4QX8B

Crystal structure of histone demethylase kdm2a-h3k36me3 complex with alpha-kg
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qx8B00
4QX7B 4QXCB 4TN7B 4QX8B 4QWNB 4QXHB 4QXBB
chains in the Genus database with same CATH superfamily
2V8SV 5FXVA 3I0OA 3GMIA 3L3PA 5L3FB 3AECA 3HKEE 3ZEFB 4JLEA 4OFZA 4DR1T 3TKLB 3KBTA 4F8HA 2NW9A 1SUMB 3SFEA 4YSZA 5HXCA 5LMNT 2BKNA 3W15B 4E7ZA 1Y64B 5FP3A 4ADZA 3A8YC 3ZSTA 2HHHT 2HH7A 1KF6A 3O1IA 5L3EB 2M67A 3RC8A 3Q5EA 2JJ9A 1SHZC 4I50E 5H6QB 2J1DG 4DMVA 4JI0T 3A7MA 4EYUA 3GA8A 2IW5B 4YXDA 5IUXA 2KLQA 3M65A 2CPTA 5CA0E 3PDYA 3CX6B 3VU7H 3PU3A 1IBKT 2M6BA 2WP9A 2JMKA 5JRCA 4PNIA 5FXXA 5ABFA 4TWDA 3KVBA 5L4HA 4U3CA 4UF0A 3ESLA 4P0BA 1GQEA 3FBLA 3FZHB 1XDPA 1O3XA 4UEMA 3F2EA 2NW8A 3GWHA 3AE7A 2W2UA 3AAIA 3Q5XA 2WMOA 2BBHA 4WBOA 3UU6A 4EV6A 3UT5E 5ADXL 1B7TA 1W0AA 4O4LE 1MMGA 3AA1B 5C8YE 2OV9A 2IC6A 2YK0A 4NIQA 2WS3A 2E5VA 3LK42 5EK2A 2NTXA 5L2LA 3RIUA 2XUEA 1MMDA 3UUBA 3QOFA 1VCSA 2CBIA 4IT4A 1HR0T 4X1IE 1S35A 2DWKA 2BBJA 1YD8G 2UXCT 2XZEA 3C98B 4AI6A 5LMUT 5ABFB 2BVLA 2AE9A 4QH1A 4UF0B 3N2OA 3U3IA 5AQHB 2JQKA 3TLSA 5JDNA 4ZXLA 3ANWA 3K1SA 3ONXA 3P4SA 2V7JA 2LM9A 1BR2A 3RKGA 3MACA 4WZXA 4ZEYA 1E7PA 2WMNA 3V5UA 4X5TA 1IJ6A 2FJBA 5JDHA 3Q9DA 5DJQC 3UU5A 5L47A 4TZ4C 4YHHT 4DV2T 1FIOA 5AQJB 2K3WA 3VR9A 2A2FX 3AAEB 3RIUC 4AQFA 4PFOA 2LRLA 3EDUA 1ZHCA 1YQ3A 3JADA 5LHGB 2YDSA 3KV6A 2W63A 5LBQB 2HPLA 3IA3A 2X0YA 4NUUA 3ZJ1A 2X0LB 2X67A 4A97A 5ABGA 3UU8A 4H9RC 2V1DB 4LF7T 2LSKA 3N5LA 3CK6A 3O4XE 4GK0E 2IMLA 2BG9E 2UXXB 1YKHB 3CPZA 2NR4A 1WCRA 1R8IA 3UUMA 1WLXA 4JUYA 5ABHA 3PURA 5HXSA 3FZMB 2K24A 2LKGA 4P09A 2YINA 5AQNB 2JIWA 1W0BA 3FXDB 1YW0A 3D0TA 5IYZE 1ZKEA 4CI2B 4COFA 4GIWA 3ETUA 3OYXA 4IHJE 4ZS3A 3UULA 1MNEA 4EEDA 4PAGA 4Z90A 2CLYB 2WCAA 2CLYC 2CXFA 5AQLB 4DR3T 2JMHA 1M7KA 2WU2A 4XAXB 3PUGA 2XAFB 2B1EA 2ODVA 4Z91A 3BQLA 4YY3T 4AQYT 4TN7B 1MIVA 4IGUA 3QB5K 4AQFC 1YKEB 5AQKB 4KX6A 3T1YT 1AJ3A 1Z8UA 4QX7B 4BJMA 3LDQB 4O4JE 3AEDA 2HN1A 5LOVE 4J2CA 1T98A 5LNKA 2I59A 2VKDA 4JEUB 4QKNA 4TWFA 4EXTA 2B76A 1LVFA 1J5ET 3AEEA 1LRZA 3ZN0B 2H3RA 2XY8B 3HKBE 4O2AE 3N9LA 2WDVA 1EZ3A 1J1JA 3RF1A 3PUAA 3AE6A 2QVAA 1IBLT 4ERRA 4HFEA 2LRKA 3GN5B 3QNUA 1T8BA 2MBGA 3CKDA 3EUHA 2KT9A 2FJDA 3JAFA 3OTOT 2ZM8A 4TV9E 5J1GA 3RRWA 4YTPA 4E7SA 4IDQA 4CN4A 4OYJA 3U78A 4EYYR 2X66A 5EZYE 4QXCB 3AA6B 4DV1T 4DIDB 3N9OA 3AE8A 2R6GF 4HWDA 4LF6T 1XWMA 2WWUA 1N33T 5IWAT 3CIRA 3QUJA 3K3OA 2XQ3A 4HE8A 4Z8XA 3ZJ2A 4C91A 2WB5A 2RPAA 5F5WA 3FXEB 1E1HB 4XBFB 3NZQA 2VL8A 3PUZF 3LG7A 3PTRB 3P50A 3ZT5A 2LE8A 2DI4A 2D9DA 3IBPA 1W09A 2XQ5A 2JQHA 1XNRT 3PUXF 4LFBT 1OXZA 2ZM2A 4CI3B 5AQIB 2Z6EA 3B13A 4PJMA 2ZM0A 3E22E 3ZLIA 4KP3C 4X20E 2V7IA 1D1BA 4WNKA 3E08A 3FB2A 1LKXA 3MZKB 4HWIB 4PJNA 3J7Yq 3K8PC 4WBNE 2LKHA 3ONJA 4MALA 5TAOA 5A1LA 1G73A 4KMCA 4GYSA 2CRBA 1HTJF 4AKGA 2QA7A 3EDVA 3B5MA 4LFAT 4GKKT 3VHLA 3R84B 4DV3T 1NAFA 3ZPOA 5J2TE 3TLTA 2NWBA 3O1HA 4LFCT 5LHIB 2H7OA 4CXWA 3MK7C 5FY7A 2LSGA 3DP7A 3WAJA 3KDSE 3CVRA 5LGNB 3ZSSA 3SOLA 5CJ5A 3MXZA 4PW8A 2E2AA 4ZI2D 2VQET 1D0YA 2Y48B 4OHFA 3F57A 2RP4A 2V26A 4HTEA 4I43B 3PU8A 2ZLYA 2BS3A 2VQFT 4WYVA 4B3RT 4HFIA 4ILAA 1UX5A 3HL6A 5FXWA 1HNZT 3CX8B 1BR1A 2V6YA 3CMLA 3ZCIA 2YU1A 1HNXT 2V7MA 5HEJA 1VCTA 4PK4A 2XQ6A 1MNDA 5JH7E 2I6HA 4UXNB 1IZNB 3L8RA 3LBXA 1UCUA 3EABA 5BR8T 3P4RA 5L3GB 2K48A 2WDRA 3IF8B 2GK9A 4ZI2C 2NP9A 4PK5A 4ZHQE 1U5PA 5HEHA 4NUVA 2DHRA 3H3AA 4H9OC 2CCQA 4UVBB 2JQQA 1WFDA 3RYIE 2YKSA 2PBIA 4HWHA 4PJJA 4B3MT 4DV6T 4JI4T 2XTLA 3UFGA 4U2ZA 5FNVE 4JI5T 4IDOA 4EB6E 3P4PA 4YFSA 2LT3A 3F31A 5FKYA 2LEHA 5JVDE 1KEYA 2Y8DA 3ABVA 4IE5A 4IDPA 1HG2A 3P4WA 2V6YB 2YDQA 2NW7A 3C4WA 3ZC0A 3PUYF 4ILCA 4P0AA 2UUAT 4XZCA 2WM9A 1ZEEA 3SWHA 1VOMA 3NVOA 2N9DA 3JAEA 1X9BA 2LOSA 5AQOB 4ZI7E 2XAGB 5DABA 3OPCA 3LBXB 5HEUA 1XNQT 1WR6A 2XASB 3TLUA 5EK3A 1FMWA 4GYRA 4NPPA 4PJLA 3HA4A 5JDMA 4HWCA 1N36T 4LF4T 4IL4A 2LM2A 3HKDE 1JNRA 5LJNA 3C64A 3CWZB 1UX4A 5FXZA 1Y01A 3RLFF 4YTNA 5L4EA 5LXTE 4B3ST 2E8IA 5HCMA 4LF8T 3PE0A 3SRZA 4EIWA 2P9BA 1D1CA 1NEKA 1FEWA 4BJNA 2KWIB 3AE1A 3QK6A 5AQTB 1HS7A 2W67A 1FMVA 1T72A 3FZFB 2CMRA 2N1GA 2ZM6T 4HGAA 4AISA 3RYFE 1FJGT 3MA9A 2PFVA 5C2TA 3OKQA 4H9SE 2QGSA 4ZS2A 3N9PA 4DR6T 2V5CA 2VKHA 3ZT6A 1XMQT 3RI5A 3AEAA 3P8CD 1M62A 1D0ZA 4ZZCA 1XMOT 3P7IA 3RGLA 3M3ZB 4YT0A 5F3JA 1OEDE 2BKPA 2IDOB 2H89A 3UU3A 2KNDA 4IE6A 2L3LA 2KZ7B 4X66T 4C90A 2BG9B 3AE9A 1I94T 4H63H 2XQYA 3AEBA 3QB5A 1QUUA 4IE4A 2NOXA 4YJ2E 2A3DA 3I9WA 4HKAA 3GN5A 1MIYA 3P4QA 4HFCA 4H9QC 4ANJA 4HFHA 5CFBA 5AQUB 2XM1A 2WU5A 1V9DA 5JDLA 3LFMA 3VRBA 3CQGB 3EHZA 2CHOA 1W9RA 2MTQA 3WAKA 4TV8E 2X68A 2XAJB 2BS4A 1UGOA 2MAWA 4U74A 3CQXC 1D1AA 3V5SA 1WYCA 5KDMC 4F6RC 3TLWA 2VVNA 2WQYA 2W62A 4QHOA 4AKIA 1X79A 3RQUA 4CN6A 2I0MA 4I4TE 2W4XA 3PJAJ 1MMNA 5LCYA 4JEHB 1IBMT 3C4XA 2VWAA 5AQGB 5AQMB 4DR7T 5C3JA 1HNWT 2LSIA 4X65T 3KV4A 1NWMX 2A72A 4WW0A 4MLKA 3RHWA 2V7LA 1S94A 4IDNA 4ZOLE 3ZYLA 4JI1T 5LYJE 3LK3B 2D0TA 1KNZA 3LK2B 2CXDA 2QRXA 5L3DB 2CWOA 3UU4A 5JR9A 5HXRA 4X64T 3O1JA 3S4UA 1IJ5A 2MPKA 3PV0F 1CHUA 4HFVA 3N2GE 2ES0A 2X0HA 5IHYA 2JQ9A 3CX7B 5E0OA 2WDQA 5HXHA 1U4QA 1YXRA 4AKLA 4QXBB 3PJAA 4X1KE 3VKHA 4GKJT 1HX8A 4YLHA 2VURA 2WSSV 4LMLA 5FMNA 1HG5A 4O4HE 2E9XA 4X1YE 1ZOYA 4MFRA 3KINB 2XQ8A 4JBWF 2IC9A 4ISTA 5FYMA 4AKHA 4IE7A 3NRXA 4BA9A 3KV5A 4M1PA 3AXJB 3NBXX 4TUYE 4EOZB 3ZKRA 2VKJA 3ETVA 4DV7T 3ZCJA 2Y6XA 3WI3A 2ACXA 2OLTA 1KFYA 3BK9A 3LJCA 3JC6D 2KSRA 4TX5A 2D2SA 1MMAA 4YTMA 5JR9B 4L5GA 5AQRB 3RH3A 5JR9C 2VKOA 2VK9A 5ETWA 2CXLA 2VVSA 2X9XA 3CQCB 1XDOA 4DR2T 2FUPA 2BVMA 4I55E 1I6ZA 2KXPB 4LF9T 5LB7B 1YQ4A 5LGUB 4UVCB 5M4YA 1HFAA 4Q25A 2E9XB 4CXXA 2PTFA 4JI3T 2E9XC 5LBMA 3ZC1A 3N9QA 4H63V 1NENA 3KBUA 3RQWA 4DMWA 3JC6C 3PUWF 5LG4A 5HXEA 2HN2A 2UU9T 2EHOA 2W0GA 3PUSA 4FI5A 2Q9QA 3RYHE 5KX5E 1Z0PA 4LF5T 2W61A 1G8XA 4JI7T 3IEEA 1JNZA 1HCIA 4L0RA 3ZMZB 2UXBT 2IIUA 4GOUA 2CHNA 4QWNB 5FL0A 4JI6T 2EHOD 3ZMVB 4UV9B 3ZMTB 4B3TT 1DU2A 2Q9QD 3K3QC 1UURA 4EZHA 2NTYA 4A56A 4YHJA 3VR8A 2AXDS 2K9AA 2XQ9A 3NWIA 4ZI3D 4A5XA 4K0UA 4MHCA 2W66A 4LMKA 5EK4A 3Q5WA 5FVKA 2WY2A 2BKOA 5LJMA 4DBRA 4JI8T 4B6XA 2F4VT 4EGWA 5FL1A 5JREA 4LMJA 4I0UA 4DBQA 3MKDA 3AA0B 3LSVA 3QC9A 3UTKA 3ZMSB 5CA1E 2EHOB 2EHOC 4EAHA 4DV0T 3AVSA 2Q9QB 1WRDA 2Q9QC 3UQ4A 2W00A 2X9HA 1WYBA 2YEVC 4OK0A 3AVRA 1KK7A 2LHNA 4U7IA 2C0SA 3UUNA 4ZI3C 1QSDA 5AQPB 3AEFA 2XJ7A 4HEAA 4DVDA 5AQVB 2LHRA 4HFDA 2XSBA 5H6RB 4YSXA 5LA6E 2VB6A 1MIWA 1L0VA 2KMFA 4GK5E 1ZV4X 3H37A 4IL9A 2C5JA 2XPKA 3AE3A 2BS2A 4CXYA 3UQ7A 2UUCT 3IHRA 4O8SA 2C5KT 1BR0A 2IAKA 3RIFA 2VL0A 2BDEA 5HWXA 3C51A 3AAAB 3FHNA 1J5WA 5HEOA 2WWVA 1OEDA 2X9WA 3EAMA 3FBZA 3I9YA 3PUQA 3OVUA 3PUVF 1HX1B 5AQSB 4AKRB 4DR5T 4EEBA 2BG9A 1N34T 3EI0A 2DL1A 2LSJA 4O2BE 2PJQA 5AQQB 4AXPA 2J4GA 3OBVE 3C50A 4U72A 2XSAA 5JRCB 4ZZBA 3G06A 3BQKA 2KWHA 4IIJE 1E2AA 4UIGA 3RYCE 4QH4A 5JTGA 3A5XA 2J62A 3FZKB 5HWYA 2D5UA 4TWHA 2JRKA 2H88A 4G2AA 2X9YA 3AE5A 4HWFA 3MJXA 2L9QA 4CI1B 3FZLB 2UXDT 2V7KA 4DO0A 3JCFA 2CE7A 2ODUA 4IE0A 4CN1A 4KBMB 4ISSA 2CEAA 2WAUA 2LOPA 2K5BB 4IDZA 3AB3B 1OEDB 3KV9A 2FBWA 1OEDC 4KI0F 1ZP0A 2DLRA 2RA1A 5JDFA 2XQ7A 5JDQA 5LP6E 4AQGA 2YOEA 3RC3A 2BG9C 1OWAA 4X62T 4NXNT 2G0UA 3RIAA 2XAHB 3HKCE 3AE4A 4CZZB 3KFWX 4NXMT 4N78D 2WZHA 5LGTB 4HFBA 3J9X1 3SS1A 3N9MA 4JI2T 5FY1A 3ANWB 2IUBA 2WZIA 3RX6A 2YDRA 2XHEB 4U33A 3OJAA 1N32T 2ZMAA 1SA0E 2JPFA 5AQFB 5LG3A 3NZPA 3UUXB 3H3MA 4QXHB 2ACZA 4ILUA 1T7SA 3C4ZA 3DJBA 3KVAA 1KNPA 4ASKA 2XAQB 3OYZA 4BAYB 2J47A 4DV5T 3ZT7A 5L3BB 1IAPA 4V1Av 2XM2A 2DWGA 5KMGP 3T1HT 3Q5DA 2V5DA 4P1NA 4G63A 2OA5A 2N2NA 4UVAB 2LSYA 3I1AA 4H9PC 4DR4T 5HEGA 5CGMA 2YU2A 3X1DA 3AXJA 4UELA 3ZYKA 5F8PA 5JQGE 1UUSA 2DCFA 1D0XA 1BR4A 4MBQA 2VASA 3VRAA 2FJEA 4IREA 1UK5A 3NRYA 3R6NA 3N9NA 1US7B 3NKZA 3N2KE 4YSYA 4PK6A 4U2YA 2KINB 5J2UE 3VKGA 1WR0A 4ILBA 2V6XA 3BQIA 4UV8B 4QH5A 3ZN1B 2L8KA 2DNXA 3ZYMA 2CBJA 5GONE 2XQ4A 3UFEA 2QYWA 1HF8A 3ONLC 3I0QA 3Q2MA 4U7YA 4AIUA 5HCJA 4O4IE 3AE2A 5DQVA 3B57A 2MYSA 1QLBA 5AFUL 3HR0A 2PG8A 1CUNA 3AA7B 5J0ZA 2H7VC 3RKOA 2YN6A 1H7CA 4JV5T 2E9XD 4DNDA 2BZBA 3EVYA 4CQIA 3O9XA 5L3CB 2D0UA 4KHPT 4KHZF 4DUZT 2MOZA 3E0ZA 1KNRA 5JDGA 2E5LT 5LHHB 5HYAA 4TNVA 3SFDA 2CA5A 4OYKA 3ZMUB 3K3NA 4U31A 5HAXA 5KXJA 2UUBT 4FJOA 4PFPA 2CM0A 4JYAT 2FJAA 3RPUA 3L39A 4K0KT 3TLVA 3HI2A 4DUYT 1SE7A 4QX8B 4YJ3E 4OX9T 4EZ4A 5BMVE 2UXNB 5CB4E 2X51A 1LVKA 5FVLA 4UR9A 4A98A 1XZYA 3L09A 4KUMB 5DQWA 3RRCA 4TNWA 4H9NC 2HPJA 2IHR1 1VRBA 3DTOA 2CWYA 2LLYA 3AEGA 4L9IA 2A9UA 2SPCA 5FY0A 4DV4T 2XQAA 4HN9A 2WBLA 2M6IA 3T8OA 2C5IT 5ABEA 2LJLA
chains in the Genus database with same CATH topology
3N9OA 5HWXA 3C51A 5FXVA 3AAAB 3FHNA 3GMIA 3I0OA 3L3PA 5L3FB 3GN5A 1MIYA 3HKEE 3ZEFB 2WWUA 2X9WA 4JLEA 3FBZA 3I9YA 4OFZA 4H9QC 4ANJA 3TKLB 3PUQA 3KBTA 2NW9A 3QUJA 3K3OA 4HE8A 4Z8XA 3ZJ2A 4AKRB 4C91A 1V9DA 5JDLA 3LFMA 5HXCA 3W15B 4E7ZA 2LSJA 3FXEB 1Y64B 4O2BE 2PJQA 5FP3A 3CQGB 4ADZA 1E1HB 4AXPA 4XBFB 3NZQA 2VL8A 3LG7A 3OBVE 3C50A 4U72A 5JRCB 2MTQA 3PTRB 3WAKA 2HH7A 4TV8E 3O1IA 5L3EB 2X68A 2M67A 2LE8A 2XAJB 3RC8A 2DI4A 3BQKA 2KWHA 3IBPA 4IIJE 4U74A 2JJ9A 1SHZC 4I50E 3CQXC 1D1AA 3V5SA 1WYCA 5H6QB 5KDMC 2J1DG 4F6RC 4DMVA 4UIGA 3RYCE 3A5XA 2W62A 4QHOA 4EYUA 4AKIA 3GA8A 2IW5B 1X79A 1OXZA 2ZM2A 5HWYA 4CI3B 2D5UA 2KLQA 2JRKA 4I4TE 3M65A 4G2AA 2X9YA 2Z6EA 3B13A 1MMNA 4PJMA 2ZM0A 5LCYA 5CA0E 3E22E 3PDYA 4JEHB 3CX6B 3ZLIA 4KP3C 3VU7H 4X20E 2V7IA 1D1BA 3C4XA 3PU3A 4WNKA 3MJXA 2L9QA 2VWAA 4CI1B 3E08A 3FB2A 1LKXA 3MZKB 2LSIA 2V7KA 4DO0A 4PJNA 2JMKA 3J7Yq 5JRCA 3K8PC 3KV4A 1NWMX 2A72A 4WBNE 2CE7A 2ODUA 4PNIA 5FXXA 3KVBA 4IE0A 4MALA 5TAOA 4UF0A 4WW0A 4MLKA 5A1LA 1G73A 4KMCA 2V7LA 1S94A 3ESLA 2CEAA 2WAUA 4GYSA 4ISSA 4KBMB 4P0BA 4ZOLE 2LOPA 2K5BB 1HTJF 4IDZA 3ZYLA 3AB3B 4AKGA 3KV9A 5LYJE 3LK3B 3FBLA 2QA7A 1O3XA 2D0TA 3EDVA 4UEMA 1KNZA 3LK2B 2DLRA 2CXDA 2RA1A 5L3DB 5JDFA 3VHLA 3F2EA 5JDQA 5LP6E 4AQGA 2NW8A 3GWHA 3R84B 1NAFA 3RC3A 2CWOA 1OWAA 5JR9A 3ZPOA 5HXRA 3O1JA 3S4UA 1IJ5A 3AAIA 5J2TE 4HFVA 3Q5XA 2NWBA 3O1HA 2G0UA 2WMOA 3N2GE 4WBOA 2ES0A 2XAHB 3UT5E 3HKCE 5ADXL 1B7TA 4O4LE 1MMGA 3AA1B 2H7OA 4CZZB 4CXWA 5LHIB 3MK7C 5FY7A 2LSGA 5IHYA 3DP7A 5C8YE 3KFWX 2IC6A 2YK0A 3CX7B 5E0OA 5HXHA 4N78D 3WAJA 3KDSE 3CVRA 5LGNB 1U4QA 3LK42 4QXBB 4AKLA 5EK2A 2NTXA 4X1KE 3J9X1 3SS1A 5LGTB 3N9MA 5L2LA 3SOLA 3MXZA 5FY1A 2XUEA 3VKHA 1MMDA 3ANWB 1HX8A 4YLHA 4PW8A 3RX6A 4ZI2D 1D0YA 2WSSV 2Y48B 2XHEB 4OHFA 5FMNA 3F57A 1HG5A 4X1IE 2RP4A 1S35A 3OJAA 4O4HE 2V26A 2E9XA 4HTEA 4X1YE 2ZMAA 4MFRA 3KINB 4I43B 3PU8A 2ZLYA 2DWKA 1SA0E 1YD8G 2JPFA 2IC9A 3NZPA 4ISTA 3UUXB 5FYMA 4AKHA 3C98B 3NRXA 4IE7A 4QXHB 4BA9A 3KV5A 4M1PA 4AI6A 4ILUA 1UX5A 3HL6A 5FXWA 3CX8B 3C4ZA 1BR1A 3DJBA 3CMLA 3NBXX 2BVLA 3KVAA 4ASKA 4TUYE 2XAQB 3ZCIA 2YU1A 3OYZA 4EOZB 4BAYB 2V7MA 4UF0B 3N2OA 2VKJA 3U3IA 4PK4A 3ETVA 3ZCJA 2Y6XA 3WI3A 2ACXA 5JDNA 5L3BB 1IAPA 3ANWA 3ONXA 1MNDA 3BK9A 4V1Av 3LJCA 5JH7E 3JC6D 4UXNB 1IZNB 2DWGA 2V7JA 5KMGP 4TX5A 2LM9A 1BR2A 3LBXA 2D2SA 1UCUA 4G63A 3MACA 1MMAA 5L3GB 2K48A 3IF8B 2GK9A 5JR9B 4ZI2C 2WMNA 4L5GA 2OA5A 3RH3A 5JR9C 2VKOA 3V5UA 1IJ6A 2VK9A 5ETWA 2N2NA 2NP9A 4PK5A 4UVAB 4ZHQE 5JDHA 2CXLA 2LSYA 3I1AA 4H9PC 1U5PA 2X9XA 3CQCB 2YU2A 3Q9DA 5DJQC 4NUVA 2BVMA 2DHRA 4UELA 4I55E 3ZYKA 3H3AA 4TZ4C 5F8PA 2KXPB 4H9OC 1FIOA 5JQGE 2CCQA 4UVBB 2JQQA 3RYIE 2PBIA 2A2FX 3AAEB 2DCFA 4PJJA 4AQFA 4PFOA 1D0XA 5LGUB 3EDUA 2XTLA 1BR4A 4MBQA 1ZHCA 2VASA 4UVCB 5M4YA 5LHGB 3NRYA 5FNVE 1HFAA 2E9XB 4CXXA 3R6NA 3KV6A 2W63A 3N9NA 2E9XC 4EB6E 1US7B 5LBMA 3ZC1A 4YFSA 5LBQB 3N2KE 2LT3A 3N9QA 2HPLA 4H63V 4PK6A 4NUUA 3ZJ1A 3F31A 2X0LB 2X67A 3KBUA 4DMWA 3JC6C 2LEHA 5JVDE 2KINB 5LG4A 4H9RC 5J2UE 5HXEA 2V1DB 2Y8DA 3VKGA 2LSKA 4IE5A 3BQIA 3N5LA 1HG2A 3O4XE 4UV8B 4GK0E 2NW7A 3C4WA 3ZN1B 3ZC0A 2L8KA 2UXXB 1YKHB 2DNXA 4P0AA 2EHOA 2W0GA 3CPZA 4XZCA 3PUSA 2WM9A 1ZEEA 4FI5A 3SWHA 1VOMA 2Q9QA 3RYHE 3UUMA 1WLXA 4JUYA 5KX5E 1Z0PA 2N9DA 3PURA 3ZYMA 5HXSA 2W61A 2K24A 4P09A 1G8XA 2LOSA 5GONE 4ZI7E 2YINA 3IEEA 1HCIA 2XAGB 5DABA 4L0RA 3ZMZB 3UFEA 3FXDB 1YW0A 3D0TA 4GOUA 3LBXB 5IYZE 1HF8A 1ZKEA 1WR6A 2XASB 4QWNB 3I0QA 3Q2MA 4CI2B 5EK3A 1FMWA 4GIWA 4GYRA 3ETUA 3OYXA 4IHJE 4ZS3A 3UULA 4O4IE 1MNEA 4PJLA 3HA4A 2EHOD 4PAGA 3ZMVB 5DQVA 5JDMA 4UV9B 3ZMTB 2CLYB 3B57A 2MYSA 2CLYC 2Q9QD 5AFUL 2CXFA 3HR0A 3K3QC 2PG8A 3HKDE 1CUNA 4EZHA 2JMHA 3AA7B 5LJNA 2H7VC 3C64A 3CWZB 1UX4A 2NTYA 4XAXB 4A56A 3PUGA 4YHJA 2XAFB 3RKOA 2B1EA 2ODVA 5FXZA 1H7CA 3BQLA 5LXTE 2K9AA 4TN7B 1MIVA 2E8IA 2E9XD 4DNDA 4ZI3D 4IGUA 2BZBA 3EVYA 4AQFC 1YKEB 3PE0A 4CQIA 4K0UA 3SRZA 4EIWA 3O9XA 2P9BA 4MHCA 5L3CB 1AJ3A 1D1CA 2D0UA 5EK4A 4QX7B 3Q5WA 4BJMA 1FEWA 4O4JE 5LOVE 4BJNA 4J2CA 2KWIB 3QK6A 2MOZA 1T98A 1HS7A 5LNKA 5LJMA 3E0ZA 4DBRA 4B6XA 1FMVA 2I59A 2VKDA 5JDGA 4JEUB 5LHHB 4QKNA 5JREA 5HYAA 2CMRA 2N1GA 4DBQA 3MKDA 4HGAA 4EXTA 2CA5A 4OYKA 3ZMUB 3AA0B 3UTKA 3QC9A 3RYFE 1LVFA 3ZMSB 5CA1E 2EHOB 3K3NA 3MA9A 5HAXA 2PFVA 2EHOC 4FJOA 4EAHA 3AVSA 2Q9QB 1WRDA 3OKQA 4H9SE 4PFPA 2Q9QC 2QGSA 2W00A 2X9HA 1WYBA 1LRZA 2CM0A 2YEVC 4OK0A 4ZS2A 3ZN0B 3N9PA 3AVRA 2H3RA 2VKHA 3RPUA 3HKBE 4O2AE 3N9LA 1KK7A 2LHNA 3HI2A 2C0SA 1EZ3A 3UUNA 4ZI3C 1QSDA 3P8CD 4QX8B 3PUAA 1D0ZA 4YJ3E 4HEAA 4DVDA 4ERRA 3P7IA 4EZ4A 5BMVE 2UXNB 5F3JA 2LHRA 3GN5B 5CB4E 2X51A 1LVKA 5H6RB 2MBGA 5LA6E 2KNDA 4IE6A 3L09A 2VB6A 3CKDA 3EUHA 4KUMB 1MIWA 5DQWA 2L3LA 2KZ7B 2KT9A 2KMFA 4GK5E 3RRCA 4C90A 2ZM8A 4H9NC 1ZV4X 3H37A 2C5JA 4H63H 2HPJA 4TV9E 5J1GA 3RRWA 1VRBA 4E7SA 2XQYA 4CXYA 3DTOA 2CWYA 4OYJA 3U78A 3IHRA 4O8SA 2C5KT 1QUUA 4IE4A 1BR0A 4L9IA 4EYYR 2X66A 2SPCA 5EZYE 2IAKA 2NOXA 4YJ2E 5FY0A 4QXCB 4HN9A 2WBLA 3AA6B 3T8OA 2C5IT 2A3DA 2BDEA 3I9WA 4HKAA 2LJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QX7 B;  4QXC B;  4TN7 B;  4QX8 B;  4QWN B;  4QXH B;  4QXB B; 
#chains in the Genus database with same CATH topology
 2V8S V;  5FXV A;  3I0O A;  3GMI A;  3L3P A;  5L3F B;  3AEC A;  3HKE E;  3ZEF B;  4JLE A;  4OFZ A;  4DR1 T;  3TKL B;  3KBT A;  4F8H A;  2NW9 A;  1SUM B;  3SFE A;  4YSZ A;  5HXC A;  5LMN T;  2BKN A;  3W15 B;  4E7Z A;  1Y64 B;  5FP3 A;  4ADZ A;  3A8Y C;  3ZST A;  2HHH T;  2HH7 A;  1KF6 A;  3O1I A;  5L3E B;  2M67 A;  3RC8 A;  3Q5E A;  2JJ9 A;  1SHZ C;  4I50 E;  5H6Q B;  2J1D G;  4DMV A;  4JI0 T;  3A7M A;  4EYU A;  3GA8 A;  2IW5 B;  4YXD A;  5IUX A;  2KLQ A;  3M65 A;  2CPT A;  5CA0 E;  3PDY A;  3CX6 B;  3VU7 H;  3PU3 A;  1IBK T;  2M6B A;  2WP9 A;  2JMK A;  5JRC A;  4PNI A;  5FXX A;  5ABF A;  4TWD A;  3KVB A;  5L4H A;  4U3C A;  4UF0 A;  3ESL A;  4P0B A;  1GQE A;  3FBL A;  3FZH B;  1XDP A;  1O3X A;  4UEM A;  3F2E A;  2NW8 A;  3GWH A;  3AE7 A;  2W2U A;  3AAI A;  3Q5X A;  2WMO A;  2BBH A;  4WBO A;  3UU6 A;  4EV6 A;  3UT5 E;  5ADX L;  1B7T A;  1W0A A;  4O4L E;  1MMG A;  3AA1 B;  5C8Y E;  2OV9 A;  2IC6 A;  2YK0 A;  4NIQ A;  2WS3 A;  2E5V A;  3LK4 2;  5EK2 A;  2NTX A;  5L2L A;  3RIU A;  2XUE A;  1MMD A;  3UUB A;  3QOF A;  1VCS A;  2CBI A;  4IT4 A;  1HR0 T;  4X1I E;  1S35 A;  2DWK A;  2BBJ A;  1YD8 G;  2UXC T;  2XZE A;  3C98 B;  4AI6 A;  5LMU T;  5ABF B;  2BVL A;  2AE9 A;  4QH1 A;  4UF0 B;  3N2O A;  3U3I A;  5AQH B;  2JQK A;  3TLS A;  5JDN A;  4ZXL A;  3ANW A;  3K1S A;  3ONX A;  3P4S A;  2V7J A;  2LM9 A;  1BR2 A;  3RKG A;  3MAC A;  4WZX A;  4ZEY A;  1E7P A;  2WMN A;  3V5U A;  4X5T A;  1IJ6 A;  2FJB A;  5JDH A;  3Q9D A;  5DJQ C;  3UU5 A;  5L47 A;  4TZ4 C;  4YHH T;  4DV2 T;  1FIO A;  5AQJ B;  2K3W A;  3VR9 A;  2A2F X;  3AAE B;  3RIU C;  4AQF A;  4PFO A;  2LRL A;  3EDU A;  1ZHC A;  1YQ3 A;  3JAD A;  5LHG B;  2YDS A;  3KV6 A;  2W63 A;  5LBQ B;  2HPL A;  3IA3 A;  2X0Y A;  4NUU A;  3ZJ1 A;  2X0L B;  2X67 A;  4A97 A;  5ABG A;  3UU8 A;  4H9R C;  2V1D B;  4LF7 T;  2LSK A;  3N5L A;  3CK6 A;  3O4X E;  4GK0 E;  2IML A;  2BG9 E;  2UXX B;  1YKH B;  3CPZ A;  2NR4 A;  1WCR A;  1R8I A;  3UUM A;  1WLX A;  4JUY A;  5ABH A;  3PUR A;  5HXS A;  3FZM B;  2K24 A;  2LKG A;  4P09 A;  2YIN A;  5AQN B;  2JIW A;  1W0B A;  3FXD B;  1YW0 A;  3D0T A;  5IYZ E;  1ZKE A;  4CI2 B;  4COF A;  4GIW A;  3ETU A;  3OYX A;  4IHJ E;  4ZS3 A;  3UUL A;  1MNE A;  4EED A;  4PAG A;  4Z90 A;  2CLY B;  2WCA A;  2CLY C;  2CXF A;  5AQL B;  4DR3 T;  2JMH A;  1M7K A;  2WU2 A;  4XAX B;  3PUG A;  2XAF B;  2B1E A;  2ODV A;  4Z91 A;  3BQL A;  4YY3 T;  4AQY T;  4TN7 B;  1MIV A;  4IGU A;  3QB5 K;  4AQF C;  1YKE B;  5AQK B;  4KX6 A;  3T1Y T;  1AJ3 A;  1Z8U A;  4QX7 B;  4BJM A;  3LDQ B;  4O4J E;  3AED A;  2HN1 A;  5LOV E;  4J2C A;  1T98 A;  5LNK A;  2I59 A;  2VKD A;  4JEU B;  4QKN A;  4TWF A;  4EXT A;  2B76 A;  1LVF A;  1J5E T;  3AEE A;  1LRZ A;  3ZN0 B;  2H3R A;  2XY8 B;  3HKB E;  4O2A E;  3N9L A;  2WDV A;  1EZ3 A;  1J1J A;  3RF1 A;  3PUA A;  3AE6 A;  2QVA A;  1IBL T;  4ERR A;  4HFE A;  2LRK A;  3GN5 B;  3QNU A;  1T8B A;  2MBG A;  3CKD A;  3EUH A;  2KT9 A;  2FJD A;  3JAF A;  3OTO T;  2ZM8 A;  4TV9 E;  5J1G A;  3RRW A;  4YTP A;  4E7S A;  4IDQ A;  4CN4 A;  4OYJ A;  3U78 A;  4EYY R;  2X66 A;  5EZY E;  4QXC B;  3AA6 B;  4DV1 T;  4DID B;  3N9O A;  3AE8 A;  2R6G F;  4HWD A;  4LF6 T;  1XWM A;  2WWU A;  1N33 T;  5IWA T;  3CIR A;  3QUJ A;  3K3O A;  2XQ3 A;  4HE8 A;  4Z8X A;  3ZJ2 A;  4C91 A;  2WB5 A;  2RPA A;  5F5W A;  3FXE B;  1E1H B;  4XBF B;  3NZQ A;  2VL8 A;  3PUZ F;  3LG7 A;  3PTR B;  3P50 A;  3ZT5 A;  2LE8 A;  2DI4 A;  2D9D A;  3IBP A;  1W09 A;  2XQ5 A;  2JQH A;  1XNR T;  3PUX F;  4LFB T;  1OXZ A;  2ZM2 A;  4CI3 B;  5AQI B;  2Z6E A;  3B13 A;  4PJM A;  2ZM0 A;  3E22 E;  3ZLI A;  4KP3 C;  4X20 E;  2V7I A;  1D1B A;  4WNK A;  3E08 A;  3FB2 A;  1LKX A;  3MZK B;  4HWI B;  4PJN A;  3J7Y q;  3K8P C;  4WBN E;  2LKH A;  3ONJ A;  4MAL A;  5TAO A;  5A1L A;  1G73 A;  4KMC A;  4GYS A;  2CRB A;  1HTJ F;  4AKG A;  2QA7 A;  3EDV A;  3B5M A;  4LFA T;  4GKK T;  3VHL A;  3R84 B;  4DV3 T;  1NAF A;  3ZPO A;  5J2T E;  3TLT A;  2NWB A;  3O1H A;  4LFC T;  5LHI B;  2H7O A;  4CXW A;  3MK7 C;  5FY7 A;  2LSG A;  3DP7 A;  3WAJ A;  3KDS E;  3CVR A;  5LGN B;  3ZSS A;  3SOL A;  5CJ5 A;  3MXZ A;  4PW8 A;  2E2A A;  4ZI2 D;  2VQE T;  1D0Y A;  2Y48 B;  4OHF A;  3F57 A;  2RP4 A;  2V26 A;  4HTE A;  4I43 B;  3PU8 A;  2ZLY A;  2BS3 A;  2VQF T;  4WYV A;  4B3R T;  4HFI A;  4ILA A;  1UX5 A;  3HL6 A;  5FXW A;  1HNZ T;  3CX8 B;  1BR1 A;  2V6Y A;  3CML A;  3ZCI A;  2YU1 A;  1HNX T;  2V7M A;  5HEJ A;  1VCT A;  4PK4 A;  2XQ6 A;  1MND A;  5JH7 E;  2I6H A;  4UXN B;  1IZN B;  3L8R A;  3LBX A;  1UCU A;  3EAB A;  5BR8 T;  3P4R A;  5L3G B;  2K48 A;  2WDR A;  3IF8 B;  2GK9 A;  4ZI2 C;  2NP9 A;  4PK5 A;  4ZHQ E;  1U5P A;  5HEH A;  4NUV A;  2DHR A;  3H3A A;  4H9O C;  2CCQ A;  4UVB B;  2JQQ A;  1WFD A;  3RYI E;  2YKS A;  2PBI A;  4HWH A;  4PJJ A;  4B3M T;  4DV6 T;  4JI4 T;  2XTL A;  3UFG A;  4U2Z A;  5FNV E;  4JI5 T;  4IDO A;  4EB6 E;  3P4P A;  4YFS A;  2LT3 A;  3F31 A;  5FKY A;  2LEH A;  5JVD E;  1KEY A;  2Y8D A;  3ABV A;  4IE5 A;  4IDP A;  1HG2 A;  3P4W A;  2V6Y B;  2YDQ A;  2NW7 A;  3C4W A;  3ZC0 A;  3PUY F;  4ILC A;  4P0A A;  2UUA T;  4XZC A;  2WM9 A;  1ZEE A;  3SWH A;  1VOM A;  3NVO A;  2N9D A;  3JAE A;  1X9B A;  2LOS A;  5AQO B;  4ZI7 E;  2XAG B;  5DAB A;  3OPC A;  3LBX B;  5HEU A;  1XNQ T;  1WR6 A;  2XAS B;  3TLU A;  5EK3 A;  1FMW A;  4GYR A;  4NPP A;  4PJL A;  3HA4 A;  5JDM A;  4HWC A;  1N36 T;  4LF4 T;  4IL4 A;  2LM2 A;  3HKD E;  1JNR A;  5LJN A;  3C64 A;  3CWZ B;  1UX4 A;  5FXZ A;  1Y01 A;  3RLF F;  4YTN A;  5L4E A;  5LXT E;  4B3S T;  2E8I A;  5HCM A;  4LF8 T;  3PE0 A;  3SRZ A;  4EIW A;  2P9B A;  1D1C A;  1NEK A;  1FEW A;  4BJN A;  2KWI B;  3AE1 A;  3QK6 A;  5AQT B;  1HS7 A;  2W67 A;  1FMV A;  1T72 A;  3FZF B;  2CMR A;  2N1G A;  2ZM6 T;  4HGA A;  4AIS A;  3RYF E;  1FJG T;  3MA9 A;  2PFV A;  5C2T A;  3OKQ A;  4H9S E;  2QGS A;  4ZS2 A;  3N9P A;  4DR6 T;  2V5C A;  2VKH A;  3ZT6 A;  1XMQ T;  3RI5 A;  3AEA A;  3P8C D;  1M62 A;  1D0Z A;  4ZZC A;  1XMO T;  3P7I A;  3RGL A;  3M3Z B;  4YT0 A;  5F3J A;  1OED E;  2BKP A;  2IDO B;  2H89 A;  3UU3 A;  2KND A;  4IE6 A;  2L3L A;  2KZ7 B;  4X66 T;  4C90 A;  2BG9 B;  3AE9 A;  1I94 T;  4H63 H;  2XQY A;  3AEB A;  3QB5 A;  1QUU A;  4IE4 A;  2NOX A;  4YJ2 E;  2A3D A;  3I9W A;  4HKA A;  3GN5 A;  1MIY A;  3P4Q A;  4HFC A;  4H9Q C;  4ANJ A;  4HFH A;  5CFB A;  5AQU B;  2XM1 A;  2WU5 A;  1V9D A;  5JDL A;  3LFM A;  3VRB A;  3CQG B;  3EHZ A;  2CHO A;  1W9R A;  2MTQ A;  3WAK A;  4TV8 E;  2X68 A;  2XAJ B;  2BS4 A;  1UGO A;  2MAW A;  4U74 A;  3CQX C;  1D1A A;  3V5S A;  1WYC A;  5KDM C;  4F6R C;  3TLW A;  2VVN A;  2WQY A;  2W62 A;  4QHO A;  4AKI A;  1X79 A;  3RQU A;  4CN6 A;  2I0M A;  4I4T E;  2W4X A;  3PJA J;  1MMN A;  5LCY A;  4JEH B;  1IBM T;  3C4X A;  2VWA A;  5AQG B;  5AQM B;  4DR7 T;  5C3J A;  1HNW T;  2LSI A;  4X65 T;  3KV4 A;  1NWM X;  2A72 A;  4WW0 A;  4MLK A;  3RHW A;  2V7L A;  1S94 A;  4IDN A;  4ZOL E;  3ZYL A;  4JI1 T;  5LYJ E;  3LK3 B;  2D0T A;  1KNZ A;  3LK2 B;  2CXD A;  2QRX A;  5L3D B;  2CWO A;  3UU4 A;  5JR9 A;  5HXR A;  4X64 T;  3O1J A;  3S4U A;  1IJ5 A;  2MPK A;  3PV0 F;  1CHU A;  4HFV A;  3N2G E;  2ES0 A;  2X0H A;  5IHY A;  2JQ9 A;  3CX7 B;  5E0O A;  2WDQ A;  5HXH A;  1U4Q A;  1YXR A;  4AKL A;  4QXB B;  3PJA A;  4X1K E;  3VKH A;  4GKJ T;  1HX8 A;  4YLH A;  2VUR A;  2WSS V;  4LML A;  5FMN A;  1HG5 A;  4O4H E;  2E9X A;  4X1Y E;  1ZOY A;  4MFR A;  3KIN B;  2XQ8 A;  4JBW F;  2IC9 A;  4IST A;  5FYM A;  4AKH A;  4IE7 A;  3NRX A;  4BA9 A;  3KV5 A;  4M1P A;  3AXJ B;  3NBX X;  4TUY E;  4EOZ B;  3ZKR A;  2VKJ A;  3ETV A;  4DV7 T;  3ZCJ A;  2Y6X A;  3WI3 A;  2ACX A;  2OLT A;  1KFY A;  3BK9 A;  3LJC A;  3JC6 D;  2KSR A;  4TX5 A;  2D2S A;  1MMA A;  4YTM A;  5JR9 B;  4L5G A;  5AQR B;  3RH3 A;  5JR9 C;  2VKO A;  2VK9 A;  5ETW A;  2CXL A;  2VVS A;  2X9X A;  3CQC B;  1XDO A;  4DR2 T;  2FUP A;  2BVM A;  4I55 E;  1I6Z A;  2KXP B;  4LF9 T;  5LB7 B;  1YQ4 A;  5LGU B;  4UVC B;  5M4Y A;  1HFA A;  4Q25 A;  2E9X B;  4CXX A;  2PTF A;  4JI3 T;  2E9X C;  5LBM A;  3ZC1 A;  3N9Q A;  4H63 V;  1NEN A;  3KBU A;  3RQW A;  4DMW A;  3JC6 C;  3PUW F;  5LG4 A;  5HXE A;  2HN2 A;  2UU9 T;  2EHO A;  2W0G A;  3PUS A;  4FI5 A;  2Q9Q A;  3RYH E;  5KX5 E;  1Z0P A;  4LF5 T;  2W61 A;  1G8X A;  4JI7 T;  3IEE A;  1JNZ A;  1HCI A;  4L0R A;  3ZMZ B;  2UXB T;  2IIU A;  4GOU A;  2CHN A;  4QWN B;  5FL0 A;  4JI6 T;  2EHO D;  3ZMV B;  4UV9 B;  3ZMT B;  4B3T T;  1DU2 A;  2Q9Q D;  3K3Q C;  1UUR A;  4EZH A;  2NTY A;  4A56 A;  4YHJ A;  3VR8 A;  2AXD S;  2K9A A;  2XQ9 A;  3NWI A;  4ZI3 D;  4A5X A;  4K0U A;  4MHC A;  2W66 A;  4LMK A;  5EK4 A;  3Q5W A;  5FVK A;  2WY2 A;  2BKO A;  5LJM A;  4DBR A;  4JI8 T;  4B6X A;  2F4V T;  4EGW A;  5FL1 A;  5JRE A;  4LMJ A;  4I0U A;  4DBQ A;  3MKD A;  3AA0 B;  3LSV A;  3QC9 A;  3UTK A;  3ZMS B;  5CA1 E;  2EHO B;  2EHO C;  4EAH A;  4DV0 T;  3AVS A;  2Q9Q B;  1WRD A;  2Q9Q C;  3UQ4 A;  2W00 A;  2X9H A;  1WYB A;  2YEV C;  4OK0 A;  3AVR A;  1KK7 A;  2LHN A;  4U7I A;  2C0S A;  3UUN A;  4ZI3 C;  1QSD A;  5AQP B;  3AEF A;  2XJ7 A;  4HEA A;  4DVD A;  5AQV B;  2LHR A;  4HFD A;  2XSB A;  5H6R B;  4YSX A;  5LA6 E;  2VB6 A;  1MIW A;  1L0V A;  2KMF A;  4GK5 E;  1ZV4 X;  3H37 A;  4IL9 A;  2C5J A;  2XPK A;  3AE3 A;  2BS2 A;  4CXY A;  3UQ7 A;  2UUC T;  3IHR A;  4O8S A;  2C5K T;  1BR0 A;  2IAK A;  3RIF A;  2VL0 A;  2BDE A;  5HWX A;  3C51 A;  3AAA B;  3FHN A;  1J5W A;  5HEO A;  2WWV A;  1OED A;  2X9W A;  3EAM A;  3FBZ A;  3I9Y A;  3PUQ A;  3OVU A;  3PUV F;  1HX1 B;  5AQS B;  4AKR B;  4DR5 T;  4EEB A;  2BG9 A;  1N34 T;  3EI0 A;  2DL1 A;  2LSJ A;  4O2B E;  2PJQ A;  5AQQ B;  4AXP A;  2J4G A;  3OBV E;  3C50 A;  4U72 A;  2XSA A;  5JRC B;  4ZZB A;  3G06 A;  3BQK A;  2KWH A;  4IIJ E;  1E2A A;  4UIG A;  3RYC E;  4QH4 A;  5JTG A;  3A5X A;  2J62 A;  3FZK B;  5HWY A;  2D5U A;  4TWH A;  2JRK A;  2H88 A;  4G2A A;  2X9Y A;  3AE5 A;  4HWF A;  3MJX A;  2L9Q A;  4CI1 B;  3FZL B;  2UXD T;  2V7K A;  4DO0 A;  3JCF A;  2CE7 A;  2ODU A;  4IE0 A;  4CN1 A;  4KBM B;  4ISS A;  2CEA A;  2WAU A;  2LOP A;  2K5B B;  4IDZ A;  3AB3 B;  1OED B;  3KV9 A;  2FBW A;  1OED C;  4KI0 F;  1ZP0 A;  2DLR A;  2RA1 A;  5JDF A;  2XQ7 A;  5JDQ A;  5LP6 E;  4AQG A;  2YOE A;  3RC3 A;  2BG9 C;  1OWA A;  4X62 T;  4NXN T;  2G0U A;  3RIA A;  2XAH B;  3HKC E;  3AE4 A;  4CZZ B;  3KFW X;  4NXM T;  4N78 D;  2WZH A;  5LGT B;  4HFB A;  3J9X 1;  3SS1 A;  3N9M A;  4JI2 T;  5FY1 A;  3ANW B;  2IUB A;  2WZI A;  3RX6 A;  2YDR A;  2XHE B;  4U33 A;  3OJA A;  1N32 T;  2ZMA A;  1SA0 E;  2JPF A;  5AQF B;  5LG3 A;  3NZP A;  3UUX B;  3H3M A;  4QXH B;  2ACZ A;  4ILU A;  1T7S A;  3C4Z A;  3DJB A;  3KVA A;  1KNP A;  4ASK A;  2XAQ B;  3OYZ A;  4BAY B;  2J47 A;  4DV5 T;  3ZT7 A;  5L3B B;  1IAP A;  4V1A v;  2XM2 A;  2DWG A;  5KMG P;  3T1H T;  3Q5D A;  2V5D A;  4P1N A;  4G63 A;  2OA5 A;  2N2N A;  4UVA B;  2LSY A;  3I1A A;  4H9P C;  4DR4 T;  5HEG A;  5CGM A;  2YU2 A;  3X1D A;  3AXJ A;  4UEL A;  3ZYK A;  5F8P A;  5JQG E;  1UUS A;  2DCF A;  1D0X A;  1BR4 A;  4MBQ A;  2VAS A;  3VRA A;  2FJE A;  4IRE A;  1UK5 A;  3NRY A;  3R6N A;  3N9N A;  1US7 B;  3NKZ A;  3N2K E;  4YSY A;  4PK6 A;  4U2Y A;  2KIN B;  5J2U E;  3VKG A;  1WR0 A;  4ILB A;  2V6X A;  3BQI A;  4UV8 B;  4QH5 A;  3ZN1 B;  2L8K A;  2DNX A;  3ZYM A;  2CBJ A;  5GON E;  2XQ4 A;  3UFE A;  2QYW A;  1HF8 A;  3ONL C;  3I0Q A;  3Q2M A;  4U7Y A;  4AIU A;  5HCJ A;  4O4I E;  3AE2 A;  5DQV A;  3B57 A;  2MYS A;  1QLB A;  5AFU L;  3HR0 A;  2PG8 A;  1CUN A;  3AA7 B;  5J0Z A;  2H7V C;  3RKO A;  2YN6 A;  1H7C A;  4JV5 T;  2E9X D;  4DND A;  2BZB A;  3EVY A;  4CQI A;  3O9X A;  5L3C B;  2D0U A;  4KHP T;  4KHZ F;  4DUZ T;  2MOZ A;  3E0Z A;  1KNR A;  5JDG A;  2E5L T;  5LHH B;  5HYA A;  4TNV A;  3SFD A;  2CA5 A;  4OYK A;  3ZMU B;  3K3N A;  4U31 A;  5HAX A;  5KXJ A;  2UUB T;  4FJO A;  4PFP A;  2CM0 A;  4JYA T;  2FJA A;  3RPU A;  3L39 A;  4K0K T;  3TLV A;  3HI2 A;  4DUY T;  1SE7 A;  4QX8 B;  4YJ3 E;  4OX9 T;  4EZ4 A;  5BMV E;  2UXN B;  5CB4 E;  2X51 A;  1LVK A;  5FVL A;  4UR9 A;  4A98 A;  1XZY A;  3L09 A;  4KUM B;  5DQW A;  3RRC A;  4TNW A;  4H9N C;  2HPJ A;  2IHR 1;  1VRB A;  3DTO A;  2CWY A;  2LLY A;  3AEG A;  4L9I A;  2A9U A;  2SPC A;  5FY0 A;  4DV4 T;  2XQA A;  4HN9 A;  2WBL A;  2M6I A;  3T8O A;  2C5I T;  5ABE A;  2LJL A; 
#chains in the Genus database with same CATH homology
 3N9O A;  5HWX A;  3C51 A;  5FXV A;  3AAA B;  3FHN A;  3GMI A;  3I0O A;  3L3P A;  5L3F B;  3GN5 A;  1MIY A;  3HKE E;  3ZEF B;  2WWU A;  2X9W A;  4JLE A;  3FBZ A;  3I9Y A;  4OFZ A;  4H9Q C;  4ANJ A;  3TKL B;  3PUQ A;  3KBT A;  2NW9 A;  3QUJ A;  3K3O A;  4HE8 A;  4Z8X A;  3ZJ2 A;  4AKR B;  4C91 A;  1V9D A;  5JDL A;  3LFM A;  5HXC A;  3W15 B;  4E7Z A;  2LSJ A;  3FXE B;  1Y64 B;  4O2B E;  2PJQ A;  5FP3 A;  3CQG B;  4ADZ A;  1E1H B;  4AXP A;  4XBF B;  3NZQ A;  2VL8 A;  3LG7 A;  3OBV E;  3C50 A;  4U72 A;  5JRC B;  2MTQ A;  3PTR B;  3WAK A;  2HH7 A;  4TV8 E;  3O1I A;  5L3E B;  2X68 A;  2M67 A;  2LE8 A;  2XAJ B;  3RC8 A;  2DI4 A;  3BQK A;  2KWH A;  3IBP A;  4IIJ E;  4U74 A;  2JJ9 A;  1SHZ C;  4I50 E;  3CQX C;  1D1A A;  3V5S A;  1WYC A;  5H6Q B;  5KDM C;  2J1D G;  4F6R C;  4DMV A;  4UIG A;  3RYC E;  3A5X A;  2W62 A;  4QHO A;  4EYU A;  4AKI A;  3GA8 A;  2IW5 B;  1X79 A;  1OXZ A;  2ZM2 A;  5HWY A;  4CI3 B;  2D5U A;  2KLQ A;  2JRK A;  4I4T E;  3M65 A;  4G2A A;  2X9Y A;  2Z6E A;  3B13 A;  1MMN A;  4PJM A;  2ZM0 A;  5LCY A;  5CA0 E;  3E22 E;  3PDY A;  4JEH B;  3CX6 B;  3ZLI A;  4KP3 C;  3VU7 H;  4X20 E;  2V7I A;  1D1B A;  3C4X A;  3PU3 A;  4WNK A;  3MJX A;  2L9Q A;  2VWA A;  4CI1 B;  3E08 A;  3FB2 A;  1LKX A;  3MZK B;  2LSI A;  2V7K A;  4DO0 A;  4PJN A;  2JMK A;  3J7Y q;  5JRC A;  3K8P C;  3KV4 A;  1NWM X;  2A72 A;  4WBN E;  2CE7 A;  2ODU A;  4PNI A;  5FXX A;  3KVB A;  4IE0 A;  4MAL A;  5TAO A;  4UF0 A;  4WW0 A;  4MLK A;  5A1L A;  1G73 A;  4KMC A;  2V7L A;  1S94 A;  3ESL A;  2CEA A;  2WAU A;  4GYS A;  4ISS A;  4KBM B;  4P0B A;  4ZOL E;  2LOP A;  2K5B B;  1HTJ F;  4IDZ A;  3ZYL A;  3AB3 B;  4AKG A;  3KV9 A;  5LYJ E;  3LK3 B;  3FBL A;  2QA7 A;  1O3X A;  2D0T A;  3EDV A;  4UEM A;  1KNZ A;  3LK2 B;  2DLR A;  2CXD A;  2RA1 A;  5L3D B;  5JDF A;  3VHL A;  3F2E A;  5JDQ A;  5LP6 E;  4AQG A;  2NW8 A;  3GWH A;  3R84 B;  1NAF A;  3RC3 A;  2CWO A;  1OWA A;  5JR9 A;  3ZPO A;  5HXR A;  3O1J A;  3S4U A;  1IJ5 A;  3AAI A;  5J2T E;  4HFV A;  3Q5X A;  2NWB A;  3O1H A;  2G0U A;  2WMO A;  3N2G E;  4WBO A;  2ES0 A;  2XAH B;  3UT5 E;  3HKC E;  5ADX L;  1B7T A;  4O4L E;  1MMG A;  3AA1 B;  2H7O A;  4CZZ B;  4CXW A;  5LHI B;  3MK7 C;  5FY7 A;  2LSG A;  5IHY A;  3DP7 A;  5C8Y E;  3KFW X;  2IC6 A;  2YK0 A;  3CX7 B;  5E0O A;  5HXH A;  4N78 D;  3WAJ A;  3KDS E;  3CVR A;  5LGN B;  1U4Q A;  3LK4 2;  4QXB B;  4AKL A;  5EK2 A;  2NTX A;  4X1K E;  3J9X 1;  3SS1 A;  5LGT B;  3N9M A;  5L2L A;  3SOL A;  3MXZ A;  5FY1 A;  2XUE A;  3VKH A;  1MMD A;  3ANW B;  1HX8 A;  4YLH A;  4PW8 A;  3RX6 A;  4ZI2 D;  1D0Y A;  2WSS V;  2Y48 B;  2XHE B;  4OHF A;  5FMN A;  3F57 A;  1HG5 A;  4X1I E;  2RP4 A;  1S35 A;  3OJA A;  4O4H E;  2V26 A;  2E9X A;  4HTE A;  4X1Y E;  2ZMA A;  4MFR A;  3KIN B;  4I43 B;  3PU8 A;  2ZLY A;  2DWK A;  1SA0 E;  1YD8 G;  2JPF A;  2IC9 A;  3NZP A;  4IST A;  3UUX B;  5FYM A;  4AKH A;  3C98 B;  3NRX A;  4IE7 A;  4QXH B;  4BA9 A;  3KV5 A;  4M1P A;  4AI6 A;  4ILU A;  1UX5 A;  3HL6 A;  5FXW A;  3CX8 B;  3C4Z A;  1BR1 A;  3DJB A;  3CML A;  3NBX X;  2BVL A;  3KVA A;  4ASK A;  4TUY E;  2XAQ B;  3ZCI A;  2YU1 A;  3OYZ A;  4EOZ B;  4BAY B;  2V7M A;  4UF0 B;  3N2O A;  2VKJ A;  3U3I A;  4PK4 A;  3ETV A;  3ZCJ A;  2Y6X A;  3WI3 A;  2ACX A;  5JDN A;  5L3B B;  1IAP A;  3ANW A;  3ONX A;  1MND A;  3BK9 A;  4V1A v;  3LJC A;  5JH7 E;  3JC6 D;  4UXN B;  1IZN B;  2DWG A;  2V7J A;  5KMG P;  4TX5 A;  2LM9 A;  1BR2 A;  3LBX A;  2D2S A;  1UCU A;  4G63 A;  3MAC A;  1MMA A;  5L3G B;  2K48 A;  3IF8 B;  2GK9 A;  5JR9 B;  4ZI2 C;  2WMN A;  4L5G A;  2OA5 A;  3RH3 A;  5JR9 C;  2VKO A;  3V5U A;  1IJ6 A;  2VK9 A;  5ETW A;  2N2N A;  2NP9 A;  4PK5 A;  4UVA B;  4ZHQ E;  5JDH A;  2CXL A;  2LSY A;  3I1A A;  4H9P C;  1U5P A;  2X9X A;  3CQC B;  2YU2 A;  3Q9D A;  5DJQ C;  4NUV A;  2BVM A;  2DHR A;  4UEL A;  4I55 E;  3ZYK A;  3H3A A;  4TZ4 C;  5F8P A;  2KXP B;  4H9O C;  1FIO A;  5JQG E;  2CCQ A;  4UVB B;  2JQQ A;  3RYI E;  2PBI A;  2A2F X;  3AAE B;  2DCF A;  4PJJ A;  4AQF A;  4PFO A;  1D0X A;  5LGU B;  3EDU A;  2XTL A;  1BR4 A;  4MBQ A;  1ZHC A;  2VAS A;  4UVC B;  5M4Y A;  5LHG B;  3NRY A;  5FNV E;  1HFA A;  2E9X B;  4CXX A;  3R6N A;  3KV6 A;  2W63 A;  3N9N A;  2E9X C;  4EB6 E;  1US7 B;  5LBM A;  3ZC1 A;  4YFS A;  5LBQ B;  3N2K E;  2LT3 A;  3N9Q A;  2HPL A;  4H63 V;  4PK6 A;  4NUU A;  3ZJ1 A;  3F31 A;  2X0L B;  2X67 A;  3KBU A;  4DMW A;  3JC6 C;  2LEH A;  5JVD E;  2KIN B;  5LG4 A;  4H9R C;  5J2U E;  5HXE A;  2V1D B;  2Y8D A;  3VKG A;  2LSK A;  4IE5 A;  3BQI A;  3N5L A;  1HG2 A;  3O4X E;  4UV8 B;  4GK0 E;  2NW7 A;  3C4W A;  3ZN1 B;  3ZC0 A;  2L8K A;  2UXX B;  1YKH B;  2DNX A;  4P0A A;  2EHO A;  2W0G A;  3CPZ A;  4XZC A;  3PUS A;  2WM9 A;  1ZEE A;  4FI5 A;  3SWH A;  1VOM A;  2Q9Q A;  3RYH E;  3UUM A;  1WLX A;  4JUY A;  5KX5 E;  1Z0P A;  2N9D A;  3PUR A;  3ZYM A;  5HXS A;  2W61 A;  2K24 A;  4P09 A;  1G8X A;  2LOS A;  5GON E;  4ZI7 E;  2YIN A;  3IEE A;  1HCI A;  2XAG B;  5DAB A;  4L0R A;  3ZMZ B;  3UFE A;  3FXD B;  1YW0 A;  3D0T A;  4GOU A;  3LBX B;  5IYZ E;  1HF8 A;  1ZKE A;  1WR6 A;  2XAS B;  4QWN B;  3I0Q A;  3Q2M A;  4CI2 B;  5EK3 A;  1FMW A;  4GIW A;  4GYR A;  3ETU A;  3OYX A;  4IHJ E;  4ZS3 A;  3UUL A;  4O4I E;  1MNE A;  4PJL A;  3HA4 A;  2EHO D;  4PAG A;  3ZMV B;  5DQV A;  5JDM A;  4UV9 B;  3ZMT B;  2CLY B;  3B57 A;  2MYS A;  2CLY C;  2Q9Q D;  5AFU L;  2CXF A;  3HR0 A;  3K3Q C;  2PG8 A;  3HKD E;  1CUN A;  4EZH A;  2JMH A;  3AA7 B;  5LJN A;  2H7V C;  3C64 A;  3CWZ B;  1UX4 A;  2NTY A;  4XAX B;  4A56 A;  3PUG A;  4YHJ A;  2XAF B;  3RKO A;  2B1E A;  2ODV A;  5FXZ A;  1H7C A;  3BQL A;  5LXT E;  2K9A A;  4TN7 B;  1MIV A;  2E8I A;  2E9X D;  4DND A;  4ZI3 D;  4IGU A;  2BZB A;  3EVY A;  4AQF C;  1YKE B;  3PE0 A;  4CQI A;  4K0U A;  3SRZ A;  4EIW A;  3O9X A;  2P9B A;  4MHC A;  5L3C B;  1AJ3 A;  1D1C A;  2D0U A;  5EK4 A;  4QX7 B;  3Q5W A;  4BJM A;  1FEW A;  4O4J E;  5LOV E;  4BJN A;  4J2C A;  2KWI B;  3QK6 A;  2MOZ A;  1T98 A;  1HS7 A;  5LNK A;  5LJM A;  3E0Z A;  4DBR A;  4B6X A;  1FMV A;  2I59 A;  2VKD A;  5JDG A;  4JEU B;  5LHH B;  4QKN A;  5JRE A;  5HYA A;  2CMR A;  2N1G A;  4DBQ A;  3MKD A;  4HGA A;  4EXT A;  2CA5 A;  4OYK A;  3ZMU B;  3AA0 B;  3UTK A;  3QC9 A;  3RYF E;  1LVF A;  3ZMS B;  5CA1 E;  2EHO B;  3K3N A;  3MA9 A;  5HAX A;  2PFV A;  2EHO C;  4FJO A;  4EAH A;  3AVS A;  2Q9Q B;  1WRD A;  3OKQ A;  4H9S E;  4PFP A;  2Q9Q C;  2QGS A;  2W00 A;  2X9H A;  1WYB A;  1LRZ A;  2CM0 A;  2YEV C;  4OK0 A;  4ZS2 A;  3ZN0 B;  3N9P A;  3AVR A;  2H3R A;  2VKH A;  3RPU A;  3HKB E;  4O2A E;  3N9L A;  1KK7 A;  2LHN A;  3HI2 A;  2C0S A;  1EZ3 A;  3UUN A;  4ZI3 C;  1QSD A;  3P8C D;  4QX8 B;  3PUA A;  1D0Z A;  4YJ3 E;  4HEA A;  4DVD A;  4ERR A;  3P7I A;  4EZ4 A;  5BMV E;  2UXN B;  5F3J A;  2LHR A;  3GN5 B;  5CB4 E;  2X51 A;  1LVK A;  5H6R B;  2MBG A;  5LA6 E;  2KND A;  4IE6 A;  3L09 A;  2VB6 A;  3CKD A;  3EUH A;  4KUM B;  1MIW A;  5DQW A;  2L3L A;  2KZ7 B;  2KT9 A;  2KMF A;  4GK5 E;  3RRC A;  4C90 A;  2ZM8 A;  4H9N C;  1ZV4 X;  3H37 A;  2C5J A;  4H63 H;  2HPJ A;  4TV9 E;  5J1G A;  3RRW A;  1VRB A;  4E7S A;  2XQY A;  4CXY A;  3DTO A;  2CWY A;  4OYJ A;  3U78 A;  3IHR A;  4O8S A;  2C5K T;  1QUU A;  4IE4 A;  1BR0 A;  4L9I A;  4EYY R;  2X66 A;  2SPC A;  5EZY E;  2IAK A;  2NOX A;  4YJ2 E;  5FY0 A;  4QXC B;  4HN9 A;  2WBL A;  3AA6 B;  3T8O A;  2C5I T;  2A3D A;  2BDE A;  3I9W A;  4HKA A;  2LJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...