5AQLB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
LGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 45
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqlB00
1HX1B 1UGOA 1UK5A 4HWCA 2D9DA 5AQHB 5AQFB 3FZKB 5AQIB 5AQKB 4HWHA 5AQLB 3A8YC 3FZHB 5AQUB 1M7KA 5AQGB 5AQSB 5AQJB 3M3ZB 1I6ZA 4HWDA 5AQNB 1T7SA 1M62A 3LDQB 5AQPB 4HWFA 5AQVB 5AQRB 3FZFB 5AQMB 5AQTB 5AQQB 4HWIB 3FZLB 5AQOB 3FZMB
chains in the Genus database with same CATH superfamily
2YU1A 5C2TA 4IHJE 4WYVA 3TLTA 3AEGA 2UUBT 3MA9A 5JRCB 2V5DA 3V5UA 4IE7A 4JI8T 2E9XB 4X20E 1J5ET 2LKGA 4ILAA 2Y8DA 5AQOB 2NP9A 1UCUA 2X66A 4UELA 4NIQA 2PJQA 4YSYA 5TAOA 3AEBA 4Z90A 4DR2T 3ZEFB 4COFA 2CA5A 3Q5DA 4UR9A 4AQYT 3AECA 3RQWA 1MMDA 1SUMB 3PV0F 4L5GA 3FZLB 3QK6A 3UFEA 2FJAA 4LF8T 1HG2A 3LSVA 5DQWA 2KT9A 3F57A 4QKNA 1W0AA 4KP3C 4C90A 1O3XA 3FB2A 4HFBA 1LVFA 2E9XD 2JMKA 3VR8A 3NBXX 4YJ3E 4AKGA 3JC6C 5CJ5A 4EZHA 3GMIA 4O4LE 1YW0A 4B6XA 3L3PA 3D0TA 3H3MA 3CQCB 3KV4A 2WMNA 4AIUA 3LDQB 4UIGA 3RH3A 5AQRB 3SS1A 4HFVA 2XAGB 3PURA 2XAHB 1UUSA 2YOEA 5FP3A 4YFSA 4JLEA 5HXEA 3AA7B 3KINB 5HXRA 3AVRA 4DVDA 2B76A 2IHR1 2N9DA 1W0BA 3PU8A 2UXBT 1HR0T 2DLRA 3NVOA 2H7OA 4AKIA 4ZI2C 1IAPA 3ZYLA 2VKJA 5LBQB 2WSSV 1LKXA 4H9SE 1XDOA 2L9QA 3JADA 3RIAA 5JDQA 2X9YA 5A1LA 2BS2A 3UQ7A 2V6YB 1J1JA 3P7IA 5EK3A 1OEDA 4QX8B 2YU2A 2DHRA 3ZMZB 2CXDA 4QH1A 2CHOA 5LGNB 2LT3A 3HKCE 5FXZA 2D2SA 2H88A 4JYAT 4LF7T 2C5JA 3C4XA 4O4HE 1SE7A 4AISA 5F8PA 1X79A 2LOSA 3N9OA 3IF8B 4DMVA 3ONLC 4EV6A 2AE9A 2I59A 3EVYA 2WP9A 3P4PA 3C64A 3RYCE 3JC6D 3AE3A 5AQPB 1FMWA 2BKOA 1MMAA 1NAFA 4EYUA 4U7YA 5LCYA 4TZ4C 2L3LA 5JR9B 3KVAA 4E7ZA 4HFDA 3CKDA 3PJAJ 3Q9DA 4F8HA 1ZKEA 2XQ4A 3RYHE 4GYSA 4AKRB 3P4SA 2XAFB 3TLWA 4ZI2D 3NRYA 2XSBA 5KMGP 2N1GA 4N78D 4PJLA 3N9MA 4O2BE 3CPZA 2CM0A 3AE8A 2IDOB 3A5XA 5KXJA 1HNZT 3OBVE 2QYWA 4ZZCA 3ZYMA 1NENA 2HN1A 3MJXA 2LM9A 4PJNA 3CQGB 3H37A 3OTOT 2BKNA 4I4TE 2VL0A 2CPTA 1HCIA 4JBWF 5AQIB 5JVDE 2OLTA 3UUMA 1HX8A 1WRDA 4IGUA 4U33A 2WDQA 2NR4A 1M62A 2WAUA 2VQFT 3GA8A 1L0VA 3RHWA 4GK0E 3UU3A 2XSAA 4TX5A 1R8IA 5C8YE 2PTFA 4DV5T 5ETWA 4GIWA 2XQ5A 3ZYKA 5JRCA 3M3ZB 2LRKA 5LJNA 1OWAA 3UULA 2E9XA 3ONJA 2LEHA 3AAAB 2XQ8A 1QSDA 2DNXA 4C91A 5H6QB 4ERRA 1OEDC 4BJMA 3VRBA 2VASA 3QNUA 5CFBA 4YXDA 1D0ZA 2LSYA 4HWFA 5LOVE 2MPKA 3FBZA 2XJ7A 4QXHB 1MMNA 1IBLT 3R6NA 4NUVA 1T98A 1W9RA 2RA1A 2CWYA 2AXDS 1LRZA 4UVCB 3FZHB 2UU9T 4DR4T 4X1IE 2LKHA 4PK4A 1ZOYA 1OXZA 1VRBA 4DMWA 1UGOA 2W4XA 2IMLA 2YEVC 5LMUT 3RIFA 2UUCT 3N9PA 2BG9E 2I0MA 2ZM6T 3O4XE 2V7KA 1J5WA 2X0LB 4U72A 3AEDA 4YLHA 5AQTB 5FKYA 3FZMB 3U78A 3RLFF 4WBOA 4OYKA 2DWKA 3ZT5A 1WCRA 4ZS3A 2IIUA 4DV4T 2Q9QB 4PK5A 3NRXA 3PE0A 4MLKA 3ZJ2A 3E0ZA 4NUUA 3O1IA 1OEDE 3N5LA 1X9BA 3ZN0B 4U2YA 3TLUA 2W2UA 2CWOA 5E0OA 2WWVA 2VVNA 4PAGA 4ZHQE 3QB5K 1IZNB 2LSGA 3I9WA 4XAXB 2UXDT 3T1HT 3MZKB 4OHFA 1JNRA 2V6YA 2KINB 1NEKA 1KK7A 3KBUA 3CX8B 1G8XA 4NXMT 2CXLA 1Y64B 2XZEA 3CX6B 4NPPA 3L09A 1V9DA 3FXDB 4P1NA 5IWAT 1IJ5A 4LF6T 2VL8A 3RGLA 2DL1A 2MYSA 2EHOA 3C4ZA 3ZLIA 4CXYA 1XMOT 2I6HA 4KUMB 2BDEA 3I1AA 4JEUB 2W00A 3KDSE 4B3RT 4YSXA 4CN1A 4MHCA 2WZHA 1XMQT 1VCTA 5ADXL 4E7SA 4I55E 4TUYE 3E22E 2IUBA 4OFZA 4ASKA 2A9UA 4X1KE 4CXWA 2NTYA 3BQKA 2V6XA 3VR9A 5JR9A 3ZCIA 5JREA 3RX6A 2XQ6A 2LOPA 3ZT6A 2M67A 2KWHA 2LSIA 2ES0A 4JI1T 4EXTA 3UTKA 2YINA 5CA0E 1FIOA 4DUYT 3HKDE 2Z6EA 3SFDA 4L0RA 1FJGT 3C50A 3G06A 2VVSA 5LP6E 4DR6T 5HEGA 2VB6A 2M6BA 3AE5A 4TWFA 3ZJ1A 3CX7B 2R6GF 2X9XA 5CA1E 3RIUC 3N9LA 4ZZBA 4YJ2E 4A56A 5BMVE 4UEMA 2E2AA 2V7JA 2PFVA 2V8SV 1HNWT 1W09A 2VQET 5LHIB 4UF0B 1WFDA 4IREA 3KV5A 5HEJA 2CBIA 5LHHB 3N9QA 2CHNA 1ZEEA 2HH7A 3WI3A 2NW7A 3BQIA 1YQ3A 2P9BA 3ZSSA 4ANJA 3ANWB 3B5MA 2NWBA 3MK7C 2V7IA 3EABA 3ZKRA 1E7PA 1VCSA 3PU3A 4HFEA 4DR3T 3A8YC 2H3RA 4PK6A 2KXPB 2KNDA 3JCFA 3S4UA 1MIWA 4LMJA 2VKOA 2JQHA 4M1PA 2A3DA 4G63A 5FVLA 4HTEA 2MTQA 3LK2B 5AQHB 1MIVA 4P0AA 3I0OA 4LMKA 2XAQB 2E8IA 3EI0A 1IBKT 1HFAA 2CEAA 3LJCA 1GQEA 3PUVF 3KV6A 3N2GE 5H6RB 2WDRA 3Q5WA 5JH7E 3A7MA 5FXWA 4JV5T 3IHRA 2EHOC 2Y6XA 2XY8B 3EDUA 2QRXA 1U5PA 2UUAT 4TNWA 3UU4A 4HFCA 4X62T 2LE8A 5HXSA 5DQVA 2YK0A 4ZI7E 2JQKA 2PBIA 4U2ZA 5L3GB 4YHHT 1KNPA 3CK6A 4EOZB 4U31A 1HTJF 4IE0A 3AA0B 4LMLA 3ESLA 2LLYA 3PTRB 4ZEYA 2IAKA 2ZM0A 4P0BA 3P8CD 2E5VA 4O4IE 4I43B 5IHYA 4CN6A 4UXNB 4HKAA 1T8BA 1SHZC 1YKHB 2K48A 5LJMA 4UV9B 3GWHA 2Q9QA 2IW5B 4JI7T 2XM2A 4XBFB 1XWMA 3LG7A 5FNVE 4LFBT 1BR0A 1WYBA 5AQFB 3I0QA 1YD8G 5L3FB 5HEOA 1KEYA 4CI2B 4HWHA 2W62A 4ISSA 4TWHA 2ACXA 2XQ3A 4DUZT 4AQFA 4CI3B 2KZ7B 1N33T 3NZPA 3RPUA 2NTXA 2WZIA 4QH4A 4PW8A 3UU8A 2JRKA 3AEAA 4X64T 4ZOLE 3UUNA 1IBMT 5LBMA 4JI3T 1S35A 1SA0E 3ZMTB 5L2LA 5JDGA 2JPFA 2KMFA 2BBHA 4LF4T 4UVAB 4AKLA 4GOUA 4DBQA 3MACA 2XQAA 1WR6A 5J0ZA 2K24A 2HHHT 4LFAT 5ABFA 3HR0A 3CMLA 3VKHA 5HYAA 4H9QC 4KMCA 4HE8A 4CN4A 1CUNA 2WBLA 4DR7T 2W67A 4DV3T 3ZMUB 4DR5T 4ZI3C 5HWXA 4I0UA 5LG3A 2BZBA 4DV2T 5LB7B 4HN9A 4DIDB 4YTPA 3HA4A 3EDVA 4TNVA 4MBQA 3RYFE 2BS4A 4WNKA 4JI4T 5FY7A 2W66A 3Q2MA 3L39A 3UU5A 3JAEA 3RYIE 3QUJA 1FMVA 4AI6A 4JI0T 3T1YT 2XTLA 3C98B 3VRAA 4ILUA 2BBJA 2DCFA 2K5BB 4JI6T 2L8KA 5ABEA 3AAIA 4PFOA 3AE7A 5AQQB 1Y01A 3SFEA 2WWUA 5LG4A 1UK5A 4QH5A 4IL4A 2CXFA 2D9DA 1YXRA 4EGWA 1KNZA 4UF0A 2XPKA 5HCMA 3FBLA 5AQKB 3MXZA 2BG9B 3M65A 3Q5EA 4J2CA 2W0GA 2C0SA 2QVAA 3EHZA 4ADZA 2MAWA 2Y48B 3I9YA 2LHNA 2XHEB 3OJAA 4GK5E 3AA1B 2LJLA 2D0TA 3BQLA 3UQ4A 2XUEA 2C5IT 4U74A 2UXCT 1UX4A 3RRCA 1OEDB 3F31A 2LSJA 5ABHA 3PUGA 4CZZB 5FMNA 3EAMA 1KF6A 3RQUA 2VK9A 3RKGA 3L8RA 4EIWA 5F5WA 4X66T 3HKEE 1HX1B 4Z91A 5CB4E 3V5SA 1M7KA 2XM1A 3VHLA 4A97A 3AVSA 3RC8A 5IYZE 3RC3A 5J1GA 4DV7T 2YDQA 4AKHA 4UVBB 3UT5E 3O1HA 1MMGA 2W61A 1WYCA 4A98A 2LSKA 2WQYA 2V1DB 2X9HA 5F3JA 1T7SA 4AXPA 5JDFA 2V5CA 4QWNB 4CXXA 2V7MA 2CLYC 4JEHB 1G73A 2A2FX 4DV6T 4X1YE 1IJ6A 1YKEB 3DTOA 2DI4A 3FHNA 2JQ9A 3P4RA 1N34T 3FXEB 4QXBB 3X1DA 1HNXT 4TN7B 5AQSB 4G2AA 3SRZA 2OA5A 5L4HA 1JNZA 3EUHA 4EB6E 4HWIB 1QLBA 2E9XC 2NOXA 1MNEA 3F2EA 2XAJB 3O9XA 1XNRT 1H7CA 5FY1A 2RPAA 4TWDA 2JIWA 3AAEB 3OKQA 2J1DG 1CHUA 2E5LT 4JI5T 4ILCA 2XQYA 2V26A 4Q25A 3CQXC 3O1JA 4OYJA 1U4QA 2CRBA 2IC6A 3PUZF 1UX5A 1KFYA 3IA3A 4DNDA 4DV0T 4L9IA 2FUPA 4DBRA 2BVLA 4ZS2A 3HL6A 2K3WA 3PUSA 2WM9A 4OX9T 4BA9A 1LVKA 4QHOA 2VWAA 1HF8A 4GKKT 3P50A 2ZLYA 3OPCA 4CQIA 2ZM2A 4YHJA 2HN2A 1XNQT 5M4YA 5LNKA 3ZC0A 3BK9A 4Z8XA 2WS3A 4EZ4A 2SPCA 5JDLA 5AQLB 4EYYR 1BR2A 3R84B 5AQNB 2VURA 2PG8A 5FVKA 3NWIA 5FL0A 3UFGA 2VKDA 5LXTE 3C51A 4QX7B 1MNDA 4HWCA 1ZP0A 4TV8E 3AE9A 4KHZF 3UUXB 1T72A 4I50E 3JAFA 2NW8A 3CVRA 2ZM8A 3J9X1 2WU5A 3PUWF 5HXHA 2X9WA 4TV9E 5AQMB 3HI2A 4PJMA 5EZYE 3K3OA 4OK0A 4IDQA 5GONE 5KX5E 5DJQC 4X65T 3AEFA 5FYMA 4KX6A 4YT0A 5L3EB 5HEUA 4WBNE 5HXCA 1Z8UA 2H7VC 3QB5A 2QA7A 3K1SA 3RKOA 1FEWA 3FZKB 3GN5B 3CWZB 4LF5T 4P09A 2QGSA 2WB5A 3HKBE 2BG9A 3AEEA 3TLVA 1Z0PA 3W15B 2LM2A 3QOFA 2CMRA 5LMNT 5HWYA 2UXNB 3AA6B 5AQUB 3WAJA 3OYZA 3P4QA 2X0YA 3U3IA 5AQVB 2BKPA 4EAHA 5JR9C 4H63V 4YTNA 3AB3B 3KFWX 3DJBA 5HAXA 1EZ3A 2YN6A 1E1HB 1XZYA 4HWDA 5KDMC 4UV8B 2EHOB 2X0HA 4DO0A 3RF1A 4B3TT 2X68A 3ZT7A 1BR1A 3T8OA 3UU6A 5FY0A 4AQGA 4NXNT 4EEDA 4B3MT 2MOZA 4DV1T 1N36T 2FJEA 4IDOA 2B1EA 4IIJE 3AE2A 4H9PC 3AE1A 3LBXB 3B13A 4XZCA 4LFCT 2ZMAA 2G0UA 3AXJB 3ABVA 5ABGA 5LA6E 5BR8T 5LYJE 3WAKA 1BR4A 2EHOD 3DP7A 5JDNA 2CE7A 3N9NA 2C5KT 3K3QC 2VKHA 4IE4A 1D1AA 4LF9T 1E2AA 4H9RC 5L4EA 4O8SA 1WR0A 4IDPA 2N2NA 5L3BB 2K9AA 2UXXB 1ZHCA 2XASB 4F6RC 4JI2T 4KHPT 4V1Av 3KV9A 2HPLA 2JMHA 3LK3B 5EK4A 4H9OC 4K0UA 4A5XA 2DWGA 3PUQA 2KLQA 3TKLB 4CI1B 3B57A 3OYXA 4IL9A 1S94A 1B7TA 2LRLA 2RP4A 1HS7A 5J2UE 1VOMA 4KI0F 5CGMA 4PFPA 3ETVA 4GYRA 3VU7H 5JDMA 3LK42 2BVMA 5FL1A 1D0XA 2KWIB 2LHRA 2BG9C 1ZV4X 1I94T 5HEHA 4ZXLA 3ZC1A 2V7LA 2WCAA 1AJ3A 2M6IA 2KSRA 2GK9A 5AQGB 3ZPOA 1I6ZA 4HFIA 2FBWA 4IDZA 4HEAA 1N32T 3N2OA 3NZQA 3ETUA 3IEEA 2CCQA 3TLSA 2J62A 1D0YA 4KBMB 2Q9QC 5J2TE 1KNRA 3KBTA 3AE4A 3ANWA 2J47A 3SWHA 5LGUB 4PJJA 2FJBA 2D0UA 4YTMA 5AFUL 5L3DB 3PUAA 2OV9A 2YKSA 4ZI3D 4HFHA 2F4VT 5HCJA 4AQFC 3ZCJA 3RIUA 2NW9A 1NWMX 2XQ9A 4H9NC 4FJOA 4BJNA 1DU2A 2IC9A 5LHGB 3H3AA 4MFRA 2XQ7A 2A72A 3RI5A 1US7B 1MIYA 2WDVA 4JUYA 2HPJA 3PUYF 3UUBA 3OVUA 4YSZA 3CIRA 5C3JA 3GN5A 3K3NA 5EK2A 3J7Yq 5JDHA 3NKZA 3N2KE 5IUXA 2ODVA 5FXVA 4GKJT 3ZMVB 2X67A 5FXXA 4MALA 3E08A 4WZXA 2CBJA 3PDYA 5L3CB 2D5UA 4X5TA 4QXCB 2JJ9A 2WU2A 2JQQA 4U3CA 5DABA 3Q5XA 2FJDA 1D1BA 4IE6A 1YQ4A 2WY2A 3AE6A 3QC9A 4IT4A 4BAYB 2ODUA 4ILBA 4FI5A 3ZSTA 2Q9QD 3PUXF 2YDSA 4PNIA 1QUUA 2J4GA 3IBPA 5JTGA 2H89A 3LFMA 3ZN1B 4HGAA 2YDRA 2MBGA 3KVBA 4O2AE 1D1CA 4ISTA 4DR1T 5JQGE 4U7IA 5AQJB 5ABFB 5L47A 4IE5A 3K8PC 3SOLA 1XDPA 2X51A 3P4WA 3ONXA 1UURA 3ZMSB 4H63H 4IDNA 4YY3T 3LBXA 2ACZA 3PJAA 3MKDA 2WMOA 3C4WA 4WW0A 4O4JE 1HG5A 2BS3A 3AXJA 1WLXA 3RRWA 4EEBA 4K0KT 4B3ST 2CLYB 3VKGA 3FZFB 2W63A 5LGTB
chains in the Genus database with same CATH topology
1HX1B 1UGOA 1UK5A 4HWCA 2D9DA 5AQHB 5AQFB 3FZKB 5AQIB 5AQKB 4HWHA 5AQLB 3A8YC 3FZHB 5AQUB 1M7KA 5AQGB 5AQSB 5AQJB 3M3ZB 1I6ZA 4HWDA 5AQNB 1T7SA 1M62A 3LDQB 5AQPB 4HWFA 5AQVB 5AQRB 3FZFB 5AQMB 5AQTB 5AQQB 4HWIB 3FZLB 5AQOB 3FZMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 B;  1UGO A;  1UK5 A;  4HWC A;  2D9D A;  5AQH B;  5AQF B;  3FZK B;  5AQI B;  5AQK B;  4HWH A;  5AQL B;  3A8Y C;  3FZH B;  5AQU B;  1M7K A;  5AQG B;  5AQS B;  5AQJ B;  3M3Z B;  1I6Z A;  4HWD A;  5AQN B;  1T7S A;  1M62 A;  3LDQ B;  5AQP B;  4HWF A;  5AQV B;  5AQR B;  3FZF B;  5AQM B;  5AQT B;  5AQQ B;  4HWI B;  3FZL B;  5AQO B;  3FZM B; 
#chains in the Genus database with same CATH topology
 2YU1 A;  5C2T A;  4IHJ E;  4WYV A;  3TLT A;  3AEG A;  2UUB T;  3MA9 A;  5JRC B;  2V5D A;  3V5U A;  4IE7 A;  4JI8 T;  2E9X B;  4X20 E;  1J5E T;  2LKG A;  4ILA A;  2Y8D A;  5AQO B;  2NP9 A;  1UCU A;  2X66 A;  4UEL A;  4NIQ A;  2PJQ A;  4YSY A;  5TAO A;  3AEB A;  4Z90 A;  4DR2 T;  3ZEF B;  4COF A;  2CA5 A;  3Q5D A;  4UR9 A;  4AQY T;  3AEC A;  3RQW A;  1MMD A;  1SUM B;  3PV0 F;  4L5G A;  3FZL B;  3QK6 A;  3UFE A;  2FJA A;  4LF8 T;  1HG2 A;  3LSV A;  5DQW A;  2KT9 A;  3F57 A;  4QKN A;  1W0A A;  4KP3 C;  4C90 A;  1O3X A;  3FB2 A;  4HFB A;  1LVF A;  2E9X D;  2JMK A;  3VR8 A;  3NBX X;  4YJ3 E;  4AKG A;  3JC6 C;  5CJ5 A;  4EZH A;  3GMI A;  4O4L E;  1YW0 A;  4B6X A;  3L3P A;  3D0T A;  3H3M A;  3CQC B;  3KV4 A;  2WMN A;  4AIU A;  3LDQ B;  4UIG A;  3RH3 A;  5AQR B;  3SS1 A;  4HFV A;  2XAG B;  3PUR A;  2XAH B;  1UUS A;  2YOE A;  5FP3 A;  4YFS A;  4JLE A;  5HXE A;  3AA7 B;  3KIN B;  5HXR A;  3AVR A;  4DVD A;  2B76 A;  2IHR 1;  2N9D A;  1W0B A;  3PU8 A;  2UXB T;  1HR0 T;  2DLR A;  3NVO A;  2H7O A;  4AKI A;  4ZI2 C;  1IAP A;  3ZYL A;  2VKJ A;  5LBQ B;  2WSS V;  1LKX A;  4H9S E;  1XDO A;  2L9Q A;  3JAD A;  3RIA A;  5JDQ A;  2X9Y A;  5A1L A;  2BS2 A;  3UQ7 A;  2V6Y B;  1J1J A;  3P7I A;  5EK3 A;  1OED A;  4QX8 B;  2YU2 A;  2DHR A;  3ZMZ B;  2CXD A;  4QH1 A;  2CHO A;  5LGN B;  2LT3 A;  3HKC E;  5FXZ A;  2D2S A;  2H88 A;  4JYA T;  4LF7 T;  2C5J A;  3C4X A;  4O4H E;  1SE7 A;  4AIS A;  5F8P A;  1X79 A;  2LOS A;  3N9O A;  3IF8 B;  4DMV A;  3ONL C;  4EV6 A;  2AE9 A;  2I59 A;  3EVY A;  2WP9 A;  3P4P A;  3C64 A;  3RYC E;  3JC6 D;  3AE3 A;  5AQP B;  1FMW A;  2BKO A;  1MMA A;  1NAF A;  4EYU A;  4U7Y A;  5LCY A;  4TZ4 C;  2L3L A;  5JR9 B;  3KVA A;  4E7Z A;  4HFD A;  3CKD A;  3PJA J;  3Q9D A;  4F8H A;  1ZKE A;  2XQ4 A;  3RYH E;  4GYS A;  4AKR B;  3P4S A;  2XAF B;  3TLW A;  4ZI2 D;  3NRY A;  2XSB A;  5KMG P;  2N1G A;  4N78 D;  4PJL A;  3N9M A;  4O2B E;  3CPZ A;  2CM0 A;  3AE8 A;  2IDO B;  3A5X A;  5KXJ A;  1HNZ T;  3OBV E;  2QYW A;  4ZZC A;  3ZYM A;  1NEN A;  2HN1 A;  3MJX A;  2LM9 A;  4PJN A;  3CQG B;  3H37 A;  3OTO T;  2BKN A;  4I4T E;  2VL0 A;  2CPT A;  1HCI A;  4JBW F;  5AQI B;  5JVD E;  2OLT A;  3UUM A;  1HX8 A;  1WRD A;  4IGU A;  4U33 A;  2WDQ A;  2NR4 A;  1M62 A;  2WAU A;  2VQF T;  3GA8 A;  1L0V A;  3RHW A;  4GK0 E;  3UU3 A;  2XSA A;  4TX5 A;  1R8I A;  5C8Y E;  2PTF A;  4DV5 T;  5ETW A;  4GIW A;  2XQ5 A;  3ZYK A;  5JRC A;  3M3Z B;  2LRK A;  5LJN A;  1OWA A;  3UUL A;  2E9X A;  3ONJ A;  2LEH A;  3AAA B;  2XQ8 A;  1QSD A;  2DNX A;  4C91 A;  5H6Q B;  4ERR A;  1OED C;  4BJM A;  3VRB A;  2VAS A;  3QNU A;  5CFB A;  4YXD A;  1D0Z A;  2LSY A;  4HWF A;  5LOV E;  2MPK A;  3FBZ A;  2XJ7 A;  4QXH B;  1MMN A;  1IBL T;  3R6N A;  4NUV A;  1T98 A;  1W9R A;  2RA1 A;  2CWY A;  2AXD S;  1LRZ A;  4UVC B;  3FZH B;  2UU9 T;  4DR4 T;  4X1I E;  2LKH A;  4PK4 A;  1ZOY A;  1OXZ A;  1VRB A;  4DMW A;  1UGO A;  2W4X A;  2IML A;  2YEV C;  5LMU T;  3RIF A;  2UUC T;  3N9P A;  2BG9 E;  2I0M A;  2ZM6 T;  3O4X E;  2V7K A;  1J5W A;  2X0L B;  4U72 A;  3AED A;  4YLH A;  5AQT B;  5FKY A;  3FZM B;  3U78 A;  3RLF F;  4WBO A;  4OYK A;  2DWK A;  3ZT5 A;  1WCR A;  4ZS3 A;  2IIU A;  4DV4 T;  2Q9Q B;  4PK5 A;  3NRX A;  3PE0 A;  4MLK A;  3ZJ2 A;  3E0Z A;  4NUU A;  3O1I A;  1OED E;  3N5L A;  1X9B A;  3ZN0 B;  4U2Y A;  3TLU A;  2W2U A;  2CWO A;  5E0O A;  2WWV A;  2VVN A;  4PAG A;  4ZHQ E;  3QB5 K;  1IZN B;  2LSG A;  3I9W A;  4XAX B;  2UXD T;  3T1H T;  3MZK B;  4OHF A;  1JNR A;  2V6Y A;  2KIN B;  1NEK A;  1KK7 A;  3KBU A;  3CX8 B;  1G8X A;  4NXM T;  2CXL A;  1Y64 B;  2XZE A;  3CX6 B;  4NPP A;  3L09 A;  1V9D A;  3FXD B;  4P1N A;  5IWA T;  1IJ5 A;  4LF6 T;  2VL8 A;  3RGL A;  2DL1 A;  2MYS A;  2EHO A;  3C4Z A;  3ZLI A;  4CXY A;  1XMO T;  2I6H A;  4KUM B;  2BDE A;  3I1A A;  4JEU B;  2W00 A;  3KDS E;  4B3R T;  4YSX A;  4CN1 A;  4MHC A;  2WZH A;  1XMQ T;  1VCT A;  5ADX L;  4E7S A;  4I55 E;  4TUY E;  3E22 E;  2IUB A;  4OFZ A;  4ASK A;  2A9U A;  4X1K E;  4CXW A;  2NTY A;  3BQK A;  2V6X A;  3VR9 A;  5JR9 A;  3ZCI A;  5JRE A;  3RX6 A;  2XQ6 A;  2LOP A;  3ZT6 A;  2M67 A;  2KWH A;  2LSI A;  2ES0 A;  4JI1 T;  4EXT A;  3UTK A;  2YIN A;  5CA0 E;  1FIO A;  4DUY T;  3HKD E;  2Z6E A;  3SFD A;  4L0R A;  1FJG T;  3C50 A;  3G06 A;  2VVS A;  5LP6 E;  4DR6 T;  5HEG A;  2VB6 A;  2M6B A;  3AE5 A;  4TWF A;  3ZJ1 A;  3CX7 B;  2R6G F;  2X9X A;  5CA1 E;  3RIU C;  3N9L A;  4ZZB A;  4YJ2 E;  4A56 A;  5BMV E;  4UEM A;  2E2A A;  2V7J A;  2PFV A;  2V8S V;  1HNW T;  1W09 A;  2VQE T;  5LHI B;  4UF0 B;  1WFD A;  4IRE A;  3KV5 A;  5HEJ A;  2CBI A;  5LHH B;  3N9Q A;  2CHN A;  1ZEE A;  2HH7 A;  3WI3 A;  2NW7 A;  3BQI A;  1YQ3 A;  2P9B A;  3ZSS A;  4ANJ A;  3ANW B;  3B5M A;  2NWB A;  3MK7 C;  2V7I A;  3EAB A;  3ZKR A;  1E7P A;  1VCS A;  3PU3 A;  4HFE A;  4DR3 T;  3A8Y C;  2H3R A;  4PK6 A;  2KXP B;  2KND A;  3JCF A;  3S4U A;  1MIW A;  4LMJ A;  2VKO A;  2JQH A;  4M1P A;  2A3D A;  4G63 A;  5FVL A;  4HTE A;  2MTQ A;  3LK2 B;  5AQH B;  1MIV A;  4P0A A;  3I0O A;  4LMK A;  2XAQ B;  2E8I A;  3EI0 A;  1IBK T;  1HFA A;  2CEA A;  3LJC A;  1GQE A;  3PUV F;  3KV6 A;  3N2G E;  5H6R B;  2WDR A;  3Q5W A;  5JH7 E;  3A7M A;  5FXW A;  4JV5 T;  3IHR A;  2EHO C;  2Y6X A;  2XY8 B;  3EDU A;  2QRX A;  1U5P A;  2UUA T;  4TNW A;  3UU4 A;  4HFC A;  4X62 T;  2LE8 A;  5HXS A;  5DQV A;  2YK0 A;  4ZI7 E;  2JQK A;  2PBI A;  4U2Z A;  5L3G B;  4YHH T;  1KNP A;  3CK6 A;  4EOZ B;  4U31 A;  1HTJ F;  4IE0 A;  3AA0 B;  4LML A;  3ESL A;  2LLY A;  3PTR B;  4ZEY A;  2IAK A;  2ZM0 A;  4P0B A;  3P8C D;  2E5V A;  4O4I E;  4I43 B;  5IHY A;  4CN6 A;  4UXN B;  4HKA A;  1T8B A;  1SHZ C;  1YKH B;  2K48 A;  5LJM A;  4UV9 B;  3GWH A;  2Q9Q A;  2IW5 B;  4JI7 T;  2XM2 A;  4XBF B;  1XWM A;  3LG7 A;  5FNV E;  4LFB T;  1BR0 A;  1WYB A;  5AQF B;  3I0Q A;  1YD8 G;  5L3F B;  5HEO A;  1KEY A;  4CI2 B;  4HWH A;  2W62 A;  4ISS A;  4TWH A;  2ACX A;  2XQ3 A;  4DUZ T;  4AQF A;  4CI3 B;  2KZ7 B;  1N33 T;  3NZP A;  3RPU A;  2NTX A;  2WZI A;  4QH4 A;  4PW8 A;  3UU8 A;  2JRK A;  3AEA A;  4X64 T;  4ZOL E;  3UUN A;  1IBM T;  5LBM A;  4JI3 T;  1S35 A;  1SA0 E;  3ZMT B;  5L2L A;  5JDG A;  2JPF A;  2KMF A;  2BBH A;  4LF4 T;  4UVA B;  4AKL A;  4GOU A;  4DBQ A;  3MAC A;  2XQA A;  1WR6 A;  5J0Z A;  2K24 A;  2HHH T;  4LFA T;  5ABF A;  3HR0 A;  3CML A;  3VKH A;  5HYA A;  4H9Q C;  4KMC A;  4HE8 A;  4CN4 A;  1CUN A;  2WBL A;  4DR7 T;  2W67 A;  4DV3 T;  3ZMU B;  4DR5 T;  4ZI3 C;  5HWX A;  4I0U A;  5LG3 A;  2BZB A;  4DV2 T;  5LB7 B;  4HN9 A;  4DID B;  4YTP A;  3HA4 A;  3EDV A;  4TNV A;  4MBQ A;  3RYF E;  2BS4 A;  4WNK A;  4JI4 T;  5FY7 A;  2W66 A;  3Q2M A;  3L39 A;  3UU5 A;  3JAE A;  3RYI E;  3QUJ A;  1FMV A;  4AI6 A;  4JI0 T;  3T1Y T;  2XTL A;  3C98 B;  3VRA A;  4ILU A;  2BBJ A;  2DCF A;  2K5B B;  4JI6 T;  2L8K A;  5ABE A;  3AAI A;  4PFO A;  3AE7 A;  5AQQ B;  1Y01 A;  3SFE A;  2WWU A;  5LG4 A;  1UK5 A;  4QH5 A;  4IL4 A;  2CXF A;  2D9D A;  1YXR A;  4EGW A;  1KNZ A;  4UF0 A;  2XPK A;  5HCM A;  3FBL A;  5AQK B;  3MXZ A;  2BG9 B;  3M65 A;  3Q5E A;  4J2C A;  2W0G A;  2C0S A;  2QVA A;  3EHZ A;  4ADZ A;  2MAW A;  2Y48 B;  3I9Y A;  2LHN A;  2XHE B;  3OJA A;  4GK5 E;  3AA1 B;  2LJL A;  2D0T A;  3BQL A;  3UQ4 A;  2XUE A;  2C5I T;  4U74 A;  2UXC T;  1UX4 A;  3RRC A;  1OED B;  3F31 A;  2LSJ A;  5ABH A;  3PUG A;  4CZZ B;  5FMN A;  3EAM A;  1KF6 A;  3RQU A;  2VK9 A;  3RKG A;  3L8R A;  4EIW A;  5F5W A;  4X66 T;  3HKE E;  1HX1 B;  4Z91 A;  5CB4 E;  3V5S A;  1M7K A;  2XM1 A;  3VHL A;  4A97 A;  3AVS A;  3RC8 A;  5IYZ E;  3RC3 A;  5J1G A;  4DV7 T;  2YDQ A;  4AKH A;  4UVB B;  3UT5 E;  3O1H A;  1MMG A;  2W61 A;  1WYC A;  4A98 A;  2LSK A;  2WQY A;  2V1D B;  2X9H A;  5F3J A;  1T7S A;  4AXP A;  5JDF A;  2V5C A;  4QWN B;  4CXX A;  2V7M A;  2CLY C;  4JEH B;  1G73 A;  2A2F X;  4DV6 T;  4X1Y E;  1IJ6 A;  1YKE B;  3DTO A;  2DI4 A;  3FHN A;  2JQ9 A;  3P4R A;  1N34 T;  3FXE B;  4QXB B;  3X1D A;  1HNX T;  4TN7 B;  5AQS B;  4G2A A;  3SRZ A;  2OA5 A;  5L4H A;  1JNZ A;  3EUH A;  4EB6 E;  4HWI B;  1QLB A;  2E9X C;  2NOX A;  1MNE A;  3F2E A;  2XAJ B;  3O9X A;  1XNR T;  1H7C A;  5FY1 A;  2RPA A;  4TWD A;  2JIW A;  3AAE B;  3OKQ A;  2J1D G;  1CHU A;  2E5L T;  4JI5 T;  4ILC A;  2XQY A;  2V26 A;  4Q25 A;  3CQX C;  3O1J A;  4OYJ A;  1U4Q A;  2CRB A;  2IC6 A;  3PUZ F;  1UX5 A;  1KFY A;  3IA3 A;  4DND A;  4DV0 T;  4L9I A;  2FUP A;  4DBR A;  2BVL A;  4ZS2 A;  3HL6 A;  2K3W A;  3PUS A;  2WM9 A;  4OX9 T;  4BA9 A;  1LVK A;  4QHO A;  2VWA A;  1HF8 A;  4GKK T;  3P50 A;  2ZLY A;  3OPC A;  4CQI A;  2ZM2 A;  4YHJ A;  2HN2 A;  1XNQ T;  5M4Y A;  5LNK A;  3ZC0 A;  3BK9 A;  4Z8X A;  2WS3 A;  4EZ4 A;  2SPC A;  5JDL A;  5AQL B;  4EYY R;  1BR2 A;  3R84 B;  5AQN B;  2VUR A;  2PG8 A;  5FVK A;  3NWI A;  5FL0 A;  3UFG A;  2VKD A;  5LXT E;  3C51 A;  4QX7 B;  1MND A;  4HWC A;  1ZP0 A;  4TV8 E;  3AE9 A;  4KHZ F;  3UUX B;  1T72 A;  4I50 E;  3JAF A;  2NW8 A;  3CVR A;  2ZM8 A;  3J9X 1;  2WU5 A;  3PUW F;  5HXH A;  2X9W A;  4TV9 E;  5AQM B;  3HI2 A;  4PJM A;  5EZY E;  3K3O A;  4OK0 A;  4IDQ A;  5GON E;  5KX5 E;  5DJQ C;  4X65 T;  3AEF A;  5FYM A;  4KX6 A;  4YT0 A;  5L3E B;  5HEU A;  4WBN E;  5HXC A;  1Z8U A;  2H7V C;  3QB5 A;  2QA7 A;  3K1S A;  3RKO A;  1FEW A;  3FZK B;  3GN5 B;  3CWZ B;  4LF5 T;  4P09 A;  2QGS A;  2WB5 A;  3HKB E;  2BG9 A;  3AEE A;  3TLV A;  1Z0P A;  3W15 B;  2LM2 A;  3QOF A;  2CMR A;  5LMN T;  5HWY A;  2UXN B;  3AA6 B;  5AQU B;  3WAJ A;  3OYZ A;  3P4Q A;  2X0Y A;  3U3I A;  5AQV B;  2BKP A;  4EAH A;  5JR9 C;  4H63 V;  4YTN A;  3AB3 B;  3KFW X;  3DJB A;  5HAX A;  1EZ3 A;  2YN6 A;  1E1H B;  1XZY A;  4HWD A;  5KDM C;  4UV8 B;  2EHO B;  2X0H A;  4DO0 A;  3RF1 A;  4B3T T;  2X68 A;  3ZT7 A;  1BR1 A;  3T8O A;  3UU6 A;  5FY0 A;  4AQG A;  4NXN T;  4EED A;  4B3M T;  2MOZ A;  4DV1 T;  1N36 T;  2FJE A;  4IDO A;  2B1E A;  4IIJ E;  3AE2 A;  4H9P C;  3AE1 A;  3LBX B;  3B13 A;  4XZC A;  4LFC T;  2ZMA A;  2G0U A;  3AXJ B;  3ABV A;  5ABG A;  5LA6 E;  5BR8 T;  5LYJ E;  3WAK A;  1BR4 A;  2EHO D;  3DP7 A;  5JDN A;  2CE7 A;  3N9N A;  2C5K T;  3K3Q C;  2VKH A;  4IE4 A;  1D1A A;  4LF9 T;  1E2A A;  4H9R C;  5L4E A;  4O8S A;  1WR0 A;  4IDP A;  2N2N A;  5L3B B;  2K9A A;  2UXX B;  1ZHC A;  2XAS B;  4F6R C;  4JI2 T;  4KHP T;  4V1A v;  3KV9 A;  2HPL A;  2JMH A;  3LK3 B;  5EK4 A;  4H9O C;  4K0U A;  4A5X A;  2DWG A;  3PUQ A;  2KLQ A;  3TKL B;  4CI1 B;  3B57 A;  3OYX A;  4IL9 A;  1S94 A;  1B7T A;  2LRL A;  2RP4 A;  1HS7 A;  5J2U E;  1VOM A;  4KI0 F;  5CGM A;  4PFP A;  3ETV A;  4GYR A;  3VU7 H;  5JDM A;  3LK4 2;  2BVM A;  5FL1 A;  1D0X A;  2KWI B;  2LHR A;  2BG9 C;  1ZV4 X;  1I94 T;  5HEH A;  4ZXL A;  3ZC1 A;  2V7L A;  2WCA A;  1AJ3 A;  2M6I A;  2KSR A;  2GK9 A;  5AQG B;  3ZPO A;  1I6Z A;  4HFI A;  2FBW A;  4IDZ A;  4HEA A;  1N32 T;  3N2O A;  3NZQ A;  3ETU A;  3IEE A;  2CCQ A;  3TLS A;  2J62 A;  1D0Y A;  4KBM B;  2Q9Q C;  5J2T E;  1KNR A;  3KBT A;  3AE4 A;  3ANW A;  2J47 A;  3SWH A;  5LGU B;  4PJJ A;  2FJB A;  2D0U A;  4YTM A;  5AFU L;  5L3D B;  3PUA A;  2OV9 A;  2YKS A;  4ZI3 D;  4HFH A;  2F4V T;  5HCJ A;  4AQF C;  3ZCJ A;  3RIU A;  2NW9 A;  1NWM X;  2XQ9 A;  4H9N C;  4FJO A;  4BJN A;  1DU2 A;  2IC9 A;  5LHG B;  3H3A A;  4MFR A;  2XQ7 A;  2A72 A;  3RI5 A;  1US7 B;  1MIY A;  2WDV A;  4JUY A;  2HPJ A;  3PUY F;  3UUB A;  3OVU A;  4YSZ A;  3CIR A;  5C3J A;  3GN5 A;  3K3N A;  5EK2 A;  3J7Y q;  5JDH A;  3NKZ A;  3N2K E;  5IUX A;  2ODV A;  5FXV A;  4GKJ T;  3ZMV B;  2X67 A;  5FXX A;  4MAL A;  3E08 A;  4WZX A;  2CBJ A;  3PDY A;  5L3C B;  2D5U A;  4X5T A;  4QXC B;  2JJ9 A;  2WU2 A;  2JQQ A;  4U3C A;  5DAB A;  3Q5X A;  2FJD A;  1D1B A;  4IE6 A;  1YQ4 A;  2WY2 A;  3AE6 A;  3QC9 A;  4IT4 A;  4BAY B;  2ODU A;  4ILB A;  4FI5 A;  3ZST A;  2Q9Q D;  3PUX F;  2YDS A;  4PNI A;  1QUU A;  2J4G A;  3IBP A;  5JTG A;  2H89 A;  3LFM A;  3ZN1 B;  4HGA A;  2YDR A;  2MBG A;  3KVB A;  4O2A E;  1D1C A;  4IST A;  4DR1 T;  5JQG E;  4U7I A;  5AQJ B;  5ABF B;  5L47 A;  4IE5 A;  3K8P C;  3SOL A;  1XDP A;  2X51 A;  3P4W A;  3ONX A;  1UUR A;  3ZMS B;  4H63 H;  4IDN A;  4YY3 T;  3LBX A;  2ACZ A;  3PJA A;  3MKD A;  2WMO A;  3C4W A;  4WW0 A;  4O4J E;  1HG5 A;  2BS3 A;  3AXJ A;  1WLX A;  3RRW A;  4EEB A;  4K0K T;  4B3S T;  2CLY B;  3VKG A;  3FZF B;  2W63 A;  5LGT B; 
#chains in the Genus database with same CATH homology
 1HX1 B;  1UGO A;  1UK5 A;  4HWC A;  2D9D A;  5AQH B;  5AQF B;  3FZK B;  5AQI B;  5AQK B;  4HWH A;  5AQL B;  3A8Y C;  3FZH B;  5AQU B;  1M7K A;  5AQG B;  5AQS B;  5AQJ B;  3M3Z B;  1I6Z A;  4HWD A;  5AQN B;  1T7S A;  1M62 A;  3LDQ B;  5AQP B;  4HWF A;  5AQV B;  5AQR B;  3FZF B;  5AQM B;  5AQT B;  5AQQ B;  4HWI B;  3FZL B;  5AQO B;  3FZM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...