1W0BA

Solution structure of the human alpha-hemoglobin stabilizing protein (ahsp) p30a mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
102
Chain Sequence
SALLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-HEMOGLOBIN STABILIZING PROTEIN
publication title NMR structure of the alpha-hemoglobin stabilizing protein: insights into conformational heterogeneity and binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 32
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1w0bA01
4IDPA 3OVUA 3QOFA 1XZYA 1W09A 4IDQA 4IDNA 1W0AA 1Z8UA 3Q5DA 3Q5EA 1W0BA 1Y01A 3IA3A 3QNUA 4IDOA 3X1DA
chains in the Genus database with same CATH superfamily
2BKNA 4DV2T 4CXWA 2VK9A 2BG9E 3JAEA 2EHOC 1HNXT 3B13A 4CZZB 3ZC1A 2C5KT 3ONXA 5HXEA 5TAOA 1FJGT 3N9PA 2IIUA 1WLXA 1QLBA 1XNQT 1HCIA 1H7CA 5AQSB 4JI8T 1XDPA 2KSRA 5LG3A 4DBQA 2WU2A 4I4TE 2W4XA 1HF8A 4QWNB 3CK6A 1IBLT 2R6GF 1YD8G 4EV6A 2Z6EA 3TLTA 4U74A 3ZYMA 2B76A 3RIFA 2DCFA 1L0VA 2XJ7A 3OYXA 3UFEA 4HWCA 4LF4T 5IHYA 2QA7A 3Q2MA 3BQLA 1WYBA 1ZOYA 4TN7B 4IREA 3SS1A 4OK0A 1Z8UA 4LFBT 2N9DA 3E22E 1XDOA 1O3XA 2BVMA 1D0XA 3AEGA 2X0YA 1HTJF 3IF8B 5DABA 5ETWA 5L3EB 2X66A 4QHOA 2XTLA 4ZI7E 4QXCB 4TWDA 3MK7C 2LSKA 2E2AA 5KDMC 4ZI2C 5AQTB 2IW5B 3PURA 4X64T 4H9SE 4QH1A 2KZ7B 2W66A 4ZHQE 3EHZA 4X5TA 3UU5A 2MBGA 5F8PA 1UUSA 4TUYE 5ABFA 1SHZC 4ZOLE 1LKXA 1BR2A 3ZN1B 2WWUA 5LBMA 2XQYA 4BAYB 3K3QC 2MTQA 2DL1A 5AQQB 5FMNA 3AA0B 3G06A 4IE0A 2BS2A 5AQIB 5HEOA 3ABVA 5LYJE 3ZMZB 1W09A 3ZN0B 5L4EA 5AQVB 3ZMUB 2M67A 3ZSTA 2DLRA 4TX5A 4EZHA 1E7PA 5JDNA 1MIWA 2KWIB 2ES0A 2Q9QB 3X1DA 2DWKA 4KHPT 3PUZF 3F2EA 2V7MA 1YXRA 3ZMTB 5JDGA 3R6NA 2OV9A 5JVDE 4ZZBA 3RF1A 2H7VC 4QXBB 3FBZA 3BK9A 4OYJA 2LSYA 2KWHA 2VQFT 2IAKA 3H3AA 3IA3A 3UUNA 3A5XA 3JC6D 5LP6E 4ZZCA 1MMGA 3RIAA 3AE3A 2VASA 2IDOB 5FP3A 4ZI3D 2K24A 4PJLA 5FY1A 2KNDA 1NENA 5IWAT 5JH7E 3RC8A 4HWHA 4ZXLA 2E5VA 5CGMA 4H9QC 4UF0B 2E9XC 4YSYA 1KFYA 4GKKT 4YT0A 2C0SA 2H3RA 3RHWA 4U7YA 4DV5T 4IE7A 1BR1A 2JQ9A 4YTPA 2V5DA 2XSBA 3CQXC 4DNDA 4AI6A 3KFWX 5CA0E 3VHLA 4MALA 1KK7A 3FZLB 4YHJA 4GIWA 1MIVA 5C8YE 1FMWA 2WMNA 3AEDA 4EXTA 2UU9T 2WDQA 3PUGA 1S35A 1N34T 4JEHB 2KINB 3EDUA 3I0QA 2LE8A 2LJLA 2NWBA 2M6IA 3Q5XA 3V5UA 2V8SV 2VB6A 3E0ZA 2RA1A 3C4XA 4X1YE 1I6ZA 3ONLC 3Q9DA 1D1AA 2JRKA 3QB5A 4DUYT 4HFCA 2KT9A 1WR6A 4ISSA 2J62A 5J1GA 3AE8A 5JRCA 2XASB 2J47A 3SWHA 5AQHB 4EOZB 1E1HB 1LVFA 1N33T 1ZP0A 2CE7A 3DP7A 5L4HA 5LJNA 5LMUT 4IDQA 3PUAA 2PTFA 4L0RA 3I9YA 2UUBT 2XAGB 3HKDE 5JDQA 4JI2T 2UUCT 2I6HA 3IHRA 3K8PC 2KMFA 4GK0E 2WWVA 5ADXL 5KMGP 1YKHB 4V1Av 3PU3A 4YFSA 1UGOA 1HX1B 3S4UA 1Y01A 2XQ3A 3O4XE 4TV9E 4HWFA 2BS4A 5FYMA 5EK3A 2E8IA 5FXWA 1VCSA 3P4WA 4PNIA 5EZYE 4UV9B 3ONJA 4HWIB 3TLWA 4LMKA 2XQ8A 4ADZA 2X0HA 3RX6A 3LDQB 3PUWF 1IJ5A 5HXSA 1KNRA 4TNVA 2BG9A 2CXDA 3FZHB 1HS7A 2BVLA 4HEAA 4U72A 3UQ4A 4JLEA 5FL0A 4AQYT 4O2BE 3CIRA 4U7IA 3QB5K 1MMDA 1W9RA 4QXHB 5ABFB 1MMNA 3CVRA 1IAPA 4XZCA 1N32T 2BG9C 4MFRA 1OEDB 3PUQA 4PJJA 3SOLA 4HFEA 4JI1T 2CA5A 4ANJA 4F6RC 1VRBA 3GWHA 2A9UA 2LSJA 2XQ6A 4JI0T 5H6RB 2C5IT 5L3BB 2VQET 3PTRB 2XM1A 4DR7T 3NRYA 3UU6A 3NRXA 2IUBA 2K5BB 3Q5EA 4X66T 2LM9A 4DVDA 4H63V 4EAHA 4JI7T 4L5GA 3L8RA 2L3LA 3JC6C 2VKOA 4I0UA 4UVCB 3ZYLA 4A56A 3ZLIA 3TLSA 4O4IE 2LHNA 2X67A 5LHIB 2WB5A 4KUMB 3JADA 2LT3A 2XQ9A 3LBXA 4GYSA 2BS3A 4O4LE 4ZI3C 3K3NA 2NTXA 3CWZB 2X9WA 3N9LA 2HPLA 4NXMT 5HEJA 5LGNB 5L3CB 2KXPB 1XMQT 4COFA 1JNZA 4X20E 3GN5A 3RQUA 4HFHA 3AEFA 4LMJA 4BJMA 2GK9A 4YTMA 5DQVA 3BQKA 4CI3B 2XQ4A 2X68A 2NW9A 3ETVA 4LFAT 2K9AA 2E5LT 1BR0A 2G0UA 4X65T 3F31A 3MA9A 1JNRA 3HI2A 5HXCA 5J2UE 2CCQA 4UIGA 3UTKA 1HG2A 4IDNA 3FBLA 4DR2T 5HEGA 3NZPA 2X9HA 3AE4A 3QC9A 4CXXA 3VU7H 4PAGA 2CLYC 5LJMA 3A7MA 4FJOA 2FJDA 4JI5T 3ZCJA 3ESLA 3DJBA 5L47A 4IE6A 3EDVA 4DR4T 3RRWA 5FL1A 2WMOA 4KP3C 3FZFB 3RPUA 3UUMA 5IUXA 1BR4A 5E0OA 2VVSA 3A8YC 2JPFA 3KV9A 3RC3A 4ERRA 2UUAT 2YU1A 3N9QA 2JMKA 3CPZA 3P4SA 2N1GA 3UFGA 2V1DB 1UCUA 2CMRA 4HN9A 3TKLB 3ZEFB 3UUXB 3HA4A 2YU2A 3CQGB 5JRCB 4HFVA 1V9DA 3J9X1 3PU8A 2DWGA 4X1IE 2Q9QD 2W63A 4PK6A 5AQUB 2ODUA 5FNVE 3O1HA 3SFEA 1US7B 2WAUA 3AAAB 2XAQB 1UX4A 4DV1T 2WY2A 3N9OA 1R8IA 3UU3A 5AQKB 3H3MA 4X1KE 1ZV4X 4YXDA 2YINA 4IE4A 5HXHA 4YJ3E 5F5WA 5L3FB 3HKEE 2V7LA 2CPTA 5CA1E 4O8SA 5ABEA 3AE6A 1MIYA 5HXRA 4TZ4C 3I1AA 3T1YT 4PJNA 4AIUA 5CB4E 4HFIA 3ZC0A 4ISTA 1HR0T 3P4QA 2LHRA 4EEBA 4MBQA 4CN4A 1DU2A 5EK2A 4B3ST 4O4JE 3AAIA 2W61A 4IDPA 2L9QA 3L09A 2JQHA 5FXZA 1IZNB 4DV4T 2I0MA 3VKHA 4OHFA 2YOEA 2PBIA 3B5MA 4LFCT 1WCRA 2E9XA 2MAWA 4ZS3A 3NBXX 3T1HT 4X62T 2V7JA 4H63H 5JR9C 2BG9B 4JUYA 5BMVE 2HH7A 5AQLB 4BJNA 4LF6T 3VRAA 4DR6T 1UK5A 2NW7A 2HPJA 3AE2A 3DTOA 3JCFA 4C91A 2LKGA 3OPCA 4MLKA 1FIOA 3SFDA 3N2KE 4FI5A 3V5SA 5JDHA 1M7KA 3P4RA 1EZ3A 5J2TE 3KV6A 5LHGB 4GOUA 2WZHA 1YQ3A 4MHCA 3CX8B 2W62A 1VCTA 1G73A 2V5CA 4I55E 4U33A 2YKSA 1LRZA 3CQCB 3AE5A 2UXDT 2V6XA 2HN2A 2PFVA 3NZQA 5ABHA 2FJBA 1HX8A 1KNZA 2CEAA 5LMNT 4ILCA 5JDLA 2HN1A 4GKJT 4DV0T 2EHOB 1NEKA 3M3ZB 1WFDA 4CN1A 1SUMB 4DIDB 3P4PA 2QGSA 5LOVE 4HTEA 5HCJA 2V7KA 4E7SA 4B3MT 4B6XA 3QOFA 2J1DG 4ILUA 3ZKRA 3LBXB 3WAJA 3WAKA 5LXTE 1CHUA 3MKDA 3AAEB 3ZPOA 1OWAA 1IBKT 2KLQA 3GN5B 3AE9A 2YDRA 2WQYA 3E08A 2B1EA 2V7IA 2D0UA 3ZJ1A 4EIWA 3TLUA 3ZJ2A 5HEUA 4TV8E 2BBJA 2F4VT 2I59A 2VURA 5M4YA 4IT4A 1YKEB 2QVAA 1CUNA 4UV8B 4H9RC 5LNKA 4WW0A 2XM2A 1MMAA 4WYVA 3IBPA 3P50A 1IJ6A 2LLYA 3KINB 2K48A 2PJQA 4PFOA 4CQIA 3L3PA 3AE7A 4LMLA 3HKCE 1XMOT 3W15B 3N9NA 4IDOA 3PJAA 3KDSE 4G2AA 2N2NA 2YDQA 4IL4A 3C98B 5HCMA 2YN6A 5LHHB 4JI4T 3ZCIA 2DHRA 4HFBA 3C51A 2DI4A 3LK2B 5FY0A 5HYAA 2IC6A 3AXJA 4EYYR 5JDMA 4HFDA 3KBTA 4KMCA 1D1CA 4JV5T 3LJCA 2Q9QC 1Z0PA 3NVOA 3ZMVB 1J1JA 1NWMX 3M65A 2FBWA 5IYZE 2V26A 3N9MA 4AXPA 2FJAA 5HWXA 2AE9A 3AECA 3PDYA 4EYUA 5FVLA 1E2AA 2JQQA 4DMWA 1I94T 2QRXA 3VRBA 2Y6XA 4JI3T 2JJ9A 2J4GA 4PK5A 1W0BA 1HNZT 1U5PA 2X51A 3KVBA 2XQ5A 1WYCA 2DNXA 2UXXB 2LOSA 3ANWA 3CKDA 2WP9A 4DMVA 3OYZA 2WCAA 3K3OA 2CXLA 4B3RT 1WRDA 1MNEA 3RYFE 5FVKA 4XBFB 2WSSV 5AQOB 4YY3T 5KX5E 4HKAA 3AA7B 2LKHA 4DUZT 1VOMA 2A3DA 2VL8A 2YEVC 2X9YA 4IE5A 3IEEA 2XUEA 4UR9A 4IIJE 4NUUA 4GK5E 1X79A 4QX8B 4UEMA 1XNRT 3EAMA 3OTOT 2BKPA 3KVAA 3SRZA 2XQ7A 3EABA 4DO0A 5AQFB 4UELA 4QKNA 1XWMA 4UVAB 4AKGA 5J0ZA 2ZLYA 2WDVA 2CXFA 4IDZA 5HWYA 3PUXF 4CI1B 3P8CD 4G63A 1KNPA 3I9WA 4K0KT 3FZMB 3AVSA 2HHHT 2E9XB 4U2ZA 1YW0A 3EVYA 4EEDA 2VL0A 4P0AA 2FUPA 3LG7A 3MJXA 4DV6T 2XY8B 1T98A 2NTYA 2C5JA 3RLFF 4K0UA 3NWIA 2LEHA 2ACZA 4B3TT 1OXZA 2BDEA 1ZKEA 4Z90A 2ZM2A 1FEWA 4YSXA 5EK4A 4ILAA 3FXDB 2ZMAA 3GMIA 2A2FX 4KI0F 4U31A 2FJEA 1MNDA 3RYCE 5KXJA 4LF9T 2OLTA 4YLHA 3RYHE 4NXNT 4DR1T 3KBUA 3AEBA 4HWDA 2X0LB 2XPKA 4H9NC 4HGAA 3AVRA 2IMLA 4Q25A 4H9PC 2NR4A 5BR8T 2W00A 4Z8XA 1D1BA 2NW8A 1T8BA 2BBHA 3Q5WA 5JQGE 3QNUA 4ASKA 3R84B 3D0TA 2BKOA 1NAFA 4NUVA 2XSAA 4AKIA 4IGUA 1M62A 4AISA 2D5UA 5JREA 2D2SA 5AFUL 4DV3T 2AXDS 3AEAA 1T72A 2VWAA 3O1IA 4DR5T 4BA9A 3CX6B 3WI3A 2CRBA 1QSDA 3PJAJ 3B57A 4N78D 1X9BA 4LF8T 2WS3A 3O1JA 4YJ2E 3RI5A 4AKHA 2VKDA 2NOXA 2MYSA 4A5XA 3U78A 3AA1B 1LVKA 4PK4A 4U2YA 4WBOA 3EI0A 2RPAA 4EB6E 2UXCT 1OEDA 3PUYF 2ODVA 3OBVE 2P9BA 3UT5E 1HNWT 1KEYA 2ZM8A 4TWHA 4JYAT 2V6YA 3U3IA 3LK3B 3I0OA 3LK42 1OEDC 4PFPA 1YQ4A 4TNWA 2UXBT 4J2CA 2YDSA 4WZXA 4KBMB 5JR9A 2IC9A 4PW8A 2JIWA 2K3WA 4LF7T 4JI6T 1ZEEA 3H37A 4AQFA 2VKHA 4I50E 2RP4A 4ILBA 2W2UA 3FHNA 3AXJB 4M1PA 2W67A 4DR3T 3ZMSB 2Y48B 3AA6B 3RKOA 4EZ4A 3QK6A 2XAHB 3RRCA 5JDFA 4JEUB 3KV4A 3Q5DA 4A98A 3PV0F 1T7SA 2LM2A 4UVBB 4AQFC 5AQGB 3FXEB 3RGLA 4PJMA 3LSVA 1OEDE 4P1NA 3CX7B 2EHOD 1FMVA 2JMHA 3ZT6A 3ZT5A 5L3GB 3ZSSA 1QUUA 3ANWB 2XAFB 2LRKA 3N5LA 1AJ3A 3UQ7A 4CN6A 1N36T 5LGTB 4OX9T 2SPCA 5LA6E 1XZYA 2NP9A 3P7IA 1D0YA 3PE0A 4KX6A 4P0BA 2CWYA 4DV7T 2WZIA 3N2OA 4QH5A 3C4ZA 1HG5A 3TLVA 2ZM0A 5HEHA 3PUVF 3AEEA 4WNKA 5C3JA 4DBRA 5AQRB 4O2AE 2MOZA 3T8OA 4QH4A 2WBLA 3RQWA 4L9IA 2ACXA 1W0AA 3ZT7A 1UURA 5H6QB 2VVNA 1G8XA 1IBMT 2D9DA 4OYKA 5DQWA 4NIQA 2UXNB 2WDRA 3VKGA 5FXVA 5AQNB 2CWOA 2LSIA 2XHEB 2Y8DA 3HL6A 4CI2B 4AKLA 3QUJA 3UULA 2XQAA 5F3JA 5LB7B 4CXYA 5L2LA 2D0TA 2CHOA 5L3DB 5GONE 4AKRB 4H9OC 3GA8A 3RYIE 4ZS2A 4ZI2D 2CLYB 3KV5A 4HE8A 3LFMA 3CMLA 2L8KA 3AE1A 4O4HE 1U4QA 3C50A 1WR0A 4JBWF 4WBNE 3MACA 3MZKB 4TWFA 3EUHA 5AQPB 2QYWA 1SA0E 3VR9A 2Q9QA 4EGWA 2LRLA 2PG8A 5FXXA 3K1SA 5LGUB 2BZBA 5CJ5A 2WM9A 4QX7B 2IHR1 4Z91A 4YHHT 2VKJA 4A97A 2JQKA 3C64A 1SE7A 4E7ZA 4AQGA 4OFZA 3PUSA 4C90A 1J5ET 1Y64B 3VR8A 3OJAA 3FB2A 3MXZA 2X9XA 5LBQB 2LSGA 4IL9A 2A72A 5DJQC 3ETUA 3RIUA 1KF6A 2XZEA 3HR0A 3OKQA 5FKYA 2LOPA 3UU8A 3FZKB 2WU5A 3HKBE 3OVUA 4LF5T 4ZEYA 2W0GA 3F57A 2MPKA 4I43B 3L39A 1D0ZA 3RIUC 2CM0A 4NPPA 3BQIA 3NKZA 3RKGA 4YSZA 5A1LA 5JTGA 4UF0A 4U3CA 4F8HA 4IHJE 3O9XA 2ZM6T 1GQEA 3C4WA 3JAFA 3RH3A 2H7OA 5LCYA 5CFBA 2XAJB 5AQMB 4XAXB 4UXNB 1UX5A 5ABGA 1ZHCA 2H88A 5LG4A 5FY7A 2CBIA 3ZYKA 3AB3B 5HAXA 2H89A 3N2GE 5C2TA 2E9XD 2M6BA 2OA5A 2CHNA 3UUBA 5AQJB 2V6YB 1S94A 2YK0A 1J5WA 2EHOA 4GYRA 1B7TA 5JR9B 3J7Yq 1HFAA 3UU4A 2CBJA 4P09A 4KHZF 4YTNA
chains in the Genus database with same CATH topology
4IDPA 3OVUA 3QOFA 1XZYA 1W09A 4IDQA 4IDNA 1W0AA 1Z8UA 3Q5DA 3Q5EA 1W0BA 1Y01A 3IA3A 3QNUA 4IDOA 3X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDP A;  3OVU A;  3QOF A;  1XZY A;  1W09 A;  4IDQ A;  4IDN A;  1W0A A;  1Z8U A;  3Q5D A;  3Q5E A;  1W0B A;  1Y01 A;  3IA3 A;  3QNU A;  4IDO A;  3X1D A; 
#chains in the Genus database with same CATH topology
 2BKN A;  4DV2 T;  4CXW A;  2VK9 A;  2BG9 E;  3JAE A;  2EHO C;  1HNX T;  3B13 A;  4CZZ B;  3ZC1 A;  2C5K T;  3ONX A;  5HXE A;  5TAO A;  1FJG T;  3N9P A;  2IIU A;  1WLX A;  1QLB A;  1XNQ T;  1HCI A;  1H7C A;  5AQS B;  4JI8 T;  1XDP A;  2KSR A;  5LG3 A;  4DBQ A;  2WU2 A;  4I4T E;  2W4X A;  1HF8 A;  4QWN B;  3CK6 A;  1IBL T;  2R6G F;  1YD8 G;  4EV6 A;  2Z6E A;  3TLT A;  4U74 A;  3ZYM A;  2B76 A;  3RIF A;  2DCF A;  1L0V A;  2XJ7 A;  3OYX A;  3UFE A;  4HWC A;  4LF4 T;  5IHY A;  2QA7 A;  3Q2M A;  3BQL A;  1WYB A;  1ZOY A;  4TN7 B;  4IRE A;  3SS1 A;  4OK0 A;  1Z8U A;  4LFB T;  2N9D A;  3E22 E;  1XDO A;  1O3X A;  2BVM A;  1D0X A;  3AEG A;  2X0Y A;  1HTJ F;  3IF8 B;  5DAB A;  5ETW A;  5L3E B;  2X66 A;  4QHO A;  2XTL A;  4ZI7 E;  4QXC B;  4TWD A;  3MK7 C;  2LSK A;  2E2A A;  5KDM C;  4ZI2 C;  5AQT B;  2IW5 B;  3PUR A;  4X64 T;  4H9S E;  4QH1 A;  2KZ7 B;  2W66 A;  4ZHQ E;  3EHZ A;  4X5T A;  3UU5 A;  2MBG A;  5F8P A;  1UUS A;  4TUY E;  5ABF A;  1SHZ C;  4ZOL E;  1LKX A;  1BR2 A;  3ZN1 B;  2WWU A;  5LBM A;  2XQY A;  4BAY B;  3K3Q C;  2MTQ A;  2DL1 A;  5AQQ B;  5FMN A;  3AA0 B;  3G06 A;  4IE0 A;  2BS2 A;  5AQI B;  5HEO A;  3ABV A;  5LYJ E;  3ZMZ B;  1W09 A;  3ZN0 B;  5L4E A;  5AQV B;  3ZMU B;  2M67 A;  3ZST A;  2DLR A;  4TX5 A;  4EZH A;  1E7P A;  5JDN A;  1MIW A;  2KWI B;  2ES0 A;  2Q9Q B;  3X1D A;  2DWK A;  4KHP T;  3PUZ F;  3F2E A;  2V7M A;  1YXR A;  3ZMT B;  5JDG A;  3R6N A;  2OV9 A;  5JVD E;  4ZZB A;  3RF1 A;  2H7V C;  4QXB B;  3FBZ A;  3BK9 A;  4OYJ A;  2LSY A;  2KWH A;  2VQF T;  2IAK A;  3H3A A;  3IA3 A;  3UUN A;  3A5X A;  3JC6 D;  5LP6 E;  4ZZC A;  1MMG A;  3RIA A;  3AE3 A;  2VAS A;  2IDO B;  5FP3 A;  4ZI3 D;  2K24 A;  4PJL A;  5FY1 A;  2KND A;  1NEN A;  5IWA T;  5JH7 E;  3RC8 A;  4HWH A;  4ZXL A;  2E5V A;  5CGM A;  4H9Q C;  4UF0 B;  2E9X C;  4YSY A;  1KFY A;  4GKK T;  4YT0 A;  2C0S A;  2H3R A;  3RHW A;  4U7Y A;  4DV5 T;  4IE7 A;  1BR1 A;  2JQ9 A;  4YTP A;  2V5D A;  2XSB A;  3CQX C;  4DND A;  4AI6 A;  3KFW X;  5CA0 E;  3VHL A;  4MAL A;  1KK7 A;  3FZL B;  4YHJ A;  4GIW A;  1MIV A;  5C8Y E;  1FMW A;  2WMN A;  3AED A;  4EXT A;  2UU9 T;  2WDQ A;  3PUG A;  1S35 A;  1N34 T;  4JEH B;  2KIN B;  3EDU A;  3I0Q A;  2LE8 A;  2LJL A;  2NWB A;  2M6I A;  3Q5X A;  3V5U A;  2V8S V;  2VB6 A;  3E0Z A;  2RA1 A;  3C4X A;  4X1Y E;  1I6Z A;  3ONL C;  3Q9D A;  1D1A A;  2JRK A;  3QB5 A;  4DUY T;  4HFC A;  2KT9 A;  1WR6 A;  4ISS A;  2J62 A;  5J1G A;  3AE8 A;  5JRC A;  2XAS B;  2J47 A;  3SWH A;  5AQH B;  4EOZ B;  1E1H B;  1LVF A;  1N33 T;  1ZP0 A;  2CE7 A;  3DP7 A;  5L4H A;  5LJN A;  5LMU T;  4IDQ A;  3PUA A;  2PTF A;  4L0R A;  3I9Y A;  2UUB T;  2XAG B;  3HKD E;  5JDQ A;  4JI2 T;  2UUC T;  2I6H A;  3IHR A;  3K8P C;  2KMF A;  4GK0 E;  2WWV A;  5ADX L;  5KMG P;  1YKH B;  4V1A v;  3PU3 A;  4YFS A;  1UGO A;  1HX1 B;  3S4U A;  1Y01 A;  2XQ3 A;  3O4X E;  4TV9 E;  4HWF A;  2BS4 A;  5FYM A;  5EK3 A;  2E8I A;  5FXW A;  1VCS A;  3P4W A;  4PNI A;  5EZY E;  4UV9 B;  3ONJ A;  4HWI B;  3TLW A;  4LMK A;  2XQ8 A;  4ADZ A;  2X0H A;  3RX6 A;  3LDQ B;  3PUW F;  1IJ5 A;  5HXS A;  1KNR A;  4TNV A;  2BG9 A;  2CXD A;  3FZH B;  1HS7 A;  2BVL A;  4HEA A;  4U72 A;  3UQ4 A;  4JLE A;  5FL0 A;  4AQY T;  4O2B E;  3CIR A;  4U7I A;  3QB5 K;  1MMD A;  1W9R A;  4QXH B;  5ABF B;  1MMN A;  3CVR A;  1IAP A;  4XZC A;  1N32 T;  2BG9 C;  4MFR A;  1OED B;  3PUQ A;  4PJJ A;  3SOL A;  4HFE A;  4JI1 T;  2CA5 A;  4ANJ A;  4F6R C;  1VRB A;  3GWH A;  2A9U A;  2LSJ A;  2XQ6 A;  4JI0 T;  5H6R B;  2C5I T;  5L3B B;  2VQE T;  3PTR B;  2XM1 A;  4DR7 T;  3NRY A;  3UU6 A;  3NRX A;  2IUB A;  2K5B B;  3Q5E A;  4X66 T;  2LM9 A;  4DVD A;  4H63 V;  4EAH A;  4JI7 T;  4L5G A;  3L8R A;  2L3L A;  3JC6 C;  2VKO A;  4I0U A;  4UVC B;  3ZYL A;  4A56 A;  3ZLI A;  3TLS A;  4O4I E;  2LHN A;  2X67 A;  5LHI B;  2WB5 A;  4KUM B;  3JAD A;  2LT3 A;  2XQ9 A;  3LBX A;  4GYS A;  2BS3 A;  4O4L E;  4ZI3 C;  3K3N A;  2NTX A;  3CWZ B;  2X9W A;  3N9L A;  2HPL A;  4NXM T;  5HEJ A;  5LGN B;  5L3C B;  2KXP B;  1XMQ T;  4COF A;  1JNZ A;  4X20 E;  3GN5 A;  3RQU A;  4HFH A;  3AEF A;  4LMJ A;  4BJM A;  2GK9 A;  4YTM A;  5DQV A;  3BQK A;  4CI3 B;  2XQ4 A;  2X68 A;  2NW9 A;  3ETV A;  4LFA T;  2K9A A;  2E5L T;  1BR0 A;  2G0U A;  4X65 T;  3F31 A;  3MA9 A;  1JNR A;  3HI2 A;  5HXC A;  5J2U E;  2CCQ A;  4UIG A;  3UTK A;  1HG2 A;  4IDN A;  3FBL A;  4DR2 T;  5HEG A;  3NZP A;  2X9H A;  3AE4 A;  3QC9 A;  4CXX A;  3VU7 H;  4PAG A;  2CLY C;  5LJM A;  3A7M A;  4FJO A;  2FJD A;  4JI5 T;  3ZCJ A;  3ESL A;  3DJB A;  5L47 A;  4IE6 A;  3EDV A;  4DR4 T;  3RRW A;  5FL1 A;  2WMO A;  4KP3 C;  3FZF B;  3RPU A;  3UUM A;  5IUX A;  1BR4 A;  5E0O A;  2VVS A;  3A8Y C;  2JPF A;  3KV9 A;  3RC3 A;  4ERR A;  2UUA T;  2YU1 A;  3N9Q A;  2JMK A;  3CPZ A;  3P4S A;  2N1G A;  3UFG A;  2V1D B;  1UCU A;  2CMR A;  4HN9 A;  3TKL B;  3ZEF B;  3UUX B;  3HA4 A;  2YU2 A;  3CQG B;  5JRC B;  4HFV A;  1V9D A;  3J9X 1;  3PU8 A;  2DWG A;  4X1I E;  2Q9Q D;  2W63 A;  4PK6 A;  5AQU B;  2ODU A;  5FNV E;  3O1H A;  3SFE A;  1US7 B;  2WAU A;  3AAA B;  2XAQ B;  1UX4 A;  4DV1 T;  2WY2 A;  3N9O A;  1R8I A;  3UU3 A;  5AQK B;  3H3M A;  4X1K E;  1ZV4 X;  4YXD A;  2YIN A;  4IE4 A;  5HXH A;  4YJ3 E;  5F5W A;  5L3F B;  3HKE E;  2V7L A;  2CPT A;  5CA1 E;  4O8S A;  5ABE A;  3AE6 A;  1MIY A;  5HXR A;  4TZ4 C;  3I1A A;  3T1Y T;  4PJN A;  4AIU A;  5CB4 E;  4HFI A;  3ZC0 A;  4IST A;  1HR0 T;  3P4Q A;  2LHR A;  4EEB A;  4MBQ A;  4CN4 A;  1DU2 A;  5EK2 A;  4B3S T;  4O4J E;  3AAI A;  2W61 A;  4IDP A;  2L9Q A;  3L09 A;  2JQH A;  5FXZ A;  1IZN B;  4DV4 T;  2I0M A;  3VKH A;  4OHF A;  2YOE A;  2PBI A;  3B5M A;  4LFC T;  1WCR A;  2E9X A;  2MAW A;  4ZS3 A;  3NBX X;  3T1H T;  4X62 T;  2V7J A;  4H63 H;  5JR9 C;  2BG9 B;  4JUY A;  5BMV E;  2HH7 A;  5AQL B;  4BJN A;  4LF6 T;  3VRA A;  4DR6 T;  1UK5 A;  2NW7 A;  2HPJ A;  3AE2 A;  3DTO A;  3JCF A;  4C91 A;  2LKG A;  3OPC A;  4MLK A;  1FIO A;  3SFD A;  3N2K E;  4FI5 A;  3V5S A;  5JDH A;  1M7K A;  3P4R A;  1EZ3 A;  5J2T E;  3KV6 A;  5LHG B;  4GOU A;  2WZH A;  1YQ3 A;  4MHC A;  3CX8 B;  2W62 A;  1VCT A;  1G73 A;  2V5C A;  4I55 E;  4U33 A;  2YKS A;  1LRZ A;  3CQC B;  3AE5 A;  2UXD T;  2V6X A;  2HN2 A;  2PFV A;  3NZQ A;  5ABH A;  2FJB A;  1HX8 A;  1KNZ A;  2CEA A;  5LMN T;  4ILC A;  5JDL A;  2HN1 A;  4GKJ T;  4DV0 T;  2EHO B;  1NEK A;  3M3Z B;  1WFD A;  4CN1 A;  1SUM B;  4DID B;  3P4P A;  2QGS A;  5LOV E;  4HTE A;  5HCJ A;  2V7K A;  4E7S A;  4B3M T;  4B6X A;  3QOF A;  2J1D G;  4ILU A;  3ZKR A;  3LBX B;  3WAJ A;  3WAK A;  5LXT E;  1CHU A;  3MKD A;  3AAE B;  3ZPO A;  1OWA A;  1IBK T;  2KLQ A;  3GN5 B;  3AE9 A;  2YDR A;  2WQY A;  3E08 A;  2B1E A;  2V7I A;  2D0U A;  3ZJ1 A;  4EIW A;  3TLU A;  3ZJ2 A;  5HEU A;  4TV8 E;  2BBJ A;  2F4V T;  2I59 A;  2VUR A;  5M4Y A;  4IT4 A;  1YKE B;  2QVA A;  1CUN A;  4UV8 B;  4H9R C;  5LNK A;  4WW0 A;  2XM2 A;  1MMA A;  4WYV A;  3IBP A;  3P50 A;  1IJ6 A;  2LLY A;  3KIN B;  2K48 A;  2PJQ A;  4PFO A;  4CQI A;  3L3P A;  3AE7 A;  4LML A;  3HKC E;  1XMO T;  3W15 B;  3N9N A;  4IDO A;  3PJA A;  3KDS E;  4G2A A;  2N2N A;  2YDQ A;  4IL4 A;  3C98 B;  5HCM A;  2YN6 A;  5LHH B;  4JI4 T;  3ZCI A;  2DHR A;  4HFB A;  3C51 A;  2DI4 A;  3LK2 B;  5FY0 A;  5HYA A;  2IC6 A;  3AXJ A;  4EYY R;  5JDM A;  4HFD A;  3KBT A;  4KMC A;  1D1C A;  4JV5 T;  3LJC A;  2Q9Q C;  1Z0P A;  3NVO A;  3ZMV B;  1J1J A;  1NWM X;  3M65 A;  2FBW A;  5IYZ E;  2V26 A;  3N9M A;  4AXP A;  2FJA A;  5HWX A;  2AE9 A;  3AEC A;  3PDY A;  4EYU A;  5FVL A;  1E2A A;  2JQQ A;  4DMW A;  1I94 T;  2QRX A;  3VRB A;  2Y6X A;  4JI3 T;  2JJ9 A;  2J4G A;  4PK5 A;  1W0B A;  1HNZ T;  1U5P A;  2X51 A;  3KVB A;  2XQ5 A;  1WYC A;  2DNX A;  2UXX B;  2LOS A;  3ANW A;  3CKD A;  2WP9 A;  4DMV A;  3OYZ A;  2WCA A;  3K3O A;  2CXL A;  4B3R T;  1WRD A;  1MNE A;  3RYF E;  5FVK A;  4XBF B;  2WSS V;  5AQO B;  4YY3 T;  5KX5 E;  4HKA A;  3AA7 B;  2LKH A;  4DUZ T;  1VOM A;  2A3D A;  2VL8 A;  2YEV C;  2X9Y A;  4IE5 A;  3IEE A;  2XUE A;  4UR9 A;  4IIJ E;  4NUU A;  4GK5 E;  1X79 A;  4QX8 B;  4UEM A;  1XNR T;  3EAM A;  3OTO T;  2BKP A;  3KVA A;  3SRZ A;  2XQ7 A;  3EAB A;  4DO0 A;  5AQF B;  4UEL A;  4QKN A;  1XWM A;  4UVA B;  4AKG A;  5J0Z A;  2ZLY A;  2WDV A;  2CXF A;  4IDZ A;  5HWY A;  3PUX F;  4CI1 B;  3P8C D;  4G63 A;  1KNP A;  3I9W A;  4K0K T;  3FZM B;  3AVS A;  2HHH T;  2E9X B;  4U2Z A;  1YW0 A;  3EVY A;  4EED A;  2VL0 A;  4P0A A;  2FUP A;  3LG7 A;  3MJX A;  4DV6 T;  2XY8 B;  1T98 A;  2NTY A;  2C5J A;  3RLF F;  4K0U A;  3NWI A;  2LEH A;  2ACZ A;  4B3T T;  1OXZ A;  2BDE A;  1ZKE A;  4Z90 A;  2ZM2 A;  1FEW A;  4YSX A;  5EK4 A;  4ILA A;  3FXD B;  2ZMA A;  3GMI A;  2A2F X;  4KI0 F;  4U31 A;  2FJE A;  1MND A;  3RYC E;  5KXJ A;  4LF9 T;  2OLT A;  4YLH A;  3RYH E;  4NXN T;  4DR1 T;  3KBU A;  3AEB A;  4HWD A;  2X0L B;  2XPK A;  4H9N C;  4HGA A;  3AVR A;  2IML A;  4Q25 A;  4H9P C;  2NR4 A;  5BR8 T;  2W00 A;  4Z8X A;  1D1B A;  2NW8 A;  1T8B A;  2BBH A;  3Q5W A;  5JQG E;  3QNU A;  4ASK A;  3R84 B;  3D0T A;  2BKO A;  1NAF A;  4NUV A;  2XSA A;  4AKI A;  4IGU A;  1M62 A;  4AIS A;  2D5U A;  5JRE A;  2D2S A;  5AFU L;  4DV3 T;  2AXD S;  3AEA A;  1T72 A;  2VWA A;  3O1I A;  4DR5 T;  4BA9 A;  3CX6 B;  3WI3 A;  2CRB A;  1QSD A;  3PJA J;  3B57 A;  4N78 D;  1X9B A;  4LF8 T;  2WS3 A;  3O1J A;  4YJ2 E;  3RI5 A;  4AKH A;  2VKD A;  2NOX A;  2MYS A;  4A5X A;  3U78 A;  3AA1 B;  1LVK A;  4PK4 A;  4U2Y A;  4WBO A;  3EI0 A;  2RPA A;  4EB6 E;  2UXC T;  1OED A;  3PUY F;  2ODV A;  3OBV E;  2P9B A;  3UT5 E;  1HNW T;  1KEY A;  2ZM8 A;  4TWH A;  4JYA T;  2V6Y A;  3U3I A;  3LK3 B;  3I0O A;  3LK4 2;  1OED C;  4PFP A;  1YQ4 A;  4TNW A;  2UXB T;  4J2C A;  2YDS A;  4WZX A;  4KBM B;  5JR9 A;  2IC9 A;  4PW8 A;  2JIW A;  2K3W A;  4LF7 T;  4JI6 T;  1ZEE A;  3H37 A;  4AQF A;  2VKH A;  4I50 E;  2RP4 A;  4ILB A;  2W2U A;  3FHN A;  3AXJ B;  4M1P A;  2W67 A;  4DR3 T;  3ZMS B;  2Y48 B;  3AA6 B;  3RKO A;  4EZ4 A;  3QK6 A;  2XAH B;  3RRC A;  5JDF A;  4JEU B;  3KV4 A;  3Q5D A;  4A98 A;  3PV0 F;  1T7S A;  2LM2 A;  4UVB B;  4AQF C;  5AQG B;  3FXE B;  3RGL A;  4PJM A;  3LSV A;  1OED E;  4P1N A;  3CX7 B;  2EHO D;  1FMV A;  2JMH A;  3ZT6 A;  3ZT5 A;  5L3G B;  3ZSS A;  1QUU A;  3ANW B;  2XAF B;  2LRK A;  3N5L A;  1AJ3 A;  3UQ7 A;  4CN6 A;  1N36 T;  5LGT B;  4OX9 T;  2SPC A;  5LA6 E;  1XZY A;  2NP9 A;  3P7I A;  1D0Y A;  3PE0 A;  4KX6 A;  4P0B A;  2CWY A;  4DV7 T;  2WZI A;  3N2O A;  4QH5 A;  3C4Z A;  1HG5 A;  3TLV A;  2ZM0 A;  5HEH A;  3PUV F;  3AEE A;  4WNK A;  5C3J A;  4DBR A;  5AQR B;  4O2A E;  2MOZ A;  3T8O A;  4QH4 A;  2WBL A;  3RQW A;  4L9I A;  2ACX A;  1W0A A;  3ZT7 A;  1UUR A;  5H6Q B;  2VVN A;  1G8X A;  1IBM T;  2D9D A;  4OYK A;  5DQW A;  4NIQ A;  2UXN B;  2WDR A;  3VKG A;  5FXV A;  5AQN B;  2CWO A;  2LSI A;  2XHE B;  2Y8D A;  3HL6 A;  4CI2 B;  4AKL A;  3QUJ A;  3UUL A;  2XQA A;  5F3J A;  5LB7 B;  4CXY A;  5L2L A;  2D0T A;  2CHO A;  5L3D B;  5GON E;  4AKR B;  4H9O C;  3GA8 A;  3RYI E;  4ZS2 A;  4ZI2 D;  2CLY B;  3KV5 A;  4HE8 A;  3LFM A;  3CML A;  2L8K A;  3AE1 A;  4O4H E;  1U4Q A;  3C50 A;  1WR0 A;  4JBW F;  4WBN E;  3MAC A;  3MZK B;  4TWF A;  3EUH A;  5AQP B;  2QYW A;  1SA0 E;  3VR9 A;  2Q9Q A;  4EGW A;  2LRL A;  2PG8 A;  5FXX A;  3K1S A;  5LGU B;  2BZB A;  5CJ5 A;  2WM9 A;  4QX7 B;  2IHR 1;  4Z91 A;  4YHH T;  2VKJ A;  4A97 A;  2JQK A;  3C64 A;  1SE7 A;  4E7Z A;  4AQG A;  4OFZ A;  3PUS A;  4C90 A;  1J5E T;  1Y64 B;  3VR8 A;  3OJA A;  3FB2 A;  3MXZ A;  2X9X A;  5LBQ B;  2LSG A;  4IL9 A;  2A72 A;  5DJQ C;  3ETU A;  3RIU A;  1KF6 A;  2XZE A;  3HR0 A;  3OKQ A;  5FKY A;  2LOP A;  3UU8 A;  3FZK B;  2WU5 A;  3HKB E;  3OVU A;  4LF5 T;  4ZEY A;  2W0G A;  3F57 A;  2MPK A;  4I43 B;  3L39 A;  1D0Z A;  3RIU C;  2CM0 A;  4NPP A;  3BQI A;  3NKZ A;  3RKG A;  4YSZ A;  5A1L A;  5JTG A;  4UF0 A;  4U3C A;  4F8H A;  4IHJ E;  3O9X A;  2ZM6 T;  1GQE A;  3C4W A;  3JAF A;  3RH3 A;  2H7O A;  5LCY A;  5CFB A;  2XAJ B;  5AQM B;  4XAX B;  4UXN B;  1UX5 A;  5ABG A;  1ZHC A;  2H88 A;  5LG4 A;  5FY7 A;  2CBI A;  3ZYK A;  3AB3 B;  5HAX A;  2H89 A;  3N2G E;  5C2T A;  2E9X D;  2M6B A;  2OA5 A;  2CHN A;  3UUB A;  5AQJ B;  2V6Y B;  1S94 A;  2YK0 A;  1J5W A;  2EHO A;  4GYR A;  1B7T A;  5JR9 B;  3J7Y q;  1HFA A;  3UU4 A;  2CBJ A;  4P09 A;  4KHZ F;  4YTN A; 
#chains in the Genus database with same CATH homology
 4IDP A;  3OVU A;  3QOF A;  1XZY A;  1W09 A;  4IDQ A;  4IDN A;  1W0A A;  1Z8U A;  3Q5D A;  3Q5E A;  1W0B A;  1Y01 A;  3IA3 A;  3QNU A;  4IDO A;  3X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...