4QX8B

Crystal structure of histone demethylase kdm2a-h3k36me3 complex with alpha-kg
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qx8B00
4TN7B 4QXCB 4QXBB 4QX8B 4QWNB 4QXHB 4QX7B
chains in the Genus database with same CATH superfamily
3KINB 4AKLA 1CUNA 5ABFB 2LSIA 4ZHQE 5FXZA 2WZHA 2XQ9A 4CQIA 5FXWA 4ZI3D 4X1KE 5JDQA 3RKGA 2MPKA 4PNIA 3MACA 5LHGB 2J1DG 4TN7B 4ZS3A 2KT9A 4JEUB 4WYVA 4IDPA 4U7YA 3SS1A 3GWHA 2BS4A 4YTMA 2DL1A 5FXVA 1N36T 4HWIB 4DR7T 3RIUA 2LRLA 4X5TA 2W62A 3EI0A 1US7B 1OXZA 2K3WA 2R6GF 2VKHA 3ZMZB 2K48A 3HKBE 1NAFA 2VVSA 5AQIB 3OTOT 3TLTA 5TAOA 1W0AA 5AQGB 5AQJB 2IW5B 3JCFA 1OEDA 4JI0T 4ISTA 3L39A 4OYJA 4U2YA 4A98A 3RRCA 5JQGE 3ZSSA 4DV0T 3F31A 5LG4A 4HFDA 3VRBA 3PV0F 2UXXB 1XWMA 4LMJA 4V1Av 4PJMA 5DJQC 1T98A 2YKSA 4HWFA 1LKXA 3LBXB 4IT4A 3OBVE 3N9PA 2MOZA 4ADZA 3IBPA 4H63H 1CHUA 2DHRA 4H9QC 5KXJA 1E7PA 5FL1A 4HFIA 4ILCA 4PK4A 4F6RC 1XMQT 2LJLA 3AAIA 3AXJB 1XNQT 4ILUA 5JR9B 3P8CD 1N33T 4YHHT 4QXBB 4NUVA 5AQRB 2DWGA 2WBLA 3SRZA 1VCSA 1D1CA 3ANWB 1V9DA 3HR0A 4PJNA 2EHOC 2J47A 2V7KA 1FIOA 4GKJT 4MFRA 4QWNB 3VRAA 2SPCA 5LJMA 4XAXB 4EZ4A 3MKDA 4WW0A 1SUMB 3ZMUB 2XM1A 3ZT7A 2W00A 1MMDA 4ILAA 1ZEEA 3CKDA 1UX4A 1YQ3A 5FMNA 1NENA 1Y64B 5LGNB 5LP6E 1ZV4X 3N9OA 5FP3A 4U2ZA 4X1YE 3WI3A 2CBJA 1HCIA 2XZEA 3PURA 3SFDA 2F4VT 1D0XA 1S35A 2BVLA 4UVAB 3EHZA 2LEHA 4UVCB 3FB2A 2M67A 4OX9T 1VCTA 3E08A 1MIVA 4ZI2C 2X68A 4C91A 3ZMVB 4IL4A 1FJGT 3O4XE 2ODUA 1XDPA 5L2LA 4E7ZA 1H7CA 5AQFB 1FEWA 3PJAJ 4ZEYA 2BBJA 4CXYA 2ACZA 4QH1A 3RF1A 3ZPOA 4G2AA 4P09A 2VWAA 3ONXA 4DMVA 4O2BE 4KHPT 2NW7A 2LM2A 1J1JA 3P4QA 2CLYB 2LSKA 3EABA 2JMHA 4DV7T 5AQKB 2P9BA 4ISSA 2ZM8A 2CCQA 2X9HA 5F5WA 3AE7A 3UFGA 4BJNA 2BKPA 4HWHA 3IEEA 5JH7E 1X79A 2YN6A 5AFUL 2Q9QC 3PUAA 4NXNT 2CHOA 1U4QA 2XSAA 4EEBA 3Q2MA 1MIWA 2LRKA 1YKEB 4O4JE 2BVMA 1Z8UA 4JEHB 4TNVA 3WAJA 3KDSE 2WSSV 3ZLIA 3FXEB 3C98B 4O8SA 3KV4A 1WR0A 3D0TA 3NRXA 4QH4A 4YTPA 3N2OA 4JYAT 4KMCA 2LKHA 1BR4A 4BJMA 5LHHB 2VL8A 1IZNB 1WCRA 2I0MA 4Z91A 2XUEA 2L3LA 1E1HB 3LJCA 1W0BA 1M7KA 3LG7A 5EK3A 3MK7C 2IAKA 2C5KT 3Q9DA 3AAEB 5JRCA 1O3XA 3JADA 1MMAA 2CMRA 2E2AA 5HWYA 4Z8XA 2J62A 2NW8A 2JJ9A 5HYAA 5JDNA 2ZM6T 3UUXB 5ETWA 4U74A 2CE7A 3PUWF 3BQLA 3ZMTB 2CWYA 2WDRA 1OEDC 5FY1A 4ZZCA 2E8IA 1XMOT 3JAEA 5HXEA 2YU2A 2BS2A 1IBMT 1OWAA 4OYKA 3P7IA 4QH5A 4DR5T 4JI6T 2A2FX 2I6HA 4QX7B 2YDSA 3KV5A 4EYYR 3ZMSB 3Q5EA 2V26A 4MBQA 3UU6A 3Q5XA 3VKHA 3C4ZA 2BKOA 2E9XB 4LFAT 3I1AA 2A9UA 5L3CB 4ZI3C 4JI4T 3BQIA 1VRBA 2LSJA 1Y01A 2K5BB 4EV6A 3RIFA 2X0LB 2L9QA 3RC8A 2H88A 2XAHB 5CFBA 2XQ4A 2IHR1 1HG5A 2C5JA 2NR4A 3CX8B 3AEEA 3HKCE 2LHNA 3AAAB 2X0YA 3RRWA 4J2CA 5CA0E 5EZYE 2W2UA 3AE5A 3AE8A 2Z6EA 3E0ZA 3N2KE 3LK2B 3RQUA 2UXCT 3K3NA 3SWHA 3EUHA 1MMNA 4QX8B 5LB7B 4CI3B 4EB6E 4O4IE 2N1GA 3I0QA 3V5UA 4GKKT 4IL9A 2CPTA 5JDGA 5F3JA 5HEGA 4UF0A 1XZYA 2NOXA 4TWDA 4DNDA 3NZPA 4M1PA 1SA0E 2WY2A 4F8HA 3U3IA 5ABFA 2QA7A 4NUUA 2LSYA 2Q9QB 2YDRA 4ASKA 3ZYMA 2WB5A 2V6XA 4LF6T 3Q5DA 3G06A 1QUUA 4LMLA 2XQYA 2VQFT 4DV4T 4YJ3E 2KWIB 3QUJA 2XAJB 4H9OC 3RH3A 3TLVA 3CQCB 2H7VC 4NPPA 5LYJE 3V5SA 2VB6A 4QHOA 3KV6A 2LOPA 3FHNA 3GN5A 4BA9A 2NTXA 2W63A 3ZKRA 4IDOA 3ZC0A 3FZHB 5CGMA 3RHWA 3LDQB 2N9DA 2WM9A 4K0UA 2D0TA 3B13A 4DV1T 2NP9A 3C50A 2XQ5A 3HKEE 2VQET 5AQVB 4EOZB 4HN9A 3AE3A 2W4XA 2CA5A 2AXDS 2VKDA 3DP7A 2YDQA 3QC9A 1I6ZA 2C0SA 5IWAT 4WBNE 3N9LA 3BQKA 5LMNT 3F2EA 3AEDA 3HL6A 3K8PC 1R8IA 1MMGA 1OEDB 2DNXA 3NBXX 5HAXA 2DWKA 5FNVE 2YEVC 2M6IA 3NKZA 2FJDA 4X64T 4GIWA 4B6XA 2ODVA 3PDYA 4KI0F 4H9PC 4U7IA 4LF8T 4Z90A 4PK6A 2V6YA 2BZBA 3AA7B 4OFZA 5CJ5A 4X65T 1JNZA 2WAUA 3CVRA 3CMLA 2WU2A 5H6QB 3AXJA 1UGOA 5L4HA 1SHZC 1NWMX 5AQOB 4DBRA 1WFDA 5AQTB 5JDHA 2HH7A 3RKOA 4EXTA 3R84B 1YW0A 3KBTA 2IMLA 2XQ7A 4OHFA 4YLHA 4UV9B 2ES0A 2V8SV 2X66A 3ZT6A 5CA1E 1X9BA 2Y48B 4B3MT 4X20E 4U33A 3ZN1B 2WCAA 5JDMA 3PU3A 2HN1A 3CQGB 2XQ6A 2A3DA 3X1DA 1IJ5A 3FZLB 4EGWA 4LFCT 3P4RA 5LGTB 2FBWA 2J4GA 2WU5A 5LMUT 1S94A 4GK5E 4JI1T 1WLXA 4ZXLA 4MLKA 5AQUB 2D5UA 5LBQB 4UXNB 5AQQB 2YK0A 3ESLA 3OKQA 1T8BA 1UX5A 2XASB 4UVBB 4QXCB 3ZEFB 3UUNA 1YD8G 2FJEA 3CK6A 2E5LT 2XQ8A 5IYZE 4JUYA 3RX6A 4EZHA 3L09A 3AE2A 3NWIA 2CXFA 3IHRA 3HI2A 2RPAA 5J2TE 4O4HE 2VASA 3TLWA 3FBLA 3QK6A 1HX8A 4AISA 4NXMT 2K24A 2BG9C 2BS3A 3EDVA 2VKOA 2AE9A 4KP3C 2UXDT 3UTKA 2CXLA 2K9AA 3KVAA 3ZYKA 5L47A 2XPKA 4HTEA 2PBIA 5AQHB 1J5WA 1WRDA 4HE8A 4IE4A 3PE0A 3PUYF 4DR4T 4O2AE 4YJ2E 4A56A 1YQ4A 4JBWF 5FVKA 3PUXF 4U72A 2WWUA 2RP4A 2ACXA 2CM0A 5AQMB 3PUGA 4YSXA 2M6BA 3RYHE 3QNUA 5ABEA 4KX6A 2YINA 2DCFA 4PFOA 4CXXA 3J9X1 2KNDA 2E9XD 1FMWA 2WP9A 5L3FB 3Q5WA 3N2GE 4AKHA 3K3QC 4E7SA 4YTNA 3CWZB 1MIYA 2BBHA 4DUZT 4AXPA 4AQFC 4DR1T 2XQ3A 1W9RA 1VOMA 4A97A 2QYWA 1E2AA 1XDOA 3ZN0B 5DQVA 1D0ZA 3I9WA 3AEGA 2ZLYA 2FJBA 3WAKA 1WR6A 4PW8A 2V7MA 4X62T 3UUBA 3M3ZB 4AI6A 2V7IA 2WDQA 2BDEA 5LBMA 1ZP0A 1UUSA 1UK5A 2HPJA 4KHZF 1BR1A 5L4EA 3UU5A 4CN6A 1G73A 3KVBA 3CIRA 5JRCB 4C90A 2JQKA 5LNKA 4I55E 5IHYA 4Q25A 2CHNA 3S4UA 2EHOB 2B1EA 2YU1A 3R6NA 2IIUA 2Y6XA 2NWBA 2UUBT 2VL0A 3I0OA 2I59A 2RA1A 4JV5T 2UU9T 2E9XA 3O1HA 3MXZA 1KEYA 3C64A 2Y8DA 2CWOA 3UFEA 4HGAA 1LVKA 3RC3A 4HFCA 5LA6E 4DV2T 1GQEA 3N9NA 1HX1B 3KBUA 2VVNA 4L0RA 2QRXA 4IDQA 3K3OA 5JR9C 4P0AA 2HPLA 1HR0T 1T72A 4AIUA 4GK0E 2N2NA 3JC6D 2BG9A 2JQHA 1M62A 4TV9E 3C51A 2XTLA 2KZ7B 3EVYA 2UXNB 4DR3T 4TZ4C 4YT0A 1KFYA 3ONLC 5LJNA 5DQWA 1KNPA 5DABA 1BR2A 3T1YT 1UCUA 3VKGA 4B3ST 5FXXA 4DBQA 3PUVF 5JTGA 4TUYE 4AKRB 3UULA 2X0HA 3CQXC 1AJ3A 4OK0A 4EAHA 5HCJA 4WZXA 2X67A 1QLBA 1HF8A 4MALA 3RYIE 4UELA 5L3GB 5L3BB 4IIJE 2X9XA 3U78A 3MJXA 3ETUA 5HXRA 3UQ7A 3MA9A 4I4TE 4UF0B 2KWHA 4JI3T 3A5XA 1ZKEA 3TKLB 4HFEA 3ZYLA 4DR2T 5L3EB 1OEDE 4DV3T 3A8YC 4AQFA 3ABVA 1FMVA 3L8RA 5ABGA 2IUBA 3SOLA 2UUAT 2IC9A 3P4SA 3RYFE 3DJBA 4PAGA 3AVSA 1B7TA 5LG3A 1WYCA 4O4LE 2OLTA 4HWDA 4N78D 2CLYC 1J5ET 3OJAA 2WWVA 1QSDA 2V7JA 2IDOB 2PG8A 5KDMC 5LCYA 2D2SA 2V7LA 2WMNA 3GN5B 3NRYA 4K0KT 3H3AA 1XNRT 5EK4A 3OVUA 3TLUA 5C3JA 3AECA 2BKNA 3VU7H 3RPUA 5BR8T 2GK9A 4ERRA 4HFBA 4IHJE 3ETVA 4GYRA 2LHRA 2NTYA 3FZMB 4I0UA 4JI7T 3LBXA 2WMOA 3ZJ1A 1WYBA 4UEMA 3AE4A 3ZJ2A 3VHLA 2CRBA 4ANJA 4HFVA 2ZM0A 3AE1A 3UUMA 2WQYA 1HNXT 2V5CA 5CB4E 3T8OA 1HG2A 5AQSB 4CZZB 3M65A 4TWFA 2LE8A 2LM9A 5FYMA 1N34T 4KUMB 4DO0A 5JR9A 2ZMAA 1IBKT 2PTFA 3O9XA 2V6YB 3QB5K 5HXSA 2JPFA 3KFWX 1BR0A 5FY0A 2FJAA 2PFVA 2V5DA 3ANWA 4LMKA 4I43B 3RIAA 2H3RA 2JMKA 3NZQA 4YY3T 5H6RB 4B3TT 2D0UA 1D1BA 5LOVE 2JQQA 1L0VA 1HNZT 4P0BA 3GA8A 5JVDE 3ZSTA 2ZM2A 2W61A 4YHJA 2KXPB 4ZOLE 4QXHB 2W66A 3AA1B 3MZKB 4DIDB 1T7SA 3I9YA 5GONE 4HEAA 4PK5A 1N32T 4LF4T 1MNEA 4NIQA 2QGSA 2UXBT 3UU4A 4UV8B 2PJQA 2X9WA 4IGUA 2E9XC 4PJLA 5E0OA 2WZIA 3T1HT 4UIGA 5J1GA 3CX7B 2G0UA 1U5PA 1IBLT 4CI2B 5HXCA 2MYSA 4IDNA 3ZCIA 4JI5T 3L3PA 2IC6A 3K1SA 2C5IT 4L5GA 4B3RT 2KSRA 4KBMB 3VR8A 4JI8T 4WBOA 2XY8B 4MHCA 4JI2T 4H63V 4GOUA 5FVLA 3AEFA 3UU8A 5AQPB 2KLQA 2KINB 3J7Yq 1I94T 5C8YE 4UR9A 3FZKB 1KNZA 4CN1A 3A7MA 2CBIA 3AB3B 1UURA 4AQGA 3RI5A 3QOFA 2WS3A 4IE5A 3W15B 1LVFA 2OA5A 4TV8E 3JAFA 3LK42 3LFMA 4YSZA 5A1LA 3PTRB 3H3MA 3ONJA 1G8XA 4DUYT 2W67A 4LFBT 3RQWA 3VR9A 4FI5A 2XAGB 2EHOD 3C4XA 2MTQA 4H9SE 4EEDA 3DTOA 2LSGA 2HN2A 2X51A 5EK2A 3LK3B 5AQNB 3FXDB 2H7OA 3UQ4A 2WDVA 1HNWT 1IAPA 1YXRA 3AA0B 2W0GA 3NVOA 4X1IE 2V1DB 4G63A 1HFAA 5HEHA 5F8PA 2VKJA 4HWCA 3F57A 3OYZA 1KK7A 4P1NA 3AEAA 3B5MA 2XM2A 3N9QA 4ZI2D 3HKDE 4QKNA 3UT5E 4PFPA 4XZCA 1HTJF 2LT3A 3EAMA 2CXDA 3N9MA 4DMWA 4HKAA 4DVDA 4DV5T 4CXWA 2JQ9A 4L9IA 2DI4A 4DR6T 3PU8A 3IA3A 1DU2A 2QVAA 5HEUA 4COFA 4U3CA 3JC6C 5J0ZA 4AKIA 2XJ7A 2L8KA 5M4YA 4IDZA 3RIUC 3RGLA 2XAQB 5KMGP 4AQYT 2XSBA 5JDLA 3C4WA 4IE7A 3ZT5A 1W09A 5HEJA 1HS7A 2H89A 4XBFB 3FZFB 3UU3A 3RYCE 5C2TA 2Q9QD 3AE9A 2MAWA 3O1JA 4TWHA 2BG9E 5ADXL 4IREA 4LF5T 2EHOA 3ZC1A 2LKGA 4ZS2A 3P50A 5BMVE 4CI1B 3PJAA 5IUXA 2A72A 3B57A 2FUPA 3ZCJA 5LGUB 4A5XA 4X66T 2CEAA 3E22E 4WNKA 3PUQA 3EDUA 2OV9A 5JDFA 4BAYB 4YSYA 3AE6A 1NEKA 2B76A 5KX5E 2JRKA 2JIWA 4H9RC 5FL0A 4I50E 4AKGA 2E5VA 5AQLB 1D0YA 1SE7A 1KNRA 1YKHB 1ZOYA 4ZZBA 4JLEA 2MBGA 5FKYA 3PUZF 2YOEA 4HFHA 2VK9A 3TLSA 3SFEA 5J2UE 3OPCA 1LRZA 4EIWA 3KV9A 4ILBA 4YXDA 5HWXA 2NW9A 4YFSA 3AEBA 1EZ3A 4CN4A 5L3DB 1JNRA 3IF8B 1KF6A 2X9YA 2VURA 1D1AA 3OYXA 4GYSA 4H9NC 3LSVA 4DV6T 3QB5A 1Z0PA 2LLYA 2HHHT 3AA6B 3CPZA 4LF9T 5HXHA 4ZI7E 4PJJA 1MNDA 2BG9B 5HEOA 3CX6B 3PUSA 3N5LA 4IE6A 2XQAA 3P4PA 1IJ6A 5JREA 3BK9A 5ABHA 2UUCT 4FJOA 5FY7A 2LOSA 3GMIA 3RLFF 1ZHCA 5LHIB 3P4WA 2DLRA 4U31A 4TX5A 4LF7T 2Q9QA 5HCMA 2XAFB 4TNWA 4IE0A 3AVRA 3HA4A 3H37A 2KMFA 4EYUA 3FBZA 2XHEB 2D9DA 3O1IA 5LXTE
chains in the Genus database with same CATH topology
3KINB 2ZMAA 5JR9A 4AKLA 1CUNA 2PBIA 2LSIA 4ZHQE 5FXZA 5HXEA 2YU2A 1WRDA 3O9XA 4CQIA 4HE8A 4IE4A 3PE0A 5HXSA 2JPFA 1OWAA 5FXWA 3KFWX 1BR0A 4OYKA 5FY0A 3P7IA 4O2AE 4ZI3D 4YJ2E 4A56A 2PFVA 4X1KE 3ANWA 5JDQA 2A2FX 4PNIA 4QX7B 4I43B 3MACA 2H3RA 2JMKA 2J1DG 4TN7B 4U72A 5LHGB 3KV5A 2WWUA 3NZQA 4ZS3A 2RP4A 2ACXA 2CM0A 2KT9A 4JEUB 4EYYR 5H6RB 3ZMSB 3PUGA 2V26A 3RYHE 4MBQA 3Q5XA 3VKHA 2YINA 2DCFA 4PFOA 2D0UA 1D1BA 3SS1A 3C4ZA 5LOVE 4CXXA 2JQQA 2E9XB 3I1AA 3GWHA 5L3CB 4P0BA 2KNDA 3J9X1 2E9XD 1FMWA 5L3FB 5FXVA 3Q5WA 3GA8A 4ZI3C 5JVDE 3BQIA 1VRBA 2LSJA 3N2GE 2K5BB 2ZM2A 4AKHA 2W61A 4YHJA 3K3QC 2X0LB 2KXPB 4ZOLE 2L9QA 4E7SA 3RC8A 3CWZB 1MIYA 2XAHB 4QXHB 3AA1B 3MZKB 1HG5A 4AXPA 2C5JA 3CX8B 3I9YA 2W62A 5GONE 4HEAA 4PK5A 4AQFC 3HKCE 1MNEA 2QGSA 4UV8B 2PJQA 1US7B 2X9WA 1VOMA 1OXZA 4IGUA 2E9XC 2LHNA 3AAAB 2VKHA 4PJLA 3ZMZB 5E0OA 3RRWA 4J2CA 4UIGA 2K48A 3HKBE 5J1GA 3ZN0B 3CX7B 5DQVA 1NAFA 2G0UA 1U5PA 1D0ZA 5CA0E 5EZYE 5TAOA 4CI2B 3I9WA 5HXCA 2ZLYA 2MYSA 3ZCIA 2Z6EA 2IW5B 3E0ZA 3WAKA 3L3PA 2IC6A 3N2KE 1WR6A 2C5IT 4ISTA 4PW8A 3LK2B 2V7MA 4L5GA 4OYJA 3K3NA 3SWHA 3EUHA 1MMNA 4QX8B 3RRCA 5JQGE 4KBMB 4CI3B 4AI6A 2V7IA 4EB6E 4O4IE 4WBOA 4MHCA 2BDEA 4H63V 4GOUA 5LBMA 2N1GA 3F31A 3I0QA 3V5UA 5LG4A 2KLQA 5JDGA 2UXXB 2KINB 2HPJA 3J7Yq 5C8YE 1BR1A 4V1Av 5F3JA 1KNZA 4PJMA 5DJQC 1T98A 4UF0A 2NOXA 1G73A 4DNDA 1LKXA 3NZPA 3LBXB 1SA0E 4M1PA 3AB3B 3KVBA 3OBVE 3N9PA 5JRCB 4C90A 4AQGA 5LNKA 2MOZA 4I55E 4IE5A 3W15B 3U3IA 2QA7A 1LVFA 2OA5A 4NUUA 2LSYA 4ADZA 2Q9QB 4TV8E 4ASKA 5IHYA 3ZYMA 3LK42 3LFMA 3IBPA 4H63H 5A1LA 3PTRB 2DHRA 4H9QC 1G8XA 3S4UA 1QUUA 2EHOB 2B1EA 2XQYA 4F6RC 4PK4A 4FI5A 2YU1A 2XAGB 4YJ3E 2EHOD 3C4XA 2LJLA 3AAIA 3R6NA 2KWIB 2Y6XA 2MTQA 2NWBA 3QUJA 4ILUA 4H9SE 5JR9B 3P8CD 3DTOA 2LSGA 3I0OA 4QXBB 2I59A 2XAJB 4NUVA 2DWGA 2X51A 2RA1A 5EK2A 2E9XA 3O1HA 3MXZA 4H9OC 2WBLA 3SRZA 3C64A 3LK3B 3RH3A 2Y8DA 3CQCB 1D1CA 2H7VC 3FXDB 2CWOA 3UFEA 2H7OA 4HGAA 3ANWB 1V9DA 3HR0A 5LYJE 1LVKA 4PJNA 3RC3A 1IAPA 5LA6E 2VB6A 3V5SA 4QHOA 3KV6A 2LOPA 3FHNA 2EHOC 3N9NA 2V7KA 3GN5A 1FIOA 3KBUA 4BA9A 3AA0B 4MFRA 4QWNB 2NTXA 2W0GA 2W63A 2SPCA 5LJMA 4L0RA 4X1IE 2V1DB 3K3OA 4G63A 4XAXB 4EZ4A 5JR9C 3ZC0A 4P0AA 1HFAA 2HPLA 5F8PA 5KX5E 3MKDA 2VKJA 4WW0A 4GK0E 3ZMUB 2N9DA 2WM9A 3F57A 3OYZA 1KK7A 4K0UA 2D0TA 2N2NA 2W00A 1MMDA 3B13A 1ZEEA 2NP9A 1UX4A 3C50A 3CKDA 3JC6D 3HKEE 5FMNA 4TV9E 3C51A 1Y64B 3N9QA 5LGNB 2XTLA 2KZ7B 3EVYA 2UXNB 4TZ4C 1ZV4X 4EOZB 4ZI2D 5LP6E 4HN9A 3N9OA 3HKDE 5FP3A 4QKNA 4X1YE 3UT5E 3WI3A 2CA5A 1HCIA 1HTJF 3PURA 4PFPA 4XZCA 5DQWA 5LJNA 1D0XA 2LT3A 5DABA 1S35A 2VKDA 1BR2A 2CXDA 3N9MA 4DMWA 3DP7A 4HKAA 4DVDA 1UCUA 3QC9A 2C0SA 2BVLA 4CXWA 3VKGA 4L9IA 4UVAB 5FXXA 2DI4A 3PU8A 2LEHA 4WBNE 4DBQA 4UVCB 3FB2A 2M67A 3JC6C 3N9LA 4TUYE 4AKRB 3UULA 4AKIA 2L8KA 3E08A 3BQKA 3F2EA 3CQXC 1MIVA 1AJ3A 4OK0A 3HL6A 2X68A 3K8PC 4ZI2C 5M4YA 1MMGA 4EAHA 2DNXA 4IDZA 4C91A 3ZMVB 3NBXX 2XAQB 5HAXA 2DWKA 5KMGP 5FNVE 2YEVC 3O4XE 2ODUA 5JDLA 2X67A 3C4WA 4GIWA 1HF8A 5L2LA 4IE7A 4E7ZA 4MALA 3RYIE 4B6XA 2ODVA 3PDYA 1H7CA 1HS7A 4H9PC 4UELA 5L3GB 5L3BB 1FEWA 4XBFB 4CXYA 4IIJE 2X9XA 3RYCE 3U78A 4PK6A 2Q9QD 2BZBA 3MJXA 3ETUA 3O1JA 3AA7B 4OFZA 5HXRA 3ZPOA 4G2AA 4P09A 2VWAA 3MA9A 3ONXA 4I4TE 4UF0B 4O2BE 4DMVA 5ADXL 2WAUA 2KWHA 2EHOA 3CVRA 3CMLA 3A5XA 2NW7A 3ZC1A 1ZKEA 4ZS2A 2CLYB 3TKLB 5H6QB 5BMVE 4CI1B 3ZYLA 2A72A 2LSKA 3B57A 3ZCJA 5L3EB 2JMHA 5LGUB 1SHZC 4AQFA 1NWMX 2P9BA 4ISSA 2CEAA 4DBRA 2ZM8A 1FMVA 3E22E 2CCQA 2X9HA 4WNKA 5JDHA 2HH7A 3PUQA 3RKOA 3EDUA 5JDFA 4EXTA 3SOLA 4BAYB 3R84B 4BJNA 2IC9A 1YW0A 3IEEA 3KBTA 5JH7E 1X79A 2JRKA 4OHFA 4YLHA 3RYFE 4UV9B 5AFUL 2Q9QC 4H9RC 2ES0A 3PUAA 3DJBA 2X66A 4PAGA 3AVSA 5CA1E 1B7TA 1U4QA 2Y48B 1WYCA 4O4LE 4I50E 4X20E 3Q2MA 1MIWA 4AKGA 3ZN1B 1YKEB 4O4JE 1D0YA 2BVMA 5JDMA 4JEHB 1YKHB 3WAJA 4N78D 2CLYC 4JLEA 3OJAA 2MBGA 1QSDA 2V7JA 3KDSE 2WSSV 3ZLIA 3PU3A 3CQGB 2VK9A 2A3DA 1IJ5A 2PG8A 5J2UE 3FXEB 5KDMC 5LCYA 1LRZA 2D2SA 4EIWA 3C98B 3KV9A 5LGTB 4O8SA 5HWXA 3KV4A 3D0TA 2V7LA 2WMNA 3NRXA 4YFSA 2NW9A 1EZ3A 3GN5B 1S94A 3N2OA 3NRYA 4GK5E 1WLXA 3H3AA 5L3DB 4KMCA 1BR4A 4MLKA 3IF8B 2D5UA 2X9YA 5EK4A 1D1AA 4UXNB 5LBQB 3OYXA 2YK0A 4GYSA 4BJMA 4H9NC 5LHHB 1Z0PA 2VL8A 1IZNB 3ESLA 3AA6B 3CPZA 3OKQA 5HXHA 4ZI7E 4PJJA 1UX5A 1MNDA 2XASB 4UVBB 4QXCB 2XUEA 3ZEFB 3VU7H 3RPUA 3UUNA 1YD8G 2GK9A 3CX6B 2L3LA 4ERRA 3PUSA 1E1HB 4IHJE 3LJCA 3N5LA 4IE6A 3ETVA 4GYRA 2LHRA 2NTYA 3LG7A 5EK3A 1IJ6A 5IYZE 3MK7C 4JUYA 2IAKA 3RX6A 5JREA 4EZHA 3BK9A 2C5KT 3L09A 3LBXA 2WMOA 3Q9DA 4FJOA 5FY7A 3ZJ1A 1WYBA 2LOSA 3GMIA 2CXFA 4UEMA 3AAEB 3ZJ2A 5JRCA 3VHLA 3IHRA 1O3XA 1MMAA 1ZHCA 3HI2A 2CMRA 5LHIB 5HWYA 5J2TE 4ANJA 4HFVA 4O4HE 2VASA 2DLRA 2ZM0A 4TX5A 2Q9QA 4Z8XA 3FBLA 3QK6A 1HX8A 2NW8A 2XAFB 2K24A 4IE0A 3UUMA 3AVRA 2JJ9A 5HYAA 5JDNA 3HA4A 3H37A 2KMFA 3UUXB 3EDVA 2VKOA 4KP3C 5ETWA 5CB4E 3T8OA 3UTKA 4EYUA 3FBZA 1HG2A 2CXLA 4U74A 4CZZB 2CE7A 2XHEB 3BQLA 2K9AA 3ZMTB 3KVAA 3ZYKA 2CWYA 3M65A 2LE8A 2LM9A 5FY1A 5FYMA 4HTEA 4KUMB 3O1IA 2E8IA 4DO0A 5LXTE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TN7 B;  4QXC B;  4QXB B;  4QX8 B;  4QWN B;  4QXH B;  4QX7 B; 
#chains in the Genus database with same CATH topology
 3KIN B;  4AKL A;  1CUN A;  5ABF B;  2LSI A;  4ZHQ E;  5FXZ A;  2WZH A;  2XQ9 A;  4CQI A;  5FXW A;  4ZI3 D;  4X1K E;  5JDQ A;  3RKG A;  2MPK A;  4PNI A;  3MAC A;  5LHG B;  2J1D G;  4TN7 B;  4ZS3 A;  2KT9 A;  4JEU B;  4WYV A;  4IDP A;  4U7Y A;  3SS1 A;  3GWH A;  2BS4 A;  4YTM A;  2DL1 A;  5FXV A;  1N36 T;  4HWI B;  4DR7 T;  3RIU A;  2LRL A;  4X5T A;  2W62 A;  3EI0 A;  1US7 B;  1OXZ A;  2K3W A;  2R6G F;  2VKH A;  3ZMZ B;  2K48 A;  3HKB E;  1NAF A;  2VVS A;  5AQI B;  3OTO T;  3TLT A;  5TAO A;  1W0A A;  5AQG B;  5AQJ B;  2IW5 B;  3JCF A;  1OED A;  4JI0 T;  4IST A;  3L39 A;  4OYJ A;  4U2Y A;  4A98 A;  3RRC A;  5JQG E;  3ZSS A;  4DV0 T;  3F31 A;  5LG4 A;  4HFD A;  3VRB A;  3PV0 F;  2UXX B;  1XWM A;  4LMJ A;  4V1A v;  4PJM A;  5DJQ C;  1T98 A;  2YKS A;  4HWF A;  1LKX A;  3LBX B;  4IT4 A;  3OBV E;  3N9P A;  2MOZ A;  4ADZ A;  3IBP A;  4H63 H;  1CHU A;  2DHR A;  4H9Q C;  5KXJ A;  1E7P A;  5FL1 A;  4HFI A;  4ILC A;  4PK4 A;  4F6R C;  1XMQ T;  2LJL A;  3AAI A;  3AXJ B;  1XNQ T;  4ILU A;  5JR9 B;  3P8C D;  1N33 T;  4YHH T;  4QXB B;  4NUV A;  5AQR B;  2DWG A;  2WBL A;  3SRZ A;  1VCS A;  1D1C A;  3ANW B;  1V9D A;  3HR0 A;  4PJN A;  2EHO C;  2J47 A;  2V7K A;  1FIO A;  4GKJ T;  4MFR A;  4QWN B;  3VRA A;  2SPC A;  5LJM A;  4XAX B;  4EZ4 A;  3MKD A;  4WW0 A;  1SUM B;  3ZMU B;  2XM1 A;  3ZT7 A;  2W00 A;  1MMD A;  4ILA A;  1ZEE A;  3CKD A;  1UX4 A;  1YQ3 A;  5FMN A;  1NEN A;  1Y64 B;  5LGN B;  5LP6 E;  1ZV4 X;  3N9O A;  5FP3 A;  4U2Z A;  4X1Y E;  3WI3 A;  2CBJ A;  1HCI A;  2XZE A;  3PUR A;  3SFD A;  2F4V T;  1D0X A;  1S35 A;  2BVL A;  4UVA B;  3EHZ A;  2LEH A;  4UVC B;  3FB2 A;  2M67 A;  4OX9 T;  1VCT A;  3E08 A;  1MIV A;  4ZI2 C;  2X68 A;  4C91 A;  3ZMV B;  4IL4 A;  1FJG T;  3O4X E;  2ODU A;  1XDP A;  5L2L A;  4E7Z A;  1H7C A;  5AQF B;  1FEW A;  3PJA J;  4ZEY A;  2BBJ A;  4CXY A;  2ACZ A;  4QH1 A;  3RF1 A;  3ZPO A;  4G2A A;  4P09 A;  2VWA A;  3ONX A;  4DMV A;  4O2B E;  4KHP T;  2NW7 A;  2LM2 A;  1J1J A;  3P4Q A;  2CLY B;  2LSK A;  3EAB A;  2JMH A;  4DV7 T;  5AQK B;  2P9B A;  4ISS A;  2ZM8 A;  2CCQ A;  2X9H A;  5F5W A;  3AE7 A;  3UFG A;  4BJN A;  2BKP A;  4HWH A;  3IEE A;  5JH7 E;  1X79 A;  2YN6 A;  5AFU L;  2Q9Q C;  3PUA A;  4NXN T;  2CHO A;  1U4Q A;  2XSA A;  4EEB A;  3Q2M A;  1MIW A;  2LRK A;  1YKE B;  4O4J E;  2BVM A;  1Z8U A;  4JEH B;  4TNV A;  3WAJ A;  3KDS E;  2WSS V;  3ZLI A;  3FXE B;  3C98 B;  4O8S A;  3KV4 A;  1WR0 A;  3D0T A;  3NRX A;  4QH4 A;  4YTP A;  3N2O A;  4JYA T;  4KMC A;  2LKH A;  1BR4 A;  4BJM A;  5LHH B;  2VL8 A;  1IZN B;  1WCR A;  2I0M A;  4Z91 A;  2XUE A;  2L3L A;  1E1H B;  3LJC A;  1W0B A;  1M7K A;  3LG7 A;  5EK3 A;  3MK7 C;  2IAK A;  2C5K T;  3Q9D A;  3AAE B;  5JRC A;  1O3X A;  3JAD A;  1MMA A;  2CMR A;  2E2A A;  5HWY A;  4Z8X A;  2J62 A;  2NW8 A;  2JJ9 A;  5HYA A;  5JDN A;  2ZM6 T;  3UUX B;  5ETW A;  4U74 A;  2CE7 A;  3PUW F;  3BQL A;  3ZMT B;  2CWY A;  2WDR A;  1OED C;  5FY1 A;  4ZZC A;  2E8I A;  1XMO T;  3JAE A;  5HXE A;  2YU2 A;  2BS2 A;  1IBM T;  1OWA A;  4OYK A;  3P7I A;  4QH5 A;  4DR5 T;  4JI6 T;  2A2F X;  2I6H A;  4QX7 B;  2YDS A;  3KV5 A;  4EYY R;  3ZMS B;  3Q5E A;  2V26 A;  4MBQ A;  3UU6 A;  3Q5X A;  3VKH A;  3C4Z A;  2BKO A;  2E9X B;  4LFA T;  3I1A A;  2A9U A;  5L3C B;  4ZI3 C;  4JI4 T;  3BQI A;  1VRB A;  2LSJ A;  1Y01 A;  2K5B B;  4EV6 A;  3RIF A;  2X0L B;  2L9Q A;  3RC8 A;  2H88 A;  2XAH B;  5CFB A;  2XQ4 A;  2IHR 1;  1HG5 A;  2C5J A;  2NR4 A;  3CX8 B;  3AEE A;  3HKC E;  2LHN A;  3AAA B;  2X0Y A;  3RRW A;  4J2C A;  5CA0 E;  5EZY E;  2W2U A;  3AE5 A;  3AE8 A;  2Z6E A;  3E0Z A;  3N2K E;  3LK2 B;  3RQU A;  2UXC T;  3K3N A;  3SWH A;  3EUH A;  1MMN A;  4QX8 B;  5LB7 B;  4CI3 B;  4EB6 E;  4O4I E;  2N1G A;  3I0Q A;  3V5U A;  4GKK T;  4IL9 A;  2CPT A;  5JDG A;  5F3J A;  5HEG A;  4UF0 A;  1XZY A;  2NOX A;  4TWD A;  4DND A;  3NZP A;  4M1P A;  1SA0 E;  2WY2 A;  4F8H A;  3U3I A;  5ABF A;  2QA7 A;  4NUU A;  2LSY A;  2Q9Q B;  2YDR A;  4ASK A;  3ZYM A;  2WB5 A;  2V6X A;  4LF6 T;  3Q5D A;  3G06 A;  1QUU A;  4LML A;  2XQY A;  2VQF T;  4DV4 T;  4YJ3 E;  2KWI B;  3QUJ A;  2XAJ B;  4H9O C;  3RH3 A;  3TLV A;  3CQC B;  2H7V C;  4NPP A;  5LYJ E;  3V5S A;  2VB6 A;  4QHO A;  3KV6 A;  2LOP A;  3FHN A;  3GN5 A;  4BA9 A;  2NTX A;  2W63 A;  3ZKR A;  4IDO A;  3ZC0 A;  3FZH B;  5CGM A;  3RHW A;  3LDQ B;  2N9D A;  2WM9 A;  4K0U A;  2D0T A;  3B13 A;  4DV1 T;  2NP9 A;  3C50 A;  2XQ5 A;  3HKE E;  2VQE T;  5AQV B;  4EOZ B;  4HN9 A;  3AE3 A;  2W4X A;  2CA5 A;  2AXD S;  2VKD A;  3DP7 A;  2YDQ A;  3QC9 A;  1I6Z A;  2C0S A;  5IWA T;  4WBN E;  3N9L A;  3BQK A;  5LMN T;  3F2E A;  3AED A;  3HL6 A;  3K8P C;  1R8I A;  1MMG A;  1OED B;  2DNX A;  3NBX X;  5HAX A;  2DWK A;  5FNV E;  2YEV C;  2M6I A;  3NKZ A;  2FJD A;  4X64 T;  4GIW A;  4B6X A;  2ODV A;  3PDY A;  4KI0 F;  4H9P C;  4U7I A;  4LF8 T;  4Z90 A;  4PK6 A;  2V6Y A;  2BZB A;  3AA7 B;  4OFZ A;  5CJ5 A;  4X65 T;  1JNZ A;  2WAU A;  3CVR A;  3CML A;  2WU2 A;  5H6Q B;  3AXJ A;  1UGO A;  5L4H A;  1SHZ C;  1NWM X;  5AQO B;  4DBR A;  1WFD A;  5AQT B;  5JDH A;  2HH7 A;  3RKO A;  4EXT A;  3R84 B;  1YW0 A;  3KBT A;  2IML A;  2XQ7 A;  4OHF A;  4YLH A;  4UV9 B;  2ES0 A;  2V8S V;  2X66 A;  3ZT6 A;  5CA1 E;  1X9B A;  2Y48 B;  4B3M T;  4X20 E;  4U33 A;  3ZN1 B;  2WCA A;  5JDM A;  3PU3 A;  2HN1 A;  3CQG B;  2XQ6 A;  2A3D A;  3X1D A;  1IJ5 A;  3FZL B;  4EGW A;  4LFC T;  3P4R A;  5LGT B;  2FBW A;  2J4G A;  2WU5 A;  5LMU T;  1S94 A;  4GK5 E;  4JI1 T;  1WLX A;  4ZXL A;  4MLK A;  5AQU B;  2D5U A;  5LBQ B;  4UXN B;  5AQQ B;  2YK0 A;  3ESL A;  3OKQ A;  1T8B A;  1UX5 A;  2XAS B;  4UVB B;  4QXC B;  3ZEF B;  3UUN A;  1YD8 G;  2FJE A;  3CK6 A;  2E5L T;  2XQ8 A;  5IYZ E;  4JUY A;  3RX6 A;  4EZH A;  3L09 A;  3AE2 A;  3NWI A;  2CXF A;  3IHR A;  3HI2 A;  2RPA A;  5J2T E;  4O4H E;  2VAS A;  3TLW A;  3FBL A;  3QK6 A;  1HX8 A;  4AIS A;  4NXM T;  2K24 A;  2BG9 C;  2BS3 A;  3EDV A;  2VKO A;  2AE9 A;  4KP3 C;  2UXD T;  3UTK A;  2CXL A;  2K9A A;  3KVA A;  3ZYK A;  5L47 A;  2XPK A;  4HTE A;  2PBI A;  5AQH B;  1J5W A;  1WRD A;  4HE8 A;  4IE4 A;  3PE0 A;  3PUY F;  4DR4 T;  4O2A E;  4YJ2 E;  4A56 A;  1YQ4 A;  4JBW F;  5FVK A;  3PUX F;  4U72 A;  2WWU A;  2RP4 A;  2ACX A;  2CM0 A;  5AQM B;  3PUG A;  4YSX A;  2M6B A;  3RYH E;  3QNU A;  5ABE A;  4KX6 A;  2YIN A;  2DCF A;  4PFO A;  4CXX A;  3J9X 1;  2KND A;  2E9X D;  1FMW A;  2WP9 A;  5L3F B;  3Q5W A;  3N2G E;  4AKH A;  3K3Q C;  4E7S A;  4YTN A;  3CWZ B;  1MIY A;  2BBH A;  4DUZ T;  4AXP A;  4AQF C;  4DR1 T;  2XQ3 A;  1W9R A;  1VOM A;  4A97 A;  2QYW A;  1E2A A;  1XDO A;  3ZN0 B;  5DQV A;  1D0Z A;  3I9W A;  3AEG A;  2ZLY A;  2FJB A;  3WAK A;  1WR6 A;  4PW8 A;  2V7M A;  4X62 T;  3UUB A;  3M3Z B;  4AI6 A;  2V7I A;  2WDQ A;  2BDE A;  5LBM A;  1ZP0 A;  1UUS A;  1UK5 A;  2HPJ A;  4KHZ F;  1BR1 A;  5L4E A;  3UU5 A;  4CN6 A;  1G73 A;  3KVB A;  3CIR A;  5JRC B;  4C90 A;  2JQK A;  5LNK A;  4I55 E;  5IHY A;  4Q25 A;  2CHN A;  3S4U A;  2EHO B;  2B1E A;  2YU1 A;  3R6N A;  2IIU A;  2Y6X A;  2NWB A;  2UUB T;  2VL0 A;  3I0O A;  2I59 A;  2RA1 A;  4JV5 T;  2UU9 T;  2E9X A;  3O1H A;  3MXZ A;  1KEY A;  3C64 A;  2Y8D A;  2CWO A;  3UFE A;  4HGA A;  1LVK A;  3RC3 A;  4HFC A;  5LA6 E;  4DV2 T;  1GQE A;  3N9N A;  1HX1 B;  3KBU A;  2VVN A;  4L0R A;  2QRX A;  4IDQ A;  3K3O A;  5JR9 C;  4P0A A;  2HPL A;  1HR0 T;  1T72 A;  4AIU A;  4GK0 E;  2N2N A;  3JC6 D;  2BG9 A;  2JQH A;  1M62 A;  4TV9 E;  3C51 A;  2XTL A;  2KZ7 B;  3EVY A;  2UXN B;  4DR3 T;  4TZ4 C;  4YT0 A;  1KFY A;  3ONL C;  5LJN A;  5DQW A;  1KNP A;  5DAB A;  1BR2 A;  3T1Y T;  1UCU A;  3VKG A;  4B3S T;  5FXX A;  4DBQ A;  3PUV F;  5JTG A;  4TUY E;  4AKR B;  3UUL A;  2X0H A;  3CQX C;  1AJ3 A;  4OK0 A;  4EAH A;  5HCJ A;  4WZX A;  2X67 A;  1QLB A;  1HF8 A;  4MAL A;  3RYI E;  4UEL A;  5L3G B;  5L3B B;  4IIJ E;  2X9X A;  3U78 A;  3MJX A;  3ETU A;  5HXR A;  3UQ7 A;  3MA9 A;  4I4T E;  4UF0 B;  2KWH A;  4JI3 T;  3A5X A;  1ZKE A;  3TKL B;  4HFE A;  3ZYL A;  4DR2 T;  5L3E B;  1OED E;  4DV3 T;  3A8Y C;  4AQF A;  3ABV A;  1FMV A;  3L8R A;  5ABG A;  2IUB A;  3SOL A;  2UUA T;  2IC9 A;  3P4S A;  3RYF E;  3DJB A;  4PAG A;  3AVS A;  1B7T A;  5LG3 A;  1WYC A;  4O4L E;  2OLT A;  4HWD A;  4N78 D;  2CLY C;  1J5E T;  3OJA A;  2WWV A;  1QSD A;  2V7J A;  2IDO B;  2PG8 A;  5KDM C;  5LCY A;  2D2S A;  2V7L A;  2WMN A;  3GN5 B;  3NRY A;  4K0K T;  3H3A A;  1XNR T;  5EK4 A;  3OVU A;  3TLU A;  5C3J A;  3AEC A;  2BKN A;  3VU7 H;  3RPU A;  5BR8 T;  2GK9 A;  4ERR A;  4HFB A;  4IHJ E;  3ETV A;  4GYR A;  2LHR A;  2NTY A;  3FZM B;  4I0U A;  4JI7 T;  3LBX A;  2WMO A;  3ZJ1 A;  1WYB A;  4UEM A;  3AE4 A;  3ZJ2 A;  3VHL A;  2CRB A;  4ANJ A;  4HFV A;  2ZM0 A;  3AE1 A;  3UUM A;  2WQY A;  1HNX T;  2V5C A;  5CB4 E;  3T8O A;  1HG2 A;  5AQS B;  4CZZ B;  3M65 A;  4TWF A;  2LE8 A;  2LM9 A;  5FYM A;  1N34 T;  4KUM B;  4DO0 A;  5JR9 A;  2ZMA A;  1IBK T;  2PTF A;  3O9X A;  2V6Y B;  3QB5 K;  5HXS A;  2JPF A;  3KFW X;  1BR0 A;  5FY0 A;  2FJA A;  2PFV A;  2V5D A;  3ANW A;  4LMK A;  4I43 B;  3RIA A;  2H3R A;  2JMK A;  3NZQ A;  4YY3 T;  5H6R B;  4B3T T;  2D0U A;  1D1B A;  5LOV E;  2JQQ A;  1L0V A;  1HNZ T;  4P0B A;  3GA8 A;  5JVD E;  3ZST A;  2ZM2 A;  2W61 A;  4YHJ A;  2KXP B;  4ZOL E;  4QXH B;  2W66 A;  3AA1 B;  3MZK B;  4DID B;  1T7S A;  3I9Y A;  5GON E;  4HEA A;  4PK5 A;  1N32 T;  4LF4 T;  1MNE A;  4NIQ A;  2QGS A;  2UXB T;  3UU4 A;  4UV8 B;  2PJQ A;  2X9W A;  4IGU A;  2E9X C;  4PJL A;  5E0O A;  2WZI A;  3T1H T;  4UIG A;  5J1G A;  3CX7 B;  2G0U A;  1U5P A;  1IBL T;  4CI2 B;  5HXC A;  2MYS A;  4IDN A;  3ZCI A;  4JI5 T;  3L3P A;  2IC6 A;  3K1S A;  2C5I T;  4L5G A;  4B3R T;  2KSR A;  4KBM B;  3VR8 A;  4JI8 T;  4WBO A;  2XY8 B;  4MHC A;  4JI2 T;  4H63 V;  4GOU A;  5FVL A;  3AEF A;  3UU8 A;  5AQP B;  2KLQ A;  2KIN B;  3J7Y q;  1I94 T;  5C8Y E;  4UR9 A;  3FZK B;  1KNZ A;  4CN1 A;  3A7M A;  2CBI A;  3AB3 B;  1UUR A;  4AQG A;  3RI5 A;  3QOF A;  2WS3 A;  4IE5 A;  3W15 B;  1LVF A;  2OA5 A;  4TV8 E;  3JAF A;  3LK4 2;  3LFM A;  4YSZ A;  5A1L A;  3PTR B;  3H3M A;  3ONJ A;  1G8X A;  4DUY T;  2W67 A;  4LFB T;  3RQW A;  3VR9 A;  4FI5 A;  2XAG B;  2EHO D;  3C4X A;  2MTQ A;  4H9S E;  4EED A;  3DTO A;  2LSG A;  2HN2 A;  2X51 A;  5EK2 A;  3LK3 B;  5AQN B;  3FXD B;  2H7O A;  3UQ4 A;  2WDV A;  1HNW T;  1IAP A;  1YXR A;  3AA0 B;  2W0G A;  3NVO A;  4X1I E;  2V1D B;  4G63 A;  1HFA A;  5HEH A;  5F8P A;  2VKJ A;  4HWC A;  3F57 A;  3OYZ A;  1KK7 A;  4P1N A;  3AEA A;  3B5M A;  2XM2 A;  3N9Q A;  4ZI2 D;  3HKD E;  4QKN A;  3UT5 E;  4PFP A;  4XZC A;  1HTJ F;  2LT3 A;  3EAM A;  2CXD A;  3N9M A;  4DMW A;  4HKA A;  4DVD A;  4DV5 T;  4CXW A;  2JQ9 A;  4L9I A;  2DI4 A;  4DR6 T;  3PU8 A;  3IA3 A;  1DU2 A;  2QVA A;  5HEU A;  4COF A;  4U3C A;  3JC6 C;  5J0Z A;  4AKI A;  2XJ7 A;  2L8K A;  5M4Y A;  4IDZ A;  3RIU C;  3RGL A;  2XAQ B;  5KMG P;  4AQY T;  2XSB A;  5JDL A;  3C4W A;  4IE7 A;  3ZT5 A;  1W09 A;  5HEJ A;  1HS7 A;  2H89 A;  4XBF B;  3FZF B;  3UU3 A;  3RYC E;  5C2T A;  2Q9Q D;  3AE9 A;  2MAW A;  3O1J A;  4TWH A;  2BG9 E;  5ADX L;  4IRE A;  4LF5 T;  2EHO A;  3ZC1 A;  2LKG A;  4ZS2 A;  3P50 A;  5BMV E;  4CI1 B;  3PJA A;  5IUX A;  2A72 A;  3B57 A;  2FUP A;  3ZCJ A;  5LGU B;  4A5X A;  4X66 T;  2CEA A;  3E22 E;  4WNK A;  3PUQ A;  3EDU A;  2OV9 A;  5JDF A;  4BAY B;  4YSY A;  3AE6 A;  1NEK A;  2B76 A;  5KX5 E;  2JRK A;  2JIW A;  4H9R C;  5FL0 A;  4I50 E;  4AKG A;  2E5V A;  5AQL B;  1D0Y A;  1SE7 A;  1KNR A;  1YKH B;  1ZOY A;  4ZZB A;  4JLE A;  2MBG A;  5FKY A;  3PUZ F;  2YOE A;  4HFH A;  2VK9 A;  3TLS A;  3SFE A;  5J2U E;  3OPC A;  1LRZ A;  4EIW A;  3KV9 A;  4ILB A;  4YXD A;  5HWX A;  2NW9 A;  4YFS A;  3AEB A;  1EZ3 A;  4CN4 A;  5L3D B;  1JNR A;  3IF8 B;  1KF6 A;  2X9Y A;  2VUR A;  1D1A A;  3OYX A;  4GYS A;  4H9N C;  3LSV A;  4DV6 T;  3QB5 A;  1Z0P A;  2LLY A;  2HHH T;  3AA6 B;  3CPZ A;  4LF9 T;  5HXH A;  4ZI7 E;  4PJJ A;  1MND A;  2BG9 B;  5HEO A;  3CX6 B;  3PUS A;  3N5L A;  4IE6 A;  2XQA A;  3P4P A;  1IJ6 A;  5JRE A;  3BK9 A;  5ABH A;  2UUC T;  4FJO A;  5FY7 A;  2LOS A;  3GMI A;  3RLF F;  1ZHC A;  5LHI B;  3P4W A;  2DLR A;  4U31 A;  4TX5 A;  4LF7 T;  2Q9Q A;  5HCM A;  2XAF B;  4TNW A;  4IE0 A;  3AVR A;  3HA4 A;  3H37 A;  2KMF A;  4EYU A;  3FBZ A;  2XHE B;  2D9D A;  3O1I A;  5LXT E; 
#chains in the Genus database with same CATH homology
 3KIN B;  2ZMA A;  5JR9 A;  4AKL A;  1CUN A;  2PBI A;  2LSI A;  4ZHQ E;  5FXZ A;  5HXE A;  2YU2 A;  1WRD A;  3O9X A;  4CQI A;  4HE8 A;  4IE4 A;  3PE0 A;  5HXS A;  2JPF A;  1OWA A;  5FXW A;  3KFW X;  1BR0 A;  4OYK A;  5FY0 A;  3P7I A;  4O2A E;  4ZI3 D;  4YJ2 E;  4A56 A;  2PFV A;  4X1K E;  3ANW A;  5JDQ A;  2A2F X;  4PNI A;  4QX7 B;  4I43 B;  3MAC A;  2H3R A;  2JMK A;  2J1D G;  4TN7 B;  4U72 A;  5LHG B;  3KV5 A;  2WWU A;  3NZQ A;  4ZS3 A;  2RP4 A;  2ACX A;  2CM0 A;  2KT9 A;  4JEU B;  4EYY R;  5H6R B;  3ZMS B;  3PUG A;  2V26 A;  3RYH E;  4MBQ A;  3Q5X A;  3VKH A;  2YIN A;  2DCF A;  4PFO A;  2D0U A;  1D1B A;  3SS1 A;  3C4Z A;  5LOV E;  4CXX A;  2JQQ A;  2E9X B;  3I1A A;  3GWH A;  5L3C B;  4P0B A;  2KND A;  3J9X 1;  2E9X D;  1FMW A;  5L3F B;  5FXV A;  3Q5W A;  3GA8 A;  4ZI3 C;  5JVD E;  3BQI A;  1VRB A;  2LSJ A;  3N2G E;  2K5B B;  2ZM2 A;  4AKH A;  2W61 A;  4YHJ A;  3K3Q C;  2X0L B;  2KXP B;  4ZOL E;  2L9Q A;  4E7S A;  3RC8 A;  3CWZ B;  1MIY A;  2XAH B;  4QXH B;  3AA1 B;  3MZK B;  1HG5 A;  4AXP A;  2C5J A;  3CX8 B;  3I9Y A;  2W62 A;  5GON E;  4HEA A;  4PK5 A;  4AQF C;  3HKC E;  1MNE A;  2QGS A;  4UV8 B;  2PJQ A;  1US7 B;  2X9W A;  1VOM A;  1OXZ A;  4IGU A;  2E9X C;  2LHN A;  3AAA B;  2VKH A;  4PJL A;  3ZMZ B;  5E0O A;  3RRW A;  4J2C A;  4UIG A;  2K48 A;  3HKB E;  5J1G A;  3ZN0 B;  3CX7 B;  5DQV A;  1NAF A;  2G0U A;  1U5P A;  1D0Z A;  5CA0 E;  5EZY E;  5TAO A;  4CI2 B;  3I9W A;  5HXC A;  2ZLY A;  2MYS A;  3ZCI A;  2Z6E A;  2IW5 B;  3E0Z A;  3WAK A;  3L3P A;  2IC6 A;  3N2K E;  1WR6 A;  2C5I T;  4IST A;  4PW8 A;  3LK2 B;  2V7M A;  4L5G A;  4OYJ A;  3K3N A;  3SWH A;  3EUH A;  1MMN A;  4QX8 B;  3RRC A;  5JQG E;  4KBM B;  4CI3 B;  4AI6 A;  2V7I A;  4EB6 E;  4O4I E;  4WBO A;  4MHC A;  2BDE A;  4H63 V;  4GOU A;  5LBM A;  2N1G A;  3F31 A;  3I0Q A;  3V5U A;  5LG4 A;  2KLQ A;  5JDG A;  2UXX B;  2KIN B;  2HPJ A;  3J7Y q;  5C8Y E;  1BR1 A;  4V1A v;  5F3J A;  1KNZ A;  4PJM A;  5DJQ C;  1T98 A;  4UF0 A;  2NOX A;  1G73 A;  4DND A;  1LKX A;  3NZP A;  3LBX B;  1SA0 E;  4M1P A;  3AB3 B;  3KVB A;  3OBV E;  3N9P A;  5JRC B;  4C90 A;  4AQG A;  5LNK A;  2MOZ A;  4I55 E;  4IE5 A;  3W15 B;  3U3I A;  2QA7 A;  1LVF A;  2OA5 A;  4NUU A;  2LSY A;  4ADZ A;  2Q9Q B;  4TV8 E;  4ASK A;  5IHY A;  3ZYM A;  3LK4 2;  3LFM A;  3IBP A;  4H63 H;  5A1L A;  3PTR B;  2DHR A;  4H9Q C;  1G8X A;  3S4U A;  1QUU A;  2EHO B;  2B1E A;  2XQY A;  4F6R C;  4PK4 A;  4FI5 A;  2YU1 A;  2XAG B;  4YJ3 E;  2EHO D;  3C4X A;  2LJL A;  3AAI A;  3R6N A;  2KWI B;  2Y6X A;  2MTQ A;  2NWB A;  3QUJ A;  4ILU A;  4H9S E;  5JR9 B;  3P8C D;  3DTO A;  2LSG A;  3I0O A;  4QXB B;  2I59 A;  2XAJ B;  4NUV A;  2DWG A;  2X51 A;  2RA1 A;  5EK2 A;  2E9X A;  3O1H A;  3MXZ A;  4H9O C;  2WBL A;  3SRZ A;  3C64 A;  3LK3 B;  3RH3 A;  2Y8D A;  3CQC B;  1D1C A;  2H7V C;  3FXD B;  2CWO A;  3UFE A;  2H7O A;  4HGA A;  3ANW B;  1V9D A;  3HR0 A;  5LYJ E;  1LVK A;  4PJN A;  3RC3 A;  1IAP A;  5LA6 E;  2VB6 A;  3V5S A;  4QHO A;  3KV6 A;  2LOP A;  3FHN A;  2EHO C;  3N9N A;  2V7K A;  3GN5 A;  1FIO A;  3KBU A;  4BA9 A;  3AA0 B;  4MFR A;  4QWN B;  2NTX A;  2W0G A;  2W63 A;  2SPC A;  5LJM A;  4L0R A;  4X1I E;  2V1D B;  3K3O A;  4G63 A;  4XAX B;  4EZ4 A;  5JR9 C;  3ZC0 A;  4P0A A;  1HFA A;  2HPL A;  5F8P A;  5KX5 E;  3MKD A;  2VKJ A;  4WW0 A;  4GK0 E;  3ZMU B;  2N9D A;  2WM9 A;  3F57 A;  3OYZ A;  1KK7 A;  4K0U A;  2D0T A;  2N2N A;  2W00 A;  1MMD A;  3B13 A;  1ZEE A;  2NP9 A;  1UX4 A;  3C50 A;  3CKD A;  3JC6 D;  3HKE E;  5FMN A;  4TV9 E;  3C51 A;  1Y64 B;  3N9Q A;  5LGN B;  2XTL A;  2KZ7 B;  3EVY A;  2UXN B;  4TZ4 C;  1ZV4 X;  4EOZ B;  4ZI2 D;  5LP6 E;  4HN9 A;  3N9O A;  3HKD E;  5FP3 A;  4QKN A;  4X1Y E;  3UT5 E;  3WI3 A;  2CA5 A;  1HCI A;  1HTJ F;  3PUR A;  4PFP A;  4XZC A;  5DQW A;  5LJN A;  1D0X A;  2LT3 A;  5DAB A;  1S35 A;  2VKD A;  1BR2 A;  2CXD A;  3N9M A;  4DMW A;  3DP7 A;  4HKA A;  4DVD A;  1UCU A;  3QC9 A;  2C0S A;  2BVL A;  4CXW A;  3VKG A;  4L9I A;  4UVA B;  5FXX A;  2DI4 A;  3PU8 A;  2LEH A;  4WBN E;  4DBQ A;  4UVC B;  3FB2 A;  2M67 A;  3JC6 C;  3N9L A;  4TUY E;  4AKR B;  3UUL A;  4AKI A;  2L8K A;  3E08 A;  3BQK A;  3F2E A;  3CQX C;  1MIV A;  1AJ3 A;  4OK0 A;  3HL6 A;  2X68 A;  3K8P C;  4ZI2 C;  5M4Y A;  1MMG A;  4EAH A;  2DNX A;  4IDZ A;  4C91 A;  3ZMV B;  3NBX X;  2XAQ B;  5HAX A;  2DWK A;  5KMG P;  5FNV E;  2YEV C;  3O4X E;  2ODU A;  5JDL A;  2X67 A;  3C4W A;  4GIW A;  1HF8 A;  5L2L A;  4IE7 A;  4E7Z A;  4MAL A;  3RYI E;  4B6X A;  2ODV A;  3PDY A;  1H7C A;  1HS7 A;  4H9P C;  4UEL A;  5L3G B;  5L3B B;  1FEW A;  4XBF B;  4CXY A;  4IIJ E;  2X9X A;  3RYC E;  3U78 A;  4PK6 A;  2Q9Q D;  2BZB A;  3MJX A;  3ETU A;  3O1J A;  3AA7 B;  4OFZ A;  5HXR A;  3ZPO A;  4G2A A;  4P09 A;  2VWA A;  3MA9 A;  3ONX A;  4I4T E;  4UF0 B;  4O2B E;  4DMV A;  5ADX L;  2WAU A;  2KWH A;  2EHO A;  3CVR A;  3CML A;  3A5X A;  2NW7 A;  3ZC1 A;  1ZKE A;  4ZS2 A;  2CLY B;  3TKL B;  5H6Q B;  5BMV E;  4CI1 B;  3ZYL A;  2A72 A;  2LSK A;  3B57 A;  3ZCJ A;  5L3E B;  2JMH A;  5LGU B;  1SHZ C;  4AQF A;  1NWM X;  2P9B A;  4ISS A;  2CEA A;  4DBR A;  2ZM8 A;  1FMV A;  3E22 E;  2CCQ A;  2X9H A;  4WNK A;  5JDH A;  2HH7 A;  3PUQ A;  3RKO A;  3EDU A;  5JDF A;  4EXT A;  3SOL A;  4BAY B;  3R84 B;  4BJN A;  2IC9 A;  1YW0 A;  3IEE A;  3KBT A;  5JH7 E;  1X79 A;  2JRK A;  4OHF A;  4YLH A;  3RYF E;  4UV9 B;  5AFU L;  2Q9Q C;  4H9R C;  2ES0 A;  3PUA A;  3DJB A;  2X66 A;  4PAG A;  3AVS A;  5CA1 E;  1B7T A;  1U4Q A;  2Y48 B;  1WYC A;  4O4L E;  4I50 E;  4X20 E;  3Q2M A;  1MIW A;  4AKG A;  3ZN1 B;  1YKE B;  4O4J E;  1D0Y A;  2BVM A;  5JDM A;  4JEH B;  1YKH B;  3WAJ A;  4N78 D;  2CLY C;  4JLE A;  3OJA A;  2MBG A;  1QSD A;  2V7J A;  3KDS E;  2WSS V;  3ZLI A;  3PU3 A;  3CQG B;  2VK9 A;  2A3D A;  1IJ5 A;  2PG8 A;  5J2U E;  3FXE B;  5KDM C;  5LCY A;  1LRZ A;  2D2S A;  4EIW A;  3C98 B;  3KV9 A;  5LGT B;  4O8S A;  5HWX A;  3KV4 A;  3D0T A;  2V7L A;  2WMN A;  3NRX A;  4YFS A;  2NW9 A;  1EZ3 A;  3GN5 B;  1S94 A;  3N2O A;  3NRY A;  4GK5 E;  1WLX A;  3H3A A;  5L3D B;  4KMC A;  1BR4 A;  4MLK A;  3IF8 B;  2D5U A;  2X9Y A;  5EK4 A;  1D1A A;  4UXN B;  5LBQ B;  3OYX A;  2YK0 A;  4GYS A;  4BJM A;  4H9N C;  5LHH B;  1Z0P A;  2VL8 A;  1IZN B;  3ESL A;  3AA6 B;  3CPZ A;  3OKQ A;  5HXH A;  4ZI7 E;  4PJJ A;  1UX5 A;  1MND A;  2XAS B;  4UVB B;  4QXC B;  2XUE A;  3ZEF B;  3VU7 H;  3RPU A;  3UUN A;  1YD8 G;  2GK9 A;  3CX6 B;  2L3L A;  4ERR A;  3PUS A;  1E1H B;  4IHJ E;  3LJC A;  3N5L A;  4IE6 A;  3ETV A;  4GYR A;  2LHR A;  2NTY A;  3LG7 A;  5EK3 A;  1IJ6 A;  5IYZ E;  3MK7 C;  4JUY A;  2IAK A;  3RX6 A;  5JRE A;  4EZH A;  3BK9 A;  2C5K T;  3L09 A;  3LBX A;  2WMO A;  3Q9D A;  4FJO A;  5FY7 A;  3ZJ1 A;  1WYB A;  2LOS A;  3GMI A;  2CXF A;  4UEM A;  3AAE B;  3ZJ2 A;  5JRC A;  3VHL A;  3IHR A;  1O3X A;  1MMA A;  1ZHC A;  3HI2 A;  2CMR A;  5LHI B;  5HWY A;  5J2T E;  4ANJ A;  4HFV A;  4O4H E;  2VAS A;  2DLR A;  2ZM0 A;  4TX5 A;  2Q9Q A;  4Z8X A;  3FBL A;  3QK6 A;  1HX8 A;  2NW8 A;  2XAF B;  2K24 A;  4IE0 A;  3UUM A;  3AVR A;  2JJ9 A;  5HYA A;  5JDN A;  3HA4 A;  3H37 A;  2KMF A;  3UUX B;  3EDV A;  2VKO A;  4KP3 C;  5ETW A;  5CB4 E;  3T8O A;  3UTK A;  4EYU A;  3FBZ A;  1HG2 A;  2CXL A;  4U74 A;  4CZZ B;  2CE7 A;  2XHE B;  3BQL A;  2K9A A;  3ZMT B;  3KVA A;  3ZYK A;  2CWY A;  3M65 A;  2LE8 A;  2LM9 A;  5FY1 A;  5FYM A;  4HTE A;  4KUM B;  3O1I A;  2E8I A;  4DO0 A;  5LXT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...