3T1HT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1hT00
1IBMT 1N32T 1HNWT 2UUAT 1FJGT 4JV5T 1XNRT 4JI1T 4LF7T 4X62T 2UXCT 4LFAT 2UU9T 1N33T 4NXNT 4LFBT 4DV4T 4JI3T 4X65T 1IBLT 1XMQT 4YHHT 4DV0T 4B3MT 1HNXT 4DUZT 4KHPT 1XNQT 4DR1T 2UUBT 4DUYT 3T1YT 4JI7T 4GKKT 4DR2T 1N36T 3T1HT 4DV5T 4JI4T 4LF8T 4DV1T 4JI2T 2ZM6T 4LF5T 4LF4T 5BR8T 4DR6T 1N34T 4DV7T 4LF9T 1XMOT 5LMNT 4DV6T 4K0KT 4DV2T 4JI6T 1I94T 4X64T 4B3TT 2F4VT 4OX9T 2VQET 4DV3T 4B3ST 4YY3T 4X66T 2E5LT 3OTOT 2UXDT 1J5ET 2UXBT 4GKJT 4LF6T 2UUCT 4LFCT 4DR4T 4DR7T 4DR3T 4DR5T 1IBKT 4AQYT 2HHHT 4B3RT 4NXMT 1HR0T 5IWAT 4JI5T 4JI0T 2VQFT 1HNZT 4JYAT 5LMUT 4JI8T
chains in the Genus database with same CATH superfamily
3SWHA 3FB2A 1IBMT 4WW0A 1N32T 5ABEA 2CBJA 4C91A 2LSGA 2QRXA 4U7YA 3H37A 4M1PA 3VRAA 1WRDA 3AVRA 4HKAA 1FJGT 3I9YA 3PJAJ 5LGNB 3AEBA 3ZMSB 5BMVE 3IF8B 5HEOA 2WWVA 2W67A 3LSVA 4EZHA 5AQMB 2V7JA 3FBZA 5AQHB 5AQJB 3UU6A 5HXSA 2KWIB 5F8PA 4LF7T 2WDRA 1J5WA 3Q5XA 2KSRA 5ABHA 2UXCT 3FXEB 2V6YB 4IDNA 5EZYE 2XM2A 3JAFA 3UU8A 3RF1A 4EOZB 4ZI2C 3I0QA 4GIWA 5HCMA 1ZKEA 2X66A 2LT3A 4H9OC 3B13A 5HEHA 3L3PA 3ZT6A 4ZI2D 3F31A 3VRBA 2XAGB 2XM1A 2JPFA 3I1AA 4E7SA 4DV4T 4JI3T 2ZM0A 2XUEA 2E9XC 2BKOA 1W9RA 2LSKA 5CJ5A 4IIJE 3C50A 1IJ5A 3NWIA 4IL4A 1MNDA 4YHHT 4DV0T 1MIYA 5FNVE 4DUZT 4EEBA 3UU5A 2LOPA 1MMNA 3ONXA 2UXXB 2KMFA 3Q5WA 4KBMB 3RYIE 3K3OA 3UFEA 3VHLA 3FZFB 3NRXA 3ZYMA 2RPAA 2CLYB 2Y48B 3UU3A 4JI7T 2C5JA 4GYSA 2X68A 4B6XA 2C5IT 1UGOA 2M6BA 1G8XA 5JDNA 2X9XA 2W62A 1KEYA 1MMGA 4JI2T 4DMWA 2CBIA 2E8IA 5FY0A 2ZM6T 4PJNA 4P09A 4YTNA 4QH4A 5JR9B 4MFRA 2IC9A 4QH1A 4IDQA 3AB3B 5KXJA 4FI5A 3X1DA 2D2SA 2YU2A 4I55E 4ZS2A 5LP6E 1X79A 3CQXC 2KZ7B 5BR8T 3TLTA 3AEGA 4DR6T 2QYWA 3T8OA 3K3QC 4MBQA 3P7IA 1ZV4X 3A8YC 2IHR1 5EK4A 4UV9B 4O4JE 1M62A 4PK6A 5JR9A 4ILUA 4EYYR 5FP3A 1D1BA 4DV6T 3O9XA 3PJAA 4DV2T 2BZBA 2BBJA 1J1JA 3RH3A 2PFVA 3QC9A 4KHZF 1D0YA 2K9AA 3D0TA 1US7B 3EVYA 3N9QA 5LYJE 3Q5DA 4XZCA 2V7LA 5LHGB 2F4VT 3V5UA 3JADA 1W09A 2W63A 5AQQB 4COFA 4H9QC 3PUZF 3EDUA 3KVBA 2J62A 3N9PA 2E9XA 3DJBA 3EABA 4Z90A 3ZPOA 4CQIA 3L09A 4HFVA 3B57A 4IE6A 5JDFA 2KWHA 4AKIA 1Y01A 5ETWA 1NAFA 4AKLA 3OTOT 2MYSA 3N9MA 1Y64B 5AQIB 4ASKA 2UXDT 5JDLA 1JNZA 4CXXA 5LG4A 2MOZA 2UXBT 2NR4A 4YXDA 4NUVA 4I43B 2K3WA 3MA9A 4QKNA 5A1LA 4GKJT 1MMAA 3KV6A 2X9YA 3AE5A 3H3MA 4NIQA 2BG9C 2IAKA 4F6RC 4DR4T 3N2OA 2VWAA 2N2NA 2VASA 4DR7T 3ESLA 3L8RA 5E0OA 5HAXA 3UUBA 3ZMTB 4DR5T 1OWAA 4BJNA 3WAJA 4B3RT 2HHHT 3P4RA 2W66A 2VB6A 3HKBE 2PJQA 1UK5A 3P50A 2QVAA 1OEDE 4J2CA 2H89A 3SFEA 4ZOLE 4G63A 2V6YA 3SRZA 5HEGA 3GN5B 2FJBA 3HKEE 1HR0T 4O4IE 4NXMT 3UQ4A 4HEAA 4QXCB 4ZS3A 2NW8A 5JREA 3R6NA 2VQFT 2J4GA 1VCSA 1YQ4A 5J1GA 3UQ7A 4JBWF 2FJDA 4ILCA 4U7IA 4DNDA 2BS4A 2L3LA 2XHEB 4LMKA 2KLQA 3ZKRA 5JDGA 4H9NC 4JYAT 3FZHB 4HWCA 2WS3A 1CHUA 3MJXA 2LLYA 3AAIA 1KFYA 5LBQB 1FMWA 3RC3A 1W0AA 1B7TA 5HXCA 3TLWA 1I94T 1BR0A 1T98A 2LRLA 3QB5A 4IDOA 3CKDA 3FHNA 4GYRA 4UVCB 3JAEA 3BQIA 3OJAA 1SE7A 2YDQA 3KV4A 5FY7A 5L3BB 2X67A 2XASB 3UUMA 2IDOB 1LRZA 1XNRT 2CWYA 4TWFA 2NW9A 1E7PA 4AQFC 4PJJA 4DBQA 3B5MA 4L9IA 3N2KE 2CCQA 5L3DB 2LHNA 1NEKA 1SHZC 4ISTA 2UU9T 4AKHA 2D5UA 1KNRA 2AE9A 4MLKA 2CRBA 3ZYLA 5CA1E 5KMGP 3AEAA 1OEDA 4P0AA 2FJEA 4I4TE 4I50E 2LHRA 1JNRA 4HE8A 5KDMC 2WWUA 1UURA 5AQPB 1YQ3A 2ODUA 2V7MA 1YXRA 2YEVC 2XQ4A 2ZMAA 5HXEA 5JRCB 1G73A 2OV9A 4FJOA 5AQOB 2NTXA 2YDRA 1QSDA 3CK6A 2MPKA 5FL0A 5IHYA 4EIWA 4TWHA 2XAHB 3AA1B 4H9SE 4CI1B 3KV5A 2ES0A 4UIGA 3O1JA 3ZMUB 2DLRA 4ZI3D 3OPCA 1OEDB 2H3RA 2XQ8A 4ZXLA 3RIAA 4YSZA 1LKXA 4ZZBA 3EAMA 4K0UA 4WBOA 3LDQB 1CUNA 3P4SA 4PW8A 3NKZA 3R84B 3ZLIA 4O4LE 1MIVA 2LRKA 4JI4T 4LF8T 2JJ9A 1VRBA 5DQWA 5LBMA 4AIUA 4LF5T 1VCTA 2XQ7A 2XTLA 4TV8E 3KDSE 4U31A 5FXXA 3ETUA 5AQRB 3N2GE 2EHOB 2HH7A 2LJLA 2NWBA 3QUJA 5LGTB 2WMOA 1I6ZA 2XY8B 3PUWF 5IYZE 4CZZB 2OLTA 2SPCA 3WAKA 1N34T 2VURA 3H3AA 4PK5A 4YJ2E 2LOSA 2D9DA 5CGMA 5LOVE 1IZNB 1WLXA 3AEEA 3HKCE 3PUGA 3PUVF 2VKJA 3RIFA 2XAJB 3ANWA 2ZLYA 4L0RA 3MKDA 1Z0PA 2V5DA 5LMNT 1IBLT 5F5WA 4P0BA 4K0KT 1WYCA 4IE4A 2WZIA 2EHOC 1X9BA 4JI6T 3RIUA 2MAWA 2JRKA 3RYHE 4B3TT 2HN1A 4MALA 5EK2A 4OX9T 2KINB 4HFDA 5C3JA 2JQ9A 4U74A 3RI5A 3AE8A 4DV3T 1VOMA 2JQHA 2X0HA 3LK2B 3N5LA 5HEJA 2Z6EA 1E1HB 2DL1A 4IL9A 4ERRA 2BS3A 3CMLA 3KBTA 2V26A 2DCFA 3RC8A 3KBUA 3KFWX 2E5LT 1YD8G 3AECA 3C64A 4TNVA 4BA9A 2LSJA 4OK0A 3O4XE 2NOXA 3LK42 4IT4A 3ZN0B 5LA6E 4ISSA 4OYJA 2E2AA 2WMNA 3TLVA 2RP4A 2W61A 3CPZA 3HR0A 3O1HA 4KUMB 2YU1A 5ABFB 3FZKB 4UF0B 3RRCA 3RHWA 1KNZA 1XWMA 4LMLA 4QH5A 3GWHA 5J0ZA 4LF6T 3I9WA 4QWNB 4IE0A 2XQ3A 3ZCIA 5EK3A 3BQKA 4TV9E 4EXTA 2Y8DA 3AE2A 3E0ZA 4O2AE 3UFGA 4AISA 1U5PA 4AXPA 4O2BE 3EDVA 4KMCA 4KP3C 5AQUB 5FXWA 3FXDB 3AE4A 4IHJE 3ZT7A 3C4WA 2VL8A 5AQSB 5CB4E 1LVFA 5L4EA 5AQTB 4C90A 2RA1A 2MTQA 1S35A 3ZC0A 4JI0T 2VKDA 3BQLA 3RYFE 4CN1A 5C2TA 2EHOD 4UVBB 2IW5B 4EB6E 4ZEYA 4U2YA 2LM2A 2XZEA 2CXFA 1HNZT 2JMKA 1YKHB 3AEFA 3MACA 3ZJ1A 3MXZA 5LHHB 3F2EA 2H7OA 1SUMB 1LVKA 2VVNA 1ZP0A 2WAUA 2UXNB 4IREA 2EHOA 4UEMA 3UUNA 5AFUL 3V5SA 4JI8T 5L3EB 1BR4A 1WCRA 2M6IA 2PBIA 3PUSA 1D0ZA 2ODVA 3PUYF 5JDMA 2UUAT 1HNWT 2XQYA 3PUQA 2YDSA 4EEDA 2IIUA 2DI4A 5LG3A 5DABA 3AA6B 3TLUA 1WR0A 1NENA 4X5TA 4X1KE 4YFSA 5JR9C 3I0OA 5JQGE 2WZHA 2Q9QB 2V6XA 5ABGA 3NRYA 4YSYA 2FUPA 4X62T 4H63H 3ZSSA 2FJAA 1KK7A 2CXLA 4H9RC 2PTFA 2WQYA 4LFAT 5FY1A 2LEHA 3ZSTA 4CI2B 2VK9A 5J2UE 4PNIA 2XQ5A 2A2FX 2L9QA 3AXJA 1KF6A 4MHCA 3CQGB 4NXNT 4ADZA 2Q9QA 2XQ6A 1UCUA 4LMJA 4LFBT 2LE8A 2OA5A 1UX4A 5AQLB 1ZOYA 3EI0A 3M65A 3TLSA 5L3CB 1WFDA 3JCFA 4Q25A 1D1CA 4B3MT 1E2AA 1HNXT 4KHPT 3U3IA 5FYMA 4ZI3C 4AKRB 3Q2MA 2YINA 1GQEA 1W0BA 2I0MA 3Q9DA 4IE7A 4UF0A 4ZHQE 2VKHA 4JEHB 1XMQT 2QA7A 3N9LA 3OYZA 2YOEA 5M4YA 2ZM8A 3IHRA 5AQKB 4UV8B 2R6GF 2XJ7A 4HFHA 3T1YT 2D0UA 3ABVA 4GKKT 3RRWA 3UT5E 2ACXA 3A5XA 4PJMA 4EZ4A 5F3JA 4DV1T 3T1HT 4X1IE 4L5GA 2YK0A 3PU8A 5L3FB 1V9DA 1O3XA 2CHNA 5AQNB 3RX6A 2BKPA 5LJMA 3GA8A 1T8BA 3ZT5A 2A3DA 3M3ZB 2W4XA 3UU4A 3P8CD 5L47A 3VKHA 2BBHA 2BG9B 4Z8XA 1UX5A 2QGSA 2B76A 4OHFA 4DV7T 3LBXA 4E7ZA 3AA7B 2N9DA 3HL6A 1BR1A 3AE9A 5FMNA 2AXDS 1YKEB 5HCJA 2LKGA 4ANJA 5ADXL 2C0SA 5J2TE 2D0TA 3K3NA 3JC6C 1HF8A 2E9XB 2M67A 3A7MA 3PDYA 3JC6D 4G2AA 4H63V 4HTEA 4QXBB 4UXNB 3UULA 5CA0E 3PURA 1AJ3A 4TX5A 4X64T 2J47A 4UVAB 4WNKA 2CM0A 4ILAA 4EYUA 3CX7B 3E22E 4TZ4C 4XAXB 4YHJA 5LB7B 1XDOA 2V1DB 2LSYA 3PV0F 5DQVA 3W15B 5HXHA 4B3ST 1WR6A 2X9HA 4PFOA 5LNKA 4X66T 3CQCB 4TUYE 2WU5A 4V1Av 2CLYC 3AE1A 3ZCJA 3QOFA 3PUAA 3AA0B 1DU2A 3FBLA 1MMDA 4GK5E 2CXDA 1L0VA 1EZ3A 3ETVA 4X20E 2Y6XA 4UR9A 1J5ET 2KT9A 2V7KA 5GONE 2XQAA 4KX6A 5LCYA 2X51A 3UUXB 4CXWA 2VVSA 3PE0A 2XSBA 5FKYA 3P4QA 4WYVA 4O4HE 2I6HA 2PG8A 1T7SA 4PAGA 4U2ZA 4XBFB 3VR9A 3VU7H 5H6RB 3ZMZB 3ANWB 2YKSA 3Q5EA 5JRCA 2LSIA 5L4HA 4DVDA 4ZI7E 2BVMA 3LFMA 5JTGA 4IDPA 1QUUA 4PK4A 2V5CA 3AXJB 2WDVA 4X1YE 4EV6A 4CXYA 4AQYT 4YJ3E 2X0LB 3IEEA 2BS2A 2XPKA 3TKLB 5JVDE 5FL1A 2GK9A 3GMIA 1KNPA 5JDHA 4JI5T 4AI6A 5AQGB 2WBLA 3AAAB 3F57A 4TNWA 3RKGA 1XDPA 1XZYA 3C4XA 4GOUA 2XQ9A 4IDZA 2C5KT 3ZC1A 5LJNA 2XAFB 1D0XA 1SA0E 2DWKA 4KI0F 4F8HA 2X9WA 1ZHCA 4EAHA 2ACZA 2CPTA 3CX8B 3FZMB 3HI2A 1FIOA 4N78D 4QX8B 5HXRA 3SS1A 1H7CA 1YW0A 3KVAA 4A5XA 4WZXA 4EGWA 3J7Yq 2BDEA 3RGLA 4JV5T 3L39A 4UELA 4JI1T 4DBRA 3ZEFB 2BG9E 1HFAA 4TN7B 3C98B 1HG5A 4PFPA 4HFBA 2JMHA 5H6QB 1HX1B 5IUXA 1BR2A 3P4PA 4HFCA 3GN5A 1UUSA 4QXHB 5TAOA 4BJMA 5L3GB 2KNDA 3OVUA 3S4UA 2B1EA 3ONJA 5ABFA 1N33T 4BAYB 2L8KA 4HFEA 5C8YE 3AEDA 3VR8A 2Q9QD 2WSSV 3EHZA 1U4QA 2CE7A 2HPLA 4X65T 3P4WA 2DWGA 3RIUC 3CWZB 1NWMX 3U78A 3N9OA 2WCAA 4Z91A 2XSAA 1QLBA 3EUHA 4HFIA 3KV9A 2E9XD 4YT0A 5LGUB 5L2LA 1XNQT 4A98A 1MNEA 3BK9A 1WYBA 3J9X1 3RLFF 3SOLA 3UTKA 2BKNA 2KXPB 3MZKB 2J1DG 4P1NA 2DNXA 5FVKA 2A9UA 4HGAA 2UUBT 3IA3A 2CA5A 2WP9A 3FZLB 2H7VC 3QK6A 3ZMVB 4YTPA 5JDQA 4DUYT 4DR2T 1ZEEA 3HA4A 2IC6A 4DV5T 1MIWA 2P9BA 2A72A 2N1GA 3RQUA 2K5BB 2IUBA 4LF4T 1D1AA 3PU3A 3QB5K 3AE7A 4CN4A 4U72A 5LHIB 4JUYA 2DHRA 4ZZCA 4NPPA 2K48A 2VL0A 2BVLA 2V7IA 3LG7A 5DJQC 4AQFA 4YLHA 3CVRA 2BG9A 2ZM2A 1HS7A 3IBPA 1Z8UA 4DMVA 3QNUA 4HWIB 3NZQA 2G0UA 2H88A 4OFZA 2W2UA 5FVLA 3RKOA 5HYAA 2CHOA 3NVOA 2E5VA 4LF9T 2W0GA 2VKOA 1XMOT 2W00A 5LXTE 3G06A 3OKQA 4U3CA 5HEUA 3OBVE 3PTRB 1N36T 4GK0E 3LK3B 1IJ6A 1S94A 4AKGA 2YN6A 2VQET 1M7KA 4WBNE 4HWFA 1HTJF 1OEDC 4YY3T 1FEWA 1T72A 3DTOA 5FXVA 2IMLA 3NBXX 2X0YA 1FMVA 2WU2A 4H9PC 4QHOA 3AE3A 2NW7A 4DR1T 3LBXB 4O8SA 2LM9A 3KINB 4IE5A 2V8SV 4NUUA 4JLEA 3LJCA 2WY2A 1HX8A 3ZJ2A 3HKDE 2WM9A 3AE6A 2CEAA 3PUXF 4HN9A 4A97A 4IGUA 2HN2A 4JEUB 5AQFB 3RPUA 4OYKA 3CX6B 3NZPA 4DIDB 3VKGA 3O1IA 2UUCT 2I59A 4LFCT 2FBWA 3SFDA 3AVSA 2Q9QC 3N9NA 4PJLA 1IAPA 4CN6A 2CMRA 3ONLC 3ZN1B 4DR3T 5FXZA 3K1SA 1R8IA 5KX5E 1HCIA 1OXZA 4TWDA 5HWXA 1IBKT 3C51A 3WI3A 2JQQA 2JIWA 3K8PC 2NTYA 4U33A 5HWYA 5CFBA 5JH7E 2K24A 3RYCE 4HWDA 3CIRA 4YSXA 4I0UA 3RQWA 4HWHA 2XAQB 3ZYKA 4AQGA 5AQVB 5IWAT 3E08A 2MBGA 4A56A 4DO0A 3C4ZA 3AAEB 2LKHA 3DP7A 4YTMA 4CI3B 2NP9A 3OYXA 4QX7B 1HG2A 2CWOA 2JQKA 2WB5A 2WDQA 4ILBA 5LMUT 3MK7C 2HPJA
chains in the Genus database with same CATH topology
1IBMT 1N32T 1HNWT 2UUAT 1FJGT 4JV5T 1XNRT 4JI1T 4LF7T 4X62T 2UXCT 4LFAT 2UU9T 1N33T 4NXNT 4LFBT 4DV4T 4JI3T 4X65T 1IBLT 1XMQT 4YHHT 4DV0T 4B3MT 1HNXT 4DUZT 4KHPT 1XNQT 4DR1T 2UUBT 4DUYT 3T1YT 4JI7T 4GKKT 4DR2T 1N36T 3T1HT 4DV5T 4JI4T 4LF8T 4DV1T 4JI2T 2ZM6T 4LF5T 4LF4T 5BR8T 4DR6T 1N34T 4DV7T 4LF9T 1XMOT 5LMNT 4DV6T 4K0KT 4DV2T 4JI6T 1I94T 4X64T 4B3TT 2F4VT 4OX9T 2VQET 4DV3T 4B3ST 4YY3T 4X66T 2E5LT 3OTOT 2UXDT 1J5ET 2UXBT 4GKJT 4LF6T 2UUCT 4LFCT 4DR4T 4DR7T 4DR3T 4DR5T 1IBKT 4AQYT 2HHHT 4B3RT 4NXMT 1HR0T 5IWAT 4JI5T 4JI0T 2VQFT 1HNZT 4JYAT 5LMUT 4JI8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM T;  1N32 T;  1HNW T;  2UUA T;  1FJG T;  4JV5 T;  1XNR T;  4JI1 T;  4LF7 T;  4X62 T;  2UXC T;  4LFA T;  2UU9 T;  1N33 T;  4NXN T;  4LFB T;  4DV4 T;  4JI3 T;  4X65 T;  1IBL T;  1XMQ T;  4YHH T;  4DV0 T;  4B3M T;  1HNX T;  4DUZ T;  4KHP T;  1XNQ T;  4DR1 T;  2UUB T;  4DUY T;  3T1Y T;  4JI7 T;  4GKK T;  4DR2 T;  1N36 T;  3T1H T;  4DV5 T;  4JI4 T;  4LF8 T;  4DV1 T;  4JI2 T;  2ZM6 T;  4LF5 T;  4LF4 T;  5BR8 T;  4DR6 T;  1N34 T;  4DV7 T;  4LF9 T;  1XMO T;  5LMN T;  4DV6 T;  4K0K T;  4DV2 T;  4JI6 T;  1I94 T;  4X64 T;  4B3T T;  2F4V T;  4OX9 T;  2VQE T;  4DV3 T;  4B3S T;  4YY3 T;  4X66 T;  2E5L T;  3OTO T;  2UXD T;  1J5E T;  2UXB T;  4GKJ T;  4LF6 T;  2UUC T;  4LFC T;  4DR4 T;  4DR7 T;  4DR3 T;  4DR5 T;  1IBK T;  4AQY T;  2HHH T;  4B3R T;  4NXM T;  1HR0 T;  5IWA T;  4JI5 T;  4JI0 T;  2VQF T;  1HNZ T;  4JYA T;  5LMU T;  4JI8 T; 
#chains in the Genus database with same CATH topology
 3SWH A;  3FB2 A;  1IBM T;  4WW0 A;  1N32 T;  5ABE A;  2CBJ A;  4C91 A;  2LSG A;  2QRX A;  4U7Y A;  3H37 A;  4M1P A;  3VRA A;  1WRD A;  3AVR A;  4HKA A;  1FJG T;  3I9Y A;  3PJA J;  5LGN B;  3AEB A;  3ZMS B;  5BMV E;  3IF8 B;  5HEO A;  2WWV A;  2W67 A;  3LSV A;  4EZH A;  5AQM B;  2V7J A;  3FBZ A;  5AQH B;  5AQJ B;  3UU6 A;  5HXS A;  2KWI B;  5F8P A;  4LF7 T;  2WDR A;  1J5W A;  3Q5X A;  2KSR A;  5ABH A;  2UXC T;  3FXE B;  2V6Y B;  4IDN A;  5EZY E;  2XM2 A;  3JAF A;  3UU8 A;  3RF1 A;  4EOZ B;  4ZI2 C;  3I0Q A;  4GIW A;  5HCM A;  1ZKE A;  2X66 A;  2LT3 A;  4H9O C;  3B13 A;  5HEH A;  3L3P A;  3ZT6 A;  4ZI2 D;  3F31 A;  3VRB A;  2XAG B;  2XM1 A;  2JPF A;  3I1A A;  4E7S A;  4DV4 T;  4JI3 T;  2ZM0 A;  2XUE A;  2E9X C;  2BKO A;  1W9R A;  2LSK A;  5CJ5 A;  4IIJ E;  3C50 A;  1IJ5 A;  3NWI A;  4IL4 A;  1MND A;  4YHH T;  4DV0 T;  1MIY A;  5FNV E;  4DUZ T;  4EEB A;  3UU5 A;  2LOP A;  1MMN A;  3ONX A;  2UXX B;  2KMF A;  3Q5W A;  4KBM B;  3RYI E;  3K3O A;  3UFE A;  3VHL A;  3FZF B;  3NRX A;  3ZYM A;  2RPA A;  2CLY B;  2Y48 B;  3UU3 A;  4JI7 T;  2C5J A;  4GYS A;  2X68 A;  4B6X A;  2C5I T;  1UGO A;  2M6B A;  1G8X A;  5JDN A;  2X9X A;  2W62 A;  1KEY A;  1MMG A;  4JI2 T;  4DMW A;  2CBI A;  2E8I A;  5FY0 A;  2ZM6 T;  4PJN A;  4P09 A;  4YTN A;  4QH4 A;  5JR9 B;  4MFR A;  2IC9 A;  4QH1 A;  4IDQ A;  3AB3 B;  5KXJ A;  4FI5 A;  3X1D A;  2D2S A;  2YU2 A;  4I55 E;  4ZS2 A;  5LP6 E;  1X79 A;  3CQX C;  2KZ7 B;  5BR8 T;  3TLT A;  3AEG A;  4DR6 T;  2QYW A;  3T8O A;  3K3Q C;  4MBQ A;  3P7I A;  1ZV4 X;  3A8Y C;  2IHR 1;  5EK4 A;  4UV9 B;  4O4J E;  1M62 A;  4PK6 A;  5JR9 A;  4ILU A;  4EYY R;  5FP3 A;  1D1B A;  4DV6 T;  3O9X A;  3PJA A;  4DV2 T;  2BZB A;  2BBJ A;  1J1J A;  3RH3 A;  2PFV A;  3QC9 A;  4KHZ F;  1D0Y A;  2K9A A;  3D0T A;  1US7 B;  3EVY A;  3N9Q A;  5LYJ E;  3Q5D A;  4XZC A;  2V7L A;  5LHG B;  2F4V T;  3V5U A;  3JAD A;  1W09 A;  2W63 A;  5AQQ B;  4COF A;  4H9Q C;  3PUZ F;  3EDU A;  3KVB A;  2J62 A;  3N9P A;  2E9X A;  3DJB A;  3EAB A;  4Z90 A;  3ZPO A;  4CQI A;  3L09 A;  4HFV A;  3B57 A;  4IE6 A;  5JDF A;  2KWH A;  4AKI A;  1Y01 A;  5ETW A;  1NAF A;  4AKL A;  3OTO T;  2MYS A;  3N9M A;  1Y64 B;  5AQI B;  4ASK A;  2UXD T;  5JDL A;  1JNZ A;  4CXX A;  5LG4 A;  2MOZ A;  2UXB T;  2NR4 A;  4YXD A;  4NUV A;  4I43 B;  2K3W A;  3MA9 A;  4QKN A;  5A1L A;  4GKJ T;  1MMA A;  3KV6 A;  2X9Y A;  3AE5 A;  3H3M A;  4NIQ A;  2BG9 C;  2IAK A;  4F6R C;  4DR4 T;  3N2O A;  2VWA A;  2N2N A;  2VAS A;  4DR7 T;  3ESL A;  3L8R A;  5E0O A;  5HAX A;  3UUB A;  3ZMT B;  4DR5 T;  1OWA A;  4BJN A;  3WAJ A;  4B3R T;  2HHH T;  3P4R A;  2W66 A;  2VB6 A;  3HKB E;  2PJQ A;  1UK5 A;  3P50 A;  2QVA A;  1OED E;  4J2C A;  2H89 A;  3SFE A;  4ZOL E;  4G63 A;  2V6Y A;  3SRZ A;  5HEG A;  3GN5 B;  2FJB A;  3HKE E;  1HR0 T;  4O4I E;  4NXM T;  3UQ4 A;  4HEA A;  4QXC B;  4ZS3 A;  2NW8 A;  5JRE A;  3R6N A;  2VQF T;  2J4G A;  1VCS A;  1YQ4 A;  5J1G A;  3UQ7 A;  4JBW F;  2FJD A;  4ILC A;  4U7I A;  4DND A;  2BS4 A;  2L3L A;  2XHE B;  4LMK A;  2KLQ A;  3ZKR A;  5JDG A;  4H9N C;  4JYA T;  3FZH B;  4HWC A;  2WS3 A;  1CHU A;  3MJX A;  2LLY A;  3AAI A;  1KFY A;  5LBQ B;  1FMW A;  3RC3 A;  1W0A A;  1B7T A;  5HXC A;  3TLW A;  1I94 T;  1BR0 A;  1T98 A;  2LRL A;  3QB5 A;  4IDO A;  3CKD A;  3FHN A;  4GYR A;  4UVC B;  3JAE A;  3BQI A;  3OJA A;  1SE7 A;  2YDQ A;  3KV4 A;  5FY7 A;  5L3B B;  2X67 A;  2XAS B;  3UUM A;  2IDO B;  1LRZ A;  1XNR T;  2CWY A;  4TWF A;  2NW9 A;  1E7P A;  4AQF C;  4PJJ A;  4DBQ A;  3B5M A;  4L9I A;  3N2K E;  2CCQ A;  5L3D B;  2LHN A;  1NEK A;  1SHZ C;  4IST A;  2UU9 T;  4AKH A;  2D5U A;  1KNR A;  2AE9 A;  4MLK A;  2CRB A;  3ZYL A;  5CA1 E;  5KMG P;  3AEA A;  1OED A;  4P0A A;  2FJE A;  4I4T E;  4I50 E;  2LHR A;  1JNR A;  4HE8 A;  5KDM C;  2WWU A;  1UUR A;  5AQP B;  1YQ3 A;  2ODU A;  2V7M A;  1YXR A;  2YEV C;  2XQ4 A;  2ZMA A;  5HXE A;  5JRC B;  1G73 A;  2OV9 A;  4FJO A;  5AQO B;  2NTX A;  2YDR A;  1QSD A;  3CK6 A;  2MPK A;  5FL0 A;  5IHY A;  4EIW A;  4TWH A;  2XAH B;  3AA1 B;  4H9S E;  4CI1 B;  3KV5 A;  2ES0 A;  4UIG A;  3O1J A;  3ZMU B;  2DLR A;  4ZI3 D;  3OPC A;  1OED B;  2H3R A;  2XQ8 A;  4ZXL A;  3RIA A;  4YSZ A;  1LKX A;  4ZZB A;  3EAM A;  4K0U A;  4WBO A;  3LDQ B;  1CUN A;  3P4S A;  4PW8 A;  3NKZ A;  3R84 B;  3ZLI A;  4O4L E;  1MIV A;  2LRK A;  4JI4 T;  4LF8 T;  2JJ9 A;  1VRB A;  5DQW A;  5LBM A;  4AIU A;  4LF5 T;  1VCT A;  2XQ7 A;  2XTL A;  4TV8 E;  3KDS E;  4U31 A;  5FXX A;  3ETU A;  5AQR B;  3N2G E;  2EHO B;  2HH7 A;  2LJL A;  2NWB A;  3QUJ A;  5LGT B;  2WMO A;  1I6Z A;  2XY8 B;  3PUW F;  5IYZ E;  4CZZ B;  2OLT A;  2SPC A;  3WAK A;  1N34 T;  2VUR A;  3H3A A;  4PK5 A;  4YJ2 E;  2LOS A;  2D9D A;  5CGM A;  5LOV E;  1IZN B;  1WLX A;  3AEE A;  3HKC E;  3PUG A;  3PUV F;  2VKJ A;  3RIF A;  2XAJ B;  3ANW A;  2ZLY A;  4L0R A;  3MKD A;  1Z0P A;  2V5D A;  5LMN T;  1IBL T;  5F5W A;  4P0B A;  4K0K T;  1WYC A;  4IE4 A;  2WZI A;  2EHO C;  1X9B A;  4JI6 T;  3RIU A;  2MAW A;  2JRK A;  3RYH E;  4B3T T;  2HN1 A;  4MAL A;  5EK2 A;  4OX9 T;  2KIN B;  4HFD A;  5C3J A;  2JQ9 A;  4U74 A;  3RI5 A;  3AE8 A;  4DV3 T;  1VOM A;  2JQH A;  2X0H A;  3LK2 B;  3N5L A;  5HEJ A;  2Z6E A;  1E1H B;  2DL1 A;  4IL9 A;  4ERR A;  2BS3 A;  3CML A;  3KBT A;  2V26 A;  2DCF A;  3RC8 A;  3KBU A;  3KFW X;  2E5L T;  1YD8 G;  3AEC A;  3C64 A;  4TNV A;  4BA9 A;  2LSJ A;  4OK0 A;  3O4X E;  2NOX A;  3LK4 2;  4IT4 A;  3ZN0 B;  5LA6 E;  4ISS A;  4OYJ A;  2E2A A;  2WMN A;  3TLV A;  2RP4 A;  2W61 A;  3CPZ A;  3HR0 A;  3O1H A;  4KUM B;  2YU1 A;  5ABF B;  3FZK B;  4UF0 B;  3RRC A;  3RHW A;  1KNZ A;  1XWM A;  4LML A;  4QH5 A;  3GWH A;  5J0Z A;  4LF6 T;  3I9W A;  4QWN B;  4IE0 A;  2XQ3 A;  3ZCI A;  5EK3 A;  3BQK A;  4TV9 E;  4EXT A;  2Y8D A;  3AE2 A;  3E0Z A;  4O2A E;  3UFG A;  4AIS A;  1U5P A;  4AXP A;  4O2B E;  3EDV A;  4KMC A;  4KP3 C;  5AQU B;  5FXW A;  3FXD B;  3AE4 A;  4IHJ E;  3ZT7 A;  3C4W A;  2VL8 A;  5AQS B;  5CB4 E;  1LVF A;  5L4E A;  5AQT B;  4C90 A;  2RA1 A;  2MTQ A;  1S35 A;  3ZC0 A;  4JI0 T;  2VKD A;  3BQL A;  3RYF E;  4CN1 A;  5C2T A;  2EHO D;  4UVB B;  2IW5 B;  4EB6 E;  4ZEY A;  4U2Y A;  2LM2 A;  2XZE A;  2CXF A;  1HNZ T;  2JMK A;  1YKH B;  3AEF A;  3MAC A;  3ZJ1 A;  3MXZ A;  5LHH B;  3F2E A;  2H7O A;  1SUM B;  1LVK A;  2VVN A;  1ZP0 A;  2WAU A;  2UXN B;  4IRE A;  2EHO A;  4UEM A;  3UUN A;  5AFU L;  3V5S A;  4JI8 T;  5L3E B;  1BR4 A;  1WCR A;  2M6I A;  2PBI A;  3PUS A;  1D0Z A;  2ODV A;  3PUY F;  5JDM A;  2UUA T;  1HNW T;  2XQY A;  3PUQ A;  2YDS A;  4EED A;  2IIU A;  2DI4 A;  5LG3 A;  5DAB A;  3AA6 B;  3TLU A;  1WR0 A;  1NEN A;  4X5T A;  4X1K E;  4YFS A;  5JR9 C;  3I0O A;  5JQG E;  2WZH A;  2Q9Q B;  2V6X A;  5ABG A;  3NRY A;  4YSY A;  2FUP A;  4X62 T;  4H63 H;  3ZSS A;  2FJA A;  1KK7 A;  2CXL A;  4H9R C;  2PTF A;  2WQY A;  4LFA T;  5FY1 A;  2LEH A;  3ZST A;  4CI2 B;  2VK9 A;  5J2U E;  4PNI A;  2XQ5 A;  2A2F X;  2L9Q A;  3AXJ A;  1KF6 A;  4MHC A;  3CQG B;  4NXN T;  4ADZ A;  2Q9Q A;  2XQ6 A;  1UCU A;  4LMJ A;  4LFB T;  2LE8 A;  2OA5 A;  1UX4 A;  5AQL B;  1ZOY A;  3EI0 A;  3M65 A;  3TLS A;  5L3C B;  1WFD A;  3JCF A;  4Q25 A;  1D1C A;  4B3M T;  1E2A A;  1HNX T;  4KHP T;  3U3I A;  5FYM A;  4ZI3 C;  4AKR B;  3Q2M A;  2YIN A;  1GQE A;  1W0B A;  2I0M A;  3Q9D A;  4IE7 A;  4UF0 A;  4ZHQ E;  2VKH A;  4JEH B;  1XMQ T;  2QA7 A;  3N9L A;  3OYZ A;  2YOE A;  5M4Y A;  2ZM8 A;  3IHR A;  5AQK B;  4UV8 B;  2R6G F;  2XJ7 A;  4HFH A;  3T1Y T;  2D0U A;  3ABV A;  4GKK T;  3RRW A;  3UT5 E;  2ACX A;  3A5X A;  4PJM A;  4EZ4 A;  5F3J A;  4DV1 T;  3T1H T;  4X1I E;  4L5G A;  2YK0 A;  3PU8 A;  5L3F B;  1V9D A;  1O3X A;  2CHN A;  5AQN B;  3RX6 A;  2BKP A;  5LJM A;  3GA8 A;  1T8B A;  3ZT5 A;  2A3D A;  3M3Z B;  2W4X A;  3UU4 A;  3P8C D;  5L47 A;  3VKH A;  2BBH A;  2BG9 B;  4Z8X A;  1UX5 A;  2QGS A;  2B76 A;  4OHF A;  4DV7 T;  3LBX A;  4E7Z A;  3AA7 B;  2N9D A;  3HL6 A;  1BR1 A;  3AE9 A;  5FMN A;  2AXD S;  1YKE B;  5HCJ A;  2LKG A;  4ANJ A;  5ADX L;  2C0S A;  5J2T E;  2D0T A;  3K3N A;  3JC6 C;  1HF8 A;  2E9X B;  2M67 A;  3A7M A;  3PDY A;  3JC6 D;  4G2A A;  4H63 V;  4HTE A;  4QXB B;  4UXN B;  3UUL A;  5CA0 E;  3PUR A;  1AJ3 A;  4TX5 A;  4X64 T;  2J47 A;  4UVA B;  4WNK A;  2CM0 A;  4ILA A;  4EYU A;  3CX7 B;  3E22 E;  4TZ4 C;  4XAX B;  4YHJ A;  5LB7 B;  1XDO A;  2V1D B;  2LSY A;  3PV0 F;  5DQV A;  3W15 B;  5HXH A;  4B3S T;  1WR6 A;  2X9H A;  4PFO A;  5LNK A;  4X66 T;  3CQC B;  4TUY E;  2WU5 A;  4V1A v;  2CLY C;  3AE1 A;  3ZCJ A;  3QOF A;  3PUA A;  3AA0 B;  1DU2 A;  3FBL A;  1MMD A;  4GK5 E;  2CXD A;  1L0V A;  1EZ3 A;  3ETV A;  4X20 E;  2Y6X A;  4UR9 A;  1J5E T;  2KT9 A;  2V7K A;  5GON E;  2XQA A;  4KX6 A;  5LCY A;  2X51 A;  3UUX B;  4CXW A;  2VVS A;  3PE0 A;  2XSB A;  5FKY A;  3P4Q A;  4WYV A;  4O4H E;  2I6H A;  2PG8 A;  1T7S A;  4PAG A;  4U2Z A;  4XBF B;  3VR9 A;  3VU7 H;  5H6R B;  3ZMZ B;  3ANW B;  2YKS A;  3Q5E A;  5JRC A;  2LSI A;  5L4H A;  4DVD A;  4ZI7 E;  2BVM A;  3LFM A;  5JTG A;  4IDP A;  1QUU A;  4PK4 A;  2V5C A;  3AXJ B;  2WDV A;  4X1Y E;  4EV6 A;  4CXY A;  4AQY T;  4YJ3 E;  2X0L B;  3IEE A;  2BS2 A;  2XPK A;  3TKL B;  5JVD E;  5FL1 A;  2GK9 A;  3GMI A;  1KNP A;  5JDH A;  4JI5 T;  4AI6 A;  5AQG B;  2WBL A;  3AAA B;  3F57 A;  4TNW A;  3RKG A;  1XDP A;  1XZY A;  3C4X A;  4GOU A;  2XQ9 A;  4IDZ A;  2C5K T;  3ZC1 A;  5LJN A;  2XAF B;  1D0X A;  1SA0 E;  2DWK A;  4KI0 F;  4F8H A;  2X9W A;  1ZHC A;  4EAH A;  2ACZ A;  2CPT A;  3CX8 B;  3FZM B;  3HI2 A;  1FIO A;  4N78 D;  4QX8 B;  5HXR A;  3SS1 A;  1H7C A;  1YW0 A;  3KVA A;  4A5X A;  4WZX A;  4EGW A;  3J7Y q;  2BDE A;  3RGL A;  4JV5 T;  3L39 A;  4UEL A;  4JI1 T;  4DBR A;  3ZEF B;  2BG9 E;  1HFA A;  4TN7 B;  3C98 B;  1HG5 A;  4PFP A;  4HFB A;  2JMH A;  5H6Q B;  1HX1 B;  5IUX A;  1BR2 A;  3P4P A;  4HFC A;  3GN5 A;  1UUS A;  4QXH B;  5TAO A;  4BJM A;  5L3G B;  2KND A;  3OVU A;  3S4U A;  2B1E A;  3ONJ A;  5ABF A;  1N33 T;  4BAY B;  2L8K A;  4HFE A;  5C8Y E;  3AED A;  3VR8 A;  2Q9Q D;  2WSS V;  3EHZ A;  1U4Q A;  2CE7 A;  2HPL A;  4X65 T;  3P4W A;  2DWG A;  3RIU C;  3CWZ B;  1NWM X;  3U78 A;  3N9O A;  2WCA A;  4Z91 A;  2XSA A;  1QLB A;  3EUH A;  4HFI A;  3KV9 A;  2E9X D;  4YT0 A;  5LGU B;  5L2L A;  1XNQ T;  4A98 A;  1MNE A;  3BK9 A;  1WYB A;  3J9X 1;  3RLF F;  3SOL A;  3UTK A;  2BKN A;  2KXP B;  3MZK B;  2J1D G;  4P1N A;  2DNX A;  5FVK A;  2A9U A;  4HGA A;  2UUB T;  3IA3 A;  2CA5 A;  2WP9 A;  3FZL B;  2H7V C;  3QK6 A;  3ZMV B;  4YTP A;  5JDQ A;  4DUY T;  4DR2 T;  1ZEE A;  3HA4 A;  2IC6 A;  4DV5 T;  1MIW A;  2P9B A;  2A72 A;  2N1G A;  3RQU A;  2K5B B;  2IUB A;  4LF4 T;  1D1A A;  3PU3 A;  3QB5 K;  3AE7 A;  4CN4 A;  4U72 A;  5LHI B;  4JUY A;  2DHR A;  4ZZC A;  4NPP A;  2K48 A;  2VL0 A;  2BVL A;  2V7I A;  3LG7 A;  5DJQ C;  4AQF A;  4YLH A;  3CVR A;  2BG9 A;  2ZM2 A;  1HS7 A;  3IBP A;  1Z8U A;  4DMV A;  3QNU A;  4HWI B;  3NZQ A;  2G0U A;  2H88 A;  4OFZ A;  2W2U A;  5FVL A;  3RKO A;  5HYA A;  2CHO A;  3NVO A;  2E5V A;  4LF9 T;  2W0G A;  2VKO A;  1XMO T;  2W00 A;  5LXT E;  3G06 A;  3OKQ A;  4U3C A;  5HEU A;  3OBV E;  3PTR B;  1N36 T;  4GK0 E;  3LK3 B;  1IJ6 A;  1S94 A;  4AKG A;  2YN6 A;  2VQE T;  1M7K A;  4WBN E;  4HWF A;  1HTJ F;  1OED C;  4YY3 T;  1FEW A;  1T72 A;  3DTO A;  5FXV A;  2IML A;  3NBX X;  2X0Y A;  1FMV A;  2WU2 A;  4H9P C;  4QHO A;  3AE3 A;  2NW7 A;  4DR1 T;  3LBX B;  4O8S A;  2LM9 A;  3KIN B;  4IE5 A;  2V8S V;  4NUU A;  4JLE A;  3LJC A;  2WY2 A;  1HX8 A;  3ZJ2 A;  3HKD E;  2WM9 A;  3AE6 A;  2CEA A;  3PUX F;  4HN9 A;  4A97 A;  4IGU A;  2HN2 A;  4JEU B;  5AQF B;  3RPU A;  4OYK A;  3CX6 B;  3NZP A;  4DID B;  3VKG A;  3O1I A;  2UUC T;  2I59 A;  4LFC T;  2FBW A;  3SFD A;  3AVS A;  2Q9Q C;  3N9N A;  4PJL A;  1IAP A;  4CN6 A;  2CMR A;  3ONL C;  3ZN1 B;  4DR3 T;  5FXZ A;  3K1S A;  1R8I A;  5KX5 E;  1HCI A;  1OXZ A;  4TWD A;  5HWX A;  1IBK T;  3C51 A;  3WI3 A;  2JQQ A;  2JIW A;  3K8P C;  2NTY A;  4U33 A;  5HWY A;  5CFB A;  5JH7 E;  2K24 A;  3RYC E;  4HWD A;  3CIR A;  4YSX A;  4I0U A;  3RQW A;  4HWH A;  2XAQ B;  3ZYK A;  4AQG A;  5AQV B;  5IWA T;  3E08 A;  2MBG A;  4A56 A;  4DO0 A;  3C4Z A;  3AAE B;  2LKH A;  3DP7 A;  4YTM A;  4CI3 B;  2NP9 A;  3OYX A;  4QX7 B;  1HG2 A;  2CWO A;  2JQK A;  2WB5 A;  2WDQ A;  4ILB A;  5LMU T;  3MK7 C;  2HPJ A; 
#chains in the Genus database with same CATH homology
 1IBM T;  1N32 T;  1HNW T;  2UUA T;  1FJG T;  4JV5 T;  1XNR T;  4JI1 T;  4LF7 T;  4X62 T;  2UXC T;  4LFA T;  2UU9 T;  1N33 T;  4NXN T;  4LFB T;  4DV4 T;  4JI3 T;  4X65 T;  1IBL T;  1XMQ T;  4YHH T;  4DV0 T;  4B3M T;  1HNX T;  4DUZ T;  4KHP T;  1XNQ T;  4DR1 T;  2UUB T;  4DUY T;  3T1Y T;  4JI7 T;  4GKK T;  4DR2 T;  1N36 T;  3T1H T;  4DV5 T;  4JI4 T;  4LF8 T;  4DV1 T;  4JI2 T;  2ZM6 T;  4LF5 T;  4LF4 T;  5BR8 T;  4DR6 T;  1N34 T;  4DV7 T;  4LF9 T;  1XMO T;  5LMN T;  4DV6 T;  4K0K T;  4DV2 T;  4JI6 T;  1I94 T;  4X64 T;  4B3T T;  2F4V T;  4OX9 T;  2VQE T;  4DV3 T;  4B3S T;  4YY3 T;  4X66 T;  2E5L T;  3OTO T;  2UXD T;  1J5E T;  2UXB T;  4GKJ T;  4LF6 T;  2UUC T;  4LFC T;  4DR4 T;  4DR7 T;  4DR3 T;  4DR5 T;  1IBK T;  4AQY T;  2HHH T;  4B3R T;  4NXM T;  1HR0 T;  5IWA T;  4JI5 T;  4JI0 T;  2VQF T;  1HNZ T;  4JYA T;  5LMU T;  4JI8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...