2L9QA

Structural characterization of small heat shock protein (hsp12)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
b'MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12 kDa heat shock protein
publication title Structural Characterization of small heat shock protein (Hsp12)
rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04119 HSP9_HSP12 Heat shock protein 9/12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1260 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2l9qA00
4AXPA 2LJLA 2L9QA
chains in the Genus database with same CATH superfamily
4NXNT 4ILUA 4ZZCA 5L3EB 1CUNA 2WMNA 2E9XD 4Z8XA 1OWAA 4X66T 2XHEB 3K8PC 3Q2MA 4LFAT 2YN6A 4JEUB 2IUBA 3RIFA 5LGTB 5KXJA 3PU3A 1YQ4A 3HR0A 2WU2A 3CVRA 2K48A 2NWBA 2WU5A 5JR9A 3RHWA 4BJMA 4A98A 2IMLA 3AE5A 5FL0A 2IC9A 2J47A 3C98B 5LOVE 3MXZA 4H9RC 1WCRA 4ZHQE 4IDNA 4B3MT 3UU3A 4DR3T 4OYKA 1MIWA 4ZI3D 4UVBB 3EDUA 1MMGA 5HYAA 3OKQA 4DV2T 2QA7A 3FBLA 2LSKA 2EHOA 5LA6E 3H37A 5EZYE 4HKAA 4TZ4C 4DV4T 2D5UA 2ACXA 4AXPA 5LG3A 3ZYMA 4B3RT 2CWOA 2FJEA 3TLUA 2G0UA 3KINB 2WSSV 2AXDS 4ADZA 2V7LA 2IC6A 1SA0E 1X9BA 4HWHA 2DNXA 5F5WA 5FYMA 2VASA 3N9LA 4DR6T 2QVAA 1S94A 5FY1A 4AISA 4OHFA 4DNDA 1UUSA 4N78D 3CQGB 2MBGA 2DL1A 4DO0A 5KMGP 4KP3C 2CPTA 3N9NA 3IHRA 2RPAA 1HTJF 4U31A 4YY3T 3GA8A 4DV5T 4QH4A 4JI7T 3QC9A 3RRCA 2WDQA 4ISSA 1HG2A 3N2GE 2V6YA 2B1EA 4DMWA 2JQKA 4WBNE 2CLYB 2V7KA 4H9SE 4DMVA 3I9YA 2JQ9A 4EEBA 4PK5A 2CRBA 4HTEA 1XNRT 4H9NC 4KX6A 3HKDE 4P0BA 3E22E 3ZYKA 5ABEA 3AAAB 3M3ZB 5LXTE 4NIQA 2DWGA 5J1GA 2BS3A 3BK9A 3BQIA 3F2EA 4HFBA 2ZM2A 4PK4A 5HEHA 4JI4T 4WNKA 3R84B 4DR2T 2VQET 3UUBA 4AKHA 4AI6A 2WP9A 1HNXT 4UF0B 2IIUA 2BS2A 1XWMA 3PJAJ 5CJ5A 3U78A 3TLVA 3ZYLA 5AQIB 2LT3A 1KF6A 3JC6C 3UU4A 4LF5T 4H9QC 1HNWT 3P4SA 1BR0A 5JH7E 5LB7B 5JDNA 5JVDE 2L9QA 2EHOC 3ESLA 5JQGE 4E7ZA 3FHNA 4O4IE 2OLTA 3PUGA 5DQVA 2MOZA 1DU2A 4BA9A 5KDMC 3X1DA 3A5XA 2VKDA 2X66A 3GMIA 1XDPA 4PJLA 2VVSA 4H9OC 4MHCA 4O4JE 2LEHA 4IIJE 2E2AA 5J2TE 1SHZC 4L0RA 4DUZT 3AE2A 5ABFB 1HNZT 4CXYA 4TNVA 5F8PA 4YJ2E 3ZC1A 3SS1A 3O4XE 3AA7B 3VR9A 4AKGA 3SOLA 3C51A 2SPCA 1VCSA 1D0YA 3LBXB 2D9DA 1CHUA 3HKBE 1WR0A 3RYFE 2JQQA 2WBLA 4O2BE 3ZT6A 3AE7A 3UU8A 4IT4A 5AQVB 4U2ZA 4UF0A 3JAEA 4ZI2D 4YXDA 4AQFA 2UU9T 4JUYA 3L8RA 2XASB 1HFAA 4DR4T 2YDRA 4IE5A 2DCFA 1D1AA 5L3FB 4PFOA 4PJMA 3CX6B 3RKOA 4CI3B 3KBTA 2KNDA 2IAKA 3E08A 4IE4A 4NPPA 2D0TA 3MZKB 3CX7B 3RRWA 3PDYA 2W67A 2WM9A 1US7B 4HWDA 1IBLT 2VURA 1G8XA 3N9PA 3NRYA 5BMVE 4H9PC 3NRXA 4CXXA 4HGAA 4JV5T 1U5PA 1T7SA 1YKEB 4CI2B 3OVUA 2LRKA 3RH3A 4ISTA 2I0MA 4NUUA 1N33T 2D0UA 2VVNA 3ZJ2A 2ZM8A 1WYBA 1FMWA 1Y01A 3NKZA 4HFVA 4CI1B 3UQ7A 4HWIB 2PFVA 4QXCB 3AEEA 4YSYA 5L4HA 3NZPA 3KVAA 4I50E 2CMRA 2C5JA 3J9X1 4FI5A 4EV6A 2BDEA 2HN2A 5FNVE 4B3TT 4O8SA 5FL1A 4YTMA 4DV3T 4LMLA 2N9DA 4MBQA 2VWAA 2WDRA 2DWKA 5JR9B 5CA0E 1XMOT 1YW0A 2MTQA 3PUVF 4ANJA 4IREA 4OYJA 3AA6B 3G06A 1HX1B 3DP7A 5HAXA 3AE9A 4B6XA 1YQ3A 5AQNB 3PE0A 4QWNB 2LHNA 2E9XC 4Z90A 2W00A 4U3CA 2A2FX 1ZV4X 3RC3A 3QK6A 1WRDA 1QSDA 3FZFB 4PFPA 2CEAA 1HG5A 2Q9QD 3AA1B 4LF7T 3OBVE 3VKGA 4CN6A 1B7TA 2KLQA 3K3QC 4A97A 1M7KA 2EHOB 2UXCT 5AQLB 2LLYA 4L9IA 4ASKA 3VHLA 3VR8A 2UUAT 3TLTA 3EHZA 2LSYA 3AB3B 3QB5K 1KNPA 1D0XA 4U33A 2W4XA 4CZZB 1FJGT 1ZHCA 3RC8A 5LMNT 5F3JA 2WMOA 3CQXC 3N9OA 2E8IA 2C5IT 2KMFA 1V9DA 3PUWF 4P0AA 4GK0E 2H88A 5HXSA 4UXNB 2V8SV 3NBXX 1JNZA 4QKNA 1SE7A 3PURA 3BQLA 4CXWA 5LHGB 3CX8B 5L3GB 1I6ZA 3EAMA 3UU6A 3N5LA 4XZCA 2WAUA 2HH7A 4NXMT 4IE6A 5AQTB 5JDMA 1WYCA 4IDPA 3RIUC 3O9XA 4EZ4A 2NR4A 1W09A 3SRZA 3RGLA 3O1HA 1MIYA 3AXJB 3KV9A 4JI5T 4ILCA 4WBOA 2XTLA 1NENA 2V6YB 4HFIA 3BQKA 3I0QA 2LM2A 4TV9E 3HL6A 5HCJA 2DLRA 3RYHE 3JADA 3T1YT 1D0ZA 4HWFA 2RA1A 2VKHA 3N2OA 2W66A 3I9WA 4V1Av 5L3DB 2J1DG 3NZQA 3P7IA 3NVOA 1GQEA 3MACA 4DV7T 2V5CA 4OK0A 5AQQB 3K3OA 4PJJA 4YSZA 1MMNA 2IW5B 4GKJT 3C4ZA 4CQIA 4C91A 2CXFA 2XUEA 3J7Yq 4LF4T 5ABGA 3A7MA 1D1CA 1X79A 5JDGA 4LF8T 5AQJB 4CN4A 3K3NA 4EGWA 2VQFT 2X0YA 4TNWA 3C50A 2A72A 4GOUA 1YKHB 5TAOA 4GYSA 4EIWA 4KI0F 2WB5A 3FZMB 3Q9DA 4UVCB 1T8BA 3RKGA 3UULA 5DQWA 2XJ7A 5CFBA 3EVYA 4JI1T 4HN9A 4IDZA 2XQ7A 4JI3T 4IDOA 4KBMB 4AQYT 3FXEB 3ZT7A 4LF9T 3AXJA 2LSGA 5HEUA 3SFEA 4FJOA 1Z8UA 2WWUA 3QUJA 2H7VC 4K0UA 1IJ5A 3UQ4A 1MMAA 2LRLA 3UUXB 3ZT5A 3AE6A 4JI6T 4X1YE 2A9UA 4U7IA 1XDOA 3ZMTB 3V5SA 4KUMB 5HEJA 3KFWX 5LNKA 3HA4A 2W61A 4WW0A 3V5UA 2VL8A 4YHJA 4PW8A 4MFRA 3S4UA 4UR9A 2WCAA 4DVDA 3GN5A 5FMNA 5ABHA 5LBMA 3DTOA 4H63H 5FXVA 3RF1A 3R6NA 2K9AA 1LVFA 3N9MA 5CGMA 2LKHA 2XM2A 2W0GA 4TN7B 5AQOB 2UXDT 3U3IA 2WQYA 2XQAA 2MAWA 4UIGA 3VRAA 4C90A 4ERRA 5JRCB 3PUXF 4ZI2C 4JYAT 2FJBA 2CE7A 2KWIB 4ZS3A 5EK4A 3HKCE 1WLXA 3K1SA 2XM1A 4I0UA 3FZHB 5HEOA 1Y64B 2K5BB 2IHR1 3P4WA 4JLEA 3E0ZA 3FB2A 3PUZF 2P9BA 2WZHA 3ZCIA 2LKGA 1LVKA 2YK0A 3OTOT 4AIUA 3WI3A 2ZM6T 2E9XA 4ZOLE 2BVLA 3IEEA 3B13A 4EZHA 1OEDC 3KVBA 4QHOA 3ZLIA 4XBFB 3C64A 3I1AA 2K3WA 2F4VT 3HKEE 5FXXA 5EK3A 4EAHA 4KHPT 3P50A 4ZS2A 1XNQT 3UUMA 4KMCA 2ODVA 4LMJA 3ONLC 1J5WA 2UXXB 4ILAA 3H3AA 4YFSA 3M65A 3AE4A 2YEVC 3ZMZB 3RYCE 1YD8G 4JI8T 4JI0T 1MNEA 3H3MA 2X67A 3EABA 4DUYT 2PG8A 5AQMB 4B3ST 1BR1A 2C0SA 2HN1A 5AQGB 2I59A 3B57A 2BKOA 5JRCA 1ZOYA 2XZEA 3MK7C 5IYZE 4JI2T 5AQRB 5L4EA 5FY0A 2YINA 2XQ6A 4LMKA 2KZ7B 4OFZA 3D0TA 2H3RA 1KFYA 2E5VA 2VKOA 5EK2A 3RIUA 5L3CB 5LP6E 4QX7B 4AKRB 2JMKA 3AECA 2A3DA 1UK5A 2XAJB 4CN1A 2JJ9A 2V7JA 5AFUL 4U2YA 2Q9QC 5JTGA 5HEGA 2WWVA 2DI4A 5M4YA 2FUPA 4JBWF 4UV8B 3PV0F 3LK42 1WR6A 4TX5A 2LJLA 1H7CA 5FKYA 2W62A 2X0HA 4IL4A 1UX5A 2C5KT 4EEDA 5AQFB 3C4XA 2BBHA 5FXZA 3Q5WA 2X9WA 1WFDA 2XQ9A 4U72A 4U7YA 3AEGA 1HS7A 2V7IA 4EYUA 2CXLA 3ZSTA 2LHRA 4TV8E 2H7OA 2FBWA 4PK6A 5JDLA 3ZSSA 1FEWA 3RQUA 3ETVA 2CLYC 1LRZA 3WAKA 2Y8DA 3KV4A 2PJQA 3MA9A 3O1IA 2XQ8A 4IE7A 2AE9A 4TWHA 5L2LA 5KX5E 5DJQC 4DBQA 4EXTA 2H89A 3AE8A 2JPFA 1NWMX 3ZEFB 3AEBA 2X9XA 3AA0B 5AQKB 3PUAA 3FZLB 4DR5T 4DV6T 2NTXA 4MALA 4K0KT 2PBIA 3N2KE 4I43B 3OPCA 4X20E 2CXDA 3L3PA 1IBKT 3AEDA 2CBJA 3OJAA 1ZKEA 1G73A 2ODUA 1MMDA 2B76A 2CCQA 1MIVA 3ETUA 3LSVA 5JDHA 2ZLYA 3ONJA 4G63A 3KV6A 3ONXA 3FBZA 2N1GA 1KEYA 1UURA 5AQSB 3FXDB 5CA1E 2BBJA 2BKNA 4YT0A 5FXWA 2CM0A 2BG9A 2E5LT 3CPZA 5JDFA 1EZ3A 2YKSA 5H6QB 4A56A 4LFBT 2W63A 3IF8B 3EI0A 4ZEYA 1N34T 4QH1A 2W2UA 3PUSA 3KV5A 2Y48B 2WY2A 3ZC0A 5H6RB 3LK2B 4PNIA 3OYXA 1MNDA 3TLWA 2WDVA 1W0AA 3PUQA 3AVRA 3ZCJA 1U4QA 2J4GA 2QGSA 4BJNA 3IBPA 1BR2A 3L09A 4TWDA 3RQWA 1ZEEA 2XSBA 2ZM0A 2JMHA 3PUYF 3AVSA 5LHHB 4X64T 1IAPA 2V6XA 2XAHB 3CK6A 3MJXA 3UFGA 4QX8B 3GN5B 3F31A 4ILBA 5C8YE 4NUVA 5CB4E 1N32T 4IE0A 3LDQB 3T8OA 2XPKA 2XQ4A 2NW8A 1OEDA 2Q9QB 4Q25A 5LMUT 2JIWA 5FP3A 3RPUA 4I4TE 3F57A 2V1DB 2X68A 4DV0T 5IUXA 5LJMA 2KINB 1E1HB 3CQCB 5AQUB 1LKXA 3JCFA 2K24A 4AKIA 2X9YA 3CWZB 2XAFB 1IZNB 5LGUB 5GONE 1W9RA 2N2NA 3N9QA 4DIDB 3AAEB 3UFEA 3ZMUB 3P4RA 2LE8A 3DJBA 4QXHB 3ZN0B 4AQGA 3LG7A 4G2AA 4EB6E 3EDVA 2E9XB 2R6GF 4GK5E 4XAXB 1QLBA 2YDQA 1Z0PA 4DR1T 3RI5A 2I6HA 4TWFA 2UXBT 4YTNA 1UCUA 2KWHA 3OYZA 2VL0A 4EYYR 1FIOA 3QNUA 3EUHA 1E2AA 3QOFA 2LSIA 2X51A 2J62A 3T1HT 3TLSA 1HR0T 3PTRB 2FJDA 5HXRA 2JQHA 2BG9C 5LBQB 2M6BA 1NEKA 4X1KE 5ETWA 3LK3B 4IL9A 3WAJA 5JR9C 3ZJ1A 2ACZA 3O1JA 2XAQB 2NW7A 1HF8A 4HFEA 3NWIA 3AE3A 4QH5A 3ABVA 3VRBA 4X5TA 2Q9QA 1M62A 4O4LE 1T72A 4UELA 2DHRA 1HCIA 3W15B 5FY7A 3PU8A 3ZPOA 3LJCA 2OV9A 2LOPA 4H63V 3ZKRA 2QRXA 4PJNA 2KT9A 4HFHA 2MYSA 2HPJA 3B5MA 1AJ3A 4IGUA 1YXRA 2ES0A 2QYWA 2V26A 4E7SA 3CKDA 2BKPA 3JAFA 4QXBB 5LCYA 4HFDA 4X65T 5E0OA 3AE1A 2RP4A 4X62T 2ZMAA 2JRKA 5LYJE 1T98A 4DV1T 4J2CA 4HWCA 2YDSA 1R8IA 3HI2A 4MLKA 1IJ6A 5L3BB 4UEMA 4HEAA 3ZMVB 5BR8T 4U74A 4COFA 3RYIE 5LHIB 4LFCT 2BG9E 4GIWA 3Q5EA 4GYRA 2NP9A 2XQ5A 2OA5A 4ZI7E 4X1IE 3AAIA 1QUUA 2XQYA 5HWXA 3SFDA 2CBIA 3A8YC 1ZP0A 3GWHA 4DBRA 2VKJA 5HCMA 3RX6A 1E7PA 1BR4A 3JC6D 4DR7T 2XQ3A 2BZBA 2XSAA 2IDOB 1L0VA 2EHOD 3I0OA 3PJAA 4ZXLA 1OXZA 3CMLA 4Z91A 4YTPA 1KK7A 2CWYA 4IDQA 4UV9B 2XY8B 5DABA 1VCTA 3LFMA 3SWHA 4YLHA 2VK9A 4M1PA 5IWAT 2Y6XA 1J1JA 4OX9T 3AEFA 1FMVA 1W0BA 4O4HE 2GK9A 1HX8A 2HPLA 2BVMA 3KBUA 2NW9A 3C4WA 1JNRA 2WS3A 3IA3A 3Q5DA 4KHZF 1OEDE 4I55E 4P09A 2BS4A 2CHNA 5LG4A 1O3XA 1UX4A 2L8KA 4HFCA 5HXCA 4GKKT 2KXPB 3TKLB 2UUCT 3FZKB 4F8HA 2FJAA 5ADXL 4O2AE 4AKLA 5ABFA 3ANWB 5HXEA 3UTKA 1SUMB 2MPKA 5C3JA 5JREA 3QB5A 2WZIA 3RLFF 5LJNA 3CIRA 2YU1A 3ZMSB 5AQHB 4LF6T 3P4PA 4YSXA 2D2SA 2M6IA 1UGOA 5C2TA 5FVKA 1J5ET 5HXHA 2M67A 3LBXA 2CHOA 2UUBT 4L5GA 1XMQT 2LSJA 2NTYA 3KDSE 5LGNB 4P1NA 4IHJE 4WYVA 5FVLA 4F6RC 4UVAB 5HWYA 3VU7H 3AEAA 2KSRA 2X9HA 2L3LA 2UXNB 4JEHB 2LOSA 2BG9B 3L39A 1VOMA 2V7MA 3UU5A 2X0LB 1S35A 4ZZBA 3VKHA 1IBMT 2YU2A 5J2UE 3P4QA 4A5XA 2XAGB 3Q5XA 2CA5A 3UUNA 5A1LA 2YOEA 1KNZA 4YJ3E 4TUYE 4EOZB 1D1BA 4BAYB 4PAGA 2VB6A 4YHHT 3MKDA 1N36T 3P8CD 3ZN1B 2PTFA 1KNRA 1XZYA 3UT5E 2Z6EA 1NAFA 5IHYA 5L47A 5AQPB 3ANWA 4AQFC 4WZXA 2LM9A 2V5DA 5J0ZA 1VRBA 1I94T 4ZI3C 2NOXA 3RIAA 2HHHT 5JDQA 1OEDB 4HE8A
chains in the Genus database with same CATH topology
2D0UA 2X68A 1Y64B 2K5BB 4ILUA 3ZJ2A 2ZM8A 5LJMA 2KINB 1WYBA 1FMWA 1E1HB 3E0ZA 3FB2A 4JLEA 2P9BA 3CQCB 4HFVA 3ZCIA 1CUNA 2WMNA 5L3EB 1LKXA 4CI1B 2E9XD 2PFVA 4QXCB 4Z8XA 1OWAA 1LVKA 2YK0A 2XHEB 3K8PC 2K24A 3Q2MA 4AKIA 2X9YA 3CWZB 2XAFB 4JEUB 1IZNB 3NZPA 3KVAA 3WI3A 5LGUB 5GONE 2E9XA 2N2NA 4ZOLE 4I50E 3N9QA 3AAEB 2BVLA 3IEEA 3B13A 2CMRA 2C5JA 3J9X1 3UFEA 4EZHA 4FI5A 3ZMUB 5LGTB 2BDEA 3PU3A 5FNVE 3HR0A 2LE8A 3DJBA 4O8SA 4QXHB 3KVBA 3CVRA 2K48A 2NWBA 3ZN0B 4QHOA 3ZLIA 4AQGA 5JR9A 3LG7A 4G2AA 4XBFB 4EB6E 3EDVA 4BJMA 2E9XB 4GK5E 3C64A 4XAXB 3I1AA 2N9DA 2IC9A 3HKEE 4MBQA 2VWAA 5FXXA 2DWKA 5EK3A 4EAHA 3C98B 5LOVE 5JR9B 5CA0E 3MXZA 1YW0A 2MTQA 4H9RC 4ZS2A 1UCUA 3UUMA 2KWHA 3OYZA 4ANJA 4ZHQE 4KMCA 2ODVA 4EYYR 4NUUA 4OYJA 1FIOA 3AA6B 3EUHA 4OYKA 1MIWA 3DP7A 2LSIA 2UXXB 2X51A 5HAXA 4ZI3D 4B6XA 3H3AA 4YFSA 3M65A 3PE0A 4QWNB 4UVBB 2LHNA 2YEVC 2E9XC 3ZMZB 3RYCE 3EDUA 3PTRB 1MMGA 1YD8G 2W00A 5HYAA 2A2FX 5HXRA 3OKQA 1ZV4X 3RC3A 2QA7A 1MNEA 3FBLA 2LSKA 3QK6A 5LBQB 2EHOA 1WRDA 5LA6E 4X1KE 1QSDA 3H37A 5ETWA 3LK3B 4PFPA 2CEAA 3WAJA 5JR9C 2X67A 5EZYE 4HKAA 4TZ4C 3ZJ1A 2PG8A 1HG5A 1BR1A 2D5UA 3O1JA 2XAQB 2Q9QD 2ACXA 2C0SA 2NW7A 4AXPA 1HF8A 3AA1B 2I59A 3B57A 3OBVE 3VKGA 3ZYMA 1B7TA 2KLQA 3K3QC 2CWOA 5JRCA 2EHOB 3MK7C 5IYZE 2Q9QA 2G0UA 3KINB 5FY0A 2YINA 2WSSV 4O4LE 4UELA 4L9IA 2DHRA 4ASKA 1HCIA 3VHLA 4ADZA 3W15B 5FY7A 2V7LA 2KZ7B 3PU8A 3ZPOA 2LSYA 4OFZA 3D0TA 3LJCA 2LOPA 2IC6A 2H3RA 3AB3B 1SA0E 4H63V 1D0XA 4PJNA 2KT9A 2VKOA 2MYSA 5EK2A 4CZZB 2HPJA 1ZHCA 2DNXA 1AJ3A 3RC8A 5FYMA 2VASA 3N9LA 4IGUA 5L3CB 5F3JA 2ES0A 2WMOA 3CQXC 3N9OA 2E8IA 2V26A 2C5IT 4E7SA 2KMFA 3CKDA 5LP6E 1V9DA 4QX7B 1S94A 5FY1A 4P0AA 4QXBB 4GK0E 5LCYA 4AKRB 5HXSA 2JMKA 5E0OA 4OHFA 2RP4A 2A3DA 4UXNB 4DNDA 3NBXX 2ZMAA 4N78D 3CQGB 2XAJB 2JRKA 2MBGA 4QKNA 4DO0A 2JJ9A 2V7JA 5KMGP 5LYJE 3PURA 3N9NA 3BQLA 4KP3C 5AFUL 1T98A 4CXWA 4J2CA 5LHGB 3CX8B 2Q9QC 5L3GB 3IHRA 2DI4A 1HTJF 3HI2A 4MLKA 5M4YA 3N5LA 4XZCA 1IJ6A 5L3BB 2WAUA 4UEMA 4UV8B 2HH7A 3LK42 1WR6A 4HEAA 3ZMVB 4U74A 3GA8A 4TX5A 2LJLA 3RYIE 5LHIB 3QC9A 1H7CA 2W62A 3RRCA 4GIWA 4ISSA 4GYRA 1HG2A 1UX5A 2C5KT 3N2GE 2B1EA 4IE6A 2NP9A 1WYCA 5JDMA 2OA5A 4DMWA 4ZI7E 4WBNE 3O9XA 4EZ4A 4X1IE 2CLYB 3AAIA 2V7KA 1QUUA 4H9SE 3SRZA 4DMVA 3C4XA 2XQYA 5HWXA 5FXZA 3O1HA 1MIYA 3I9YA 3Q5WA 2X9WA 3KV9A 4U72A 3GWHA 4DBRA 2VKJA 4WBOA 3RX6A 4PK5A 1BR4A 2XTLA 3JC6D 1HS7A 2V7IA 3BQKA 2BZBA 4EYUA 2CXLA 3I0QA 4HTEA 4H9NC 4TV9E 2LHRA 3HL6A 4TV8E 2H7OA 3HKDE 4P0BA 3E22E 3ZYKA 2DLRA 4PK6A 3RYHE 5JDLA 2EHOD 3AAAB 5LXTE 1FEWA 2DWGA 3ETVA 3I0OA 5J1GA 2CLYC 1OXZA 3BK9A 3BQIA 3CMLA 3F2EA 1D0ZA 1LRZA 2ZM2A 2Y8DA 3WAKA 2VKHA 2RA1A 3KV4A 4PK4A 2PJQA 3MA9A 3O1IA 3N2OA 4IE7A 3I9WA 1KK7A 2CWYA 4V1Av 4UV9B 5L3DB 4WNKA 2J1DG 5DABA 3NZQA 3P7IA 3R84B 3SWHA 3LFMA 5L2LA 4YLHA 5KX5E 2VK9A 4M1PA 5DJQC 4AKHA 2Y6XA 4DBQA 4AI6A 4EXTA 4UF0B 2JPFA 3MACA 1FMVA 4OK0A 3U78A 1NWMX 3K3OA 4PJJA 1MMNA 2IW5B 4O4HE 3ZYLA 3C4ZA 4CQIA 2GK9A 3ZEFB 4C91A 2CXFA 2LT3A 2XUEA 2X9XA 3AA0B 1HX8A 3J7Yq 2HPLA 2BVMA 3KBUA 3PUAA 1D1CA 2NW9A 3C4WA 1X79A 5JDGA 3JC6C 4H9QC 3K3NA 1BR0A 4I55E 5JH7E 4P09A 3C50A 2A72A 2NTXA 4MALA 4GOUA 5LG4A 2PBIA 1O3XA 5JDNA 1UX4A 5JVDE 2L9QA 2EHOC 3N2KE 1YKHB 3ESLA 4GYSA 2L8KA 4I43B 5TAOA 4E7ZA 3FHNA 5JQGE 4O4IE 5HXCA 3PUGA 4X20E 5DQVA 2CXDA 2KXPB 4EIWA 3L3PA 3TKLB 2MOZA 3OJAA 4BA9A 1ZKEA 3Q9DA 4UVCB 5KDMC 1G73A 2ODUA 1MMDA 2CCQA 3A5XA 3UULA 5ADXL 1MIVA 2VKDA 2X66A 5DQWA 3ETUA 3GMIA 4PJLA 4O2AE 4H9OC 4AKLA 4MHCA 3ANWB 5HXEA 5JDHA 2ZLYA 4O4JE 2LEHA 4IIJE 3UTKA 4G63A 3KV6A 3ONXA 3EVYA 4HN9A 5JREA 3FBZA 5J2TE 4IDZA 2N1GA 4KBMB 1SHZC 5LJNA 2YU1A 3ZMSB 3FXEB 4L0RA 2LSGA 3FXDB 5CA1E 2D2SA 4CXYA 4FJOA 5F8PA 2WWUA 4YJ2E 5HXHA 2M67A 3LBXA 4L5GA 3ZC1A 3SS1A 3QUJA 3O4XE 2LSJA 2NTYA 3AA7B 2H7VC 3KDSE 5LGNB 4AKGA 3SOLA 4K0UA 3C51A 4IHJE 5FXWA 2CM0A 1IJ5A 2SPCA 4F6RC 1D0YA 3CPZA 3LBXB 1EZ3A 5JDFA 5H6QB 1MMAA 4UVAB 5HWYA 4A56A 2W63A 3HKBE 3IF8B 3UUXB 3RYFE 3VU7H 2JQQA 2WBLA 2X9HA 4O2BE 2L3LA 2UXNB 4X1YE 4JEHB 2LOSA 1VOMA 3PUSA 2V7MA 3ZMTB 3KV5A 2Y48B 3V5SA 2X0LB 4KUMB 3ZC0A 4UF0A 1S35A 5H6RB 3LK2B 3VKHA 4ZI2D 4PNIA 3KFWX 3OYXA 3HA4A 5LNKA 1MNDA 2YU2A 4AQFA 5J2UE 2W61A 4WW0A 3PUQA 4JUYA 3V5UA 3AVRA 3ZCJA 2VL8A 1U4QA 4YHJA 2XASB 4PW8A 1HFAA 2XAGB 3Q5XA 4MFRA 2CA5A 3S4UA 2QGSA 4IE5A 4BJNA 2DCFA 4DVDA 1D1AA 3IBPA 3UUNA 5A1LA 5L3FB 1KNZA 4PFOA 3GN5A 1BR2A 3CX6B 4PJMA 4YJ3E 3L09A 3RKOA 4CI3B 1ZEEA 4TUYE 2ZM0A 3KBTA 4EOZB 2KNDA 2JMHA 1D1BA 3AVSA 4BAYB 5FMNA 2IAKA 4PAGA 5LHHB 5LBMA 3E08A 3DTOA 2VB6A 4H63H 5FXVA 4IE4A 3R6NA 2K9AA 1IAPA 3MKDA 1LVFA 2D0TA 3CX7B 3MZKB 2XAHB 3RRWA 3P8CD 3ZN1B 3PDYA 3N9MA 3MJXA 2WM9A 4QX8B 3GN5B 3UT5E 1US7B 2Z6EA 3F31A 2W0GA 5C8YE 4NUVA 1NAFA 5CB4E 4TN7B 3U3IA 5IHYA 1G8XA 3N9PA 3ANWA 4AQFC 4IE0A 2LM9A 3NRYA 3T8OA 4UIGA 5BMVE 4H9PC 4C90A 2NW8A 4ERRA 5JRCB 3NRXA 4CXXA 4HGAA 4ZI2C 1U5PA 2Q9QB 2CE7A 1VRBA 1YKEB 2KWIB 4ZS3A 5EK4A 4CI2B 3HKCE 4ZI3C 2NOXA 1WLXA 5FP3A 3RPUA 5JDQA 4I4TE 3F57A 4ISTA 3RH3A 2V1DB 1Z0PA 4HE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AXP A;  2LJL A;  2L9Q A; 
#chains in the Genus database with same CATH topology
 4NXN T;  4ILU A;  4ZZC A;  5L3E B;  1CUN A;  2WMN A;  2E9X D;  4Z8X A;  1OWA A;  4X66 T;  2XHE B;  3K8P C;  3Q2M A;  4LFA T;  2YN6 A;  4JEU B;  2IUB A;  3RIF A;  5LGT B;  5KXJ A;  3PU3 A;  1YQ4 A;  3HR0 A;  2WU2 A;  3CVR A;  2K48 A;  2NWB A;  2WU5 A;  5JR9 A;  3RHW A;  4BJM A;  4A98 A;  2IML A;  3AE5 A;  5FL0 A;  2IC9 A;  2J47 A;  3C98 B;  5LOV E;  3MXZ A;  4H9R C;  1WCR A;  4ZHQ E;  4IDN A;  4B3M T;  3UU3 A;  4DR3 T;  4OYK A;  1MIW A;  4ZI3 D;  4UVB B;  3EDU A;  1MMG A;  5HYA A;  3OKQ A;  4DV2 T;  2QA7 A;  3FBL A;  2LSK A;  2EHO A;  5LA6 E;  3H37 A;  5EZY E;  4HKA A;  4TZ4 C;  4DV4 T;  2D5U A;  2ACX A;  4AXP A;  5LG3 A;  3ZYM A;  4B3R T;  2CWO A;  2FJE A;  3TLU A;  2G0U A;  3KIN B;  2WSS V;  2AXD S;  4ADZ A;  2V7L A;  2IC6 A;  1SA0 E;  1X9B A;  4HWH A;  2DNX A;  5F5W A;  5FYM A;  2VAS A;  3N9L A;  4DR6 T;  2QVA A;  1S94 A;  5FY1 A;  4AIS A;  4OHF A;  4DND A;  1UUS A;  4N78 D;  3CQG B;  2MBG A;  2DL1 A;  4DO0 A;  5KMG P;  4KP3 C;  2CPT A;  3N9N A;  3IHR A;  2RPA A;  1HTJ F;  4U31 A;  4YY3 T;  3GA8 A;  4DV5 T;  4QH4 A;  4JI7 T;  3QC9 A;  3RRC A;  2WDQ A;  4ISS A;  1HG2 A;  3N2G E;  2V6Y A;  2B1E A;  4DMW A;  2JQK A;  4WBN E;  2CLY B;  2V7K A;  4H9S E;  4DMV A;  3I9Y A;  2JQ9 A;  4EEB A;  4PK5 A;  2CRB A;  4HTE A;  1XNR T;  4H9N C;  4KX6 A;  3HKD E;  4P0B A;  3E22 E;  3ZYK A;  5ABE A;  3AAA B;  3M3Z B;  5LXT E;  4NIQ A;  2DWG A;  5J1G A;  2BS3 A;  3BK9 A;  3BQI A;  3F2E A;  4HFB A;  2ZM2 A;  4PK4 A;  5HEH A;  4JI4 T;  4WNK A;  3R84 B;  4DR2 T;  2VQE T;  3UUB A;  4AKH A;  4AI6 A;  2WP9 A;  1HNX T;  4UF0 B;  2IIU A;  2BS2 A;  1XWM A;  3PJA J;  5CJ5 A;  3U78 A;  3TLV A;  3ZYL A;  5AQI B;  2LT3 A;  1KF6 A;  3JC6 C;  3UU4 A;  4LF5 T;  4H9Q C;  1HNW T;  3P4S A;  1BR0 A;  5JH7 E;  5LB7 B;  5JDN A;  5JVD E;  2L9Q A;  2EHO C;  3ESL A;  5JQG E;  4E7Z A;  3FHN A;  4O4I E;  2OLT A;  3PUG A;  5DQV A;  2MOZ A;  1DU2 A;  4BA9 A;  5KDM C;  3X1D A;  3A5X A;  2VKD A;  2X66 A;  3GMI A;  1XDP A;  4PJL A;  2VVS A;  4H9O C;  4MHC A;  4O4J E;  2LEH A;  4IIJ E;  2E2A A;  5J2T E;  1SHZ C;  4L0R A;  4DUZ T;  3AE2 A;  5ABF B;  1HNZ T;  4CXY A;  4TNV A;  5F8P A;  4YJ2 E;  3ZC1 A;  3SS1 A;  3O4X E;  3AA7 B;  3VR9 A;  4AKG A;  3SOL A;  3C51 A;  2SPC A;  1VCS A;  1D0Y A;  3LBX B;  2D9D A;  1CHU A;  3HKB E;  1WR0 A;  3RYF E;  2JQQ A;  2WBL A;  4O2B E;  3ZT6 A;  3AE7 A;  3UU8 A;  4IT4 A;  5AQV B;  4U2Z A;  4UF0 A;  3JAE A;  4ZI2 D;  4YXD A;  4AQF A;  2UU9 T;  4JUY A;  3L8R A;  2XAS B;  1HFA A;  4DR4 T;  2YDR A;  4IE5 A;  2DCF A;  1D1A A;  5L3F B;  4PFO A;  4PJM A;  3CX6 B;  3RKO A;  4CI3 B;  3KBT A;  2KND A;  2IAK A;  3E08 A;  4IE4 A;  4NPP A;  2D0T A;  3MZK B;  3CX7 B;  3RRW A;  3PDY A;  2W67 A;  2WM9 A;  1US7 B;  4HWD A;  1IBL T;  2VUR A;  1G8X A;  3N9P A;  3NRY A;  5BMV E;  4H9P C;  3NRX A;  4CXX A;  4HGA A;  4JV5 T;  1U5P A;  1T7S A;  1YKE B;  4CI2 B;  3OVU A;  2LRK A;  3RH3 A;  4IST A;  2I0M A;  4NUU A;  1N33 T;  2D0U A;  2VVN A;  3ZJ2 A;  2ZM8 A;  1WYB A;  1FMW A;  1Y01 A;  3NKZ A;  4HFV A;  4CI1 B;  3UQ7 A;  4HWI B;  2PFV A;  4QXC B;  3AEE A;  4YSY A;  5L4H A;  3NZP A;  3KVA A;  4I50 E;  2CMR A;  2C5J A;  3J9X 1;  4FI5 A;  4EV6 A;  2BDE A;  2HN2 A;  5FNV E;  4B3T T;  4O8S A;  5FL1 A;  4YTM A;  4DV3 T;  4LML A;  2N9D A;  4MBQ A;  2VWA A;  2WDR A;  2DWK A;  5JR9 B;  5CA0 E;  1XMO T;  1YW0 A;  2MTQ A;  3PUV F;  4ANJ A;  4IRE A;  4OYJ A;  3AA6 B;  3G06 A;  1HX1 B;  3DP7 A;  5HAX A;  3AE9 A;  4B6X A;  1YQ3 A;  5AQN B;  3PE0 A;  4QWN B;  2LHN A;  2E9X C;  4Z90 A;  2W00 A;  4U3C A;  2A2F X;  1ZV4 X;  3RC3 A;  3QK6 A;  1WRD A;  1QSD A;  3FZF B;  4PFP A;  2CEA A;  1HG5 A;  2Q9Q D;  3AA1 B;  4LF7 T;  3OBV E;  3VKG A;  4CN6 A;  1B7T A;  2KLQ A;  3K3Q C;  4A97 A;  1M7K A;  2EHO B;  2UXC T;  5AQL B;  2LLY A;  4L9I A;  4ASK A;  3VHL A;  3VR8 A;  2UUA T;  3TLT A;  3EHZ A;  2LSY A;  3AB3 B;  3QB5 K;  1KNP A;  1D0X A;  4U33 A;  2W4X A;  4CZZ B;  1FJG T;  1ZHC A;  3RC8 A;  5LMN T;  5F3J A;  2WMO A;  3CQX C;  3N9O A;  2E8I A;  2C5I T;  2KMF A;  1V9D A;  3PUW F;  4P0A A;  4GK0 E;  2H88 A;  5HXS A;  4UXN B;  2V8S V;  3NBX X;  1JNZ A;  4QKN A;  1SE7 A;  3PUR A;  3BQL A;  4CXW A;  5LHG B;  3CX8 B;  5L3G B;  1I6Z A;  3EAM A;  3UU6 A;  3N5L A;  4XZC A;  2WAU A;  2HH7 A;  4NXM T;  4IE6 A;  5AQT B;  5JDM A;  1WYC A;  4IDP A;  3RIU C;  3O9X A;  4EZ4 A;  2NR4 A;  1W09 A;  3SRZ A;  3RGL A;  3O1H A;  1MIY A;  3AXJ B;  3KV9 A;  4JI5 T;  4ILC A;  4WBO A;  2XTL A;  1NEN A;  2V6Y B;  4HFI A;  3BQK A;  3I0Q A;  2LM2 A;  4TV9 E;  3HL6 A;  5HCJ A;  2DLR A;  3RYH E;  3JAD A;  3T1Y T;  1D0Z A;  4HWF A;  2RA1 A;  2VKH A;  3N2O A;  2W66 A;  3I9W A;  4V1A v;  5L3D B;  2J1D G;  3NZQ A;  3P7I A;  3NVO A;  1GQE A;  3MAC A;  4DV7 T;  2V5C A;  4OK0 A;  5AQQ B;  3K3O A;  4PJJ A;  4YSZ A;  1MMN A;  2IW5 B;  4GKJ T;  3C4Z A;  4CQI A;  4C91 A;  2CXF A;  2XUE A;  3J7Y q;  4LF4 T;  5ABG A;  3A7M A;  1D1C A;  1X79 A;  5JDG A;  4LF8 T;  5AQJ B;  4CN4 A;  3K3N A;  4EGW A;  2VQF T;  2X0Y A;  4TNW A;  3C50 A;  2A72 A;  4GOU A;  1YKH B;  5TAO A;  4GYS A;  4EIW A;  4KI0 F;  2WB5 A;  3FZM B;  3Q9D A;  4UVC B;  1T8B A;  3RKG A;  3UUL A;  5DQW A;  2XJ7 A;  5CFB A;  3EVY A;  4JI1 T;  4HN9 A;  4IDZ A;  2XQ7 A;  4JI3 T;  4IDO A;  4KBM B;  4AQY T;  3FXE B;  3ZT7 A;  4LF9 T;  3AXJ A;  2LSG A;  5HEU A;  3SFE A;  4FJO A;  1Z8U A;  2WWU A;  3QUJ A;  2H7V C;  4K0U A;  1IJ5 A;  3UQ4 A;  1MMA A;  2LRL A;  3UUX B;  3ZT5 A;  3AE6 A;  4JI6 T;  4X1Y E;  2A9U A;  4U7I A;  1XDO A;  3ZMT B;  3V5S A;  4KUM B;  5HEJ A;  3KFW X;  5LNK A;  3HA4 A;  2W61 A;  4WW0 A;  3V5U A;  2VL8 A;  4YHJ A;  4PW8 A;  4MFR A;  3S4U A;  4UR9 A;  2WCA A;  4DVD A;  3GN5 A;  5FMN A;  5ABH A;  5LBM A;  3DTO A;  4H63 H;  5FXV A;  3RF1 A;  3R6N A;  2K9A A;  1LVF A;  3N9M A;  5CGM A;  2LKH A;  2XM2 A;  2W0G A;  4TN7 B;  5AQO B;  2UXD T;  3U3I A;  2WQY A;  2XQA A;  2MAW A;  4UIG A;  3VRA A;  4C90 A;  4ERR A;  5JRC B;  3PUX F;  4ZI2 C;  4JYA T;  2FJB A;  2CE7 A;  2KWI B;  4ZS3 A;  5EK4 A;  3HKC E;  1WLX A;  3K1S A;  2XM1 A;  4I0U A;  3FZH B;  5HEO A;  1Y64 B;  2K5B B;  2IHR 1;  3P4W A;  4JLE A;  3E0Z A;  3FB2 A;  3PUZ F;  2P9B A;  2WZH A;  3ZCI A;  2LKG A;  1LVK A;  2YK0 A;  3OTO T;  4AIU A;  3WI3 A;  2ZM6 T;  2E9X A;  4ZOL E;  2BVL A;  3IEE A;  3B13 A;  4EZH A;  1OED C;  3KVB A;  4QHO A;  3ZLI A;  4XBF B;  3C64 A;  3I1A A;  2K3W A;  2F4V T;  3HKE E;  5FXX A;  5EK3 A;  4EAH A;  4KHP T;  3P50 A;  4ZS2 A;  1XNQ T;  3UUM A;  4KMC A;  2ODV A;  4LMJ A;  3ONL C;  1J5W A;  2UXX B;  4ILA A;  3H3A A;  4YFS A;  3M65 A;  3AE4 A;  2YEV C;  3ZMZ B;  3RYC E;  1YD8 G;  4JI8 T;  4JI0 T;  1MNE A;  3H3M A;  2X67 A;  3EAB A;  4DUY T;  2PG8 A;  5AQM B;  4B3S T;  1BR1 A;  2C0S A;  2HN1 A;  5AQG B;  2I59 A;  3B57 A;  2BKO A;  5JRC A;  1ZOY A;  2XZE A;  3MK7 C;  5IYZ E;  4JI2 T;  5AQR B;  5L4E A;  5FY0 A;  2YIN A;  2XQ6 A;  4LMK A;  2KZ7 B;  4OFZ A;  3D0T A;  2H3R A;  1KFY A;  2E5V A;  2VKO A;  5EK2 A;  3RIU A;  5L3C B;  5LP6 E;  4QX7 B;  4AKR B;  2JMK A;  3AEC A;  2A3D A;  1UK5 A;  2XAJ B;  4CN1 A;  2JJ9 A;  2V7J A;  5AFU L;  4U2Y A;  2Q9Q C;  5JTG A;  5HEG A;  2WWV A;  2DI4 A;  5M4Y A;  2FUP A;  4JBW F;  4UV8 B;  3PV0 F;  3LK4 2;  1WR6 A;  4TX5 A;  2LJL A;  1H7C A;  5FKY A;  2W62 A;  2X0H A;  4IL4 A;  1UX5 A;  2C5K T;  4EED A;  5AQF B;  3C4X A;  2BBH A;  5FXZ A;  3Q5W A;  2X9W A;  1WFD A;  2XQ9 A;  4U72 A;  4U7Y A;  3AEG A;  1HS7 A;  2V7I A;  4EYU A;  2CXL A;  3ZST A;  2LHR A;  4TV8 E;  2H7O A;  2FBW A;  4PK6 A;  5JDL A;  3ZSS A;  1FEW A;  3RQU A;  3ETV A;  2CLY C;  1LRZ A;  3WAK A;  2Y8D A;  3KV4 A;  2PJQ A;  3MA9 A;  3O1I A;  2XQ8 A;  4IE7 A;  2AE9 A;  4TWH A;  5L2L A;  5KX5 E;  5DJQ C;  4DBQ A;  4EXT A;  2H89 A;  3AE8 A;  2JPF A;  1NWM X;  3ZEF B;  3AEB A;  2X9X A;  3AA0 B;  5AQK B;  3PUA A;  3FZL B;  4DR5 T;  4DV6 T;  2NTX A;  4MAL A;  4K0K T;  2PBI A;  3N2K E;  4I43 B;  3OPC A;  4X20 E;  2CXD A;  3L3P A;  1IBK T;  3AED A;  2CBJ A;  3OJA A;  1ZKE A;  1G73 A;  2ODU A;  1MMD A;  2B76 A;  2CCQ A;  1MIV A;  3ETU A;  3LSV A;  5JDH A;  2ZLY A;  3ONJ A;  4G63 A;  3KV6 A;  3ONX A;  3FBZ A;  2N1G A;  1KEY A;  1UUR A;  5AQS B;  3FXD B;  5CA1 E;  2BBJ A;  2BKN A;  4YT0 A;  5FXW A;  2CM0 A;  2BG9 A;  2E5L T;  3CPZ A;  5JDF A;  1EZ3 A;  2YKS A;  5H6Q B;  4A56 A;  4LFB T;  2W63 A;  3IF8 B;  3EI0 A;  4ZEY A;  1N34 T;  4QH1 A;  2W2U A;  3PUS A;  3KV5 A;  2Y48 B;  2WY2 A;  3ZC0 A;  5H6R B;  3LK2 B;  4PNI A;  3OYX A;  1MND A;  3TLW A;  2WDV A;  1W0A A;  3PUQ A;  3AVR A;  3ZCJ A;  1U4Q A;  2J4G A;  2QGS A;  4BJN A;  3IBP A;  1BR2 A;  3L09 A;  4TWD A;  3RQW A;  1ZEE A;  2XSB A;  2ZM0 A;  2JMH A;  3PUY F;  3AVS A;  5LHH B;  4X64 T;  1IAP A;  2V6X A;  2XAH B;  3CK6 A;  3MJX A;  3UFG A;  4QX8 B;  3GN5 B;  3F31 A;  4ILB A;  5C8Y E;  4NUV A;  5CB4 E;  1N32 T;  4IE0 A;  3LDQ B;  3T8O A;  2XPK A;  2XQ4 A;  2NW8 A;  1OED A;  2Q9Q B;  4Q25 A;  5LMU T;  2JIW A;  5FP3 A;  3RPU A;  4I4T E;  3F57 A;  2V1D B;  2X68 A;  4DV0 T;  5IUX A;  5LJM A;  2KIN B;  1E1H B;  3CQC B;  5AQU B;  1LKX A;  3JCF A;  2K24 A;  4AKI A;  2X9Y A;  3CWZ B;  2XAF B;  1IZN B;  5LGU B;  5GON E;  1W9R A;  2N2N A;  3N9Q A;  4DID B;  3AAE B;  3UFE A;  3ZMU B;  3P4R A;  2LE8 A;  3DJB A;  4QXH B;  3ZN0 B;  4AQG A;  3LG7 A;  4G2A A;  4EB6 E;  3EDV A;  2E9X B;  2R6G F;  4GK5 E;  4XAX B;  1QLB A;  2YDQ A;  1Z0P A;  4DR1 T;  3RI5 A;  2I6H A;  4TWF A;  2UXB T;  4YTN A;  1UCU A;  2KWH A;  3OYZ A;  2VL0 A;  4EYY R;  1FIO A;  3QNU A;  3EUH A;  1E2A A;  3QOF A;  2LSI A;  2X51 A;  2J62 A;  3T1H T;  3TLS A;  1HR0 T;  3PTR B;  2FJD A;  5HXR A;  2JQH A;  2BG9 C;  5LBQ B;  2M6B A;  1NEK A;  4X1K E;  5ETW A;  3LK3 B;  4IL9 A;  3WAJ A;  5JR9 C;  3ZJ1 A;  2ACZ A;  3O1J A;  2XAQ B;  2NW7 A;  1HF8 A;  4HFE A;  3NWI A;  3AE3 A;  4QH5 A;  3ABV A;  3VRB A;  4X5T A;  2Q9Q A;  1M62 A;  4O4L E;  1T72 A;  4UEL A;  2DHR A;  1HCI A;  3W15 B;  5FY7 A;  3PU8 A;  3ZPO A;  3LJC A;  2OV9 A;  2LOP A;  4H63 V;  3ZKR A;  2QRX A;  4PJN A;  2KT9 A;  4HFH A;  2MYS A;  2HPJ A;  3B5M A;  1AJ3 A;  4IGU A;  1YXR A;  2ES0 A;  2QYW A;  2V26 A;  4E7S A;  3CKD A;  2BKP A;  3JAF A;  4QXB B;  5LCY A;  4HFD A;  4X65 T;  5E0O A;  3AE1 A;  2RP4 A;  4X62 T;  2ZMA A;  2JRK A;  5LYJ E;  1T98 A;  4DV1 T;  4J2C A;  4HWC A;  2YDS A;  1R8I A;  3HI2 A;  4MLK A;  1IJ6 A;  5L3B B;  4UEM A;  4HEA A;  3ZMV B;  5BR8 T;  4U74 A;  4COF A;  3RYI E;  5LHI B;  4LFC T;  2BG9 E;  4GIW A;  3Q5E A;  4GYR A;  2NP9 A;  2XQ5 A;  2OA5 A;  4ZI7 E;  4X1I E;  3AAI A;  1QUU A;  2XQY A;  5HWX A;  3SFD A;  2CBI A;  3A8Y C;  1ZP0 A;  3GWH A;  4DBR A;  2VKJ A;  5HCM A;  3RX6 A;  1E7P A;  1BR4 A;  3JC6 D;  4DR7 T;  2XQ3 A;  2BZB A;  2XSA A;  2IDO B;  1L0V A;  2EHO D;  3I0O A;  3PJA A;  4ZXL A;  1OXZ A;  3CML A;  4Z91 A;  4YTP A;  1KK7 A;  2CWY A;  4IDQ A;  4UV9 B;  2XY8 B;  5DAB A;  1VCT A;  3LFM A;  3SWH A;  4YLH A;  2VK9 A;  4M1P A;  5IWA T;  2Y6X A;  1J1J A;  4OX9 T;  3AEF A;  1FMV A;  1W0B A;  4O4H E;  2GK9 A;  1HX8 A;  2HPL A;  2BVM A;  3KBU A;  2NW9 A;  3C4W A;  1JNR A;  2WS3 A;  3IA3 A;  3Q5D A;  4KHZ F;  1OED E;  4I55 E;  4P09 A;  2BS4 A;  2CHN A;  5LG4 A;  1O3X A;  1UX4 A;  2L8K A;  4HFC A;  5HXC A;  4GKK T;  2KXP B;  3TKL B;  2UUC T;  3FZK B;  4F8H A;  2FJA A;  5ADX L;  4O2A E;  4AKL A;  5ABF A;  3ANW B;  5HXE A;  3UTK A;  1SUM B;  2MPK A;  5C3J A;  5JRE A;  3QB5 A;  2WZI A;  3RLF F;  5LJN A;  3CIR A;  2YU1 A;  3ZMS B;  5AQH B;  4LF6 T;  3P4P A;  4YSX A;  2D2S A;  2M6I A;  1UGO A;  5C2T A;  5FVK A;  1J5E T;  5HXH A;  2M67 A;  3LBX A;  2CHO A;  2UUB T;  4L5G A;  1XMQ T;  2LSJ A;  2NTY A;  3KDS E;  5LGN B;  4P1N A;  4IHJ E;  4WYV A;  5FVL A;  4F6R C;  4UVA B;  5HWY A;  3VU7 H;  3AEA A;  2KSR A;  2X9H A;  2L3L A;  2UXN B;  4JEH B;  2LOS A;  2BG9 B;  3L39 A;  1VOM A;  2V7M A;  3UU5 A;  2X0L B;  1S35 A;  4ZZB A;  3VKH A;  1IBM T;  2YU2 A;  5J2U E;  3P4Q A;  4A5X A;  2XAG B;  3Q5X A;  2CA5 A;  3UUN A;  5A1L A;  2YOE A;  1KNZ A;  4YJ3 E;  4TUY E;  4EOZ B;  1D1B A;  4BAY B;  4PAG A;  2VB6 A;  4YHH T;  3MKD A;  1N36 T;  3P8C D;  3ZN1 B;  2PTF A;  1KNR A;  1XZY A;  3UT5 E;  2Z6E A;  1NAF A;  5IHY A;  5L47 A;  5AQP B;  3ANW A;  4AQF C;  4WZX A;  2LM9 A;  2V5D A;  5J0Z A;  1VRB A;  1I94 T;  4ZI3 C;  2NOX A;  3RIA A;  2HHH T;  5JDQ A;  1OED B;  4HE8 A; 
#chains in the Genus database with same CATH homology
 2D0U A;  2X68 A;  1Y64 B;  2K5B B;  4ILU A;  3ZJ2 A;  2ZM8 A;  5LJM A;  2KIN B;  1WYB A;  1FMW A;  1E1H B;  3E0Z A;  3FB2 A;  4JLE A;  2P9B A;  3CQC B;  4HFV A;  3ZCI A;  1CUN A;  2WMN A;  5L3E B;  1LKX A;  4CI1 B;  2E9X D;  2PFV A;  4QXC B;  4Z8X A;  1OWA A;  1LVK A;  2YK0 A;  2XHE B;  3K8P C;  2K24 A;  3Q2M A;  4AKI A;  2X9Y A;  3CWZ B;  2XAF B;  4JEU B;  1IZN B;  3NZP A;  3KVA A;  3WI3 A;  5LGU B;  5GON E;  2E9X A;  2N2N A;  4ZOL E;  4I50 E;  3N9Q A;  3AAE B;  2BVL A;  3IEE A;  3B13 A;  2CMR A;  2C5J A;  3J9X 1;  3UFE A;  4EZH A;  4FI5 A;  3ZMU B;  5LGT B;  2BDE A;  3PU3 A;  5FNV E;  3HR0 A;  2LE8 A;  3DJB A;  4O8S A;  4QXH B;  3KVB A;  3CVR A;  2K48 A;  2NWB A;  3ZN0 B;  4QHO A;  3ZLI A;  4AQG A;  5JR9 A;  3LG7 A;  4G2A A;  4XBF B;  4EB6 E;  3EDV A;  4BJM A;  2E9X B;  4GK5 E;  3C64 A;  4XAX B;  3I1A A;  2N9D A;  2IC9 A;  3HKE E;  4MBQ A;  2VWA A;  5FXX A;  2DWK A;  5EK3 A;  4EAH A;  3C98 B;  5LOV E;  5JR9 B;  5CA0 E;  3MXZ A;  1YW0 A;  2MTQ A;  4H9R C;  4ZS2 A;  1UCU A;  3UUM A;  2KWH A;  3OYZ A;  4ANJ A;  4ZHQ E;  4KMC A;  2ODV A;  4EYY R;  4NUU A;  4OYJ A;  1FIO A;  3AA6 B;  3EUH A;  4OYK A;  1MIW A;  3DP7 A;  2LSI A;  2UXX B;  2X51 A;  5HAX A;  4ZI3 D;  4B6X A;  3H3A A;  4YFS A;  3M65 A;  3PE0 A;  4QWN B;  4UVB B;  2LHN A;  2YEV C;  2E9X C;  3ZMZ B;  3RYC E;  3EDU A;  3PTR B;  1MMG A;  1YD8 G;  2W00 A;  5HYA A;  2A2F X;  5HXR A;  3OKQ A;  1ZV4 X;  3RC3 A;  2QA7 A;  1MNE A;  3FBL A;  2LSK A;  3QK6 A;  5LBQ B;  2EHO A;  1WRD A;  5LA6 E;  4X1K E;  1QSD A;  3H37 A;  5ETW A;  3LK3 B;  4PFP A;  2CEA A;  3WAJ A;  5JR9 C;  2X67 A;  5EZY E;  4HKA A;  4TZ4 C;  3ZJ1 A;  2PG8 A;  1HG5 A;  1BR1 A;  2D5U A;  3O1J A;  2XAQ B;  2Q9Q D;  2ACX A;  2C0S A;  2NW7 A;  4AXP A;  1HF8 A;  3AA1 B;  2I59 A;  3B57 A;  3OBV E;  3VKG A;  3ZYM A;  1B7T A;  2KLQ A;  3K3Q C;  2CWO A;  5JRC A;  2EHO B;  3MK7 C;  5IYZ E;  2Q9Q A;  2G0U A;  3KIN B;  5FY0 A;  2YIN A;  2WSS V;  4O4L E;  4UEL A;  4L9I A;  2DHR A;  4ASK A;  1HCI A;  3VHL A;  4ADZ A;  3W15 B;  5FY7 A;  2V7L A;  2KZ7 B;  3PU8 A;  3ZPO A;  2LSY A;  4OFZ A;  3D0T A;  3LJC A;  2LOP A;  2IC6 A;  2H3R A;  3AB3 B;  1SA0 E;  4H63 V;  1D0X A;  4PJN A;  2KT9 A;  2VKO A;  2MYS A;  5EK2 A;  4CZZ B;  2HPJ A;  1ZHC A;  2DNX A;  1AJ3 A;  3RC8 A;  5FYM A;  2VAS A;  3N9L A;  4IGU A;  5L3C B;  5F3J A;  2ES0 A;  2WMO A;  3CQX C;  3N9O A;  2E8I A;  2V26 A;  2C5I T;  4E7S A;  2KMF A;  3CKD A;  5LP6 E;  1V9D A;  4QX7 B;  1S94 A;  5FY1 A;  4P0A A;  4QXB B;  4GK0 E;  5LCY A;  4AKR B;  5HXS A;  2JMK A;  5E0O A;  4OHF A;  2RP4 A;  2A3D A;  4UXN B;  4DND A;  3NBX X;  2ZMA A;  4N78 D;  3CQG B;  2XAJ B;  2JRK A;  2MBG A;  4QKN A;  4DO0 A;  2JJ9 A;  2V7J A;  5KMG P;  5LYJ E;  3PUR A;  3N9N A;  3BQL A;  4KP3 C;  5AFU L;  1T98 A;  4CXW A;  4J2C A;  5LHG B;  3CX8 B;  2Q9Q C;  5L3G B;  3IHR A;  2DI4 A;  1HTJ F;  3HI2 A;  4MLK A;  5M4Y A;  3N5L A;  4XZC A;  1IJ6 A;  5L3B B;  2WAU A;  4UEM A;  4UV8 B;  2HH7 A;  3LK4 2;  1WR6 A;  4HEA A;  3ZMV B;  4U74 A;  3GA8 A;  4TX5 A;  2LJL A;  3RYI E;  5LHI B;  3QC9 A;  1H7C A;  2W62 A;  3RRC A;  4GIW A;  4ISS A;  4GYR A;  1HG2 A;  1UX5 A;  2C5K T;  3N2G E;  2B1E A;  4IE6 A;  2NP9 A;  1WYC A;  5JDM A;  2OA5 A;  4DMW A;  4ZI7 E;  4WBN E;  3O9X A;  4EZ4 A;  4X1I E;  2CLY B;  3AAI A;  2V7K A;  1QUU A;  4H9S E;  3SRZ A;  4DMV A;  3C4X A;  2XQY A;  5HWX A;  5FXZ A;  3O1H A;  1MIY A;  3I9Y A;  3Q5W A;  2X9W A;  3KV9 A;  4U72 A;  3GWH A;  4DBR A;  2VKJ A;  4WBO A;  3RX6 A;  4PK5 A;  1BR4 A;  2XTL A;  3JC6 D;  1HS7 A;  2V7I A;  3BQK A;  2BZB A;  4EYU A;  2CXL A;  3I0Q A;  4HTE A;  4H9N C;  4TV9 E;  2LHR A;  3HL6 A;  4TV8 E;  2H7O A;  3HKD E;  4P0B A;  3E22 E;  3ZYK A;  2DLR A;  4PK6 A;  3RYH E;  5JDL A;  2EHO D;  3AAA B;  5LXT E;  1FEW A;  2DWG A;  3ETV A;  3I0O A;  5J1G A;  2CLY C;  1OXZ A;  3BK9 A;  3BQI A;  3CML A;  3F2E A;  1D0Z A;  1LRZ A;  2ZM2 A;  2Y8D A;  3WAK A;  2VKH A;  2RA1 A;  3KV4 A;  4PK4 A;  2PJQ A;  3MA9 A;  3O1I A;  3N2O A;  4IE7 A;  3I9W A;  1KK7 A;  2CWY A;  4V1A v;  4UV9 B;  5L3D B;  4WNK A;  2J1D G;  5DAB A;  3NZQ A;  3P7I A;  3R84 B;  3SWH A;  3LFM A;  5L2L A;  4YLH A;  5KX5 E;  2VK9 A;  4M1P A;  5DJQ C;  4AKH A;  2Y6X A;  4DBQ A;  4AI6 A;  4EXT A;  4UF0 B;  2JPF A;  3MAC A;  1FMV A;  4OK0 A;  3U78 A;  1NWM X;  3K3O A;  4PJJ A;  1MMN A;  2IW5 B;  4O4H E;  3ZYL A;  3C4Z A;  4CQI A;  2GK9 A;  3ZEF B;  4C91 A;  2CXF A;  2LT3 A;  2XUE A;  2X9X A;  3AA0 B;  1HX8 A;  3J7Y q;  2HPL A;  2BVM A;  3KBU A;  3PUA A;  1D1C A;  2NW9 A;  3C4W A;  1X79 A;  5JDG A;  3JC6 C;  4H9Q C;  3K3N A;  1BR0 A;  4I55 E;  5JH7 E;  4P09 A;  3C50 A;  2A72 A;  2NTX A;  4MAL A;  4GOU A;  5LG4 A;  2PBI A;  1O3X A;  5JDN A;  1UX4 A;  5JVD E;  2L9Q A;  2EHO C;  3N2K E;  1YKH B;  3ESL A;  4GYS A;  2L8K A;  4I43 B;  5TAO A;  4E7Z A;  3FHN A;  5JQG E;  4O4I E;  5HXC A;  3PUG A;  4X20 E;  5DQV A;  2CXD A;  2KXP B;  4EIW A;  3L3P A;  3TKL B;  2MOZ A;  3OJA A;  4BA9 A;  1ZKE A;  3Q9D A;  4UVC B;  5KDM C;  1G73 A;  2ODU A;  1MMD A;  2CCQ A;  3A5X A;  3UUL A;  5ADX L;  1MIV A;  2VKD A;  2X66 A;  5DQW A;  3ETU A;  3GMI A;  4PJL A;  4O2A E;  4H9O C;  4AKL A;  4MHC A;  3ANW B;  5HXE A;  5JDH A;  2ZLY A;  4O4J E;  2LEH A;  4IIJ E;  3UTK A;  4G63 A;  3KV6 A;  3ONX A;  3EVY A;  4HN9 A;  5JRE A;  3FBZ A;  5J2T E;  4IDZ A;  2N1G A;  4KBM B;  1SHZ C;  5LJN A;  2YU1 A;  3ZMS B;  3FXE B;  4L0R A;  2LSG A;  3FXD B;  5CA1 E;  2D2S A;  4CXY A;  4FJO A;  5F8P A;  2WWU A;  4YJ2 E;  5HXH A;  2M67 A;  3LBX A;  4L5G A;  3ZC1 A;  3SS1 A;  3QUJ A;  3O4X E;  2LSJ A;  2NTY A;  3AA7 B;  2H7V C;  3KDS E;  5LGN B;  4AKG A;  3SOL A;  4K0U A;  3C51 A;  4IHJ E;  5FXW A;  2CM0 A;  1IJ5 A;  2SPC A;  4F6R C;  1D0Y A;  3CPZ A;  3LBX B;  1EZ3 A;  5JDF A;  5H6Q B;  1MMA A;  4UVA B;  5HWY A;  4A56 A;  2W63 A;  3HKB E;  3IF8 B;  3UUX B;  3RYF E;  3VU7 H;  2JQQ A;  2WBL A;  2X9H A;  4O2B E;  2L3L A;  2UXN B;  4X1Y E;  4JEH B;  2LOS A;  1VOM A;  3PUS A;  2V7M A;  3ZMT B;  3KV5 A;  2Y48 B;  3V5S A;  2X0L B;  4KUM B;  3ZC0 A;  4UF0 A;  1S35 A;  5H6R B;  3LK2 B;  3VKH A;  4ZI2 D;  4PNI A;  3KFW X;  3OYX A;  3HA4 A;  5LNK A;  1MND A;  2YU2 A;  4AQF A;  5J2U E;  2W61 A;  4WW0 A;  3PUQ A;  4JUY A;  3V5U A;  3AVR A;  3ZCJ A;  2VL8 A;  1U4Q A;  4YHJ A;  2XAS B;  4PW8 A;  1HFA A;  2XAG B;  3Q5X A;  4MFR A;  2CA5 A;  3S4U A;  2QGS A;  4IE5 A;  4BJN A;  2DCF A;  4DVD A;  1D1A A;  3IBP A;  3UUN A;  5A1L A;  5L3F B;  1KNZ A;  4PFO A;  3GN5 A;  1BR2 A;  3CX6 B;  4PJM A;  4YJ3 E;  3L09 A;  3RKO A;  4CI3 B;  1ZEE A;  4TUY E;  2ZM0 A;  3KBT A;  4EOZ B;  2KND A;  2JMH A;  1D1B A;  3AVS A;  4BAY B;  5FMN A;  2IAK A;  4PAG A;  5LHH B;  5LBM A;  3E08 A;  3DTO A;  2VB6 A;  4H63 H;  5FXV A;  4IE4 A;  3R6N A;  2K9A A;  1IAP A;  3MKD A;  1LVF A;  2D0T A;  3CX7 B;  3MZK B;  2XAH B;  3RRW A;  3P8C D;  3ZN1 B;  3PDY A;  3N9M A;  3MJX A;  2WM9 A;  4QX8 B;  3GN5 B;  3UT5 E;  1US7 B;  2Z6E A;  3F31 A;  2W0G A;  5C8Y E;  4NUV A;  1NAF A;  5CB4 E;  4TN7 B;  3U3I A;  5IHY A;  1G8X A;  3N9P A;  3ANW A;  4AQF C;  4IE0 A;  2LM9 A;  3NRY A;  3T8O A;  4UIG A;  5BMV E;  4H9P C;  4C90 A;  2NW8 A;  4ERR A;  5JRC B;  3NRX A;  4CXX A;  4HGA A;  4ZI2 C;  1U5P A;  2Q9Q B;  2CE7 A;  1VRB A;  1YKE B;  2KWI B;  4ZS3 A;  5EK4 A;  4CI2 B;  3HKC E;  4ZI3 C;  2NOX A;  1WLX A;  5FP3 A;  3RPU A;  5JDQ A;  4I4T E;  3F57 A;  4IST A;  3RH3 A;  2V1D B;  1Z0P A;  4HE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...