5AQLB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
b'LGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 45
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqlB00
1I6ZA 5AQFB 5AQPB 3FZFB 5AQKB 5AQJB 4HWFA 4HWCA 1M62A 5AQOB 5AQSB 2D9DA 5AQTB 5AQHB 3FZMB 3M3ZB 5AQUB 4HWIB 1M7KA 5AQLB 5AQNB 1UGOA 5AQRB 3A8YC 1UK5A 5AQGB 5AQMB 3FZHB 3FZLB 5AQQB 3LDQB 1T7SA 5AQIB 4HWDA 3FZKB 1HX1B 4HWHA 5AQVB
chains in the Genus database with same CATH superfamily
1KK7A 4IT4A 2WDVA 3DJBA 2FJAA 2YDRA 4TUYE 2V1DB 1T72A 4EYYR 4EZHA 3RYFE 1WFDA 2NW9A 1FJGT 2JQ9A 1XMOT 2MOZA 3AE1A 3LK3B 5AQHB 2PBIA 2WDRA 5AQNB 2XQ7A 3O1JA 2VK9A 4HFBA 3I0OA 4EV6A 3RGLA 5LHIB 5JRCB 1GQEA 2B1EA 4ZOLE 4O2BE 2V6XA 4IDNA 4KMCA 3AECA 4NIQA 4QX8B 5ETWA 2L8KA 3AAEB 3EI0A 5FVKA 4U33A 1ZHCA 4ZI3D 2J4GA 3RIFA 3PDYA 5L47A 3A8YC 5AQGB 5GONE 2XHEB 5HAXA 3AA6B 1D0ZA 3V5SA 4EYUA 1D1BA 3AA1B 4H9NC 4ISTA 4BAYB 1IJ5A 4PW8A 3LBXB 2WCAA 2VKDA 3VRBA 1MMGA 4WYVA 4DR6T 2CM0A 3RYCE 4U7IA 5ABFB 1D0XA 2WMNA 5LXTE 1FIOA 5IHYA 3SFEA 4IE7A 3C4ZA 4CI3B 4DV4T 3HKDE 3UU5A 2M67A 3WAJA 2YU2A 2NWBA 4X1KE 2D5UA 3ZJ1A 1HF8A 4PJNA 1MIYA 4UR9A 2UUAT 3ETVA 2DL1A 4UEMA 4PJJA 2KWHA 5LP6E 4TX5A 1SUMB 1B7TA 3AE5A 3NZPA 4QH4A 4DBRA 4UF0B 3CX6B 1XNQT 2DNXA 4JI0T 5HXSA 3RHWA 2NR4A 2JMHA 2MYSA 4JYAT 3T1HT 3SRZA 2KZ7B 2JJ9A 2LKGA 1Z8UA 5F8PA 3NVOA 2HN2A 2ACZA 4UF0A 5JDQA 3AEEA 1U5PA 2VL0A 5TAOA 5CFBA 2QA7A 4EAHA 4UVBB 5KMGP 4CI2B 3ZC0A 3AE7A 5CGMA 4JI1T 4OHFA 2LM2A 5EK4A 3OTOT 5DABA 1SE7A 2H7VC 3ZMTB 2XAFB 5J2TE 3F2EA 1NEKA 3AEBA 2LJLA 4PAGA 3MK7C 4GK5E 3PE0A 4DMVA 5JQGE 3UUMA 5AQPB 2IHR1 4MFRA 3ZSTA 2NTYA 3AE9A 4M1PA 3RYHE 2X9HA 4U74A 1WRDA 3AA0B 4BA9A 4F6RC 4ZZBA 2UXCT 1YW0A 1XDPA 5EZYE 4ANJA 2WZIA 5LG4A 4CXWA 2BKOA 3UU4A 2W2UA 3WAKA 1YD8G 5FXXA 3I9WA 3JCFA 4ZZCA 4HWIB 3KVBA 1VOMA 2N1GA 2CXDA 2H3RA 4TV9E 3AE8A 2CE7A 4TZ4C 2XTLA 1LKXA 1D1AA 4DV1T 2XAQB 1M62A 1HG2A 3IHRA 3KFWX 4U2ZA 4X20E 3QOFA 3DTOA 4KUMB 2LOPA 4DV2T 4JUYA 2YINA 2CPTA 5LYJE 3UUNA 4EZ4A 4YTPA 3ZYMA 4JI2T 2OV9A 2PG8A 1J5ET 4QKNA 4CXYA 2ZM8A 3HL6A 2IUBA 3RC8A 3RIAA 1T7SA 3FXEB 2YU1A 4O4IE 3QK6A 1HS7A 4AQGA 2V7IA 2K24A 1R8IA 2FBWA 3TLWA 2V26A 2VKHA 2WWVA 3U3IA 1N34T 4ISSA 4AKHA 3ZJ2A 2XAJB 5FKYA 3A5XA 2D2SA 3BQIA 5AQIB 1J1JA 3FZFB 5AQJB 5LGNB 3M65A 2W63A 3OVUA 3KINB 3M3ZB 5LG3A 4QH5A 5LBMA 3KDSE 5JREA 4YXDA 2FJDA 2LSIA 3BK9A 3SWHA 4KHZF 5CA1E 2MBGA 4ILAA 2K9AA 3OKQA 3B5MA 5HEJA 4PK4A 3UFGA 4X1YE 1N36T 2IDOB 1J5WA 2CLYC 3ZKRA 2BVMA 3UU3A 5HCJA 3KV5A 3N5LA 2CXLA 4LFCT 3EUHA 2X68A 3AE6A 4ZXLA 2XAHB 3OYXA 3QNUA 1HNWT 1UURA 2CHOA 4IREA 2EHOA 3MXZA 2BDEA 3AAIA 4PK5A 5KXJA 1FMVA 4ILCA 3ZMVB 3JC6C 5AQTB 4X66T 4IE5A 3PUVF 2IC9A 2WU2A 1UUSA 1G8XA 5IYZE 1BR4A 1UK5A 2RA1A 4G63A 2YDQA 5HXEA 2WQYA 2WP9A 2X66A 5JVDE 4WW0A 2VVNA 2XM2A 3HKEE 4AQFA 5FP3A 3GN5B 5EK2A 4DO0A 3FBLA 1US7B 5FYMA 2V7MA 2W67A 1MIVA 4JI5T 4WBOA 4ADZA 1LVKA 3UUBA 2R6GF 1HTJF 1MMAA 1I94T 5FL1A 3IEEA 4QX7B 2V7JA 3C51A 4JI8T 3R84B 2J47A 4U2YA 4H9SE 2ZMAA 1ZEEA 2X0LB 2M6BA 3KV6A 3KV9A 4LMLA 2W66A 4TWFA 5DJQC 2UXNB 2W00A 4HFEA 4ZHQE 4OYJA 2UUCT 4X62T 5FXZA 3RIUA 4LFBT 5JDHA 2J1DG 1D0YA 2BS4A 2CEAA 4IDOA 5F3JA 2KWIB 1X79A 3HKCE 1IBMT 3RH3A 3MACA 3D0TA 3ZT5A 3L8RA 4JEHB 1QUUA 2LHNA 3ZCJA 1UGOA 4FJOA 2XPKA 4UIGA 5L4EA 2WBLA 4PJMA 4GIWA 4A56A 3W15B 3GA8A 2XQ8A 3O1HA 2WWUA 3VR9A 3L09A 5LGUB 2E9XB 4JI4T 3ZPOA 4K0UA 4EIWA 2KXPB 2XQ6A 2KNDA 1I6ZA 4EGWA 1CHUA 5J0ZA 2VL8A 5FMNA 5JDGA 3PURA 4YT0A 1M7KA 2E9XA 1MIWA 2MPKA 3EDVA 1XMQT 5LJMA 2A72A 4H9PC 4AISA 2XASB 2XSBA 3QB5A 4I43B 2XM1A 3OYZA 3HKBE 4ZI7E 5AQFB 2ZLYA 3AA7B 3CMLA 4L5GA 2LKHA 5LB7B 4ZS2A 4TN7B 3RX6A 4LMJA 2CXFA 2LHRA 1W09A 3R6NA 1HCIA 4Q25A 3CIRA 4JI3T 4HN9A 3P4SA 5C8YE 4XAXB 4JI6T 4AXPA 2X0HA 1OWAA 5DQVA 2WY2A 4DR7T 4DV3T 4GKKT 5JR9A 2WB5A 4V1Av 4CXXA 2XSAA 4MALA 3N9MA 4EXTA 4IGUA 5AQRB 4TWDA 5HWXA 4IE6A 3Q5EA 3N9OA 2K5BB 3ZN1B 1WLXA 4DV5T 2OLTA 3P8CD 2PFVA 3GMIA 4NUUA 2W61A 5L3DB 4HFCA 2GK9A 4KP3C 3CX8B 5M4YA 4UVCB 3PV0F 1ZV4X 5DQWA 3HA4A 2WZHA 3PU8A 3OJAA 3FB2A 4GOUA 2V8SV 3LDQB 3PUZF 4DIDB 1BR1A 3PTRB 4H63V 4IL9A 3AAAB 2CMRA 1IBKT 3MJXA 1KFYA 5LBQB 2BVLA 1NENA 5LHGB 4DMWA 3KBTA 2E5VA 2OA5A 4YHJA 2P9BA 3PUSA 3ZC1A 3QUJA 4UV8B 3EVYA 2K48A 4IE0A 3AE3A 5FY0A 4IDQA 2WMOA 1KNPA 5L3CB 2IC6A 2UUBT 1ZKEA 3L3PA 2V5DA 3CQCB 2KMFA 4IDZA 5LCYA 1NAFA 4B3TT 1SA0E 3S4UA 2W0GA 3RKGA 2LEHA 3CVRA 1S35A 3X1DA 2A2FX 4P0BA 1Y64B 1X9BA 5HEGA 2E5LT 4B3MT 3EABA 3ONLC 4HWHA 2NTXA 4ZS3A 4HFIA 3UQ7A 3Q9DA 1W9RA 2JQHA 2V7KA 3I9YA 2AXDS 3G06A 4GK0E 3RYIE 3RI5A 4B3RT 1E1HB 3ANWB 1FEWA 4OX9T 4TNWA 4J2CA 3UULA 3A7MA 1KEYA 1YKHB 2Q9QA 2BS2A 4KI0F 3AVSA 3CKDA 4HFDA 4DUYT 3HR0A 4DV6T 5BR8T 4YLHA 4NPPA 2JQQA 2VQFT 5LOVE 5HCMA 4L0RA 5H6RB 3ANWA 2V6YA 2BG9E 2JPFA 3PJAA 3H37A 2DWKA 2JRKA 3RKOA 4LMKA 3NWIA 5L3FB 3C50A 4X5TA 5FXWA 4QH1A 2YK0A 3N9NA 3ONJA 3OPCA 3LK42 3TKLB 5AQQB 2LRKA 1HX1B 4HKAA 2NP9A 3RQUA 3LSVA 4HWFA 4AQYT 3ZT7A 1CUNA 3CQGB 2ZM2A 1HFAA 3FZLB 2VURA 3EAMA 3ZCIA 2QGSA 2XZEA 1T8BA 2MTQA 4LF5T 1HG5A 4NXNT 3I1AA 5HEOA 4GYRA 3PJAJ 1WYCA 3F31A 3LFMA 3RQWA 4UELA 2EHOC 2KSRA 4EB6E 5AQMB 5CJ5A 5ABHA 1KNRA 3ZN0B 2L9QA 4KHPT 1JNRA 2RP4A 2H7OA 4GKJT 1OEDA 4YTNA 4A5XA 2JQKA 4LF6T 2Y48B 4QXBB 4BJMA 1O3XA 1MMNA 3TLTA 2X9XA 4YJ2E 5FL0A 2J62A 3C98B 4LF7T 2YEVC 4UVAB 2V5CA 5HXRA 2A9UA 2KT9A 4X64T 1IZNB 4UV9B 5CB4E 4AQFC 5ABGA 5HEHA 4ZI3C 2W62A 3B13A 3U78A 2LSYA 3ESLA 4ERRA 4XBFB 3K3NA 2EHOB 4HFVA 3JAEA 4PNIA 3FZKB 4C91A 4F8HA 2LT3A 3SFDA 1E7PA 2ODVA 3H3MA 4DR1T 4IDPA 3ZMZB 2I59A 2H89A 2Z6EA 4ASKA 5ADXL 2FUPA 3AEDA 3FZMB 2XQ3A 4O8SA 4P1NA 2XAGB 1L0VA 3SOLA 4IL4A 3RIUC 1IAPA 4AKIA 3ZT6A 2X9WA 2LSKA 4JI7T 2CBJA 2VWAA 2WS3A 4QXHB 2BG9B 4B3ST 4LFAT 3BQLA 3PUXF 3E22E 5LMUT 5F5WA 2NOXA 1HR0T 4P0AA 1XWMA 2HPLA 2D9DA 2BG9A 1UX4A 5FVLA 3QB5K 5J2UE 4NXMT 2XQ5A 3CPZA 3RPUA 4U3CA 4YHHT 4U7YA 4WZXA 4ILBA 4C90A 2YOEA 4DUZT 2E9XC 4JBWF 3F57A 3PUGA 3VKHA 3UTKA 3AEGA 1BR0A 1IJ6A 2FJEA 3FHNA 4Z91A 3JAFA 4O4JE 3N9LA 4YY3T 3J7Yq 2NW7A 1G73A 2I0MA 5J1GA 3TLVA 4KBMB 3QC9A 2LRLA 3OBVE 3PU3A 5ABEA 4KX6A 5FNVE 3FXDB 3AE2A 5JR9C 2CWYA 1MMDA 2IMLA 1FMWA 1Z0PA 3LK2B 4HWCA 2VKJA 2BKNA 2LLYA 2VASA 4ILUA 3Q5DA 5AQLB 2EHOD 5FY7A 1V9DA 5L3GB 4AKRB 2ES0A 2D0TA 4TNVA 2IAKA 3IA3A 3K8PC 5JDNA 4JEUB 3VRAA 3VKGA 5BMVE 3CK6A 4CN6A 5AQUB 2CWOA 3P50A 1U4QA 2HH7A 3P7IA 2IW5B 1XZYA 4YFSA 2C5IT 5KX5E 2C0SA 5JR9B 3IBPA 4H9QC 2CRBA 2WAUA 4FI5A 2VQET 2E8IA 2JMKA 3UFEA 3ABVA 5JRCA 2X0YA 2WSSV 1QLBA 4OYKA 4QWNB 3K3QC 3ZYKA 4COFA 2MAWA 5JDFA 4YSZA 1VCTA 2F4VT 2QYWA 4BJNA 4A97A 4Z8XA 2BBHA 2N2NA 3I0QA 4OK0A 2XQYA 2X51A 1T98A 3EDUA 2XQ4A 1IBLT 2W4XA 4U72A 3SS1A 5EK3A 5LNKA 3UU6A 4E7SA 1LRZA 4AKGA 2C5KT 3JC6D 5E0OA 2SPCA 1BR2A 3O4XE 3N9PA 2WU5A 4IHJE 3NRYA 3LBXA 5LA6E 2WDQA 3T8OA 3NBXX 3TLSA 4PK6A 4EOZB 1OEDE 2AE9A 2BKPA 4JLEA 1N32T 4HEAA 2CHNA 5FY1A 3UUXB 2I6HA 5LGTB 1VCSA 1MNEA 5ABFA 4DR5T 4H63H 4N78D 3P4WA 3VU7H 3PUWF 3ZSSA 2HPJA 2BBJA 2X67A 4I50E 1YQ3A 2X9YA 2WM9A 4OFZA 1YXRA 2L3LA 3KV4A 1W0BA 3E0ZA 3PUYF 3ZEFB 1D1CA 4NUVA 3N2OA 2ZM6T 2C5JA 4QXCB 3V5UA 2IIUA 3PUQA 2Q9QC 3UQ4A 2UU9T 3MKDA 3ONXA 5HEUA 4G2AA 4TV8E 3NKZA 5L3BB 4DV7T 2Y8DA 4HFHA 2HHHT 3UU8A 5JTGA 2XUEA 2B76A 4P09A 2K3WA 4YSXA 4ZI2C 2DLRA 3NRXA 4XZCA 2VVSA 5AQSB 3CQXC 4PFPA 2E9XD 4X65T 2VB6A 1H7CA 1XNRT 2BZBA 4CZZB 3FZHB 2KINB 3AXJB 3K1SA 2KLQA 4HWDA 3Q5WA 2ACXA 3C64A 4DBQA 2Q9QB 3L39A 5L3EB 5AQKB 5C3JA 5A1LA 2Y6XA 3MZKB 4LF8T 3O1IA 5LJNA 2DCFA 1OXZA 3RRWA 5L2LA 5HXHA 5JDLA 4O4HE 2V6YB 3AXJA 2UXDT 3TLUA 4EEDA 4ZEYA 4JV5T 2YN6A 4MBQA 3CX7B 4IIJE 2XY8B 1HNXT 2YDSA 3N2GE 4CN1A 3C4XA 5KDMC 2LSJA 5JDMA 5LMNT 3N9QA 4DR2T 1YQ4A 2LSGA 4H9RC 3ZLIA 3AEFA 3AE4A 4MHCA 4AIUA 2N9DA 4I4TE 1OEDC 5HWYA 1Y01A 2ZM0A 2YKSA 3AB3B 3GWHA 3IF8B 3LJCA 4I55E 4Z90A 4O4LE 3P4PA 4DV0T 2CBIA 1NWMX 1QSDA 3C4WA 5AQOB 4K0KT 3EHZA 4AI6A 2LM9A 1W0AA 2RPAA 2DI4A 2QRXA 4E7ZA 1LVFA 4HTEA 2CCQA 3JADA 1KF6A 4WBNE 5L4HA 3O9XA 4CN4A 3ZMUB 1OEDB 2QVAA 4PJLA 4DR3T 2XQAA 1E2AA 3KBUA 2M6IA 1WR0A 2DWGA 2BS3A 1WCRA 2PTFA 1UCUA 4CI1B 1SHZC 1MNDA 5CA0E 4TWHA 3Q2MA 1HX8A 2DHRA 3RLFF 3N2KE 3RC3A 2G0UA 4U31A 1HNZT 3VR8A 4L9IA 4YTMA 3B57A 5HYAA 1DU2A 2HN1A 1YKEB 1N33T 5C2TA 3ETUA 4DNDA 2XJ7A 2VKOA 1UX5A 2A3DA 2Q9QD 2NW8A 2CA5A 4LF4T 4PFOA 2BG9C 3HI2A 4WNKA 5IWAT 4H9OC 2LE8A 2JIWA 1ZP0A 2V7LA 4HGAA 2PJQA 4GYSA 2D0UA 4ZI2D 3P4QA 2LOSA 3CWZB 3MA9A 2UXBT 4B6XA 5JH7E 4YSYA 1KNZA 3FBZA 4O2AE 1WR6A 5HXCA 4LF9T 3J9X1 3PUAA 3NZQA 5H6QB 1WYBA 4AKLA 1EZ3A 5IUXA 3AVRA 2XQ9A 2CLYB 4DR4T 2H88A 4QHOA 4IE4A 4CQIA 3WI3A 4A98A 3ZMSB 5AQVB 3AEAA 4EEBA 1S94A 5LHHB 4HE8A 3Q5XA 3UT5E 3K3OA 2FJBA 3RRCA 3DP7A 4MLKA 2ODUA 3BQKA 3T1YT 3E08A 2UXXB 3P4RA 3LG7A 3KVAA 5AFUL 4UXNB 1XDOA 5FXVA 3VHLA 3H3AA 1AJ3A 1ZOYA 4X1IE 1JNZA 4DVDA 3GN5A 3ZYLA 2E2AA 3RF1A 4YJ3E 1VRBA 4I0UA
chains in the Genus database with same CATH topology
1I6ZA 5AQFB 5AQPB 3FZFB 5AQKB 5AQJB 4HWFA 4HWCA 1M62A 5AQOB 5AQSB 2D9DA 5AQTB 5AQHB 3FZMB 3M3ZB 5AQUB 4HWIB 1M7KA 5AQLB 5AQNB 1UGOA 5AQRB 3A8YC 1UK5A 5AQGB 5AQMB 3FZHB 3FZLB 5AQQB 3LDQB 1T7SA 5AQIB 4HWDA 3FZKB 1HX1B 4HWHA 5AQVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  5AQF B;  5AQP B;  3FZF B;  5AQK B;  5AQJ B;  4HWF A;  4HWC A;  1M62 A;  5AQO B;  5AQS B;  2D9D A;  5AQT B;  5AQH B;  3FZM B;  3M3Z B;  5AQU B;  4HWI B;  1M7K A;  5AQL B;  5AQN B;  1UGO A;  5AQR B;  3A8Y C;  1UK5 A;  5AQG B;  5AQM B;  3FZH B;  3FZL B;  5AQQ B;  3LDQ B;  1T7S A;  5AQI B;  4HWD A;  3FZK B;  1HX1 B;  4HWH A;  5AQV B; 
#chains in the Genus database with same CATH topology
 1KK7 A;  4IT4 A;  2WDV A;  3DJB A;  2FJA A;  2YDR A;  4TUY E;  2V1D B;  1T72 A;  4EYY R;  4EZH A;  3RYF E;  1WFD A;  2NW9 A;  1FJG T;  2JQ9 A;  1XMO T;  2MOZ A;  3AE1 A;  3LK3 B;  5AQH B;  2PBI A;  2WDR A;  5AQN B;  2XQ7 A;  3O1J A;  2VK9 A;  4HFB A;  3I0O A;  4EV6 A;  3RGL A;  5LHI B;  5JRC B;  1GQE A;  2B1E A;  4ZOL E;  4O2B E;  2V6X A;  4IDN A;  4KMC A;  3AEC A;  4NIQ A;  4QX8 B;  5ETW A;  2L8K A;  3AAE B;  3EI0 A;  5FVK A;  4U33 A;  1ZHC A;  4ZI3 D;  2J4G A;  3RIF A;  3PDY A;  5L47 A;  3A8Y C;  5AQG B;  5GON E;  2XHE B;  5HAX A;  3AA6 B;  1D0Z A;  3V5S A;  4EYU A;  1D1B A;  3AA1 B;  4H9N C;  4IST A;  4BAY B;  1IJ5 A;  4PW8 A;  3LBX B;  2WCA A;  2VKD A;  3VRB A;  1MMG A;  4WYV A;  4DR6 T;  2CM0 A;  3RYC E;  4U7I A;  5ABF B;  1D0X A;  2WMN A;  5LXT E;  1FIO A;  5IHY A;  3SFE A;  4IE7 A;  3C4Z A;  4CI3 B;  4DV4 T;  3HKD E;  3UU5 A;  2M67 A;  3WAJ A;  2YU2 A;  2NWB A;  4X1K E;  2D5U A;  3ZJ1 A;  1HF8 A;  4PJN A;  1MIY A;  4UR9 A;  2UUA T;  3ETV A;  2DL1 A;  4UEM A;  4PJJ A;  2KWH A;  5LP6 E;  4TX5 A;  1SUM B;  1B7T A;  3AE5 A;  3NZP A;  4QH4 A;  4DBR A;  4UF0 B;  3CX6 B;  1XNQ T;  2DNX A;  4JI0 T;  5HXS A;  3RHW A;  2NR4 A;  2JMH A;  2MYS A;  4JYA T;  3T1H T;  3SRZ A;  2KZ7 B;  2JJ9 A;  2LKG A;  1Z8U A;  5F8P A;  3NVO A;  2HN2 A;  2ACZ A;  4UF0 A;  5JDQ A;  3AEE A;  1U5P A;  2VL0 A;  5TAO A;  5CFB A;  2QA7 A;  4EAH A;  4UVB B;  5KMG P;  4CI2 B;  3ZC0 A;  3AE7 A;  5CGM A;  4JI1 T;  4OHF A;  2LM2 A;  5EK4 A;  3OTO T;  5DAB A;  1SE7 A;  2H7V C;  3ZMT B;  2XAF B;  5J2T E;  3F2E A;  1NEK A;  3AEB A;  2LJL A;  4PAG A;  3MK7 C;  4GK5 E;  3PE0 A;  4DMV A;  5JQG E;  3UUM A;  5AQP B;  2IHR 1;  4MFR A;  3ZST A;  2NTY A;  3AE9 A;  4M1P A;  3RYH E;  2X9H A;  4U74 A;  1WRD A;  3AA0 B;  4BA9 A;  4F6R C;  4ZZB A;  2UXC T;  1YW0 A;  1XDP A;  5EZY E;  4ANJ A;  2WZI A;  5LG4 A;  4CXW A;  2BKO A;  3UU4 A;  2W2U A;  3WAK A;  1YD8 G;  5FXX A;  3I9W A;  3JCF A;  4ZZC A;  4HWI B;  3KVB A;  1VOM A;  2N1G A;  2CXD A;  2H3R A;  4TV9 E;  3AE8 A;  2CE7 A;  4TZ4 C;  2XTL A;  1LKX A;  1D1A A;  4DV1 T;  2XAQ B;  1M62 A;  1HG2 A;  3IHR A;  3KFW X;  4U2Z A;  4X20 E;  3QOF A;  3DTO A;  4KUM B;  2LOP A;  4DV2 T;  4JUY A;  2YIN A;  2CPT A;  5LYJ E;  3UUN A;  4EZ4 A;  4YTP A;  3ZYM A;  4JI2 T;  2OV9 A;  2PG8 A;  1J5E T;  4QKN A;  4CXY A;  2ZM8 A;  3HL6 A;  2IUB A;  3RC8 A;  3RIA A;  1T7S A;  3FXE B;  2YU1 A;  4O4I E;  3QK6 A;  1HS7 A;  4AQG A;  2V7I A;  2K24 A;  1R8I A;  2FBW A;  3TLW A;  2V26 A;  2VKH A;  2WWV A;  3U3I A;  1N34 T;  4ISS A;  4AKH A;  3ZJ2 A;  2XAJ B;  5FKY A;  3A5X A;  2D2S A;  3BQI A;  5AQI B;  1J1J A;  3FZF B;  5AQJ B;  5LGN B;  3M65 A;  2W63 A;  3OVU A;  3KIN B;  3M3Z B;  5LG3 A;  4QH5 A;  5LBM A;  3KDS E;  5JRE A;  4YXD A;  2FJD A;  2LSI A;  3BK9 A;  3SWH A;  4KHZ F;  5CA1 E;  2MBG A;  4ILA A;  2K9A A;  3OKQ A;  3B5M A;  5HEJ A;  4PK4 A;  3UFG A;  4X1Y E;  1N36 T;  2IDO B;  1J5W A;  2CLY C;  3ZKR A;  2BVM A;  3UU3 A;  5HCJ A;  3KV5 A;  3N5L A;  2CXL A;  4LFC T;  3EUH A;  2X68 A;  3AE6 A;  4ZXL A;  2XAH B;  3OYX A;  3QNU A;  1HNW T;  1UUR A;  2CHO A;  4IRE A;  2EHO A;  3MXZ A;  2BDE A;  3AAI A;  4PK5 A;  5KXJ A;  1FMV A;  4ILC A;  3ZMV B;  3JC6 C;  5AQT B;  4X66 T;  4IE5 A;  3PUV F;  2IC9 A;  2WU2 A;  1UUS A;  1G8X A;  5IYZ E;  1BR4 A;  1UK5 A;  2RA1 A;  4G63 A;  2YDQ A;  5HXE A;  2WQY A;  2WP9 A;  2X66 A;  5JVD E;  4WW0 A;  2VVN A;  2XM2 A;  3HKE E;  4AQF A;  5FP3 A;  3GN5 B;  5EK2 A;  4DO0 A;  3FBL A;  1US7 B;  5FYM A;  2V7M A;  2W67 A;  1MIV A;  4JI5 T;  4WBO A;  4ADZ A;  1LVK A;  3UUB A;  2R6G F;  1HTJ F;  1MMA A;  1I94 T;  5FL1 A;  3IEE A;  4QX7 B;  2V7J A;  3C51 A;  4JI8 T;  3R84 B;  2J47 A;  4U2Y A;  4H9S E;  2ZMA A;  1ZEE A;  2X0L B;  2M6B A;  3KV6 A;  3KV9 A;  4LML A;  2W66 A;  4TWF A;  5DJQ C;  2UXN B;  2W00 A;  4HFE A;  4ZHQ E;  4OYJ A;  2UUC T;  4X62 T;  5FXZ A;  3RIU A;  4LFB T;  5JDH A;  2J1D G;  1D0Y A;  2BS4 A;  2CEA A;  4IDO A;  5F3J A;  2KWI B;  1X79 A;  3HKC E;  1IBM T;  3RH3 A;  3MAC A;  3D0T A;  3ZT5 A;  3L8R A;  4JEH B;  1QUU A;  2LHN A;  3ZCJ A;  1UGO A;  4FJO A;  2XPK A;  4UIG A;  5L4E A;  2WBL A;  4PJM A;  4GIW A;  4A56 A;  3W15 B;  3GA8 A;  2XQ8 A;  3O1H A;  2WWU A;  3VR9 A;  3L09 A;  5LGU B;  2E9X B;  4JI4 T;  3ZPO A;  4K0U A;  4EIW A;  2KXP B;  2XQ6 A;  2KND A;  1I6Z A;  4EGW A;  1CHU A;  5J0Z A;  2VL8 A;  5FMN A;  5JDG A;  3PUR A;  4YT0 A;  1M7K A;  2E9X A;  1MIW A;  2MPK A;  3EDV A;  1XMQ T;  5LJM A;  2A72 A;  4H9P C;  4AIS A;  2XAS B;  2XSB A;  3QB5 A;  4I43 B;  2XM1 A;  3OYZ A;  3HKB E;  4ZI7 E;  5AQF B;  2ZLY A;  3AA7 B;  3CML A;  4L5G A;  2LKH A;  5LB7 B;  4ZS2 A;  4TN7 B;  3RX6 A;  4LMJ A;  2CXF A;  2LHR A;  1W09 A;  3R6N A;  1HCI A;  4Q25 A;  3CIR A;  4JI3 T;  4HN9 A;  3P4S A;  5C8Y E;  4XAX B;  4JI6 T;  4AXP A;  2X0H A;  1OWA A;  5DQV A;  2WY2 A;  4DR7 T;  4DV3 T;  4GKK T;  5JR9 A;  2WB5 A;  4V1A v;  4CXX A;  2XSA A;  4MAL A;  3N9M A;  4EXT A;  4IGU A;  5AQR B;  4TWD A;  5HWX A;  4IE6 A;  3Q5E A;  3N9O A;  2K5B B;  3ZN1 B;  1WLX A;  4DV5 T;  2OLT A;  3P8C D;  2PFV A;  3GMI A;  4NUU A;  2W61 A;  5L3D B;  4HFC A;  2GK9 A;  4KP3 C;  3CX8 B;  5M4Y A;  4UVC B;  3PV0 F;  1ZV4 X;  5DQW A;  3HA4 A;  2WZH A;  3PU8 A;  3OJA A;  3FB2 A;  4GOU A;  2V8S V;  3LDQ B;  3PUZ F;  4DID B;  1BR1 A;  3PTR B;  4H63 V;  4IL9 A;  3AAA B;  2CMR A;  1IBK T;  3MJX A;  1KFY A;  5LBQ B;  2BVL A;  1NEN A;  5LHG B;  4DMW A;  3KBT A;  2E5V A;  2OA5 A;  4YHJ A;  2P9B A;  3PUS A;  3ZC1 A;  3QUJ A;  4UV8 B;  3EVY A;  2K48 A;  4IE0 A;  3AE3 A;  5FY0 A;  4IDQ A;  2WMO A;  1KNP A;  5L3C B;  2IC6 A;  2UUB T;  1ZKE A;  3L3P A;  2V5D A;  3CQC B;  2KMF A;  4IDZ A;  5LCY A;  1NAF A;  4B3T T;  1SA0 E;  3S4U A;  2W0G A;  3RKG A;  2LEH A;  3CVR A;  1S35 A;  3X1D A;  2A2F X;  4P0B A;  1Y64 B;  1X9B A;  5HEG A;  2E5L T;  4B3M T;  3EAB A;  3ONL C;  4HWH A;  2NTX A;  4ZS3 A;  4HFI A;  3UQ7 A;  3Q9D A;  1W9R A;  2JQH A;  2V7K A;  3I9Y A;  2AXD S;  3G06 A;  4GK0 E;  3RYI E;  3RI5 A;  4B3R T;  1E1H B;  3ANW B;  1FEW A;  4OX9 T;  4TNW A;  4J2C A;  3UUL A;  3A7M A;  1KEY A;  1YKH B;  2Q9Q A;  2BS2 A;  4KI0 F;  3AVS A;  3CKD A;  4HFD A;  4DUY T;  3HR0 A;  4DV6 T;  5BR8 T;  4YLH A;  4NPP A;  2JQQ A;  2VQF T;  5LOV E;  5HCM A;  4L0R A;  5H6R B;  3ANW A;  2V6Y A;  2BG9 E;  2JPF A;  3PJA A;  3H37 A;  2DWK A;  2JRK A;  3RKO A;  4LMK A;  3NWI A;  5L3F B;  3C50 A;  4X5T A;  5FXW A;  4QH1 A;  2YK0 A;  3N9N A;  3ONJ A;  3OPC A;  3LK4 2;  3TKL B;  5AQQ B;  2LRK A;  1HX1 B;  4HKA A;  2NP9 A;  3RQU A;  3LSV A;  4HWF A;  4AQY T;  3ZT7 A;  1CUN A;  3CQG B;  2ZM2 A;  1HFA A;  3FZL B;  2VUR A;  3EAM A;  3ZCI A;  2QGS A;  2XZE A;  1T8B A;  2MTQ A;  4LF5 T;  1HG5 A;  4NXN T;  3I1A A;  5HEO A;  4GYR A;  3PJA J;  1WYC A;  3F31 A;  3LFM A;  3RQW A;  4UEL A;  2EHO C;  2KSR A;  4EB6 E;  5AQM B;  5CJ5 A;  5ABH A;  1KNR A;  3ZN0 B;  2L9Q A;  4KHP T;  1JNR A;  2RP4 A;  2H7O A;  4GKJ T;  1OED A;  4YTN A;  4A5X A;  2JQK A;  4LF6 T;  2Y48 B;  4QXB B;  4BJM A;  1O3X A;  1MMN A;  3TLT A;  2X9X A;  4YJ2 E;  5FL0 A;  2J62 A;  3C98 B;  4LF7 T;  2YEV C;  4UVA B;  2V5C A;  5HXR A;  2A9U A;  2KT9 A;  4X64 T;  1IZN B;  4UV9 B;  5CB4 E;  4AQF C;  5ABG A;  5HEH A;  4ZI3 C;  2W62 A;  3B13 A;  3U78 A;  2LSY A;  3ESL A;  4ERR A;  4XBF B;  3K3N A;  2EHO B;  4HFV A;  3JAE A;  4PNI A;  3FZK B;  4C91 A;  4F8H A;  2LT3 A;  3SFD A;  1E7P A;  2ODV A;  3H3M A;  4DR1 T;  4IDP A;  3ZMZ B;  2I59 A;  2H89 A;  2Z6E A;  4ASK A;  5ADX L;  2FUP A;  3AED A;  3FZM B;  2XQ3 A;  4O8S A;  4P1N A;  2XAG B;  1L0V A;  3SOL A;  4IL4 A;  3RIU C;  1IAP A;  4AKI A;  3ZT6 A;  2X9W A;  2LSK A;  4JI7 T;  2CBJ A;  2VWA A;  2WS3 A;  4QXH B;  2BG9 B;  4B3S T;  4LFA T;  3BQL A;  3PUX F;  3E22 E;  5LMU T;  5F5W A;  2NOX A;  1HR0 T;  4P0A A;  1XWM A;  2HPL A;  2D9D A;  2BG9 A;  1UX4 A;  5FVL A;  3QB5 K;  5J2U E;  4NXM T;  2XQ5 A;  3CPZ A;  3RPU A;  4U3C A;  4YHH T;  4U7Y A;  4WZX A;  4ILB A;  4C90 A;  2YOE A;  4DUZ T;  2E9X C;  4JBW F;  3F57 A;  3PUG A;  3VKH A;  3UTK A;  3AEG A;  1BR0 A;  1IJ6 A;  2FJE A;  3FHN A;  4Z91 A;  3JAF A;  4O4J E;  3N9L A;  4YY3 T;  3J7Y q;  2NW7 A;  1G73 A;  2I0M A;  5J1G A;  3TLV A;  4KBM B;  3QC9 A;  2LRL A;  3OBV E;  3PU3 A;  5ABE A;  4KX6 A;  5FNV E;  3FXD B;  3AE2 A;  5JR9 C;  2CWY A;  1MMD A;  2IML A;  1FMW A;  1Z0P A;  3LK2 B;  4HWC A;  2VKJ A;  2BKN A;  2LLY A;  2VAS A;  4ILU A;  3Q5D A;  5AQL B;  2EHO D;  5FY7 A;  1V9D A;  5L3G B;  4AKR B;  2ES0 A;  2D0T A;  4TNV A;  2IAK A;  3IA3 A;  3K8P C;  5JDN A;  4JEU B;  3VRA A;  3VKG A;  5BMV E;  3CK6 A;  4CN6 A;  5AQU B;  2CWO A;  3P50 A;  1U4Q A;  2HH7 A;  3P7I A;  2IW5 B;  1XZY A;  4YFS A;  2C5I T;  5KX5 E;  2C0S A;  5JR9 B;  3IBP A;  4H9Q C;  2CRB A;  2WAU A;  4FI5 A;  2VQE T;  2E8I A;  2JMK A;  3UFE A;  3ABV A;  5JRC A;  2X0Y A;  2WSS V;  1QLB A;  4OYK A;  4QWN B;  3K3Q C;  3ZYK A;  4COF A;  2MAW A;  5JDF A;  4YSZ A;  1VCT A;  2F4V T;  2QYW A;  4BJN A;  4A97 A;  4Z8X A;  2BBH A;  2N2N A;  3I0Q A;  4OK0 A;  2XQY A;  2X51 A;  1T98 A;  3EDU A;  2XQ4 A;  1IBL T;  2W4X A;  4U72 A;  3SS1 A;  5EK3 A;  5LNK A;  3UU6 A;  4E7S A;  1LRZ A;  4AKG A;  2C5K T;  3JC6 D;  5E0O A;  2SPC A;  1BR2 A;  3O4X E;  3N9P A;  2WU5 A;  4IHJ E;  3NRY A;  3LBX A;  5LA6 E;  2WDQ A;  3T8O A;  3NBX X;  3TLS A;  4PK6 A;  4EOZ B;  1OED E;  2AE9 A;  2BKP A;  4JLE A;  1N32 T;  4HEA A;  2CHN A;  5FY1 A;  3UUX B;  2I6H A;  5LGT B;  1VCS A;  1MNE A;  5ABF A;  4DR5 T;  4H63 H;  4N78 D;  3P4W A;  3VU7 H;  3PUW F;  3ZSS A;  2HPJ A;  2BBJ A;  2X67 A;  4I50 E;  1YQ3 A;  2X9Y A;  2WM9 A;  4OFZ A;  1YXR A;  2L3L A;  3KV4 A;  1W0B A;  3E0Z A;  3PUY F;  3ZEF B;  1D1C A;  4NUV A;  3N2O A;  2ZM6 T;  2C5J A;  4QXC B;  3V5U A;  2IIU A;  3PUQ A;  2Q9Q C;  3UQ4 A;  2UU9 T;  3MKD A;  3ONX A;  5HEU A;  4G2A A;  4TV8 E;  3NKZ A;  5L3B B;  4DV7 T;  2Y8D A;  4HFH A;  2HHH T;  3UU8 A;  5JTG A;  2XUE A;  2B76 A;  4P09 A;  2K3W A;  4YSX A;  4ZI2 C;  2DLR A;  3NRX A;  4XZC A;  2VVS A;  5AQS B;  3CQX C;  4PFP A;  2E9X D;  4X65 T;  2VB6 A;  1H7C A;  1XNR T;  2BZB A;  4CZZ B;  3FZH B;  2KIN B;  3AXJ B;  3K1S A;  2KLQ A;  4HWD A;  3Q5W A;  2ACX A;  3C64 A;  4DBQ A;  2Q9Q B;  3L39 A;  5L3E B;  5AQK B;  5C3J A;  5A1L A;  2Y6X A;  3MZK B;  4LF8 T;  3O1I A;  5LJN A;  2DCF A;  1OXZ A;  3RRW A;  5L2L A;  5HXH A;  5JDL A;  4O4H E;  2V6Y B;  3AXJ A;  2UXD T;  3TLU A;  4EED A;  4ZEY A;  4JV5 T;  2YN6 A;  4MBQ A;  3CX7 B;  4IIJ E;  2XY8 B;  1HNX T;  2YDS A;  3N2G E;  4CN1 A;  3C4X A;  5KDM C;  2LSJ A;  5JDM A;  5LMN T;  3N9Q A;  4DR2 T;  1YQ4 A;  2LSG A;  4H9R C;  3ZLI A;  3AEF A;  3AE4 A;  4MHC A;  4AIU A;  2N9D A;  4I4T E;  1OED C;  5HWY A;  1Y01 A;  2ZM0 A;  2YKS A;  3AB3 B;  3GWH A;  3IF8 B;  3LJC A;  4I55 E;  4Z90 A;  4O4L E;  3P4P A;  4DV0 T;  2CBI A;  1NWM X;  1QSD A;  3C4W A;  5AQO B;  4K0K T;  3EHZ A;  4AI6 A;  2LM9 A;  1W0A A;  2RPA A;  2DI4 A;  2QRX A;  4E7Z A;  1LVF A;  4HTE A;  2CCQ A;  3JAD A;  1KF6 A;  4WBN E;  5L4H A;  3O9X A;  4CN4 A;  3ZMU B;  1OED B;  2QVA A;  4PJL A;  4DR3 T;  2XQA A;  1E2A A;  3KBU A;  2M6I A;  1WR0 A;  2DWG A;  2BS3 A;  1WCR A;  2PTF A;  1UCU A;  4CI1 B;  1SHZ C;  1MND A;  5CA0 E;  4TWH A;  3Q2M A;  1HX8 A;  2DHR A;  3RLF F;  3N2K E;  3RC3 A;  2G0U A;  4U31 A;  1HNZ T;  3VR8 A;  4L9I A;  4YTM A;  3B57 A;  5HYA A;  1DU2 A;  2HN1 A;  1YKE B;  1N33 T;  5C2T A;  3ETU A;  4DND A;  2XJ7 A;  2VKO A;  1UX5 A;  2A3D A;  2Q9Q D;  2NW8 A;  2CA5 A;  4LF4 T;  4PFO A;  2BG9 C;  3HI2 A;  4WNK A;  5IWA T;  4H9O C;  2LE8 A;  2JIW A;  1ZP0 A;  2V7L A;  4HGA A;  2PJQ A;  4GYS A;  2D0U A;  4ZI2 D;  3P4Q A;  2LOS A;  3CWZ B;  3MA9 A;  2UXB T;  4B6X A;  5JH7 E;  4YSY A;  1KNZ A;  3FBZ A;  4O2A E;  1WR6 A;  5HXC A;  4LF9 T;  3J9X 1;  3PUA A;  3NZQ A;  5H6Q B;  1WYB A;  4AKL A;  1EZ3 A;  5IUX A;  3AVR A;  2XQ9 A;  2CLY B;  4DR4 T;  2H88 A;  4QHO A;  4IE4 A;  4CQI A;  3WI3 A;  4A98 A;  3ZMS B;  5AQV B;  3AEA A;  4EEB A;  1S94 A;  5LHH B;  4HE8 A;  3Q5X A;  3UT5 E;  3K3O A;  2FJB A;  3RRC A;  3DP7 A;  4MLK A;  2ODU A;  3BQK A;  3T1Y T;  3E08 A;  2UXX B;  3P4R A;  3LG7 A;  3KVA A;  5AFU L;  4UXN B;  1XDO A;  5FXV A;  3VHL A;  3H3A A;  1AJ3 A;  1ZOY A;  4X1I E;  1JNZ A;  4DVD A;  3GN5 A;  3ZYL A;  2E2A A;  3RF1 A;  4YJ3 E;  1VRB A;  4I0U A; 
#chains in the Genus database with same CATH homology
 1I6Z A;  5AQF B;  5AQP B;  3FZF B;  5AQK B;  5AQJ B;  4HWF A;  4HWC A;  1M62 A;  5AQO B;  5AQS B;  2D9D A;  5AQT B;  5AQH B;  3FZM B;  3M3Z B;  5AQU B;  4HWI B;  1M7K A;  5AQL B;  5AQN B;  1UGO A;  5AQR B;  3A8Y C;  1UK5 A;  5AQG B;  5AQM B;  3FZH B;  3FZL B;  5AQQ B;  3LDQ B;  1T7S A;  5AQI B;  4HWD A;  3FZK B;  1HX1 B;  4HWH A;  5AQV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...