2L9QA

Structural characterization of small heat shock protein (hsp12)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of small heat shock protein (Hsp12)
rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords 12 kDa heat shock protein
total genus 26
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04119 HSP9_HSP12 Heat shock protein 9/12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1260 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2l9qA00
2L9QA 2LJLA 4AXPA
chains in the Genus database with same CATH superfamily
3ZT5A 4KP3C 3T1YT 2V7LA 5L2LA 5CA1E 4HWCA 2H3RA 3IF8B 4H9NC 4YXDA 2UXXB 2QGSA 3HKDE 2J1DG 2VVNA 2MBGA 2CXDA 3PUVF 4ADZA 5LHIB 4DV7T 3ETVA 3LK42 3Q9DA 1Z8UA 4PJLA 4N78D 4O4IE 4AISA 4IE6A 4YSXA 2VURA 2IW5B 3ZN0B 4X62T 3MZKB 5DJQC 5JDNA 5JRCB 3ONJA 1S94A 4HFCA 2E9XD 1D1BA 3AVRA 2V5CA 1D0XA 5FVLA 3KV5A 2PJQA 1IBMT 3NZQA 4IGUA 4JYAT 1HG2A 1X79A 2CRBA 2M67A 4ANJA 5AQRB 5CJ5A 3S4UA 3CX8B 3VR8A 4C91A 1D1CA 4UIGA 2DNXA 5CA0E 5M4YA 4KHPT 4CXYA 2WQYA 3RKOA 1N33T 3PUAA 3VRBA 4YLHA 5LHGB 1UUSA 1UGOA 4ZZCA 5HXEA 1HR0T 1AJ3A 4EGWA 5LGNB 3KBTA 4HFVA 4L9IA 4ILCA 5AQPB 3SS1A 4IL9A 5FL0A 5AFUL 1L0VA 3SOLA 2D0TA 1MIWA 3QUJA 4YHHT 1FMVA 4B3ST 2FUPA 3IBPA 4PK5A 5A1LA 5LMNT 2WDQA 3C4XA 3ZC0A 1N32T 1XWMA 3RPUA 2UXBT 4O4LE 5CFBA 4JI6T 4JI8T 3IA3A 1W0BA 3ZYMA 4LFCT 3KV6A 4IE4A 2L9QA 4DIDB 4P1NA 4ZS3A 2BG9B 3PTRB 4IHJE 3CPZA 2H7OA 5JR9C 4X66T 5CGMA 4JI2T 2HN2A 1MIYA 2JMHA 2BKPA 2NW9A 4KBMB 3AE3A 4TZ4C 2KMFA 2V1DB 3NZPA 1VCSA 3PU3A 4IDQA 3UFGA 4DVDA 3C4ZA 3I0QA 1Y64B 1CUNA 1IAPA 2ACZA 3AE1A 2MYSA 4UF0B 5EK3A 2N9DA 2XQ4A 2MPKA 5ABHA 2DHRA 2WWVA 2N1GA 4OK0A 4OYJA 4DV4T 4LF5T 5LBQB 3QB5A 5IUXA 2ZM8A 4X1YE 3UU4A 3R84B 4AQYT 2BBJA 3ANWA 3CX7B 2A72A 3HKBE 4DBRA 4A56A 3AE5A 4AKGA 2Y8DA 3AVSA 3K3QC 1UK5A 5JH7E 2CLYC 3OVUA 1HCIA 3VKGA 2LHRA 1KFYA 3F31A 4GOUA 5JDQA 4HFIA 3FZHB 3PUWF 1DU2A 2KT9A 1OWAA 2HPJA 3N2KE 1O3XA 2E9XC 2W61A 1QSDA 3H37A 3OJAA 4HFBA 1WYCA 3ETUA 4HFEA 4HGAA 2D9DA 3ZEFB 4DV2T 4JI0T 4B3RT 4AKIA 4AKHA 2RP4A 2WAUA 3LBXA 3JC6D 4DNDA 4OX9T 4TNWA 3AA6B 2E5VA 5FY1A 2FJDA 2WU5A 1OEDE 4ISSA 2V6XA 5FXVA 4U31A 4BJMA 4E7ZA 5HEHA 1ZV4X 3MK7C 2V8SV 3P4QA 4HEAA 4IT4A 4O2BE 1UX5A 3C64A 3NVOA 2Q9QC 4HKAA 4AKLA 3HL6A 3NBXX 4QKNA 3ZJ2A 4ERRA 1IBKT 2PTFA 2PFVA 1VOMA 4NPPA 4LF9T 5HXHA 3N5LA 2H89A 2ZLYA 4YTNA 3AEGA 2KLQA 4YTMA 2A9UA 5AQLB 2K24A 4TWDA 5HCJA 3DTOA 3J9X1 4HFDA 4ASKA 5JDLA 4JV5T 3AXJB 5HEUA 1QLBA 3P4RA 2QA7A 4ZI7E 1GQEA 5H6RB 2D2SA 1EZ3A 4A5XA 2YU2A 2IIUA 4B6XA 1M7KA 4ZZBA 4ZI2D 4FJOA 2I6HA 3Q2MA 3UT5E 3AAIA 4LF6T 2ACXA 4F6RC 4UXNB 1WLXA 4PW8A 2YOEA 1V9DA 2JMKA 2WDVA 5KXJA 3LK3B 2VQFT 3PJAJ 4GIWA 3BQIA 3FBLA 4DR6T 3RGLA 4H9OC 2KWIB 5JREA 1FJGT 1I94T 4X1KE 2BVLA 2HN1A 5FY7A 5KX5E 2CCQA 1IZNB 3ZKRA 1JNRA 2CBJA 4J2CA 4IDZA 1HNWT 4LF7T 2LT3A 3AE6A 3JADA 4Z90A 4AXPA 5ADXL 3FZLB 3OBVE 5AQJB 3AECA 5HAXA 2IC9A 2QYWA 3CMLA 4I50E 4NIQA 1KNZA 5JQGE 4NXNT 4DR7T 1HFAA 2B1EA 1CHUA 2FBWA 2NOXA 2XTLA 4JLEA 1WRDA 4LMKA 2KZ7B 3TLSA 2WY2A 2W0GA 1D0ZA 2LRLA 3RIAA 3RQWA 2JPFA 3GWHA 3LJCA 4PJMA 3O9XA 4DV6T 2BG9E 2CEAA 4HWHA 3E0ZA 4QXBB 5FXXA 4BAYB 4ZS2A 5JTGA 3G06A 1XMQT 4AI6A 4ILAA 5DABA 2BDEA 4AKRB 4TN7B 4BA9A 2LOSA 3NRXA 1MIVA 3LBXB 2IC6A 2W67A 4G63A 4Z91A 5FXWA 5JVDE 5LNKA 1J5ET 2C5KT 3HKCE 1XNRT 1HX1B 2GK9A 2V26A 2LRKA 4IDPA 4H9QC 2WDRA 2Q9QD 4TX5A 3Q5WA 3NKZA 4HFHA 4C90A 3AA7B 4WNKA 1D1AA 3PUQA 2DWKA 1LVKA 4H63H 2J47A 2XUEA 2QRXA 2DL1A 3Q5DA 5HWYA 4YJ2E 4B3MT 3UU6A 2BZBA 2B76A 2XHEB 4P0AA 2VKDA 2UXNB 3LG7A 4JEUB 3PUZF 3AXJA 5LCYA 1KNRA 2MTQA 4DUYT 3U3IA 2LSGA 4MALA 1MMAA 3RI5A 3GA8A 4OFZA 2VL8A 1MNDA 2DWGA 3HR0A 4QH1A 4QX7B 3E08A 5FNVE 5HWXA 1HS7A 3PUGA 4X1IE 4YJ3E 2XJ7A 3FXEB 1KEYA 2VKOA 2XQ3A 2A3DA 3AB3B 3P7IA 1NAFA 4QHOA 5ETWA 3W15B 3ZSSA 4AIUA 5IWAT 4DR5T 3ZSTA 2CXLA 2W2UA 3F57A 3PURA 4IREA 4AQFA 4GKJT 2ODUA 2XM2A 1BR2A 2V7IA 2LSIA 2JIWA 3IHRA 4WBNE 3A8YC 2F4VT 4GKKT 3FHNA 3KVAA 2IMLA 2LM9A 2BG9C 3UFEA 4DR4T 2MOZA 1MMGA 2SPCA 4P0BA 4Q25A 1XMOT 2CHOA 4PK4A 3K3NA 3JC6C 2XQ8A 1SHZC 1S35A 5H6QB 4UEMA 2VB6A 1SA0E 4Z8XA 2UUCT 2K9AA 3C98B 2ES0A 1MMNA 4LF8T 2KSRA 3ZMZB 2XAJB 2K3WA 4GYSA 4IDNA 5ABGA 2OLTA 3A5XA 3ABVA 2Q9QB 4MHCA 4UELA 1M62A 2XQYA 5FMNA 3ONXA 2E8IA 2P9BA 3LDQB 3ZCJA 3IEEA 2JQHA 1MMDA 4I4TE 3ZN1B 3ZLIA 4EAHA 2XQ7A 3FXDB 4U74A 4YHJA 3UULA 5J2TE 4YSYA 2ZMAA 1G8XA 3O1JA 5AQIB 2WZIA 2YINA 4H9RC 4TNVA 3UUBA 2CLYB 2K48A 3FBZA 4PNIA 3CX6B 5HYAA 5J2UE 3ZMTB 3AEDA 2W62A 4JEHB 4DMVA 2X0HA 2XAFB 4EYYR 5LJNA 4YY3T 5AQNB 5LA6E 3P4PA 3C4WA 4L0RA 4EEBA 5L4HA 4UR9A 3N9OA 1WFDA 3KINB 4I55E 5LG4A 3CQCB 3BK9A 3J7Yq 4DO0A 4EZHA 1HG5A 3GN5A 2LHNA 2LSYA 3PUYF 4K0UA 4O4HE 4PFPA 1BR4A 2CM0A 5LOVE 1HF8A 3SFDA 3T8OA 2BG9A 4GYRA 5C3JA 5L47A 3TLVA 2XASB 4CI2B 4QWNB 4JI4T 1N34T 1LKXA 3WI3A 2I0MA 2CXFA 2OA5A 5HEOA 1XNQT 2WS3A 4KI0F 3VRAA 3OKQA 5LBMA 4ISTA 3M3ZB 3O1HA 5JDMA 4EZ4A 3C51A 1T98A 2DI4A 2HH7A 1NEKA 3HKEE 2YK0A 5F5WA 1YW0A 2C5IT 3ZYLA 3SRZA 3BQKA 1T8BA 4EEDA 3UU3A 3AEBA 1ZKEA 3AE7A 3UU5A 4UV8B 2ODVA 2LSJA 3UTKA 2CHNA 3RHWA 5KDMC 5L3DB 3UQ7A 2UUBT 3L3PA 1UCUA 3RYCE 5FP3A 2LLYA 2A2FX 3A7MA 2X9YA 3DP7A 3H3MA 3N2OA 3EHZA 5FXZA 4ZI3D 3PUXF 3K8PC 4EIWA 5JDGA 2DLRA 2XM1A 3I0OA 4HWDA 4ZXLA 2BS3A 5LHHB 1YD8G 1YXRA 3H3AA 5LYJE 4PAGA 2MAWA 1OXZA 4ZI3C 3V5UA 2FJBA 1HX8A 4KX6A 3VU7H 3ZMUB 5ABFA 5L3EB 4X64T 4TUYE 4I43B 3MJXA 3ZYKA 3OYXA 3RC8A 4QH5A 1XDOA 4U33A 4WZXA 5DQWA 2M6BA 3CQXC 2V7MA 1JNZA 1US7B 3ZC1A 2VKJA 3KV4A 1MNEA 4OYKA 2JQKA 2IHR1 2QVAA 4GK5E 4HWIB 2G0UA 1NENA 2BKNA 2KNDA 2W66A 4I0UA 4IL4A 4UF0A 4COFA 5EK4A 4ZI2C 5KMGP 4YTPA 3EDUA 2LM2A 2JRKA 3AEAA 3MACA 4FI5A 2IAKA 3RIUC 4CQIA 4EB6E 2L3LA 2X9WA 3EUHA 2YDQA 1UX4A 4H9SE 2J62A 5L3CB 2VQET 4DV0T 1U5PA 3RRCA 2WZHA 1E1HB 2Z6EA 3L8RA 4U7YA 4EV6A 1IBLT 4IE5A 4F8HA 5C2TA 4XZCA 4DUZT 3N2GE 1YKEB 2IUBA 4P09A 5DQVA 4QX8B 1I6ZA 3LK2B 5AQTB 1T72A 2ZM2A 5F3JA 3I1AA 4CN6A 1IJ6A 3RRWA 2NW7A 3RQUA 4YFSA 4CN1A 4HWFA 5HXSA 3AEEA 2DCFA 4HTEA 1HNZT 4EXTA 2NTYA 4WYVA 3P8CD 3O4XE 2D0UA 3KV9A 3LSVA 4KHZF 3ZT6A 2JJ9A 4XBFB 2VWAA 3D0TA 2H88A 2RA1A 2H7VC 5BMVE 2XAQB 5F8PA 2XZEA 4AQGA 2M6IA 2CE7A 5C8YE 2LKHA 2WU2A 3OTOT 4MLKA 4JI5T 3AAEB 1XDPA 3N9LA 5LGTB 2XQ9A 4NUVA 3VKHA 2WMNA 3ZPOA 4UV9B 1LRZA 3Q5XA 4DV3T 4G2AA 3KFWX 3PE0A 4CI3B 2BS2A 3AEFA 3NRYA 3HI2A 1U4QA 2EHOD 3B13A 3N9NA 5AQUB 2PG8A 2VASA 3AA0B 3B5MA 3TKLB 1SE7A 5JDHA 2NTXA 2PBIA 3RC3A 5J0ZA 3RIUA 1J1JA 4B3TT 4WW0A 3RKGA 2VKHA 1W09A 4KUMB 4E7SA 3P50A 1J5WA 3DJBA 4GK0E 1FMWA 4UVCB 3PU8A 5FYMA 3UUXB 4LFAT 3AAAB 3AA1B 3ZMSB 3I9YA 2JQ9A 3EI0A 2I59A 1Z0PA 1VRBA 5AQKB 2C0SA 2BBHA 2V7KA 3R6NA 2Y48B 3CQGB 5J1GA 5JR9B 3QB5K 5L3FB 2UXDT 5AQHB 2WBLA 2RPAA 5LP6E 2XAHB 1ZHCA 5AQMB 2X68A 1FEWA 4CI1B 4DMWA 3ANWB 4EOZB 4A97A 2XQ5A 4AQFC 2J4GA 1BR1A 1OEDA 4LMLA 3ZT7A 4L5GA 5FVKA 1WR0A 5HEJA 1E2AA 5AQVB 3QNUA 4PK6A 5JR9A 4QXHB 2E9XA 2UUAT 3ONLC 3QOFA 4HE8A 1ZOYA 4M1PA 2XSAA 3PJAA 2KINB 3VR9A 5LGUB 3AE4A 1X9BA 2XAGB 4KMCA 3RYFE 2CWYA 2K5BB 4IE0A 2VK9A 4U72A 2BVMA 3RH3A 3AE2A 3CKDA 3B57A 4CXWA 2LE8A 3AE9A 4U2ZA 2C5JA 5LB7B 4ZEYA 4TWFA 2V7JA 5AQOB 5HCMA 1WCRA 2E2AA 2N2NA 3ZCIA 2EHOB 2WSSV 3AE8A 2VVSA 2W4XA 3EAMA 1T7SA 3WAJA 2FJEA 2LKGA 2VL0A 4ILBA 4DR2T 4JI7T 4TV8E 2OV9A 5LMUT 3T1HT 2BKOA 2NR4A 3MXZA 1R8IA 3EABA 3LFMA 3RIFA 1ZP0A 2FJAA 3BQLA 5BR8T 3KBUA 4ZOLE 4WBOA 5IHYA 5AQSB 2YKSA 5EZYE 2LSKA 3GMIA 3QC9A 2E5LT 1YKHB 2HPLA 2YEVC 3PUSA 3RX6A 4CN4A 3N9MA 4NUUA 3O1IA 4QXCB 1VCTA 1KF6A 1D0YA 2W63A 5ABEA 4NXMT 4UVAB 2KXPB 2CA5A 2W00A 2EHOC 4JI3T 2LJLA 3OYZA 3UUNA 1BR0A 1W0AA 5AQFB 3RF1A 4BJNA 3K1SA 4DBQA 2JQQA 3FB2A 4IDOA 3WAKA 1Y01A 4U2YA 3CVRA 1OEDC 1ZEEA 3P4SA 3RYIE 3E22E 2E9XB 2WP9A 3QK6A 4O8SA 2Q9QA 4JUYA 4IE7A 2WWUA 3L39A 3X1DA 4DR1T 4EYUA 1SUMB 4O4JE 2R6GF 5FY0A 1LVFA 5GONE 3U78A 4LMJA 4CZZB 1WR6A 2Y6XA 2D5UA 5E0OA 3MKDA 4JBWF 2CMRA 3MA9A 2WCAA 2YU1A 2AXDS 2L8KA 3N9PA 3PV0F 1HNXT 3TLTA 1W9RA 2WM9A 4OHFA 5EK2A 4A98A 4MBQA 1E7PA 2X9XA 2NW8A 3JCFA 3V5SA 3UQ4A 1OEDB 1YQ4A 4DR3T 4K0KT 2AE9A 4YSZA 2YDRA 4ILUA 2CWOA 1FIOA 4CXXA 4YT0A 2XQ6A 2ZM6T 3SFEA 4JI1T 1WYBA 2UXCT 4X5TA 2X0LB 4H63V 2IDOB 5HEGA 3ESLA 2X0YA 4DV1T 4HN9A 4PFOA 5IYZE 3TLUA 2NWBA 3L09A 1N36T 3FZFB 3CK6A 3CWZB 4QH4A 2XSBA 2LOPA 3SWHA 5LG3A 5TAOA 4IIJE 5L3BB 5FKYA 2CPTA 2EHOA 1IJ5A 2BS4A 3JAEA 4O2AE 2X66A 3M65A 2YN6A 2X67A 1G73A 3FZMB 4MFRA 2KWHA 4LF4T 2CBIA 3EVYA 2V5DA 1NWMX 3RLFF 3JAFA 2X51A 3PDYA 2UU9T 3I9WA 4X20E 3KDSE 5AQQB 2X9HA 2YDSA 3KVBA 5LJMA 4ZHQE 3RYHE 1KK7A 3HA4A 5L4EA 3F2EA 2XY8B 4U7IA 1XZYA 2LEHA 3UUMA 5JDFA 4H9PC 2NP9A 3UU8A 1YQ3A 3TLWA 3N9QA 5LXTE 1UURA 3EDVA 3NWIA 4TV9E 5HXCA 5AQGB 5L3GB 4PJNA 3OPCA 3K3OA 5ABFB 1B7TA 5HXRA 3GN5B 4TWHA 2WB5A 4XAXB 2XPKA 2XQAA 2ZM0A 2V6YA 4LFBT 5CB4E 1HTJF 4X65T 4PJJA 4V1Av 5FL1A 1QUUA 4UVBB 2WMOA 4DV5T 3Q5EA 3P4WA 2HHHT 3CIRA 3C50A 3VHLA 1H7CA 2V6YB 1KNPA 3ZMVB 3FZKB 4U3CA 5JRCA 3ZJ1A
chains in the Genus database with same CATH topology
4KP3C 2V7LA 5L2LA 5CA1E 2H3RA 3IF8B 4H9NC 2UXXB 2QGSA 3HKDE 2J1DG 2MBGA 2CXDA 4ADZA 5LHIB 3ETVA 3LK42 3Q9DA 4PJLA 4N78D 4O4IE 4IE6A 3ZN0B 3MZKB 5DJQC 5JDNA 5JRCB 1S94A 2E9XD 1D1BA 3AVRA 1D0XA 3KV5A 2PJQA 3NZQA 4IGUA 1HG2A 1X79A 2M67A 4ANJA 3S4UA 3CX8B 4C91A 5CA0E 1D1CA 4UIGA 2DNXA 5M4YA 4CXYA 3RKOA 3PUAA 4YLHA 5LHGB 5HXEA 1AJ3A 5LGNB 3KBTA 4HFVA 4L9IA 3SS1A 5AFUL 3SOLA 2D0TA 1MIWA 3QUJA 1FMVA 3ZC0A 3IBPA 4PK5A 5A1LA 3C4XA 3RPUA 4O4LE 3ZYMA 3KV6A 4IE4A 2L9QA 4ZS3A 3PTRB 4IHJE 3CPZA 2H7OA 5JR9C 1MIYA 2JMHA 2NW9A 4KBMB 4TZ4C 2KMFA 2V1DB 3NZPA 3PU3A 4DVDA 3C4ZA 3I0QA 1Y64B 1CUNA 1IAPA 2MYSA 4UF0B 5EK3A 2N9DA 2DHRA 2N1GA 4OK0A 4OYJA 5LBQB 2ZM8A 4X1YE 3R84B 3ANWA 3CX7B 2A72A 3HKBE 4DBRA 4A56A 4AKGA 2Y8DA 3AVSA 3K3QC 5JH7E 2CLYC 1HCIA 3VKGA 2LHRA 3F31A 4GOUA 5JDQA 2KT9A 1OWAA 2HPJA 3N2KE 1O3XA 2E9XC 2W61A 1QSDA 3H37A 3OJAA 4HGAA 1WYCA 3ETUA 5JDMA 3ZEFB 4AKIA 4AKHA 2RP4A 2WAUA 3LBXA 3JC6D 4DNDA 3AA6B 5FY1A 5FXVA 4ISSA 4BJMA 4E7ZA 1ZV4X 3MK7C 4HEAA 4O2BE 1UX5A 3C64A 4AKLA 2Q9QC 4HKAA 3HL6A 3NBXX 4QKNA 3ZJ2A 4ERRA 2PFVA 1VOMA 5HXHA 3N5LA 2ZLYA 2KLQA 3J9X1 2K24A 3DTOA 5JDLA 4ASKA 2QA7A 4ZI7E 5H6RB 2D2SA 1EZ3A 2YU2A 4B6XA 4ZI2D 4FJOA 3Q2MA 3UT5E 3AAIA 2ACXA 4F6RC 4UXNB 1WLXA 4PW8A 1V9DA 2JMKA 3LK3B 4GIWA 3BQIA 3FBLA 4H9OC 2KWIB 5JREA 4X1KE 2BVLA 5FY7A 5KX5E 2CCQA 1IZNB 4J2CA 4IDZA 2LT3A 5ADXL 3OBVE 5HAXA 2IC9A 3CMLA 4I50E 1KNZA 5JQGE 1HFAA 2B1EA 2NOXA 2XTLA 4JLEA 1WRDA 2KZ7B 2W0GA 1D0ZA 2JPFA 3GWHA 3LJCA 4PJMA 3O9XA 2CEAA 4QXBB 5FXXA 3E0ZA 4BAYB 4ZS2A 4AI6A 5DABA 2BDEA 4AKRB 4TN7B 4BA9A 2LOSA 3NRXA 1MIVA 3LBXB 2IC6A 4G63A 5FXWA 5JVDE 5LNKA 2C5KT 3HKCE 2GK9A 2V26A 4H9QC 2Q9QD 4TX5A 3Q5WA 4C90A 3AA7B 4WNKA 1D1AA 3PUQA 2DWKA 1LVKA 4H63H 2XUEA 4YJ2E 5HWYA 2BZBA 2XHEB 4P0AA 2VKDA 2UXNB 3LG7A 4JEUB 5LCYA 2MTQA 3U3IA 2LSGA 4MALA 1MMAA 3GA8A 4OFZA 2VL8A 1MNDA 2DWGA 3HR0A 5FNVE 4QX7B 3E08A 5HWXA 1HS7A 3PUGA 4X1IE 4YJ3E 3FXEB 2VKOA 3AB3B 2A3DA 3W15B 3P7IA 1NAFA 4QHOA 5ETWA 2CXLA 3PURA 3F57A 4AQFA 2ODUA 1BR2A 2V7IA 2LSIA 4WBNE 3IHRA 3FHNA 3KVAA 2LM9A 3UFEA 2MOZA 1MMGA 2SPCA 4P0BA 4PK4A 3K3NA 3JC6C 1SHZC 1S35A 5H6QB 4UEMA 2VB6A 1SA0E 4Z8XA 2K9AA 3C98B 2ES0A 1MMNA 3ZMZB 2XAJB 4GYSA 3A5XA 2Q9QB 4MHCA 4UELA 2XQYA 5FMNA 3ONXA 2E8IA 2P9BA 3ZCJA 3ZLIA 3IEEA 3ZN1B 1MMDA 4I4TE 4CZZB 4EAHA 3FXDB 4U74A 4YHJA 3UULA 2ZMAA 1G8XA 3O1JA 2YINA 4H9RC 2CLYB 2K48A 3FBZA 4PNIA 3CX6B 5HYAA 5J2UE 3ZMTB 4DMVA 2W62A 4JEHB 4EYYR 2XAFB 5LJNA 5LA6E 4L0RA 3C4WA 3J7Yq 3N9OA 3KINB 4I55E 5LG4A 3CQCB 3BK9A 4DO0A 4EZHA 1HG5A 3GN5A 2LHNA 2LSYA 4K0UA 4O4HE 5LOVE 4PFPA 1BR4A 2CM0A 1HF8A 3T8OA 4GYRA 2XASB 4CI2B 4QWNB 1LKXA 3WI3A 2CXFA 2OA5A 3OKQA 5LBMA 4ISTA 3O1HA 4EZ4A 3C51A 1T98A 2DI4A 2HH7A 3HKEE 2YK0A 3ZYLA 1YW0A 2C5IT 3SRZA 3BQKA 1ZKEA 4UV8B 2ODVA 2LSJA 3UTKA 5KDMC 5L3DB 3L3PA 1UCUA 3RYCE 5FP3A 2A2FX 3N2OA 2X9YA 3DP7A 5FXZA 4ZI3D 3K8PC 4EIWA 5JDGA 2DLRA 3I0OA 5LHHB 1YD8G 3H3AA 5LYJE 4PAGA 3VU7H 1OXZA 4ZI3C 3V5UA 3ZMUB 1HX8A 5L3EB 4TUYE 4I43B 3MJXA 3ZYKA 3OYXA 3RC8A 5DQWA 3CQXC 3ZC1A 2V7MA 1US7B 2VKJA 3KV4A 1MNEA 4OYKA 5LP6E 4GK5E 2IW5B 4AXPA 2G0UA 4UF0A 2KNDA 5EK4A 4ZI2C 5KMGP 3EDUA 3MACA 2JRKA 4FI5A 4CQIA 2IAKA 4EB6E 2L3LA 2X9WA 3EUHA 1UX4A 4H9SE 5L3CB 1U5PA 3RRCA 1E1HB 2Z6EA 4IE5A 4XZCA 3N2GE 1YKEB 4P09A 5DQVA 4QX8B 3LK2B 2ZM2A 5F3JA 3I1AA 1IJ6A 3RRWA 2NW7A 4YFSA 5HXSA 2DCFA 4HTEA 4EXTA 2NTYA 3P8CD 3O4XE 2D0UA 3KV9A 2JJ9A 4XBFB 2VWAA 3D0TA 2RA1A 2H7VC 5BMVE 2XAQB 5F8PA 4AQGA 2CE7A 5C8YE 4MLKA 3AAEB 5LGTB 3N9LA 4NUVA 3VKHA 2WMNA 3ZPOA 4UV9B 1LRZA 3Q5XA 4G2AA 3KFWX 3PE0A 4CI3B 3NRYA 3HI2A 1U4QA 2EHOD 3B13A 3N9NA 3TKLB 2PG8A 2VASA 3AA0B 5JDHA 2NTXA 2PBIA 3RC3A 4WW0A 2VKHA 4KUMB 4E7SA 3DJBA 4GK0E 1FMWA 4UVCB 3PU8A 5FYMA 3UUXB 3AAAB 3AA1B 3ZMSB 3I9YA 2I59A 1Z0PA 1VRBA 2C0SA 2V7KA 3R6NA 2Y48B 3CQGB 5J1GA 5JR9B 5L3FB 2WBLA 2XAHB 1ZHCA 2X68A 1FEWA 4CI1B 4DMWA 3ANWB 4EOZB 4AQFC 1BR1A 4L5GA 4PK6A 5JR9A 4QXHB 2E9XA 4HE8A 4M1PA 2KINB 5LGUB 2XAGB 4KMCA 3RYFE 2CWYA 2K5BB 4IE0A 2VK9A 4U72A 2BVMA 3RH3A 3CKDA 3B57A 4CXWA 2LE8A 2C5JA 2V7JA 2N2NA 3ZCIA 2EHOB 2WSSV 3WAJA 4TV8E 5J2TE 3MXZA 3LFMA 3BQLA 3KBUA 4ZOLE 4WBOA 5IHYA 5EZYE 2LSKA 3GMIA 3QC9A 1YKHB 2HPLA 2YEVC 3PUSA 3RX6A 3N9MA 4NUUA 3O1IA 4QXCB 1D0YA 2W63A 4UVAB 2KXPB 2CA5A 2W00A 2EHOC 2LJLA 3OYZA 3UUNA 1BR0A 4BJNA 4DBQA 2JQQA 3FB2A 3WAKA 3CVRA 1ZEEA 3RYIE 3E22E 2E9XB 3QK6A 4O8SA 2Q9QA 4JUYA 4IE7A 2WWUA 4EYUA 4O4JE 3U78A 5FY0A 5GONE 1LVFA 1WR6A 2Y6XA 2D5UA 5E0OA 3MKDA 2CMRA 3MA9A 2YU1A 3N9PA 2L8KA 2WM9A 4OHFA 5EK2A 4MBQA 2X9XA 2NW8A 3V5SA 4ILUA 2CWOA 1FIOA 4CXXA 1WYBA 2X0LB 4H63V 3ESLA 4HN9A 4PFOA 5IYZE 2NWBA 3L09A 3CWZB 2LOPA 3SWHA 5TAOA 4IIJE 5L3BB 2EHOA 1IJ5A 4O2AE 2X66A 3M65A 2X67A 1G73A 4MFRA 2KWHA 3EVYA 1NWMX 3PDYA 2X51A 3I9WA 4X20E 3KDSE 2X9HA 5LJMA 3KVBA 4ZHQE 3RYHE 1KK7A 3HA4A 3F2EA 2LEHA 3UUMA 5JDFA 4H9PC 2NP9A 3N9QA 5LXTE 3EDVA 5L3GB 4TV9E 5HXCA 4PJNA 3K3OA 1B7TA 5HXRA 3GN5B 4XAXB 2ZM0A 5CB4E 1HTJF 4PJJA 4V1Av 1QUUA 4UVBB 2WMOA 3VHLA 3C50A 1H7CA 3ZMVB 5JRCA 3ZJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9Q A;  2LJL A;  4AXP A; 
#chains in the Genus database with same CATH topology
 3ZT5 A;  4KP3 C;  3T1Y T;  2V7L A;  5L2L A;  5CA1 E;  4HWC A;  2H3R A;  3IF8 B;  4H9N C;  4YXD A;  2UXX B;  2QGS A;  3HKD E;  2J1D G;  2VVN A;  2MBG A;  2CXD A;  3PUV F;  4ADZ A;  5LHI B;  4DV7 T;  3ETV A;  3LK4 2;  3Q9D A;  1Z8U A;  4PJL A;  4N78 D;  4O4I E;  4AIS A;  4IE6 A;  4YSX A;  2VUR A;  2IW5 B;  3ZN0 B;  4X62 T;  3MZK B;  5DJQ C;  5JDN A;  5JRC B;  3ONJ A;  1S94 A;  4HFC A;  2E9X D;  1D1B A;  3AVR A;  2V5C A;  1D0X A;  5FVL A;  3KV5 A;  2PJQ A;  1IBM T;  3NZQ A;  4IGU A;  4JYA T;  1HG2 A;  1X79 A;  2CRB A;  2M67 A;  4ANJ A;  5AQR B;  5CJ5 A;  3S4U A;  3CX8 B;  3VR8 A;  4C91 A;  1D1C A;  4UIG A;  2DNX A;  5CA0 E;  5M4Y A;  4KHP T;  4CXY A;  2WQY A;  3RKO A;  1N33 T;  3PUA A;  3VRB A;  4YLH A;  5LHG B;  1UUS A;  1UGO A;  4ZZC A;  5HXE A;  1HR0 T;  1AJ3 A;  4EGW A;  5LGN B;  3KBT A;  4HFV A;  4L9I A;  4ILC A;  5AQP B;  3SS1 A;  4IL9 A;  5FL0 A;  5AFU L;  1L0V A;  3SOL A;  2D0T A;  1MIW A;  3QUJ A;  4YHH T;  1FMV A;  4B3S T;  2FUP A;  3IBP A;  4PK5 A;  5A1L A;  5LMN T;  2WDQ A;  3C4X A;  3ZC0 A;  1N32 T;  1XWM A;  3RPU A;  2UXB T;  4O4L E;  5CFB A;  4JI6 T;  4JI8 T;  3IA3 A;  1W0B A;  3ZYM A;  4LFC T;  3KV6 A;  4IE4 A;  2L9Q A;  4DID B;  4P1N A;  4ZS3 A;  2BG9 B;  3PTR B;  4IHJ E;  3CPZ A;  2H7O A;  5JR9 C;  4X66 T;  5CGM A;  4JI2 T;  2HN2 A;  1MIY A;  2JMH A;  2BKP A;  2NW9 A;  4KBM B;  3AE3 A;  4TZ4 C;  2KMF A;  2V1D B;  3NZP A;  1VCS A;  3PU3 A;  4IDQ A;  3UFG A;  4DVD A;  3C4Z A;  3I0Q A;  1Y64 B;  1CUN A;  1IAP A;  2ACZ A;  3AE1 A;  2MYS A;  4UF0 B;  5EK3 A;  2N9D A;  2XQ4 A;  2MPK A;  5ABH A;  2DHR A;  2WWV A;  2N1G A;  4OK0 A;  4OYJ A;  4DV4 T;  4LF5 T;  5LBQ B;  3QB5 A;  5IUX A;  2ZM8 A;  4X1Y E;  3UU4 A;  3R84 B;  4AQY T;  2BBJ A;  3ANW A;  3CX7 B;  2A72 A;  3HKB E;  4DBR A;  4A56 A;  3AE5 A;  4AKG A;  2Y8D A;  3AVS A;  3K3Q C;  1UK5 A;  5JH7 E;  2CLY C;  3OVU A;  1HCI A;  3VKG A;  2LHR A;  1KFY A;  3F31 A;  4GOU A;  5JDQ A;  4HFI A;  3FZH B;  3PUW F;  1DU2 A;  2KT9 A;  1OWA A;  2HPJ A;  3N2K E;  1O3X A;  2E9X C;  2W61 A;  1QSD A;  3H37 A;  3OJA A;  4HFB A;  1WYC A;  3ETU A;  4HFE A;  4HGA A;  2D9D A;  3ZEF B;  4DV2 T;  4JI0 T;  4B3R T;  4AKI A;  4AKH A;  2RP4 A;  2WAU A;  3LBX A;  3JC6 D;  4DND A;  4OX9 T;  4TNW A;  3AA6 B;  2E5V A;  5FY1 A;  2FJD A;  2WU5 A;  1OED E;  4ISS A;  2V6X A;  5FXV A;  4U31 A;  4BJM A;  4E7Z A;  5HEH A;  1ZV4 X;  3MK7 C;  2V8S V;  3P4Q A;  4HEA A;  4IT4 A;  4O2B E;  1UX5 A;  3C64 A;  3NVO A;  2Q9Q C;  4HKA A;  4AKL A;  3HL6 A;  3NBX X;  4QKN A;  3ZJ2 A;  4ERR A;  1IBK T;  2PTF A;  2PFV A;  1VOM A;  4NPP A;  4LF9 T;  5HXH A;  3N5L A;  2H89 A;  2ZLY A;  4YTN A;  3AEG A;  2KLQ A;  4YTM A;  2A9U A;  5AQL B;  2K24 A;  4TWD A;  5HCJ A;  3DTO A;  3J9X 1;  4HFD A;  4ASK A;  5JDL A;  4JV5 T;  3AXJ B;  5HEU A;  1QLB A;  3P4R A;  2QA7 A;  4ZI7 E;  1GQE A;  5H6R B;  2D2S A;  1EZ3 A;  4A5X A;  2YU2 A;  2IIU A;  4B6X A;  1M7K A;  4ZZB A;  4ZI2 D;  4FJO A;  2I6H A;  3Q2M A;  3UT5 E;  3AAI A;  4LF6 T;  2ACX A;  4F6R C;  4UXN B;  1WLX A;  4PW8 A;  2YOE A;  1V9D A;  2JMK A;  2WDV A;  5KXJ A;  3LK3 B;  2VQF T;  3PJA J;  4GIW A;  3BQI A;  3FBL A;  4DR6 T;  3RGL A;  4H9O C;  2KWI B;  5JRE A;  1FJG T;  1I94 T;  4X1K E;  2BVL A;  2HN1 A;  5FY7 A;  5KX5 E;  2CCQ A;  1IZN B;  3ZKR A;  1JNR A;  2CBJ A;  4J2C A;  4IDZ A;  1HNW T;  4LF7 T;  2LT3 A;  3AE6 A;  3JAD A;  4Z90 A;  4AXP A;  5ADX L;  3FZL B;  3OBV E;  5AQJ B;  3AEC A;  5HAX A;  2IC9 A;  2QYW A;  3CML A;  4I50 E;  4NIQ A;  1KNZ A;  5JQG E;  4NXN T;  4DR7 T;  1HFA A;  2B1E A;  1CHU A;  2FBW A;  2NOX A;  2XTL A;  4JLE A;  1WRD A;  4LMK A;  2KZ7 B;  3TLS A;  2WY2 A;  2W0G A;  1D0Z A;  2LRL A;  3RIA A;  3RQW A;  2JPF A;  3GWH A;  3LJC A;  4PJM A;  3O9X A;  4DV6 T;  2BG9 E;  2CEA A;  4HWH A;  3E0Z A;  4QXB B;  5FXX A;  4BAY B;  4ZS2 A;  5JTG A;  3G06 A;  1XMQ T;  4AI6 A;  4ILA A;  5DAB A;  2BDE A;  4AKR B;  4TN7 B;  4BA9 A;  2LOS A;  3NRX A;  1MIV A;  3LBX B;  2IC6 A;  2W67 A;  4G63 A;  4Z91 A;  5FXW A;  5JVD E;  5LNK A;  1J5E T;  2C5K T;  3HKC E;  1XNR T;  1HX1 B;  2GK9 A;  2V26 A;  2LRK A;  4IDP A;  4H9Q C;  2WDR A;  2Q9Q D;  4TX5 A;  3Q5W A;  3NKZ A;  4HFH A;  4C90 A;  3AA7 B;  4WNK A;  1D1A A;  3PUQ A;  2DWK A;  1LVK A;  4H63 H;  2J47 A;  2XUE A;  2QRX A;  2DL1 A;  3Q5D A;  5HWY A;  4YJ2 E;  4B3M T;  3UU6 A;  2BZB A;  2B76 A;  2XHE B;  4P0A A;  2VKD A;  2UXN B;  3LG7 A;  4JEU B;  3PUZ F;  3AXJ A;  5LCY A;  1KNR A;  2MTQ A;  4DUY T;  3U3I A;  2LSG A;  4MAL A;  1MMA A;  3RI5 A;  3GA8 A;  4OFZ A;  2VL8 A;  1MND A;  2DWG A;  3HR0 A;  4QH1 A;  4QX7 B;  3E08 A;  5FNV E;  5HWX A;  1HS7 A;  3PUG A;  4X1I E;  4YJ3 E;  2XJ7 A;  3FXE B;  1KEY A;  2VKO A;  2XQ3 A;  2A3D A;  3AB3 B;  3P7I A;  1NAF A;  4QHO A;  5ETW A;  3W15 B;  3ZSS A;  4AIU A;  5IWA T;  4DR5 T;  3ZST A;  2CXL A;  2W2U A;  3F57 A;  3PUR A;  4IRE A;  4AQF A;  4GKJ T;  2ODU A;  2XM2 A;  1BR2 A;  2V7I A;  2LSI A;  2JIW A;  3IHR A;  4WBN E;  3A8Y C;  2F4V T;  4GKK T;  3FHN A;  3KVA A;  2IML A;  2LM9 A;  2BG9 C;  3UFE A;  4DR4 T;  2MOZ A;  1MMG A;  2SPC A;  4P0B A;  4Q25 A;  1XMO T;  2CHO A;  4PK4 A;  3K3N A;  3JC6 C;  2XQ8 A;  1SHZ C;  1S35 A;  5H6Q B;  4UEM A;  2VB6 A;  1SA0 E;  4Z8X A;  2UUC T;  2K9A A;  3C98 B;  2ES0 A;  1MMN A;  4LF8 T;  2KSR A;  3ZMZ B;  2XAJ B;  2K3W A;  4GYS A;  4IDN A;  5ABG A;  2OLT A;  3A5X A;  3ABV A;  2Q9Q B;  4MHC A;  4UEL A;  1M62 A;  2XQY A;  5FMN A;  3ONX A;  2E8I A;  2P9B A;  3LDQ B;  3ZCJ A;  3IEE A;  2JQH A;  1MMD A;  4I4T E;  3ZN1 B;  3ZLI A;  4EAH A;  2XQ7 A;  3FXD B;  4U74 A;  4YHJ A;  3UUL A;  5J2T E;  4YSY A;  2ZMA A;  1G8X A;  3O1J A;  5AQI B;  2WZI A;  2YIN A;  4H9R C;  4TNV A;  3UUB A;  2CLY B;  2K48 A;  3FBZ A;  4PNI A;  3CX6 B;  5HYA A;  5J2U E;  3ZMT B;  3AED A;  2W62 A;  4JEH B;  4DMV A;  2X0H A;  2XAF B;  4EYY R;  5LJN A;  4YY3 T;  5AQN B;  5LA6 E;  3P4P A;  3C4W A;  4L0R A;  4EEB A;  5L4H A;  4UR9 A;  3N9O A;  1WFD A;  3KIN B;  4I55 E;  5LG4 A;  3CQC B;  3BK9 A;  3J7Y q;  4DO0 A;  4EZH A;  1HG5 A;  3GN5 A;  2LHN A;  2LSY A;  3PUY F;  4K0U A;  4O4H E;  4PFP A;  1BR4 A;  2CM0 A;  5LOV E;  1HF8 A;  3SFD A;  3T8O A;  2BG9 A;  4GYR A;  5C3J A;  5L47 A;  3TLV A;  2XAS B;  4CI2 B;  4QWN B;  4JI4 T;  1N34 T;  1LKX A;  3WI3 A;  2I0M A;  2CXF A;  2OA5 A;  5HEO A;  1XNQ T;  2WS3 A;  4KI0 F;  3VRA A;  3OKQ A;  5LBM A;  4IST A;  3M3Z B;  3O1H A;  5JDM A;  4EZ4 A;  3C51 A;  1T98 A;  2DI4 A;  2HH7 A;  1NEK A;  3HKE E;  2YK0 A;  5F5W A;  1YW0 A;  2C5I T;  3ZYL A;  3SRZ A;  3BQK A;  1T8B A;  4EED A;  3UU3 A;  3AEB A;  1ZKE A;  3AE7 A;  3UU5 A;  4UV8 B;  2ODV A;  2LSJ A;  3UTK A;  2CHN A;  3RHW A;  5KDM C;  5L3D B;  3UQ7 A;  2UUB T;  3L3P A;  1UCU A;  3RYC E;  5FP3 A;  2LLY A;  2A2F X;  3A7M A;  2X9Y A;  3DP7 A;  3H3M A;  3N2O A;  3EHZ A;  5FXZ A;  4ZI3 D;  3PUX F;  3K8P C;  4EIW A;  5JDG A;  2DLR A;  2XM1 A;  3I0O A;  4HWD A;  4ZXL A;  2BS3 A;  5LHH B;  1YD8 G;  1YXR A;  3H3A A;  5LYJ E;  4PAG A;  2MAW A;  1OXZ A;  4ZI3 C;  3V5U A;  2FJB A;  1HX8 A;  4KX6 A;  3VU7 H;  3ZMU B;  5ABF A;  5L3E B;  4X64 T;  4TUY E;  4I43 B;  3MJX A;  3ZYK A;  3OYX A;  3RC8 A;  4QH5 A;  1XDO A;  4U33 A;  4WZX A;  5DQW A;  2M6B A;  3CQX C;  2V7M A;  1JNZ A;  1US7 B;  3ZC1 A;  2VKJ A;  3KV4 A;  1MNE A;  4OYK A;  2JQK A;  2IHR 1;  2QVA A;  4GK5 E;  4HWI B;  2G0U A;  1NEN A;  2BKN A;  2KND A;  2W66 A;  4I0U A;  4IL4 A;  4UF0 A;  4COF A;  5EK4 A;  4ZI2 C;  5KMG P;  4YTP A;  3EDU A;  2LM2 A;  2JRK A;  3AEA A;  3MAC A;  4FI5 A;  2IAK A;  3RIU C;  4CQI A;  4EB6 E;  2L3L A;  2X9W A;  3EUH A;  2YDQ A;  1UX4 A;  4H9S E;  2J62 A;  5L3C B;  2VQE T;  4DV0 T;  1U5P A;  3RRC A;  2WZH A;  1E1H B;  2Z6E A;  3L8R A;  4U7Y A;  4EV6 A;  1IBL T;  4IE5 A;  4F8H A;  5C2T A;  4XZC A;  4DUZ T;  3N2G E;  1YKE B;  2IUB A;  4P09 A;  5DQV A;  4QX8 B;  1I6Z A;  3LK2 B;  5AQT B;  1T72 A;  2ZM2 A;  5F3J A;  3I1A A;  4CN6 A;  1IJ6 A;  3RRW A;  2NW7 A;  3RQU A;  4YFS A;  4CN1 A;  4HWF A;  5HXS A;  3AEE A;  2DCF A;  4HTE A;  1HNZ T;  4EXT A;  2NTY A;  4WYV A;  3P8C D;  3O4X E;  2D0U A;  3KV9 A;  3LSV A;  4KHZ F;  3ZT6 A;  2JJ9 A;  4XBF B;  2VWA A;  3D0T A;  2H88 A;  2RA1 A;  2H7V C;  5BMV E;  2XAQ B;  5F8P A;  2XZE A;  4AQG A;  2M6I A;  2CE7 A;  5C8Y E;  2LKH A;  2WU2 A;  3OTO T;  4MLK A;  4JI5 T;  3AAE B;  1XDP A;  3N9L A;  5LGT B;  2XQ9 A;  4NUV A;  3VKH A;  2WMN A;  3ZPO A;  4UV9 B;  1LRZ A;  3Q5X A;  4DV3 T;  4G2A A;  3KFW X;  3PE0 A;  4CI3 B;  2BS2 A;  3AEF A;  3NRY A;  3HI2 A;  1U4Q A;  2EHO D;  3B13 A;  3N9N A;  5AQU B;  2PG8 A;  2VAS A;  3AA0 B;  3B5M A;  3TKL B;  1SE7 A;  5JDH A;  2NTX A;  2PBI A;  3RC3 A;  5J0Z A;  3RIU A;  1J1J A;  4B3T T;  4WW0 A;  3RKG A;  2VKH A;  1W09 A;  4KUM B;  4E7S A;  3P50 A;  1J5W A;  3DJB A;  4GK0 E;  1FMW A;  4UVC B;  3PU8 A;  5FYM A;  3UUX B;  4LFA T;  3AAA B;  3AA1 B;  3ZMS B;  3I9Y A;  2JQ9 A;  3EI0 A;  2I59 A;  1Z0P A;  1VRB A;  5AQK B;  2C0S A;  2BBH A;  2V7K A;  3R6N A;  2Y48 B;  3CQG B;  5J1G A;  5JR9 B;  3QB5 K;  5L3F B;  2UXD T;  5AQH B;  2WBL A;  2RPA A;  5LP6 E;  2XAH B;  1ZHC A;  5AQM B;  2X68 A;  1FEW A;  4CI1 B;  4DMW A;  3ANW B;  4EOZ B;  4A97 A;  2XQ5 A;  4AQF C;  2J4G A;  1BR1 A;  1OED A;  4LML A;  3ZT7 A;  4L5G A;  5FVK A;  1WR0 A;  5HEJ A;  1E2A A;  5AQV B;  3QNU A;  4PK6 A;  5JR9 A;  4QXH B;  2E9X A;  2UUA T;  3ONL C;  3QOF A;  4HE8 A;  1ZOY A;  4M1P A;  2XSA A;  3PJA A;  2KIN B;  3VR9 A;  5LGU B;  3AE4 A;  1X9B A;  2XAG B;  4KMC A;  3RYF E;  2CWY A;  2K5B B;  4IE0 A;  2VK9 A;  4U72 A;  2BVM A;  3RH3 A;  3AE2 A;  3CKD A;  3B57 A;  4CXW A;  2LE8 A;  3AE9 A;  4U2Z A;  2C5J A;  5LB7 B;  4ZEY A;  4TWF A;  2V7J A;  5AQO B;  5HCM A;  1WCR A;  2E2A A;  2N2N A;  3ZCI A;  2EHO B;  2WSS V;  3AE8 A;  2VVS A;  2W4X A;  3EAM A;  1T7S A;  3WAJ A;  2FJE A;  2LKG A;  2VL0 A;  4ILB A;  4DR2 T;  4JI7 T;  4TV8 E;  2OV9 A;  5LMU T;  3T1H T;  2BKO A;  2NR4 A;  3MXZ A;  1R8I A;  3EAB A;  3LFM A;  3RIF A;  1ZP0 A;  2FJA A;  3BQL A;  5BR8 T;  3KBU A;  4ZOL E;  4WBO A;  5IHY A;  5AQS B;  2YKS A;  5EZY E;  2LSK A;  3GMI A;  3QC9 A;  2E5L T;  1YKH B;  2HPL A;  2YEV C;  3PUS A;  3RX6 A;  4CN4 A;  3N9M A;  4NUU A;  3O1I A;  4QXC B;  1VCT A;  1KF6 A;  1D0Y A;  2W63 A;  5ABE A;  4NXM T;  4UVA B;  2KXP B;  2CA5 A;  2W00 A;  2EHO C;  4JI3 T;  2LJL A;  3OYZ A;  3UUN A;  1BR0 A;  1W0A A;  5AQF B;  3RF1 A;  4BJN A;  3K1S A;  4DBQ A;  2JQQ A;  3FB2 A;  4IDO A;  3WAK A;  1Y01 A;  4U2Y A;  3CVR A;  1OED C;  1ZEE A;  3P4S A;  3RYI E;  3E22 E;  2E9X B;  2WP9 A;  3QK6 A;  4O8S A;  2Q9Q A;  4JUY A;  4IE7 A;  2WWU A;  3L39 A;  3X1D A;  4DR1 T;  4EYU A;  1SUM B;  4O4J E;  2R6G F;  5FY0 A;  1LVF A;  5GON E;  3U78 A;  4LMJ A;  4CZZ B;  1WR6 A;  2Y6X A;  2D5U A;  5E0O A;  3MKD A;  4JBW F;  2CMR A;  3MA9 A;  2WCA A;  2YU1 A;  2AXD S;  2L8K A;  3N9P A;  3PV0 F;  1HNX T;  3TLT A;  1W9R A;  2WM9 A;  4OHF A;  5EK2 A;  4A98 A;  4MBQ A;  1E7P A;  2X9X A;  2NW8 A;  3JCF A;  3V5S A;  3UQ4 A;  1OED B;  1YQ4 A;  4DR3 T;  4K0K T;  2AE9 A;  4YSZ A;  2YDR A;  4ILU A;  2CWO A;  1FIO A;  4CXX A;  4YT0 A;  2XQ6 A;  2ZM6 T;  3SFE A;  4JI1 T;  1WYB A;  2UXC T;  4X5T A;  2X0L B;  4H63 V;  2IDO B;  5HEG A;  3ESL A;  2X0Y A;  4DV1 T;  4HN9 A;  4PFO A;  5IYZ E;  3TLU A;  2NWB A;  3L09 A;  1N36 T;  3FZF B;  3CK6 A;  3CWZ B;  4QH4 A;  2XSB A;  2LOP A;  3SWH A;  5LG3 A;  5TAO A;  4IIJ E;  5L3B B;  5FKY A;  2CPT A;  2EHO A;  1IJ5 A;  2BS4 A;  3JAE A;  4O2A E;  2X66 A;  3M65 A;  2YN6 A;  2X67 A;  1G73 A;  3FZM B;  4MFR A;  2KWH A;  4LF4 T;  2CBI A;  3EVY A;  2V5D A;  1NWM X;  3RLF F;  3JAF A;  2X51 A;  3PDY A;  2UU9 T;  3I9W A;  4X20 E;  3KDS E;  5AQQ B;  2X9H A;  2YDS A;  3KVB A;  5LJM A;  4ZHQ E;  3RYH E;  1KK7 A;  3HA4 A;  5L4E A;  3F2E A;  2XY8 B;  4U7I A;  1XZY A;  2LEH A;  3UUM A;  5JDF A;  4H9P C;  2NP9 A;  3UU8 A;  1YQ3 A;  3TLW A;  3N9Q A;  5LXT E;  1UUR A;  3EDV A;  3NWI A;  4TV9 E;  5HXC A;  5AQG B;  5L3G B;  4PJN A;  3OPC A;  3K3O A;  5ABF B;  1B7T A;  5HXR A;  3GN5 B;  4TWH A;  2WB5 A;  4XAX B;  2XPK A;  2XQA A;  2ZM0 A;  2V6Y A;  4LFB T;  5CB4 E;  1HTJ F;  4X65 T;  4PJJ A;  4V1A v;  5FL1 A;  1QUU A;  4UVB B;  2WMO A;  4DV5 T;  3Q5E A;  3P4W A;  2HHH T;  3CIR A;  3C50 A;  3VHL A;  1H7C A;  2V6Y B;  1KNP A;  3ZMV B;  3FZK B;  4U3C A;  5JRC A;  3ZJ1 A; 
#chains in the Genus database with same CATH homology
 4KP3 C;  2V7L A;  5L2L A;  5CA1 E;  2H3R A;  3IF8 B;  4H9N C;  2UXX B;  2QGS A;  3HKD E;  2J1D G;  2MBG A;  2CXD A;  4ADZ A;  5LHI B;  3ETV A;  3LK4 2;  3Q9D A;  4PJL A;  4N78 D;  4O4I E;  4IE6 A;  3ZN0 B;  3MZK B;  5DJQ C;  5JDN A;  5JRC B;  1S94 A;  2E9X D;  1D1B A;  3AVR A;  1D0X A;  3KV5 A;  2PJQ A;  3NZQ A;  4IGU A;  1HG2 A;  1X79 A;  2M67 A;  4ANJ A;  3S4U A;  3CX8 B;  4C91 A;  5CA0 E;  1D1C A;  4UIG A;  2DNX A;  5M4Y A;  4CXY A;  3RKO A;  3PUA A;  4YLH A;  5LHG B;  5HXE A;  1AJ3 A;  5LGN B;  3KBT A;  4HFV A;  4L9I A;  3SS1 A;  5AFU L;  3SOL A;  2D0T A;  1MIW A;  3QUJ A;  1FMV A;  3ZC0 A;  3IBP A;  4PK5 A;  5A1L A;  3C4X A;  3RPU A;  4O4L E;  3ZYM A;  3KV6 A;  4IE4 A;  2L9Q A;  4ZS3 A;  3PTR B;  4IHJ E;  3CPZ A;  2H7O A;  5JR9 C;  1MIY A;  2JMH A;  2NW9 A;  4KBM B;  4TZ4 C;  2KMF A;  2V1D B;  3NZP A;  3PU3 A;  4DVD A;  3C4Z A;  3I0Q A;  1Y64 B;  1CUN A;  1IAP A;  2MYS A;  4UF0 B;  5EK3 A;  2N9D A;  2DHR A;  2N1G A;  4OK0 A;  4OYJ A;  5LBQ B;  2ZM8 A;  4X1Y E;  3R84 B;  3ANW A;  3CX7 B;  2A72 A;  3HKB E;  4DBR A;  4A56 A;  4AKG A;  2Y8D A;  3AVS A;  3K3Q C;  5JH7 E;  2CLY C;  1HCI A;  3VKG A;  2LHR A;  3F31 A;  4GOU A;  5JDQ A;  2KT9 A;  1OWA A;  2HPJ A;  3N2K E;  1O3X A;  2E9X C;  2W61 A;  1QSD A;  3H37 A;  3OJA A;  4HGA A;  1WYC A;  3ETU A;  5JDM A;  3ZEF B;  4AKI A;  4AKH A;  2RP4 A;  2WAU A;  3LBX A;  3JC6 D;  4DND A;  3AA6 B;  5FY1 A;  5FXV A;  4ISS A;  4BJM A;  4E7Z A;  1ZV4 X;  3MK7 C;  4HEA A;  4O2B E;  1UX5 A;  3C64 A;  4AKL A;  2Q9Q C;  4HKA A;  3HL6 A;  3NBX X;  4QKN A;  3ZJ2 A;  4ERR A;  2PFV A;  1VOM A;  5HXH A;  3N5L A;  2ZLY A;  2KLQ A;  3J9X 1;  2K24 A;  3DTO A;  5JDL A;  4ASK A;  2QA7 A;  4ZI7 E;  5H6R B;  2D2S A;  1EZ3 A;  2YU2 A;  4B6X A;  4ZI2 D;  4FJO A;  3Q2M A;  3UT5 E;  3AAI A;  2ACX A;  4F6R C;  4UXN B;  1WLX A;  4PW8 A;  1V9D A;  2JMK A;  3LK3 B;  4GIW A;  3BQI A;  3FBL A;  4H9O C;  2KWI B;  5JRE A;  4X1K E;  2BVL A;  5FY7 A;  5KX5 E;  2CCQ A;  1IZN B;  4J2C A;  4IDZ A;  2LT3 A;  5ADX L;  3OBV E;  5HAX A;  2IC9 A;  3CML A;  4I50 E;  1KNZ A;  5JQG E;  1HFA A;  2B1E A;  2NOX A;  2XTL A;  4JLE A;  1WRD A;  2KZ7 B;  2W0G A;  1D0Z A;  2JPF A;  3GWH A;  3LJC A;  4PJM A;  3O9X A;  2CEA A;  4QXB B;  5FXX A;  3E0Z A;  4BAY B;  4ZS2 A;  4AI6 A;  5DAB A;  2BDE A;  4AKR B;  4TN7 B;  4BA9 A;  2LOS A;  3NRX A;  1MIV A;  3LBX B;  2IC6 A;  4G63 A;  5FXW A;  5JVD E;  5LNK A;  2C5K T;  3HKC E;  2GK9 A;  2V26 A;  4H9Q C;  2Q9Q D;  4TX5 A;  3Q5W A;  4C90 A;  3AA7 B;  4WNK A;  1D1A A;  3PUQ A;  2DWK A;  1LVK A;  4H63 H;  2XUE A;  4YJ2 E;  5HWY A;  2BZB A;  2XHE B;  4P0A A;  2VKD A;  2UXN B;  3LG7 A;  4JEU B;  5LCY A;  2MTQ A;  3U3I A;  2LSG A;  4MAL A;  1MMA A;  3GA8 A;  4OFZ A;  2VL8 A;  1MND A;  2DWG A;  3HR0 A;  5FNV E;  4QX7 B;  3E08 A;  5HWX A;  1HS7 A;  3PUG A;  4X1I E;  4YJ3 E;  3FXE B;  2VKO A;  3AB3 B;  2A3D A;  3W15 B;  3P7I A;  1NAF A;  4QHO A;  5ETW A;  2CXL A;  3PUR A;  3F57 A;  4AQF A;  2ODU A;  1BR2 A;  2V7I A;  2LSI A;  4WBN E;  3IHR A;  3FHN A;  3KVA A;  2LM9 A;  3UFE A;  2MOZ A;  1MMG A;  2SPC A;  4P0B A;  4PK4 A;  3K3N A;  3JC6 C;  1SHZ C;  1S35 A;  5H6Q B;  4UEM A;  2VB6 A;  1SA0 E;  4Z8X A;  2K9A A;  3C98 B;  2ES0 A;  1MMN A;  3ZMZ B;  2XAJ B;  4GYS A;  3A5X A;  2Q9Q B;  4MHC A;  4UEL A;  2XQY A;  5FMN A;  3ONX A;  2E8I A;  2P9B A;  3ZCJ A;  3ZLI A;  3IEE A;  3ZN1 B;  1MMD A;  4I4T E;  4CZZ B;  4EAH A;  3FXD B;  4U74 A;  4YHJ A;  3UUL A;  2ZMA A;  1G8X A;  3O1J A;  2YIN A;  4H9R C;  2CLY B;  2K48 A;  3FBZ A;  4PNI A;  3CX6 B;  5HYA A;  5J2U E;  3ZMT B;  4DMV A;  2W62 A;  4JEH B;  4EYY R;  2XAF B;  5LJN A;  5LA6 E;  4L0R A;  3C4W A;  3J7Y q;  3N9O A;  3KIN B;  4I55 E;  5LG4 A;  3CQC B;  3BK9 A;  4DO0 A;  4EZH A;  1HG5 A;  3GN5 A;  2LHN A;  2LSY A;  4K0U A;  4O4H E;  5LOV E;  4PFP A;  1BR4 A;  2CM0 A;  1HF8 A;  3T8O A;  4GYR A;  2XAS B;  4CI2 B;  4QWN B;  1LKX A;  3WI3 A;  2CXF A;  2OA5 A;  3OKQ A;  5LBM A;  4IST A;  3O1H A;  4EZ4 A;  3C51 A;  1T98 A;  2DI4 A;  2HH7 A;  3HKE E;  2YK0 A;  3ZYL A;  1YW0 A;  2C5I T;  3SRZ A;  3BQK A;  1ZKE A;  4UV8 B;  2ODV A;  2LSJ A;  3UTK A;  5KDM C;  5L3D B;  3L3P A;  1UCU A;  3RYC E;  5FP3 A;  2A2F X;  3N2O A;  2X9Y A;  3DP7 A;  5FXZ A;  4ZI3 D;  3K8P C;  4EIW A;  5JDG A;  2DLR A;  3I0O A;  5LHH B;  1YD8 G;  3H3A A;  5LYJ E;  4PAG A;  3VU7 H;  1OXZ A;  4ZI3 C;  3V5U A;  3ZMU B;  1HX8 A;  5L3E B;  4TUY E;  4I43 B;  3MJX A;  3ZYK A;  3OYX A;  3RC8 A;  5DQW A;  3CQX C;  3ZC1 A;  2V7M A;  1US7 B;  2VKJ A;  3KV4 A;  1MNE A;  4OYK A;  5LP6 E;  4GK5 E;  2IW5 B;  4AXP A;  2G0U A;  4UF0 A;  2KND A;  5EK4 A;  4ZI2 C;  5KMG P;  3EDU A;  3MAC A;  2JRK A;  4FI5 A;  4CQI A;  2IAK A;  4EB6 E;  2L3L A;  2X9W A;  3EUH A;  1UX4 A;  4H9S E;  5L3C B;  1U5P A;  3RRC A;  1E1H B;  2Z6E A;  4IE5 A;  4XZC A;  3N2G E;  1YKE B;  4P09 A;  5DQV A;  4QX8 B;  3LK2 B;  2ZM2 A;  5F3J A;  3I1A A;  1IJ6 A;  3RRW A;  2NW7 A;  4YFS A;  5HXS A;  2DCF A;  4HTE A;  4EXT A;  2NTY A;  3P8C D;  3O4X E;  2D0U A;  3KV9 A;  2JJ9 A;  4XBF B;  2VWA A;  3D0T A;  2RA1 A;  2H7V C;  5BMV E;  2XAQ B;  5F8P A;  4AQG A;  2CE7 A;  5C8Y E;  4MLK A;  3AAE B;  5LGT B;  3N9L A;  4NUV A;  3VKH A;  2WMN A;  3ZPO A;  4UV9 B;  1LRZ A;  3Q5X A;  4G2A A;  3KFW X;  3PE0 A;  4CI3 B;  3NRY A;  3HI2 A;  1U4Q A;  2EHO D;  3B13 A;  3N9N A;  3TKL B;  2PG8 A;  2VAS A;  3AA0 B;  5JDH A;  2NTX A;  2PBI A;  3RC3 A;  4WW0 A;  2VKH A;  4KUM B;  4E7S A;  3DJB A;  4GK0 E;  1FMW A;  4UVC B;  3PU8 A;  5FYM A;  3UUX B;  3AAA B;  3AA1 B;  3ZMS B;  3I9Y A;  2I59 A;  1Z0P A;  1VRB A;  2C0S A;  2V7K A;  3R6N A;  2Y48 B;  3CQG B;  5J1G A;  5JR9 B;  5L3F B;  2WBL A;  2XAH B;  1ZHC A;  2X68 A;  1FEW A;  4CI1 B;  4DMW A;  3ANW B;  4EOZ B;  4AQF C;  1BR1 A;  4L5G A;  4PK6 A;  5JR9 A;  4QXH B;  2E9X A;  4HE8 A;  4M1P A;  2KIN B;  5LGU B;  2XAG B;  4KMC A;  3RYF E;  2CWY A;  2K5B B;  4IE0 A;  2VK9 A;  4U72 A;  2BVM A;  3RH3 A;  3CKD A;  3B57 A;  4CXW A;  2LE8 A;  2C5J A;  2V7J A;  2N2N A;  3ZCI A;  2EHO B;  2WSS V;  3WAJ A;  4TV8 E;  5J2T E;  3MXZ A;  3LFM A;  3BQL A;  3KBU A;  4ZOL E;  4WBO A;  5IHY A;  5EZY E;  2LSK A;  3GMI A;  3QC9 A;  1YKH B;  2HPL A;  2YEV C;  3PUS A;  3RX6 A;  3N9M A;  4NUU A;  3O1I A;  4QXC B;  1D0Y A;  2W63 A;  4UVA B;  2KXP B;  2CA5 A;  2W00 A;  2EHO C;  2LJL A;  3OYZ A;  3UUN A;  1BR0 A;  4BJN A;  4DBQ A;  2JQQ A;  3FB2 A;  3WAK A;  3CVR A;  1ZEE A;  3RYI E;  3E22 E;  2E9X B;  3QK6 A;  4O8S A;  2Q9Q A;  4JUY A;  4IE7 A;  2WWU A;  4EYU A;  4O4J E;  3U78 A;  5FY0 A;  5GON E;  1LVF A;  1WR6 A;  2Y6X A;  2D5U A;  5E0O A;  3MKD A;  2CMR A;  3MA9 A;  2YU1 A;  3N9P A;  2L8K A;  2WM9 A;  4OHF A;  5EK2 A;  4MBQ A;  2X9X A;  2NW8 A;  3V5S A;  4ILU A;  2CWO A;  1FIO A;  4CXX A;  1WYB A;  2X0L B;  4H63 V;  3ESL A;  4HN9 A;  4PFO A;  5IYZ E;  2NWB A;  3L09 A;  3CWZ B;  2LOP A;  3SWH A;  5TAO A;  4IIJ E;  5L3B B;  2EHO A;  1IJ5 A;  4O2A E;  2X66 A;  3M65 A;  2X67 A;  1G73 A;  4MFR A;  2KWH A;  3EVY A;  1NWM X;  3PDY A;  2X51 A;  3I9W A;  4X20 E;  3KDS E;  2X9H A;  5LJM A;  3KVB A;  4ZHQ E;  3RYH E;  1KK7 A;  3HA4 A;  3F2E A;  2LEH A;  3UUM A;  5JDF A;  4H9P C;  2NP9 A;  3N9Q A;  5LXT E;  3EDV A;  5L3G B;  4TV9 E;  5HXC A;  4PJN A;  3K3O A;  1B7T A;  5HXR A;  3GN5 B;  4XAX B;  2ZM0 A;  5CB4 E;  1HTJ F;  4PJJ A;  4V1A v;  1QUU A;  4UVB B;  2WMO A;  3VHL A;  3C50 A;  1H7C A;  3ZMV B;  5JRC A;  3ZJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...