5AQLB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
LGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 45
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqlB00
1HX1B 4HWHA 5AQQB 3LDQB 3FZLB 5AQVB 4HWCA 5AQGB 5AQFB 5AQOB 5AQIB 3FZKB 3M3ZB 1UK5A 1M7KA 5AQRB 3FZMB 2D9DA 4HWFA 3FZHB 5AQLB 5AQKB 3A8YC 5AQJB 1M62A 5AQPB 3FZFB 5AQHB 5AQMB 5AQTB 4HWDA 1UGOA 5AQUB 1I6ZA 4HWIB 5AQNB 1T7SA 5AQSB
chains in the Genus database with same CATH superfamily
3N9QA 3PUWF 3KBUA 3RGLA 3IEEA 4HFHA 3A5XA 1Z0PA 3I1AA 5LCYA 3T8OA 4IHJE 1HS7A 2IDOB 3BQKA 5JVDE 2ZM6T 1M7KA 1KNRA 2FJDA 2CXFA 4P0BA 4U74A 4IT4A 1YD8G 4KHZF 2KZ7B 5FMNA 3PUXF 4DV6T 4H9RC 5LBQB 2WU2A 3RYFE 5JDQA 4DR7T 3KFWX 3CWZB 1UCUA 5ABHA 1MIWA 1OEDA 3CX7B 3FXEB 2X9HA 3QNUA 4UF0B 2A72A 4ZI2D 3RC3A 2YN6A 4GYRA 4CQIA 4PJLA 4H9SE 5JDGA 4GKKT 3RKOA 3B5MA 1I6ZA 2YKSA 3SRZA 4GKJT 5TAOA 3CQGB 3IF8B 4HEAA 2HPJA 4DR3T 2C5JA 2V6XA 4H63H 4ILAA 2W63A 3PE0A 4WNKA 3KV5A 3EDUA 2E8IA 3KBTA 3FHNA 2QYWA 3LSVA 2CXDA 4DIDB 5HXEA 3AVRA 1ZKEA 4IE7A 4DMVA 4AI6A 3PU3A 1D0YA 1XDOA 5AQIB 1LKXA 4YSZA 2BZBA 1S94A 2RP4A 4ILCA 4U31A 1N33T 3P4WA 1QSDA 2WP9A 4HFVA 2J1DG 3OYXA 1HTJF 4TV8E 3UU6A 2WS3A 3MJXA 3I9WA 4GOUA 4JYAT 4O2AE 5DQWA 3AEEA 3AE7A 3O4XE 4LMJA 2VKOA 4TUYE 4YJ2E 4DR5T 3PUQA 4ILUA 4B6XA 3IA3A 4UEMA 2KXPB 2XQ6A 5AQMB 2LHRA 1N36T 3BK9A 4O4LE 3PV0F 4UV9B 3KV6A 1YW0A 2V6YA 4IE6A 2W0GA 3RI5A 3NKZA 2YDQA 3OVUA 2I6HA 4DNDA 2XSBA 4HFEA 2XY8B 5FL0A 2WZIA 2FBWA 5FP3A 3QUJA 5AQQB 3ABVA 4UR9A 1NEKA 2CEAA 4OYJA 3R6NA 1J5WA 2J4GA 1CUNA 5IHYA 3AXJA 1HF8A 3K8PC 5HEOA 1KK7A 4DBQA 5C3JA 5JR9C 4O4JE 1HNXT 4ZOLE 4LFAT 4ZS3A 3LJCA 4ADZA 2XSAA 3B57A 4EXTA 5HXHA 4CN1A 2N9DA 2PG8A 1MMGA 1U4QA 2VL8A 4GYSA 3RIUA 4DBRA 1L0VA 1WLXA 3L09A 3P4PA 1WR6A 4EYYR 1XDPA 4DV1T 5HYAA 1UUSA 4EEBA 1G8XA 2Q9QB 5LHHB 3F31A 5BR8T 4DR2T 2CM0A 2K9AA 2EHOC 1D1BA 2M6BA 5L3CB 1W0BA 2BBHA 3RIUC 3L3PA 3ZYLA 4ZEYA 2XAJB 3AEGA 3PUVF 4YY3T 4DV2T 4CXYA 2M67A 3Q5WA 4TV9E 1KNZA 3VU7H 3TLSA 5CJ5A 3LK3B 4LF8T 4A98A 1J1JA 5DQVA 2WB5A 3CPZA 5LA6E 4ZZBA 2CLYB 5LHGB 3MZKB 4I4TE 2HH7A 3BQIA 5FY7A 4EZ4A 5FNVE 4NIQA 5ABGA 4LF4T 4COFA 2I59A 2PBIA 5L3FB 4QX7B 2YOEA 4XAXB 1V9DA 2YEVC 5LB7B 3FBZA 2JJ9A 2VKHA 4DV7T 4X20E 3GA8A 2VURA 5HXRA 3ZMZB 1MIYA 4YSXA 1SUMB 2XQ9A 4LMKA 4DR6T 2DWKA 2HN1A 2VKDA 2XQ4A 3C4WA 5C2TA 3OTOT 1MNDA 2WDQA 1SHZC 3CKDA 3MK7C 4YFSA 4Z91A 5L3BB 1WRDA 1FIOA 4HWDA 2Y6XA 3TLUA 3ZN0B 2LEHA 5JR9B 4X1IE 4HWIB 3AE5A 2M6IA 4IE4A 5FXWA 5HEUA 4IL4A 3SFEA 1HCIA 4JI6T 3TLVA 3J9X1 1T7SA 4ISSA 5L3DB 2LSIA 2V7KA 2A3DA 2JQKA 4MFRA 2DWGA 2JMHA 4UVCB 1VRBA 4LF7T 3T1YT 4LF6T 4AKGA 3N9PA 3TLWA 2BKOA 3KDSE 1XZYA 2KWHA 3ANWA 3QK6A 5FY1A 5LGNB 1J5ET 4JI3T 3AE8A 3JC6D 3HKBE 5JR9A 3MA9A 5AQRB 2WWVA 3ZC0A 1YXRA 5JRCA 2HPLA 4UIGA 2BVLA 3FZHB 5LP6E 5HEGA 1Y64B 3AA1B 1UX5A 2L8KA 3N9MA 2WWUA 4KUMB 5EZYE 3LBXB 1MNEA 3UU3A 3O1JA 3ZYKA 4ZI2C 1XMOT 1HX8A 1G73A 2BDEA 4JUYA 3ZYMA 1UGOA 5AQUB 4DV0T 2MAWA 2B76A 1WYBA 3UU5A 3CX8B 2UUBT 3UT5E 2WMNA 2YU1A 2BKPA 4U2YA 5J0ZA 3J7Yq 3NBXX 1IBMT 3KVBA 2BG9B 2C0SA 2VWAA 4BAYB 2QRXA 2WM9A 3NZQA 4WW0A 4DO0A 2YK0A 1BR0A 4ZXLA 3LDQB 3H3AA 1XMQT 2JIWA 3C51A 3N2KE 3EAMA 2XQYA 5ABFB 4JEUB 1H7CA 2V5CA 3O1HA 5HXSA 2CHOA 2HHHT 1S35A 1BR1A 3RQWA 2WDVA 3AEDA 3EVYA 3P7IA 4IDQA 4IDOA 4C91A 4HWFA 4UVAB 3OJAA 3P4SA 4AQFC 4L0RA 5LMNT 4K0UA 3ZJ2A 4C90A 1FMWA 3B13A 5AQHB 3ZKRA 4BJMA 4HTEA 1BR2A 4CI1B 2CHNA 4DMWA 3CX6B 4DV4T 1IBLT 3VKGA 4CN4A 5HEJA 4AKIA 1IJ5A 2W66A 2WSSV 3LFMA 3N9OA 2OLTA 3VHLA 4IL9A 4A97A 4E7ZA 2PFVA 2LKGA 3CVRA 3FB2A 3JADA 3P8CD 3OPCA 3ZLIA 3HKCE 2JPFA 4IDPA 4UF0A 2FJEA 4H9PC 2UUAT 5AQOB 3AE9A 5H6QB 5FY0A 4NPPA 4LFCT 1WR0A 5FVKA 3UFGA 1MIVA 1T8BA 2JQQA 2UXDT 4PK5A 5JRCB 4FI5A 1NAFA 1ZV4X 2VASA 1LRZA 3I0OA 2MOZA 3Q5EA 5DABA 3VR8A 5L4EA 3RIFA 4JI8T 2E5VA 5A1LA 2Q9QD 4ZZCA 2BG9C 3LBXA 2IC9A 2H88A 2X9XA 3EABA 1FJGT 5M4YA 4KI0F 4ZS2A 1X79A 4AXPA 2V1DB 1JNZA 2W00A 5F5WA 2QA7A 2CBJA 2SPCA 3EDVA 2ZMAA 3P4RA 4JEHB 1IBKT 1HNZT 2W67A 2H89A 5L3GB 4EV6A 4KMCA 3AE4A 2ZM0A 5FL1A 5H6RB 2C5IT 2X0LB 3JAEA 4PNIA 2Q9QC 3PTRB 2WAUA 2XM1A 3AE6A 4TWDA 4YTMA 3OKQA 4YT0A 4G63A 3HL6A 1MMDA 4JI4T 2ZLYA 2X9YA 2ZM8A 3NRXA 4ERRA 2CWYA 2X51A 2H3RA 4F8HA 2XQAA 5L4HA 4ZI3D 5E0OA 4TNWA 4OX9T 5JQGE 3RRCA 5HWYA 3VRBA 4QWNB 5HCMA 3ETVA 4AIUA 3CIRA 4IREA 4AISA 2LOPA 1FEWA 2XAFB 2Y48B 4XZCA 3CMLA 2G0UA 4EOZB 4YHHT 3T1HT 5AQJB 2CWOA 2J62A 1M62A 2UUCT 3RLFF 2V26A 2UXCT 2XQ8A 3LK42 2OA5A 5LGUB 1Y01A 2UXBT 3JAFA 3Q9DA 3C64A 3NZPA 1WYCA 3RX6A 2XAGB 2D0TA 3PJAA 3X1DA 2WBLA 5JDMA 4HN9A 2E9XC 2LM9A 3IBPA 3OBVE 4WZXA 3RF1A 3C4ZA 3ZJ1A 4DR1T 4B3TT 2PTFA 3ZMSB 5AFUL 2X0HA 3DP7A 3F2EA 3ZPOA 2X9WA 3ESLA 4AKRB 2XM2A 2Q9QA 2NR4A 5AQVB 3FZKB 3AE3A 1MMAA 2VVSA 2YDRA 3KV9A 3M3ZB 3M65A 2MBGA 4O4IE 2ACZA 3MACA 3RQUA 5IWAT 4K0KT 1WFDA 2XASB 5CA1E 5KX5E 5EK4A 5L2LA 2BG9A 3QOFA 5CB4E 5CFBA 4QKNA 5LYJE 4X62T 2X0YA 2LSKA 2XPKA 3PJAJ 4HGAA 5AQLB 2RA1A 4ILBA 3ZT5A 4LFBT 4DUZT 2Z6EA 3WAJA 4JI0T 2IAKA 3ZCIA 4CZZB 4CN6A 2E9XD 4NUUA 3ZC1A 2LRKA 4QX8B 3WI3A 3UUBA 2WCAA 5F8PA 4JV5T 1VCSA 2ES0A 1T72A 3GN5A 4MHCA 2BS4A 4NUVA 3V5UA 4B3ST 1HR0T 4G2AA 4TX5A 5LMUT 1WCRA 3U3IA 2D0UA 2LRLA 5AQNB 1ZOYA 4J2CA 4PFOA 4JI2T 2BVMA 1CHUA 2WU5A 3CQCB 4CXXA 5KMGP 2YDSA 2VVNA 4TNVA 1HFAA 3UQ7A 5LBMA 4XBFB 2KINB 2DLRA 3N2OA 2EHOB 4Z90A 1XNQT 4V1Av 3RHWA 3E08A 4B3MT 3C50A 3D0TA 2KNDA 2Y8DA 4MBQA 4AQGA 1AJ3A 2X68A 3GWHA 5LOVE 3U78A 2KWIB 3L39A 2FJAA 2K24A 2V6YB 4A5XA 2XAQB 1NWMX 4PAGA 5HAXA 3UU4A 3KVAA 3Q5DA 4EAHA 1SE7A 3OYZA 3RIAA 2CMRA 2KLQA 1Z8UA 4I50E 3TLTA 4PK6A 4ANJA 5CA0E 4IIJE 1VOMA 2WDRA 4EYUA 1D1CA 3NWIA 3W15B 2VL0A 3P50A 2DNXA 3K1SA 3N9LA 2V5DA 5AQTB 4P1NA 3ZMTB 3AE2A 1KF6A 2WZHA 3NRYA 3WAKA 4P0AA 4DR4T 4JI5T 3FXDB 4KP3C 4YHJA 1SA0E 2ODUA 4X66T 5GONE 4KHPT 4IDZA 2A9UA 3UTKA 2LSYA 3SS1A 3N5LA 2LSGA 3ONXA 1R8IA 2NOXA 2BG9E 4LMLA 2DCFA 3MKDA 5FKYA 4AKLA 4YTNA 5J2UE 1YQ4A 2UXXB 4YJ3E 2V7MA 5L3EB 2DI4A 2W62A 3Q2MA 4I0UA 3RRWA 2HN2A 2KT9A 1UURA 2ACXA 3ZSTA 4EIWA 2F4VT 1OWAA 3RYCE 5J2TE 3N2GE 2IUBA 5AQKB 3VRAA 5ABEA 5JTGA 2CA5A 5L47A 4NXNT 2WY2A 2BS2A 2FJBA 4X5TA 4BJNA 2N2NA 2KSRA 2I0MA 2J47A 3AEBA 3HKDE 3AE1A 3ZT7A 3I0QA 4O8SA 2D2SA 2JQHA 2CLYC 3P4QA 3AEFA 4ZI3C 5IUXA 1YKHB 4GIWA 2WQYA 2IMLA 3G06A 1JNRA 3H3MA 4BA9A 4TWHA 4CI2B 5F3JA 5LXTE 5AQSB 3RYHE 1LVFA 5LG3A 3HI2A 3RKGA 1X9BA 3O1IA 2VQFT 2PJQA 3CQXC 2NTYA 1OEDB 3Q5XA 5KDMC 1OEDE 2LJLA 4I55E 1W9RA 3HKEE 5FVLA 3ONLC 4MALA 4YTPA 4JI7T 4Z8XA 4QHOA 1KFYA 4PW8A 4PFPA 3UUXB 2LHNA 3H37A 1W09A 2FUPA 4HFDA 1HG5A 4UV8B 2IW5B 5LG4A 3DTOA 2DHRA 5HWXA 4LF5T 4HFBA 3V5SA 3A8YC 3MXZA 3S4UA 3FZFB 3E22E 2OV9A 5EK3A 5ETWA 3R84B 2K48A 1D0XA 1QLBA 2UXNB 3PURA 4OHFA 4PJNA 4UXNB 3ZMVB 5LJNA 2LM2A 3C98B 4P09A 2QGSA 2VKJA 2MYSA 4AQYT 4ISTA 2H7VC 4HKAA 4DV5T 1E1HB 3RH3A 3AA0B 4OYKA 4IE5A 3LK2B 2XAHB 2V7LA 4Q25A 5JREA 1N32T 4JLEA 4U7IA 4U7YA 1HNWT 4HWCA 2B1EA 2WMOA 3AEAA 3JC6C 4ZHQE 4LF9T 3UQ4A 4U3CA 2D5UA 3EI0A 1XWMA 3AAIA 4UVBB 1N34T 4GK5E 1US7B 4WBNE 5FYMA 2D9DA 3L8RA 5HEHA 1QUUA 4H9QC 4O4HE 3RPUA 5JDNA 1T98A 1KEYA 5LJMA 2W61A 2XTLA 2ZM2A 2XZEA 3PUSA 3GMIA 1IZNB 2VB6A 3PUGA 4F6RC 4ZI7E 1IAPA 2LLYA 5HXCA 4HFCA 3ANWB 1YKEB 3UULA 5FXXA 3SWHA 3GN5B 2P9BA 3I9YA 2K3WA 2W4XA 2XQ7A 3PUZF 2NP9A 3RYIE 3UUNA 3SOLA 1HG2A 3PUAA 4WYVA 3PU8A 2IC6A 4HWHA 4JBWF 4QH1A 4KX6A 2R6GF 4U72A 4X64T 4B3RT 2A2FX 2V7IA 2X67A 3FZLB 3JCFA 1E2AA 3BQLA 1IJ6A 3ZCJA 5FXZA 5CGMA 3CK6A 2ODVA 2IHR1 2L9QA 4IDNA 1UK5A 5JDFA 3TKLB 4CXWA 4YXDA 3K3OA 1B7TA 3FBLA 4UELA 1W0AA 2GK9A 4TZ4C 2NW8A 1NENA 2E2AA 3AB3B 1FMVA 4L9IA 2BBJA 5AQPB 2LT3A 2JMKA 2YU2A 2EHOA 3ZSSA 3AXJB 4E7SA 2E5LT 4IE0A 1MMNA 2MTQA 2QVAA 2VK9A 4H9OC 3HA4A 4QXHB 4YSYA 2RPAA 3AVSA 3DJBA 3AAEB 1ZP0A 3K3NA 4O2BE 3RC8A 2KMFA 2XQ3A 2AE9A 5C8YE 4GK0E 4OFZA 4I43B 2CXLA 2NTXA 1XNRT 3E0ZA 2NW9A 2XHEB 4X1KE 4N78D 2E9XB 4MLKA 2LKHA 3QB5A 4PJMA 3ETUA 1I94T 4TN7B 1BR4A 4JI1T 4U2ZA 3FZMB 4WBOA 1KNPA 2XJ7A 4EGWA 3AAAB 3K3QC 2LE8A 4H63V 2BKNA 3LG7A 1OEDC 3PDYA 1D1AA 4X1YE 3ZN1B 4ASKA 5ADXL 3HR0A 3SFDA 4OK0A 4KBMB 3EHZA 3VR9A 3N9NA 3PUYF 2CRBA 4QH4A 2K5BB 5KXJA 2CPTA 5ABFA 2XUEA 4EEDA 2E9XA 3QB5K 4L5GA 5JDHA 2UU9T 4HFIA 4EB6E 2V7JA 4QXCB 3VKHA 3UUMA 4X65T 3ONJA 4FJOA 1D0ZA 4EZHA 1O3XA 2VQET 5LHIB 2N1GA 2JRKA 2W2UA 3C4XA 5IYZE 3ZEFB 2IIUA 1HX1B 4H9NC 1VCTA 5FXVA 1E7PA 4A56A 5AQFB 3QC9A 2MPKA 4QXBB 5AQGB 4DUYT 4DV3T 2BS3A 1OXZA 5HCJA 3KINB 2EHOD 3AECA 5JH7E 3F57A 5DJQC 5BMVE 3A7MA 3AA6B 4IGUA 2C5KT 5JDLA 3IHRA 1EZ3A 1YQ3A 3EUHA 1U5PA 4PJJA 4TWFA 4YLHA 2XQ5A 3UFEA 5LNKA 2LSJA 4AKHA 1DU2A 4CI3B 1ZHCA 3UU8A 3AA7B 5EK2A 3ZMUB 4NXMT 4AQFA 5J1GA 5LGTB 2YINA 2L3LA 3NVOA 2H7OA 1GQEA 2JQ9A 4QH5A 3ZT6A 2CBIA 4PK4A 4U33A 2LOSA 3O9XA 4HE8A 1LVKA 1UX4A 2NW7A 3KV4A 4DVDA 2AXDS 2V8SV 2X66A 2CCQA 1ZEEA 4M1PA 2DL1A 2CE7A 2NWBA
chains in the Genus database with same CATH topology
1HX1B 4HWHA 5AQQB 3LDQB 3FZLB 5AQVB 4HWCA 5AQGB 5AQFB 5AQOB 5AQIB 3FZKB 3M3ZB 1UK5A 1M7KA 5AQRB 3FZMB 2D9DA 4HWFA 3FZHB 5AQLB 5AQKB 3A8YC 5AQJB 1M62A 5AQPB 3FZFB 5AQHB 5AQMB 5AQTB 4HWDA 1UGOA 5AQUB 1I6ZA 4HWIB 5AQNB 1T7SA 5AQSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 B;  4HWH A;  5AQQ B;  3LDQ B;  3FZL B;  5AQV B;  4HWC A;  5AQG B;  5AQF B;  5AQO B;  5AQI B;  3FZK B;  3M3Z B;  1UK5 A;  1M7K A;  5AQR B;  3FZM B;  2D9D A;  4HWF A;  3FZH B;  5AQL B;  5AQK B;  3A8Y C;  5AQJ B;  1M62 A;  5AQP B;  3FZF B;  5AQH B;  5AQM B;  5AQT B;  4HWD A;  1UGO A;  5AQU B;  1I6Z A;  4HWI B;  5AQN B;  1T7S A;  5AQS B; 
#chains in the Genus database with same CATH topology
 3N9Q A;  3PUW F;  3KBU A;  3RGL A;  3IEE A;  4HFH A;  3A5X A;  1Z0P A;  3I1A A;  5LCY A;  3T8O A;  4IHJ E;  1HS7 A;  2IDO B;  3BQK A;  5JVD E;  2ZM6 T;  1M7K A;  1KNR A;  2FJD A;  2CXF A;  4P0B A;  4U74 A;  4IT4 A;  1YD8 G;  4KHZ F;  2KZ7 B;  5FMN A;  3PUX F;  4DV6 T;  4H9R C;  5LBQ B;  2WU2 A;  3RYF E;  5JDQ A;  4DR7 T;  3KFW X;  3CWZ B;  1UCU A;  5ABH A;  1MIW A;  1OED A;  3CX7 B;  3FXE B;  2X9H A;  3QNU A;  4UF0 B;  2A72 A;  4ZI2 D;  3RC3 A;  2YN6 A;  4GYR A;  4CQI A;  4PJL A;  4H9S E;  5JDG A;  4GKK T;  3RKO A;  3B5M A;  1I6Z A;  2YKS A;  3SRZ A;  4GKJ T;  5TAO A;  3CQG B;  3IF8 B;  4HEA A;  2HPJ A;  4DR3 T;  2C5J A;  2V6X A;  4H63 H;  4ILA A;  2W63 A;  3PE0 A;  4WNK A;  3KV5 A;  3EDU A;  2E8I A;  3KBT A;  3FHN A;  2QYW A;  3LSV A;  2CXD A;  4DID B;  5HXE A;  3AVR A;  1ZKE A;  4IE7 A;  4DMV A;  4AI6 A;  3PU3 A;  1D0Y A;  1XDO A;  5AQI B;  1LKX A;  4YSZ A;  2BZB A;  1S94 A;  2RP4 A;  4ILC A;  4U31 A;  1N33 T;  3P4W A;  1QSD A;  2WP9 A;  4HFV A;  2J1D G;  3OYX A;  1HTJ F;  4TV8 E;  3UU6 A;  2WS3 A;  3MJX A;  3I9W A;  4GOU A;  4JYA T;  4O2A E;  5DQW A;  3AEE A;  3AE7 A;  3O4X E;  4LMJ A;  2VKO A;  4TUY E;  4YJ2 E;  4DR5 T;  3PUQ A;  4ILU A;  4B6X A;  3IA3 A;  4UEM A;  2KXP B;  2XQ6 A;  5AQM B;  2LHR A;  1N36 T;  3BK9 A;  4O4L E;  3PV0 F;  4UV9 B;  3KV6 A;  1YW0 A;  2V6Y A;  4IE6 A;  2W0G A;  3RI5 A;  3NKZ A;  2YDQ A;  3OVU A;  2I6H A;  4DND A;  2XSB A;  4HFE A;  2XY8 B;  5FL0 A;  2WZI A;  2FBW A;  5FP3 A;  3QUJ A;  5AQQ B;  3ABV A;  4UR9 A;  1NEK A;  2CEA A;  4OYJ A;  3R6N A;  1J5W A;  2J4G A;  1CUN A;  5IHY A;  3AXJ A;  1HF8 A;  3K8P C;  5HEO A;  1KK7 A;  4DBQ A;  5C3J A;  5JR9 C;  4O4J E;  1HNX T;  4ZOL E;  4LFA T;  4ZS3 A;  3LJC A;  4ADZ A;  2XSA A;  3B57 A;  4EXT A;  5HXH A;  4CN1 A;  2N9D A;  2PG8 A;  1MMG A;  1U4Q A;  2VL8 A;  4GYS A;  3RIU A;  4DBR A;  1L0V A;  1WLX A;  3L09 A;  3P4P A;  1WR6 A;  4EYY R;  1XDP A;  4DV1 T;  5HYA A;  1UUS A;  4EEB A;  1G8X A;  2Q9Q B;  5LHH B;  3F31 A;  5BR8 T;  4DR2 T;  2CM0 A;  2K9A A;  2EHO C;  1D1B A;  2M6B A;  5L3C B;  1W0B A;  2BBH A;  3RIU C;  3L3P A;  3ZYL A;  4ZEY A;  2XAJ B;  3AEG A;  3PUV F;  4YY3 T;  4DV2 T;  4CXY A;  2M67 A;  3Q5W A;  4TV9 E;  1KNZ A;  3VU7 H;  3TLS A;  5CJ5 A;  3LK3 B;  4LF8 T;  4A98 A;  1J1J A;  5DQV A;  2WB5 A;  3CPZ A;  5LA6 E;  4ZZB A;  2CLY B;  5LHG B;  3MZK B;  4I4T E;  2HH7 A;  3BQI A;  5FY7 A;  4EZ4 A;  5FNV E;  4NIQ A;  5ABG A;  4LF4 T;  4COF A;  2I59 A;  2PBI A;  5L3F B;  4QX7 B;  2YOE A;  4XAX B;  1V9D A;  2YEV C;  5LB7 B;  3FBZ A;  2JJ9 A;  2VKH A;  4DV7 T;  4X20 E;  3GA8 A;  2VUR A;  5HXR A;  3ZMZ B;  1MIY A;  4YSX A;  1SUM B;  2XQ9 A;  4LMK A;  4DR6 T;  2DWK A;  2HN1 A;  2VKD A;  2XQ4 A;  3C4W A;  5C2T A;  3OTO T;  1MND A;  2WDQ A;  1SHZ C;  3CKD A;  3MK7 C;  4YFS A;  4Z91 A;  5L3B B;  1WRD A;  1FIO A;  4HWD A;  2Y6X A;  3TLU A;  3ZN0 B;  2LEH A;  5JR9 B;  4X1I E;  4HWI B;  3AE5 A;  2M6I A;  4IE4 A;  5FXW A;  5HEU A;  4IL4 A;  3SFE A;  1HCI A;  4JI6 T;  3TLV A;  3J9X 1;  1T7S A;  4ISS A;  5L3D B;  2LSI A;  2V7K A;  2A3D A;  2JQK A;  4MFR A;  2DWG A;  2JMH A;  4UVC B;  1VRB A;  4LF7 T;  3T1Y T;  4LF6 T;  4AKG A;  3N9P A;  3TLW A;  2BKO A;  3KDS E;  1XZY A;  2KWH A;  3ANW A;  3QK6 A;  5FY1 A;  5LGN B;  1J5E T;  4JI3 T;  3AE8 A;  3JC6 D;  3HKB E;  5JR9 A;  3MA9 A;  5AQR B;  2WWV A;  3ZC0 A;  1YXR A;  5JRC A;  2HPL A;  4UIG A;  2BVL A;  3FZH B;  5LP6 E;  5HEG A;  1Y64 B;  3AA1 B;  1UX5 A;  2L8K A;  3N9M A;  2WWU A;  4KUM B;  5EZY E;  3LBX B;  1MNE A;  3UU3 A;  3O1J A;  3ZYK A;  4ZI2 C;  1XMO T;  1HX8 A;  1G73 A;  2BDE A;  4JUY A;  3ZYM A;  1UGO A;  5AQU B;  4DV0 T;  2MAW A;  2B76 A;  1WYB A;  3UU5 A;  3CX8 B;  2UUB T;  3UT5 E;  2WMN A;  2YU1 A;  2BKP A;  4U2Y A;  5J0Z A;  3J7Y q;  3NBX X;  1IBM T;  3KVB A;  2BG9 B;  2C0S A;  2VWA A;  4BAY B;  2QRX A;  2WM9 A;  3NZQ A;  4WW0 A;  4DO0 A;  2YK0 A;  1BR0 A;  4ZXL A;  3LDQ B;  3H3A A;  1XMQ T;  2JIW A;  3C51 A;  3N2K E;  3EAM A;  2XQY A;  5ABF B;  4JEU B;  1H7C A;  2V5C A;  3O1H A;  5HXS A;  2CHO A;  2HHH T;  1S35 A;  1BR1 A;  3RQW A;  2WDV A;  3AED A;  3EVY A;  3P7I A;  4IDQ A;  4IDO A;  4C91 A;  4HWF A;  4UVA B;  3OJA A;  3P4S A;  4AQF C;  4L0R A;  5LMN T;  4K0U A;  3ZJ2 A;  4C90 A;  1FMW A;  3B13 A;  5AQH B;  3ZKR A;  4BJM A;  4HTE A;  1BR2 A;  4CI1 B;  2CHN A;  4DMW A;  3CX6 B;  4DV4 T;  1IBL T;  3VKG A;  4CN4 A;  5HEJ A;  4AKI A;  1IJ5 A;  2W66 A;  2WSS V;  3LFM A;  3N9O A;  2OLT A;  3VHL A;  4IL9 A;  4A97 A;  4E7Z A;  2PFV A;  2LKG A;  3CVR A;  3FB2 A;  3JAD A;  3P8C D;  3OPC A;  3ZLI A;  3HKC E;  2JPF A;  4IDP A;  4UF0 A;  2FJE A;  4H9P C;  2UUA T;  5AQO B;  3AE9 A;  5H6Q B;  5FY0 A;  4NPP A;  4LFC T;  1WR0 A;  5FVK A;  3UFG A;  1MIV A;  1T8B A;  2JQQ A;  2UXD T;  4PK5 A;  5JRC B;  4FI5 A;  1NAF A;  1ZV4 X;  2VAS A;  1LRZ A;  3I0O A;  2MOZ A;  3Q5E A;  5DAB A;  3VR8 A;  5L4E A;  3RIF A;  4JI8 T;  2E5V A;  5A1L A;  2Q9Q D;  4ZZC A;  2BG9 C;  3LBX A;  2IC9 A;  2H88 A;  2X9X A;  3EAB A;  1FJG T;  5M4Y A;  4KI0 F;  4ZS2 A;  1X79 A;  4AXP A;  2V1D B;  1JNZ A;  2W00 A;  5F5W A;  2QA7 A;  2CBJ A;  2SPC A;  3EDV A;  2ZMA A;  3P4R A;  4JEH B;  1IBK T;  1HNZ T;  2W67 A;  2H89 A;  5L3G B;  4EV6 A;  4KMC A;  3AE4 A;  2ZM0 A;  5FL1 A;  5H6R B;  2C5I T;  2X0L B;  3JAE A;  4PNI A;  2Q9Q C;  3PTR B;  2WAU A;  2XM1 A;  3AE6 A;  4TWD A;  4YTM A;  3OKQ A;  4YT0 A;  4G63 A;  3HL6 A;  1MMD A;  4JI4 T;  2ZLY A;  2X9Y A;  2ZM8 A;  3NRX A;  4ERR A;  2CWY A;  2X51 A;  2H3R A;  4F8H A;  2XQA A;  5L4H A;  4ZI3 D;  5E0O A;  4TNW A;  4OX9 T;  5JQG E;  3RRC A;  5HWY A;  3VRB A;  4QWN B;  5HCM A;  3ETV A;  4AIU A;  3CIR A;  4IRE A;  4AIS A;  2LOP A;  1FEW A;  2XAF B;  2Y48 B;  4XZC A;  3CML A;  2G0U A;  4EOZ B;  4YHH T;  3T1H T;  5AQJ B;  2CWO A;  2J62 A;  1M62 A;  2UUC T;  3RLF F;  2V26 A;  2UXC T;  2XQ8 A;  3LK4 2;  2OA5 A;  5LGU B;  1Y01 A;  2UXB T;  3JAF A;  3Q9D A;  3C64 A;  3NZP A;  1WYC A;  3RX6 A;  2XAG B;  2D0T A;  3PJA A;  3X1D A;  2WBL A;  5JDM A;  4HN9 A;  2E9X C;  2LM9 A;  3IBP A;  3OBV E;  4WZX A;  3RF1 A;  3C4Z A;  3ZJ1 A;  4DR1 T;  4B3T T;  2PTF A;  3ZMS B;  5AFU L;  2X0H A;  3DP7 A;  3F2E A;  3ZPO A;  2X9W A;  3ESL A;  4AKR B;  2XM2 A;  2Q9Q A;  2NR4 A;  5AQV B;  3FZK B;  3AE3 A;  1MMA A;  2VVS A;  2YDR A;  3KV9 A;  3M3Z B;  3M65 A;  2MBG A;  4O4I E;  2ACZ A;  3MAC A;  3RQU A;  5IWA T;  4K0K T;  1WFD A;  2XAS B;  5CA1 E;  5KX5 E;  5EK4 A;  5L2L A;  2BG9 A;  3QOF A;  5CB4 E;  5CFB A;  4QKN A;  5LYJ E;  4X62 T;  2X0Y A;  2LSK A;  2XPK A;  3PJA J;  4HGA A;  5AQL B;  2RA1 A;  4ILB A;  3ZT5 A;  4LFB T;  4DUZ T;  2Z6E A;  3WAJ A;  4JI0 T;  2IAK A;  3ZCI A;  4CZZ B;  4CN6 A;  2E9X D;  4NUU A;  3ZC1 A;  2LRK A;  4QX8 B;  3WI3 A;  3UUB A;  2WCA A;  5F8P A;  4JV5 T;  1VCS A;  2ES0 A;  1T72 A;  3GN5 A;  4MHC A;  2BS4 A;  4NUV A;  3V5U A;  4B3S T;  1HR0 T;  4G2A A;  4TX5 A;  5LMU T;  1WCR A;  3U3I A;  2D0U A;  2LRL A;  5AQN B;  1ZOY A;  4J2C A;  4PFO A;  4JI2 T;  2BVM A;  1CHU A;  2WU5 A;  3CQC B;  4CXX A;  5KMG P;  2YDS A;  2VVN A;  4TNV A;  1HFA A;  3UQ7 A;  5LBM A;  4XBF B;  2KIN B;  2DLR A;  3N2O A;  2EHO B;  4Z90 A;  1XNQ T;  4V1A v;  3RHW A;  3E08 A;  4B3M T;  3C50 A;  3D0T A;  2KND A;  2Y8D A;  4MBQ A;  4AQG A;  1AJ3 A;  2X68 A;  3GWH A;  5LOV E;  3U78 A;  2KWI B;  3L39 A;  2FJA A;  2K24 A;  2V6Y B;  4A5X A;  2XAQ B;  1NWM X;  4PAG A;  5HAX A;  3UU4 A;  3KVA A;  3Q5D A;  4EAH A;  1SE7 A;  3OYZ A;  3RIA A;  2CMR A;  2KLQ A;  1Z8U A;  4I50 E;  3TLT A;  4PK6 A;  4ANJ A;  5CA0 E;  4IIJ E;  1VOM A;  2WDR A;  4EYU A;  1D1C A;  3NWI A;  3W15 B;  2VL0 A;  3P50 A;  2DNX A;  3K1S A;  3N9L A;  2V5D A;  5AQT B;  4P1N A;  3ZMT B;  3AE2 A;  1KF6 A;  2WZH A;  3NRY A;  3WAK A;  4P0A A;  4DR4 T;  4JI5 T;  3FXD B;  4KP3 C;  4YHJ A;  1SA0 E;  2ODU A;  4X66 T;  5GON E;  4KHP T;  4IDZ A;  2A9U A;  3UTK A;  2LSY A;  3SS1 A;  3N5L A;  2LSG A;  3ONX A;  1R8I A;  2NOX A;  2BG9 E;  4LML A;  2DCF A;  3MKD A;  5FKY A;  4AKL A;  4YTN A;  5J2U E;  1YQ4 A;  2UXX B;  4YJ3 E;  2V7M A;  5L3E B;  2DI4 A;  2W62 A;  3Q2M A;  4I0U A;  3RRW A;  2HN2 A;  2KT9 A;  1UUR A;  2ACX A;  3ZST A;  4EIW A;  2F4V T;  1OWA A;  3RYC E;  5J2T E;  3N2G E;  2IUB A;  5AQK B;  3VRA A;  5ABE A;  5JTG A;  2CA5 A;  5L47 A;  4NXN T;  2WY2 A;  2BS2 A;  2FJB A;  4X5T A;  4BJN A;  2N2N A;  2KSR A;  2I0M A;  2J47 A;  3AEB A;  3HKD E;  3AE1 A;  3ZT7 A;  3I0Q A;  4O8S A;  2D2S A;  2JQH A;  2CLY C;  3P4Q A;  3AEF A;  4ZI3 C;  5IUX A;  1YKH B;  4GIW A;  2WQY A;  2IML A;  3G06 A;  1JNR A;  3H3M A;  4BA9 A;  4TWH A;  4CI2 B;  5F3J A;  5LXT E;  5AQS B;  3RYH E;  1LVF A;  5LG3 A;  3HI2 A;  3RKG A;  1X9B A;  3O1I A;  2VQF T;  2PJQ A;  3CQX C;  2NTY A;  1OED B;  3Q5X A;  5KDM C;  1OED E;  2LJL A;  4I55 E;  1W9R A;  3HKE E;  5FVL A;  3ONL C;  4MAL A;  4YTP A;  4JI7 T;  4Z8X A;  4QHO A;  1KFY A;  4PW8 A;  4PFP A;  3UUX B;  2LHN A;  3H37 A;  1W09 A;  2FUP A;  4HFD A;  1HG5 A;  4UV8 B;  2IW5 B;  5LG4 A;  3DTO A;  2DHR A;  5HWX A;  4LF5 T;  4HFB A;  3V5S A;  3A8Y C;  3MXZ A;  3S4U A;  3FZF B;  3E22 E;  2OV9 A;  5EK3 A;  5ETW A;  3R84 B;  2K48 A;  1D0X A;  1QLB A;  2UXN B;  3PUR A;  4OHF A;  4PJN A;  4UXN B;  3ZMV B;  5LJN A;  2LM2 A;  3C98 B;  4P09 A;  2QGS A;  2VKJ A;  2MYS A;  4AQY T;  4IST A;  2H7V C;  4HKA A;  4DV5 T;  1E1H B;  3RH3 A;  3AA0 B;  4OYK A;  4IE5 A;  3LK2 B;  2XAH B;  2V7L A;  4Q25 A;  5JRE A;  1N32 T;  4JLE A;  4U7I A;  4U7Y A;  1HNW T;  4HWC A;  2B1E A;  2WMO A;  3AEA A;  3JC6 C;  4ZHQ E;  4LF9 T;  3UQ4 A;  4U3C A;  2D5U A;  3EI0 A;  1XWM A;  3AAI A;  4UVB B;  1N34 T;  4GK5 E;  1US7 B;  4WBN E;  5FYM A;  2D9D A;  3L8R A;  5HEH A;  1QUU A;  4H9Q C;  4O4H E;  3RPU A;  5JDN A;  1T98 A;  1KEY A;  5LJM A;  2W61 A;  2XTL A;  2ZM2 A;  2XZE A;  3PUS A;  3GMI A;  1IZN B;  2VB6 A;  3PUG A;  4F6R C;  4ZI7 E;  1IAP A;  2LLY A;  5HXC A;  4HFC A;  3ANW B;  1YKE B;  3UUL A;  5FXX A;  3SWH A;  3GN5 B;  2P9B A;  3I9Y A;  2K3W A;  2W4X A;  2XQ7 A;  3PUZ F;  2NP9 A;  3RYI E;  3UUN A;  3SOL A;  1HG2 A;  3PUA A;  4WYV A;  3PU8 A;  2IC6 A;  4HWH A;  4JBW F;  4QH1 A;  4KX6 A;  2R6G F;  4U72 A;  4X64 T;  4B3R T;  2A2F X;  2V7I A;  2X67 A;  3FZL B;  3JCF A;  1E2A A;  3BQL A;  1IJ6 A;  3ZCJ A;  5FXZ A;  5CGM A;  3CK6 A;  2ODV A;  2IHR 1;  2L9Q A;  4IDN A;  1UK5 A;  5JDF A;  3TKL B;  4CXW A;  4YXD A;  3K3O A;  1B7T A;  3FBL A;  4UEL A;  1W0A A;  2GK9 A;  4TZ4 C;  2NW8 A;  1NEN A;  2E2A A;  3AB3 B;  1FMV A;  4L9I A;  2BBJ A;  5AQP B;  2LT3 A;  2JMK A;  2YU2 A;  2EHO A;  3ZSS A;  3AXJ B;  4E7S A;  2E5L T;  4IE0 A;  1MMN A;  2MTQ A;  2QVA A;  2VK9 A;  4H9O C;  3HA4 A;  4QXH B;  4YSY A;  2RPA A;  3AVS A;  3DJB A;  3AAE B;  1ZP0 A;  3K3N A;  4O2B E;  3RC8 A;  2KMF A;  2XQ3 A;  2AE9 A;  5C8Y E;  4GK0 E;  4OFZ A;  4I43 B;  2CXL A;  2NTX A;  1XNR T;  3E0Z A;  2NW9 A;  2XHE B;  4X1K E;  4N78 D;  2E9X B;  4MLK A;  2LKH A;  3QB5 A;  4PJM A;  3ETU A;  1I94 T;  4TN7 B;  1BR4 A;  4JI1 T;  4U2Z A;  3FZM B;  4WBO A;  1KNP A;  2XJ7 A;  4EGW A;  3AAA B;  3K3Q C;  2LE8 A;  4H63 V;  2BKN A;  3LG7 A;  1OED C;  3PDY A;  1D1A A;  4X1Y E;  3ZN1 B;  4ASK A;  5ADX L;  3HR0 A;  3SFD A;  4OK0 A;  4KBM B;  3EHZ A;  3VR9 A;  3N9N A;  3PUY F;  2CRB A;  4QH4 A;  2K5B B;  5KXJ A;  2CPT A;  5ABF A;  2XUE A;  4EED A;  2E9X A;  3QB5 K;  4L5G A;  5JDH A;  2UU9 T;  4HFI A;  4EB6 E;  2V7J A;  4QXC B;  3VKH A;  3UUM A;  4X65 T;  3ONJ A;  4FJO A;  1D0Z A;  4EZH A;  1O3X A;  2VQE T;  5LHI B;  2N1G A;  2JRK A;  2W2U A;  3C4X A;  5IYZ E;  3ZEF B;  2IIU A;  1HX1 B;  4H9N C;  1VCT A;  5FXV A;  1E7P A;  4A56 A;  5AQF B;  3QC9 A;  2MPK A;  4QXB B;  5AQG B;  4DUY T;  4DV3 T;  2BS3 A;  1OXZ A;  5HCJ A;  3KIN B;  2EHO D;  3AEC A;  5JH7 E;  3F57 A;  5DJQ C;  5BMV E;  3A7M A;  3AA6 B;  4IGU A;  2C5K T;  5JDL A;  3IHR A;  1EZ3 A;  1YQ3 A;  3EUH A;  1U5P A;  4PJJ A;  4TWF A;  4YLH A;  2XQ5 A;  3UFE A;  5LNK A;  2LSJ A;  4AKH A;  1DU2 A;  4CI3 B;  1ZHC A;  3UU8 A;  3AA7 B;  5EK2 A;  3ZMU B;  4NXM T;  4AQF A;  5J1G A;  5LGT B;  2YIN A;  2L3L A;  3NVO A;  2H7O A;  1GQE A;  2JQ9 A;  4QH5 A;  3ZT6 A;  2CBI A;  4PK4 A;  4U33 A;  2LOS A;  3O9X A;  4HE8 A;  1LVK A;  1UX4 A;  2NW7 A;  3KV4 A;  4DVD A;  2AXD S;  2V8S V;  2X66 A;  2CCQ A;  1ZEE A;  4M1P A;  2DL1 A;  2CE7 A;  2NWB A; 
#chains in the Genus database with same CATH homology
 1HX1 B;  4HWH A;  5AQQ B;  3LDQ B;  3FZL B;  5AQV B;  4HWC A;  5AQG B;  5AQF B;  5AQO B;  5AQI B;  3FZK B;  3M3Z B;  1UK5 A;  1M7K A;  5AQR B;  3FZM B;  2D9D A;  4HWF A;  3FZH B;  5AQL B;  5AQK B;  3A8Y C;  5AQJ B;  1M62 A;  5AQP B;  3FZF B;  5AQH B;  5AQM B;  5AQT B;  4HWD A;  1UGO A;  5AQU B;  1I6Z A;  4HWI B;  5AQN B;  1T7S A;  5AQS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...