF8 A;  2EHO D;  3FZK B;  4TNV A;  4F6R C;  3PUQ A;  1MMD A;  3RC3 A;  4YTN A;  4WNK A;  4ZXL A;  3B13 A;  5DJQ C;  3PE0 A;  3H3M A;  4HFB A;  4OX9 T;  1FEW A;  2A2F X;  2XAH B;  3IF8 B;  1KFY A;  2NWB A;  3UU3 A;  3MXZ A;  1T72 A;  4HEA A;  3CKD A;  2BG9 B;  4OHF A;  4P09 A;  3NZQ A;  2NTX A;  4J2C A;  3ZN0 B;  3TLV A;  2XQ6 A;  3PUR A;  2WDQ A;  3T1Y T;  3ZMS B;  3BQI A;  3EDU A;  2LOS A;  5IYZ E;  5L3G B;  2UUC T;  1HX8 A;  2V6Y B;  2GK9 A;  5LHI B;  4H9R C;  4ASK A;  3AEE A;  4LFB T;  4DMW A;  4TN7 B;  3PUX F;  4UV9 B;  2OA5 A;  1S94 A;  3A7M A;  4YJ3 E;  3VU7 H;  4DV4 T;  2ACZ A;  3RYH E;  5HXR A;  4X1Y E;  3WAK A;  2R6G F;  1MIY A;  2HHH T;  4B3S T;  2X0Y A;  1DU2 A;  2LM9 A;  4HTE A;  3PV0 F;  5LXT E;  4K0K T;  2EHO C;  2JQQ A;  3ZJ2 A;  5FXX A;  5JRE A;  2CBJ A;  4WYV A;  1KNZ A;  1UCU A;  2WDV A;  3EAM A;  3RI5 A;  3RKG A;  4QH1 A;  4CXW A;  1VOM A;  1FMW A;  3I1A A;  5H6R B;  4ZI3 C;  4JI5 T;  3UFG A;  3HKE E;  2JQH A;  4ILA A;  2W63 A;  3F31 A;  1W0B A;  2MOZ A;  4TUY E;  4YTM A;  3T1H T;  4TNW A;  3K1S A;  2HH7 A;  1YQ3 A;  2WWU A;  2XHE B;  4GK5 E;  2E9X B;  3EAB A;  3PUZ F;  4CN6 A;  5A1L A;  2I0M A;  2XUE A;  4DV7 T;  2JRK A;  4AKI A;  3ZYM A;  2V7M A;  1WLX A;  3LFM A;  3A5X A;  1B7T A;  3EVY A;  2XQA A;  1U4Q A;  2BS3 A;  1UX5 A;  3N2G E;  5F5W A;  3RHW A;  3R84 B;  1XNR T;  4HWH A;  4IDQ A;  4IE0 A;  4TV9 E;  4EGW A;  4A5X A;  1FJG T;  3CQC B;  1J1J A;  3BQL A;  3PJA A;  4IST A;  4UIG A;  2LT3 A;  2H7V C;  2WP9 A;  2V7I A;  3AAA B;  3GN5 B;  3N9N A;  3RC8 A;  2KWI B;  2BKN A;  4KP3 C;  5FXV A;  2KSR A;  4TWF A;  4HFV A;  2LRK A;  4ZHQ E;  2YDR A;  4COF A;  3NZP A;  3FXE B;  3MJX A;  3W15 B;  2W67 A;  4ISS A;  2EHO A;  3RPU A;  3ONX A;  4I0U A;  4IRE A;  2JMK A;  2DNX A;  2BBH A;  5AQL B;  2BKP A; 
#chains in the Genus database with same CATH homology
 2DI4 A;  3CML A;  5JR9 A;  3CX8 B;  3L3P A;  3BQK A;  3NBX X;  4GYS A;  3RKO A;  2KIN B;  4EYU A;  4IDZ A;  2QA7 A;  4MHC A;  4C90 A;  2VKH A;  4O2A E;  4B6X A;  3KV5 A;  4FI5 A;  5EK4 A;  2CA5 A;  3ZCJ A;  3ZYL A;  3I0O A;  2QGS A;  3PU3 A;  3N9Q A;  5HWX A;  3ZC0 A;  2LOP A;  3KDS E;  4BA9 A;  5LP6 E;  2Y6X A;  1MMN A;  2W00 A;  3C50 A;  3PUS A;  2UXN B;  3F57 A;  4Z8X A;  1YW0 A;  4ZS2 A;  3RYI E;  3UUL A;  2XAS B;  3QK6 A;  3V5S A;  4V1A v;  2X9Y A;  3S4U A;  5HXS A;  2KLQ A;  3AA0 B;  3ANW B;  2A72 A;  3LBX A;  5JR9 C;  1D0Y A;  2JJ9 A;  4AKG A;  3AAE B;  2V1D B;  3WI3 A;  1WR6 A;  4AKH A;  2X0L B;  3FB2 A;  4C91 A;  5TAO A;  2VK9 A;  5LG4 A;  1HG5 A;  1D1B A;  3ETU A;  4X1K E;  2XQY A;  1VRB A;  1SHZ C;  5KMG P;  5LOV E;  3Q5X A;  4QXH B;  1MIW A;  2CXD A;  2ZLY A;  4MBQ A;  4DBQ A;  2CWO A;  3OBV E;  4QX8 B;  4UXN B;  1NAF A;  4L9I A;  4NUV A;  4DO0 A;  3D0T A;  1ZKE A;  4CI1 B;  3JC6 C;  3OYZ A;  2B1E A;  1U5P A;  4MAL A;  2LSK A;  5LA6 E;  3O1I A;  4TZ4 C;  2LSY A;  4I43 B;  3NRX A;  5FY7 A;  2WSS V;  2BVM A;  4XZC A;  2L8K A;  4HN9 A;  4H9O C;  5HXC A;  3DJB A;  3KVB A;  5LJM A;  4H9P C;  2D0T A;  3KBT A;  3E0Z A;  1HS7 A;  2D5U A;  2C5I T;  3EUH A;  4KBM B;  2NTY A;  4UV8 B;  3UUN A;  1CUN A;  3N9L A;  2L3L A;  2V7J A;  4I55 E;  2ZM8 A;  4YFS A;  2X68 A;  2MYS A;  3ZYK A;  3K3N A;  4ADZ A;  2X9W A;  3OJA A;  4EB6 E;  4H63 V;  4PJJ A;  2ODV A;  1QSD A;  2V7L A;  5CA0 E;  5BMV E;  3DP7 A;  5JVD E;  5JQG E;  3AA6 B;  3OKQ A;  3RRW A;  2CMR A;  3P8C D;  4ZI3 D;  5HXE A;  5L3E B;  2X67 A;  1HFA A;  5FMN A;  1LRZ A;  2MBG A;  2CXF A;  3AVS A;  4OFZ A;  4MFR A;  3I0Q A;  4CQI A;  3ZN1 B;  3P7I A;  2BVL A;  2RP4 A;  3FBZ A;  4M1P A;  3HKB E;  3K3Q C;  2PG8 A;  4K0U A;  4TX5 A;  4DMV A;  1G8X A;  2YU2 A;  5KDM C;  3OYX A;  3F2E A;  4BJM A;  3HA4 A;  4UVA B;  2X66 A;  2WM9 A;  1D1C A;  5FY0 A;  1OWA A;  3RYF E;  3M65 A;  4HE8 A;  1V9D A;  2K24 A;  2CE7 A;  3N9O A;  5HAX A;  3ZMU B;  1WYB A;  2DWG A;  4ZI2 C;  2P9B A;  2YIN A;  3C64 A;  2EHO B;  2UXX B;  2W61 A;  5FXW A;  2YK0 A;  3Q2M A;  3SWH A;  5DQW A;  2BZB A;  3SOL A;  2M67 A;  2LHR A;  2ODU A;  2E9X D;  2PFV A;  2ES0 A;  4IE5 A;  3K3O A;  5LBQ B;  1IJ5 A;  3ZLI A;  5JDQ A;  4QKN A;  2IAK A;  4QXB B;  4EXT A;  2CEA A;  4L0R A;  2XAJ B;  2PJQ A;  4X1I E;  4GK0 E;  5LGN B;  2WMO A;  2ZM2 A;  3UT5 E;  3QC9 A;  3KV6 A;  3LK4 2;  2H3R A;  1WRD A;  3BK9 A;  4H9S E;  2IW5 B;  3CX6 B;  4CZZ B;  3C98 B;  4G2A A;  2LEH A;  4I4T E;  5JDF A;  3UUX B;  1MNE A;  2K5B B;  4PK6 A;  3CQG B;  4H63 H;  5J2U E;  5FXZ A;  4P0A A;  2YU1 A;  4A56 A;  1BR0 A;  1ZHC A;  4HKA A;  3H37 A;  3C4Z A;  3FXD B;  4AQF C;  3B57 A;  5JDM A;  3ESL A;  3LK3 B;  4UF0 A;  3FBL A;  5L3G B;  5LYJ E;  3Q5W A;  2CM0 A;  3MZK B;  4O4L E;  4OK0 A;  2KZ7 B;  3HI2 A;  5E0O A;  2E9X C;  4HGA A;  2WBL A;  2ZMA A;  3VKH A;  4TV8 E;  3IHR A;  2VKO A;  3I9W A;  4IHJ E;  2D0U A;  2Q9Q D;  4CXX A;  3AA7 B;  4YJ2 E;  1AJ3 A;  2YEV C;  2L9Q A;  2C5J A;  5DQV A;  5FP3 A;  4H9N C;  3C4X A;  2DCF A;  4JUY A;  2VL8 A;  1BR1 A;  4UVB B;  4DVD A;  3U78 A;  5EZY E;  5LHH B;  4UEL A;  4IGU A;  5LNK A;  3MK7 C;  2Q9Q B;  1E1H B;  1HCI A;  2LE8 A;  4IE7 A;  2VB6 A;  3PU8 A;  3PDY A;  1D0X A;  3LJC A;  4OYJ A;  1YD8 G;  2A3D A;  1IZN B;  5JDH A;  2W62 A;  1QUU A;  1D1A A;  4AQF A;  3ZMV B;  4H9Q C;  4EIW A;  3K8P C;  4PJN A;  3PUG A;  2LSI A;  3O4X E;  3UTK A;  1EZ3 A;  4EZ4 A;  3O9X A;  1IJ6 A;  4I50 E;  2N9D A;  3KFW X;  5L3C B;  5L3F B;  1SA0 E;  2WAU A;  1NWM X;  4P0B A;  5H6Q B;  4JLE A;  2MTQ A;  3TKL B;  1Y64 B;  1IAP A;  5HYA A;  2KWH A;  3ZMZ B;  3N2K E;  3GN5 A;  2JMH A;  4O2B E;  1MMA A;  5EK3 A;  4ZOL E;  2K48 A;  4AKR B;  4AQG A;  1ZV4 X;  2CXL A;  3O1H A;  5JDL A;  3I9Y A;  1O3X A;  3O1J A;  4WBN E;  3ZMT B;  5FNV E;  3EDV A;  2E9X A;  4WBO A;  5JH7 E;  5KX5 E;  2E8I A;  3AAI A;  3H3A A;  1MMG A;  3JC6 D;  5LHG B;  4XAX B;  3RX6 A;  5L2L A;  3KBU A;  2JPF A;  2XAF B;  4XBF B;  4E7S A;  2LSJ A;  2ZM0 A;  4KUM B;  2BDE A;  5CA1 E;  3ETV A;  1H7C A;  1FMV A;  4IIJ E;  2VKD A;  3LK2 B;  3SRZ A;  1LVK A;  2DWK A;  3J7Y q;  2I59 A;  2X9X A;  2DLR A;  2K9A A;  5LCY A;  3NRY A;  2CWY A;  4IE4 A;  4CI3 B;  4AXP A;  2LJL A;  3WAJ A;  1UX4 A;  2PBI A;  4ZI7 E;  4X20 E;  2X9H A;  1HG2 A;  3GA8 A;  3KVA A;  4OYK A;  1T98 A;  3KV9 A;  2J1D G;  4GOU A;  1LKX A;  3AA1 B;  4JEH B;  2LHN A;  3AB3 B;  4EAH A;  5JDN A;  3AVR A;  4PNI A;  4AKL A;  4PFO A;  4JEU B;  4G63 A;  4QXC B;  5GON E;  4IE6 A;  1YKH B;  3R6N A;  2VKJ A;  1BR2 A;  1WYC A;  2C5K T;  5LGT B;  2Z6E A;  4WW0 A;  5C8Y E;  3HKC E;  4GYR A;  5F8P A;  4O4H E;  4EZH A;  5HWY A;  4QX7 B;  3N5L A;  4PJM A;  2C0S A;  2V26 A;  3HKD E;  4AI6 A;  2NW7 A;  3VHL A;  3SS1 A;  4ZI2 D;  4QHO A;  1MND A;  3PUA A;  4ERR A;  2NOX A;  4KMC A;  3ANW A;  3LBX B;  3RRC A;  2KMF A;  4MLK A;  4CI2 B;  3J9X 1;  3DTO A;  4PAG A;  5J1G A;  3MA9 A;  4ANJ A;  1BR4 A;  4U72 A;  3UFE A;  3MAC A;  4CXY A;  5LJN A;  4NUU A;  3VKG A;  4UVC B;  4BJN A;  3U3I A;  3KIN B;  4BAY B;  3RYC E;  3ZPO A;  4O8S A;  1US7 B;  5F3J A;  1KK7 A;  3CPZ A;  2XTL A;  5HXH A;  2KT9 A;  3N9P A;  2Y8D A;  3ZJ1 A;  2N1G A;  5JRC A;  4PJL A;  1HTJ F;  3FHN A;  5LBM A;  2CCQ A;  2Q9Q A;  3IBP A;  3PTR B;  5IHY A;  5LGU B;  4UEM A;  3GWH A;  2D2S A;  4FJO A;  3ZEF B;  4N78 D;  2ACX A;  2DHR A;  1YKE B;  4ILU A;  2RA1 A;  4PK5 A;  1X79 A;  5M4Y A;  1FIO A;  2NW9 A;  3V5U A;  5EK2 A;  2SPC A;  1G73 A;  1ZEE A;  5JRC B;  2LSG A;  4GIW A;  2CLY B;  3ZC1 A;  3CVR A;  5FYM A;  3LG7 A;  5AFU L;  5L3B B;  2KXP B;  5ADX L;  5CB4 E;  4EOZ B;  5L3D B;  3HR0 A;  3UUM A;  4YLH A;  3Q9D A;  1Z0P A;  2XAQ B;  4YHJ A;  2HPJ A;  4E7Z A;  3N2O A;  5DAB A;  5JDG A;  2G0U A;  2Y48 B;  4PFP A;  4O4I E;  2NP9 A;  2HPL A;  2VAS A;  3C4W A;  2KND A;  1MIV A;  1S35 A;  2VWA A;  3IEE A;  2W0G A;  2N2N A;  2Q9Q C;  3CX7 B;  3HL6 A;  1LVF A;  2V7K A;  3ZCI A;  2NW8 A;  4O4J E;  5JR9 B;  2CLY C;  3N9M A;  4UF0 B;  4DND A;  3CQX C;  2X51 A;  4QWN B;  3RH3 A;  3T8O A;  4ZS3 A;  5FY1 A;  2IC9 A;  4DBR A;  3E22 E;  4PK4 A;  3QUJ A;  1D0Z A;  5ETW A;  2XAG B;  3CWZ B;  4PW8 A;  1OXZ A;  3C51 A;  4U74 A;  3E08 A;  3KV4 A;  3MKD A;  5J2T E;  2WMN A;  3L09 A;  3GMI A;  2IC6 A;  2H7O A;  1HF8 A;  2EHO D;  4F6R C;  3PUQ A;  1MMD A;  3RC3 A;  4WNK A;  3B13 A;  5DJQ C;  3PE0 A;  1FEW A;  2A2F X;  2XAH B;  3IF8 B;  2NWB A;  3MXZ A;  4HEA A;  3CKD A;  4OHF A;  4P09 A;  3ZN0 B;  3NZQ A;  2NTX A;  4J2C A;  4EYY R;  3PUR A;  3ZMS B;  3BQI A;  3EDU A;  2LOS A;  5IYZ E;  1HX8 A;  2GK9 A;  5LHI B;  4H9R C;  4ASK A;  4DMW A;  4TN7 B;  4UV9 B;  3VU7 H;  2OA5 A;  1S94 A;  4YJ3 E;  3RYH E;  5HXR A;  4X1Y E;  3WAK A;  1MIY A;  2LM9 A;  4HTE A;  5LXT E;  2EHO C;  2JQQ A;  3ZJ2 A;  5FXX A;  5JRE A;  1KNZ A;  1UCU A;  4CXW A;  1VOM A;  1FMW A;  3I1A A;  5H6R B;  4ZI3 C;  3HKE E;  2W63 A;  3F31 A;  2MOZ A;  4TUY E;  2HH7 A;  2WWU A;  2XHE B;  4GK5 E;  2E9X B;  5A1L A;  2XUE A;  4AKI A;  2JRK A;  3ZYM A;  2V7M A;  1WLX A;  3LFM A;  3A5X A;  1B7T A;  3EVY A;  1U4Q A;  3N2G E;  1UX5 A;  3R84 B;  4TV9 E;  4IE0 A;  3CQC B;  3BQL A;  4UIG A;  4IST A;  2LT3 A;  2H7V C;  3GN5 B;  2V7I A;  3AAA B;  3N9N A;  3RC8 A;  2KWI B;  5FXV A;  4KP3 C;  4HFV A;  4ZHQ E;  3NZP A;  3FXE B;  3MJX A;  3W15 B;  4ISS A;  2EHO A;  3RPU A;  3ONX A;  2JMK A;  2DNX A;  4L5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...