3T1HT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1hT00
2UU9T 4LF8T 4GKKT 1IBMT 2UUAT 1XNRT 4NXNT 4LFBT 4DV2T 4DR2T 1XNQT 1HNXT 4LF6T 2HHHT 2UUBT 4X62T 4DV4T 4LF7T 2F4VT 4YY3T 4DV5T 1N34T 1HR0T 4JYAT 3OTOT 2E5LT 1N33T 4JI3T 4DV1T 1FJGT 4DUYT 1HNZT 4JI2T 2UXDT 4JI0T 4B3TT 4AQYT 4DV0T 4OX9T 1N32T 4K0KT 4B3MT 1J5ET 4DV7T 4JI6T 1XMQT 4DV6T 1IBLT 4LF9T 4DR1T 4JI5T 4LF4T 4DR6T 1N36T 4DR7T 4JI1T 4LFAT 2UXBT 5LMUT 4LF5T 1HNWT 1I94T 4JI4T 4X66T 2VQET 3T1HT 4KHPT 4X64T 2ZM6T 5IWAT 4YHHT 3T1YT 4JV5T 4DR5T 4DUZT 5LMNT 4LFCT 4B3ST 4GKJT 2VQFT 1XMOT 2UXCT 4JI8T 2UUCT 5BR8T 4JI7T 4NXMT 4DR4T 4X65T 4B3RT 1IBKT 4DV3T 4DR3T
chains in the Genus database with same CATH superfamily
4EEBA 3HKDE 3MA9A 3EDVA 2WBLA 2XAJB 3CMLA 3ETUA 5ABGA 2HHHT 4X62T 2D2SA 4CXWA 1J1JA 2RA1A 2E9XB 2VB6A 5LG4A 2XUEA 4Z90A 4P0BA 3H3MA 4UV8B 3IHRA 3ZT5A 2UXDT 5AQNB 1HX1B 2PG8A 3AE2A 1KFYA 5CA1E 4YLHA 2A2FX 3FZHB 5LBMA 3C4WA 4OHFA 2W4XA 5LXTE 2LEHA 4PAGA 2WU5A 4JI5T 4ZI3C 4GYRA 4XAXB 4U74A 4ILCA 2XQ5A 3ZMVB 4JEUB 3RIUA 4U3CA 2X9XA 3LK42 1I94T 3RKGA 1HG5A 4JI4T 3PUWF 2WS3A 2CHOA 4PK4A 4TZ4C 2WWVA 4HN9A 4B6XA 1E1HB 1LVKA 4UV9B 4KMCA 3J7Yq 5AQSB 3ZN0B 4H9PC 2CHNA 5AQHB 5AQLB 5EK2A 1T98A 3MACA 5J2TE 3MKDA 2ZM2A 3FB2A 4GK5E 5DABA 3SFDA 1WYCA 2LSJA 4HWFA 2KNDA 4WYVA 4A97A 2NTXA 1YXRA 3NRXA 4I4TE 2XM2A 4IREA 4YY3T 3G06A 1N34T 3B13A 4HFVA 1YKEB 4IDQA 4LMKA 3ZN1B 2H89A 3ZKRA 1MMDA 4BA9A 3HA4A 4C90A 2WDQA 2NWBA 5ABFA 1QSDA 4K0KT 5J1GA 2DWGA 2XY8B 5E0OA 3Q9DA 2LRKA 2H7VC 5IYZE 4COFA 2JPFA 3EAMA 2OA5A 5JR9C 3QUJA 4ZOLE 4ZI3D 2MTQA 4HWDA 2X9YA 2Y6XA 1VCTA 2ODVA 4GYSA 3AAEB 4LFCT 4HFEA 4XBFB 1UX4A 2YU2A 4ANJA 2Z6EA 4NIQA 2NP9A 4X65T 2MAWA 1WYBA 4EIWA 1JNRA 5IHYA 3RIAA 2V6YB 4U7IA 1YQ4A 1HNXT 3ZPOA 3R6NA 4AQGA 3KFWX 2BG9E 4DV4T 3AVSA 3QOFA 4LF7T 3PDYA 4HWIB 2KMFA 1HR0T 4FJOA 1W09A 2EHOC 3PUQA 2V5CA 4YSYA 4DUYT 5AQGB 5FYMA 3ZCJA 3ETVA 1XWMA 3GN5A 4UF0B 5LGTB 3C4ZA 3IF8B 3H37A 4HFCA 2X0HA 2P9BA 2K9AA 2NTYA 3KBTA 4LF9T 1YQ3A 3AE6A 1I6ZA 4DR1T 3PUZF 4JBWF 1Y64B 3EABA 1WR0A 4HKAA 1FMWA 3X1DA 3N2OA 5AQPB 3U3IA 5F5WA 4IE0A 5KXJA 2LSGA 5LHHB 5FMNA 2W00A 2CLYB 3A7MA 4EZHA 3T1YT 1NWMX 4H9SE 4HE8A 2NW9A 3CKDA 2X0YA 2YU1A 4AXPA 3LG7A 4IDNA 4ZI7E 4P09A 3GMIA 4PK5A 2V7LA 3PJAJ 2UU9T 4NXNT 3UFEA 5L3EB 3KV5A 1YW0A 3UTKA 2FJAA 2M67A 3J9X1 4YFSA 2GK9A 3JAEA 4JYAT 2OV9A 4L0RA 3K3QC 1N33T 4JI3T 2J4GA 1T7SA 4HFIA 3D0TA 5JR9A 3IBPA 2PBIA 4OYJA 4ZXLA 3ZCIA 2WSSV 4DO0A 2KINB 3TLVA 4UEMA 5JDQA 5L4EA 3ZMTB 5FY1A 4ZS2A 3U78A 4DR6T 3QK6A 4LFAT 3AXJB 2KLQA 3LJCA 4PJNA 2VKHA 4O2BE 4EYUA 4TX5A 5L4HA 4HWCA 4KHPT 3PUGA 4AIUA 2WP9A 3CQXC 3KV6A 4KP3C 2KSRA 4AISA 3L3PA 3M3ZB 5LMNT 3JC6D 3TLUA 2IC9A 4YXDA 2PTFA 1KNPA 3DP7A 4IT4A 5HEGA 5C8YE 1S35A 2EHOA 2FJDA 1OWAA 2WDVA 1LVFA 2QVAA 4CQIA 1IJ5A 2FJEA 2FBWA 1XNQT 5LCYA 5HCMA 2AE9A 4ADZA 1WR6A 5AQUB 4DMWA 2YN6A 2WDRA 4CN6A 4HGAA 2D0TA 2X9HA 4N78D 5FNVE 2BVMA 1NEKA 3CK6A 1JNZA 2C5IT 4MLKA 4TWDA 3JAFA 3Q5DA 2XASB 2Y8DA 5ABFB 3RH3A 3RQUA 2V7IA 1U4QA 2Y48B 4ZS3A 4HFBA 2MYSA 2NW8A 2NW7A 1IBLT 2CPTA 5DQWA 4QHOA 4UR9A 3EDUA 1FEWA 2PFVA 2CCQA 4O8SA 2IIUA 4JI1T 1BR2A 2W63A 2DL1A 2QA7A 3I9WA 5AQMB 2UXBT 3C50A 2JQ9A 1HNWT 3RRWA 2H7OA 4IE4A 5HXSA 4CZZB 2CBJA 3CX7B 3P4RA 2I6HA 2RPAA 1XDPA 3AAAB 2DI4A 2B1EA 4YHHT 3AE1A 1D0YA 1HG2A 4DUZT 2WB5A 3UU3A 2BG9C 3FBZA 4F8HA 3C51A 4AKLA 4TV9E 1NENA 3N9QA 2LKGA 3OJAA 1IBKT 1T8BA 5CA0E 1CHUA 4P0AA 5FXZA 4H63V 1MMNA 4DIDB 2LKHA 4X5TA 2WM9A 2XQ8A 2IDOB 2IMLA 2M6BA 4QXHB 2IC6A 1Z0PA 1SA0E 4DV1T 1HCIA 1FJGT 2L9QA 3O1HA 3SS1A 2ES0A 1HNZT 5L2LA 3GN5B 1IZNB 5LJNA 3AEFA 5F3JA 1D1AA 4I0UA 2BS2A 4QH4A 4PJLA 3RGLA 4MFRA 3P8CD 2BZBA 4TWHA 4DV6T 2HN2A 2XAHB 3EVYA 4O4LE 3ZYLA 2BVLA 2Q9QC 2XQ6A 5HEOA 2X68A 1Z8UA 5LMUT 5FVLA 3AE4A 4UELA 3ZYKA 3ANWA 3W15B 4AKHA 1SE7A 1MNEA 3K3NA 2YKSA 1OEDC 2WQYA 4TV8E 2LRLA 2YOEA 1US7B 5FVKA 5CB4E 3SRZA 4AQFC 5HWXA 1GQEA 5JRCA 2BKOA 3Q5XA 2CWOA 2LM2A 4YTNA 4NUVA 2CA5A 1FMVA 1QLBA 3LBXA 4YSZA 1LKXA 3ZJ1A 4ZZCA 4YTMA 4IL4A 4JEHB 3AA1B 1FIOA 3RYIE 4U33A 2UUBT 3N9MA 5GONE 4ZI2D 3E08A 5HCJA 5HEHA 2D0UA 2CXLA 2E5LT 2YINA 3PUYF 1WFDA 2E9XC 5AQJB 2KZ7B 2BKNA 2K48A 3ZC1A 3AA6B 5L3DB 2CEAA 5JR9B 3QB5K 4B3TT 4IDPA 3AB3B 4DV0T 4GOUA 4EOZB 2I59A 4ISTA 3OYXA 2YK0A 2LHRA 2UXNB 4H9OC 3VKGA 3CIRA 2BG9A 3AEAA 4ILAA 3RYFE 4F6RC 3PTRB 2ODUA 1OXZA 3RQWA 4UVBB 3UULA 3ZLIA 5JDNA 1HX8A 2W2UA 3UFGA 4K0UA 2JJ9A 1EZ3A 3VKHA 2VWAA 2XQAA 4GK0E 4XZCA 2A3DA 3KVBA 1XZYA 2XQ7A 4JI8T 3AE5A 4NXMT 2BS4A 2CE7A 5FXVA 2X66A 1W0AA 4DBQA 3AE3A 4LF8T 1IBMT 4PFPA 1O3XA 4TUYE 4HEAA 3K3OA 1T72A 2PJQA 2JQKA 2LOSA 2F4VT 3NZPA 1E2AA 2CXFA 3T8OA 4IL9A 2SPCA 1VCSA 3CX6B 4YSXA 5KDMC 4U2YA 2XSAA 2Q9QA 3HKEE 3KV4A 3N9PA 3ZMZB 3JCFA 3FHNA 4ILBA 2MPKA 3ONXA 5FKYA 1BR4A 1QUUA 1E7PA 4AQFA 1WLXA 1BR0A 3AEEA 1NAFA 4J2CA 5EK3A 5HYAA 4IIJE 3L39A 4X66T 2J1DG 3OYZA 1XDOA 4UXNB 5LYJE 2XQ3A 2V7JA 2ZM8A 2IUBA 3QNUA 3IA3A 2V8SV 2K24A 3N2KE 5A1LA 4H63H 3HL6A 2BKPA 3NKZA 4X20E 3I0QA 2JMHA 2XPKA 3N5LA 3CX8B 2A9UA 3P50A 4WZXA 2DWKA 4E7SA 2KWIB 2L3LA 3MJXA 1UCUA 5LBQB 1V9DA 1KNZA 4WNKA 3OTOT 3ZT7A 2VK9A 2YDSA 3FXDB 2J62A 2WY2A 3H3AA 2M6IA 1KK7A 4I55E 5HXEA 2XAGB 4UVCB 1OEDE 4YJ3E 2MBGA 1H7CA 5C3JA 3N2GE 3UT5E 1G8XA 1J5ET 4DV7T 4KX6A 4TNVA 3DTOA 1S94A 4HWHA 2XHEB 3ZYMA 4ZZBA 3KV9A 1ZHCA 3TLTA 2LOPA 4ZEYA 2EHOD 3VU7H 3ANWB 4CN4A 3MXZA 2JRKA 3KINB 3IEEA 5EK4A 3BQIA 3NWIA 2ACZA 4X64T 4CXYA 4TNWA 2UXXB 2CLYC 1X9BA 4B3ST 2DNXA 2DHRA 2FUPA 2D9DA 2LLYA 4H9QC 5JRCB 4C91A 2WCAA 2XJ7A 3RRCA 3RHWA 1B7TA 5HEJA 5L3CB 4LMLA 3TLSA 3AE9A 3F2EA 5AQRB 3HI2A 4ZHQE 2VKDA 2VL8A 4UIGA 1ZOYA 2XZEA 2C5KT 3ZT6A 5LG3A 2ZM0A 5FXXA 3F57A 3AAIA 3TKLB 5FL1A 2NR4A 4TWFA 4H9RC 4U72A 3PUXF 3ZC0A 2WAUA 3LDQB 2X0LB 4EXTA 2NOXA 4X1IE 5AQOB 1Y01A 4OX9T 3RC8A 3LFMA 3R84B 4IE6A 4QH5A 3ESLA 2BG9B 4O2AE 1BR1A 1N36T 3AECA 3PU8A 1AJ3A 3LK2B 4JUYA 5LA6E 3RPUA 4YT0A 2E2AA 5AFUL 3F31A 3NBXX 4I50E 3RIUC 2VQET 3T1HT 2HPJA 3B5MA 3VR9A 4PW8A 3WAKA 3OPCA 5ABEA 5AQQB 2QYWA 5IWAT 2V6YA 2I0MA 4DR5T 1HFAA 5ETWA 1VRBA 4Q25A 4O4IE 2W62A 5LGNB 2W0GA 5H6RB 3NZQA 5KMGP 4QWNB 3UU5A 3S4UA 2WMOA 4GKKT 3AE7A 4U7YA 1WCRA 4UVAB 4DV2T 2V26A 4OK0A 2LSIA 1W0BA 2WU2A 2WMNA 3TLWA 4MBQA 4WBOA 3P4WA 5L3GB 5H6QB 4ASKA 5L3FB 1IJ6A 5LOVE 2VVNA 4IE7A 4IE5A 4EZ4A 5JDHA 4A98A 1ZEEA 2ZLYA 4YHJA 1IAPA 2LT3A 5AQFB 3NVOA 1MNDA 2XAFB 2C0SA 3K1SA 4LF4T 2LSKA 4OFZA 2B76A 3P4SA 2WZHA 5L47A 3ZSTA 3CWZB 2YEVC 5HWYA 2K5BB 4EEDA 5J2UE 4QXCB 3ZSSA 4JV5T 4KUMB 4QXBB 5JREA 4M1PA 3BQLA 3RI5A 2UXCT 4FI5A 2XQ4A 3EI0A 4B3RT 2RP4A 3CQGB 5FL0A 2ACXA 5JTGA 3VRBA 3UQ7A 4LFBT 4PFOA 4DR2T 3E22E 4O4HE 1ZP0A 5LJMA 4QKNA 2BBHA 4MALA 2V5DA 5HXCA 3L09A 1HTJF 4X1KE 2VVSA 3MZKB 2XAQB 3A8YC 4A56A 4DMVA 3AXJA 3AEBA 3I9YA 2R6GF 3UU6A 3Q5EA 2HN1A 3SWHA 4B3MT 5LP6E 4JI6T 4HFHA 2LM9A 5F8PA 5FXWA 1MMAA 3LK3B 4QX7B 3PJAA 3FBLA 1G73A 2CMRA 4AKGA 2QGSA 3O1IA 2BS3A 4L9IA 3N9NA 4BAYB 3V5UA 5IUXA 4IDOA 4E7ZA 4U31A 3VHLA 4WBNE 4AI6A 2VKOA 1YD8G 3GA8A 4QH1A 3O4XE 3BK9A 4CI1B 1HF8A 2Q9QD 4LMJA 3FZLB 3VRAA 3Q2MA 5JDMA 5CJ5A 5L3BB 1XNRT 1KF6A 2CRBA 3RF1A 5CGMA 4DVDA 4QX8B 2CM0A 2EHOB 5AQKB 4YTPA 5BMVE 4CI2B 2N9DA 3FZKB 3PUVF 3KVAA 4JI2T 5EZYE 5LHIB 2N1GA 5ADXL 4NUUA 3GWHA 2QRXA 2CWYA 1D0ZA 3AA7B 4NPPA 1UURA 3AVRA 4KI0F 2XQYA 2A72A 1WRDA 3N9OA 5C2TA 3UU8A 4G2AA 2W61A 4PJMA 4EGWA 1SUMB 1MMGA 5FP3A 2E9XD 2V7KA 3RX6A 4PNIA 2V6XA 1OEDA 2ZM6T 5AQIB 1D0XA 3FZFB 2VQFT 3E0ZA 3RC3A 2UUCT 5BR8T 3ONLC 5FY7A 3EHZA 2JMKA 4H9NC 3C98B 3I1AA 2G0UA 5HAXA 5JH7E 5M4YA 2VURA 3O9XA 4LF6T 3UUNA 2K3WA 1DU2A 3UQ4A 1W9RA 1M7KA 1KNRA 2KXPB 2E9XA 3OVUA 3PURA 3ZMSB 3LSVA 2BBJA 3C4XA 2JIWA 2MOZA 1L0VA 3OKQA 4EB6E 3FXEB 3RIFA 4HFDA 4EAHA 2HPLA 3ABVA 3HR0A 3AA0B 4AQYT 2WZIA 4EV6A 5J0ZA 3N9LA 5AQVB 1N32T 3B57A 3JC6C 4CXXA 4AKIA 2E8IA 1XMQT 1HS7A 3QC9A 1X79A 2HH7A 4YJ2E 3ZEFB 4DR7T 4V1Av 1MIWA 3Q5WA 3RYCE 3P4QA 1VOMA 4LF5T 3UUBA 2KWHA 3RYHE 2H3RA 2LJLA 5DQVA 4GIWA 2XQ9A 4WW0A 4O4JE 3KDSE 4IDZA 1M62A 1ZKEA 3OBVE 2IHR1 3PV0F 4GKJT 3P7IA 1XMOT 3VR8A 5LNKA 1ZV4X 2LSYA 1MIYA 4AKRB 2UUAT 5LGUB 2W66A 3AEGA 4Z91A 3AEDA 4PJJA 4BJMA 3RKOA 5ABHA 3A5XA 4BJNA 2L8KA 5HXHA 4HTEA 1R8IA 3CPZA 1UGOA 2CBIA 3LBXB 4CN1A 4Z8XA 2DLRA 3EUHA 4EYYR 4JI0T 3V5SA 2JQHA 5KX5E 1U5PA 3ONJA 3AE8A 2BDEA 3PU3A 3QB5A 4IHJE 3K8PC 3BQKA 3O1JA 3M65A 3HKCE 5JDFA 4KBMB 2J47A 1LRZA 3JADA 4L5GA 2VL0A 3L8RA 1D1BA 2X9WA 4MHCA 2WWUA 3NRYA 3RLFF 2LE8A 4KHZF 5HXRA 3SOLA 1MIVA 1UUSA 2H88A 5JVDE 5DJQC 2JQQA 4DBRA 2OLTA 4JI7T 4U2ZA 5TAOA 4OYKA 2E5VA 3MK7C 3UUMA 4DV3T 4DR3T 2XSBA 2D5UA 3I0OA 4CI3B 4ERRA 2CXDA 2X67A 4PK6A 3C64A 2V1DB 2IAKA 3CVRA 2VASA 1UK5A 2IW5B 4DV5T 1CUNA 2FJBA 2ZMAA 1KEYA 4ISSA 3P4PA 4TN7B 3SFEA 1SHZC 3KBUA 3ZJ2A 4UF0A 3ZMUB 2N2NA 2DCFA 4A5XA 3PUSA 2Q9QB 4I43B 5JDLA 5CFBA 2C5JA 5AQTB 2V7MA 3WI3A 3PUAA 3WAJA 3UU4A 2W67A 5LB7B 3FZMB 5JQGE 4ILUA 2VKJA 2LHNA 4P1NA 2KT9A 2YDQA 4DNDA 1OEDB 2XM1A 4ZI2C 5FY0A 4X1YE 2AXDS 1UX5A 3HKBE 5LHGB 3UUXB 2XTLA 4G63A 3DJBA 2X51A 3PE0A 1YKHB 2YDRA 1D1CA 3CQCB 4DR4T 4IGUA 5JDGA 1J5WA 4JLEA 5HEUA
chains in the Genus database with same CATH topology
2UU9T 4LF8T 4GKKT 1IBMT 2UUAT 1XNRT 4NXNT 4LFBT 4DV2T 4DR2T 1XNQT 1HNXT 4LF6T 2HHHT 2UUBT 4X62T 4DV4T 4LF7T 2F4VT 4YY3T 4DV5T 1N34T 1HR0T 4JYAT 3OTOT 2E5LT 1N33T 4JI3T 4DV1T 1FJGT 4DUYT 1HNZT 4JI2T 2UXDT 4JI0T 4B3TT 4AQYT 4DV0T 4OX9T 1N32T 4K0KT 4B3MT 1J5ET 4DV7T 4JI6T 1XMQT 4DV6T 1IBLT 4LF9T 4DR1T 4JI5T 4LF4T 4DR6T 1N36T 4DR7T 4JI1T 4LFAT 2UXBT 5LMUT 4LF5T 1HNWT 1I94T 4JI4T 4X66T 2VQET 3T1HT 4KHPT 4X64T 2ZM6T 5IWAT 4YHHT 3T1YT 4JV5T 4DR5T 4DUZT 5LMNT 4LFCT 4B3ST 4GKJT 2VQFT 1XMOT 2UXCT 4JI8T 2UUCT 5BR8T 4JI7T 4NXMT 4DR4T 4X65T 4B3RT 1IBKT 4DV3T 4DR3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 T;  4LF8 T;  4GKK T;  1IBM T;  2UUA T;  1XNR T;  4NXN T;  4LFB T;  4DV2 T;  4DR2 T;  1XNQ T;  1HNX T;  4LF6 T;  2HHH T;  2UUB T;  4X62 T;  4DV4 T;  4LF7 T;  2F4V T;  4YY3 T;  4DV5 T;  1N34 T;  1HR0 T;  4JYA T;  3OTO T;  2E5L T;  1N33 T;  4JI3 T;  4DV1 T;  1FJG T;  4DUY T;  1HNZ T;  4JI2 T;  2UXD T;  4JI0 T;  4B3T T;  4AQY T;  4DV0 T;  4OX9 T;  1N32 T;  4K0K T;  4B3M T;  1J5E T;  4DV7 T;  4JI6 T;  1XMQ T;  4DV6 T;  1IBL T;  4LF9 T;  4DR1 T;  4JI5 T;  4LF4 T;  4DR6 T;  1N36 T;  4DR7 T;  4JI1 T;  4LFA T;  2UXB T;  5LMU T;  4LF5 T;  1HNW T;  1I94 T;  4JI4 T;  4X66 T;  2VQE T;  3T1H T;  4KHP T;  4X64 T;  2ZM6 T;  5IWA T;  4YHH T;  3T1Y T;  4JV5 T;  4DR5 T;  4DUZ T;  5LMN T;  4LFC T;  4B3S T;  4GKJ T;  2VQF T;  1XMO T;  2UXC T;  4JI8 T;  2UUC T;  5BR8 T;  4JI7 T;  4NXM T;  4DR4 T;  4X65 T;  4B3R T;  1IBK T;  4DV3 T;  4DR3 T; 
#chains in the Genus database with same CATH topology
 4EEB A;  3HKD E;  3MA9 A;  3EDV A;  2WBL A;  2XAJ B;  3CML A;  3ETU A;  5ABG A;  2HHH T;  4X62 T;  2D2S A;  4CXW A;  1J1J A;  2RA1 A;  2E9X B;  2VB6 A;  5LG4 A;  2XUE A;  4Z90 A;  4P0B A;  3H3M A;  4UV8 B;  3IHR A;  3ZT5 A;  2UXD T;  5AQN B;  1HX1 B;  2PG8 A;  3AE2 A;  1KFY A;  5CA1 E;  4YLH A;  2A2F X;  3FZH B;  5LBM A;  3C4W A;  4OHF A;  2W4X A;  5LXT E;  2LEH A;  4PAG A;  2WU5 A;  4JI5 T;  4ZI3 C;  4GYR A;  4XAX B;  4U74 A;  4ILC A;  2XQ5 A;  3ZMV B;  4JEU B;  3RIU A;  4U3C A;  2X9X A;  3LK4 2;  1I94 T;  3RKG A;  1HG5 A;  4JI4 T;  3PUW F;  2WS3 A;  2CHO A;  4PK4 A;  4TZ4 C;  2WWV A;  4HN9 A;  4B6X A;  1E1H B;  1LVK A;  4UV9 B;  4KMC A;  3J7Y q;  5AQS B;  3ZN0 B;  4H9P C;  2CHN A;  5AQH B;  5AQL B;  5EK2 A;  1T98 A;  3MAC A;  5J2T E;  3MKD A;  2ZM2 A;  3FB2 A;  4GK5 E;  5DAB A;  3SFD A;  1WYC A;  2LSJ A;  4HWF A;  2KND A;  4WYV A;  4A97 A;  2NTX A;  1YXR A;  3NRX A;  4I4T E;  2XM2 A;  4IRE A;  4YY3 T;  3G06 A;  1N34 T;  3B13 A;  4HFV A;  1YKE B;  4IDQ A;  4LMK A;  3ZN1 B;  2H89 A;  3ZKR A;  1MMD A;  4BA9 A;  3HA4 A;  4C90 A;  2WDQ A;  2NWB A;  5ABF A;  1QSD A;  4K0K T;  5J1G A;  2DWG A;  2XY8 B;  5E0O A;  3Q9D A;  2LRK A;  2H7V C;  5IYZ E;  4COF A;  2JPF A;  3EAM A;  2OA5 A;  5JR9 C;  3QUJ A;  4ZOL E;  4ZI3 D;  2MTQ A;  4HWD A;  2X9Y A;  2Y6X A;  1VCT A;  2ODV A;  4GYS A;  3AAE B;  4LFC T;  4HFE A;  4XBF B;  1UX4 A;  2YU2 A;  4ANJ A;  2Z6E A;  4NIQ A;  2NP9 A;  4X65 T;  2MAW A;  1WYB A;  4EIW A;  1JNR A;  5IHY A;  3RIA A;  2V6Y B;  4U7I A;  1YQ4 A;  1HNX T;  3ZPO A;  3R6N A;  4AQG A;  3KFW X;  2BG9 E;  4DV4 T;  3AVS A;  3QOF A;  4LF7 T;  3PDY A;  4HWI B;  2KMF A;  1HR0 T;  4FJO A;  1W09 A;  2EHO C;  3PUQ A;  2V5C A;  4YSY A;  4DUY T;  5AQG B;  5FYM A;  3ZCJ A;  3ETV A;  1XWM A;  3GN5 A;  4UF0 B;  5LGT B;  3C4Z A;  3IF8 B;  3H37 A;  4HFC A;  2X0H A;  2P9B A;  2K9A A;  2NTY A;  3KBT A;  4LF9 T;  1YQ3 A;  3AE6 A;  1I6Z A;  4DR1 T;  3PUZ F;  4JBW F;  1Y64 B;  3EAB A;  1WR0 A;  4HKA A;  1FMW A;  3X1D A;  3N2O A;  5AQP B;  3U3I A;  5F5W A;  4IE0 A;  5KXJ A;  2LSG A;  5LHH B;  5FMN A;  2W00 A;  2CLY B;  3A7M A;  4EZH A;  3T1Y T;  1NWM X;  4H9S E;  4HE8 A;  2NW9 A;  3CKD A;  2X0Y A;  2YU1 A;  4AXP A;  3LG7 A;  4IDN A;  4ZI7 E;  4P09 A;  3GMI A;  4PK5 A;  2V7L A;  3PJA J;  2UU9 T;  4NXN T;  3UFE A;  5L3E B;  3KV5 A;  1YW0 A;  3UTK A;  2FJA A;  2M67 A;  3J9X 1;  4YFS A;  2GK9 A;  3JAE A;  4JYA T;  2OV9 A;  4L0R A;  3K3Q C;  1N33 T;  4JI3 T;  2J4G A;  1T7S A;  4HFI A;  3D0T A;  5JR9 A;  3IBP A;  2PBI A;  4OYJ A;  4ZXL A;  3ZCI A;  2WSS V;  4DO0 A;  2KIN B;  3TLV A;  4UEM A;  5JDQ A;  5L4E A;  3ZMT B;  5FY1 A;  4ZS2 A;  3U78 A;  4DR6 T;  3QK6 A;  4LFA T;  3AXJ B;  2KLQ A;  3LJC A;  4PJN A;  2VKH A;  4O2B E;  4EYU A;  4TX5 A;  5L4H A;  4HWC A;  4KHP T;  3PUG A;  4AIU A;  2WP9 A;  3CQX C;  3KV6 A;  4KP3 C;  2KSR A;  4AIS A;  3L3P A;  3M3Z B;  5LMN T;  3JC6 D;  3TLU A;  2IC9 A;  4YXD A;  2PTF A;  1KNP A;  3DP7 A;  4IT4 A;  5HEG A;  5C8Y E;  1S35 A;  2EHO A;  2FJD A;  1OWA A;  2WDV A;  1LVF A;  2QVA A;  4CQI A;  1IJ5 A;  2FJE A;  2FBW A;  1XNQ T;  5LCY A;  5HCM A;  2AE9 A;  4ADZ A;  1WR6 A;  5AQU B;  4DMW A;  2YN6 A;  2WDR A;  4CN6 A;  4HGA A;  2D0T A;  2X9H A;  4N78 D;  5FNV E;  2BVM A;  1NEK A;  3CK6 A;  1JNZ A;  2C5I T;  4MLK A;  4TWD A;  3JAF A;  3Q5D A;  2XAS B;  2Y8D A;  5ABF B;  3RH3 A;  3RQU A;  2V7I A;  1U4Q A;  2Y48 B;  4ZS3 A;  4HFB A;  2MYS A;  2NW8 A;  2NW7 A;  1IBL T;  2CPT A;  5DQW A;  4QHO A;  4UR9 A;  3EDU A;  1FEW A;  2PFV A;  2CCQ A;  4O8S A;  2IIU A;  4JI1 T;  1BR2 A;  2W63 A;  2DL1 A;  2QA7 A;  3I9W A;  5AQM B;  2UXB T;  3C50 A;  2JQ9 A;  1HNW T;  3RRW A;  2H7O A;  4IE4 A;  5HXS A;  4CZZ B;  2CBJ A;  3CX7 B;  3P4R A;  2I6H A;  2RPA A;  1XDP A;  3AAA B;  2DI4 A;  2B1E A;  4YHH T;  3AE1 A;  1D0Y A;  1HG2 A;  4DUZ T;  2WB5 A;  3UU3 A;  2BG9 C;  3FBZ A;  4F8H A;  3C51 A;  4AKL A;  4TV9 E;  1NEN A;  3N9Q A;  2LKG A;  3OJA A;  1IBK T;  1T8B A;  5CA0 E;  1CHU A;  4P0A A;  5FXZ A;  4H63 V;  1MMN A;  4DID B;  2LKH A;  4X5T A;  2WM9 A;  2XQ8 A;  2IDO B;  2IML A;  2M6B A;  4QXH B;  2IC6 A;  1Z0P A;  1SA0 E;  4DV1 T;  1HCI A;  1FJG T;  2L9Q A;  3O1H A;  3SS1 A;  2ES0 A;  1HNZ T;  5L2L A;  3GN5 B;  1IZN B;  5LJN A;  3AEF A;  5F3J A;  1D1A A;  4I0U A;  2BS2 A;  4QH4 A;  4PJL A;  3RGL A;  4MFR A;  3P8C D;  2BZB A;  4TWH A;  4DV6 T;  2HN2 A;  2XAH B;  3EVY A;  4O4L E;  3ZYL A;  2BVL A;  2Q9Q C;  2XQ6 A;  5HEO A;  2X68 A;  1Z8U A;  5LMU T;  5FVL A;  3AE4 A;  4UEL A;  3ZYK A;  3ANW A;  3W15 B;  4AKH A;  1SE7 A;  1MNE A;  3K3N A;  2YKS A;  1OED C;  2WQY A;  4TV8 E;  2LRL A;  2YOE A;  1US7 B;  5FVK A;  5CB4 E;  3SRZ A;  4AQF C;  5HWX A;  1GQE A;  5JRC A;  2BKO A;  3Q5X A;  2CWO A;  2LM2 A;  4YTN A;  4NUV A;  2CA5 A;  1FMV A;  1QLB A;  3LBX A;  4YSZ A;  1LKX A;  3ZJ1 A;  4ZZC A;  4YTM A;  4IL4 A;  4JEH B;  3AA1 B;  1FIO A;  3RYI E;  4U33 A;  2UUB T;  3N9M A;  5GON E;  4ZI2 D;  3E08 A;  5HCJ A;  5HEH A;  2D0U A;  2CXL A;  2E5L T;  2YIN A;  3PUY F;  1WFD A;  2E9X C;  5AQJ B;  2KZ7 B;  2BKN A;  2K48 A;  3ZC1 A;  3AA6 B;  5L3D B;  2CEA A;  5JR9 B;  3QB5 K;  4B3T T;  4IDP A;  3AB3 B;  4DV0 T;  4GOU A;  4EOZ B;  2I59 A;  4IST A;  3OYX A;  2YK0 A;  2LHR A;  2UXN B;  4H9O C;  3VKG A;  3CIR A;  2BG9 A;  3AEA A;  4ILA A;  3RYF E;  4F6R C;  3PTR B;  2ODU A;  1OXZ A;  3RQW A;  4UVB B;  3UUL A;  3ZLI A;  5JDN A;  1HX8 A;  2W2U A;  3UFG A;  4K0U A;  2JJ9 A;  1EZ3 A;  3VKH A;  2VWA A;  2XQA A;  4GK0 E;  4XZC A;  2A3D A;  3KVB A;  1XZY A;  2XQ7 A;  4JI8 T;  3AE5 A;  4NXM T;  2BS4 A;  2CE7 A;  5FXV A;  2X66 A;  1W0A A;  4DBQ A;  3AE3 A;  4LF8 T;  1IBM T;  4PFP A;  1O3X A;  4TUY E;  4HEA A;  3K3O A;  1T72 A;  2PJQ A;  2JQK A;  2LOS A;  2F4V T;  3NZP A;  1E2A A;  2CXF A;  3T8O A;  4IL9 A;  2SPC A;  1VCS A;  3CX6 B;  4YSX A;  5KDM C;  4U2Y A;  2XSA A;  2Q9Q A;  3HKE E;  3KV4 A;  3N9P A;  3ZMZ B;  3JCF A;  3FHN A;  4ILB A;  2MPK A;  3ONX A;  5FKY A;  1BR4 A;  1QUU A;  1E7P A;  4AQF A;  1WLX A;  1BR0 A;  3AEE A;  1NAF A;  4J2C A;  5EK3 A;  5HYA A;  4IIJ E;  3L39 A;  4X66 T;  2J1D G;  3OYZ A;  1XDO A;  4UXN B;  5LYJ E;  2XQ3 A;  2V7J A;  2ZM8 A;  2IUB A;  3QNU A;  3IA3 A;  2V8S V;  2K24 A;  3N2K E;  5A1L A;  4H63 H;  3HL6 A;  2BKP A;  3NKZ A;  4X20 E;  3I0Q A;  2JMH A;  2XPK A;  3N5L A;  3CX8 B;  2A9U A;  3P50 A;  4WZX A;  2DWK A;  4E7S A;  2KWI B;  2L3L A;  3MJX A;  1UCU A;  5LBQ B;  1V9D A;  1KNZ A;  4WNK A;  3OTO T;  3ZT7 A;  2VK9 A;  2YDS A;  3FXD B;  2J62 A;  2WY2 A;  3H3A A;  2M6I A;  1KK7 A;  4I55 E;  5HXE A;  2XAG B;  4UVC B;  1OED E;  4YJ3 E;  2MBG A;  1H7C A;  5C3J A;  3N2G E;  3UT5 E;  1G8X A;  1J5E T;  4DV7 T;  4KX6 A;  4TNV A;  3DTO A;  1S94 A;  4HWH A;  2XHE B;  3ZYM A;  4ZZB A;  3KV9 A;  1ZHC A;  3TLT A;  2LOP A;  4ZEY A;  2EHO D;  3VU7 H;  3ANW B;  4CN4 A;  3MXZ A;  2JRK A;  3KIN B;  3IEE A;  5EK4 A;  3BQI A;  3NWI A;  2ACZ A;  4X64 T;  4CXY A;  4TNW A;  2UXX B;  2CLY C;  1X9B A;  4B3S T;  2DNX A;  2DHR A;  2FUP A;  2D9D A;  2LLY A;  4H9Q C;  5JRC B;  4C91 A;  2WCA A;  2XJ7 A;  3RRC A;  3RHW A;  1B7T A;  5HEJ A;  5L3C B;  4LML A;  3TLS A;  3AE9 A;  3F2E A;  5AQR B;  3HI2 A;  4ZHQ E;  2VKD A;  2VL8 A;  4UIG A;  1ZOY A;  2XZE A;  2C5K T;  3ZT6 A;  5LG3 A;  2ZM0 A;  5FXX A;  3F57 A;  3AAI A;  3TKL B;  5FL1 A;  2NR4 A;  4TWF A;  4H9R C;  4U72 A;  3PUX F;  3ZC0 A;  2WAU A;  3LDQ B;  2X0L B;  4EXT A;  2NOX A;  4X1I E;  5AQO B;  1Y01 A;  4OX9 T;  3RC8 A;  3LFM A;  3R84 B;  4IE6 A;  4QH5 A;  3ESL A;  2BG9 B;  4O2A E;  1BR1 A;  1N36 T;  3AEC A;  3PU8 A;  1AJ3 A;  3LK2 B;  4JUY A;  5LA6 E;  3RPU A;  4YT0 A;  2E2A A;  5AFU L;  3F31 A;  3NBX X;  4I50 E;  3RIU C;  2VQE T;  3T1H T;  2HPJ A;  3B5M A;  3VR9 A;  4PW8 A;  3WAK A;  3OPC A;  5ABE A;  5AQQ B;  2QYW A;  5IWA T;  2V6Y A;  2I0M A;  4DR5 T;  1HFA A;  5ETW A;  1VRB A;  4Q25 A;  4O4I E;  2W62 A;  5LGN B;  2W0G A;  5H6R B;  3NZQ A;  5KMG P;  4QWN B;  3UU5 A;  3S4U A;  2WMO A;  4GKK T;  3AE7 A;  4U7Y A;  1WCR A;  4UVA B;  4DV2 T;  2V26 A;  4OK0 A;  2LSI A;  1W0B A;  2WU2 A;  2WMN A;  3TLW A;  4MBQ A;  4WBO A;  3P4W A;  5L3G B;  5H6Q B;  4ASK A;  5L3F B;  1IJ6 A;  5LOV E;  2VVN A;  4IE7 A;  4IE5 A;  4EZ4 A;  5JDH A;  4A98 A;  1ZEE A;  2ZLY A;  4YHJ A;  1IAP A;  2LT3 A;  5AQF B;  3NVO A;  1MND A;  2XAF B;  2C0S A;  3K1S A;  4LF4 T;  2LSK A;  4OFZ A;  2B76 A;  3P4S A;  2WZH A;  5L47 A;  3ZST A;  3CWZ B;  2YEV C;  5HWY A;  2K5B B;  4EED A;  5J2U E;  4QXC B;  3ZSS A;  4JV5 T;  4KUM B;  4QXB B;  5JRE A;  4M1P A;  3BQL A;  3RI5 A;  2UXC T;  4FI5 A;  2XQ4 A;  3EI0 A;  4B3R T;  2RP4 A;  3CQG B;  5FL0 A;  2ACX A;  5JTG A;  3VRB A;  3UQ7 A;  4LFB T;  4PFO A;  4DR2 T;  3E22 E;  4O4H E;  1ZP0 A;  5LJM A;  4QKN A;  2BBH A;  4MAL A;  2V5D A;  5HXC A;  3L09 A;  1HTJ F;  4X1K E;  2VVS A;  3MZK B;  2XAQ B;  3A8Y C;  4A56 A;  4DMV A;  3AXJ A;  3AEB A;  3I9Y A;  2R6G F;  3UU6 A;  3Q5E A;  2HN1 A;  3SWH A;  4B3M T;  5LP6 E;  4JI6 T;  4HFH A;  2LM9 A;  5F8P A;  5FXW A;  1MMA A;  3LK3 B;  4QX7 B;  3PJA A;  3FBL A;  1G73 A;  2CMR A;  4AKG A;  2QGS A;  3O1I A;  2BS3 A;  4L9I A;  3N9N A;  4BAY B;  3V5U A;  5IUX A;  4IDO A;  4E7Z A;  4U31 A;  3VHL A;  4WBN E;  4AI6 A;  2VKO A;  1YD8 G;  3GA8 A;  4QH1 A;  3O4X E;  3BK9 A;  4CI1 B;  1HF8 A;  2Q9Q D;  4LMJ A;  3FZL B;  3VRA A;  3Q2M A;  5JDM A;  5CJ5 A;  5L3B B;  1XNR T;  1KF6 A;  2CRB A;  3RF1 A;  5CGM A;  4DVD A;  4QX8 B;  2CM0 A;  2EHO B;  5AQK B;  4YTP A;  5BMV E;  4CI2 B;  2N9D A;  3FZK B;  3PUV F;  3KVA A;  4JI2 T;  5EZY E;  5LHI B;  2N1G A;  5ADX L;  4NUU A;  3GWH A;  2QRX A;  2CWY A;  1D0Z A;  3AA7 B;  4NPP A;  1UUR A;  3AVR A;  4KI0 F;  2XQY A;  2A72 A;  1WRD A;  3N9O A;  5C2T A;  3UU8 A;  4G2A A;  2W61 A;  4PJM A;  4EGW A;  1SUM B;  1MMG A;  5FP3 A;  2E9X D;  2V7K A;  3RX6 A;  4PNI A;  2V6X A;  1OED A;  2ZM6 T;  5AQI B;  1D0X A;  3FZF B;  2VQF T;  3E0Z A;  3RC3 A;  2UUC T;  5BR8 T;  3ONL C;  5FY7 A;  3EHZ A;  2JMK A;  4H9N C;  3C98 B;  3I1A A;  2G0U A;  5HAX A;  5JH7 E;  5M4Y A;  2VUR A;  3O9X A;  4LF6 T;  3UUN A;  2K3W A;  1DU2 A;  3UQ4 A;  1W9R A;  1M7K A;  1KNR A;  2KXP B;  2E9X A;  3OVU A;  3PUR A;  3ZMS B;  3LSV A;  2BBJ A;  3C4X A;  2JIW A;  2MOZ A;  1L0V A;  3OKQ A;  4EB6 E;  3FXE B;  3RIF A;  4HFD A;  4EAH A;  2HPL A;  3ABV A;  3HR0 A;  3AA0 B;  4AQY T;  2WZI A;  4EV6 A;  5J0Z A;  3N9L A;  5AQV B;  1N32 T;  3B57 A;  3JC6 C;  4CXX A;  4AKI A;  2E8I A;  1XMQ T;  1HS7 A;  3QC9 A;  1X79 A;  2HH7 A;  4YJ2 E;  3ZEF B;  4DR7 T;  4V1A v;  1MIW A;  3Q5W A;  3RYC E;  3P4Q A;  1VOM A;  4LF5 T;  3UUB A;  2KWH A;  3RYH E;  2H3R A;  2LJL A;  5DQV A;  4GIW A;  2XQ9 A;  4WW0 A;  4O4J E;  3KDS E;  4IDZ A;  1M62 A;  1ZKE A;  3OBV E;  2IHR 1;  3PV0 F;  4GKJ T;  3P7I A;  1XMO T;  3VR8 A;  5LNK A;  1ZV4 X;  2LSY A;  1MIY A;  4AKR B;  2UUA T;  5LGU B;  2W66 A;  3AEG A;  4Z91 A;  3AED A;  4PJJ A;  4BJM A;  3RKO A;  5ABH A;  3A5X A;  4BJN A;  2L8K A;  5HXH A;  4HTE A;  1R8I A;  3CPZ A;  1UGO A;  2CBI A;  3LBX B;  4CN1 A;  4Z8X A;  2DLR A;  3EUH A;  4EYY R;  4JI0 T;  3V5S A;  2JQH A;  5KX5 E;  1U5P A;  3ONJ A;  3AE8 A;  2BDE A;  3PU3 A;  3QB5 A;  4IHJ E;  3K8P C;  3BQK A;  3O1J A;  3M65 A;  3HKC E;  5JDF A;  4KBM B;  2J47 A;  1LRZ A;  3JAD A;  4L5G A;  2VL0 A;  3L8R A;  1D1B A;  2X9W A;  4MHC A;  2WWU A;  3NRY A;  3RLF F;  2LE8 A;  4KHZ F;  5HXR A;  3SOL A;  1MIV A;  1UUS A;  2H88 A;  5JVD E;  5DJQ C;  2JQQ A;  4DBR A;  2OLT A;  4JI7 T;  4U2Z A;  5TAO A;  4OYK A;  2E5V A;  3MK7 C;  3UUM A;  4DV3 T;  4DR3 T;  2XSB A;  2D5U A;  3I0O A;  4CI3 B;  4ERR A;  2CXD A;  2X67 A;  4PK6 A;  3C64 A;  2V1D B;  2IAK A;  3CVR A;  2VAS A;  1UK5 A;  2IW5 B;  4DV5 T;  1CUN A;  2FJB A;  2ZMA A;  1KEY A;  4ISS A;  3P4P A;  4TN7 B;  3SFE A;  1SHZ C;  3KBU A;  3ZJ2 A;  4UF0 A;  3ZMU B;  2N2N A;  2DCF A;  4A5X A;  3PUS A;  2Q9Q B;  4I43 B;  5JDL A;  5CFB A;  2C5J A;  5AQT B;  2V7M A;  3WI3 A;  3PUA A;  3WAJ A;  3UU4 A;  2W67 A;  5LB7 B;  3FZM B;  5JQG E;  4ILU A;  2VKJ A;  2LHN A;  4P1N A;  2KT9 A;  2YDQ A;  4DND A;  1OED B;  2XM1 A;  4ZI2 C;  5FY0 A;  4X1Y E;  2AXD S;  1UX5 A;  3HKB E;  5LHG B;  3UUX B;  2XTL A;  4G63 A;  3DJB A;  2X51 A;  3PE0 A;  1YKH B;  2YDR A;  1D1C A;  3CQC B;  4DR4 T;  4IGU A;  5JDG A;  1J5W A;  4JLE A;  5HEU A; 
#chains in the Genus database with same CATH homology
 2UU9 T;  4LF8 T;  4GKK T;  1IBM T;  2UUA T;  1XNR T;  4NXN T;  4LFB T;  4DV2 T;  4DR2 T;  1XNQ T;  1HNX T;  4LF6 T;  2HHH T;  2UUB T;  4X62 T;  4DV4 T;  4LF7 T;  2F4V T;  4YY3 T;  4DV5 T;  1N34 T;  1HR0 T;  4JYA T;  3OTO T;  2E5L T;  1N33 T;  4JI3 T;  4DV1 T;  1FJG T;  4DUY T;  1HNZ T;  4JI2 T;  2UXD T;  4JI0 T;  4B3T T;  4AQY T;  4DV0 T;  4OX9 T;  1N32 T;  4K0K T;  4B3M T;  1J5E T;  4DV7 T;  4JI6 T;  1XMQ T;  4DV6 T;  1IBL T;  4LF9 T;  4DR1 T;  4JI5 T;  4LF4 T;  4DR6 T;  1N36 T;  4DR7 T;  4JI1 T;  4LFA T;  2UXB T;  5LMU T;  4LF5 T;  1HNW T;  1I94 T;  4JI4 T;  4X66 T;  2VQE T;  3T1H T;  4KHP T;  4X64 T;  2ZM6 T;  5IWA T;  4YHH T;  3T1Y T;  4JV5 T;  4DR5 T;  4DUZ T;  5LMN T;  4LFC T;  4B3S T;  4GKJ T;  2VQF T;  1XMO T;  2UXC T;  4JI8 T;  2UUC T;  5BR8 T;  4JI7 T;  4NXM T;  4DR4 T;  4X65 T;  4B3R T;  1IBK T;  4DV3 T;  4DR3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...