5AQLB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
LGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqlB00
1I6ZA 3LDQB 1HX1B 3FZLB 4HWCA 5AQSB 5AQGB 5AQIB 5AQPB 5AQVB 4HWHA 3FZMB 5AQRB 5AQQB 5AQFB 5AQKB 4HWFA 5AQTB 5AQOB 1T7SA 5AQJB 1UK5A 3M3ZB 3FZHB 2D9DA 5AQNB 3A8YC 5AQUB 1UGOA 4HWIB 1M7KA 5AQMB 3FZKB 3FZFB 1M62A 4HWDA 5AQHB 5AQLB
chains in the Genus database with same CATH superfamily
5LBMA 3AE4A 4ZI3D 5L3FB 2BBHA 4LF8T 3PE0A 3RKGA 4IDQA 4JUYA 4ZHQE 3AXJA 3RLFF 3MK7C 2WQYA 1IBLT 4UEMA 2VKHA 2VURA 5HEUA 2A72A 1SHZC 3KBTA 3CX8B 4LFCT 1SUMB 5H6QB 3EVYA 4HWDA 2L8KA 1D0ZA 1E7PA 5FY0A 2XQ9A 4LF4T 3ZMVB 2F4VT 4E7SA 2BS3A 3AA7B 4YHJA 4AQFA 4F6RC 3ZC0A 4IL9A 3VHLA 4Z8XA 2MBGA 3RHWA 5F8PA 4HFCA 1YQ3A 4V1Av 5AQSB 4MFRA 2IC6A 3EAMA 4EZHA 5ABHA 4JBWF 2FJAA 5AQKB 3AAEB 1XDPA 3H3MA 1ZP0A 5LHGB 5AQNB 3CWZB 4LFBT 3U3IA 1IAPA 3PUXF 3AEAA 4LF7T 3AAIA 5EK4A 3PUGA 4WZXA 5FVLA 3AVSA 3FZMB 5DQVA 2RP4A 3TLTA 4YJ2E 2D0UA 2B76A 4ZOLE 3OKQA 4G2AA 4COFA 1WR6A 4AQFC 1Z8UA 3E0ZA 4IE4A 5CB4E 3FHNA 2X9HA 1X79A 3PUZF 4QX8B 5DQWA 3RIUA 3UUBA 4GYSA 4H9RC 4I0UA 2I59A 3K3OA 4KP3C 3R84B 1NENA 2X9XA 4ZZBA 1L0VA 4U33A 2CM0A 2BVLA 2BZBA 4J2CA 2WMNA 2WCAA 3PJAJ 3P4WA 2YK0A 1OWAA 1D1BA 1KK7A 2VASA 3EABA 3AEFA 2X9WA 1W0AA 4BJMA 2M6BA 3ABVA 2D5UA 3RI5A 1ZHCA 1G73A 2H7VC 2K48A 4H9SE 2KSRA 1S94A 2YU1A 2VQET 4GKKT 4HE8A 2WWVA 4UV8B 2WWUA 4WBNE 4ZXLA 3QB5A 3P7IA 3AEDA 3RPUA 3RIUC 3LDQB 5H6RB 4A5XA 1LRZA 4MHCA 3EHZA 2XSAA 4EYYR 1UCUA 3MXZA 5FXVA 4DUZT 3UU5A 2NOXA 2WM9A 5TAOA 2LT3A 3KV4A 5C2TA 1Z0PA 5AQLB 1LVFA 2NTYA 1YW0A 3UUNA 4JI6T 4FJOA 4YLHA 4CN6A 3UU4A 4TV9E 4WYVA 1MIYA 3ZMTB 2E5VA 5HYAA 4IL4A 4OFZA 2CE7A 3UT5E 1MMNA 4UVCB 2LSKA 2VK9A 2NWBA 3NVOA 2VQFT 4IHJE 5JRCB 3O9XA 2V1DB 3LG7A 5KMGP 2X51A 4UR9A 3FB2A 2XQ4A 5AQOB 2V7JA 2JQKA 4EIWA 4IE0A 3KV9A 2DWGA 3JAFA 5ETWA 3RIAA 4Z90A 2A3DA 2N2NA 2X9YA 2XQAA 3UU8A 3SOLA 3TLSA 1KNPA 2DWKA 4PK5A 4GK0E 2LM9A 4O4HE 1HF8A 2NP9A 5JVDE 1N36T 3LBXA 1FEWA 3JC6D 1XZYA 3GN5B 2QGSA 4ILAA 4NXMT 3P50A 4HWHA 3VRAA 3AE9A 4KI0F 4IE6A 3PUYF 2FJDA 3LK3B 2WSSV 2V6YA 2MAWA 4YJ3E 5HCJA 3N9PA 3VR9A 2AXDS 3C64A 4ISTA 4TNWA 3SRZA 1D1AA 3P4QA 5AQVB 3CX6B 4DO0A 2B1EA 4BAYB 4IDZA 3AE1A 4B3RT 1KFYA 1HFAA 4YT0A 2HPJA 2V7MA 1XWMA 3ZJ1A 4N78D 3HR0A 3LK2B 3K1SA 4H63V 3JADA 4I4TE 2JPFA 5CFBA 1WFDA 4JEUB 1SA0E 3ZCIA 4DR4T 5LYJE 4DV0T 5HEGA 3J9X1 3M65A 4A97A 3DJBA 2KWHA 2LHRA 4CZZB 2V7KA 3QC9A 2E9XB 1IZNB 2ZM8A 1BR2A 2C5KT 5LB7B 2W63A 1YKHB 2UXDT 2JQ9A 3ANWA 1OEDC 1HX8A 1HNWT 3ONJA 2LHNA 4YTPA 5LG4A 1Y64B 4A98A 3A5XA 4P09A 5JDMA 5BMVE 5JR9A 4KBMB 1E1HB 5AQHB 3AEBA 3BQIA 4YFSA 3I9YA 3N9LA 3HI2A 1HS7A 2OLTA 5M4YA 2JJ9A 5C8YE 4WNKA 4A56A 4L0RA 2BG9A 3ZYKA 1NEKA 2BKOA 3P4RA 5A1LA 3OVUA 2AE9A 3HKDE 3L39A 4XBFB 2Q9QC 4PNIA 4JI5T 4X1KE 5JREA 4LF5T 1J5ET 3NZPA 3PJAA 4HN9A 2CXDA 2KWIB 5EZYE 3TLVA 3WAJA 3HA4A 3AVRA 5JTGA 5JR9C 2P9BA 2CA5A 2E8IA 4QH4A 4NUVA 2NW9A 2QVAA 2BS2A 4YSXA 2BKPA 2UXNB 4TWFA 2BG9B 2XZEA 2UUCT 3PUQA 1D0XA 3ZT5A 4ASKA 3HKBE 4DBQA 5L3CB 3R6NA 3KINB 4UXNB 5CA0E 5HWXA 3LJCA 2XASB 3B57A 4UIGA 3JC6C 1HR0T 2VL0A 5L3DB 3X1DA 2CLYC 3O1IA 3MJXA 4IDOA 3ONXA 4GOUA 2VWAA 3NBXX 2Y6XA 2M6IA 3ZCJA 5HXEA 4QXCB 3QUJA 4JLEA 5AQPB 4UF0B 1LVKA 2PTFA 3SWHA 3WI3A 1BR1A 3K3NA 2DLRA 2W4XA 5FYMA 2J1DG 4ILBA 3H37A 4DV5T 2D0TA 3UQ7A 5JDGA 2OV9A 3CQCB 3ZN0B 4ZI7E 2UU9T 4IIJE 2VVSA 2V7IA 4DV7T 4AIUA 4HFDA 1MMDA 3CQGB 3Q5WA 3N9NA 1OEDE 2PG8A 5HXHA 3EI0A 3N2KE 1AJ3A 4FI5A 1KEYA 4EB6E 2CWYA 2FJEA 2Z6EA 5ABGA 3AXJB 5AQTB 3AE6A 4DV2T 4HGAA 2CWOA 4X1IE 4DR1T 4O2AE 3FZFB 5FVKA 2H89A 4KHPT 4H9NC 4ILUA 1XNRT 5KDMC 1FJGT 3AA0B 1MMAA 5AQUB 3K8PC 5LOVE 1VCTA 1VOMA 1M62A 2XAJB 2LKGA 3F31A 3F2EA 5IUXA 4EGWA 3IA3A 3ZT6A 4JI2T 4L9IA 4B6XA 5L3GB 3EDVA 3PTRB 3G06A 2X68A 1V9DA 2LKHA 2LE8A 1HG2A 1U5PA 1FMWA 1W09A 1T72A 2FUPA 3MACA 3O1JA 3CMLA 4QKNA 3KVAA 4O4LE 4DMWA 3KVBA 4PJNA 5HXRA 4HFEA 3BQKA 5AQIB 3KDSE 2W62A 2UUBT 1FIOA 3T1HT 4UELA 2I6HA 2LJLA 3UFGA 4MLKA 4EXTA 1D0YA 4DR7T 4AI6A 2M67A 3N9QA 4YSYA 2MTQA 2XUEA 1R8IA 3ETUA 2CHNA 5LG3A 2YDQA 4HWCA 4DIDB 5BR8T 1UX4A 1QSDA 2XQ7A 2WZHA 1I94T 4DMVA 4L5GA 4ZS2A 4CI3B 2G0UA 3J7Yq 4PK4A 2CBJA 2JRKA 4DR5T 3MZKB 3RYHE 3RQUA 2KZ7B 4P0BA 5JDNA 4IE7A 1UURA 2WMOA 3O1HA 4ZI2D 4LF9T 3C4WA 2QA7A 2IIUA 1N32T 4ZS3A 5J2UE 5FL0A 5LNKA 1W9RA 1O3XA 3BQLA 4K0KT 3UFEA 2FJBA 5LXTE 3GWHA 3W15B 4X20E 4DR6T 2KLQA 1NAFA 2CMRA 2Q9QD 2BDEA 3V5UA 4O4JE 4TX5A 3ZYMA 3RF1A 4YSZA 2XQ8A 4PK6A 3ZSSA 3UTKA 3NZQA 2D9DA 2ZLYA 4TN7B 5L3EB 4X1YE 2YKSA 3NKZA 3ESLA 3D0TA 2WAUA 4AKRB 5HEHA 3E22E 2K3WA 2RPAA 3JAEA 2EHOD 3AEGA 4HFBA 2BS4A 5LP6E 5HAXA 3OPCA 3LSVA 3UQ4A 4AKHA 2V5DA 4DV3T 3MKDA 3UUMA 4HFHA 3ZMZB 2H88A 2XHEB 2Y48B 3RC8A 2LSYA 4C90A 2XQ6A 2CRBA 2HN2A 2PFVA 2ZM2A 2CEAA 3FZKB 5LHIB 2L3LA 3CVRA 3UULA 5LA6E 4P0AA 4GIWA 4I55E 5JDQA 2ACZA 4B3ST 3ZN1B 1OEDA 1CHUA 5FXXA 5HWYA 5JDFA 2JMHA 3LBXB 3Q5DA 4O2BE 5IYZE 2XAGB 4ILCA 3CX7B 5LCYA 3CIRA 3RQWA 3AEEA 2V6YB 4OYJA 5GONE 1UUSA 4IREA 4Z91A 5HXSA 4TUYE 1MIWA 3A7MA 4U74A 4TWDA 5ABFA 3RYIE 5FNVE 1OEDB 4UVBB 4U2ZA 3V5SA 4NPPA 4BA9A 2Q9QA 5LGUB 2LOPA 4CN1A 2YDSA 2WBLA 2LLYA 4CI2B 3C4ZA 1S35A 4EZ4A 2E9XC 4CQIA 5L47A 4PJLA 5FL1A 4IGUA 3M3ZB 1Y01A 2UXCT 4IE5A 2XAQB 2CHOA 3OYZA 2YU2A 4U72A 2WP9A 2YN6A 3VU7H 4ZI2C 4DV4T 2WDVA 3F57A 1ZKEA 3KV5A 3QB5K 3E08A 5JQGE 3FXDB 2KMFA 2HPLA 2IC9A 3C98B 3VR8A 2EHOA 2XPKA 3TKLB 1IJ6A 2Q9QB 4YXDA 3ANWB 1WYBA 3ETVA 3ZMUB 5FY1A 2V8SV 2JQHA 2LSGA 3O4XE 4OK0A 4MBQA 3MA9A 3FBZA 4PAGA 5ADXL 2ODVA 4LMJA 5JR9B 3PV0F 4LF6T 3IBPA 2LRLA 5FXZA 1D1CA 1LKXA 5DJQC 3ZMSB 2DL1A 4KX6A 1B7TA 5L4EA 4JI4T 2XM2A 1BR4A 3RYCE 2ZMAA 1WRDA 1XMOT 2W66A 5FP3A 4KMCA 2LRKA 2WU2A 4O8SA 4K0UA 2JMKA 2EHOC 3KV6A 4U7IA 1E2AA 2WS3A 3NRXA 2WDQA 4XZCA 3AE7A 2V6XA 5AQGB 3CPZA 2LSIA 2XAHB 2CLYB 4U2YA 3C50A 2BKNA 4TV8E 2UXBT 2CPTA 3CQXC 5FKYA 4AKLA 1XDOA 3RH3A 3VRBA 4DR3T 3L8RA 3HKCE 4X66T 4EAHA 4F8HA 3AE5A 4JI1T 3AE2A 1HG5A 4CXYA 5AQJB 3A8YC 5LGNB 2E2AA 5HCMA 4Q25A 4H9OC 2MOZA 5HXCA 3FZLB 2J62A 3DP7A 5KX5E 1G8XA 4DVDA 1QLBA 2QRXA 3IHRA 2XJ7A 4HTEA 4QXBB 4OX9T 4AXPA 2NR4A 4EOZB 5IWAT 5AFUL 2IHR1 2IW5B 2WY2A 1J5WA 4BJNA 3PUSA 2H7OA 3PURA 3C4XA 5FMNA 4JYAT 3H3AA 3RC3A 3AAAB 5CGMA 2WB5A 3ZC1A 5DABA 3ZKRA 1HCIA 4X5TA 5AQRB 2J4GA 4X65T 4AQYT 4DV1T 4XAXB 5CA1E 5LJMA 2K9AA 1EZ3A 4HWIB 1M7KA 2LEHA 3QOFA 4TZ4C 1WCRA 4P1NA 2C5IT 1ZV4X 3GMIA 2PJQA 4IDNA 3T1YT 3RIFA 4I50E 2XQYA 3I9WA 1OXZA 4QH5A 3U78A 3NRYA 5JDLA 3OBVE 5F5WA 3Q5EA 3IF8B 3JCFA 1HTJF 1HNXT 2KT9A 4CI1B 1T8BA 4DUYT 4JI7T 3ZSTA 2XSBA 2XQ3A 4CN4A 4JI8T 2N1GA 3DTOA 3N5LA 2MYSA 3UUXB 2NTXA 3OYXA 5LGTB 5ABEA 2V26A 5J1GA 2KNDA 2YINA 3N2OA 5LJNA 1UK5A 4QHOA 4WBOA 2BG9E 4WW0A 2LSJA 4GYRA 2V5CA 2VKOA 1HX1B 3AA1B 4CXXA 1YQ4A 2N9DA 3QK6A 1YXRA 2VKDA 2X0YA 3PU8A 2X0LB 5JH7E 3RGLA 1H7CA 2L9QA 5AQFB 1UX5A 1ZOYA 4PFOA 1WLXA 5J0ZA 2E9XD 2RA1A 1J1JA 4AQGA 4HFIA 1KNRA 3I1AA 3ZYLA 4TNVA 2PBIA 5EK3A 2VVNA 3BK9A 2ZM6T 1GQEA 2NW7A 4PJMA 2W00A 3UU6A 4ZI3C 4PW8A 4H9QC 2H3RA 5JRCA 2YDRA 1WYCA 4OYKA 2DHRA 4DNDA 5AQMB 2A2FX 2XTLA 4QXHB 3P4PA 4YTMA 4AKIA 3RRCA 3B13A 2WZIA 2W61A 4B3MT 3Q5XA 1U4QA 2LM2A 5KXJA 2FBWA 5F3JA 2XM1A 2ES0A 2XQ5A 1HNZT 2KINB 4DR2T 2K24A 2BVMA 1BR0A 4B3TT 2WU5A 4CXWA 3PUVF 3EUHA 4HKAA 5JDHA 3GN5A 3P8CD 3SS1A 2QYWA 3OJAA 2UXXB 1T7SA 3ZLIA 4H9PC 3SFDA 3TLWA 1X9BA 2YEVC 1WR0A 4OHFA 3KBUA 1N33T 4ADZA 2GK9A 3K3QC 4DBRA 2DI4A 3HKEE 4UVAB 2X0HA 4ZZCA 5LBQB 2KXPB 1IBMT 4O4IE 4HWFA 2VKJA 4E7ZA 3I0OA 4KHZF 2MPKA 3GA8A 4YY3T 1NWMX 1ZEEA 2IAKA 5HEOA 5J2TE 2CXFA 1YKEB 5E0OA 4X64T 2JQQA 2C0SA 2CBIA 5LHHB 5FXWA 1N34T 5L4HA 4LMKA 2E9XA 4UV9B 4JV5T 3S4UA 3N2GE 2CCQA 3RKOA 3EDUA 2OA5A 4LFAT 2X66A 2VB6A 3KFWX 1US7B 2ACXA 5LMUT 1VCSA 4HEAA 3C51A 5AQQB 4C91A 2XY8B 2HN1A 4LMLA 3RYFE 1YD8G 2DNXA 4JEHB 4YTNA 1I6ZA 5LMNT 1MIVA 2W0GA 5C3JA 2LOSA 3SFEA 1IJ5A 4I43B 4EV6A 3AECA 4EYUA 1MMGA 1KNZA 1XMQT 2SPCA 2DCFA 1MNDA 2E5LT 2UUAT 4M1PA 2XAFB 4AKGA 3L09A 4ANJA 3FXEB 3PUWF 2W2UA 5L2LA 5ABFB 3ZT7A 5FY7A 1QUUA 3VKGA 5IHYA 2I0MA 3PUAA 1DU2A 1VRBA 4PJJA 2JIWA 4IT4A 3N9MA 2HHHT 3ONLC 3B5MA 3LFMA 4QWNB 4GK5E 3CKDA 2Y8DA 2ODUA 4ERRA 3I0QA 1SE7A 3OTOT 2IUBA 4NIQA 1T98A 3ZEFB 2W67A 5HEJA 4HFVA 2V7LA 3AA6B 3ZJ2A 2WDRA 3TLUA 1UGOA 2NW8A 3QNUA 1MNEA 3CK6A 4MALA 4U31A 4H63H 4PFPA 4JI0T 1JNRA 2A9UA 2BBJA 1FMVA 4YHHT 4QH1A 2EHOB 3PU3A 2VL8A 4AISA 4EEBA 2C5JA 4EEDA 4DV6T 3LK42 5L3BB 4U3CA 2HH7A 2CXLA 3Q9DA 2ZM0A 2IDOB 2X67A 3RRWA 3P4SA 4UF0A 4X62T 3PDYA 2J47A 4ISSA 4NXNT 3FZHB 1CUNA 4KUMB 4G63A 3VKHA 3FBLA 3ZPOA 2BG9C 3RX6A 4GKJT 4ZEYA 5CJ5A 2YOEA 2R6GF 3NWIA 3IEEA 3AE8A 1KF6A 3N9OA 4NUUA 2D2SA 4JI3T 3AB3B 4U7YA 3T8OA 1W0BA 3Q2MA 4IDPA 4TWHA 3AE3A 3HL6A 3UU3A 2K5BB 1JNZA 3L3PA 3WAKA 1IBKT 1XNQT 4QX7B 2IMLA 5EK2A
chains in the Genus database with same CATH topology
1I6ZA 3LDQB 1HX1B 3FZLB 4HWCA 5AQSB 5AQGB 5AQIB 5AQPB 5AQVB 4HWHA 3FZMB 5AQRB 5AQQB 5AQFB 5AQKB 4HWFA 5AQTB 5AQOB 1T7SA 5AQJB 1UK5A 3M3ZB 3FZHB 2D9DA 5AQNB 3A8YC 5AQUB 1UGOA 4HWIB 1M7KA 5AQMB 3FZKB 3FZFB 1M62A 4HWDA 5AQHB 5AQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  3LDQ B;  1HX1 B;  3FZL B;  4HWC A;  5AQS B;  5AQG B;  5AQI B;  5AQP B;  5AQV B;  4HWH A;  3FZM B;  5AQR B;  5AQQ B;  5AQF B;  5AQK B;  4HWF A;  5AQT B;  5AQO B;  1T7S A;  5AQJ B;  1UK5 A;  3M3Z B;  3FZH B;  2D9D A;  5AQN B;  3A8Y C;  5AQU B;  1UGO A;  4HWI B;  1M7K A;  5AQM B;  3FZK B;  3FZF B;  1M62 A;  4HWD A;  5AQH B;  5AQL B; 
#chains in the Genus database with same CATH topology
 5LBM A;  3AE4 A;  4ZI3 D;  5L3F B;  2BBH A;  4LF8 T;  3PE0 A;  3RKG A;  4IDQ A;  4JUY A;  4ZHQ E;  3AXJ A;  3RLF F;  3MK7 C;  2WQY A;  1IBL T;  4UEM A;  2VKH A;  2VUR A;  5HEU A;  2A72 A;  1SHZ C;  3KBT A;  3CX8 B;  4LFC T;  1SUM B;  5H6Q B;  3EVY A;  4HWD A;  2L8K A;  1D0Z A;  1E7P A;  5FY0 A;  2XQ9 A;  4LF4 T;  3ZMV B;  2F4V T;  4E7S A;  2BS3 A;  3AA7 B;  4YHJ A;  4AQF A;  4F6R C;  3ZC0 A;  4IL9 A;  3VHL A;  4Z8X A;  2MBG A;  3RHW A;  5F8P A;  4HFC A;  1YQ3 A;  4V1A v;  5AQS B;  4MFR A;  2IC6 A;  3EAM A;  4EZH A;  5ABH A;  4JBW F;  2FJA A;  5AQK B;  3AAE B;  1XDP A;  3H3M A;  1ZP0 A;  5LHG B;  5AQN B;  3CWZ B;  4LFB T;  3U3I A;  1IAP A;  3PUX F;  3AEA A;  4LF7 T;  3AAI A;  5EK4 A;  3PUG A;  4WZX A;  5FVL A;  3AVS A;  3FZM B;  5DQV A;  2RP4 A;  3TLT A;  4YJ2 E;  2D0U A;  2B76 A;  4ZOL E;  3OKQ A;  4G2A A;  4COF A;  1WR6 A;  4AQF C;  1Z8U A;  3E0Z A;  4IE4 A;  5CB4 E;  3FHN A;  2X9H A;  1X79 A;  3PUZ F;  4QX8 B;  5DQW A;  3RIU A;  3UUB A;  4GYS A;  4H9R C;  4I0U A;  2I59 A;  3K3O A;  4KP3 C;  3R84 B;  1NEN A;  2X9X A;  4ZZB A;  1L0V A;  4U33 A;  2CM0 A;  2BVL A;  2BZB A;  4J2C A;  2WMN A;  2WCA A;  3PJA J;  3P4W A;  2YK0 A;  1OWA A;  1D1B A;  1KK7 A;  2VAS A;  3EAB A;  3AEF A;  2X9W A;  1W0A A;  4BJM A;  2M6B A;  3ABV A;  2D5U A;  3RI5 A;  1ZHC A;  1G73 A;  2H7V C;  2K48 A;  4H9S E;  2KSR A;  1S94 A;  2YU1 A;  2VQE T;  4GKK T;  4HE8 A;  2WWV A;  4UV8 B;  2WWU A;  4WBN E;  4ZXL A;  3QB5 A;  3P7I A;  3AED A;  3RPU A;  3RIU C;  3LDQ B;  5H6R B;  4A5X A;  1LRZ A;  4MHC A;  3EHZ A;  2XSA A;  4EYY R;  1UCU A;  3MXZ A;  5FXV A;  4DUZ T;  3UU5 A;  2NOX A;  2WM9 A;  5TAO A;  2LT3 A;  3KV4 A;  5C2T A;  1Z0P A;  5AQL B;  1LVF A;  2NTY A;  1YW0 A;  3UUN A;  4JI6 T;  4FJO A;  4YLH A;  4CN6 A;  3UU4 A;  4TV9 E;  4WYV A;  1MIY A;  3ZMT B;  2E5V A;  5HYA A;  4IL4 A;  4OFZ A;  2CE7 A;  3UT5 E;  1MMN A;  4UVC B;  2LSK A;  2VK9 A;  2NWB A;  3NVO A;  2VQF T;  4IHJ E;  5JRC B;  3O9X A;  2V1D B;  3LG7 A;  5KMG P;  2X51 A;  4UR9 A;  3FB2 A;  2XQ4 A;  5AQO B;  2V7J A;  2JQK A;  4EIW A;  4IE0 A;  3KV9 A;  2DWG A;  3JAF A;  5ETW A;  3RIA A;  4Z90 A;  2A3D A;  2N2N A;  2X9Y A;  2XQA A;  3UU8 A;  3SOL A;  3TLS A;  1KNP A;  2DWK A;  4PK5 A;  4GK0 E;  2LM9 A;  4O4H E;  1HF8 A;  2NP9 A;  5JVD E;  1N36 T;  3LBX A;  1FEW A;  3JC6 D;  1XZY A;  3GN5 B;  2QGS A;  4ILA A;  4NXM T;  3P50 A;  4HWH A;  3VRA A;  3AE9 A;  4KI0 F;  4IE6 A;  3PUY F;  2FJD A;  3LK3 B;  2WSS V;  2V6Y A;  2MAW A;  4YJ3 E;  5HCJ A;  3N9P A;  3VR9 A;  2AXD S;  3C64 A;  4IST A;  4TNW A;  3SRZ A;  1D1A A;  3P4Q A;  5AQV B;  3CX6 B;  4DO0 A;  2B1E A;  4BAY B;  4IDZ A;  3AE1 A;  4B3R T;  1KFY A;  1HFA A;  4YT0 A;  2HPJ A;  2V7M A;  1XWM A;  3ZJ1 A;  4N78 D;  3HR0 A;  3LK2 B;  3K1S A;  4H63 V;  3JAD A;  4I4T E;  2JPF A;  5CFB A;  1WFD A;  4JEU B;  1SA0 E;  3ZCI A;  4DR4 T;  5LYJ E;  4DV0 T;  5HEG A;  3J9X 1;  3M65 A;  4A97 A;  3DJB A;  2KWH A;  2LHR A;  4CZZ B;  2V7K A;  3QC9 A;  2E9X B;  1IZN B;  2ZM8 A;  1BR2 A;  2C5K T;  5LB7 B;  2W63 A;  1YKH B;  2UXD T;  2JQ9 A;  3ANW A;  1OED C;  1HX8 A;  1HNW T;  3ONJ A;  2LHN A;  4YTP A;  5LG4 A;  1Y64 B;  4A98 A;  3A5X A;  4P09 A;  5JDM A;  5BMV E;  5JR9 A;  4KBM B;  1E1H B;  5AQH B;  3AEB A;  3BQI A;  4YFS A;  3I9Y A;  3N9L A;  3HI2 A;  1HS7 A;  2OLT A;  5M4Y A;  2JJ9 A;  5C8Y E;  4WNK A;  4A56 A;  4L0R A;  2BG9 A;  3ZYK A;  1NEK A;  2BKO A;  3P4R A;  5A1L A;  3OVU A;  2AE9 A;  3HKD E;  3L39 A;  4XBF B;  2Q9Q C;  4PNI A;  4JI5 T;  4X1K E;  5JRE A;  4LF5 T;  1J5E T;  3NZP A;  3PJA A;  4HN9 A;  2CXD A;  2KWI B;  5EZY E;  3TLV A;  3WAJ A;  3HA4 A;  3AVR A;  5JTG A;  5JR9 C;  2P9B A;  2CA5 A;  2E8I A;  4QH4 A;  4NUV A;  2NW9 A;  2QVA A;  2BS2 A;  4YSX A;  2BKP A;  2UXN B;  4TWF A;  2BG9 B;  2XZE A;  2UUC T;  3PUQ A;  1D0X A;  3ZT5 A;  4ASK A;  3HKB E;  4DBQ A;  5L3C B;  3R6N A;  3KIN B;  4UXN B;  5CA0 E;  5HWX A;  3LJC A;  2XAS B;  3B57 A;  4UIG A;  3JC6 C;  1HR0 T;  2VL0 A;  5L3D B;  3X1D A;  2CLY C;  3O1I A;  3MJX A;  4IDO A;  3ONX A;  4GOU A;  2VWA A;  3NBX X;  2Y6X A;  2M6I A;  3ZCJ A;  5HXE A;  4QXC B;  3QUJ A;  4JLE A;  5AQP B;  4UF0 B;  1LVK A;  2PTF A;  3SWH A;  3WI3 A;  1BR1 A;  3K3N A;  2DLR A;  2W4X A;  5FYM A;  2J1D G;  4ILB A;  3H37 A;  4DV5 T;  2D0T A;  3UQ7 A;  5JDG A;  2OV9 A;  3CQC B;  3ZN0 B;  4ZI7 E;  2UU9 T;  4IIJ E;  2VVS A;  2V7I A;  4DV7 T;  4AIU A;  4HFD A;  1MMD A;  3CQG B;  3Q5W A;  3N9N A;  1OED E;  2PG8 A;  5HXH A;  3EI0 A;  3N2K E;  1AJ3 A;  4FI5 A;  1KEY A;  4EB6 E;  2CWY A;  2FJE A;  2Z6E A;  5ABG A;  3AXJ B;  5AQT B;  3AE6 A;  4DV2 T;  4HGA A;  2CWO A;  4X1I E;  4DR1 T;  4O2A E;  3FZF B;  5FVK A;  2H89 A;  4KHP T;  4H9N C;  4ILU A;  1XNR T;  5KDM C;  1FJG T;  3AA0 B;  1MMA A;  5AQU B;  3K8P C;  5LOV E;  1VCT A;  1VOM A;  1M62 A;  2XAJ B;  2LKG A;  3F31 A;  3F2E A;  5IUX A;  4EGW A;  3IA3 A;  3ZT6 A;  4JI2 T;  4L9I A;  4B6X A;  5L3G B;  3EDV A;  3PTR B;  3G06 A;  2X68 A;  1V9D A;  2LKH A;  2LE8 A;  1HG2 A;  1U5P A;  1FMW A;  1W09 A;  1T72 A;  2FUP A;  3MAC A;  3O1J A;  3CML A;  4QKN A;  3KVA A;  4O4L E;  4DMW A;  3KVB A;  4PJN A;  5HXR A;  4HFE A;  3BQK A;  5AQI B;  3KDS E;  2W62 A;  2UUB T;  1FIO A;  3T1H T;  4UEL A;  2I6H A;  2LJL A;  3UFG A;  4MLK A;  4EXT A;  1D0Y A;  4DR7 T;  4AI6 A;  2M67 A;  3N9Q A;  4YSY A;  2MTQ A;  2XUE A;  1R8I A;  3ETU A;  2CHN A;  5LG3 A;  2YDQ A;  4HWC A;  4DID B;  5BR8 T;  1UX4 A;  1QSD A;  2XQ7 A;  2WZH A;  1I94 T;  4DMV A;  4L5G A;  4ZS2 A;  4CI3 B;  2G0U A;  3J7Y q;  4PK4 A;  2CBJ A;  2JRK A;  4DR5 T;  3MZK B;  3RYH E;  3RQU A;  2KZ7 B;  4P0B A;  5JDN A;  4IE7 A;  1UUR A;  2WMO A;  3O1H A;  4ZI2 D;  4LF9 T;  3C4W A;  2QA7 A;  2IIU A;  1N32 T;  4ZS3 A;  5J2U E;  5FL0 A;  5LNK A;  1W9R A;  1O3X A;  3BQL A;  4K0K T;  3UFE A;  2FJB A;  5LXT E;  3GWH A;  3W15 B;  4X20 E;  4DR6 T;  2KLQ A;  1NAF A;  2CMR A;  2Q9Q D;  2BDE A;  3V5U A;  4O4J E;  4TX5 A;  3ZYM A;  3RF1 A;  4YSZ A;  2XQ8 A;  4PK6 A;  3ZSS A;  3UTK A;  3NZQ A;  2D9D A;  2ZLY A;  4TN7 B;  5L3E B;  4X1Y E;  2YKS A;  3NKZ A;  3ESL A;  3D0T A;  2WAU A;  4AKR B;  5HEH A;  3E22 E;  2K3W A;  2RPA A;  3JAE A;  2EHO D;  3AEG A;  4HFB A;  2BS4 A;  5LP6 E;  5HAX A;  3OPC A;  3LSV A;  3UQ4 A;  4AKH A;  2V5D A;  4DV3 T;  3MKD A;  3UUM A;  4HFH A;  3ZMZ B;  2H88 A;  2XHE B;  2Y48 B;  3RC8 A;  2LSY A;  4C90 A;  2XQ6 A;  2CRB A;  2HN2 A;  2PFV A;  2ZM2 A;  2CEA A;  3FZK B;  5LHI B;  2L3L A;  3CVR A;  3UUL A;  5LA6 E;  4P0A A;  4GIW A;  4I55 E;  5JDQ A;  2ACZ A;  4B3S T;  3ZN1 B;  1OED A;  1CHU A;  5FXX A;  5HWY A;  5JDF A;  2JMH A;  3LBX B;  3Q5D A;  4O2B E;  5IYZ E;  2XAG B;  4ILC A;  3CX7 B;  5LCY A;  3CIR A;  3RQW A;  3AEE A;  2V6Y B;  4OYJ A;  5GON E;  1UUS A;  4IRE A;  4Z91 A;  5HXS A;  4TUY E;  1MIW A;  3A7M A;  4U74 A;  4TWD A;  5ABF A;  3RYI E;  5FNV E;  1OED B;  4UVB B;  4U2Z A;  3V5S A;  4NPP A;  4BA9 A;  2Q9Q A;  5LGU B;  2LOP A;  4CN1 A;  2YDS A;  2WBL A;  2LLY A;  4CI2 B;  3C4Z A;  1S35 A;  4EZ4 A;  2E9X C;  4CQI A;  5L47 A;  4PJL A;  5FL1 A;  4IGU A;  3M3Z B;  1Y01 A;  2UXC T;  4IE5 A;  2XAQ B;  2CHO A;  3OYZ A;  2YU2 A;  4U72 A;  2WP9 A;  2YN6 A;  3VU7 H;  4ZI2 C;  4DV4 T;  2WDV A;  3F57 A;  1ZKE A;  3KV5 A;  3QB5 K;  3E08 A;  5JQG E;  3FXD B;  2KMF A;  2HPL A;  2IC9 A;  3C98 B;  3VR8 A;  2EHO A;  2XPK A;  3TKL B;  1IJ6 A;  2Q9Q B;  4YXD A;  3ANW B;  1WYB A;  3ETV A;  3ZMU B;  5FY1 A;  2V8S V;  2JQH A;  2LSG A;  3O4X E;  4OK0 A;  4MBQ A;  3MA9 A;  3FBZ A;  4PAG A;  5ADX L;  2ODV A;  4LMJ A;  5JR9 B;  3PV0 F;  4LF6 T;  3IBP A;  2LRL A;  5FXZ A;  1D1C A;  1LKX A;  5DJQ C;  3ZMS B;  2DL1 A;  4KX6 A;  1B7T A;  5L4E A;  4JI4 T;  2XM2 A;  1BR4 A;  3RYC E;  2ZMA A;  1WRD A;  1XMO T;  2W66 A;  5FP3 A;  4KMC A;  2LRK A;  2WU2 A;  4O8S A;  4K0U A;  2JMK A;  2EHO C;  3KV6 A;  4U7I A;  1E2A A;  2WS3 A;  3NRX A;  2WDQ A;  4XZC A;  3AE7 A;  2V6X A;  5AQG B;  3CPZ A;  2LSI A;  2XAH B;  2CLY B;  4U2Y A;  3C50 A;  2BKN A;  4TV8 E;  2UXB T;  2CPT A;  3CQX C;  5FKY A;  4AKL A;  1XDO A;  3RH3 A;  3VRB A;  4DR3 T;  3L8R A;  3HKC E;  4X66 T;  4EAH A;  4F8H A;  3AE5 A;  4JI1 T;  3AE2 A;  1HG5 A;  4CXY A;  5AQJ B;  3A8Y C;  5LGN B;  2E2A A;  5HCM A;  4Q25 A;  4H9O C;  2MOZ A;  5HXC A;  3FZL B;  2J62 A;  3DP7 A;  5KX5 E;  1G8X A;  4DVD A;  1QLB A;  2QRX A;  3IHR A;  2XJ7 A;  4HTE A;  4QXB B;  4OX9 T;  4AXP A;  2NR4 A;  4EOZ B;  5IWA T;  5AFU L;  2IHR 1;  2IW5 B;  2WY2 A;  1J5W A;  4BJN A;  3PUS A;  2H7O A;  3PUR A;  3C4X A;  5FMN A;  4JYA T;  3H3A A;  3RC3 A;  3AAA B;  5CGM A;  2WB5 A;  3ZC1 A;  5DAB A;  3ZKR A;  1HCI A;  4X5T A;  5AQR B;  2J4G A;  4X65 T;  4AQY T;  4DV1 T;  4XAX B;  5CA1 E;  5LJM A;  2K9A A;  1EZ3 A;  4HWI B;  1M7K A;  2LEH A;  3QOF A;  4TZ4 C;  1WCR A;  4P1N A;  2C5I T;  1ZV4 X;  3GMI A;  2PJQ A;  4IDN A;  3T1Y T;  3RIF A;  4I50 E;  2XQY A;  3I9W A;  1OXZ A;  4QH5 A;  3U78 A;  3NRY A;  5JDL A;  3OBV E;  5F5W A;  3Q5E A;  3IF8 B;  3JCF A;  1HTJ F;  1HNX T;  2KT9 A;  4CI1 B;  1T8B A;  4DUY T;  4JI7 T;  3ZST A;  2XSB A;  2XQ3 A;  4CN4 A;  4JI8 T;  2N1G A;  3DTO A;  3N5L A;  2MYS A;  3UUX B;  2NTX A;  3OYX A;  5LGT B;  5ABE A;  2V26 A;  5J1G A;  2KND A;  2YIN A;  3N2O A;  5LJN A;  1UK5 A;  4QHO A;  4WBO A;  2BG9 E;  4WW0 A;  2LSJ A;  4GYR A;  2V5C A;  2VKO A;  1HX1 B;  3AA1 B;  4CXX A;  1YQ4 A;  2N9D A;  3QK6 A;  1YXR A;  2VKD A;  2X0Y A;  3PU8 A;  2X0L B;  5JH7 E;  3RGL A;  1H7C A;  2L9Q A;  5AQF B;  1UX5 A;  1ZOY A;  4PFO A;  1WLX A;  5J0Z A;  2E9X D;  2RA1 A;  1J1J A;  4AQG A;  4HFI A;  1KNR A;  3I1A A;  3ZYL A;  4TNV A;  2PBI A;  5EK3 A;  2VVN A;  3BK9 A;  2ZM6 T;  1GQE A;  2NW7 A;  4PJM A;  2W00 A;  3UU6 A;  4ZI3 C;  4PW8 A;  4H9Q C;  2H3R A;  5JRC A;  2YDR A;  1WYC A;  4OYK A;  2DHR A;  4DND A;  5AQM B;  2A2F X;  2XTL A;  4QXH B;  3P4P A;  4YTM A;  4AKI A;  3RRC A;  3B13 A;  2WZI A;  2W61 A;  4B3M T;  3Q5X A;  1U4Q A;  2LM2 A;  5KXJ A;  2FBW A;  5F3J A;  2XM1 A;  2ES0 A;  2XQ5 A;  1HNZ T;  2KIN B;  4DR2 T;  2K24 A;  2BVM A;  1BR0 A;  4B3T T;  2WU5 A;  4CXW A;  3PUV F;  3EUH A;  4HKA A;  5JDH A;  3GN5 A;  3P8C D;  3SS1 A;  2QYW A;  3OJA A;  2UXX B;  1T7S A;  3ZLI A;  4H9P C;  3SFD A;  3TLW A;  1X9B A;  2YEV C;  1WR0 A;  4OHF A;  3KBU A;  1N33 T;  4ADZ A;  2GK9 A;  3K3Q C;  4DBR A;  2DI4 A;  3HKE E;  4UVA B;  2X0H A;  4ZZC A;  5LBQ B;  2KXP B;  1IBM T;  4O4I E;  4HWF A;  2VKJ A;  4E7Z A;  3I0O A;  4KHZ F;  2MPK A;  3GA8 A;  4YY3 T;  1NWM X;  1ZEE A;  2IAK A;  5HEO A;  5J2T E;  2CXF A;  1YKE B;  5E0O A;  4X64 T;  2JQQ A;  2C0S A;  2CBI A;  5LHH B;  5FXW A;  1N34 T;  5L4H A;  4LMK A;  2E9X A;  4UV9 B;  4JV5 T;  3S4U A;  3N2G E;  2CCQ A;  3RKO A;  3EDU A;  2OA5 A;  4LFA T;  2X66 A;  2VB6 A;  3KFW X;  1US7 B;  2ACX A;  5LMU T;  1VCS A;  4HEA A;  3C51 A;  5AQQ B;  4C91 A;  2XY8 B;  2HN1 A;  4LML A;  3RYF E;  1YD8 G;  2DNX A;  4JEH B;  4YTN A;  1I6Z A;  5LMN T;  1MIV A;  2W0G A;  5C3J A;  2LOS A;  3SFE A;  1IJ5 A;  4I43 B;  4EV6 A;  3AEC A;  4EYU A;  1MMG A;  1KNZ A;  1XMQ T;  2SPC A;  2DCF A;  1MND A;  2E5L T;  2UUA T;  4M1P A;  2XAF B;  4AKG A;  3L09 A;  4ANJ A;  3FXE B;  3PUW F;  2W2U A;  5L2L A;  5ABF B;  3ZT7 A;  5FY7 A;  1QUU A;  3VKG A;  5IHY A;  2I0M A;  3PUA A;  1DU2 A;  1VRB A;  4PJJ A;  2JIW A;  4IT4 A;  3N9M A;  2HHH T;  3ONL C;  3B5M A;  3LFM A;  4QWN B;  4GK5 E;  3CKD A;  2Y8D A;  2ODU A;  4ERR A;  3I0Q A;  1SE7 A;  3OTO T;  2IUB A;  4NIQ A;  1T98 A;  3ZEF B;  2W67 A;  5HEJ A;  4HFV A;  2V7L A;  3AA6 B;  3ZJ2 A;  2WDR A;  3TLU A;  1UGO A;  2NW8 A;  3QNU A;  1MNE A;  3CK6 A;  4MAL A;  4U31 A;  4H63 H;  4PFP A;  4JI0 T;  1JNR A;  2A9U A;  2BBJ A;  1FMV A;  4YHH T;  4QH1 A;  2EHO B;  3PU3 A;  2VL8 A;  4AIS A;  4EEB A;  2C5J A;  4EED A;  4DV6 T;  3LK4 2;  5L3B B;  4U3C A;  2HH7 A;  2CXL A;  3Q9D A;  2ZM0 A;  2IDO B;  2X67 A;  3RRW A;  3P4S A;  4UF0 A;  4X62 T;  3PDY A;  2J47 A;  4ISS A;  4NXN T;  3FZH B;  1CUN A;  4KUM B;  4G63 A;  3VKH A;  3FBL A;  3ZPO A;  2BG9 C;  3RX6 A;  4GKJ T;  4ZEY A;  5CJ5 A;  2YOE A;  2R6G F;  3NWI A;  3IEE A;  3AE8 A;  1KF6 A;  3N9O A;  4NUU A;  2D2S A;  4JI3 T;  3AB3 B;  4U7Y A;  3T8O A;  1W0B A;  3Q2M A;  4IDP A;  4TWH A;  3AE3 A;  3HL6 A;  3UU3 A;  2K5B B;  1JNZ A;  3L3P A;  3WAK A;  1IBK T;  1XNQ T;  4QX7 B;  2IML A;  5EK2 A; 
#chains in the Genus database with same CATH homology
 1I6Z A;  3LDQ B;  1HX1 B;  3FZL B;  4HWC A;  5AQS B;  5AQG B;  5AQI B;  5AQP B;  5AQV B;  4HWH A;  3FZM B;  5AQR B;  5AQQ B;  5AQF B;  5AQK B;  4HWF A;  5AQT B;  5AQO B;  1T7S A;  5AQJ B;  1UK5 A;  3M3Z B;  3FZH B;  2D9D A;  5AQN B;  3A8Y C;  5AQU B;  1UGO A;  4HWI B;  1M7K A;  5AQM B;  3FZK B;  3FZF B;  1M62 A;  4HWD A;  5AQH B;  5AQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...