2JPFA

Bpp3783_115-220
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
KQQLQEHAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHGTPPTASDVVGMPQWQEYTAMLRERFAGLDTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords Hypothetical protein
publication title Bpp3783_115-220
rcsb
source organism Bordetella parapertussis
total genus 19
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11516 DUF3220 Protein of unknown function (DUF3120)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.960 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jpfA01
2JPFA
chains in the Genus database with same CATH superfamily
4PW8A 2Y48B 1D0YA 2ACZA 5LBQB 3ZN0B 2L8KA 3EABA 5M4YA 3ZJ1A 1US7B 4BJMA 5AQFB 4LF7T 3AE9A 2LKHA 4Z91A 3HL6A 3B13A 5C8YE 1L0VA 4YJ3E 2ZM2A 2D2SA 2NOXA 1W9RA 2V7LA 2WU2A 4P09A 4IDZA 1VRBA 1CHUA 3JC6D 4UV9B 5AFUL 2C5KT 2Y6XA 5AQNB 2ZM8A 3H37A 4ILBA 3Q5DA 3CX6B 4P0AA 3KVAA 1KEYA 5C2TA 4EYUA 2YU1A 2IC9A 1U4QA 2XQAA 3ZYLA 1HS7A 3AE8A 3F57A 1SHZC 4DR2T 4DV6T 2I0MA 3AEBA 3OYXA 2W00A 2Q9QA 5ADXL 5ABFB 2KMFA 1T72A 3AAIA 2XQ9A 3EDVA 4FJOA 4EOZB 2PG8A 4KBMB 4HFIA 3CPZA 4NUVA 1W0BA 2LRLA 4FI5A 1MNDA 2WAUA 3A5XA 4CI3B 1W09A 2NW7A 2K9AA 2VB6A 4JBWF 1FEWA 5TAOA 4UELA 4O4JE 3BQKA 1CUNA 5CA1E 3LK3B 4IIJE 1Z8UA 2WZIA 4TX5A 2BBHA 5AQPB 4IDPA 5CA0E 3ZMTB 2B1EA 3V5UA 4X66T 4UIGA 4YTMA 3TLTA 3RYIE 1SUMB 4WYVA 3OTOT 5L3DB 3LDQB 4QHOA 4UF0A 3VRBA 3LFMA 4NPPA 2FJAA 1N36T 4PFPA 3AA0B 5BR8T 2HPLA 4TWHA 3AE4A 4UEMA 3PUVF 4F8HA 1ZHCA 5C3JA 1IAPA 3E22E 4LMKA 2BKOA 1LVFA 2CBIA 4TNVA 4PK5A 1FIOA 3UFGA 3AAEB 2HN2A 5F3JA 2DHRA 1AJ3A 3GN5B 3SFEA 5FXXA 2LM2A 3RIUC 3P7IA 2WP9A 3CQXC 4AQFA 2LOSA 4JI0T 5LB7B 4CQIA 4GK5E 3UQ4A 2XQ5A 2EHOA 2H89A 4O8SA 1MIVA 4HFVA 2V6YA 2P9BA 3PU8A 4MLKA 1YQ4A 1XDPA 2F4VT 4X1KE 5AQIB 2Q9QD 3F31A 3LK2B 5A1LA 3ZLIA 2W63A 5BMVE 2VWAA 3K1SA 3ETUA 4TWDA 2W66A 1ZV4X 4K0UA 4ISSA 2VKJA 5HWYA 4NUUA 1D1AA 3KV6A 4X62T 4ZHQE 3AVRA 4I55E 4A97A 3VRAA 5JR9A 4IDQA 2FJDA 3K3NA 4TUYE 2Z6EA 4TV9E 5L3FB 3PTRB 3FZKB 3HKEE 2N2NA 3NRXA 4GK0E 2CMRA 3AA1B 4IDOA 2UUAT 2A72A 1D1CA 2BG9B 2XHEB 2YU2A 4TNWA 3PUAA 1IBLT 1KFYA 5FXVA 4LFAT 5HYAA 4H9SE 1SE7A 1ZP0A 4JI4T 3RQUA 3R84B 2J1DG 3ZC0A 3GA8A 5HCJA 5FY7A 2UXCT 2V5CA 4P1NA 4DV2T 4E7ZA 5H6QB 3KBTA 5JDMA 1HNWT 2NW8A 4QKNA 5HEJA 1R8IA 3MZKB 5CGMA 3MXZA 3EHZA 5H6RB 5LGTB 2JRKA 2FUPA 4LMLA 5JRCA 1O3XA 2CA5A 4HFHA 4C91A 4I0UA 1LKXA 4MFRA 4IGUA 2B76A 4GYSA 5AQSB 2BBJA 4AKGA 1VOMA 3O9XA 3UT5E 4DBRA 4DUZT 2EHOD 3VHLA 3J9X1 3N9MA 1IZNB 3NWIA 3N5LA 3AXJA 2ACXA 2UU9T 2X9HA 3P50A 4C90A 1Y01A 3KINB 3I1AA 5HXCA 3R6NA 2M6IA 4X20E 3I0QA 1GQEA 1YXRA 2FBWA 2SPCA 5LHGB 4CZZB 4IE5A 2HPJA 2MOZA 3V5SA 2LM9A 4IT4A 4HKAA 5L3BB 4QH5A 5JDHA 4B3RT 2E9XA 4YSYA 2BZBA 3CX7B 3ZJ2A 3I9YA 3TLWA 3C64A 3RC8A 3O1HA 4HFEA 3UU5A 5CFBA 3DP7A 2DI4A 1WLXA 1J5ET 3KBUA 4ZS3A 3C4XA 5J2UE 2K24A 2XAHB 1T7SA 4B3MT 1I6ZA 2HHHT 1WR0A 2DLRA 2YOEA 3T1HT 3FZFB 1M7KA 5J1GA 2CHOA 3OPCA 4OK0A 3QK6A 3FBZA 3H3AA 4U74A 5EK2A 4KMCA 1IJ5A 1E7PA 5FY0A 2NTYA 1KNZA 4OYKA 4EV6A 3NZPA 3AVSA 5JDNA 2BS4A 3ZC1A 3P4QA 1WCRA 1G8XA 2VKDA 2PBIA 2XSBA 3P8CD 2WCAA 2VURA 3DTOA 4PJLA 4AKRB 1IBMT 4LFBT 5AQTB 4YY3T 1J5WA 3X1DA 3ONXA 4U72A 3C4ZA 5L4HA 3K8PC 4KP3C 2C5IT 3AE5A 4H63H 4HFBA 5AQJB 3NBXX 2WBLA 3Q2MA 2FJEA 3CKDA 4DUYT 4Q25A 4U7YA 4ASKA 2X68A 1X79A 3B57A 2WDQA 3TKLB 3N9QA 3WAJA 2DNXA 3ETVA 1JNZA 4XBFB 2C0SA 2YK0A 2M6BA 5J2TE 5DQWA 2L9QA 2C5JA 2E9XD 4WW0A 3SWHA 4DR1T 3FXEB 3RIAA 3QUJA 1U5PA 3PDYA 1BR0A 3JC6C 3OKQA 2R6GF 3RH3A 4ZI2C 5FP3A 2QA7A 5DQVA 2M67A 5LA6E 5AQHB 2XAJB 4KI0F 4EEBA 3OYZA 1DU2A 4IE4A 3RYFE 5ETWA 2ODVA 4CI1B 1EZ3A 1D0ZA 4PK6A 2BVLA 3F2EA 1HTJF 4EGWA 5FVLA 1HF8A 2NW9A 4HWDA 4ERRA 2W67A 3ZEFB 2L3LA 1YQ3A 3AB3B 5HXEA 5HCMA 3TLVA 3UUXB 2X0LB 3UQ7A 2RP4A 1UCUA 3RIFA 2V7JA 2X0HA 3ZYMA 5JTGA 4ADZA 4YHHT 2XASB 3ANWA 4HFCA 2MBGA 5L3GB 2YDRA 4DR3T 2YEVC 2CPTA 2HH7A 3EAMA 4LF4T 3UFEA 4HWHA 2E5LT 2N1GA 5FKYA 2XAFB 3PUSA 2DCFA 4JI6T 2OV9A 4H9PC 1V9DA 4U2ZA 2XUEA 2J4GA 2BG9E 4I50E 2KSRA 4K0KT 2XJ7A 2K5BB 2XQ7A 2H7VC 3HKDE 3PUGA 4G63A 4LFCT 5FYMA 4YXDA 3J7Yq 1X9BA 4DV0T 3B5MA 3FZLB 4CN1A 5JDLA 1XZYA 3LBXB 2OA5A 2WDRA 3RGLA 3IHRA 3MA9A 2DWKA 3C50A 5EK4A 1OWAA 4UR9A 4A98A 4MBQA 3LG7A 3RRWA 3PV0F 3L09A 5L2LA 3W15B 2HN1A 3RC3A 1H7CA 1W0AA 4DV5T 2W61A 4DMWA 4DV4T 2WMOA 2LHRA 2Y8DA 2NTXA 3I9WA 3BQIA 3ZMVB 4OFZA 2IIUA 4TV8E 1BR2A 3ZSSA 3KV9A 3FZMB 2BG9C 4JI3T 2IHR1 1HNZT 3NZQA 4HWFA 1YKEB 1VCSA 3JAFA 2BDEA 2ES0A 4PK4A 3HR0A 4GKKT 5EK3A 2YINA 3UUNA 3EI0A 2KNDA 2VL0A 1QUUA 3H3MA 5IHYA 5LYJE 4PFOA 4WZXA 3T8OA 4DO0A 3AEEA 4U7IA 2VKOA 5ABEA 1FMWA 4OHFA 1IBKT 4ZZCA 4XZCA 3AA6B 4EXTA 4QXCB 3AEFA 1MNEA 3ZMZB 3ZMSB 4ANJA 3ZT7A 3N2KE 5FL0A 2UXNB 3PE0A 4MHCA 4UVBB 3LSVA 2A9UA 4WBOA 4O4HE 4B3TT 2V1DB 4M1PA 5LJMA 2IC6A 2NR4A 1J1JA 3RKGA 5LMUT 2I6HA 3PUZF 3O1IA 4JI5T 5HEGA 2Q9QB 2CXFA 2X51A 3PUWF 1MMNA 4U3CA 1S35A 4ILAA 2ODUA 4TN7B 1OEDA 3P4RA 2XAQB 2LEHA 2J62A 5LOVE 2N9DA 1N32T 4DR7T 1NEKA 3KDSE 4AKHA 1QLBA 1HNXT 2XQ8A 5LG4A 4HE8A 2LLYA 3ZCJA 4COFA 4DV7T 1MIYA 3AE3A 2V8SV 3S4UA 1Z0PA 2KWIB 4AQFC 4KX6A 3AE7A 4DMVA 2QRXA 1UX4A 3Q9DA 1XDOA 2FJBA 4ZEYA 4I4TE 4IL9A 4AIUA 2A3DA 3IBPA 4UF0B 4ZOLE 2WSSV 2RPAA 1YD8G 4P0BA 2JMHA 4G2AA 1JNRA 3ZT5A 5LCYA 3ZMUB 4BAYB 3CQGB 5AQUB 3P4WA 1HX8A 5AQOB 2XM2A 1M62A 2XQ3A 2YDQA 2V7KA 2V6XA 3ZKRA 4GKJT 4EZHA 4QWNB 3AE2A 1WYBA 2CWOA 4UVAB 3D0TA 1ZEEA 3MJXA 4YTPA 2IW5B 2WY2A 2UXBT 1FMVA 2XAGB 2WM9A 1FJGT 3VKHA 4CN4A 5AQGB 2D0TA 3UU8A 5KXJA 4NXNT 3PJAJ 4J2CA 3UUBA 3SRZA 2EHOB 4ZI3C 4NXMT 3AECA 4V1Av 2X9YA 2CRBA 5FXZA 5CB4E 2LSIA 3QB5A 2V6YB 3QOFA 5ABFA 3LK42 3CVRA 2XQ6A 4GOUA 2JPFA 3QC9A 5KX5E 1XMQT 1SA0E 3JCFA 3RPUA 5HAXA 4YFSA 4CI2B 4BJNA 4EIWA 4KHPT 3SS1A 5L3CB 2W62A 2XY8B 2VK9A 3UUMA 4GYRA 1OXZA 4PAGA 2PJQA 1NAFA 5LHIB 2LSKA 5JR9B 4X5TA 4UV8B 4DR5T 2D0UA 1NENA 3UU4A 2KWHA 2JQ9A 3ONLC 2BVMA 2CCQA 2X67A 1S94A 1UX5A 4AQYT 4IE7A 2LE8A 4XAXB 5JREA 3TLUA 1MMAA 5AQQB 3PUYF 2WWVA 4ISTA 4O2AE 4YTNA 5AQMB 5JDQA 4LF5T 3WAKA 3MACA 3PUXF 1OEDB 2I59A 2E2AA 1WR6A 3WI3A 2VQET 2KLQA 5LG3A 4U31A 4CN6A 2H7OA 2YDSA 5AQLB 1HX1B 5FY1A 1XNRT 5LHHB 3C51A 2J47A 2IMLA 3GN5A 2W2UA 4ZI7E 5DJQC 4QXHB 4YJ2E 5JRCB 2AXDS 5HWXA 4O4IE 5LXTE 2DWGA 1NWMX 4B6XA 3VR9A 3GWHA 2E8IA 3EUHA 3P4SA 5HEUA 3AE1A 2LSJA 2UUBT 2LRKA 4HEAA 3RF1A 2KXPB 2XQ4A 4EAHA 3IF8B 4N78D 4U2YA 3SOLA 2CEAA 4O4LE 1KNRA 3L3PA 2UUCT 3RHWA 3MK7C 3AXJB 3Q5WA 2QVAA 4B3ST 3PU3A 3RLFF 4BA9A 4F6RC 4AQGA 5IWAT 4Z90A 1IJ6A 5DABA 3ONJA 4ZI2D 2RA1A 3QB5K 5CJ5A 5LBMA 2H3RA 2PFVA 3RIUA 2ZMAA 1BR1A 2K3WA 2OLTA 3CWZB 2E9XB 3PJAA 2MPKA 4L0RA 2BG9A 4CXXA 3E0ZA 4DNDA 4DBQA 3AAAB 3BQLA 4UVCB 4MALA 2JQHA 2CE7A 4DIDB 1MMGA 3JAEA 4PJMA 3AA7B 2KINB 1G73A 5HXHA 4X1IE 3CX8B 3RI5A 5HXSA 5J0ZA 1HG2A 4DR6T 3IEEA 4HGAA 5JDGA 2JMKA 3U3IA 5FVKA 4U33A 2IAKA 3L8RA 5LP6E 3N9PA 2GK9A 4H9NC 3CQCB 2WWUA 2NWBA 4YSXA 1N33T 3HKBE 3K3QC 4WNKA 1T98A 5FL1A 1ZKEA 3AEAA 4DV1T 2MTQA 4LF6T 5LNKA 4EZ4A 3HA4A 1LVKA 3N9NA 3C4WA 4ZXLA 2JQKA 1WFDA 3N9LA 3RKOA 1KF6A 4GIWA 5HEHA 2WQYA 3NVOA 4JYAT 2XZEA 2VKHA 3RQWA 5KDMC 4HWIB 3MKDA 4L9IA 5LGNB 3A8YC 2QGSA 3GMIA 4LF9T 4IHJE 3NRYA 4DV3T 4IREA 4AKIA 3AEDA 3N2OA 2CM0A 4I43B 4YSZA 2MAWA 3UU6A 3Q5EA 1KNPA 4X1YE 4EB6E 2D9DA 5E0OA 3I0OA 3ZT6A 4IDNA 2VVNA 3VR8A 3FXDB 4AXPA 3UU3A 4O2BE 2Q9QC 2VQFT 3RRCA 3RX6A 4QH4A 5JQGE 2X0YA 1I94T 3L39A 2E5VA 5HEOA 3FHNA 1XWMA 4ZS2A 1VCTA 5FMNA 2XM1A 4QX7B 3G06A 1D1BA 4X64T 2MYSA 2UXDT 2XSAA 1N34T 2K48A 1KK7A 4OYJA 3ZN1B 2JQQA 3P4PA 4TWFA 1MMDA 1WYCA 4JI1T 4L5GA 5JVDE 4JI2T 5AQKB 3C98B 3CK6A 3FB2A 5FNVE 3M65A 2VVSA 3VKGA 4HN9A 2G0UA 5GONE 3RYHE 2LSGA 4QX8B 4PJNA 2A2FX 3AE6A 4IE0A 3JADA 5L3EB 3K3OA 4LMJA 4YHJA 1HFAA 2KZ7B 5L4EA 3IA3A 3OJAA 2D5UA 3Q5XA 3ANWB 3ABVA 3CMLA 4E7SA 2LT3A 3NKZA 1ZOYA 5AQVB 3HI2A 2BKPA 4HFDA 2CXLA 2XQYA 1UUSA 4AKLA 3N2GE 2JJ9A 2CBJA 1XNQT 3FBLA 2H88A 3O1JA 3RYCE 4A5XA 3M3ZB 2VASA 2BKNA 4JI7T 5JH7E 4AISA 3ESLA 2ZM6T 2CHNA 2V7IA 2X9XA 5KMGP 3EVYA 3PUQA 2VL8A 5F5WA 1BR4A 2EHOC 2XTLA 4JI8T 1B7TA 3TLSA 4OX9T 2JIWA 2WU5A 4KUMB 2X66A 4H9RC 1OEDE 2W0GA 1XMOT 3ZYKA 4NIQA 4PNIA 2LSYA 2WDVA 2PTFA 3KV4A 3DJBA 4HTEA 4QXBB 3QNUA 3EDUA 2YKSA 2WZHA 2ZM0A 3UTKA 3CIRA 5EZYE 4EYYR 5LJNA 3E08A 5JR9C 3SFDA 2ZLYA 2CWYA 5LGUB 2LKGA 5FXWA 1E2AA 1D0XA 5L47A 2NP9A 2V26A 2CLYC 1HG5A 1Y64B 1YW0A 3VU7H 2UXXB 3O4XE 2LHNA 4CXWA 1HR0T 5AQRB 3BK9A 4IE6A 3LJCA 4LF8T 4CXYA 2LJLA 3OBVE 4JUYA 4DVDA 4AI6A 1OEDC 1WRDA 2AE9A 1UGOA 4H9QC 1QSDA 1HCIA 1UK5A 2V7MA 4WBNE 5JDFA 4ILUA 4JLEA 4ZI3D 1MIWA 2WS3A 4KHZF 3KV5A 5LMNT 2CXDA 3OVUA 4QH1A 2BS3A 4JEUB 1T8BA 2LOPA 3ZPOA 3ZCIA 1LRZA 2XPKA 2WB5A 4TZ4C 3T1YT 3KFWX 5F8PA 5IYZE 2CLYB 3PURA 2BS2A 4DR4T 4YLHA 1E1HB 4Z8XA 3A7MA 4UXNB 4JV5T 1UURA 2DL1A 3LBXA 2QYWA 4PJJA 3AEGA 4JEHB 2V5DA 5ABGA 1YKHB 4IL4A 4H9OC 2YN6A 4HWCA 3ZSTA 4EEDA 2WMNA 3HKCE 2KT9A 3KVBA 4ILCA 4ZZBA 2IDOB 4H63V 2X9WA 3FZHB 4X65T 4A56A 5HXRA 3UULA 5IUXA 4YT0A 2IUBA 3N9OA 2E9XC 3U78A 2W4XA 5ABHA
chains in the Genus database with same CATH topology
5L3BB 4O4HE 5LNKA 4EZ4A 2V1DB 5JDHA 3HA4A 1LVKA 4PW8A 2E9XA 2Y48B 1D0YA 5LBQB 3N9NA 4M1PA 5LJMA 2IC6A 3C4WA 3ZN0B 2L8KA 2BZBA 3N9LA 5M4YA 3RKOA 3CX7B 3ZJ1A 3ZJ2A 1US7B 3I9YA 3O1IA 3C64A 3RC8A 4BJMA 3O1HA 4GIWA 2Q9QB 2CXFA 2X51A 1MMNA 3DP7A 2DI4A 3HL6A 1S35A 3B13A 2ODUA 5C8YE 4TN7B 1WLXA 3KBUA 4ZS3A 2VKHA 3C4XA 5KDMC 4YJ3E 5J2UE 2ZM2A 2XAQB 2K24A 2XAHB 3MKDA 4L9IA 5LGNB 2LEHA 2QGSA 3GMIA 2D2SA 2NOXA 5LOVE 2DLRA 2N9DA 2V7LA 4IHJE 3NRYA 4P09A 4IDZA 5J1GA 4AKIA 3KDSE 1VRBA 4AKHA 3N2OA 3JC6D 4OK0A 2CM0A 3QK6A 4I43B 4UV9B 3FBZA 3H3AA 4U74A 5LG4A 5EK2A 4HE8A 4KMCA 3ZCJA 5AFUL 1IJ5A 2C5KT 4X1YE 2Y6XA 4EB6E 2ZM8A 3H37A 5FY0A 5E0OA 3I0OA 3CX6B 4P0AA 1MIYA 2NTYA 3KVAA 3S4UA 1Z0PA 2KWIB 4AQFC 1KNZA 3FXDB 4AXPA 4EYUA 2YU1A 4DMVA 2IC9A 4O2BE 1U4QA 4OYKA 1UX4A 3ZYLA 1HS7A 2Q9QC 3RRCA 3NZPA 3AVSA 3F57A 3RX6A 5JQGE 3Q9DA 5JDNA 1SHZC 3ZC1A 3FHNA 4ZS2A 3OYXA 4I4TE 2A3DA 1G8XA 3IBPA 5FMNA 4QX7B 2W00A 2Q9QA 2VKDA 4UF0B 4ZOLE 2PBIA 2WSSV 5ADXL 1YD8G 4P0BA 2JMHA 1D1BA 3P8CD 4G2AA 2KMFA 3DTOA 2MYSA 4PJLA 4AKRB 3AAIA 3EDVA 4FJOA 5LCYA 4EOZB 3ZMUB 2K48A 3ONXA 4BAYB 4U72A 3CQGB 1KK7A 3C4ZA 4OYJA 3ZN1B 2JQQA 1MMDA 1WYCA 2PG8A 4KBMB 1HX8A 3K8PC 3CPZA 4NUVA 4L5GA 4KP3C 2C5IT 4FI5A 1MNDA 5JVDE 4H63H 2V7KA 3C98B 3NBXX 2WAUA 2WBLA 3A5XA 3Q2MA 4CI3B 4EZHA 2NW7A 3CKDA 3FB2A 2K9AA 5FNVE 2VB6A 1FEWA 3M65A 3VKGA 4HN9A 4QWNB 4UELA 5TAOA 4O4JE 3BQKA 4ASKA 2X68A 1WYBA 1X79A 2CWOA 3B57A 4UVAB 2G0UA 1CUNA 3D0TA 5GONE 5CA1E 3RYHE 3LK3B 2LSGA 1ZEEA 3MJXA 4IIJE 4QX8B 4PJNA 3TKLB 2A2FX 4TX5A 3N9QA 3WAJA 2DNXA 2IW5B 4IE0A 3ETVA 1FMVA 5CA0E 3ZMTB 2C0SA 4XBFB 2YK0A 2XAGB 2WM9A 3VKHA 2B1EA 3V5UA 2D0TA 4UIGA 5L3EB 3K3OA 5J2TE 4J2CA 3RYIE 5DQWA 3SRZA 2EHOB 4ZI3C 5L3DB 4V1Av 4YHJA 2X9YA 1HFAA 2L9QA 2C5JA 5FXZA 2E9XD 5CB4E 4WW0A 3SWHA 2KZ7B 2LSIA 3FXEB 4QHOA 4UF0A 3LFMA 3OJAA 2D5UA 3Q5XA 3ANWB 3QUJA 3LK42 1U5PA 3CVRA 4PFPA 3PDYA 1BR0A 3CMLA 4GOUA 4E7SA 3AA0B 2JPFA 3QC9A 2HPLA 2LT3A 3JC6C 3OKQA 5KX5E 4UEMA 3RH3A 1SA0E 4ZI2C 5FP3A 3RPUA 1ZHCA 2QA7A 5HAXA 4YFSA 3HI2A 5DQVA 4CI2B 2M67A 1IAPA 2CXLA 2XQYA 3E22E 3SS1A 5LA6E 4BJNA 2W62A 4EIWA 5L3CB 2XAJB 2VK9A 4AKLA 3N2GE 3OYZA 1LVFA 2JJ9A 3UUMA 4IE4A 4GYRA 1OXZA 4PK5A 3RYFE 5ETWA 2ODVA 3FBLA 1FIOA 4PAGA 3AAEB 4CI1B 1EZ3A 2PJQA 2DHRA 1NAFA 5F3JA 1D0ZA 3O1JA 5LHIB 1AJ3A 4PK6A 2LSKA 3RYCE 5JR9B 2VASA 3GN5B 2BVLA 5FXXA 4UV8B 3F2EA 1HTJF 2D0UA 3P7IA 5JH7E 3ESLA 1HF8A 2V7IA 2X9XA 2NW9A 5KMGP 3EVYA 3PUQA 2VL8A 1BR4A 2KWHA 2EHOC 2XTLA 4ERRA 3ZEFB 3CQXC 4AQFA 2L3LA 1B7TA 2LOSA 3AB3B 5HXEA 4KUMB 3UUXB 2X0LB 2BVMA 2X66A 2RP4A 2CCQA 2X67A 4GK5E 1UCUA 1S94A 4CQIA 1UX5A 2EHOA 4H9RC 4O8SA 1MIVA 4HFVA 4IE7A 2V7JA 2LE8A 3ZYMA 2W0GA 3ZYKA 4ADZA 2P9BA 4XAXB 5JREA 2XASB 3ANWA 3PU8A 4MLKA 1MMAA 4PNIA 4ISTA 4O2AE 2LSYA 2MBGA 5JDQA 5L3GB 4X1KE 2YEVC 3KV4A 3DJBA 3WAKA 3MACA 2Q9QD 3F31A 3LK2B 2HH7A 5A1LA 4HTEA 3ZLIA 2W63A 4QXBB 2I59A 5BMVE 3EDUA 1WR6A 2VWAA 3WI3A 2ZM0A 3UFEA 3ETUA 3UTKA 1ZV4X 2N1GA 2KLQA 4K0UA 5EZYE 4ISSA 2VKJA 5HWYA 2XAFB 3E08A 4EYYR 3PUSA 5JR9C 5LJNA 2H7OA 2DCFA 4NUUA 1D1AA 3KV6A 5FY1A 4H9PC 5LHHB 4ZHQE 3C51A 2ZLYA 2CWYA 3AVRA 1V9DA 4I55E 5LGUB 2XUEA 5JR9A 4I50E 3GN5A 5FXWA 3K3NA 1D0XA 4TUYE 4ZI7E 5DJQC 4QXHB 4YJ2E 5JRCB 2Z6EA 4TV9E 2NP9A 2V26A 5L3FB 3PTRB 5HWXA 2K5BB 4O4IE 2H7VC 3HKEE 2N2NA 5LXTE 2CLYC 3HKDE 2DWGA 3NRXA 1NWMX 3PUGA 4B6XA 4G63A 4GK0E 1HG5A 5FYMA 1Y64B 2CMRA 3J7Yq 3AA1B 3GWHA 2E8IA 2A72A 1D1CA 3EUHA 2XHEB 1YW0A 2LSJA 3VU7H 2UXXB 2YU2A 3O4XE 2LHNA 4CXWA 3PUAA 4HEAA 5JDLA 2KXPB 3BK9A 4IE6A 3LJCA 3LBXB 4EAHA 3IF8B 4CXYA 2OA5A 4N78D 5FXVA 2LJLA 3IHRA 5HYAA 3MA9A 3OBVE 2DWKA 4JUYA 3SOLA 3C50A 5EK4A 1OWAA 2CEAA 4O4LE 4DVDA 4AI6A 1WRDA 4H9SE 4MBQA 4H9QC 3LG7A 1QSDA 3R84B 2J1DG 1HCIA 2V7MA 3L3PA 4WBNE 5JDFA 3ZC0A 3MK7C 3RRWA 3GA8A 5FY7A 3Q5WA 4ILUA 4JLEA 3L09A 5L2LA 3W15B 3RC3A 1H7CA 4ZI3D 1MIWA 4E7ZA 5H6QB 2W61A 3KBTA 3PU3A 4BA9A 5JDMA 3KV5A 2NW8A 4DMWA 4QKNA 2WMOA 2LHRA 2CXDA 2Y8DA 3MZKB 4AQGA 4F6RC 3MXZA 2NTXA 3I9WA 3BQIA 3ZMVB 4OFZA 5H6RB 5LGTB 4TV8E 1BR2A 2JRKA 4JEUB 2LOPA 1IJ6A 5DABA 5JRCA 4ZI2D 2RA1A 1O3XA 2CA5A 3ZPOA 3KV9A 3ZCIA 1LRZA 5LBMA 2H3RA 4C91A 2PFVA 1LKXA 4MFRA 3NZQA 4IGUA 1YKEB 4TZ4C 2ZMAA 1BR1A 3KFWX 3CWZB 5F8PA 5IYZE 2BDEA 2CLYB 2E9XB 2ES0A 4GYSA 4PK4A 3PURA 4L0RA 3HR0A 4YLHA 1E1HB 4Z8XA 4CXXA 5EK3A 2YINA 3E0ZA 4DNDA 4DBQA 4UXNB 4AKGA 3AAAB 1VOMA 3BQLA 3UUNA 2KNDA 4UVCB 4MALA 1QUUA 2CE7A 3LBXA 3O9XA 5IHYA 1MMGA 5LYJE 4PJMA 4PFOA 4PJJA 3UT5E 4DBRA 4JEHB 3AA7B 2KINB 1G73A 5HXHA 1YKHB 2EHOD 4X1IE 3T8OA 3VHLA 4DO0A 3CX8B 4H9OC 3J9X1 5HXSA 2VKOA 2WMNA 3N9MA 1IZNB 1HG2A 3HKCE 1FMWA 2KT9A 3N5LA 4OHFA 2ACXA 3KVBA 3IEEA 4HGAA 5JDGA 2X9HA 4XZCA 2JMKA 3AA6B 3U3IA 4EXTA 4QXCB 4H63V 2IAKA 2X9WA 4C90A 5LP6E 3KINB 3N9PA 3I1AA 2GK9A 5HXCA 4H9NC 3CQCB 3R6NA 2WWUA 2NWBA 4X20E 1MNEA 3HKBE 3K3QC 3ZMZB 4A56A 5HXRA 3ZMSB 4ANJA 4WNKA 3I0QA 3UULA 3N2KE 1T98A 2SPCA 5LHGB 1ZKEA 4CZZB 3N9OA 4IE5A 2HPJA 2E9XC 2MOZA 3V5SA 2UXNB 3U78A 2MTQA 2LM9A 3PE0A 4MHCA 4UVBB 4HKAA 4WBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPF A; 
#chains in the Genus database with same CATH topology
 4PW8 A;  2Y48 B;  1D0Y A;  2ACZ A;  5LBQ B;  3ZN0 B;  2L8K A;  3EAB A;  5M4Y A;  3ZJ1 A;  1US7 B;  4BJM A;  5AQF B;  4LF7 T;  3AE9 A;  2LKH A;  4Z91 A;  3HL6 A;  3B13 A;  5C8Y E;  1L0V A;  4YJ3 E;  2ZM2 A;  2D2S A;  2NOX A;  1W9R A;  2V7L A;  2WU2 A;  4P09 A;  4IDZ A;  1VRB A;  1CHU A;  3JC6 D;  4UV9 B;  5AFU L;  2C5K T;  2Y6X A;  5AQN B;  2ZM8 A;  3H37 A;  4ILB A;  3Q5D A;  3CX6 B;  4P0A A;  3KVA A;  1KEY A;  5C2T A;  4EYU A;  2YU1 A;  2IC9 A;  1U4Q A;  2XQA A;  3ZYL A;  1HS7 A;  3AE8 A;  3F57 A;  1SHZ C;  4DR2 T;  4DV6 T;  2I0M A;  3AEB A;  3OYX A;  2W00 A;  2Q9Q A;  5ADX L;  5ABF B;  2KMF A;  1T72 A;  3AAI A;  2XQ9 A;  3EDV A;  4FJO A;  4EOZ B;  2PG8 A;  4KBM B;  4HFI A;  3CPZ A;  4NUV A;  1W0B A;  2LRL A;  4FI5 A;  1MND A;  2WAU A;  3A5X A;  4CI3 B;  1W09 A;  2NW7 A;  2K9A A;  2VB6 A;  4JBW F;  1FEW A;  5TAO A;  4UEL A;  4O4J E;  3BQK A;  1CUN A;  5CA1 E;  3LK3 B;  4IIJ E;  1Z8U A;  2WZI A;  4TX5 A;  2BBH A;  5AQP B;  4IDP A;  5CA0 E;  3ZMT B;  2B1E A;  3V5U A;  4X66 T;  4UIG A;  4YTM A;  3TLT A;  3RYI E;  1SUM B;  4WYV A;  3OTO T;  5L3D B;  3LDQ B;  4QHO A;  4UF0 A;  3VRB A;  3LFM A;  4NPP A;  2FJA A;  1N36 T;  4PFP A;  3AA0 B;  5BR8 T;  2HPL A;  4TWH A;  3AE4 A;  4UEM A;  3PUV F;  4F8H A;  1ZHC A;  5C3J A;  1IAP A;  3E22 E;  4LMK A;  2BKO A;  1LVF A;  2CBI A;  4TNV A;  4PK5 A;  1FIO A;  3UFG A;  3AAE B;  2HN2 A;  5F3J A;  2DHR A;  1AJ3 A;  3GN5 B;  3SFE A;  5FXX A;  2LM2 A;  3RIU C;  3P7I A;  2WP9 A;  3CQX C;  4AQF A;  2LOS A;  4JI0 T;  5LB7 B;  4CQI A;  4GK5 E;  3UQ4 A;  2XQ5 A;  2EHO A;  2H89 A;  4O8S A;  1MIV A;  4HFV A;  2V6Y A;  2P9B A;  3PU8 A;  4MLK A;  1YQ4 A;  1XDP A;  2F4V T;  4X1K E;  5AQI B;  2Q9Q D;  3F31 A;  3LK2 B;  5A1L A;  3ZLI A;  2W63 A;  5BMV E;  2VWA A;  3K1S A;  3ETU A;  4TWD A;  2W66 A;  1ZV4 X;  4K0U A;  4ISS A;  2VKJ A;  5HWY A;  4NUU A;  1D1A A;  3KV6 A;  4X62 T;  4ZHQ E;  3AVR A;  4I55 E;  4A97 A;  3VRA A;  5JR9 A;  4IDQ A;  2FJD A;  3K3N A;  4TUY E;  2Z6E A;  4TV9 E;  5L3F B;  3PTR B;  3FZK B;  3HKE E;  2N2N A;  3NRX A;  4GK0 E;  2CMR A;  3AA1 B;  4IDO A;  2UUA T;  2A72 A;  1D1C A;  2BG9 B;  2XHE B;  2YU2 A;  4TNW A;  3PUA A;  1IBL T;  1KFY A;  5FXV A;  4LFA T;  5HYA A;  4H9S E;  1SE7 A;  1ZP0 A;  4JI4 T;  3RQU A;  3R84 B;  2J1D G;  3ZC0 A;  3GA8 A;  5HCJ A;  5FY7 A;  2UXC T;  2V5C A;  4P1N A;  4DV2 T;  4E7Z A;  5H6Q B;  3KBT A;  5JDM A;  1HNW T;  2NW8 A;  4QKN A;  5HEJ A;  1R8I A;  3MZK B;  5CGM A;  3MXZ A;  3EHZ A;  5H6R B;  5LGT B;  2JRK A;  2FUP A;  4LML A;  5JRC A;  1O3X A;  2CA5 A;  4HFH A;  4C91 A;  4I0U A;  1LKX A;  4MFR A;  4IGU A;  2B76 A;  4GYS A;  5AQS B;  2BBJ A;  4AKG A;  1VOM A;  3O9X A;  3UT5 E;  4DBR A;  4DUZ T;  2EHO D;  3VHL A;  3J9X 1;  3N9M A;  1IZN B;  3NWI A;  3N5L A;  3AXJ A;  2ACX A;  2UU9 T;  2X9H A;  3P50 A;  4C90 A;  1Y01 A;  3KIN B;  3I1A A;  5HXC A;  3R6N A;  2M6I A;  4X20 E;  3I0Q A;  1GQE A;  1YXR A;  2FBW A;  2SPC A;  5LHG B;  4CZZ B;  4IE5 A;  2HPJ A;  2MOZ A;  3V5S A;  2LM9 A;  4IT4 A;  4HKA A;  5L3B B;  4QH5 A;  5JDH A;  4B3R T;  2E9X A;  4YSY A;  2BZB A;  3CX7 B;  3ZJ2 A;  3I9Y A;  3TLW A;  3C64 A;  3RC8 A;  3O1H A;  4HFE A;  3UU5 A;  5CFB A;  3DP7 A;  2DI4 A;  1WLX A;  1J5E T;  3KBU A;  4ZS3 A;  3C4X A;  5J2U E;  2K24 A;  2XAH B;  1T7S A;  4B3M T;  1I6Z A;  2HHH T;  1WR0 A;  2DLR A;  2YOE A;  3T1H T;  3FZF B;  1M7K A;  5J1G A;  2CHO A;  3OPC A;  4OK0 A;  3QK6 A;  3FBZ A;  3H3A A;  4U74 A;  5EK2 A;  4KMC A;  1IJ5 A;  1E7P A;  5FY0 A;  2NTY A;  1KNZ A;  4OYK A;  4EV6 A;  3NZP A;  3AVS A;  5JDN A;  2BS4 A;  3ZC1 A;  3P4Q A;  1WCR A;  1G8X A;  2VKD A;  2PBI A;  2XSB A;  3P8C D;  2WCA A;  2VUR A;  3DTO A;  4PJL A;  4AKR B;  1IBM T;  4LFB T;  5AQT B;  4YY3 T;  1J5W A;  3X1D A;  3ONX A;  4U72 A;  3C4Z A;  5L4H A;  3K8P C;  4KP3 C;  2C5I T;  3AE5 A;  4H63 H;  4HFB A;  5AQJ B;  3NBX X;  2WBL A;  3Q2M A;  2FJE A;  3CKD A;  4DUY T;  4Q25 A;  4U7Y A;  4ASK A;  2X68 A;  1X79 A;  3B57 A;  2WDQ A;  3TKL B;  3N9Q A;  3WAJ A;  2DNX A;  3ETV A;  1JNZ A;  4XBF B;  2C0S A;  2YK0 A;  2M6B A;  5J2T E;  5DQW A;  2L9Q A;  2C5J A;  2E9X D;  4WW0 A;  3SWH A;  4DR1 T;  3FXE B;  3RIA A;  3QUJ A;  1U5P A;  3PDY A;  1BR0 A;  3JC6 C;  3OKQ A;  2R6G F;  3RH3 A;  4ZI2 C;  5FP3 A;  2QA7 A;  5DQV A;  2M67 A;  5LA6 E;  5AQH B;  2XAJ B;  4KI0 F;  4EEB A;  3OYZ A;  1DU2 A;  4IE4 A;  3RYF E;  5ETW A;  2ODV A;  4CI1 B;  1EZ3 A;  1D0Z A;  4PK6 A;  2BVL A;  3F2E A;  1HTJ F;  4EGW A;  5FVL A;  1HF8 A;  2NW9 A;  4HWD A;  4ERR A;  2W67 A;  3ZEF B;  2L3L A;  1YQ3 A;  3AB3 B;  5HXE A;  5HCM A;  3TLV A;  3UUX B;  2X0L B;  3UQ7 A;  2RP4 A;  1UCU A;  3RIF A;  2V7J A;  2X0H A;  3ZYM A;  5JTG A;  4ADZ A;  4YHH T;  2XAS B;  3ANW A;  4HFC A;  2MBG A;  5L3G B;  2YDR A;  4DR3 T;  2YEV C;  2CPT A;  2HH7 A;  3EAM A;  4LF4 T;  3UFE A;  4HWH A;  2E5L T;  2N1G A;  5FKY A;  2XAF B;  3PUS A;  2DCF A;  4JI6 T;  2OV9 A;  4H9P C;  1V9D A;  4U2Z A;  2XUE A;  2J4G A;  2BG9 E;  4I50 E;  2KSR A;  4K0K T;  2XJ7 A;  2K5B B;  2XQ7 A;  2H7V C;  3HKD E;  3PUG A;  4G63 A;  4LFC T;  5FYM A;  4YXD A;  3J7Y q;  1X9B A;  4DV0 T;  3B5M A;  3FZL B;  4CN1 A;  5JDL A;  1XZY A;  3LBX B;  2OA5 A;  2WDR A;  3RGL A;  3IHR A;  3MA9 A;  2DWK A;  3C50 A;  5EK4 A;  1OWA A;  4UR9 A;  4A98 A;  4MBQ A;  3LG7 A;  3RRW A;  3PV0 F;  3L09 A;  5L2L A;  3W15 B;  2HN1 A;  3RC3 A;  1H7C A;  1W0A A;  4DV5 T;  2W61 A;  4DMW A;  4DV4 T;  2WMO A;  2LHR A;  2Y8D A;  2NTX A;  3I9W A;  3BQI A;  3ZMV B;  4OFZ A;  2IIU A;  4TV8 E;  1BR2 A;  3ZSS A;  3KV9 A;  3FZM B;  2BG9 C;  4JI3 T;  2IHR 1;  1HNZ T;  3NZQ A;  4HWF A;  1YKE B;  1VCS A;  3JAF A;  2BDE A;  2ES0 A;  4PK4 A;  3HR0 A;  4GKK T;  5EK3 A;  2YIN A;  3UUN A;  3EI0 A;  2KND A;  2VL0 A;  1QUU A;  3H3M A;  5IHY A;  5LYJ E;  4PFO A;  4WZX A;  3T8O A;  4DO0 A;  3AEE A;  4U7I A;  2VKO A;  5ABE A;  1FMW A;  4OHF A;  1IBK T;  4ZZC A;  4XZC A;  3AA6 B;  4EXT A;  4QXC B;  3AEF A;  1MNE A;  3ZMZ B;  3ZMS B;  4ANJ A;  3ZT7 A;  3N2K E;  5FL0 A;  2UXN B;  3PE0 A;  4MHC A;  4UVB B;  3LSV A;  2A9U A;  4WBO A;  4O4H E;  4B3T T;  2V1D B;  4M1P A;  5LJM A;  2IC6 A;  2NR4 A;  1J1J A;  3RKG A;  5LMU T;  2I6H A;  3PUZ F;  3O1I A;  4JI5 T;  5HEG A;  2Q9Q B;  2CXF A;  2X51 A;  3PUW F;  1MMN A;  4U3C A;  1S35 A;  4ILA A;  2ODU A;  4TN7 B;  1OED A;  3P4R A;  2XAQ B;  2LEH A;  2J62 A;  5LOV E;  2N9D A;  1N32 T;  4DR7 T;  1NEK A;  3KDS E;  4AKH A;  1QLB A;  1HNX T;  2XQ8 A;  5LG4 A;  4HE8 A;  2LLY A;  3ZCJ A;  4COF A;  4DV7 T;  1MIY A;  3AE3 A;  2V8S V;  3S4U A;  1Z0P A;  2KWI B;  4AQF C;  4KX6 A;  3AE7 A;  4DMV A;  2QRX A;  1UX4 A;  3Q9D A;  1XDO A;  2FJB A;  4ZEY A;  4I4T E;  4IL9 A;  4AIU A;  2A3D A;  3IBP A;  4UF0 B;  4ZOL E;  2WSS V;  2RPA A;  1YD8 G;  4P0B A;  2JMH A;  4G2A A;  1JNR A;  3ZT5 A;  5LCY A;  3ZMU B;  4BAY B;  3CQG B;  5AQU B;  3P4W A;  1HX8 A;  5AQO B;  2XM2 A;  1M62 A;  2XQ3 A;  2YDQ A;  2V7K A;  2V6X A;  3ZKR A;  4GKJ T;  4EZH A;  4QWN B;  3AE2 A;  1WYB A;  2CWO A;  4UVA B;  3D0T A;  1ZEE A;  3MJX A;  4YTP A;  2IW5 B;  2WY2 A;  2UXB T;  1FMV A;  2XAG B;  2WM9 A;  1FJG T;  3VKH A;  4CN4 A;  5AQG B;  2D0T A;  3UU8 A;  5KXJ A;  4NXN T;  3PJA J;  4J2C A;  3UUB A;  3SRZ A;  2EHO B;  4ZI3 C;  4NXM T;  3AEC A;  4V1A v;  2X9Y A;  2CRB A;  5FXZ A;  5CB4 E;  2LSI A;  3QB5 A;  2V6Y B;  3QOF A;  5ABF A;  3LK4 2;  3CVR A;  2XQ6 A;  4GOU A;  2JPF A;  3QC9 A;  5KX5 E;  1XMQ T;  1SA0 E;  3JCF A;  3RPU A;  5HAX A;  4YFS A;  4CI2 B;  4BJN A;  4EIW A;  4KHP T;  3SS1 A;  5L3C B;  2W62 A;  2XY8 B;  2VK9 A;  3UUM A;  4GYR A;  1OXZ A;  4PAG A;  2PJQ A;  1NAF A;  5LHI B;  2LSK A;  5JR9 B;  4X5T A;  4UV8 B;  4DR5 T;  2D0U A;  1NEN A;  3UU4 A;  2KWH A;  2JQ9 A;  3ONL C;  2BVM A;  2CCQ A;  2X67 A;  1S94 A;  1UX5 A;  4AQY T;  4IE7 A;  2LE8 A;  4XAX B;  5JRE A;  3TLU A;  1MMA A;  5AQQ B;  3PUY F;  2WWV A;  4IST A;  4O2A E;  4YTN A;  5AQM B;  5JDQ A;  4LF5 T;  3WAK A;  3MAC A;  3PUX F;  1OED B;  2I59 A;  2E2A A;  1WR6 A;  3WI3 A;  2VQE T;  2KLQ A;  5LG3 A;  4U31 A;  4CN6 A;  2H7O A;  2YDS A;  5AQL B;  1HX1 B;  5FY1 A;  1XNR T;  5LHH B;  3C51 A;  2J47 A;  2IML A;  3GN5 A;  2W2U A;  4ZI7 E;  5DJQ C;  4QXH B;  4YJ2 E;  5JRC B;  2AXD S;  5HWX A;  4O4I E;  5LXT E;  2DWG A;  1NWM X;  4B6X A;  3VR9 A;  3GWH A;  2E8I A;  3EUH A;  3P4S A;  5HEU A;  3AE1 A;  2LSJ A;  2UUB T;  2LRK A;  4HEA A;  3RF1 A;  2KXP B;  2XQ4 A;  4EAH A;  3IF8 B;  4N78 D;  4U2Y A;  3SOL A;  2CEA A;  4O4L E;  1KNR A;  3L3P A;  2UUC T;  3RHW A;  3MK7 C;  3AXJ B;  3Q5W A;  2QVA A;  4B3S T;  3PU3 A;  3RLF F;  4BA9 A;  4F6R C;  4AQG A;  5IWA T;  4Z90 A;  1IJ6 A;  5DAB A;  3ONJ A;  4ZI2 D;  2RA1 A;  3QB5 K;  5CJ5 A;  5LBM A;  2H3R A;  2PFV A;  3RIU A;  2ZMA A;  1BR1 A;  2K3W A;  2OLT A;  3CWZ B;  2E9X B;  3PJA A;  2MPK A;  4L0R A;  2BG9 A;  4CXX A;  3E0Z A;  4DND A;  4DBQ A;  3AAA B;  3BQL A;  4UVC B;  4MAL A;  2JQH A;  2CE7 A;  4DID B;  1MMG A;  3JAE A;  4PJM A;  3AA7 B;  2KIN B;  1G73 A;  5HXH A;  4X1I E;  3CX8 B;  3RI5 A;  5HXS A;  5J0Z A;  1HG2 A;  4DR6 T;  3IEE A;  4HGA A;  5JDG A;  2JMK A;  3U3I A;  5FVK A;  4U33 A;  2IAK A;  3L8R A;  5LP6 E;  3N9P A;  2GK9 A;  4H9N C;  3CQC B;  2WWU A;  2NWB A;  4YSX A;  1N33 T;  3HKB E;  3K3Q C;  4WNK A;  1T98 A;  5FL1 A;  1ZKE A;  3AEA A;  4DV1 T;  2MTQ A;  4LF6 T;  5LNK A;  4EZ4 A;  3HA4 A;  1LVK A;  3N9N A;  3C4W A;  4ZXL A;  2JQK A;  1WFD A;  3N9L A;  3RKO A;  1KF6 A;  4GIW A;  5HEH A;  2WQY A;  3NVO A;  4JYA T;  2XZE A;  2VKH A;  3RQW A;  5KDM C;  4HWI B;  3MKD A;  4L9I A;  5LGN B;  3A8Y C;  2QGS A;  3GMI A;  4LF9 T;  4IHJ E;  3NRY A;  4DV3 T;  4IRE A;  4AKI A;  3AED A;  3N2O A;  2CM0 A;  4I43 B;  4YSZ A;  2MAW A;  3UU6 A;  3Q5E A;  1KNP A;  4X1Y E;  4EB6 E;  2D9D A;  5E0O A;  3I0O A;  3ZT6 A;  4IDN A;  2VVN A;  3VR8 A;  3FXD B;  4AXP A;  3UU3 A;  4O2B E;  2Q9Q C;  2VQF T;  3RRC A;  3RX6 A;  4QH4 A;  5JQG E;  2X0Y A;  1I94 T;  3L39 A;  2E5V A;  5HEO A;  3FHN A;  1XWM A;  4ZS2 A;  1VCT A;  5FMN A;  2XM1 A;  4QX7 B;  3G06 A;  1D1B A;  4X64 T;  2MYS A;  2UXD T;  2XSA A;  1N34 T;  2K48 A;  1KK7 A;  4OYJ A;  3ZN1 B;  2JQQ A;  3P4P A;  4TWF A;  1MMD A;  1WYC A;  4JI1 T;  4L5G A;  5JVD E;  4JI2 T;  5AQK B;  3C98 B;  3CK6 A;  3FB2 A;  5FNV E;  3M65 A;  2VVS A;  3VKG A;  4HN9 A;  2G0U A;  5GON E;  3RYH E;  2LSG A;  4QX8 B;  4PJN A;  2A2F X;  3AE6 A;  4IE0 A;  3JAD A;  5L3E B;  3K3O A;  4LMJ A;  4YHJ A;  1HFA A;  2KZ7 B;  5L4E A;  3IA3 A;  3OJA A;  2D5U A;  3Q5X A;  3ANW B;  3ABV A;  3CML A;  4E7S A;  2LT3 A;  3NKZ A;  1ZOY A;  5AQV B;  3HI2 A;  2BKP A;  4HFD A;  2CXL A;  2XQY A;  1UUS A;  4AKL A;  3N2G E;  2JJ9 A;  2CBJ A;  1XNQ T;  3FBL A;  2H88 A;  3O1J A;  3RYC E;  4A5X A;  3M3Z B;  2VAS A;  2BKN A;  4JI7 T;  5JH7 E;  4AIS A;  3ESL A;  2ZM6 T;  2CHN A;  2V7I A;  2X9X A;  5KMG P;  3EVY A;  3PUQ A;  2VL8 A;  5F5W A;  1BR4 A;  2EHO C;  2XTL A;  4JI8 T;  1B7T A;  3TLS A;  4OX9 T;  2JIW A;  2WU5 A;  4KUM B;  2X66 A;  4H9R C;  1OED E;  2W0G A;  1XMO T;  3ZYK A;  4NIQ A;  4PNI A;  2LSY A;  2WDV A;  2PTF A;  3KV4 A;  3DJB A;  4HTE A;  4QXB B;  3QNU A;  3EDU A;  2YKS A;  2WZH A;  2ZM0 A;  3UTK A;  3CIR A;  5EZY E;  4EYY R;  5LJN A;  3E08 A;  5JR9 C;  3SFD A;  2ZLY A;  2CWY A;  5LGU B;  2LKG A;  5FXW A;  1E2A A;  1D0X A;  5L47 A;  2NP9 A;  2V26 A;  2CLY C;  1HG5 A;  1Y64 B;  1YW0 A;  3VU7 H;  2UXX B;  3O4X E;  2LHN A;  4CXW A;  1HR0 T;  5AQR B;  3BK9 A;  4IE6 A;  3LJC A;  4LF8 T;  4CXY A;  2LJL A;  3OBV E;  4JUY A;  4DVD A;  4AI6 A;  1OED C;  1WRD A;  2AE9 A;  1UGO A;  4H9Q C;  1QSD A;  1HCI A;  1UK5 A;  2V7M A;  4WBN E;  5JDF A;  4ILU A;  4JLE A;  4ZI3 D;  1MIW A;  2WS3 A;  4KHZ F;  3KV5 A;  5LMN T;  2CXD A;  3OVU A;  4QH1 A;  2BS3 A;  4JEU B;  1T8B A;  2LOP A;  3ZPO A;  3ZCI A;  1LRZ A;  2XPK A;  2WB5 A;  4TZ4 C;  3T1Y T;  3KFW X;  5F8P A;  5IYZ E;  2CLY B;  3PUR A;  2BS2 A;  4DR4 T;  4YLH A;  1E1H B;  4Z8X A;  3A7M A;  4UXN B;  4JV5 T;  1UUR A;  2DL1 A;  3LBX A;  2QYW A;  4PJJ A;  3AEG A;  4JEH B;  2V5D A;  5ABG A;  1YKH B;  4IL4 A;  4H9O C;  2YN6 A;  4HWC A;  3ZST A;  4EED A;  2WMN A;  3HKC E;  2KT9 A;  3KVB A;  4ILC A;  4ZZB A;  2IDO B;  4H63 V;  2X9W A;  3FZH B;  4X65 T;  4A56 A;  5HXR A;  3UUL A;  5IUX A;  4YT0 A;  2IUB A;  3N9O A;  2E9X C;  3U78 A;  2W4X A;  5ABH A; 
#chains in the Genus database with same CATH homology
 5L3B B;  4O4H E;  5LNK A;  4EZ4 A;  2V1D B;  5JDH A;  3HA4 A;  1LVK A;  4PW8 A;  2E9X A;  2Y48 B;  1D0Y A;  5LBQ B;  3N9N A;  4M1P A;  5LJM A;  2IC6 A;  3C4W A;  3ZN0 B;  2L8K A;  2BZB A;  3N9L A;  5M4Y A;  3RKO A;  3CX7 B;  3ZJ1 A;  3ZJ2 A;  1US7 B;  3I9Y A;  3O1I A;  3C64 A;  3RC8 A;  4BJM A;  3O1H A;  4GIW A;  2Q9Q B;  2CXF A;  2X51 A;  1MMN A;  3DP7 A;  2DI4 A;  3HL6 A;  1S35 A;  3B13 A;  2ODU A;  5C8Y E;  4TN7 B;  1WLX A;  3KBU A;  4ZS3 A;  2VKH A;  3C4X A;  5KDM C;  4YJ3 E;  5J2U E;  2ZM2 A;  2XAQ B;  2K24 A;  2XAH B;  3MKD A;  4L9I A;  5LGN B;  2LEH A;  2QGS A;  3GMI A;  2D2S A;  2NOX A;  5LOV E;  2DLR A;  2N9D A;  2V7L A;  4IHJ E;  3NRY A;  4P09 A;  4IDZ A;  5J1G A;  4AKI A;  3KDS E;  1VRB A;  4AKH A;  3N2O A;  3JC6 D;  4OK0 A;  2CM0 A;  3QK6 A;  4I43 B;  4UV9 B;  3FBZ A;  3H3A A;  4U74 A;  5LG4 A;  5EK2 A;  4HE8 A;  4KMC A;  3ZCJ A;  5AFU L;  1IJ5 A;  2C5K T;  4X1Y E;  2Y6X A;  4EB6 E;  2ZM8 A;  3H37 A;  5FY0 A;  5E0O A;  3I0O A;  3CX6 B;  4P0A A;  1MIY A;  2NTY A;  3KVA A;  3S4U A;  1Z0P A;  2KWI B;  4AQF C;  1KNZ A;  3FXD B;  4AXP A;  4EYU A;  2YU1 A;  4DMV A;  2IC9 A;  4O2B E;  1U4Q A;  4OYK A;  1UX4 A;  3ZYL A;  1HS7 A;  2Q9Q C;  3RRC A;  3NZP A;  3AVS A;  3F57 A;  3RX6 A;  5JQG E;  3Q9D A;  5JDN A;  1SHZ C;  3ZC1 A;  3FHN A;  4ZS2 A;  3OYX A;  4I4T E;  2A3D A;  1G8X A;  3IBP A;  5FMN A;  4QX7 B;  2W00 A;  2Q9Q A;  2VKD A;  4UF0 B;  4ZOL E;  2PBI A;  2WSS V;  5ADX L;  1YD8 G;  4P0B A;  2JMH A;  1D1B A;  3P8C D;  4G2A A;  2KMF A;  3DTO A;  2MYS A;  4PJL A;  4AKR B;  3AAI A;  3EDV A;  4FJO A;  5LCY A;  4EOZ B;  3ZMU B;  2K48 A;  3ONX A;  4BAY B;  4U72 A;  3CQG B;  1KK7 A;  3C4Z A;  4OYJ A;  3ZN1 B;  2JQQ A;  1MMD A;  1WYC A;  2PG8 A;  4KBM B;  1HX8 A;  3K8P C;  3CPZ A;  4NUV A;  4L5G A;  4KP3 C;  2C5I T;  4FI5 A;  1MND A;  5JVD E;  4H63 H;  2V7K A;  3C98 B;  3NBX X;  2WAU A;  2WBL A;  3A5X A;  3Q2M A;  4CI3 B;  4EZH A;  2NW7 A;  3CKD A;  3FB2 A;  2K9A A;  5FNV E;  2VB6 A;  1FEW A;  3M65 A;  3VKG A;  4HN9 A;  4QWN B;  4UEL A;  5TAO A;  4O4J E;  3BQK A;  4ASK A;  2X68 A;  1WYB A;  1X79 A;  2CWO A;  3B57 A;  4UVA B;  2G0U A;  1CUN A;  3D0T A;  5GON E;  5CA1 E;  3RYH E;  3LK3 B;  2LSG A;  1ZEE A;  3MJX A;  4IIJ E;  4QX8 B;  4PJN A;  3TKL B;  2A2F X;  4TX5 A;  3N9Q A;  3WAJ A;  2DNX A;  2IW5 B;  4IE0 A;  3ETV A;  1FMV A;  5CA0 E;  3ZMT B;  2C0S A;  4XBF B;  2YK0 A;  2XAG B;  2WM9 A;  3VKH A;  2B1E A;  3V5U A;  2D0T A;  4UIG A;  5L3E B;  3K3O A;  5J2T E;  4J2C A;  3RYI E;  5DQW A;  3SRZ A;  2EHO B;  4ZI3 C;  5L3D B;  4V1A v;  4YHJ A;  2X9Y A;  1HFA A;  2L9Q A;  2C5J A;  5FXZ A;  2E9X D;  5CB4 E;  4WW0 A;  3SWH A;  2KZ7 B;  2LSI A;  3FXE B;  4QHO A;  4UF0 A;  3LFM A;  3OJA A;  2D5U A;  3Q5X A;  3ANW B;  3QUJ A;  3LK4 2;  1U5P A;  3CVR A;  4PFP A;  3PDY A;  1BR0 A;  3CML A;  4GOU A;  4E7S A;  3AA0 B;  2JPF A;  3QC9 A;  2HPL A;  2LT3 A;  3JC6 C;  3OKQ A;  5KX5 E;  4UEM A;  3RH3 A;  1SA0 E;  4ZI2 C;  5FP3 A;  3RPU A;  1ZHC A;  2QA7 A;  5HAX A;  4YFS A;  3HI2 A;  5DQV A;  4CI2 B;  2M67 A;  1IAP A;  2CXL A;  2XQY A;  3E22 E;  3SS1 A;  5LA6 E;  4BJN A;  2W62 A;  4EIW A;  5L3C B;  2XAJ B;  2VK9 A;  4AKL A;  3N2G E;  3OYZ A;  1LVF A;  2JJ9 A;  3UUM A;  4IE4 A;  4GYR A;  1OXZ A;  4PK5 A;  3RYF E;  5ETW A;  2ODV A;  3FBL A;  1FIO A;  4PAG A;  3AAE B;  4CI1 B;  1EZ3 A;  2PJQ A;  2DHR A;  1NAF A;  5F3J A;  1D0Z A;  3O1J A;  5LHI B;  1AJ3 A;  4PK6 A;  2LSK A;  3RYC E;  5JR9 B;  2VAS A;  3GN5 B;  2BVL A;  5FXX A;  4UV8 B;  3F2E A;  1HTJ F;  2D0U A;  3P7I A;  5JH7 E;  3ESL A;  1HF8 A;  2V7I A;  2X9X A;  2NW9 A;  5KMG P;  3EVY A;  3PUQ A;  2VL8 A;  1BR4 A;  2KWH A;  2EHO C;  2XTL A;  4ERR A;  3ZEF B;  3CQX C;  4AQF A;  2L3L A;  1B7T A;  2LOS A;  3AB3 B;  5HXE A;  4KUM B;  3UUX B;  2X0L B;  2BVM A;  2X66 A;  2RP4 A;  2CCQ A;  2X67 A;  4GK5 E;  1UCU A;  1S94 A;  4CQI A;  1UX5 A;  2EHO A;  4H9R C;  4O8S A;  1MIV A;  4HFV A;  4IE7 A;  2V7J A;  2LE8 A;  3ZYM A;  2W0G A;  3ZYK A;  4ADZ A;  2P9B A;  4XAX B;  5JRE A;  2XAS B;  3ANW A;  3PU8 A;  4MLK A;  1MMA A;  4PNI A;  4IST A;  4O2A E;  2LSY A;  2MBG A;  5JDQ A;  5L3G B;  4X1K E;  2YEV C;  3KV4 A;  3DJB A;  3WAK A;  3MAC A;  2Q9Q D;  3F31 A;  3LK2 B;  2HH7 A;  5A1L A;  4HTE A;  3ZLI A;  2W63 A;  4QXB B;  2I59 A;  5BMV E;  3EDU A;  1WR6 A;  2VWA A;  3WI3 A;  2ZM0 A;  3UFE A;  3ETU A;  3UTK A;  1ZV4 X;  2N1G A;  2KLQ A;  4K0U A;  5EZY E;  4ISS A;  2VKJ A;  5HWY A;  2XAF B;  3E08 A;  4EYY R;  3PUS A;  5JR9 C;  5LJN A;  2H7O A;  2DCF A;  4NUU A;  1D1A A;  3KV6 A;  5FY1 A;  4H9P C;  5LHH B;  4ZHQ E;  3C51 A;  2ZLY A;  2CWY A;  3AVR A;  1V9D A;  4I55 E;  5LGU B;  2XUE A;  5JR9 A;  4I50 E;  3GN5 A;  5FXW A;  3K3N A;  1D0X A;  4TUY E;  4ZI7 E;  5DJQ C;  4QXH B;  4YJ2 E;  5JRC B;  2Z6E A;  4TV9 E;  2NP9 A;  2V26 A;  5L3F B;  3PTR B;  5HWX A;  2K5B B;  4O4I E;  2H7V C;  3HKE E;  2N2N A;  5LXT E;  2CLY C;  3HKD E;  2DWG A;  3NRX A;  1NWM X;  3PUG A;  4B6X A;  4G63 A;  4GK0 E;  1HG5 A;  5FYM A;  1Y64 B;  2CMR A;  3J7Y q;  3AA1 B;  3GWH A;  2E8I A;  2A72 A;  1D1C A;  3EUH A;  2XHE B;  1YW0 A;  2LSJ A;  3VU7 H;  2UXX B;  2YU2 A;  3O4X E;  2LHN A;  4CXW A;  3PUA A;  4HEA A;  5JDL A;  2KXP B;  3BK9 A;  4IE6 A;  3LJC A;  3LBX B;  4EAH A;  3IF8 B;  4CXY A;  2OA5 A;  4N78 D;  5FXV A;  2LJL A;  3IHR A;  5HYA A;  3MA9 A;  3OBV E;  2DWK A;  4JUY A;  3SOL A;  3C50 A;  5EK4 A;  1OWA A;  2CEA A;  4O4L E;  4DVD A;  4AI6 A;  1WRD A;  4H9S E;  4MBQ A;  4H9Q C;  3LG7 A;  1QSD A;  3R84 B;  2J1D G;  1HCI A;  2V7M A;  3L3P A;  4WBN E;  5JDF A;  3ZC0 A;  3MK7 C;  3RRW A;  3GA8 A;  5FY7 A;  3Q5W A;  4ILU A;  4JLE A;  3L09 A;  5L2L A;  3W15 B;  3RC3 A;  1H7C A;  4ZI3 D;  1MIW A;  4E7Z A;  5H6Q B;  2W61 A;  3KBT A;  3PU3 A;  4BA9 A;  5JDM A;  3KV5 A;  2NW8 A;  4DMW A;  4QKN A;  2WMO A;  2LHR A;  2CXD A;  2Y8D A;  3MZK B;  4AQG A;  4F6R C;  3MXZ A;  2NTX A;  3I9W A;  3BQI A;  3ZMV B;  4OFZ A;  5H6R B;  5LGT B;  4TV8 E;  1BR2 A;  2JRK A;  4JEU B;  2LOP A;  1IJ6 A;  5DAB A;  5JRC A;  4ZI2 D;  2RA1 A;  1O3X A;  2CA5 A;  3ZPO A;  3KV9 A;  3ZCI A;  1LRZ A;  5LBM A;  2H3R A;  4C91 A;  2PFV A;  1LKX A;  4MFR A;  3NZQ A;  4IGU A;  1YKE B;  4TZ4 C;  2ZMA A;  1BR1 A;  3KFW X;  3CWZ B;  5F8P A;  5IYZ E;  2BDE A;  2CLY B;  2E9X B;  2ES0 A;  4GYS A;  4PK4 A;  3PUR A;  4L0R A;  3HR0 A;  4YLH A;  1E1H B;  4Z8X A;  4CXX A;  5EK3 A;  2YIN A;  3E0Z A;  4DND A;  4DBQ A;  4UXN B;  4AKG A;  3AAA B;  1VOM A;  3BQL A;  3UUN A;  2KND A;  4UVC B;  4MAL A;  1QUU A;  2CE7 A;  3LBX A;  3O9X A;  5IHY A;  1MMG A;  5LYJ E;  4PJM A;  4PFO A;  4PJJ A;  3UT5 E;  4DBR A;  4JEH B;  3AA7 B;  2KIN B;  1G73 A;  5HXH A;  1YKH B;  2EHO D;  4X1I E;  3T8O A;  3VHL A;  4DO0 A;  3CX8 B;  4H9O C;  3J9X 1;  5HXS A;  2VKO A;  2WMN A;  3N9M A;  1IZN B;  1HG2 A;  3HKC E;  1FMW A;  2KT9 A;  3N5L A;  4OHF A;  2ACX A;  3KVB A;  3IEE A;  4HGA A;  5JDG A;  2X9H A;  4XZC A;  2JMK A;  3AA6 B;  3U3I A;  4EXT A;  4QXC B;  4H63 V;  2IAK A;  2X9W A;  4C90 A;  5LP6 E;  3KIN B;  3N9P A;  3I1A A;  2GK9 A;  5HXC A;  4H9N C;  3CQC B;  3R6N A;  2WWU A;  2NWB A;  4X20 E;  1MNE A;  3HKB E;  3K3Q C;  3ZMZ B;  4A56 A;  5HXR A;  3ZMS B;  4ANJ A;  4WNK A;  3I0Q A;  3UUL A;  3N2K E;  1T98 A;  2SPC A;  5LHG B;  1ZKE A;  4CZZ B;  3N9O A;  4IE5 A;  2HPJ A;  2E9X C;  2MOZ A;  3V5S A;  2UXN B;  3U78 A;  2MTQ A;  2LM9 A;  3PE0 A;  4MHC A;  4UVB B;  4HKA A;  4WBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...