2L9QA

Structural characterization of small heat shock protein (hsp12)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords 12 kDa heat shock protein
publication title Structural Characterization of small heat shock protein (Hsp12)
rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04119 HSP9_HSP12 Heat shock protein 9/12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1260 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2l9qA00
2LJLA 2L9QA 4AXPA
chains in the Genus database with same CATH superfamily
2YKSA 3FZLB 4N78D 2KINB 2CXDA 4ZOLE 1J5WA 4CN6A 3LFMA 3I9WA 4P1NA 2V26A 2A2FX 4DV0T 3N5LA 2J1DG 4EZHA 2HHHT 5AQQB 5F5WA 2K48A 1T72A 3ZKRA 3IEEA 4V1Av 2Y8DA 4ZEYA 4HTEA 3KV9A 4E7ZA 2BBJA 2XQYA 3OYXA 2XQ8A 2BS2A 4A56A 4X20E 4JI5T 2RA1A 2CA5A 5JDHA 1MMDA 2BKNA 3UT5E 2EHOD 5LGNB 4H63V 4FJOA 2LKHA 3A5XA 3K3NA 3DTOA 5L47A 4PK4A 4OX9T 3RIAA 2D5UA 3P4PA 2V7MA 3F57A 3QC9A 1X9BA 3FXDB 2B1EA 4QH1A 3CQGB 4YTNA 3FB2A 4DVDA 3AXJB 5HXEA 5JRCA 1B7TA 3CQXC 2UXBT 2J47A 4I55E 3RKGA 5EK3A 1XZYA 1WR0A 2HH7A 3PU8A 4TWHA 4HWFA 3X1DA 2XM2A 2D9DA 2MPKA 4IE6A 4LMKA 2VKOA 4EOZB 3ZC0A 2UUCT 3TKLB 2C5JA 2LHRA 5FY0A 1WRDA 1Y01A 2WBLA 5JDNA 2CXFA 4U33A 2IIUA 1YQ3A 4HFHA 5L4HA 2KZ7B 2EHOA 5LXTE 1Z8UA 5AQUB 5JVDE 5ABGA 4UEMA 2BVLA 5HXCA 3HKDE 2XASB 2IMLA 4QXCB 1VRBA 2WDRA 1KNRA 2WZHA 2H3RA 3CX7B 1XMOT 3F31A 4TX5A 4AI6A 2P9BA 3R6NA 2KMFA 4X1IE 2WU2A 2BBHA 4B3ST 4JEUB 4DV4T 4GK5E 3RYHE 5JR9C 4ERRA 1HNXT 2X0LB 3UFEA 2HPLA 5L3GB 2BG9C 4TV8E 3A7MA 5AQLB 4ZS2A 2XSBA 3NKZA 3RIUA 5CJ5A 4ISTA 3G06A 4PK6A 4EZ4A 3LDQB 2LRLA 1KK7A 4B3RT 4TWFA 1VOMA 1UUSA 4MLKA 3C50A 3CX8B 2YK0A 4JLEA 5FNVE 5FXWA 5HCJA 4GKJT 3AAIA 3C98B 1UGOA 4CI2B 4GK0E 4ILBA 4CN4A 4JI3T 2PTFA 1FEWA 3QOFA 1IZNB 5LYJE 5LGUB 4JI7T 3O4XE 2VK9A 1J1JA 2E9XD 3TLUA 5IWAT 3TLTA 2UXDT 4HFCA 3W15B 2WDQA 2J62A 5AQMB 1YXRA 3N2OA 4CI3B 2W0GA 3RLFF 4IHJE 4UXNB 2R6GF 3UULA 2WP9A 5C8YE 4HEAA 2Y6XA 4DV7T 2PFVA 1FJGT 1W09A 2WWUA 4NXMT 3ZSSA 4UV9B 3SFEA 2V7KA 1XNQT 4ILAA 4DIDB 3HA4A 3RIFA 2LOSA 4ZZBA 4OK0A 2KXPB 4XBFB 2LOPA 1J5ET 2H7OA 5FVLA 1R8IA 5CFBA 3FZKB 1W9RA 2JQQA 5L4EA 5JREA 2C0SA 2UXXB 3SS1A 4AKIA 2N1GA 4CXWA 2M6BA 2X51A 5F3JA 2A3DA 3NVOA 3JAFA 2UXCT 4YTPA 4H9OC 4KHZF 2D2SA 4X1KE 4LFAT 3VRAA 3LK42 1UURA 4HWDA 3A8YC 3AE5A 4Q25A 3MJXA 4ZI2C 4IT4A 2C5IT 3JC6C 4BJMA 2V7LA 1HCIA 3OJAA 2CM0A 3FZFB 4YHHT 4X66T 3R84B 4IE0A 3CX6B 3LK2B 2WAUA 2ZM2A 2I59A 4JYAT 2BZBA 3HL6A 3N9MA 3PUXF 4X62T 3MACA 3VKHA 4MALA 5ABFB 3D0TA 5IUXA 3AA0B 5KMGP 3ETVA 2AXDS 5J2TE 2I6HA 4HFEA 3J9X1 4LF5T 3K3OA 1IAPA 4U3CA 5L3DB 2VL0A 3C4ZA 3QNUA 3CK6A 5JR9A 2W66A 5C2TA 2BG9A 4KMCA 4IDNA 4A98A 2K5BB 2QA7A 5LP6E 2KNDA 4AXPA 1HR0T 2XQAA 4DV3T 1JNRA 3O1HA 4OYKA 1T7SA 4I0UA 1G8XA 4F6RC 2V7JA 5FYMA 2L3LA 2YDRA 5HXRA 3C51A 1QSDA 3RKOA 5AQHB 4LFBT 4YJ3E 2YOEA 5J1GA 2XQ9A 5KXJA 2YEVC 3LBXB 1SE7A 4KI0F 3SWHA 1M62A 2VQFT 4EB6E 3AE7A 1H7CA 1HNZT 3ANWA 2KWHA 3B5MA 2LM9A 2WB5A 1W0BA 3KV5A 4KX6A 4DV2T 2DCFA 1SHZC 2JMKA 5LHHB 4LFCT 2VB6A 1NAFA 4DV6T 3BQKA 4AQGA 4HGAA 3UQ4A 3ZC1A 3IBPA 1I94T 1S35A 5HCMA 4IIJE 2FJDA 4ZI2D 4BAYB 5JTGA 4H9PC 1FIOA 3P4WA 4NPPA 5HWXA 1V9DA 2ZLYA 2JQHA 3OTOT 1N34T 4YLHA 3PUGA 5AQPB 1WLXA 2BS4A 3ESLA 2M6IA 2V6YA 5FY1A 1DU2A 2LM2A 2NTXA 4XZCA 4GOUA 4COFA 4EAHA 3N9OA 4JI6T 3B57A 4L0RA 1EZ3A 5AQRB 3AE8A 3QUJA 2JMHA 3M3ZB 1MMGA 5CGMA 5CA1E 3E08A 5LJNA 3TLSA 4QXBB 3JCFA 1O3XA 3SOLA 4DUYT 5AQNB 4F8HA 5HXHA 2LSYA 3ZMZB 1MMNA 5AQOB 2IW5B 2ZM6T 1D0YA 3RRWA 4ZS3A 3HR0A 2XJ7A 5H6RB 4UELA 3AXJA 2CBJA 2CPTA 1ZKEA 2LEHA 3RGLA 2FUPA 4UIGA 4UVAB 2PJQA 1UX5A 3LG7A 4MFRA 3OPCA 2JRKA 3PTRB 3KVBA 3Q5XA 3VR8A 3S4UA 4L9IA 4YTMA 3ZMSB 2XAHB 3UQ7A 3MA9A 2WDVA 4AKRB 1HTJF 4PJJA 2K3WA 3Q9DA 5JQGE 4HKAA 4WBNE 2CXLA 3ZMUB 2AE9A 3FBZA 4GKKT 1BR0A 1XDOA 2Q9QB 3NRYA 2WS3A 1OEDE 4K0KT 1ZHCA 2BKOA 3AB3B 3RI5A 3PJAJ 2X68A 3UUMA 5LJMA 1XNRT 4JI2T 4QHOA 2ZM8A 1HFAA 3RHWA 4OYJA 3SRZA 3ZYKA 1LRZA 1UX4A 4DR1T 2CEAA 4U2YA 1D1AA 3RYFE 5C3JA 4LMLA 4BA9A 4DUZT 3Q2MA 3FHNA 5L3FB 3T1HT 1YD8G 1KFYA 2BS3A 4C91A 3H3AA 1X79A 2D0TA 3EDVA 3ONXA 4QWNB 4B6XA 2LLYA 2LSJA 3AEAA 4PFOA 2CHOA 3HKEE 4G2AA 3NWIA 4J2CA 3VHLA 5KX5E 4PJLA 1IJ5A 3OKQA 1HNWT 2X0YA 3TLWA 4JBWF 1NENA 4DR6T 2DWGA 2MOZA 3KVAA 4H9QC 1YW0A 5DJQC 5FL0A 4UR9A 2XSAA 2XAQB 3NZPA 5DQWA 5HXSA 4YSYA 3U3IA 5JDGA 4DV5T 2WCAA 2X9HA 2UUAT 4QX8B 1QUUA 3F2EA 1MMAA 1E2AA 3IHRA 3WAKA 3GA8A 3HI2A 3ZLIA 3NBXX 2EHOB 5LBMA 2FJAA 3MK7C 4U2ZA 4JI4T 4WYVA 3OBVE 5E0OA 4U7IA 3KINB 4ANJA 3GMIA 2XY8B 2LE8A 5J0ZA 2L9QA 3AECA 4LF4T 3RC8A 3O1JA 2NR4A 1WYCA 1SA0E 4YFSA 1OWAA 3ZYLA 4XAXB 4UVBB 2XHEB 4IL9A 1JNZA 4JI8T 3ONJA 3LK3B 1VCSA 5LBQB 4Z91A 2ES0A 4I50E 3WAJA 4U31A 2W2UA 2XUEA 4B3TT 1UK5A 3J7Yq 3IF8B 3LJCA 3RPUA 4I4TE 2L8KA 4PAGA 3ZJ1A 3ZN1B 4C90A 3CIRA 3PV0F 1T8BA 4YHJA 2WWVA 2WM9A 2HN1A 2Y48B 2X0HA 3JAEA 5DQVA 3UUXB 5HEHA 3NRXA 5ABFA 4O8SA 3L3PA 2IHR1 2G0UA 3U78A 3Q5EA 2E2AA 3AE4A 2CHNA 1N36T 3CMLA 2Z6EA 5TAOA 3AE2A 3H3MA 4H9RC 1MIYA 3CWZB 2CRBA 1VCTA 4U74A 2OA5A 1FMVA 2W62A 2ODUA 5AFUL 2Q9QC 3C4XA 5A1LA 4HFBA 2LRKA 5HEOA 3UU4A 2WY2A 3P4SA 2B76A 2FJBA 3BQIA 2HPJA 4IGUA 5L3EB 5EK4A 1ZV4X 3I0OA 3PUAA 5LMNT 4TUYE 4PFPA 5EZYE 4DO0A 3RQWA 3ZT5A 4CN1A 1CUNA 1HX1B 3UUBA 4NUUA 4HFDA 3C4WA 1BR1A 4LF9T 1W0AA 2NWBA 4CI1B 4DBQA 2E9XB 3QK6A 3RF1A 3WI3A 5AQTB 4NIQA 2LSIA 4M1PA 4O4LE 2ACXA 4IDPA 2JPFA 2KSRA 4O4IE 4EXTA 4P0AA 4O4HE 3I1AA 4O2BE 2QRXA 3GN5A 2H89A 5LOVE 5AQGB 1IJ6A 3ZCIA 2JJ9A 4O4JE 1WFDA 2X9WA 4ADZA 3HKBE 2XAJB 1S94A 3KFWX 1N33T 3AA6B 4HFVA 4IDZA 3P8CD 3NZQA 1N32T 2KWIB 3AVSA 2DHRA 3ZCJA 3O9XA 4UV8B 3ETUA 3AEBA 4HN9A 3E0ZA 5FXXA 5CB4E 2RP4A 1OEDB 1D1BA 2V5DA 3P7IA 2Q9QD 3PJAA 3ZMTB 2I0MA 3JC6D 2IDOB 3UU5A 2CLYB 4QXHB 1SUMB 2WQYA 5F8PA 2MTQA 5FKYA 3Q5WA 2VL8A 3L09A 3FBLA 1IBLT 1NEKA 1YKEB 5ABEA 2VKDA 2VVSA 4YT0A 1KNZA 2H88A 1NWMX 4TV9E 4X64T 3PUVF 1MNEA 1FMWA 4ASKA 5L3BB 3N9QA 5M4YA 2F4VT 1ZOYA 2XPKA 3AAEB 3ANWB 2FJEA 2UUBT 3PUZF 3RRCA 3EUHA 4EV6A 3UU3A 3PUQA 2CE7A 2CBIA 2E5VA 1ZEEA 2BVMA 1IBMT 4AKLA 5FXVA 4UF0B 4EYYR 2PG8A 2UU9T 2Q9QA 2YINA 1D0XA 2V7IA 3DJBA 3AEFA 5BR8T 2NW8A 4H9SE 2ZMAA 5FVKA 3PUSA 4QKNA 5HYAA 4KHPT 3ZSTA 4IE7A 2CWOA 4K0UA 4ZZCA 1CHUA 2DL1A 2V6YB 1WR6A 5LA6E 3GWHA 4BJNA 4NUVA 2LJLA 3KBTA 1XDPA 1UCUA 4GYRA 3VR9A 2W00A 2DWKA 5HEGA 4DR7T 5DABA 3MXZA 5H6QB 2KT9A 4I43B 2IC9A 2DI4A 3N2KE 1US7B 1XMQT 4MHCA 5JH7E 3AAAB 4QH5A 4AKHA 1KEYA 4EEDA 2VURA 2BG9E 4OFZA 4Z90A 3RYIE 5EK2A 3B13A 2LSGA 3T1YT 2NP9A 2DLRA 3DP7A 3E22E 3ZEFB 2MBGA 3ZT7A 4HWHA 4AQYT 1AJ3A 3KBUA 3PDYA 4YXDA 4WBOA 2NOXA 3PE0A 2E9XC 2ZM0A 2XAFB 3EI0A 4GYSA 2LSKA 4IL4A 3RYCE 1BR2A 4PK5A 3ZPOA 4DMWA 4H9NC 4IE4A 4JI0T 4AIUA 3LSVA 2MAWA 3K1SA 3AVRA 2RPAA 3UU8A 2N9DA 2W61A 5HEUA 4LF8T 4AQFC 3P4RA 2V1DB 2NTYA 1KF6A 4HE8A 2XZEA 4Z8XA 3UUNA 2YU1A 1LVFA 3EDUA 5L2LA 2K24A 2CMRA 2VKHA 4LF6T 5JRCB 3UU6A 4DBRA 4JUYA 2XQ7A 4HFIA 3V5SA 5ETWA 3N9NA 4DR3T 2NW9A 4YSXA 3K3QC 3EVYA 2XTLA 4ILUA 3ABVA 4E7SA 5LNKA 3T8OA 4IREA 2YU2A 2VWAA 1OEDC 3O1IA 5LG3A 1HG2A 2IUBA 2X9YA 3MKDA 2YDQA 5HEJA 2V5CA 4ZI3C 4PJMA 2CLYC 4IDOA 2J4GA 1LKXA 5FL1A 2XQ5A 3OYZA 4MBQA 4KBMB 2YDSA 3CPZA 3FZMB 3EAMA 5AQKB 5L3CB 3RC3A 1U4QA 3VU7H 2BDEA 3P50A 5ABHA 4AISA 2H7VC 3CVRA 3UTKA 4TNWA 4PJNA 2LHNA 4P0BA 3SFDA 2XQ3A 2XAGB 3QB5K 1D1CA 4EEBA 4ILCA 3N9PA 5BMVE 4YJ2E 4NXNT 3AE3A 2OLTA 4KP3C 1Y64B 4ZHQE 4GIWA 2X67A 5FXZA 4PNIA 2IAKA 3PURA 5LGTB 2KLQA 2VASA 1GQEA 2A9UA 4TN7B 3AEEA 3N9LA 4U7YA 2E8IA 4B3MT 3I9YA 4EGWA 1QLBA 2BKPA 2WZIA 5JDLA 2VQET 3RX6A 4AKGA 2V8SV 5KDMC 1XWMA 2ACZA 5HWYA 2W67A 3KV4A 4UVCB 2JQKA 5HAXA 4QH4A 3KDSE 2VKJA 4ZXLA 4DR5T 2W63A 5J2UE 4EIWA 1YKHB 4JI1T 2IC6A 4DMVA 5LMUT 5FP3A 2C5KT 5FMNA 3C64A 3M65A 2CWYA 1D0ZA 3RQUA 4CXXA 2V6XA 2E9XA 2D0UA 3EHZA 4OHFA 3PUWF 4ZI3D 1MIVA 1YQ4A 4YY3T 4X65T 3FXEB 2ODVA 3PUYF 4H63H 2A72A 5CA0E 2XM1A 3AE6A 3ZYMA 1OXZA 4CQIA 1MNDA 4AQFA 5LG4A 3ZMVB 4ISSA 3AA7B 2OV9A 2XQ4A 1M7KA 3LBXA 3AEDA 5AQFB 2QVAA 2WU5A 2E5LT 5LB7B 2LKGA 4TZ4C 1HX8A 2K9AA 4LF7T 5JDQA 1E1HB 1LVKA 3I0QA 5IYZE 2CCQA 3AA1B 4A5XA 3QB5A 3V5UA 3N2GE 4WZXA 1IBKT 3BQLA 5LHIB 3UFGA 4G63A 2WSSV 4JV5T 3L39A 2UXNB 5AQVB 3BK9A 4JEHB 2YN6A 3VRBA 4EYUA 1WYBA 1OEDA 3ZJ2A 4FI5A 3IA3A 4IE5A 2LT3A 3CKDA 2WMNA 4LMJA 3HKCE 4CZZB 5LHGB 3AEGA 3ZT6A 1HG5A 2WMOA 4PW8A 3RH3A 3L8RA 1HS7A 5AQJB 1MIWA 5JDFA 2QGSA 3CQCB 4KUMB 1HF8A 4X1YE 5ADXL 5JDMA 3P4QA 5IHYA 2NW7A 2N2NA 4YSZA 3AE1A 2EHOC 5FY7A 5GONE 3MZKB 2X9XA 3PU3A 3ZN0B 3FZHB 4L5GA 5JR9B 3AE9A 2DNXA 4TWDA 3ONLC 2BG9B 5AQSB 2VVNA 4A97A 4QX7B 4WW0A 4DV1T 4UF0A 1KNPA 1G73A 1T98A 2GK9A 2QYWA 1ZP0A 4IDQA 4DR2T 2X66A 3GN5B 3Q5DA 1I6ZA 1WCRA 1L0VA 1E7PA 3K8PC 4P09A 4O2AE 1BR4A 2JIWA 4DR4T 2HN2A 2JQ9A 2M67A 2PBIA 3TLVA 4HWCA 4U72A 2MYSA 2XQ6A 4X5TA 4HWIB 1Z0PA 4CXYA 2W4XA 3RIUC 3EABA 3H37A 1U5PA 4ZI7E 3JADA 4WNKA 3KV6A 2FBWA 3OVUA 5AQIB 4TNVA 3VKGA 4DNDA 5LCYA 2SPCA
chains in the Genus database with same CATH topology
2K5BB 2ES0A 4I50E 2N9DA 2QA7A 2W61A 4N78D 2KNDA 5LP6E 2KINB 2CXDA 4ZOLE 4AQFC 4AXPA 3WAJA 2V1DB 2XUEA 2NTYA 4HE8A 3LFMA 3O1HA 3I9WA 4OYKA 3J7Yq 3IF8B 3LJCA 3RPUA 1G8XA 4Z8XA 4I4TE 2L8KA 2V26A 4PAGA 2A2FX 3UUNA 4F6RC 3ZJ1A 2YU1A 1LVFA 3EDUA 3ZN1B 4C90A 5L2LA 2V7JA 3N5LA 2J1DG 2L3LA 5FYMA 4EZHA 5HXRA 2K24A 2CMRA 2VKHA 3C51A 5JRCB 1QSDA 3RKOA 4YHJA 4YJ3E 4DBRA 4JUYA 2K48A 2WM9A 2Y48B 5J1GA 3V5SA 3IEEA 5DQVA 3N9NA 5ETWA 2YEVC 4V1Av 2Y8DA 3UUXB 2NW9A 3LBXB 4HTEA 3KV9A 3K3QC 3NRXA 3EVYA 4E7ZA 2XTLA 4ILUA 4O8SA 3SWHA 2XQYA 3OYXA 3L3PA 4E7SA 5LNKA 4A56A 4EB6E 4X20E 3T8OA 2G0UA 3U78A 1H7CA 2RA1A 2CA5A 5JDHA 3ANWA 2KWHA 2YU2A 2VWAA 3CMLA 1MMDA 3UT5E 2LM9A 2Z6EA 2EHOD 3O1IA 5TAOA 5LGNB 1HG2A 3KV5A 4H63V 4FJOA 2X9YA 2DCFA 3MKDA 3A5XA 1SHZC 2JMKA 1MIYA 3CWZB 4H9RC 3K3NA 3DTOA 5LHHB 2VB6A 4PK4A 1NAFA 4U74A 3BQKA 2OA5A 1FMVA 2W62A 4ZI3C 4AQGA 2ODUA 4HGAA 4PJMA 2CLYC 5AFUL 2Q9QC 3ZC1A 2D5UA 3C4XA 3IBPA 1S35A 5A1LA 2V7MA 4IIJE 3F57A 3QC9A 1LKXA 4ZI2D 4BAYB 3FXDB 2B1EA 3OYZA 3CQGB 3BQIA 2HPJA 4MBQA 4H9PC 4KBMB 1FIOA 3FB2A 4IGUA 4DVDA 5EK4A 5L3EB 5HWXA 1V9DA 1ZV4X 3I0OA 3PUAA 5HXEA 3CPZA 2ZLYA 5JRCA 5L3CB 4TUYE 3RC3A 1U4QA 4PFPA 5EZYE 3VU7H 2BDEA 4DO0A 1B7TA 3CQXC 4I55E 5EK3A 1CUNA 4YLHA 3PUGA 1WLXA 2H7VC 3ESLA 3CVRA 5FY1A 4NUUA 3UTKA 2HH7A 2NTXA 4PJNA 3PU8A 4XZCA 4GOUA 3C4WA 2LHNA 4P0BA 4EAHA 3N9OA 2XAGB 4IE6A 1BR1A 2VKOA 3B57A 4EOZB 2NWBA 1D1CA 3ZC0A 4L0RA 4CI1B 1EZ3A 3TKLB 2C5JA 3N9PA 5BMVE 2LHRA 4YJ2E 5FY0A 3QUJA 2JMHA 1WRDA 4DBQA 2E9XB 3QK6A 2WBLA 4KP3C 5JDNA 3WI3A 1MMGA 1Y64B 5CA1E 3E08A 2CXFA 4ZHQE 4GIWA 2X67A 5FXZA 4PNIA 2IAKA 2LSIA 5LJNA 3PURA 5LGTB 4M1PA 4O4LE 2KLQA 2ACXA 2VASA 2KZ7B 2EHOA 2JPFA 4QXBB 5LXTE 4TN7B 1O3XA 4O4IE 3SOLA 4EXTA 4P0AA 3N9LA 4O4HE 3I1AA 5JVDE 2E8IA 3I9YA 5HXHA 4UEMA 2LSYA 5JDLA 2BVLA 3ZMZB 1MMNA 4O2BE 5HXCA 3GN5A 5LOVE 2IW5B 3RX6A 4AKGA 1D0YA 3RRWA 5KDMC 3HKDE 4ZS3A 1IJ6A 5HWYA 3ZCIA 2XASB 3HR0A 2JJ9A 4QXCB 1VRBA 4UELA 5H6RB 4O4JE 3KV4A 2X9WA 4ADZA 3HKBE 2H3RA 2XAJB 3CX7B 4UVCB 1ZKEA 1S94A 3F31A 3KFWX 5HAXA 4TX5A 3KDSE 3AA6B 2VKJA 4HFVA 4AI6A 2P9BA 2LEHA 3R6NA 2KMFA 4IDZA 2W63A 3P8CD 4X1IE 5J2UE 4EIWA 4UIGA 4UVAB 2PJQA 1UX5A 1YKHB 4JEUB 3LG7A 2IC6A 3NZQA 4MFRA 4DMVA 2JRKA 3PTRB 4GK5E 3RYHE 5FP3A 3KVBA 4ERRA 5JR9C 3Q5XA 2C5KT 5FMNA 2X0LB 3UFEA 2KWIB 3S4UA 4L9IA 3C64A 3M65A 2CWYA 2DHRA 3AVSA 1D0ZA 2HPLA 5L3GB 4TV8E 3ZMSB 3ZCJA 4CXXA 3O9XA 2XAHB 2E9XA 4UV8B 3ETUA 3MA9A 4ZS2A 2D0UA 4HN9A 4OHFA 4AKRB 3E0ZA 4ISTA 5FXXA 1HTJF 4PK6A 4PJJA 4EZ4A 5CB4E 4ZI3D 2RP4A 1D1BA 1MIVA 3P7IA 3Q9DA 2Q9QD 1KK7A 3ZMTB 5JQGE 1VOMA 3FXEB 4HKAA 2ODVA 3C50A 4MLKA 4WBNE 3CX8B 3JC6D 2YK0A 2CXLA 3ZMUB 3FBZA 4JLEA 4H63H 2A72A 5CA0E 5FNVE 5FXWA 3ZYMA 1BR0A 1OXZA 2CLYB 2Q9QB 3NRYA 4CQIA 3AAIA 1MNDA 4AQFA 5LG4A 4QXHB 3ZMVB 4ISSA 5F8PA 3C98B 2MTQA 4CI2B 4GK0E 3AA7B 3Q5WA 2VL8A 3L09A 1ZHCA 3FBLA 3LBXA 3AB3B 1FEWA 1IZNB 1YKEB 2VKDA 5LYJE 2X68A 5LGUB 3O4XE 1KNZA 3UUMA 5LJMA 4TZ4C 2VK9A 1HX8A 2E9XD 2K9AA 5JDQA 1NWMX 4TV9E 1E1HB 4QHOA 1LVKA 3I0QA 5IYZE 2CCQA 2ZM8A 3AA1B 1MNEA 1FMWA 1HFAA 4OYJA 3SRZA 3V5UA 3ZYKA 4ASKA 5L3BB 1LRZA 1UX4A 3N2GE 3N9QA 5M4YA 2CEAA 3AAEB 1D1AA 3RYFE 3W15B 3BQLA 3N2OA 4BA9A 3ANWB 5LHIB 4G63A 2WSSV 3Q2MA 2W0GA 3FHNA 4CI3B 5L3FB 1YD8G 4IHJE 4UXNB 4C91A 3UULA 3H3AA 2UXNB 3RRCA 3BK9A 4JEHB 1X79A 2D0TA 5C8YE 4HEAA 3EDVA 3EUHA 3ONXA 2Y6XA 1WYBA 4QWNB 4EYUA 2PFVA 3ZJ2A 3PUQA 2LSJA 4FI5A 2CE7A 4B6XA 4PFOA 1ZEEA 2BVMA 3HKEE 4G2AA 2WWUA 4AKLA 4IE5A 5FXVA 4UF0B 2LT3A 4EYYR 4J2CA 3CKDA 2PG8A 3VHLA 5KX5E 4UV9B 2WMNA 4PJLA 2Q9QA 2YINA 1IJ5A 3HKCE 4CZZB 1D0XA 5LHGB 2V7KA 2V7IA 3DJBA 3OKQA 2NW8A 1HG5A 2WMOA 4PW8A 4H9SE 3RH3A 2ZMAA 1HS7A 3PUSA 4QKNA 1MIWA 3HA4A 5HYAA 5JDFA 2LOSA 2QGSA 3CQCB 4OK0A 4KUMB 2DWGA 2KXPB 1HF8A 2MOZA 3KVAA 4H9QC 4XBFB 4X1YE 5ADXL 2LOPA 1YW0A 4IE7A 5DJQC 2H7OA 5JDMA 2CWOA 4K0UA 5IHYA 2NW7A 2N2NA 2XAQB 1WR6A 3NZPA 5LA6E 3GWHA 4BJNA 2JQQA 4NUVA 5DQWA 5HXSA 2LJLA 3KBTA 1UCUA 5JREA 4GYRA 2C0SA 3U3IA 2UXXB 2EHOC 5JDGA 5FY7A 5GONE 3MZKB 2X9XA 2W00A 2N1GA 3PU3A 3SS1A 2X9HA 2DWKA 4CXWA 4AKIA 4QX8B 3ZN0B 1QUUA 3F2EA 2X51A 5F3JA 2A3DA 4L5GA 1MMAA 5JR9B 5DABA 3MXZA 5H6QB 3IHRA 2DNXA 4H9OC 2D2SA 2KT9A 4I43B 3WAKA 2IC9A 2DI4A 3GA8A 4X1KE 3N2KE 4QX7B 3HI2A 4WW0A 3ZLIA 1US7B 3LK42 3NBXX 4MHCA 2EHOB 5JH7E 3MJXA 5LBMA 4UF0A 3AAAB 1G73A 1T98A 2GK9A 4ZI2C 2C5IT 3MK7C 3JC6C 4BJMA 4AKHA 2V7LA 1HCIA 3OJAA 2CM0A 2X66A 3R84B 4IE0A 3GN5B 4OFZA 3RYIE 3CX6B 3LK2B 5EK2A 3B13A 2WAUA 3OBVE 2LSGA 5E0OA 2ZM2A 3K8PC 2NP9A 2DLRA 2I59A 4O2AE 3DP7A 4P09A 3KINB 1BR4A 2BZBA 3E22E 3ZEFB 2MBGA 4ANJA 3GMIA 3HL6A 3N9MA 3MACA 3VKHA 1AJ3A 3KBUA 3PDYA 2M67A 2PBIA 2LE8A 4MALA 2L9QA 3RC8A 3O1JA 3D0TA 4WBOA 2NOXA 4U72A 3PE0A 3AA0B 2E9XC 2MYSA 2ZM0A 1WYCA 1SA0E 2XAFB 5KMGP 3ETVA 1Z0PA 4CXYA 4GYSA 5J2TE 2LSKA 3J9X1 4YFSA 3RYCE 3K3OA 1OWAA 1IAPA 3H37A 1U5PA 1BR2A 3ZYLA 4ZI7E 4PK5A 4XAXB 3ZPOA 4DMWA 4UVBB 4H9NC 5L3DB 4WNKA 3KV6A 4IE4A 2XHEB 3C4ZA 3LK3B 3AVRA 5JR9A 3VKGA 5LBQB 4DNDA 5LCYA 2SPCA 4KMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJL A;  2L9Q A;  4AXP A; 
#chains in the Genus database with same CATH topology
 2YKS A;  3FZL B;  4N78 D;  2KIN B;  2CXD A;  4ZOL E;  1J5W A;  4CN6 A;  3LFM A;  3I9W A;  4P1N A;  2V26 A;  2A2F X;  4DV0 T;  3N5L A;  2J1D G;  4EZH A;  2HHH T;  5AQQ B;  5F5W A;  2K48 A;  1T72 A;  3ZKR A;  3IEE A;  4V1A v;  2Y8D A;  4ZEY A;  4HTE A;  3KV9 A;  4E7Z A;  2BBJ A;  2XQY A;  3OYX A;  2XQ8 A;  2BS2 A;  4A56 A;  4X20 E;  4JI5 T;  2RA1 A;  2CA5 A;  5JDH A;  1MMD A;  2BKN A;  3UT5 E;  2EHO D;  5LGN B;  4H63 V;  4FJO A;  2LKH A;  3A5X A;  3K3N A;  3DTO A;  5L47 A;  4PK4 A;  4OX9 T;  3RIA A;  2D5U A;  3P4P A;  2V7M A;  3F57 A;  3QC9 A;  1X9B A;  3FXD B;  2B1E A;  4QH1 A;  3CQG B;  4YTN A;  3FB2 A;  4DVD A;  3AXJ B;  5HXE A;  5JRC A;  1B7T A;  3CQX C;  2UXB T;  2J47 A;  4I55 E;  3RKG A;  5EK3 A;  1XZY A;  1WR0 A;  2HH7 A;  3PU8 A;  4TWH A;  4HWF A;  3X1D A;  2XM2 A;  2D9D A;  2MPK A;  4IE6 A;  4LMK A;  2VKO A;  4EOZ B;  3ZC0 A;  2UUC T;  3TKL B;  2C5J A;  2LHR A;  5FY0 A;  1WRD A;  1Y01 A;  2WBL A;  5JDN A;  2CXF A;  4U33 A;  2IIU A;  1YQ3 A;  4HFH A;  5L4H A;  2KZ7 B;  2EHO A;  5LXT E;  1Z8U A;  5AQU B;  5JVD E;  5ABG A;  4UEM A;  2BVL A;  5HXC A;  3HKD E;  2XAS B;  2IML A;  4QXC B;  1VRB A;  2WDR A;  1KNR A;  2WZH A;  2H3R A;  3CX7 B;  1XMO T;  3F31 A;  4TX5 A;  4AI6 A;  2P9B A;  3R6N A;  2KMF A;  4X1I E;  2WU2 A;  2BBH A;  4B3S T;  4JEU B;  4DV4 T;  4GK5 E;  3RYH E;  5JR9 C;  4ERR A;  1HNX T;  2X0L B;  3UFE A;  2HPL A;  5L3G B;  2BG9 C;  4TV8 E;  3A7M A;  5AQL B;  4ZS2 A;  2XSB A;  3NKZ A;  3RIU A;  5CJ5 A;  4IST A;  3G06 A;  4PK6 A;  4EZ4 A;  3LDQ B;  2LRL A;  1KK7 A;  4B3R T;  4TWF A;  1VOM A;  1UUS A;  4MLK A;  3C50 A;  3CX8 B;  2YK0 A;  4JLE A;  5FNV E;  5FXW A;  5HCJ A;  4GKJ T;  3AAI A;  3C98 B;  1UGO A;  4CI2 B;  4GK0 E;  4ILB A;  4CN4 A;  4JI3 T;  2PTF A;  1FEW A;  3QOF A;  1IZN B;  5LYJ E;  5LGU B;  4JI7 T;  3O4X E;  2VK9 A;  1J1J A;  2E9X D;  3TLU A;  5IWA T;  3TLT A;  2UXD T;  4HFC A;  3W15 B;  2WDQ A;  2J62 A;  5AQM B;  1YXR A;  3N2O A;  4CI3 B;  2W0G A;  3RLF F;  4IHJ E;  4UXN B;  2R6G F;  3UUL A;  2WP9 A;  5C8Y E;  4HEA A;  2Y6X A;  4DV7 T;  2PFV A;  1FJG T;  1W09 A;  2WWU A;  4NXM T;  3ZSS A;  4UV9 B;  3SFE A;  2V7K A;  1XNQ T;  4ILA A;  4DID B;  3HA4 A;  3RIF A;  2LOS A;  4ZZB A;  4OK0 A;  2KXP B;  4XBF B;  2LOP A;  1J5E T;  2H7O A;  5FVL A;  1R8I A;  5CFB A;  3FZK B;  1W9R A;  2JQQ A;  5L4E A;  5JRE A;  2C0S A;  2UXX B;  3SS1 A;  4AKI A;  2N1G A;  4CXW A;  2M6B A;  2X51 A;  5F3J A;  2A3D A;  3NVO A;  3JAF A;  2UXC T;  4YTP A;  4H9O C;  4KHZ F;  2D2S A;  4X1K E;  4LFA T;  3VRA A;  3LK4 2;  1UUR A;  4HWD A;  3A8Y C;  3AE5 A;  4Q25 A;  3MJX A;  4ZI2 C;  4IT4 A;  2C5I T;  3JC6 C;  4BJM A;  2V7L A;  1HCI A;  3OJA A;  2CM0 A;  3FZF B;  4YHH T;  4X66 T;  3R84 B;  4IE0 A;  3CX6 B;  3LK2 B;  2WAU A;  2ZM2 A;  2I59 A;  4JYA T;  2BZB A;  3HL6 A;  3N9M A;  3PUX F;  4X62 T;  3MAC A;  3VKH A;  4MAL A;  5ABF B;  3D0T A;  5IUX A;  3AA0 B;  5KMG P;  3ETV A;  2AXD S;  5J2T E;  2I6H A;  4HFE A;  3J9X 1;  4LF5 T;  3K3O A;  1IAP A;  4U3C A;  5L3D B;  2VL0 A;  3C4Z A;  3QNU A;  3CK6 A;  5JR9 A;  2W66 A;  5C2T A;  2BG9 A;  4KMC A;  4IDN A;  4A98 A;  2K5B B;  2QA7 A;  5LP6 E;  2KND A;  4AXP A;  1HR0 T;  2XQA A;  4DV3 T;  1JNR A;  3O1H A;  4OYK A;  1T7S A;  4I0U A;  1G8X A;  4F6R C;  2V7J A;  5FYM A;  2L3L A;  2YDR A;  5HXR A;  3C51 A;  1QSD A;  3RKO A;  5AQH B;  4LFB T;  4YJ3 E;  2YOE A;  5J1G A;  2XQ9 A;  5KXJ A;  2YEV C;  3LBX B;  1SE7 A;  4KI0 F;  3SWH A;  1M62 A;  2VQF T;  4EB6 E;  3AE7 A;  1H7C A;  1HNZ T;  3ANW A;  2KWH A;  3B5M A;  2LM9 A;  2WB5 A;  1W0B A;  3KV5 A;  4KX6 A;  4DV2 T;  2DCF A;  1SHZ C;  2JMK A;  5LHH B;  4LFC T;  2VB6 A;  1NAF A;  4DV6 T;  3BQK A;  4AQG A;  4HGA A;  3UQ4 A;  3ZC1 A;  3IBP A;  1I94 T;  1S35 A;  5HCM A;  4IIJ E;  2FJD A;  4ZI2 D;  4BAY B;  5JTG A;  4H9P C;  1FIO A;  3P4W A;  4NPP A;  5HWX A;  1V9D A;  2ZLY A;  2JQH A;  3OTO T;  1N34 T;  4YLH A;  3PUG A;  5AQP B;  1WLX A;  2BS4 A;  3ESL A;  2M6I A;  2V6Y A;  5FY1 A;  1DU2 A;  2LM2 A;  2NTX A;  4XZC A;  4GOU A;  4COF A;  4EAH A;  3N9O A;  4JI6 T;  3B57 A;  4L0R A;  1EZ3 A;  5AQR B;  3AE8 A;  3QUJ A;  2JMH A;  3M3Z B;  1MMG A;  5CGM A;  5CA1 E;  3E08 A;  5LJN A;  3TLS A;  4QXB B;  3JCF A;  1O3X A;  3SOL A;  4DUY T;  5AQN B;  4F8H A;  5HXH A;  2LSY A;  3ZMZ B;  1MMN A;  5AQO B;  2IW5 B;  2ZM6 T;  1D0Y A;  3RRW A;  4ZS3 A;  3HR0 A;  2XJ7 A;  5H6R B;  4UEL A;  3AXJ A;  2CBJ A;  2CPT A;  1ZKE A;  2LEH A;  3RGL A;  2FUP A;  4UIG A;  4UVA B;  2PJQ A;  1UX5 A;  3LG7 A;  4MFR A;  3OPC A;  2JRK A;  3PTR B;  3KVB A;  3Q5X A;  3VR8 A;  3S4U A;  4L9I A;  4YTM A;  3ZMS B;  2XAH B;  3UQ7 A;  3MA9 A;  2WDV A;  4AKR B;  1HTJ F;  4PJJ A;  2K3W A;  3Q9D A;  5JQG E;  4HKA A;  4WBN E;  2CXL A;  3ZMU B;  2AE9 A;  3FBZ A;  4GKK T;  1BR0 A;  1XDO A;  2Q9Q B;  3NRY A;  2WS3 A;  1OED E;  4K0K T;  1ZHC A;  2BKO A;  3AB3 B;  3RI5 A;  3PJA J;  2X68 A;  3UUM A;  5LJM A;  1XNR T;  4JI2 T;  4QHO A;  2ZM8 A;  1HFA A;  3RHW A;  4OYJ A;  3SRZ A;  3ZYK A;  1LRZ A;  1UX4 A;  4DR1 T;  2CEA A;  4U2Y A;  1D1A A;  3RYF E;  5C3J A;  4LML A;  4BA9 A;  4DUZ T;  3Q2M A;  3FHN A;  5L3F B;  3T1H T;  1YD8 G;  1KFY A;  2BS3 A;  4C91 A;  3H3A A;  1X79 A;  2D0T A;  3EDV A;  3ONX A;  4QWN B;  4B6X A;  2LLY A;  2LSJ A;  3AEA A;  4PFO A;  2CHO A;  3HKE E;  4G2A A;  3NWI A;  4J2C A;  3VHL A;  5KX5 E;  4PJL A;  1IJ5 A;  3OKQ A;  1HNW T;  2X0Y A;  3TLW A;  4JBW F;  1NEN A;  4DR6 T;  2DWG A;  2MOZ A;  3KVA A;  4H9Q C;  1YW0 A;  5DJQ C;  5FL0 A;  4UR9 A;  2XSA A;  2XAQ B;  3NZP A;  5DQW A;  5HXS A;  4YSY A;  3U3I A;  5JDG A;  4DV5 T;  2WCA A;  2X9H A;  2UUA T;  4QX8 B;  1QUU A;  3F2E A;  1MMA A;  1E2A A;  3IHR A;  3WAK A;  3GA8 A;  3HI2 A;  3ZLI A;  3NBX X;  2EHO B;  5LBM A;  2FJA A;  3MK7 C;  4U2Z A;  4JI4 T;  4WYV A;  3OBV E;  5E0O A;  4U7I A;  3KIN B;  4ANJ A;  3GMI A;  2XY8 B;  2LE8 A;  5J0Z A;  2L9Q A;  3AEC A;  4LF4 T;  3RC8 A;  3O1J A;  2NR4 A;  1WYC A;  1SA0 E;  4YFS A;  1OWA A;  3ZYL A;  4XAX B;  4UVB B;  2XHE B;  4IL9 A;  1JNZ A;  4JI8 T;  3ONJ A;  3LK3 B;  1VCS A;  5LBQ B;  4Z91 A;  2ES0 A;  4I50 E;  3WAJ A;  4U31 A;  2W2U A;  2XUE A;  4B3T T;  1UK5 A;  3J7Y q;  3IF8 B;  3LJC A;  3RPU A;  4I4T E;  2L8K A;  4PAG A;  3ZJ1 A;  3ZN1 B;  4C90 A;  3CIR A;  3PV0 F;  1T8B A;  4YHJ A;  2WWV A;  2WM9 A;  2HN1 A;  2Y48 B;  2X0H A;  3JAE A;  5DQV A;  3UUX B;  5HEH A;  3NRX A;  5ABF A;  4O8S A;  3L3P A;  2IHR 1;  2G0U A;  3U78 A;  3Q5E A;  2E2A A;  3AE4 A;  2CHN A;  1N36 T;  3CML A;  2Z6E A;  5TAO A;  3AE2 A;  3H3M A;  4H9R C;  1MIY A;  3CWZ B;  2CRB A;  1VCT A;  4U74 A;  2OA5 A;  1FMV A;  2W62 A;  2ODU A;  5AFU L;  2Q9Q C;  3C4X A;  5A1L A;  4HFB A;  2LRK A;  5HEO A;  3UU4 A;  2WY2 A;  3P4S A;  2B76 A;  2FJB A;  3BQI A;  2HPJ A;  4IGU A;  5L3E B;  5EK4 A;  1ZV4 X;  3I0O A;  3PUA A;  5LMN T;  4TUY E;  4PFP A;  5EZY E;  4DO0 A;  3RQW A;  3ZT5 A;  4CN1 A;  1CUN A;  1HX1 B;  3UUB A;  4NUU A;  4HFD A;  3C4W A;  1BR1 A;  4LF9 T;  1W0A A;  2NWB A;  4CI1 B;  4DBQ A;  2E9X B;  3QK6 A;  3RF1 A;  3WI3 A;  5AQT B;  4NIQ A;  2LSI A;  4M1P A;  4O4L E;  2ACX A;  4IDP A;  2JPF A;  2KSR A;  4O4I E;  4EXT A;  4P0A A;  4O4H E;  3I1A A;  4O2B E;  2QRX A;  3GN5 A;  2H89 A;  5LOV E;  5AQG B;  1IJ6 A;  3ZCI A;  2JJ9 A;  4O4J E;  1WFD A;  2X9W A;  4ADZ A;  3HKB E;  2XAJ B;  1S94 A;  3KFW X;  1N33 T;  3AA6 B;  4HFV A;  4IDZ A;  3P8C D;  3NZQ A;  1N32 T;  2KWI B;  3AVS A;  2DHR A;  3ZCJ A;  3O9X A;  4UV8 B;  3ETU A;  3AEB A;  4HN9 A;  3E0Z A;  5FXX A;  5CB4 E;  2RP4 A;  1OED B;  1D1B A;  2V5D A;  3P7I A;  2Q9Q D;  3PJA A;  3ZMT B;  2I0M A;  3JC6 D;  2IDO B;  3UU5 A;  2CLY B;  4QXH B;  1SUM B;  2WQY A;  5F8P A;  2MTQ A;  5FKY A;  3Q5W A;  2VL8 A;  3L09 A;  3FBL A;  1IBL T;  1NEK A;  1YKE B;  5ABE A;  2VKD A;  2VVS A;  4YT0 A;  1KNZ A;  2H88 A;  1NWM X;  4TV9 E;  4X64 T;  3PUV F;  1MNE A;  1FMW A;  4ASK A;  5L3B B;  3N9Q A;  5M4Y A;  2F4V T;  1ZOY A;  2XPK A;  3AAE B;  3ANW B;  2FJE A;  2UUB T;  3PUZ F;  3RRC A;  3EUH A;  4EV6 A;  3UU3 A;  3PUQ A;  2CE7 A;  2CBI A;  2E5V A;  1ZEE A;  2BVM A;  1IBM T;  4AKL A;  5FXV A;  4UF0 B;  4EYY R;  2PG8 A;  2UU9 T;  2Q9Q A;  2YIN A;  1D0X A;  2V7I A;  3DJB A;  3AEF A;  5BR8 T;  2NW8 A;  4H9S E;  2ZMA A;  5FVK A;  3PUS A;  4QKN A;  5HYA A;  4KHP T;  3ZST A;  4IE7 A;  2CWO A;  4K0U A;  4ZZC A;  1CHU A;  2DL1 A;  2V6Y B;  1WR6 A;  5LA6 E;  3GWH A;  4BJN A;  4NUV A;  2LJL A;  3KBT A;  1XDP A;  1UCU A;  4GYR A;  3VR9 A;  2W00 A;  2DWK A;  5HEG A;  4DR7 T;  5DAB A;  3MXZ A;  5H6Q B;  2KT9 A;  4I43 B;  2IC9 A;  2DI4 A;  3N2K E;  1US7 B;  1XMQ T;  4MHC A;  5JH7 E;  3AAA B;  4QH5 A;  4AKH A;  1KEY A;  4EED A;  2VUR A;  2BG9 E;  4OFZ A;  4Z90 A;  3RYI E;  5EK2 A;  3B13 A;  2LSG A;  3T1Y T;  2NP9 A;  2DLR A;  3DP7 A;  3E22 E;  3ZEF B;  2MBG A;  3ZT7 A;  4HWH A;  4AQY T;  1AJ3 A;  3KBU A;  3PDY A;  4YXD A;  4WBO A;  2NOX A;  3PE0 A;  2E9X C;  2ZM0 A;  2XAF B;  3EI0 A;  4GYS A;  2LSK A;  4IL4 A;  3RYC E;  1BR2 A;  4PK5 A;  3ZPO A;  4DMW A;  4H9N C;  4IE4 A;  4JI0 T;  4AIU A;  3LSV A;  2MAW A;  3K1S A;  3AVR A;  2RPA A;  3UU8 A;  2N9D A;  2W61 A;  5HEU A;  4LF8 T;  4AQF C;  3P4R A;  2V1D B;  2NTY A;  1KF6 A;  4HE8 A;  2XZE A;  4Z8X A;  3UUN A;  2YU1 A;  1LVF A;  3EDU A;  5L2L A;  2K24 A;  2CMR A;  2VKH A;  4LF6 T;  5JRC B;  3UU6 A;  4DBR A;  4JUY A;  2XQ7 A;  4HFI A;  3V5S A;  5ETW A;  3N9N A;  4DR3 T;  2NW9 A;  4YSX A;  3K3Q C;  3EVY A;  2XTL A;  4ILU A;  3ABV A;  4E7S A;  5LNK A;  3T8O A;  4IRE A;  2YU2 A;  2VWA A;  1OED C;  3O1I A;  5LG3 A;  1HG2 A;  2IUB A;  2X9Y A;  3MKD A;  2YDQ A;  5HEJ A;  2V5C A;  4ZI3 C;  4PJM A;  2CLY C;  4IDO A;  2J4G A;  1LKX A;  5FL1 A;  2XQ5 A;  3OYZ A;  4MBQ A;  4KBM B;  2YDS A;  3CPZ A;  3FZM B;  3EAM A;  5AQK B;  5L3C B;  3RC3 A;  1U4Q A;  3VU7 H;  2BDE A;  3P50 A;  5ABH A;  4AIS A;  2H7V C;  3CVR A;  3UTK A;  4TNW A;  4PJN A;  2LHN A;  4P0B A;  3SFD A;  2XQ3 A;  2XAG B;  3QB5 K;  1D1C A;  4EEB A;  4ILC A;  3N9P A;  5BMV E;  4YJ2 E;  4NXN T;  3AE3 A;  2OLT A;  4KP3 C;  1Y64 B;  4ZHQ E;  4GIW A;  2X67 A;  5FXZ A;  4PNI A;  2IAK A;  3PUR A;  5LGT B;  2KLQ A;  2VAS A;  1GQE A;  2A9U A;  4TN7 B;  3AEE A;  3N9L A;  4U7Y A;  2E8I A;  4B3M T;  3I9Y A;  4EGW A;  1QLB A;  2BKP A;  2WZI A;  5JDL A;  2VQE T;  3RX6 A;  4AKG A;  2V8S V;  5KDM C;  1XWM A;  2ACZ A;  5HWY A;  2W67 A;  3KV4 A;  4UVC B;  2JQK A;  5HAX A;  4QH4 A;  3KDS E;  2VKJ A;  4ZXL A;  4DR5 T;  2W63 A;  5J2U E;  4EIW A;  1YKH B;  4JI1 T;  2IC6 A;  4DMV A;  5LMU T;  5FP3 A;  2C5K T;  5FMN A;  3C64 A;  3M65 A;  2CWY A;  1D0Z A;  3RQU A;  4CXX A;  2V6X A;  2E9X A;  2D0U A;  3EHZ A;  4OHF A;  3PUW F;  4ZI3 D;  1MIV A;  1YQ4 A;  4YY3 T;  4X65 T;  3FXE B;  2ODV A;  3PUY F;  4H63 H;  2A72 A;  5CA0 E;  2XM1 A;  3AE6 A;  3ZYM A;  1OXZ A;  4CQI A;  1MND A;  4AQF A;  5LG4 A;  3ZMV B;  4ISS A;  3AA7 B;  2OV9 A;  2XQ4 A;  1M7K A;  3LBX A;  3AED A;  5AQF B;  2QVA A;  2WU5 A;  2E5L T;  5LB7 B;  2LKG A;  4TZ4 C;  1HX8 A;  2K9A A;  4LF7 T;  5JDQ A;  1E1H B;  1LVK A;  3I0Q A;  5IYZ E;  2CCQ A;  3AA1 B;  4A5X A;  3QB5 A;  3V5U A;  3N2G E;  4WZX A;  1IBK T;  3BQL A;  5LHI B;  3UFG A;  4G63 A;  2WSS V;  4JV5 T;  3L39 A;  2UXN B;  5AQV B;  3BK9 A;  4JEH B;  2YN6 A;  3VRB A;  4EYU A;  1WYB A;  1OED A;  3ZJ2 A;  4FI5 A;  3IA3 A;  4IE5 A;  2LT3 A;  3CKD A;  2WMN A;  4LMJ A;  3HKC E;  4CZZ B;  5LHG B;  3AEG A;  3ZT6 A;  1HG5 A;  2WMO A;  4PW8 A;  3RH3 A;  3L8R A;  1HS7 A;  5AQJ B;  1MIW A;  5JDF A;  2QGS A;  3CQC B;  4KUM B;  1HF8 A;  4X1Y E;  5ADX L;  5JDM A;  3P4Q A;  5IHY A;  2NW7 A;  2N2N A;  4YSZ A;  3AE1 A;  2EHO C;  5FY7 A;  5GON E;  3MZK B;  2X9X A;  3PU3 A;  3ZN0 B;  3FZH B;  4L5G A;  5JR9 B;  3AE9 A;  2DNX A;  4TWD A;  3ONL C;  2BG9 B;  5AQS B;  2VVN A;  4A97 A;  4QX7 B;  4WW0 A;  4DV1 T;  4UF0 A;  1KNP A;  1G73 A;  1T98 A;  2GK9 A;  2QYW A;  1ZP0 A;  4IDQ A;  4DR2 T;  2X66 A;  3GN5 B;  3Q5D A;  1I6Z A;  1WCR A;  1L0V A;  1E7P A;  3K8P C;  4P09 A;  4O2A E;  1BR4 A;  2JIW A;  4DR4 T;  2HN2 A;  2JQ9 A;  2M67 A;  2PBI A;  3TLV A;  4HWC A;  4U72 A;  2MYS A;  2XQ6 A;  4X5T A;  4HWI B;  1Z0P A;  4CXY A;  2W4X A;  3RIU C;  3EAB A;  3H37 A;  1U5P A;  4ZI7 E;  3JAD A;  4WNK A;  3KV6 A;  2FBW A;  3OVU A;  5AQI B;  4TNV A;  3VKG A;  4DND A;  5LCY A;  2SPC A; 
#chains in the Genus database with same CATH homology
 2K5B B;  2ES0 A;  4I50 E;  2N9D A;  2QA7 A;  2W61 A;  4N78 D;  2KND A;  5LP6 E;  2KIN B;  2CXD A;  4ZOL E;  4AQF C;  4AXP A;  3WAJ A;  2V1D B;  2XUE A;  2NTY A;  4HE8 A;  3LFM A;  3O1H A;  3I9W A;  4OYK A;  3J7Y q;  3IF8 B;  3LJC A;  3RPU A;  1G8X A;  4Z8X A;  4I4T E;  2L8K A;  2V26 A;  4PAG A;  2A2F X;  3UUN A;  4F6R C;  3ZJ1 A;  2YU1 A;  1LVF A;  3EDU A;  3ZN1 B;  4C90 A;  5L2L A;  2V7J A;  3N5L A;  2J1D G;  2L3L A;  5FYM A;  4EZH A;  5HXR A;  2K24 A;  2CMR A;  2VKH A;  3C51 A;  5JRC B;  1QSD A;  3RKO A;  4YHJ A;  4YJ3 E;  4DBR A;  4JUY A;  2K48 A;  2WM9 A;  2Y48 B;  5J1G A;  3V5S A;  3IEE A;  5DQV A;  3N9N A;  5ETW A;  2YEV C;  4V1A v;  2Y8D A;  3UUX B;  2NW9 A;  3LBX B;  4HTE A;  3KV9 A;  3K3Q C;  3NRX A;  3EVY A;  4E7Z A;  2XTL A;  4ILU A;  4O8S A;  3SWH A;  2XQY A;  3OYX A;  3L3P A;  4E7S A;  5LNK A;  4A56 A;  4EB6 E;  4X20 E;  3T8O A;  2G0U A;  3U78 A;  1H7C A;  2RA1 A;  2CA5 A;  5JDH A;  3ANW A;  2KWH A;  2YU2 A;  2VWA A;  3CML A;  1MMD A;  3UT5 E;  2LM9 A;  2Z6E A;  2EHO D;  3O1I A;  5TAO A;  5LGN B;  1HG2 A;  3KV5 A;  4H63 V;  4FJO A;  2X9Y A;  2DCF A;  3MKD A;  3A5X A;  1SHZ C;  2JMK A;  1MIY A;  3CWZ B;  4H9R C;  3K3N A;  3DTO A;  5LHH B;  2VB6 A;  4PK4 A;  1NAF A;  4U74 A;  3BQK A;  2OA5 A;  1FMV A;  2W62 A;  4ZI3 C;  4AQG A;  2ODU A;  4HGA A;  4PJM A;  2CLY C;  5AFU L;  2Q9Q C;  3ZC1 A;  2D5U A;  3C4X A;  3IBP A;  1S35 A;  5A1L A;  2V7M A;  4IIJ E;  3F57 A;  3QC9 A;  1LKX A;  4ZI2 D;  4BAY B;  3FXD B;  2B1E A;  3OYZ A;  3CQG B;  3BQI A;  2HPJ A;  4MBQ A;  4H9P C;  4KBM B;  1FIO A;  3FB2 A;  4IGU A;  4DVD A;  5EK4 A;  5L3E B;  5HWX A;  1V9D A;  1ZV4 X;  3I0O A;  3PUA A;  5HXE A;  3CPZ A;  2ZLY A;  5JRC A;  5L3C B;  4TUY E;  3RC3 A;  1U4Q A;  4PFP A;  5EZY E;  3VU7 H;  2BDE A;  4DO0 A;  1B7T A;  3CQX C;  4I55 E;  5EK3 A;  1CUN A;  4YLH A;  3PUG A;  1WLX A;  2H7V C;  3ESL A;  3CVR A;  5FY1 A;  4NUU A;  3UTK A;  2HH7 A;  2NTX A;  4PJN A;  3PU8 A;  4XZC A;  4GOU A;  3C4W A;  2LHN A;  4P0B A;  4EAH A;  3N9O A;  2XAG B;  4IE6 A;  1BR1 A;  2VKO A;  3B57 A;  4EOZ B;  2NWB A;  1D1C A;  3ZC0 A;  4L0R A;  4CI1 B;  1EZ3 A;  3TKL B;  2C5J A;  3N9P A;  5BMV E;  2LHR A;  4YJ2 E;  5FY0 A;  3QUJ A;  2JMH A;  1WRD A;  4DBQ A;  2E9X B;  3QK6 A;  2WBL A;  4KP3 C;  5JDN A;  3WI3 A;  1MMG A;  1Y64 B;  5CA1 E;  3E08 A;  2CXF A;  4ZHQ E;  4GIW A;  2X67 A;  5FXZ A;  4PNI A;  2IAK A;  2LSI A;  5LJN A;  3PUR A;  5LGT B;  4M1P A;  4O4L E;  2KLQ A;  2ACX A;  2VAS A;  2KZ7 B;  2EHO A;  2JPF A;  4QXB B;  5LXT E;  4TN7 B;  1O3X A;  4O4I E;  3SOL A;  4EXT A;  4P0A A;  3N9L A;  4O4H E;  3I1A A;  5JVD E;  2E8I A;  3I9Y A;  5HXH A;  4UEM A;  2LSY A;  5JDL A;  2BVL A;  3ZMZ B;  1MMN A;  4O2B E;  5HXC A;  3GN5 A;  5LOV E;  2IW5 B;  3RX6 A;  4AKG A;  1D0Y A;  3RRW A;  5KDM C;  3HKD E;  4ZS3 A;  1IJ6 A;  5HWY A;  3ZCI A;  2XAS B;  3HR0 A;  2JJ9 A;  4QXC B;  1VRB A;  4UEL A;  5H6R B;  4O4J E;  3KV4 A;  2X9W A;  4ADZ A;  3HKB E;  2H3R A;  2XAJ B;  3CX7 B;  4UVC B;  1ZKE A;  1S94 A;  3F31 A;  3KFW X;  5HAX A;  4TX5 A;  3KDS E;  3AA6 B;  2VKJ A;  4HFV A;  4AI6 A;  2P9B A;  2LEH A;  3R6N A;  2KMF A;  4IDZ A;  2W63 A;  3P8C D;  4X1I E;  5J2U E;  4EIW A;  4UIG A;  4UVA B;  2PJQ A;  1UX5 A;  1YKH B;  4JEU B;  3LG7 A;  2IC6 A;  3NZQ A;  4MFR A;  4DMV A;  2JRK A;  3PTR B;  4GK5 E;  3RYH E;  5FP3 A;  3KVB A;  4ERR A;  5JR9 C;  3Q5X A;  2C5K T;  5FMN A;  2X0L B;  3UFE A;  2KWI B;  3S4U A;  4L9I A;  3C64 A;  3M65 A;  2CWY A;  2DHR A;  3AVS A;  1D0Z A;  2HPL A;  5L3G B;  4TV8 E;  3ZMS B;  3ZCJ A;  4CXX A;  3O9X A;  2XAH B;  2E9X A;  4UV8 B;  3ETU A;  3MA9 A;  4ZS2 A;  2D0U A;  4HN9 A;  4OHF A;  4AKR B;  3E0Z A;  4IST A;  5FXX A;  1HTJ F;  4PK6 A;  4PJJ A;  4EZ4 A;  5CB4 E;  4ZI3 D;  2RP4 A;  1D1B A;  1MIV A;  3P7I A;  3Q9D A;  2Q9Q D;  1KK7 A;  3ZMT B;  5JQG E;  1VOM A;  3FXE B;  4HKA A;  2ODV A;  3C50 A;  4MLK A;  4WBN E;  3CX8 B;  3JC6 D;  2YK0 A;  2CXL A;  3ZMU B;  3FBZ A;  4JLE A;  4H63 H;  2A72 A;  5CA0 E;  5FNV E;  5FXW A;  3ZYM A;  1BR0 A;  1OXZ A;  2CLY B;  2Q9Q B;  3NRY A;  4CQI A;  3AAI A;  1MND A;  4AQF A;  5LG4 A;  4QXH B;  3ZMV B;  4ISS A;  5F8P A;  3C98 B;  2MTQ A;  4CI2 B;  4GK0 E;  3AA7 B;  3Q5W A;  2VL8 A;  3L09 A;  1ZHC A;  3FBL A;  3LBX A;  3AB3 B;  1FEW A;  1IZN B;  1YKE B;  2VKD A;  5LYJ E;  2X68 A;  5LGU B;  3O4X E;  1KNZ A;  3UUM A;  5LJM A;  4TZ4 C;  2VK9 A;  1HX8 A;  2E9X D;  2K9A A;  5JDQ A;  1NWM X;  4TV9 E;  1E1H B;  4QHO A;  1LVK A;  3I0Q A;  5IYZ E;  2CCQ A;  2ZM8 A;  3AA1 B;  1MNE A;  1FMW A;  1HFA A;  4OYJ A;  3SRZ A;  3V5U A;  3ZYK A;  4ASK A;  5L3B B;  1LRZ A;  1UX4 A;  3N2G E;  3N9Q A;  5M4Y A;  2CEA A;  3AAE B;  1D1A A;  3RYF E;  3W15 B;  3BQL A;  3N2O A;  4BA9 A;  3ANW B;  5LHI B;  4G63 A;  2WSS V;  3Q2M A;  2W0G A;  3FHN A;  4CI3 B;  5L3F B;  1YD8 G;  4IHJ E;  4UXN B;  4C91 A;  3UUL A;  3H3A A;  2UXN B;  3RRC A;  3BK9 A;  4JEH B;  1X79 A;  2D0T A;  5C8Y E;  4HEA A;  3EDV A;  3EUH A;  3ONX A;  2Y6X A;  1WYB A;  4QWN B;  4EYU A;  2PFV A;  3ZJ2 A;  3PUQ A;  2LSJ A;  4FI5 A;  2CE7 A;  4B6X A;  4PFO A;  1ZEE A;  2BVM A;  3HKE E;  4G2A A;  2WWU A;  4AKL A;  4IE5 A;  5FXV A;  4UF0 B;  2LT3 A;  4EYY R;  4J2C A;  3CKD A;  2PG8 A;  3VHL A;  5KX5 E;  4UV9 B;  2WMN A;  4PJL A;  2Q9Q A;  2YIN A;  1IJ5 A;  3HKC E;  4CZZ B;  1D0X A;  5LHG B;  2V7K A;  2V7I A;  3DJB A;  3OKQ A;  2NW8 A;  1HG5 A;  2WMO A;  4PW8 A;  4H9S E;  3RH3 A;  2ZMA A;  1HS7 A;  3PUS A;  4QKN A;  1MIW A;  3HA4 A;  5HYA A;  5JDF A;  2LOS A;  2QGS A;  3CQC B;  4OK0 A;  4KUM B;  2DWG A;  2KXP B;  1HF8 A;  2MOZ A;  3KVA A;  4H9Q C;  4XBF B;  4X1Y E;  5ADX L;  2LOP A;  1YW0 A;  4IE7 A;  5DJQ C;  2H7O A;  5JDM A;  2CWO A;  4K0U A;  5IHY A;  2NW7 A;  2N2N A;  2XAQ B;  1WR6 A;  3NZP A;  5LA6 E;  3GWH A;  4BJN A;  2JQQ A;  4NUV A;  5DQW A;  5HXS A;  2LJL A;  3KBT A;  1UCU A;  5JRE A;  4GYR A;  2C0S A;  3U3I A;  2UXX B;  2EHO C;  5JDG A;  5FY7 A;  5GON E;  3MZK B;  2X9X A;  2W00 A;  2N1G A;  3PU3 A;  3SS1 A;  2X9H A;  2DWK A;  4CXW A;  4AKI A;  4QX8 B;  3ZN0 B;  1QUU A;  3F2E A;  2X51 A;  5F3J A;  2A3D A;  4L5G A;  1MMA A;  5JR9 B;  5DAB A;  3MXZ A;  5H6Q B;  3IHR A;  2DNX A;  4H9O C;  2D2S A;  2KT9 A;  4I43 B;  3WAK A;  2IC9 A;  2DI4 A;  3GA8 A;  4X1K E;  3N2K E;  4QX7 B;  3HI2 A;  4WW0 A;  3ZLI A;  1US7 B;  3LK4 2;  3NBX X;  4MHC A;  2EHO B;  5JH7 E;  3MJX A;  5LBM A;  4UF0 A;  3AAA B;  1G73 A;  1T98 A;  2GK9 A;  4ZI2 C;  2C5I T;  3MK7 C;  3JC6 C;  4BJM A;  4AKH A;  2V7L A;  1HCI A;  3OJA A;  2CM0 A;  2X66 A;  3R84 B;  4IE0 A;  3GN5 B;  4OFZ A;  3RYI E;  3CX6 B;  3LK2 B;  5EK2 A;  3B13 A;  2WAU A;  3OBV E;  2LSG A;  5E0O A;  2ZM2 A;  3K8P C;  2NP9 A;  2DLR A;  2I59 A;  4O2A E;  3DP7 A;  4P09 A;  3KIN B;  1BR4 A;  2BZB A;  3E22 E;  3ZEF B;  2MBG A;  4ANJ A;  3GMI A;  3HL6 A;  3N9M A;  3MAC A;  3VKH A;  1AJ3 A;  3KBU A;  3PDY A;  2M67 A;  2PBI A;  2LE8 A;  4MAL A;  2L9Q A;  3RC8 A;  3O1J A;  3D0T A;  4WBO A;  2NOX A;  4U72 A;  3PE0 A;  3AA0 B;  2E9X C;  2MYS A;  2ZM0 A;  1WYC A;  1SA0 E;  2XAF B;  5KMG P;  3ETV A;  1Z0P A;  4CXY A;  4GYS A;  5J2T E;  2LSK A;  3J9X 1;  4YFS A;  3RYC E;  3K3O A;  1OWA A;  1IAP A;  3H37 A;  1U5P A;  1BR2 A;  3ZYL A;  4ZI7 E;  4PK5 A;  4XAX B;  3ZPO A;  4DMW A;  4UVB B;  4H9N C;  5L3D B;  4WNK A;  3KV6 A;  4IE4 A;  2XHE B;  3C4Z A;  3LK3 B;  3AVR A;  5JR9 A;  3VKG A;  5LBQ B;  4DND A;  5LCY A;  2SPC A;  4KMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...