3T1HT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1hT00
4KHPT 1IBMT 1HR0T 2UUAT 3T1YT 2VQFT 4B3MT 2UXDT 4JI4T 4DV6T 4DUZT 1FJGT 4B3ST 4DV5T 4LF5T 4DR6T 4DV2T 1XMOT 4DR1T 5BR8T 2ZM6T 4JI1T 1N34T 1IBKT 2E5LT 4B3TT 4DR7T 4NXNT 3OTOT 4X62T 4DR3T 1XNRT 4LF6T 4K0KT 4OX9T 4LF4T 2UU9T 4X65T 4JI3T 4DV0T 4JI6T 2HHHT 4X64T 4LFAT 4GKKT 4X66T 1HNZT 4JYAT 4AQYT 1J5ET 4JI7T 1XNQT 2VQET 5LMNT 5IWAT 4GKJT 4LF9T 4JV5T 4DUYT 4LFCT 4YY3T 4DV7T 4DR4T 4LFBT 4LF7T 2UUCT 1N36T 4JI0T 4DR5T 4DV1T 1I94T 1HNWT 2UXBT 1N33T 3T1HT 4JI2T 1XMQT 4DV3T 4LF8T 4DR2T 4JI5T 4NXMT 4B3RT 2F4VT 1HNXT 1IBLT 2UUBT 4JI8T 1N32T 4DV4T 4YHHT 5LMUT 2UXCT
chains in the Genus database with same CATH superfamily
5M4YA 2XAQB 2UUAT 1D1BA 3FZLB 2E9XD 4A5XA 2NW9A 2XQ3A 5HXEA 5IHYA 1AJ3A 4WW0A 3C4WA 2XASB 4NXNT 2WMNA 3SFEA 2WWUA 4GK5E 1D0XA 2XTLA 5LHHB 3TLUA 1LVKA 1D0ZA 2WDRA 2V5DA 5H6QB 4TNWA 2UU9T 4JEHB 4U72A 4EYYR 4X66T 3PURA 1ZKEA 2XQYA 4PJMA 3VKHA 5F3JA 2WBLA 4H9RC 3VRBA 1OEDE 2WM9A 3VR9A 3PUVF 4U74A 1N36T 2NWBA 3VR8A 2OV9A 4AIUA 5ABGA 3GN5A 3ZMZB 5IUXA 5FXXA 1WYBA 3RPUA 4EGWA 4JI5T 5ABEA 3KBTA 5FY1A 4IIJE 2IUBA 3V5SA 5H6RB 1KEYA 3RYHE 4DO0A 2W4XA 2KINB 2XSAA 4P09A 3KV6A 3M3ZB 3M65A 3HKDE 4TZ4C 2JQQA 3KBUA 1M62A 2DNXA 1U5PA 2QVAA 5ABHA 4IDOA 3N2GE 2VK9A 2KLQA 3AVSA 4YT0A 3NRYA 4YXDA 3WAJA 2X9WA 5LA6E 1E1HB 3UQ4A 2A72A 4ZI2C 2K48A 5TAOA 2FBWA 2JMHA 5JRCA 1J5ET 2AXDS 1WRDA 1XNQT 5LGUB 5IWAT 2L8KA 2WSSV 2EHOB 2C0SA 3O9XA 2I59A 2NP9A 3MA9A 2LHNA 3HA4A 3S4UA 4CI2B 2BKOA 2YK0A 2BS4A 5FYMA 4WBOA 4QKNA 3BK9A 4LMKA 2K9AA 2CLYB 3Q5XA 1YQ3A 3G06A 4GIWA 4OK0A 3PUAA 3RIUA 4UVAB 3UULA 4AQGA 2XAHB 4DV6T 5HEHA 4K0UA 2J47A 2D9DA 5LG4A 2W62A 1CUNA 5FXVA 3I0OA 3KV5A 3OTOT 4OHFA 1NWMX 4NPPA 2KMFA 3UU6A 4TX5A 3JAEA 1X9BA 2JMKA 1ZEEA 3UUBA 3FHNA 2VL0A 2V5CA 3RLFF 3KFWX 2V7LA 3NBXX 1HTJF 1BR1A 5FNVE 4HWHA 4HWFA 2X67A 3BQKA 3U3IA 4LFCT 4QXHB 2XQ8A 2Q9QD 3B57A 4EAHA 3IA3A 5KDMC 4QX8B 1OEDC 3N9MA 3FZKB 3AE2A 3K1SA 2HN2A 1MMDA 1NENA 2FJDA 4TV8E 4CXYA 1G8XA 3ANWB 1OEDA 2W00A 4AKIA 4JI8T 2X9XA 1ZOYA 3AE1A 4KUMB 1IJ6A 2DL1A 3RRWA 4A98A 4KI0F 5HXSA 3N9NA 3RGLA 3AE6A 1VCTA 2G0UA 4UF0B 3O4XE 4CZZB 4GK0E 2JQKA 4MBQA 2E9XB 5J1GA 2V6XA 4B3TT 5FVKA 4NUVA 2X0YA 5FVLA 2M67A 3NWIA 4X20E 2KNDA 4F8HA 5CFBA 4PFOA 4PW8A 2XJ7A 1GQEA 3MZKB 3LJCA 3A5XA 2PFVA 5LJNA 4X65T 1MIYA 1QSDA 2LHRA 4X64T 3I0QA 4WBNE 2D5UA 2V8SV 2IIUA 5JTGA 2ZM8A 1HS7A 2CLYC 2V1DB 2QYWA 3PTRB 4I55E 1LRZA 4JV5T 4M1PA 4ZI3D 2R6GF 5FY0A 3P4QA 2X51A 2N9DA 3EUHA 4DV7T 4DR4T 1DU2A 4FI5A 2A3DA 2VURA 5CA1E 4DR5T 5L3FB 1S35A 3T1HT 3PU3A 4EZHA 3OKQA 4CI3B 3AE9A 3RIFA 3ZPOA 2BKNA 3EDVA 4YTNA 2UXXB 3HKEE 2WS3A 3D0TA 2V7MA 4ILCA 1MIWA 5EK2A 4YHJA 4DV5T 4DR6T 5JDQA 5JR9B 2C5JA 2P9BA 2C5KT 2K24A 4IE0A 4IGUA 1XDOA 5J2UE 4A56A 3KDSE 2V6YA 2KZ7B 5AQRB 5IYZE 3RHWA 4H9SE 5LGNB 2BZBA 2LM2A 4QH1A 1HG5A 4AKRB 4PK6A 3ZLIA 5HWYA 2BS2A 5EK3A 3B13A 4YTPA 3EAMA 3Q5DA 4LF7T 5FXWA 1HCIA 1NEKA 3RYFE 4YLHA 1WR6A 3UU4A 3AE4A 1CHUA 3OJAA 4U7IA 2E9XC 4OYJA 4U3CA 4OFZA 2MYSA 2ODUA 4ZHQE 2LLYA 2WDVA 3AA7B 4DVDA 2YDQA 5ETWA 3OYXA 4COFA 3VU7H 4ILUA 4H63V 3EVYA 1N32T 4DV4T 2E9XA 3NZPA 4EYUA 3AAAB 3L8RA 4P1NA 5LHIB 5JRCB 3LBXA 1IBMT 3P8CD 3NVOA 2YDRA 3FBLA 2FJAA 3SFDA 5KMGP 2JJ9A 4JEUB 4PK4A 2CHNA 1N34T 2Y6XA 2PJQA 4XAXB 4ZXLA 4HTEA 3EI0A 4DR3T 2N1GA 5JDGA 2K3WA 3QNUA 2KWIB 2Y48B 4PAGA 4IDPA 3CQXC 4OX9T 1FIOA 5JDHA 4EZ4A 1J5WA 2NW8A 4H63H 1HF8A 3MXZA 4QWNB 3ETUA 3VKGA 2J1DG 3PJAA 3UT5E 1BR4A 2X9YA 4LF9T 3O1JA 3BQIA 4QHOA 2VWAA 5FL1A 4ZEYA 1YW0A 2LE8A 2WZIA 5AQTB 4PFPA 5JR9C 1KNPA 5ABFB 2H88A 5FMNA 2WQYA 3IHRA 4UV8B 1ZV4X 3BQLA 5HEUA 2B76A 3LK2B 5AQHB 3ZMUB 1EZ3A 2BG9E 4L9IA 5JR9A 2V26A 2XQ9A 1IBLT 5FY7A 3IBPA 2CPTA 4AQFC 2OA5A 3RQWA 4EOZB 2XM2A 3JC6D 2Z6EA 4LF5T 2YU1A 3PUQA 4AQFA 4QXBB 1ZP0A 2XAFB 4ZZCA 1IZNB 3QB5K 2LJLA 5CGMA 3AEFA 4ZOLE 3J7Yq 4KX6A 3RIAA 4K0KT 4UVCB 2IW5B 2BG9B 3F31A 5L3GB 5L2LA 1OEDB 4IE6A 1E2AA 4UIGA 3QK6A 3WI3A 3ZCIA 4DNDA 3PE0A 2V7KA 3AEGA 1WLXA 4GKJT 4HWIB 3AXJB 2LRKA 2IHR1 5LBQB 3AEBA 4E7ZA 3IEEA 3PUYF 3JAFA 4IE4A 4TUYE 1W0AA 2RA1A 3U78A 4I4TE 1FMVA 3VHLA 5JH7E 3AE7A 1NAFA 3CPZA 2E2AA 3UFEA 4O4IE 1YQ4A 5AQPB 2VL8A 5L3EB 2LRLA 4KHZF 1YKHB 1JNZA 2XZEA 3ZMTB 3Q2MA 3PDYA 3FZMB 3CMLA 3C4ZA 2WU2A 3PUZF 4IDNA 3RIUC 3I9WA 3UUNA 3A7MA 1IBKT 2K5BB 4YSYA 1I6ZA 4NUUA 3ZT5A 5HEJA 2LM9A 2NTYA 4B6XA 2IDOB 4JBWF 3MJXA 1MIVA 2VKJA 2WZHA 4JI3T 1SA0E 5LB7B 4YSZA 5AQVB 2WY2A 1MNEA 4CN6A 1HNZT 4WZXA 1T98A 5ABFA 4ZI2D 4AQYT 3R6NA 4PK5A 1SUMB 2Q9QA 3SOLA 3OBVE 4L5GA 2MPKA 2XAJB 2DLRA 1WR0A 3FB2A 5LG3A 4BAYB 3IF8B 5LCYA 4JI0T 5JREA 3AAIA 5L4HA 4C91A 5DJQC 3X1DA 3ZCJA 1XZYA 2RPAA 5EK4A 3RX6A 3CX7B 2V6YB 3AA6B 5AQFB 3P4RA 2BS3A 5DQVA 2N2NA 2YINA 3EABA 5J0ZA 1XWMA 4GYSA 2BG9C 4HFIA 4I43B 3V5UA 3DP7A 4DR1T 2BG9A 2YU2A 4JI1T 3L09A 2ODVA 2SPCA 3ZYKA 3LG7A 2LSYA 5HXRA 5C2TA 2DWKA 4FJOA 3ZMVB 1UURA 2CRBA 4ZI3C 4BJMA 5DQWA 2HN1A 2I6HA 3JADA 3AXJA 3RQUA 3OPCA 4LF4T 1T72A 5L3CB 3ZSTA 2BBJA 5JQGE 4UV9B 4KBMB 3FZHB 3CKDA 3CX6B 3LBXB 3GWHA 4WYVA 4IDQA 4A97A 3AA1B 2QRXA 4MLKA 4H9QC 1LVFA 3N9PA 5AQKB 4DMVA 5AQLB 5DABA 3N9QA 1YD8G 3HKCE 5J2TE 2KXPB 2C5IT 3A8YC 2BBHA 3I9YA 4UEMA 4ISTA 1W9RA 2ZLYA 2BVLA 4YHHT 4IL9A 3ONLC 1WYCA 4I50E 3N5LA 5AQMB 2KSRA 2D0UA 4H9PC 1KK7A 3UU5A 2CE7A 3HI2A 4ADZA 4EIWA 3ZYMA 4EEBA 5C3JA 1L0VA 2CBJA 2IC6A 3O1HA 2LEHA 3RKOA 1MMAA 1V9DA 1XNRT 2EHOD 4LF6T 4HKAA 2WAUA 4UXNB 3P4SA 4MFRA 4ERRA 3JCFA 4LMLA 5LP6E 4JI6T 4P0BA 3OVUA 2NW7A 4LFAT 5LYJE 2WP9A 1FMWA 1S94A 1Z8UA 3I1AA 3TLVA 2DI4A 3PUXF 2E8IA 3W15B 3ZC0A 3N9LA 5LBMA 2W66A 4XZCA 5L4EA 2LT3A 2VKOA 5LNKA 5A1LA 1WCRA 3UQ7A 3B5MA 4LFBT 3E08A 1MNDA 4U31A 5ADXL 2KT9A 3AE3A 3RF1A 4HEAA 2CMRA 4U7YA 3C64A 1OXZA 2LKGA 5E0OA 3RI5A 4O2BE 3UUMA 4X1IE 5AQOB 1HNXT 2MBGA 2CCQA 2UUBT 1QUUA 2D2SA 2X0LB 3AECA 3UFGA 3R84B 3OYZA 2CWOA 4HFBA 2IAKA 1UGOA 1JNRA 4JI4T 5HAXA 4F6RC 4HFVA 2OLTA 3H3MA 1LKXA 4IHJE 4PJNA 2X68A 1HFAA 3ZJ2A 3LK3B 4E7SA 4L0RA 1MMGA 4IDZA 4QH4A 3NZQA 4DV0T 2NR4A 4G2AA 1OWAA 4DBRA 1KF6A 4JLEA 3ZKRA 2CWYA 3AEEA 3ESLA 4JI7T 3NRXA 4ISSA 2PTFA 2LSJA 3C50A 2W0GA 2H7OA 4O4JE 2DHRA 2AE9A 2LSIA 3JC6C 4PJLA 1KFYA 5HXHA 4DV3T 4O4LE 1US7B 1G73A 4AXPA 2X9HA 5LMUT 5HEGA 4HFCA 1HG2A 3ZN0B 2Q9QB 2XHEB 4HE8A 4KMCA 4ILBA 5LJMA 1FJGT 5LHGB 3L39A 4DV2T 3PU8A 3RC3A 3PJAJ 2ZM6T 2WCAA 4HWCA 2DWGA 3RH3A 4TN7B 4GOUA 3RYIE 2A2FX 5FKYA 3CK6A 3AA0B 3MK7C 2JRKA 3KINB 4ZZBA 4V1Av 1XDPA 2HPLA 3K3NA 3TLWA 2YDSA 1O3XA 1IAPA 2CM0A 3UU8A 3SWHA 2UXNB 3HKBE 3ONJA 2QA7A 3E22E 5JVDE 4EEDA 3AE5A 3UUXB 2V7JA 5HYAA 2W61A 4DR2T 4XBFB 2E5VA 3P4WA 1HX8A 4ZI7E 4UR9A 4IE7A 3KV9A 4HN9A 1VRBA 1UK5A 2PBIA 2WWVA 5JDNA 4C90A 1YKEB 4UVBB 3T1YT 2VQFT 3ZN1B 3P50A 4B3ST 1U4QA 2L3LA 3RYCE 3GMIA 3LSVA 2H89A 4P0AA 3Q5EA 4YJ3E 4Z91A 3C51A 2IC9A 3E0ZA 2CA5A 2A9UA 5FL0A 2FJEA 4G63A 4QH5A 2M6BA 2VKHA 3ZT6A 1UX4A 3P7IA 2DCFA 4GYRA 2CXLA 5AFUL 5GONE 3AVRA 4IREA 1D1CA 3TLSA 3AB3B 4GKKT 1MMNA 2YEVC 4TV9E 3GA8A 2JIWA 4BJNA 3K3OA 4UELA 5AQIB 2JPFA 3QB5A 2H7VC 4HFEA 5F5WA 2BVMA 2CXFA 4LMJA 1QLBA 2WMOA 2FJBA 2Q9QC 3KV4A 1BR2A 4H9OC 4DBQA 3UTKA 4Z8XA 3CVRA 1ZHCA 1D0YA 1Y01A 3PUSA 3QUJA 4QX7B 1I94T 2UXBT 2XQ4A 3K8PC 2KWHA 1W0BA 2XQ7A 4X1KE 3RC8A 5HCJA 2I0MA 3TKLB 2XAGB 2JQHA 1UX5A 2GK9A 5HXCA 5CJ5A 4KHPT 4H9NC 3ZT7A 4CXWA 4B3MT 2UXDT 4O2AE 3ONXA 1W09A 3WAKA 3CQCB 4HWDA 2XM1A 1UCUA 3SS1A 3ZSSA 3FXEB 5JDFA 2J4GA 3ZMSB 1D1AA 3K3QC 4O8SA 2JQ9A 1E7PA 3SRZA 2M6IA 5L3DB 2ACXA 3P4PA 3AE8A 4J2CA 2ACZA 2X0HA 2MTQA 3ABVA 2H3RA 5F8PA 5LXTE 4HFHA 2HHHT 3RKGA 3AEAA 4IE5A 2HPJA 4YFSA 4CN1A 4JUYA 3MACA 5HCMA 1B7TA 3F2EA 2VQET 2LSKA 4TNVA 3H37A 3CIRA 2NTXA 3KVBA 5FXZA 2XQ6A 3J9X1 5FP3A 3ZC1A 4YY3T 3DJBA 3CWZB 2WU5A 2UUCT 2WB5A 3QC9A 2W2UA 3TLTA 1N33T 1KNZA 1SHZC 2LSGA 5EZYE 3ZJ1A 1XMQT 3N2OA 4NIQA 2PG8A 2VVSA 3PUGA 1SE7A 5HEOA 2Y8DA 5AQSB 2NOXA 4N78D 2F4VT 1X79A 4AKLA 2W67A 3MKDA 1YXRA 3LFMA 4TWDA 3EDUA 2UXCT 4EXTA 2IMLA 2EHOC 4I0UA 4ASKA 1HR0T 4U2ZA 3CQGB 2ZM2A 1VCSA 4YSXA 2XY8B 3ETVA 2XQ5A 4CXXA 2VASA 4HFDA 1UUSA 2WDQA 2EHOA 2BDEA 5C8YE 3T8OA 2CEAA 4X5TA 2E5LT 3O1IA 2LKHA 4Q25A 2ZM0A 3AEDA 2D0TA 1FEWA 2CXDA 4X1YE 3ZYLA 4ZS3A 4AI6A 2VVNA 2LOPA 4KP3C 1VOMA 1R8IA 1HX1B 3KVAA 4CQIA 2QGSA 2YN6A 4DMWA 4O4HE 5L47A 4JYAT 5CB4E 1WFDA 2LOSA 5LMNT 2B1EA 3EHZA 4AISA 2VB6A 4U2YA 5L3BB 5AQGB 2XQAA 2CHOA 5LGTB 2J62A 4TWFA 3Q9DA 4ILAA 5HWXA 4IL4A 4DV1T 3VRAA 1HNWT 4JI2T 3QOFA 4PJJA 4LF8T 3DTOA 4TWHA 4U33A 5AQNB 3PUWF 5BMVE 4WNKA 5AQQB 4MHCA 3H3AA 3RRCA 3FBZA 1M7KA 3GN5B 5AQUB 3LDQB 2RP4A 5AQJB 3CX8B 2XSBA 1Y64B 5LOVE 4DUZT 4HGAA 3Q5WA 2MAWA 1XMOT 4Z90A 2XPKA 5BR8T 2HH7A 4EB6E 4DR7T 1T8BA 4X62T 5CA0E 4ZS2A 2CBIA 2X66A 2V7IA 1T7SA 2VKDA 1J1JA 5KXJA 4OYKA 4DIDB 4EV6A 4BA9A 4MALA 1KNRA 5KX5E 3NKZA 3ANWA 3AAEB 1H7CA 1BR0A 3FXDB 3C98B 5JDMA 2FUPA 2MOZA 2W63A 4QXCB 4AKHA 4AKGA 3N9OA 4UF0A 3LK42 4DUYT 2L9QA 1Z0PA 4PNIA 4CI1B 2XUEA 3UU3A 3C4XA 3N2KE 4CN4A 2ES0A 3HL6A 4YJ2E 2YKSA 5JDLA 2YOEA 4ANJA 4NXMT 3L3PA 4B3RT 3F57A 4IT4A 3HR0A 3PV0F 4YTMA 3ZEFB 3FZFB 2BKPA 1IJ5A 2ZMAA
chains in the Genus database with same CATH topology
4KHPT 1IBMT 1HR0T 2UUAT 3T1YT 2VQFT 4B3MT 2UXDT 4JI4T 4DV6T 4DUZT 1FJGT 4B3ST 4DV5T 4LF5T 4DR6T 4DV2T 1XMOT 4DR1T 5BR8T 2ZM6T 4JI1T 1N34T 1IBKT 2E5LT 4B3TT 4DR7T 4NXNT 3OTOT 4X62T 4DR3T 1XNRT 4LF6T 4K0KT 4OX9T 4LF4T 2UU9T 4X65T 4JI3T 4DV0T 4JI6T 2HHHT 4X64T 4LFAT 4GKKT 4X66T 1HNZT 4JYAT 4AQYT 1J5ET 4JI7T 1XNQT 2VQET 5LMNT 5IWAT 4GKJT 4LF9T 4JV5T 4DUYT 4LFCT 4YY3T 4DV7T 4DR4T 4LFBT 4LF7T 2UUCT 1N36T 4JI0T 4DR5T 4DV1T 1I94T 1HNWT 2UXBT 1N33T 3T1HT 4JI2T 1XMQT 4DV3T 4LF8T 4DR2T 4JI5T 4NXMT 4B3RT 2F4VT 1HNXT 1IBLT 2UUBT 4JI8T 1N32T 4DV4T 4YHHT 5LMUT 2UXCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP T;  1IBM T;  1HR0 T;  2UUA T;  3T1Y T;  2VQF T;  4B3M T;  2UXD T;  4JI4 T;  4DV6 T;  4DUZ T;  1FJG T;  4B3S T;  4DV5 T;  4LF5 T;  4DR6 T;  4DV2 T;  1XMO T;  4DR1 T;  5BR8 T;  2ZM6 T;  4JI1 T;  1N34 T;  1IBK T;  2E5L T;  4B3T T;  4DR7 T;  4NXN T;  3OTO T;  4X62 T;  4DR3 T;  1XNR T;  4LF6 T;  4K0K T;  4OX9 T;  4LF4 T;  2UU9 T;  4X65 T;  4JI3 T;  4DV0 T;  4JI6 T;  2HHH T;  4X64 T;  4LFA T;  4GKK T;  4X66 T;  1HNZ T;  4JYA T;  4AQY T;  1J5E T;  4JI7 T;  1XNQ T;  2VQE T;  5LMN T;  5IWA T;  4GKJ T;  4LF9 T;  4JV5 T;  4DUY T;  4LFC T;  4YY3 T;  4DV7 T;  4DR4 T;  4LFB T;  4LF7 T;  2UUC T;  1N36 T;  4JI0 T;  4DR5 T;  4DV1 T;  1I94 T;  1HNW T;  2UXB T;  1N33 T;  3T1H T;  4JI2 T;  1XMQ T;  4DV3 T;  4LF8 T;  4DR2 T;  4JI5 T;  4NXM T;  4B3R T;  2F4V T;  1HNX T;  1IBL T;  2UUB T;  4JI8 T;  1N32 T;  4DV4 T;  4YHH T;  5LMU T;  2UXC T; 
#chains in the Genus database with same CATH topology
 5M4Y A;  2XAQ B;  2UUA T;  1D1B A;  3FZL B;  2E9X D;  4A5X A;  2NW9 A;  2XQ3 A;  5HXE A;  5IHY A;  1AJ3 A;  4WW0 A;  3C4W A;  2XAS B;  4NXN T;  2WMN A;  3SFE A;  2WWU A;  4GK5 E;  1D0X A;  2XTL A;  5LHH B;  3TLU A;  1LVK A;  1D0Z A;  2WDR A;  2V5D A;  5H6Q B;  4TNW A;  2UU9 T;  4JEH B;  4U72 A;  4EYY R;  4X66 T;  3PUR A;  1ZKE A;  2XQY A;  4PJM A;  3VKH A;  5F3J A;  2WBL A;  4H9R C;  3VRB A;  1OED E;  2WM9 A;  3VR9 A;  3PUV F;  4U74 A;  1N36 T;  2NWB A;  3VR8 A;  2OV9 A;  4AIU A;  5ABG A;  3GN5 A;  3ZMZ B;  5IUX A;  5FXX A;  1WYB A;  3RPU A;  4EGW A;  4JI5 T;  5ABE A;  3KBT A;  5FY1 A;  4IIJ E;  2IUB A;  3V5S A;  5H6R B;  1KEY A;  3RYH E;  4DO0 A;  2W4X A;  2KIN B;  2XSA A;  4P09 A;  3KV6 A;  3M3Z B;  3M65 A;  3HKD E;  4TZ4 C;  2JQQ A;  3KBU A;  1M62 A;  2DNX A;  1U5P A;  2QVA A;  5ABH A;  4IDO A;  3N2G E;  2VK9 A;  2KLQ A;  3AVS A;  4YT0 A;  3NRY A;  4YXD A;  3WAJ A;  2X9W A;  5LA6 E;  1E1H B;  3UQ4 A;  2A72 A;  4ZI2 C;  2K48 A;  5TAO A;  2FBW A;  2JMH A;  5JRC A;  1J5E T;  2AXD S;  1WRD A;  1XNQ T;  5LGU B;  5IWA T;  2L8K A;  2WSS V;  2EHO B;  2C0S A;  3O9X A;  2I59 A;  2NP9 A;  3MA9 A;  2LHN A;  3HA4 A;  3S4U A;  4CI2 B;  2BKO A;  2YK0 A;  2BS4 A;  5FYM A;  4WBO A;  4QKN A;  3BK9 A;  4LMK A;  2K9A A;  2CLY B;  3Q5X A;  1YQ3 A;  3G06 A;  4GIW A;  4OK0 A;  3PUA A;  3RIU A;  4UVA B;  3UUL A;  4AQG A;  2XAH B;  4DV6 T;  5HEH A;  4K0U A;  2J47 A;  2D9D A;  5LG4 A;  2W62 A;  1CUN A;  5FXV A;  3I0O A;  3KV5 A;  3OTO T;  4OHF A;  1NWM X;  4NPP A;  2KMF A;  3UU6 A;  4TX5 A;  3JAE A;  1X9B A;  2JMK A;  1ZEE A;  3UUB A;  3FHN A;  2VL0 A;  2V5C A;  3RLF F;  3KFW X;  2V7L A;  3NBX X;  1HTJ F;  1BR1 A;  5FNV E;  4HWH A;  4HWF A;  2X67 A;  3BQK A;  3U3I A;  4LFC T;  4QXH B;  2XQ8 A;  2Q9Q D;  3B57 A;  4EAH A;  3IA3 A;  5KDM C;  4QX8 B;  1OED C;  3N9M A;  3FZK B;  3AE2 A;  3K1S A;  2HN2 A;  1MMD A;  1NEN A;  2FJD A;  4TV8 E;  4CXY A;  1G8X A;  3ANW B;  1OED A;  2W00 A;  4AKI A;  4JI8 T;  2X9X A;  1ZOY A;  3AE1 A;  4KUM B;  1IJ6 A;  2DL1 A;  3RRW A;  4A98 A;  4KI0 F;  5HXS A;  3N9N A;  3RGL A;  3AE6 A;  1VCT A;  2G0U A;  4UF0 B;  3O4X E;  4CZZ B;  4GK0 E;  2JQK A;  4MBQ A;  2E9X B;  5J1G A;  2V6X A;  4B3T T;  5FVK A;  4NUV A;  2X0Y A;  5FVL A;  2M67 A;  3NWI A;  4X20 E;  2KND A;  4F8H A;  5CFB A;  4PFO A;  4PW8 A;  2XJ7 A;  1GQE A;  3MZK B;  3LJC A;  3A5X A;  2PFV A;  5LJN A;  4X65 T;  1MIY A;  1QSD A;  2LHR A;  4X64 T;  3I0Q A;  4WBN E;  2D5U A;  2V8S V;  2IIU A;  5JTG A;  2ZM8 A;  1HS7 A;  2CLY C;  2V1D B;  2QYW A;  3PTR B;  4I55 E;  1LRZ A;  4JV5 T;  4M1P A;  4ZI3 D;  2R6G F;  5FY0 A;  3P4Q A;  2X51 A;  2N9D A;  3EUH A;  4DV7 T;  4DR4 T;  1DU2 A;  4FI5 A;  2A3D A;  2VUR A;  5CA1 E;  4DR5 T;  5L3F B;  1S35 A;  3T1H T;  3PU3 A;  4EZH A;  3OKQ A;  4CI3 B;  3AE9 A;  3RIF A;  3ZPO A;  2BKN A;  3EDV A;  4YTN A;  2UXX B;  3HKE E;  2WS3 A;  3D0T A;  2V7M A;  4ILC A;  1MIW A;  5EK2 A;  4YHJ A;  4DV5 T;  4DR6 T;  5JDQ A;  5JR9 B;  2C5J A;  2P9B A;  2C5K T;  2K24 A;  4IE0 A;  4IGU A;  1XDO A;  5J2U E;  4A56 A;  3KDS E;  2V6Y A;  2KZ7 B;  5AQR B;  5IYZ E;  3RHW A;  4H9S E;  5LGN B;  2BZB A;  2LM2 A;  4QH1 A;  1HG5 A;  4AKR B;  4PK6 A;  3ZLI A;  5HWY A;  2BS2 A;  5EK3 A;  3B13 A;  4YTP A;  3EAM A;  3Q5D A;  4LF7 T;  5FXW A;  1HCI A;  1NEK A;  3RYF E;  4YLH A;  1WR6 A;  3UU4 A;  3AE4 A;  1CHU A;  3OJA A;  4U7I A;  2E9X C;  4OYJ A;  4U3C A;  4OFZ A;  2MYS A;  2ODU A;  4ZHQ E;  2LLY A;  2WDV A;  3AA7 B;  4DVD A;  2YDQ A;  5ETW A;  3OYX A;  4COF A;  3VU7 H;  4ILU A;  4H63 V;  3EVY A;  1N32 T;  4DV4 T;  2E9X A;  3NZP A;  4EYU A;  3AAA B;  3L8R A;  4P1N A;  5LHI B;  5JRC B;  3LBX A;  1IBM T;  3P8C D;  3NVO A;  2YDR A;  3FBL A;  2FJA A;  3SFD A;  5KMG P;  2JJ9 A;  4JEU B;  4PK4 A;  2CHN A;  1N34 T;  2Y6X A;  2PJQ A;  4XAX B;  4ZXL A;  4HTE A;  3EI0 A;  4DR3 T;  2N1G A;  5JDG A;  2K3W A;  3QNU A;  2KWI B;  2Y48 B;  4PAG A;  4IDP A;  3CQX C;  4OX9 T;  1FIO A;  5JDH A;  4EZ4 A;  1J5W A;  2NW8 A;  4H63 H;  1HF8 A;  3MXZ A;  4QWN B;  3ETU A;  3VKG A;  2J1D G;  3PJA A;  3UT5 E;  1BR4 A;  2X9Y A;  4LF9 T;  3O1J A;  3BQI A;  4QHO A;  2VWA A;  5FL1 A;  4ZEY A;  1YW0 A;  2LE8 A;  2WZI A;  5AQT B;  4PFP A;  5JR9 C;  1KNP A;  5ABF B;  2H88 A;  5FMN A;  2WQY A;  3IHR A;  4UV8 B;  1ZV4 X;  3BQL A;  5HEU A;  2B76 A;  3LK2 B;  5AQH B;  3ZMU B;  1EZ3 A;  2BG9 E;  4L9I A;  5JR9 A;  2V26 A;  2XQ9 A;  1IBL T;  5FY7 A;  3IBP A;  2CPT A;  4AQF C;  2OA5 A;  3RQW A;  4EOZ B;  2XM2 A;  3JC6 D;  2Z6E A;  4LF5 T;  2YU1 A;  3PUQ A;  4AQF A;  4QXB B;  1ZP0 A;  2XAF B;  4ZZC A;  1IZN B;  3QB5 K;  2LJL A;  5CGM A;  3AEF A;  4ZOL E;  3J7Y q;  4KX6 A;  3RIA A;  4K0K T;  4UVC B;  2IW5 B;  2BG9 B;  3F31 A;  5L3G B;  5L2L A;  1OED B;  4IE6 A;  1E2A A;  4UIG A;  3QK6 A;  3WI3 A;  3ZCI A;  4DND A;  3PE0 A;  2V7K A;  3AEG A;  1WLX A;  4GKJ T;  4HWI B;  3AXJ B;  2LRK A;  2IHR 1;  5LBQ B;  3AEB A;  4E7Z A;  3IEE A;  3PUY F;  3JAF A;  4IE4 A;  4TUY E;  1W0A A;  2RA1 A;  3U78 A;  4I4T E;  1FMV A;  3VHL A;  5JH7 E;  3AE7 A;  1NAF A;  3CPZ A;  2E2A A;  3UFE A;  4O4I E;  1YQ4 A;  5AQP B;  2VL8 A;  5L3E B;  2LRL A;  4KHZ F;  1YKH B;  1JNZ A;  2XZE A;  3ZMT B;  3Q2M A;  3PDY A;  3FZM B;  3CML A;  3C4Z A;  2WU2 A;  3PUZ F;  4IDN A;  3RIU C;  3I9W A;  3UUN A;  3A7M A;  1IBK T;  2K5B B;  4YSY A;  1I6Z A;  4NUU A;  3ZT5 A;  5HEJ A;  2LM9 A;  2NTY A;  4B6X A;  2IDO B;  4JBW F;  3MJX A;  1MIV A;  2VKJ A;  2WZH A;  4JI3 T;  1SA0 E;  5LB7 B;  4YSZ A;  5AQV B;  2WY2 A;  1MNE A;  4CN6 A;  1HNZ T;  4WZX A;  1T98 A;  5ABF A;  4ZI2 D;  4AQY T;  3R6N A;  4PK5 A;  1SUM B;  2Q9Q A;  3SOL A;  3OBV E;  4L5G A;  2MPK A;  2XAJ B;  2DLR A;  1WR0 A;  3FB2 A;  5LG3 A;  4BAY B;  3IF8 B;  5LCY A;  4JI0 T;  5JRE A;  3AAI A;  5L4H A;  4C91 A;  5DJQ C;  3X1D A;  3ZCJ A;  1XZY A;  2RPA A;  5EK4 A;  3RX6 A;  3CX7 B;  2V6Y B;  3AA6 B;  5AQF B;  3P4R A;  2BS3 A;  5DQV A;  2N2N A;  2YIN A;  3EAB A;  5J0Z A;  1XWM A;  4GYS A;  2BG9 C;  4HFI A;  4I43 B;  3V5U A;  3DP7 A;  4DR1 T;  2BG9 A;  2YU2 A;  4JI1 T;  3L09 A;  2ODV A;  2SPC A;  3ZYK A;  3LG7 A;  2LSY A;  5HXR A;  5C2T A;  2DWK A;  4FJO A;  3ZMV B;  1UUR A;  2CRB A;  4ZI3 C;  4BJM A;  5DQW A;  2HN1 A;  2I6H A;  3JAD A;  3AXJ A;  3RQU A;  3OPC A;  4LF4 T;  1T72 A;  5L3C B;  3ZST A;  2BBJ A;  5JQG E;  4UV9 B;  4KBM B;  3FZH B;  3CKD A;  3CX6 B;  3LBX B;  3GWH A;  4WYV A;  4IDQ A;  4A97 A;  3AA1 B;  2QRX A;  4MLK A;  4H9Q C;  1LVF A;  3N9P A;  5AQK B;  4DMV A;  5AQL B;  5DAB A;  3N9Q A;  1YD8 G;  3HKC E;  5J2T E;  2KXP B;  2C5I T;  3A8Y C;  2BBH A;  3I9Y A;  4UEM A;  4IST A;  1W9R A;  2ZLY A;  2BVL A;  4YHH T;  4IL9 A;  3ONL C;  1WYC A;  4I50 E;  3N5L A;  5AQM B;  2KSR A;  2D0U A;  4H9P C;  1KK7 A;  3UU5 A;  2CE7 A;  3HI2 A;  4ADZ A;  4EIW A;  3ZYM A;  4EEB A;  5C3J A;  1L0V A;  2CBJ A;  2IC6 A;  3O1H A;  2LEH A;  3RKO A;  1MMA A;  1V9D A;  1XNR T;  2EHO D;  4LF6 T;  4HKA A;  2WAU A;  4UXN B;  3P4S A;  4MFR A;  4ERR A;  3JCF A;  4LML A;  5LP6 E;  4JI6 T;  4P0B A;  3OVU A;  2NW7 A;  4LFA T;  5LYJ E;  2WP9 A;  1FMW A;  1S94 A;  1Z8U A;  3I1A A;  3TLV A;  2DI4 A;  3PUX F;  2E8I A;  3W15 B;  3ZC0 A;  3N9L A;  5LBM A;  2W66 A;  4XZC A;  5L4E A;  2LT3 A;  2VKO A;  5LNK A;  5A1L A;  1WCR A;  3UQ7 A;  3B5M A;  4LFB T;  3E08 A;  1MND A;  4U31 A;  5ADX L;  2KT9 A;  3AE3 A;  3RF1 A;  4HEA A;  2CMR A;  4U7Y A;  3C64 A;  1OXZ A;  2LKG A;  5E0O A;  3RI5 A;  4O2B E;  3UUM A;  4X1I E;  5AQO B;  1HNX T;  2MBG A;  2CCQ A;  2UUB T;  1QUU A;  2D2S A;  2X0L B;  3AEC A;  3UFG A;  3R84 B;  3OYZ A;  2CWO A;  4HFB A;  2IAK A;  1UGO A;  1JNR A;  4JI4 T;  5HAX A;  4F6R C;  4HFV A;  2OLT A;  3H3M A;  1LKX A;  4IHJ E;  4PJN A;  2X68 A;  1HFA A;  3ZJ2 A;  3LK3 B;  4E7S A;  4L0R A;  1MMG A;  4IDZ A;  4QH4 A;  3NZQ A;  4DV0 T;  2NR4 A;  4G2A A;  1OWA A;  4DBR A;  1KF6 A;  4JLE A;  3ZKR A;  2CWY A;  3AEE A;  3ESL A;  4JI7 T;  3NRX A;  4ISS A;  2PTF A;  2LSJ A;  3C50 A;  2W0G A;  2H7O A;  4O4J E;  2DHR A;  2AE9 A;  2LSI A;  3JC6 C;  4PJL A;  1KFY A;  5HXH A;  4DV3 T;  4O4L E;  1US7 B;  1G73 A;  4AXP A;  2X9H A;  5LMU T;  5HEG A;  4HFC A;  1HG2 A;  3ZN0 B;  2Q9Q B;  2XHE B;  4HE8 A;  4KMC A;  4ILB A;  5LJM A;  1FJG T;  5LHG B;  3L39 A;  4DV2 T;  3PU8 A;  3RC3 A;  3PJA J;  2ZM6 T;  2WCA A;  4HWC A;  2DWG A;  3RH3 A;  4TN7 B;  4GOU A;  3RYI E;  2A2F X;  5FKY A;  3CK6 A;  3AA0 B;  3MK7 C;  2JRK A;  3KIN B;  4ZZB A;  4V1A v;  1XDP A;  2HPL A;  3K3N A;  3TLW A;  2YDS A;  1O3X A;  1IAP A;  2CM0 A;  3UU8 A;  3SWH A;  2UXN B;  3HKB E;  3ONJ A;  2QA7 A;  3E22 E;  5JVD E;  4EED A;  3AE5 A;  3UUX B;  2V7J A;  5HYA A;  2W61 A;  4DR2 T;  4XBF B;  2E5V A;  3P4W A;  1HX8 A;  4ZI7 E;  4UR9 A;  4IE7 A;  3KV9 A;  4HN9 A;  1VRB A;  1UK5 A;  2PBI A;  2WWV A;  5JDN A;  4C90 A;  1YKE B;  4UVB B;  3T1Y T;  2VQF T;  3ZN1 B;  3P50 A;  4B3S T;  1U4Q A;  2L3L A;  3RYC E;  3GMI A;  3LSV A;  2H89 A;  4P0A A;  3Q5E A;  4YJ3 E;  4Z91 A;  3C51 A;  2IC9 A;  3E0Z A;  2CA5 A;  2A9U A;  5FL0 A;  2FJE A;  4G63 A;  4QH5 A;  2M6B A;  2VKH A;  3ZT6 A;  1UX4 A;  3P7I A;  2DCF A;  4GYR A;  2CXL A;  5AFU L;  5GON E;  3AVR A;  4IRE A;  1D1C A;  3TLS A;  3AB3 B;  4GKK T;  1MMN A;  2YEV C;  4TV9 E;  3GA8 A;  2JIW A;  4BJN A;  3K3O A;  4UEL A;  5AQI B;  2JPF A;  3QB5 A;  2H7V C;  4HFE A;  5F5W A;  2BVM A;  2CXF A;  4LMJ A;  1QLB A;  2WMO A;  2FJB A;  2Q9Q C;  3KV4 A;  1BR2 A;  4H9O C;  4DBQ A;  3UTK A;  4Z8X A;  3CVR A;  1ZHC A;  1D0Y A;  1Y01 A;  3PUS A;  3QUJ A;  4QX7 B;  1I94 T;  2UXB T;  2XQ4 A;  3K8P C;  2KWH A;  1W0B A;  2XQ7 A;  4X1K E;  3RC8 A;  5HCJ A;  2I0M A;  3TKL B;  2XAG B;  2JQH A;  1UX5 A;  2GK9 A;  5HXC A;  5CJ5 A;  4KHP T;  4H9N C;  3ZT7 A;  4CXW A;  4B3M T;  2UXD T;  4O2A E;  3ONX A;  1W09 A;  3WAK A;  3CQC B;  4HWD A;  2XM1 A;  1UCU A;  3SS1 A;  3ZSS A;  3FXE B;  5JDF A;  2J4G A;  3ZMS B;  1D1A A;  3K3Q C;  4O8S A;  2JQ9 A;  1E7P A;  3SRZ A;  2M6I A;  5L3D B;  2ACX A;  3P4P A;  3AE8 A;  4J2C A;  2ACZ A;  2X0H A;  2MTQ A;  3ABV A;  2H3R A;  5F8P A;  5LXT E;  4HFH A;  2HHH T;  3RKG A;  3AEA A;  4IE5 A;  2HPJ A;  4YFS A;  4CN1 A;  4JUY A;  3MAC A;  5HCM A;  1B7T A;  3F2E A;  2VQE T;  2LSK A;  4TNV A;  3H37 A;  3CIR A;  2NTX A;  3KVB A;  5FXZ A;  2XQ6 A;  3J9X 1;  5FP3 A;  3ZC1 A;  4YY3 T;  3DJB A;  3CWZ B;  2WU5 A;  2UUC T;  2WB5 A;  3QC9 A;  2W2U A;  3TLT A;  1N33 T;  1KNZ A;  1SHZ C;  2LSG A;  5EZY E;  3ZJ1 A;  1XMQ T;  3N2O A;  4NIQ A;  2PG8 A;  2VVS A;  3PUG A;  1SE7 A;  5HEO A;  2Y8D A;  5AQS B;  2NOX A;  4N78 D;  2F4V T;  1X79 A;  4AKL A;  2W67 A;  3MKD A;  1YXR A;  3LFM A;  4TWD A;  3EDU A;  2UXC T;  4EXT A;  2IML A;  2EHO C;  4I0U A;  4ASK A;  1HR0 T;  4U2Z A;  3CQG B;  2ZM2 A;  1VCS A;  4YSX A;  2XY8 B;  3ETV A;  2XQ5 A;  4CXX A;  2VAS A;  4HFD A;  1UUS A;  2WDQ A;  2EHO A;  2BDE A;  5C8Y E;  3T8O A;  2CEA A;  4X5T A;  2E5L T;  3O1I A;  2LKH A;  4Q25 A;  2ZM0 A;  3AED A;  2D0T A;  1FEW A;  2CXD A;  4X1Y E;  3ZYL A;  4ZS3 A;  4AI6 A;  2VVN A;  2LOP A;  4KP3 C;  1VOM A;  1R8I A;  1HX1 B;  3KVA A;  4CQI A;  2QGS A;  2YN6 A;  4DMW A;  4O4H E;  5L47 A;  4JYA T;  5CB4 E;  1WFD A;  2LOS A;  5LMN T;  2B1E A;  3EHZ A;  4AIS A;  2VB6 A;  4U2Y A;  5L3B B;  5AQG B;  2XQA A;  2CHO A;  5LGT B;  2J62 A;  4TWF A;  3Q9D A;  4ILA A;  5HWX A;  4IL4 A;  4DV1 T;  3VRA A;  1HNW T;  4JI2 T;  3QOF A;  4PJJ A;  4LF8 T;  3DTO A;  4TWH A;  4U33 A;  5AQN B;  3PUW F;  5BMV E;  4WNK A;  5AQQ B;  4MHC A;  3H3A A;  3RRC A;  3FBZ A;  1M7K A;  3GN5 B;  5AQU B;  3LDQ B;  2RP4 A;  5AQJ B;  3CX8 B;  2XSB A;  1Y64 B;  5LOV E;  4DUZ T;  4HGA A;  3Q5W A;  2MAW A;  1XMO T;  4Z90 A;  2XPK A;  5BR8 T;  2HH7 A;  4EB6 E;  4DR7 T;  1T8B A;  4X62 T;  5CA0 E;  4ZS2 A;  2CBI A;  2X66 A;  2V7I A;  1T7S A;  2VKD A;  1J1J A;  5KXJ A;  4OYK A;  4DID B;  4EV6 A;  4BA9 A;  4MAL A;  1KNR A;  5KX5 E;  3NKZ A;  3ANW A;  3AAE B;  1H7C A;  1BR0 A;  3FXD B;  3C98 B;  5JDM A;  2FUP A;  2MOZ A;  2W63 A;  4QXC B;  4AKH A;  4AKG A;  3N9O A;  4UF0 A;  3LK4 2;  4DUY T;  2L9Q A;  1Z0P A;  4PNI A;  4CI1 B;  2XUE A;  3UU3 A;  3C4X A;  3N2K E;  4CN4 A;  2ES0 A;  3HL6 A;  4YJ2 E;  2YKS A;  5JDL A;  2YOE A;  4ANJ A;  4NXM T;  3L3P A;  4B3R T;  3F57 A;  4IT4 A;  3HR0 A;  3PV0 F;  4YTM A;  3ZEF B;  3FZF B;  2BKP A;  1IJ5 A;  2ZMA A; 
#chains in the Genus database with same CATH homology
 4KHP T;  1IBM T;  1HR0 T;  2UUA T;  3T1Y T;  2VQF T;  4B3M T;  2UXD T;  4JI4 T;  4DV6 T;  4DUZ T;  1FJG T;  4B3S T;  4DV5 T;  4LF5 T;  4DR6 T;  4DV2 T;  1XMO T;  4DR1 T;  5BR8 T;  2ZM6 T;  4JI1 T;  1N34 T;  1IBK T;  2E5L T;  4B3T T;  4DR7 T;  4NXN T;  3OTO T;  4X62 T;  4DR3 T;  1XNR T;  4LF6 T;  4K0K T;  4OX9 T;  4LF4 T;  2UU9 T;  4X65 T;  4JI3 T;  4DV0 T;  4JI6 T;  2HHH T;  4X64 T;  4LFA T;  4GKK T;  4X66 T;  1HNZ T;  4JYA T;  4AQY T;  1J5E T;  4JI7 T;  1XNQ T;  2VQE T;  5LMN T;  5IWA T;  4GKJ T;  4LF9 T;  4JV5 T;  4DUY T;  4LFC T;  4YY3 T;  4DV7 T;  4DR4 T;  4LFB T;  4LF7 T;  2UUC T;  1N36 T;  4JI0 T;  4DR5 T;  4DV1 T;  1I94 T;  1HNW T;  2UXB T;  1N33 T;  3T1H T;  4JI2 T;  1XMQ T;  4DV3 T;  4LF8 T;  4DR2 T;  4JI5 T;  4NXM T;  4B3R T;  2F4V T;  1HNX T;  1IBL T;  2UUB T;  4JI8 T;  1N32 T;  4DV4 T;  4YHH T;  5LMU T;  2UXC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...