2A3DA

Solution structure of a de novo designed single chain three-helix bundle (a3d)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
b'MGSWAEFKQRLAAIKTRLQALGGSEAELAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDELQAYRHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (DE NOVO THREE-HELIX BUNDLE)
publication title Solution structure and dynamics of a de novo designed three-helix bundle protein.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Three-helix bundle
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a3dA00
2A3DA 2MTQA
chains in the Genus database with same CATH superfamily
3P7IA 4OFZA 1AJ3A 5JR9B 1HNZT 2LLYA 3H37A 3RYIE 4QHOA 1KNRA 4PJMA 4I4TE 4ZI2C 2PJQA 4DR6T 3KBTA 2HPLA 4H9NC 1KK7A 3AE3A 3NRYA 4JI5T 4JI4T 3AE7A 5F5WA 5LCYA 2IMLA 3ANWB 4X1IE 1VOMA 2JJ9A 1GQEA 3CPZA 3B13A 2CPTA 1YW0A 2LJLA 5ETWA 1SA0E 3TKLB 1MNEA 2HH7A 3AECA 3AE9A 4AXPA 3MXZA 2D2SA 5AQNB 3PU3A 2Q9QD 2WDRA 5HWYA 5LBQB 3CIRA 5FMNA 2K24A 4DV0T 5JDHA 4EZHA 4GOUA 2H89A 2V6YB 2LSGA 2QRXA 4UXNB 3EAMA 5EK3A 4AKRB 3PJAA 4ADZA 3AE4A 2BS4A 2V7MA 4B3ST 1D1AA 4HFEA 3UQ7A 4H63H 2NR4A 3FBLA 3LG7A 3JC6D 4F8HA 4IT4A 1OEDC 3R6NA 1YKEB 1N32T 1U5PA 2HPJA 4OHFA 4CI3B 2WDVA 3T1HT 2V8SV 2XJ7A 2LSYA 4ZZBA 3EABA 3VHLA 5IWAT 3QUJA 4COFA 3TLWA 2XQ9A 3SOLA 4IE5A 1HX8A 1G8XA 2E5LT 3ONXA 4B3MT 2CWOA 2V7KA 4X20E 3RYCE 2G0UA 3UFEA 2KSRA 5AQVB 3I0QA 3RF1A 2BBJA 2JMHA 3BQLA 5JRCA 3C4WA 4ILBA 2CBIA 3RX6A 4O2BE 4N78D 2W4XA 1BR0A 3ZC0A 1L0VA 3I1AA 2XAJB 3QB5A 3H3MA 4HFCA 2NW9A 2FJDA 2VQET 2VVSA 3FZFB 4Z90A 4PFPA 4DMVA 3B57A 2CA5A 5LHIB 4HEAA 4O4JE 5AQFB 3G06A 3FZHB 5AQOB 3UQ4A 4L0RA 3LJCA 1IAPA 4C90A 2P9BA 2ZM6T 2NWBA 3O1IA 3N9QA 4HFVA 1OXZA 4QH5A 1W0AA 5LB7B 2IUBA 2W67A 1WR6A 3FB2A 3KDSE 3E0ZA 4IDQA 3M3ZB 3L3PA 5JDNA 4LF4T 2YINA 4U7IA 5GONE 3RLFF 1I6ZA 2VK9A 3NZPA 4DR3T 3BQIA 4YHJA 5DABA 1S35A 2WB5A 1KF6A 5AFUL 3LBXA 4HWHA 3P4WA 3P4RA 2WM9A 1WLXA 2WWVA 2IAKA 4KHPT 4BJNA 4Q25A 5BMVE 2I59A 1BR4A 4BJMA 2JMKA 3AA1B 5J2TE 4DV2T 3ONLC 5HAXA 4AKLA 2V26A 2HHHT 2Q9QA 4YLHA 4YXDA 5AQQB 4J2CA 4C91A 3P4PA 1IJ5A 4G2AA 2UXCT 4TUYE 4ZI2D 5CJ5A 2M6IA 2V7IA 2VB6A 3N9NA 2DWKA 2WBLA 2QVAA 1OEDB 1VCTA 4DBQA 2ZMAA 2QGSA 3L39A 5JDFA 2XAFB 1YXRA 4UEMA 3CQCB 4KMCA 2BKOA 4U2ZA 2UXXB 3TLVA 4QXCB 1UX5A 3SWHA 1N36T 1NEKA 3UU8A 2K9AA 2WAUA 4DV3T 2UUCT 4TX5A 5ABEA 5LP6E 2WZHA 3PUGA 4YFSA 1Z8UA 3Q5XA 2WCAA 4MHCA 4GK0E 5E0OA 3ZT7A 5LGTB 1S94A 1E1HB 3CWZB 4ZZCA 4U74A 5JR9C 2FUPA 2OA5A 5L3FB 2XQ6A 4HWIB 3GMIA 1OEDE 3CMLA 1LRZA 3A7MA 3B5MA 2WWUA 4PW8A 4OK0A 5DQWA 3RC8A 3RRCA 4LFBT 4TNWA 2F4VT 4IE7A 3PURA 2BKPA 2BKNA 5L3CB 3C4XA 2QYWA 3EI0A 4TNVA 3K1SA 4JV5T 5C2TA 3FXDB 1E2AA 2LHNA 2WU2A 3R84B 4ISTA 2E2AA 1N33T 5JRCB 3J9X1 2J1DG 2ES0A 4WW0A 3AA6B 4IE6A 2CMRA 4HFIA 4IGUA 3RQWA 2DCFA 2XQ4A 2X68A 5LJMA 5HXSA 4ZS3A 5ABGA 3UULA 3RPUA 5FNVE 4QX8B 4X62T 4DMWA 3EUHA 4GK5E 4ZI7E 4ASKA 3RRWA 3ZKRA 3PJAJ 2YOEA 1UX4A 1T8BA 2N1GA 2BVLA 3E22E 5LG3A 4HWDA 2W0GA 3ZN1B 2XQYA 4X1KE 5L47A 1HG5A 3AE5A 2BG9A 1XZYA 2DLRA 4AQFA 1UUSA 3KV5A 1IBKT 2YU1A 2XQ5A 2Z6EA 2KXPB 3UFGA 3OKQA 2X9WA 2CBJA 2XAHB 2XY8B 1G73A 3VR9A 2HN1A 3M65A 4UV9B 3K3OA 2E9XA 2JQHA 3CQXC 4TV8E 1US7B 3K3QC 4YSXA 3CQGB 2WY2A 3ZYLA 4EV6A 4BA9A 3TLUA 1JNZA 1R8IA 3RC3A 5LGNB 2UXBT 4CI1B 2WDQA 5LOVE 2R6GF 3RIUC 2M6BA 5AQMB 4JI6T 1KNPA 5JH7E 2BBHA 4X66T 1MIVA 3MK7C 1UK5A 2BDEA 1YKHB 2CXDA 2LSIA 4JI2T 3N2OA 2VURA 3RYFE 1ZOYA 2LSJA 2EHOA 4QXBB 3F57A 2NW7A 3RHWA 3ZT5A 2XM1A 1SHZC 2MBGA 4IDNA 5H6RB 5LMUT 2X66A 3WI3A 3RQUA 4WBOA 3MACA 4UF0A 4CXXA 2OLTA 2UUAT 2IDOB 2JRKA 3C4ZA 4H9QC 3LK2B 4X1YE 3ZJ2A 3NZQA 1YD8G 3IA3A 1FMVA 3AEFA 2UU9T 4TZ4C 2D0TA 2NOXA 3AE1A 2NW8A 4WBNE 3GWHA 1WRDA 4LF5T 4GKKT 4G63A 3N9OA 4ANJA 4HE8A 4QX7B 2A72A 3OTOT 4LMKA 2KT9A 1SE7A 4A56A 5LNKA 2LSKA 5AQJB 4JUYA 1XDPA 2PG8A 2Y48B 4P1NA 2CXLA 4H9OC 1JNRA 3ZMVB 2ZM0A 4HGAA 3IHRA 1FJGT 2W2UA 2D9DA 2JPFA 5F3JA 3PUXF 4IE0A 3LK42 3OJAA 3QB5K 4ILCA 5FXZA 3ETVA 5CB4E 3ZJ1A 3CX8B 1VRBA 5JDMA 1FIOA 1YQ3A 1NENA 4UIGA 3Q2MA 1XWMA 4YSZA 2XSBA 2XZEA 2X67A 4EB6E 2A3DA 3UUBA 4LFCT 4X5TA 2IW5B 3FZLB 2H88A 3OBVE 4EYUA 2KMFA 2YDRA 2CEAA 4ZS2A 2RPAA 3AVRA 1BR2A 2DHRA 3AA0B 5A1LA 2CHNA 2XPKA 4EZ4A 3ETUA 5LGUB 3VKHA 2IC6A 3IEEA 5ABHA 1D1BA 1UGOA 2WS3A 4KHZF 2FJAA 4MLKA 4CZZB 2JIWA 3I9YA 3KFWX 2XASB 2WP9A 4FJOA 1B7TA 3OVUA 4DR2T 3EDUA 3ESLA 5J0ZA 3U78A 2X51A 5FVKA 2ACXA 3HI2A 4IL4A 3L09A 2UXDT 2JQQA 4UVAB 3ZMUB 3N2GE 3RGLA 4DNDA 2D0UA 2W63A 1HTJF 3D0TA 3DJBA 5L3EB 3LK3B 2V7LA 4DIDB 2E9XB 5HCMA 3MKDA 2C5IT 5HWXA 3NVOA 2CRBA 1QSDA 1LVKA 2H7OA 2VL0A 4H9PC 1WYCA 4UR9A 2W66A 4YSYA 1EZ3A 5LYJE 4QH1A 1D1CA 4KBMB 3ZC1A 3UU6A 5JDGA 4KUMB 3AEGA 3U3IA 4Z8XA 4AISA 5IUXA 1U4QA 2LKGA 3RIAA 3Q5WA 2CCQA 2K5BB 4H9SE 2EHOB 2W61A 2MAWA 2CLYB 3L8RA 3ZMZB 2X0HA 5JQGE 3RYHE 2IIUA 3IF8B 4HFDA 2SPCA 4ZI3C 4EXTA 1ZKEA 4TWDA 2FBWA 3JAEA 5FP3A 5JTGA 2YK0A 5FYMA 2V1DB 2H7VC 3ZMSB 2Y6XA 4A98A 3BK9A 1ZP0A 4YY3T 4IHJE 1HR0T 3CKDA 4X64T 1KNZA 3V5SA 3OYZA 4YTMA 5F8PA 1V9DA 3AE6A 3AB3B 2KWHA 1WYBA 2VKDA 5LA6E 3W15B 5AQPB 1T98A 5HCJA 1Y64B 3O1HA 1ZHCA 4DR1T 1XMOT 5HXRA 2YEVC 2E5VA 2V6YA 1E7PA 4JI3T 3E08A 3IBPA 3T1YT 2NP9A 3ZSTA 5FXXA 3AEAA 3QK6A 4H9RC 4P0BA 2CM0A 4JI7T 2CE7A 3QC9A 1ZV4X 2KZ7B 3ZEFB 4IE4A 3HL6A 4PJLA 3UU3A 2UUBT 1UCUA 3T8OA 2V6XA 4PAGA 4ZOLE 2GK9A 3UT5E 3JC6C 1HS7A 3PTRB 4I43B 1D0XA 4HTEA 4ERRA 3PUWF 5DJQC 4AKIA 5HEGA 4DR4T 2A2FX 4BAYB 2WZIA 2J4GA 1W9RA 2L8KA 4NPPA 3PUQA 5LG4A 4I0UA 2A9UA 3ZT6A 2I0MA 1J5ET 4ZXLA 2ZM2A 3ZPOA 3AEDA 2YDQA 3DTOA 4M1PA 2L3LA 3EDVA 5JVDE 4EOZB 3AA7B 3LSVA 3J7Yq 4EAHA 5IHYA 5C3JA 3N9LA 2LOSA 4IDPA 5H6QB 5FXWA 2V5DA 1YQ4A 3AE2A 3N9PA 2J47A 4LFAT 4U3CA 5AQRB 4DUYT 3JCFA 4DV1T 3KBUA 4O4HE 4EEBA 2X9XA 3AVSA 5EK4A 1MMNA 1MNDA 1HNXT 5AQIB 2V7JA 2MPKA 3AEBA 2WQYA 2DI4A 4IIJE 3HA4A 4GYSA 4LF8T 5C8YE 5KDMC 1O3XA 3LBXB 1QUUA 3AAAB 3UU5A 2X9YA 5LMNT 3UUXB 3KINB 4KX6A 1T7SA 2LHRA 1QLBA 2PTFA 4QKNA 2BZBA 2BS2A 2M67A 1N34T 1H7CA 2IC9A 5HXCA 3F2EA 4PK6A 2X0LB 1T72A 2Q9QB 4HFHA 4NIQA 2ZM8A 2WMNA 2KNDA 4YTNA 3SS1A 3O1JA 4O2AE 4HKAA 2B1EA 3QOFA 5HEOA 4E7ZA 1HG2A 2LT3A 2VASA 3HKDE 2VWAA 2BG9C 2OV9A 5JREA 4AQFC 3RIFA 1IJ6A 4ILAA 4O4LE 2B76A 3AAIA 3MA9A 4QH4A 4JI1T 2RP4A 3PUZF 4TWFA 4ZI3D 4DR7T 3OPCA 4Z91A 3FXEB 5KX5E 3KV6A 1LKXA 4CN4A 5AQLB 3UUMA 2MYSA 3RI5A 1OEDA 3K3NA 3PE0A 4WNKA 4PJNA 4DUZT 2E9XC 3I0OA 5HXHA 4HWCA 3P50A 5HXEA 4U7YA 5ABFA 2X0YA 3C98B 4NUVA 4HFBA 3ZCIA 3UTKA 4LMLA 5CA0E 2AXDS 4B3RT 4EEDA 4JLEA 2D5UA 3ZLIA 4UV8B 4PJJA 3FHNA 2FJBA 5M4YA 3A8YC 4K0KT 4U72A 2EHOC 4DV4T 4AKHA 3AE8A 1MIWA 2CLYC 1X9BA 4U31A 4DO0A 2K3WA 2JQ9A 3NWIA 3C64A 2ODUA 4CXWA 3LFMA 5AQHB 4EIWA 2E8IA 5FVLA 3JADA 1WFDA 2X9HA 2HN2A 4TWHA 4LF7T 4F6RC 3A5XA 4O4IE 2CHOA 1CHUA 2QA7A 4WYVA 2PBIA 2L9QA 1W09A 3HKCE 3N5LA 2XHEB 5FKYA 4PFOA 4GIWA 4KI0F 3ZMTB 5AQTB 1HF8A 3AAEB 4I55E 3ZN0B 3Q5DA 4ZEYA 3GN5A 2WSSV 4MALA 4P09A 4ISSA 4L5GA 4DV6T 1MIYA 4QWNB 5BR8T 5FY0A 2KINB 3MZKB 1I94T 4JYAT 3ZYMA 3K8PC 2RA1A 5J1GA 4IDZA 4UELA 3P4SA 3I9WA 2N2NA 5AQGB 4DR5T 1WCRA 1X79A 4AKGA 4JBWF 5DQVA 4IDOA 2BG9B 4I50E 2VKJA 3CK6A 3VRAA 4LF6T 2ACZA 3PUYF 1XMQT 1VCSA 4IL9A 3PU8A 3SFDA 3JAFA 4JI8T 2KWIB 2C5KT 3NBXX 3WAKA 3O4XE 2LKHA 3AXJA 4DV7T 3V5UA 5HEHA 1HX1B 3FBZA 3FZMB 4YJ3E 3X1DA 4PNIA 3F31A 2XTLA 4XBFB 2J62A 4LF9T 1SUMB 2AE9A 4L9IA 2XQAA 4QXHB 1UURA 3VR8A 2XAQB 2YN6A 1D0ZA 3SRZA 1XNQT 2H3RA 2BG9E 4PK4A 3PUVF 1J1JA 4OX9T 5L2LA 3PDYA 2MOZA 5HYAA 4DV5T 3CX6B 4DBRA 2VVNA 5J2UE 4K0UA 3GA8A 5JR9A 2CWYA 1MMDA 4WZXA 1HFAA 2LM9A 3NKZA 3P8CD 3VRBA 4UF0B 5LBMA 2LM2A 5ADXL 1FMWA 3N2KE 2XQ7A 5L3BB 4LMJA 1IBMT 3ZYKA 3ANWA 2ZLYA 2E9XD 3QNUA 1IBLT 4AIUA 3TLSA 5L3DB 4AI6A 5AQKB 2N9DA 4UVBB 2UXNB 2BVMA 4TV9E 5JDLA 2ODVA 4CXYA 4U33A 5ABFB 4ZHQE 5FL0A 3EVYA 2YDSA 4DVDA 4CN1A 2MTQA 3UU4A 4ILUA 1HCIA 2W62A 3TLTA 5L4EA 3O9XA 2LE8A 2Q9QC 3KV9A 5FY1A 3AEEA 5CFBA 4P0AA 2WMOA 2IHR1 2W00A 1KFYA 3SFEA 1Y01A 4X65T 2XSAA 3UUNA 3MJXA 4CQIA 5FY7A 4OYJA 2EHOD 3N9MA 4GKJT 3OYXA 4AQYT 4AQGA 3H3AA 3KV4A 1J5WA 1XNRT 4B6XA 1M62A 2VL8A 4E7SA 4PK5A 3KVBA 4YT0A 1KEYA 4XZCA 4EGWA 2DWGA 2BS3A 5FXVA 3BQKA 1CUNA 4CN6A 2K48A 1ZEEA 2XQ8A 2NTXA 4YJ2E 5CA1E 3HKBE 4A5XA 5KXJA 2LEHA 4JI0T 3ZCJA 2XM2A 5IYZE 1WR0A 4IREA 1BR1A 3RKGA 2C0SA 4MBQA 1HNWT 1D0YA 4B3TT 2DL1A 3KVAA 3CVRA 3VKGA 1M7KA 4V1Av 1NWMX 5L3GB 4H63V 1MMAA 5FL1A 4NXMT 5L4HA 3ONJA 4YHHT 3NRXA 4NUUA 3GN5B 2LOPA 3PV0F 3Q9DA 4FI5A 2WU5A 1OWAA 1LVFA 5HEJA 5KMGP 5LXTE 2I6HA 4NXNT 3C51A 3DP7A 1FEWA 2FJEA 3PUAA 2DNXA 3EHZA 4OYKA 3HR0A 2YKSA 2KLQA 1Z0PA 1W0BA 3LDQB 3RKOA 1XDOA 5LHGB 3WAJA 3RIUA 3CX7B 3PUSA 3HKEE 2V5CA 5EZYE 4HWFA 2XAGB 1NAFA 5HEUA 3RH3A 5AQUB 4EYYR 4JEUB 5EK2A 2LRLA 4JEHB 2NTYA 5JDQA 5CGMA 4A97A 3FZKB 2Y8DA 4MFRA 1MMGA 4YTPA 3AXJB 3Q5EA 4CI2B 2VQFT 1IZNB 2VKHA 2VKOA 4TN7B 4KP3C 5LJNA 2C5JA 3S4UA 1DU2A 2XQ3A 4GYRA 2YU2A 2PFVA 3P4QA 2CXFA 3ZSSA 4UVCB 2LRKA 4XAXB 4U2YA 3C50A 4HN9A 5TAOA 2JQKA 3VU7H 3ABVA 5LHHB 4O8SA 5AQSB 2XUEA
chains in the Genus database with same CATH topology
3P7IA 4OFZA 3U3IA 1AJ3A 5JR9B 2LHNA 3HKCE 3N5LA 4ISTA 3R84B 5JRCB 4Z8XA 2XHEB 3J9X1 2J1DG 1U4QA 2ES0A 3H37A 4GIWA 4PFOA 3ZMTB 4WW0A 3AA6B 4IE6A 2CMRA 1HF8A 3AAEB 4I55E 3RYIE 3Q5WA 4QHOA 2CCQA 2K5BB 4H9SE 4IGUA 4PJMA 2EHOB 3ZN0B 2W61A 4I4TE 2DCFA 4ZI2C 2PJQA 2X68A 5LJMA 3GN5A 2CLYB 3KBTA 2HPLA 4H9NC 3ZMZB 5HXSA 4ZS3A 1KK7A 2WSSV 3NRYA 4MALA 4P09A 3UULA 3RPUA 4ISSA 5JQGE 4L5GA 3RYHE 3IF8B 1MIYA 4QWNB 5FNVE 5FY0A 5LCYA 4QX8B 2KINB 3MZKB 3ANWB 2SPCA 4ZI3C 3ZYMA 3EUHA 3K8PC 2RA1A 4X1IE 5J1GA 4GK5E 4IDZA 4UELA 4EXTA 4ZI7E 1VOMA 2JJ9A 4ASKA 1ZKEA 3RRWA 3CPZA 3I9WA 3B13A 1UX4A 1YW0A 2LJLA 5ETWA 2N2NA 1SA0E 2N1GA 5FP3A 3TKLB 2BVLA 1X79A 3E22E 2YK0A 4AKGA 5FYMA 2V1DB 1MNEA 2HH7A 2H7VC 4AXPA 3ZMSB 3MXZA 2Y6XA 2D2SA 3BK9A 5DQVA 2W0GA 2Q9QD 3PU3A 2VKJA 4I50E 4IHJE 5HWYA 3ZN1B 3CKDA 5LBQB 2XQYA 1KNZA 3V5SA 4X1KE 3OYZA 1HG5A 5F8PA 2DLRA 1V9DA 5FMNA 2K24A 3AB3B 4AQFA 5JDHA 4EZHA 2KWHA 4GOUA 1WYBA 3KV5A 2VKDA 2YU1A 5LA6E 3W15B 2Z6EA 1T98A 2LSGA 2KXPB 1Y64B 3O1HA 4UXNB 1ZHCA 3PU8A 3OKQA 5EK3A 2X9WA 5HXRA 2YEVC 2XAHB 4AKRB 1G73A 2KWIB 3E08A 4ADZA 2C5KT 3IBPA 3M65A 4UV9B 2V7MA 2NP9A 3NBXX 3K3OA 2E9XA 3WAKA 1D1AA 3O4XE 3CQXC 5FXXA 3QK6A 4H9RC 4P0BA 4TV8E 2CM0A 1US7B 3K3QC 3V5UA 4H63H 2CE7A 4YJ3E 3FBZA 3QC9A 3CQGB 1ZV4X 2KZ7B 3FBLA 3ZYLA 4PNIA 3ZEFB 3F31A 4DMWA 2XTLA 3LG7A 4BA9A 4XBFB 3JC6D 3R6NA 1YKEB 1U5PA 4IE4A 3HL6A 4PJLA 3RC3A 2HPJA 4L9IA 4OHFA 4CI3B 5LGNB 4QXHB 1UCUA 3T8OA 2XAQB 2LSYA 1D0ZA 3VHLA 4PAGA 3QUJA 4ZOLE 2GK9A 3SRZA 3UT5E 4CI1B 3JC6C 3SOLA 1HS7A 4IE5A 5LOVE 2H3RA 1HX8A 3PTRB 1D0XA 4I43B 1G8XA 4HTEA 4PK4A 4ERRA 5L2LA 3PDYA 5DJQC 2MOZA 5JH7E 4AKIA 5HYAA 3ONXA 3CX6B 4DBRA 2CWOA 5J2UE 2A2FX 4K0UA 3GA8A 4BAYB 1MIVA 2V7KA 4X20E 3MK7C 2G0UA 3RYCE 3UFEA 2BDEA 5JR9A 3I0QA 1YKHB 2CXDA 2CWYA 2LSIA 2JMHA 3BQLA 5JRCA 2L8KA 3C4WA 3RX6A 3PUQA 1MMDA 3N2OA 5LG4A 4O2BE 1HFAA 4N78D 3RYFE 2LSJA 2EHOA 2LM9A 4QXBB 3F57A 2NW7A 3ZC0A 1BR0A 3I1AA 2XAJB 3P8CD 1SHZC 2MBGA 4UF0B 5H6RB 2NW9A 2X66A 3WI3A 5LBMA 5ADXL 1FMWA 2ZM2A 3N2KE 4WBOA 3ZPOA 5L3BB 3MACA 4UF0A 4CXXA 3DTOA 4M1PA 2L3LA 3EDVA 5JVDE 3ZYKA 3ANWA 4EOZB 2ZLYA 2E9XD 3AA7B 3J7Yq 4PFPA 4EAHA 4DMVA 5IHYA 3B57A 2CA5A 2LOSA 3N9LA 5H6QB 5FXWA 5L3DB 4AI6A 2JRKA 2N9DA 5LHIB 4HEAA 3C4ZA 4UVBB 4O4JE 4H9QC 2UXNB 3LK2B 2BVMA 4TV9E 4X1YE 3ZJ2A 3N9PA 5JDLA 2ODVA 3NZQA 4CXYA 1YD8G 4L0RA 3LJCA 1IAPA 4C90A 2P9BA 4ZHQE 2NWBA 3O1IA 3N9QA 4HFVA 1OXZA 1FMVA 3EVYA 4TZ4C 2D0TA 2NOXA 3KBUA 4DVDA 2MTQA 2NW8A 4O4HE 2X9XA 4WBNE 4ILUA 1WR6A 3AVSA 3GWHA 5EK4A 1WRDA 3FB2A 1MMNA 1HCIA 2W62A 1MNDA 3E0ZA 3KDSE 2LE8A 3O9XA 4G63A 2Q9QC 3N9OA 3KV9A 5FY1A 3L3PA 4ANJA 4HE8A 4P0AA 2WMOA 4QX7B 2V7JA 2A72A 5JDNA 2W00A 2YINA 2KT9A 2DI4A 4IIJE 3HA4A 4GYSA 5GONE 5C8YE 4A56A 3UUNA 2VK9A 3MJXA 3NZPA 4CQIA 5FY7A 4OYJA 1O3XA 5KDMC 5LNKA 2EHOD 2LSKA 3N9MA 3LBXB 1QUUA 3BQIA 3AAAB 4YHJA 5DABA 2X9YA 1S35A 3OYXA 4JUYA 4AQGA 3H3AA 2PG8A 3KV4A 3UUXB 5AFUL 3KINB 3LBXA 2Y48B 4B6XA 2VL8A 4E7SA 2CXLA 4PK5A 4H9OC 2LHRA 3KVBA 4XZCA 4QKNA 3ZMVB 2WM9A 2BZBA 2ZM0A 1WLXA 2DWGA 2IAKA 2M67A 4HGAA 5FXVA 3BQKA 1CUNA 1H7CA 4BJNA 2IC9A 5BMVE 3IHRA 2I59A 1BR4A 5HXCA 4BJMA 2JPFA 3F2EA 2JMKA 3AA1B 4PK6A 5F3JA 5J2TE 2K48A 1ZEEA 5HAXA 2NTXA 2X0LB 4YJ2E 2Q9QB 4IE0A 5CA1E 3HKBE 3LK42 2ZM8A 2WMNA 3OJAA 5FXZA 3ETVA 5CB4E 2KNDA 3ZJ1A 4AKLA 3CX8B 3SS1A 2LEHA 2V26A 1VRBA 3O1JA 2Q9QA 4O2AE 3ZCJA 4YLHA 5IYZE 5JDMA 1FIOA 1BR1A 4HKAA 4UIGA 2B1EA 2C0SA 4MBQA 4J2CA 3Q2MA 4E7ZA 1D0YA 3KVAA 1HG2A 2X67A 4C91A 3CVRA 1IJ5A 2LT3A 2VASA 3HKDE 4G2AA 4EB6E 3VKGA 2VWAA 4TUYE 4ZI2D 4V1Av 2A3DA 1NWMX 5L3GB 2IW5B 5JREA 4H63V 1MMAA 4AQFC 1IJ6A 2V7IA 2VB6A 4O4LE 3AAIA 3MA9A 3NRXA 3OBVE 4EYUA 3N9NA 2DWKA 4NUUA 2KMFA 2RP4A 2WBLA 2LOPA 3GN5B 3Q9DA 4FI5A 1OWAA 2CEAA 4ZI3D 1LVFA 4ZS2A 5KMGP 5LXTE 3AVRA 3FXEB 4DBQA 5KX5E 3KV6A 1LKXA 1BR2A 2ZMAA 2DHRA 3AA0B 2QGSA 5A1LA 3UUMA 3C51A 2MYSA 3DP7A 1FEWA 3K3NA 5JDFA 4EZ4A 3PE0A 3ETUA 3PUAA 2DNXA 4WNKA 4PJNA 5LGUB 3VKHA 4OYKA 2IC6A 3IEEA 3HR0A 2E9XC 1D1BA 2XAFB 2KLQA 1Z0PA 4UEMA 3RKOA 3CQCB 4KMCA 3I0OA 5LHGB 5HXHA 4MLKA 4CZZB 3WAJA 3I9YA 3KFWX 2UXXB 5HXEA 3CX7B 2XASB 3PUSA 3C98B 4QXCB 4FJOA 1UX5A 1B7TA 4NUVA 3SWHA 3HKEE 5JDGA 3EDUA 3ESLA 3ZCIA 5EZYE 2XAGB 3UTKA 5CA0E 2K9AA 2WAUA 3U78A 4TX5A 5LP6E 3PUGA 2X51A 1NAFA 2ACXA 4YFSA 3HI2A 4JLEA 3Q5XA 4MHCA 4GK0E 5E0OA 3RH3A 5LGTB 2D5UA 1S94A 3L09A 3ZLIA 1E1HB 2JQQA 4EYYR 4UV8B 4JEUB 4UVAB 3ZMUB 3N2GE 5EK2A 3CWZB 4DNDA 2D0UA 2W63A 1HTJF 4JEHB 4PJJA 4U74A 5JR9C 2NTYA 3FHNA 5JDQA 3D0TA 2OA5A 5L3FB 3DJBA 5M4YA 5L3EB 3LK3B 2Y8DA 2V7LA 4MFRA 2E9XB 4U72A 1MMGA 2EHOC 3GMIA 4AKHA 3CMLA 1MIWA 2CLYC 3MKDA 4CI2B 1LRZA 4DO0A 2C5IT 5HWXA 2WWUA 4PW8A 4OK0A 3C64A 2ODUA 1IZNB 2VKHA 2VKOA 4CXWA 3LFMA 4TN7B 4EIWA 4KP3C 5LJNA 2C5JA 5DQWA 2E8IA 3RC8A 1QSDA 3S4UA 3RRCA 4GYRA 2YU2A 1LVKA 2H7OA 2PFVA 2CXFA 2X9HA 4IE7A 3PURA 4UVCB 4XAXB 4H9PC 1WYCA 4F6RC 5L3CB 3A5XA 3C4XA 3C50A 4O4IE 4HN9A 5TAOA 1EZ3A 5LYJE 1D1CA 2QA7A 4KBMB 3ZC1A 2PBIA 3VU7H 5LHHB 4O8SA 3FXDB 2L9QA 4KUMB 2XUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3D A;  2MTQ A; 
#chains in the Genus database with same CATH topology
 3P7I A;  4OFZ A;  1AJ3 A;  5JR9 B;  1HNZ T;  2LLY A;  3H37 A;  3RYI E;  4QHO A;  1KNR A;  4PJM A;  4I4T E;  4ZI2 C;  2PJQ A;  4DR6 T;  3KBT A;  2HPL A;  4H9N C;  1KK7 A;  3AE3 A;  3NRY A;  4JI5 T;  4JI4 T;  3AE7 A;  5F5W A;  5LCY A;  2IML A;  3ANW B;  4X1I E;  1VOM A;  2JJ9 A;  1GQE A;  3CPZ A;  3B13 A;  2CPT A;  1YW0 A;  2LJL A;  5ETW A;  1SA0 E;  3TKL B;  1MNE A;  2HH7 A;  3AEC A;  3AE9 A;  4AXP A;  3MXZ A;  2D2S A;  5AQN B;  3PU3 A;  2Q9Q D;  2WDR A;  5HWY A;  5LBQ B;  3CIR A;  5FMN A;  2K24 A;  4DV0 T;  5JDH A;  4EZH A;  4GOU A;  2H89 A;  2V6Y B;  2LSG A;  2QRX A;  4UXN B;  3EAM A;  5EK3 A;  4AKR B;  3PJA A;  4ADZ A;  3AE4 A;  2BS4 A;  2V7M A;  4B3S T;  1D1A A;  4HFE A;  3UQ7 A;  4H63 H;  2NR4 A;  3FBL A;  3LG7 A;  3JC6 D;  4F8H A;  4IT4 A;  1OED C;  3R6N A;  1YKE B;  1N32 T;  1U5P A;  2HPJ A;  4OHF A;  4CI3 B;  2WDV A;  3T1H T;  2V8S V;  2XJ7 A;  2LSY A;  4ZZB A;  3EAB A;  3VHL A;  5IWA T;  3QUJ A;  4COF A;  3TLW A;  2XQ9 A;  3SOL A;  4IE5 A;  1HX8 A;  1G8X A;  2E5L T;  3ONX A;  4B3M T;  2CWO A;  2V7K A;  4X20 E;  3RYC E;  2G0U A;  3UFE A;  2KSR A;  5AQV B;  3I0Q A;  3RF1 A;  2BBJ A;  2JMH A;  3BQL A;  5JRC A;  3C4W A;  4ILB A;  2CBI A;  3RX6 A;  4O2B E;  4N78 D;  2W4X A;  1BR0 A;  3ZC0 A;  1L0V A;  3I1A A;  2XAJ B;  3QB5 A;  3H3M A;  4HFC A;  2NW9 A;  2FJD A;  2VQE T;  2VVS A;  3FZF B;  4Z90 A;  4PFP A;  4DMV A;  3B57 A;  2CA5 A;  5LHI B;  4HEA A;  4O4J E;  5AQF B;  3G06 A;  3FZH B;  5AQO B;  3UQ4 A;  4L0R A;  3LJC A;  1IAP A;  4C90 A;  2P9B A;  2ZM6 T;  2NWB A;  3O1I A;  3N9Q A;  4HFV A;  1OXZ A;  4QH5 A;  1W0A A;  5LB7 B;  2IUB A;  2W67 A;  1WR6 A;  3FB2 A;  3KDS E;  3E0Z A;  4IDQ A;  3M3Z B;  3L3P A;  5JDN A;  4LF4 T;  2YIN A;  4U7I A;  5GON E;  3RLF F;  1I6Z A;  2VK9 A;  3NZP A;  4DR3 T;  3BQI A;  4YHJ A;  5DAB A;  1S35 A;  2WB5 A;  1KF6 A;  5AFU L;  3LBX A;  4HWH A;  3P4W A;  3P4R A;  2WM9 A;  1WLX A;  2WWV A;  2IAK A;  4KHP T;  4BJN A;  4Q25 A;  5BMV E;  2I59 A;  1BR4 A;  4BJM A;  2JMK A;  3AA1 B;  5J2T E;  4DV2 T;  3ONL C;  5HAX A;  4AKL A;  2V26 A;  2HHH T;  2Q9Q A;  4YLH A;  4YXD A;  5AQQ B;  4J2C A;  4C91 A;  3P4P A;  1IJ5 A;  4G2A A;  2UXC T;  4TUY E;  4ZI2 D;  5CJ5 A;  2M6I A;  2V7I A;  2VB6 A;  3N9N A;  2DWK A;  2WBL A;  2QVA A;  1OED B;  1VCT A;  4DBQ A;  2ZMA A;  2QGS A;  3L39 A;  5JDF A;  2XAF B;  1YXR A;  4UEM A;  3CQC B;  4KMC A;  2BKO A;  4U2Z A;  2UXX B;  3TLV A;  4QXC B;  1UX5 A;  3SWH A;  1N36 T;  1NEK A;  3UU8 A;  2K9A A;  2WAU A;  4DV3 T;  2UUC T;  4TX5 A;  5ABE A;  5LP6 E;  2WZH A;  3PUG A;  4YFS A;  1Z8U A;  3Q5X A;  2WCA A;  4MHC A;  4GK0 E;  5E0O A;  3ZT7 A;  5LGT B;  1S94 A;  1E1H B;  3CWZ B;  4ZZC A;  4U74 A;  5JR9 C;  2FUP A;  2OA5 A;  5L3F B;  2XQ6 A;  4HWI B;  3GMI A;  1OED E;  3CML A;  1LRZ A;  3A7M A;  3B5M A;  2WWU A;  4PW8 A;  4OK0 A;  5DQW A;  3RC8 A;  3RRC A;  4LFB T;  4TNW A;  2F4V T;  4IE7 A;  3PUR A;  2BKP A;  2BKN A;  5L3C B;  3C4X A;  2QYW A;  3EI0 A;  4TNV A;  3K1S A;  4JV5 T;  5C2T A;  3FXD B;  1E2A A;  2LHN A;  2WU2 A;  3R84 B;  4IST A;  2E2A A;  1N33 T;  5JRC B;  3J9X 1;  2J1D G;  2ES0 A;  4WW0 A;  3AA6 B;  4IE6 A;  2CMR A;  4HFI A;  4IGU A;  3RQW A;  2DCF A;  2XQ4 A;  2X68 A;  5LJM A;  5HXS A;  4ZS3 A;  5ABG A;  3UUL A;  3RPU A;  5FNV E;  4QX8 B;  4X62 T;  4DMW A;  3EUH A;  4GK5 E;  4ZI7 E;  4ASK A;  3RRW A;  3ZKR A;  3PJA J;  2YOE A;  1UX4 A;  1T8B A;  2N1G A;  2BVL A;  3E22 E;  5LG3 A;  4HWD A;  2W0G A;  3ZN1 B;  2XQY A;  4X1K E;  5L47 A;  1HG5 A;  3AE5 A;  2BG9 A;  1XZY A;  2DLR A;  4AQF A;  1UUS A;  3KV5 A;  1IBK T;  2YU1 A;  2XQ5 A;  2Z6E A;  2KXP B;  3UFG A;  3OKQ A;  2X9W A;  2CBJ A;  2XAH B;  2XY8 B;  1G73 A;  3VR9 A;  2HN1 A;  3M65 A;  4UV9 B;  3K3O A;  2E9X A;  2JQH A;  3CQX C;  4TV8 E;  1US7 B;  3K3Q C;  4YSX A;  3CQG B;  2WY2 A;  3ZYL A;  4EV6 A;  4BA9 A;  3TLU A;  1JNZ A;  1R8I A;  3RC3 A;  5LGN B;  2UXB T;  4CI1 B;  2WDQ A;  5LOV E;  2R6G F;  3RIU C;  2M6B A;  5AQM B;  4JI6 T;  1KNP A;  5JH7 E;  2BBH A;  4X66 T;  1MIV A;  3MK7 C;  1UK5 A;  2BDE A;  1YKH B;  2CXD A;  2LSI A;  4JI2 T;  3N2O A;  2VUR A;  3RYF E;  1ZOY A;  2LSJ A;  2EHO A;  4QXB B;  3F57 A;  2NW7 A;  3RHW A;  3ZT5 A;  2XM1 A;  1SHZ C;  2MBG A;  4IDN A;  5H6R B;  5LMU T;  2X66 A;  3WI3 A;  3RQU A;  4WBO A;  3MAC A;  4UF0 A;  4CXX A;  2OLT A;  2UUA T;  2IDO B;  2JRK A;  3C4Z A;  4H9Q C;  3LK2 B;  4X1Y E;  3ZJ2 A;  3NZQ A;  1YD8 G;  3IA3 A;  1FMV A;  3AEF A;  2UU9 T;  4TZ4 C;  2D0T A;  2NOX A;  3AE1 A;  2NW8 A;  4WBN E;  3GWH A;  1WRD A;  4LF5 T;  4GKK T;  4G63 A;  3N9O A;  4ANJ A;  4HE8 A;  4QX7 B;  2A72 A;  3OTO T;  4LMK A;  2KT9 A;  1SE7 A;  4A56 A;  5LNK A;  2LSK A;  5AQJ B;  4JUY A;  1XDP A;  2PG8 A;  2Y48 B;  4P1N A;  2CXL A;  4H9O C;  1JNR A;  3ZMV B;  2ZM0 A;  4HGA A;  3IHR A;  1FJG T;  2W2U A;  2D9D A;  2JPF A;  5F3J A;  3PUX F;  4IE0 A;  3LK4 2;  3OJA A;  3QB5 K;  4ILC A;  5FXZ A;  3ETV A;  5CB4 E;  3ZJ1 A;  3CX8 B;  1VRB A;  5JDM A;  1FIO A;  1YQ3 A;  1NEN A;  4UIG A;  3Q2M A;  1XWM A;  4YSZ A;  2XSB A;  2XZE A;  2X67 A;  4EB6 E;  2A3D A;  3UUB A;  4LFC T;  4X5T A;  2IW5 B;  3FZL B;  2H88 A;  3OBV E;  4EYU A;  2KMF A;  2YDR A;  2CEA A;  4ZS2 A;  2RPA A;  3AVR A;  1BR2 A;  2DHR A;  3AA0 B;  5A1L A;  2CHN A;  2XPK A;  4EZ4 A;  3ETU A;  5LGU B;  3VKH A;  2IC6 A;  3IEE A;  5ABH A;  1D1B A;  1UGO A;  2WS3 A;  4KHZ F;  2FJA A;  4MLK A;  4CZZ B;  2JIW A;  3I9Y A;  3KFW X;  2XAS B;  2WP9 A;  4FJO A;  1B7T A;  3OVU A;  4DR2 T;  3EDU A;  3ESL A;  5J0Z A;  3U78 A;  2X51 A;  5FVK A;  2ACX A;  3HI2 A;  4IL4 A;  3L09 A;  2UXD T;  2JQQ A;  4UVA B;  3ZMU B;  3N2G E;  3RGL A;  4DND A;  2D0U A;  2W63 A;  1HTJ F;  3D0T A;  3DJB A;  5L3E B;  3LK3 B;  2V7L A;  4DID B;  2E9X B;  5HCM A;  3MKD A;  2C5I T;  5HWX A;  3NVO A;  2CRB A;  1QSD A;  1LVK A;  2H7O A;  2VL0 A;  4H9P C;  1WYC A;  4UR9 A;  2W66 A;  4YSY A;  1EZ3 A;  5LYJ E;  4QH1 A;  1D1C A;  4KBM B;  3ZC1 A;  3UU6 A;  5JDG A;  4KUM B;  3AEG A;  3U3I A;  4Z8X A;  4AIS A;  5IUX A;  1U4Q A;  2LKG A;  3RIA A;  3Q5W A;  2CCQ A;  2K5B B;  4H9S E;  2EHO B;  2W61 A;  2MAW A;  2CLY B;  3L8R A;  3ZMZ B;  2X0H A;  5JQG E;  3RYH E;  2IIU A;  3IF8 B;  4HFD A;  2SPC A;  4ZI3 C;  4EXT A;  1ZKE A;  4TWD A;  2FBW A;  3JAE A;  5FP3 A;  5JTG A;  2YK0 A;  5FYM A;  2V1D B;  2H7V C;  3ZMS B;  2Y6X A;  4A98 A;  3BK9 A;  1ZP0 A;  4YY3 T;  4IHJ E;  1HR0 T;  3CKD A;  4X64 T;  1KNZ A;  3V5S A;  3OYZ A;  4YTM A;  5F8P A;  1V9D A;  3AE6 A;  3AB3 B;  2KWH A;  1WYB A;  2VKD A;  5LA6 E;  3W15 B;  5AQP B;  1T98 A;  5HCJ A;  1Y64 B;  3O1H A;  1ZHC A;  4DR1 T;  1XMO T;  5HXR A;  2YEV C;  2E5V A;  2V6Y A;  1E7P A;  4JI3 T;  3E08 A;  3IBP A;  3T1Y T;  2NP9 A;  3ZST A;  5FXX A;  3AEA A;  3QK6 A;  4H9R C;  4P0B A;  2CM0 A;  4JI7 T;  2CE7 A;  3QC9 A;  1ZV4 X;  2KZ7 B;  3ZEF B;  4IE4 A;  3HL6 A;  4PJL A;  3UU3 A;  2UUB T;  1UCU A;  3T8O A;  2V6X A;  4PAG A;  4ZOL E;  2GK9 A;  3UT5 E;  3JC6 C;  1HS7 A;  3PTR B;  4I43 B;  1D0X A;  4HTE A;  4ERR A;  3PUW F;  5DJQ C;  4AKI A;  5HEG A;  4DR4 T;  2A2F X;  4BAY B;  2WZI A;  2J4G A;  1W9R A;  2L8K A;  4NPP A;  3PUQ A;  5LG4 A;  4I0U A;  2A9U A;  3ZT6 A;  2I0M A;  1J5E T;  4ZXL A;  2ZM2 A;  3ZPO A;  3AED A;  2YDQ A;  3DTO A;  4M1P A;  2L3L A;  3EDV A;  5JVD E;  4EOZ B;  3AA7 B;  3LSV A;  3J7Y q;  4EAH A;  5IHY A;  5C3J A;  3N9L A;  2LOS A;  4IDP A;  5H6Q B;  5FXW A;  2V5D A;  1YQ4 A;  3AE2 A;  3N9P A;  2J47 A;  4LFA T;  4U3C A;  5AQR B;  4DUY T;  3JCF A;  4DV1 T;  3KBU A;  4O4H E;  4EEB A;  2X9X A;  3AVS A;  5EK4 A;  1MMN A;  1MND A;  1HNX T;  5AQI B;  2V7J A;  2MPK A;  3AEB A;  2WQY A;  2DI4 A;  4IIJ E;  3HA4 A;  4GYS A;  4LF8 T;  5C8Y E;  5KDM C;  1O3X A;  3LBX B;  1QUU A;  3AAA B;  3UU5 A;  2X9Y A;  5LMN T;  3UUX B;  3KIN B;  4KX6 A;  1T7S A;  2LHR A;  1QLB A;  2PTF A;  4QKN A;  2BZB A;  2BS2 A;  2M67 A;  1N34 T;  1H7C A;  2IC9 A;  5HXC A;  3F2E A;  4PK6 A;  2X0L B;  1T72 A;  2Q9Q B;  4HFH A;  4NIQ A;  2ZM8 A;  2WMN A;  2KND A;  4YTN A;  3SS1 A;  3O1J A;  4O2A E;  4HKA A;  2B1E A;  3QOF A;  5HEO A;  4E7Z A;  1HG2 A;  2LT3 A;  2VAS A;  3HKD E;  2VWA A;  2BG9 C;  2OV9 A;  5JRE A;  4AQF C;  3RIF A;  1IJ6 A;  4ILA A;  4O4L E;  2B76 A;  3AAI A;  3MA9 A;  4QH4 A;  4JI1 T;  2RP4 A;  3PUZ F;  4TWF A;  4ZI3 D;  4DR7 T;  3OPC A;  4Z91 A;  3FXE B;  5KX5 E;  3KV6 A;  1LKX A;  4CN4 A;  5AQL B;  3UUM A;  2MYS A;  3RI5 A;  1OED A;  3K3N A;  3PE0 A;  4WNK A;  4PJN A;  4DUZ T;  2E9X C;  3I0O A;  5HXH A;  4HWC A;  3P50 A;  5HXE A;  4U7Y A;  5ABF A;  2X0Y A;  3C98 B;  4NUV A;  4HFB A;  3ZCI A;  3UTK A;  4LML A;  5CA0 E;  2AXD S;  4B3R T;  4EED A;  4JLE A;  2D5U A;  3ZLI A;  4UV8 B;  4PJJ A;  3FHN A;  2FJB A;  5M4Y A;  3A8Y C;  4K0K T;  4U72 A;  2EHO C;  4DV4 T;  4AKH A;  3AE8 A;  1MIW A;  2CLY C;  1X9B A;  4U31 A;  4DO0 A;  2K3W A;  2JQ9 A;  3NWI A;  3C64 A;  2ODU A;  4CXW A;  3LFM A;  5AQH B;  4EIW A;  2E8I A;  5FVL A;  3JAD A;  1WFD A;  2X9H A;  2HN2 A;  4TWH A;  4LF7 T;  4F6R C;  3A5X A;  4O4I E;  2CHO A;  1CHU A;  2QA7 A;  4WYV A;  2PBI A;  2L9Q A;  1W09 A;  3HKC E;  3N5L A;  2XHE B;  5FKY A;  4PFO A;  4GIW A;  4KI0 F;  3ZMT B;  5AQT B;  1HF8 A;  3AAE B;  4I55 E;  3ZN0 B;  3Q5D A;  4ZEY A;  3GN5 A;  2WSS V;  4MAL A;  4P09 A;  4ISS A;  4L5G A;  4DV6 T;  1MIY A;  4QWN B;  5BR8 T;  5FY0 A;  2KIN B;  3MZK B;  1I94 T;  4JYA T;  3ZYM A;  3K8P C;  2RA1 A;  5J1G A;  4IDZ A;  4UEL A;  3P4S A;  3I9W A;  2N2N A;  5AQG B;  4DR5 T;  1WCR A;  1X79 A;  4AKG A;  4JBW F;  5DQV A;  4IDO A;  2BG9 B;  4I50 E;  2VKJ A;  3CK6 A;  3VRA A;  4LF6 T;  2ACZ A;  3PUY F;  1XMQ T;  1VCS A;  4IL9 A;  3PU8 A;  3SFD A;  3JAF A;  4JI8 T;  2KWI B;  2C5K T;  3NBX X;  3WAK A;  3O4X E;  2LKH A;  3AXJ A;  4DV7 T;  3V5U A;  5HEH A;  1HX1 B;  3FBZ A;  3FZM B;  4YJ3 E;  3X1D A;  4PNI A;  3F31 A;  2XTL A;  4XBF B;  2J62 A;  4LF9 T;  1SUM B;  2AE9 A;  4L9I A;  2XQA A;  4QXH B;  1UUR A;  3VR8 A;  2XAQ B;  2YN6 A;  1D0Z A;  3SRZ A;  1XNQ T;  2H3R A;  2BG9 E;  4PK4 A;  3PUV F;  1J1J A;  4OX9 T;  5L2L A;  3PDY A;  2MOZ A;  5HYA A;  4DV5 T;  3CX6 B;  4DBR A;  2VVN A;  5J2U E;  4K0U A;  3GA8 A;  5JR9 A;  2CWY A;  1MMD A;  4WZX A;  1HFA A;  2LM9 A;  3NKZ A;  3P8C D;  3VRB A;  4UF0 B;  5LBM A;  2LM2 A;  5ADX L;  1FMW A;  3N2K E;  2XQ7 A;  5L3B B;  4LMJ A;  1IBM T;  3ZYK A;  3ANW A;  2ZLY A;  2E9X D;  3QNU A;  1IBL T;  4AIU A;  3TLS A;  5L3D B;  4AI6 A;  5AQK B;  2N9D A;  4UVB B;  2UXN B;  2BVM A;  4TV9 E;  5JDL A;  2ODV A;  4CXY A;  4U33 A;  5ABF B;  4ZHQ E;  5FL0 A;  3EVY A;  2YDS A;  4DVD A;  4CN1 A;  2MTQ A;  3UU4 A;  4ILU A;  1HCI A;  2W62 A;  3TLT A;  5L4E A;  3O9X A;  2LE8 A;  2Q9Q C;  3KV9 A;  5FY1 A;  3AEE A;  5CFB A;  4P0A A;  2WMO A;  2IHR 1;  2W00 A;  1KFY A;  3SFE A;  1Y01 A;  4X65 T;  2XSA A;  3UUN A;  3MJX A;  4CQI A;  5FY7 A;  4OYJ A;  2EHO D;  3N9M A;  4GKJ T;  3OYX A;  4AQY T;  4AQG A;  3H3A A;  3KV4 A;  1J5W A;  1XNR T;  4B6X A;  1M62 A;  2VL8 A;  4E7S A;  4PK5 A;  3KVB A;  4YT0 A;  1KEY A;  4XZC A;  4EGW A;  2DWG A;  2BS3 A;  5FXV A;  3BQK A;  1CUN A;  4CN6 A;  2K48 A;  1ZEE A;  2XQ8 A;  2NTX A;  4YJ2 E;  5CA1 E;  3HKB E;  4A5X A;  5KXJ A;  2LEH A;  4JI0 T;  3ZCJ A;  2XM2 A;  5IYZ E;  1WR0 A;  4IRE A;  1BR1 A;  3RKG A;  2C0S A;  4MBQ A;  1HNW T;  1D0Y A;  4B3T T;  2DL1 A;  3KVA A;  3CVR A;  3VKG A;  1M7K A;  4V1A v;  1NWM X;  5L3G B;  4H63 V;  1MMA A;  5FL1 A;  4NXM T;  5L4H A;  3ONJ A;  4YHH T;  3NRX A;  4NUU A;  3GN5 B;  2LOP A;  3PV0 F;  3Q9D A;  4FI5 A;  2WU5 A;  1OWA A;  1LVF A;  5HEJ A;  5KMG P;  5LXT E;  2I6H A;  4NXN T;  3C51 A;  3DP7 A;  1FEW A;  2FJE A;  3PUA A;  2DNX A;  3EHZ A;  4OYK A;  3HR0 A;  2YKS A;  2KLQ A;  1Z0P A;  1W0B A;  3LDQ B;  3RKO A;  1XDO A;  5LHG B;  3WAJ A;  3RIU A;  3CX7 B;  3PUS A;  3HKE E;  2V5C A;  5EZY E;  4HWF A;  2XAG B;  1NAF A;  5HEU A;  3RH3 A;  5AQU B;  4EYY R;  4JEU B;  5EK2 A;  2LRL A;  4JEH B;  2NTY A;  5JDQ A;  5CGM A;  4A97 A;  3FZK B;  2Y8D A;  4MFR A;  1MMG A;  4YTP A;  3AXJ B;  3Q5E A;  4CI2 B;  2VQF T;  1IZN B;  2VKH A;  2VKO A;  4TN7 B;  4KP3 C;  5LJN A;  2C5J A;  3S4U A;  1DU2 A;  2XQ3 A;  4GYR A;  2YU2 A;  2PFV A;  3P4Q A;  2CXF A;  3ZSS A;  4UVC B;  2LRK A;  4XAX B;  4U2Y A;  3C50 A;  4HN9 A;  5TAO A;  2JQK A;  3VU7 H;  3ABV A;  5LHH B;  4O8S A;  5AQS B;  2XUE A; 
#chains in the Genus database with same CATH homology
 3P7I A;  4OFZ A;  3U3I A;  1AJ3 A;  5JR9 B;  2LHN A;  3HKC E;  3N5L A;  4IST A;  3R84 B;  5JRC B;  4Z8X A;  2XHE B;  3J9X 1;  2J1D G;  1U4Q A;  2ES0 A;  3H37 A;  4GIW A;  4PFO A;  3ZMT B;  4WW0 A;  3AA6 B;  4IE6 A;  2CMR A;  1HF8 A;  3AAE B;  4I55 E;  3RYI E;  3Q5W A;  4QHO A;  2CCQ A;  2K5B B;  4H9S E;  4IGU A;  4PJM A;  2EHO B;  3ZN0 B;  2W61 A;  4I4T E;  2DCF A;  4ZI2 C;  2PJQ A;  2X68 A;  5LJM A;  3GN5 A;  2CLY B;  3KBT A;  2HPL A;  4H9N C;  3ZMZ B;  5HXS A;  4ZS3 A;  1KK7 A;  2WSS V;  3NRY A;  4MAL A;  4P09 A;  3UUL A;  3RPU A;  4ISS A;  5JQG E;  4L5G A;  3RYH E;  3IF8 B;  1MIY A;  4QWN B;  5FNV E;  5FY0 A;  5LCY A;  4QX8 B;  2KIN B;  3MZK B;  3ANW B;  2SPC A;  4ZI3 C;  3ZYM A;  3EUH A;  3K8P C;  2RA1 A;  4X1I E;  5J1G A;  4GK5 E;  4IDZ A;  4UEL A;  4EXT A;  4ZI7 E;  1VOM A;  2JJ9 A;  4ASK A;  1ZKE A;  3RRW A;  3CPZ A;  3I9W A;  3B13 A;  1UX4 A;  1YW0 A;  2LJL A;  5ETW A;  2N2N A;  1SA0 E;  2N1G A;  5FP3 A;  3TKL B;  2BVL A;  1X79 A;  3E22 E;  2YK0 A;  4AKG A;  5FYM A;  2V1D B;  1MNE A;  2HH7 A;  2H7V C;  4AXP A;  3ZMS B;  3MXZ A;  2Y6X A;  2D2S A;  3BK9 A;  5DQV A;  2W0G A;  2Q9Q D;  3PU3 A;  2VKJ A;  4I50 E;  4IHJ E;  5HWY A;  3ZN1 B;  3CKD A;  5LBQ B;  2XQY A;  1KNZ A;  3V5S A;  4X1K E;  3OYZ A;  1HG5 A;  5F8P A;  2DLR A;  1V9D A;  5FMN A;  2K24 A;  3AB3 B;  4AQF A;  5JDH A;  4EZH A;  2KWH A;  4GOU A;  1WYB A;  3KV5 A;  2VKD A;  2YU1 A;  5LA6 E;  3W15 B;  2Z6E A;  1T98 A;  2LSG A;  2KXP B;  1Y64 B;  3O1H A;  4UXN B;  1ZHC A;  3PU8 A;  3OKQ A;  5EK3 A;  2X9W A;  5HXR A;  2YEV C;  2XAH B;  4AKR B;  1G73 A;  2KWI B;  3E08 A;  4ADZ A;  2C5K T;  3IBP A;  3M65 A;  4UV9 B;  2V7M A;  2NP9 A;  3NBX X;  3K3O A;  2E9X A;  3WAK A;  1D1A A;  3O4X E;  3CQX C;  5FXX A;  3QK6 A;  4H9R C;  4P0B A;  4TV8 E;  2CM0 A;  1US7 B;  3K3Q C;  3V5U A;  4H63 H;  2CE7 A;  4YJ3 E;  3FBZ A;  3QC9 A;  3CQG B;  1ZV4 X;  2KZ7 B;  3FBL A;  3ZYL A;  4PNI A;  3ZEF B;  3F31 A;  4DMW A;  2XTL A;  3LG7 A;  4BA9 A;  4XBF B;  3JC6 D;  3R6N A;  1YKE B;  1U5P A;  4IE4 A;  3HL6 A;  4PJL A;  3RC3 A;  2HPJ A;  4L9I A;  4OHF A;  4CI3 B;  5LGN B;  4QXH B;  1UCU A;  3T8O A;  2XAQ B;  2LSY A;  1D0Z A;  3VHL A;  4PAG A;  3QUJ A;  4ZOL E;  2GK9 A;  3SRZ A;  3UT5 E;  4CI1 B;  3JC6 C;  3SOL A;  1HS7 A;  4IE5 A;  5LOV E;  2H3R A;  1HX8 A;  3PTR B;  1D0X A;  4I43 B;  1G8X A;  4HTE A;  4PK4 A;  4ERR A;  5L2L A;  3PDY A;  5DJQ C;  2MOZ A;  5JH7 E;  4AKI A;  5HYA A;  3ONX A;  3CX6 B;  4DBR A;  2CWO A;  5J2U E;  2A2F X;  4K0U A;  3GA8 A;  4BAY B;  1MIV A;  2V7K A;  4X20 E;  3MK7 C;  2G0U A;  3RYC E;  3UFE A;  2BDE A;  5JR9 A;  3I0Q A;  1YKH B;  2CXD A;  2CWY A;  2LSI A;  2JMH A;  3BQL A;  5JRC A;  2L8K A;  3C4W A;  3RX6 A;  3PUQ A;  1MMD A;  3N2O A;  5LG4 A;  4O2B E;  1HFA A;  4N78 D;  3RYF E;  2LSJ A;  2EHO A;  2LM9 A;  4QXB B;  3F57 A;  2NW7 A;  3ZC0 A;  1BR0 A;  3I1A A;  2XAJ B;  3P8C D;  1SHZ C;  2MBG A;  4UF0 B;  5H6R B;  2NW9 A;  2X66 A;  3WI3 A;  5LBM A;  5ADX L;  1FMW A;  2ZM2 A;  3N2K E;  4WBO A;  3ZPO A;  5L3B B;  3MAC A;  4UF0 A;  4CXX A;  3DTO A;  4M1P A;  2L3L A;  3EDV A;  5JVD E;  3ZYK A;  3ANW A;  4EOZ B;  2ZLY A;  2E9X D;  3AA7 B;  3J7Y q;  4PFP A;  4EAH A;  4DMV A;  5IHY A;  3B57 A;  2CA5 A;  2LOS A;  3N9L A;  5H6Q B;  5FXW A;  5L3D B;  4AI6 A;  2JRK A;  2N9D A;  5LHI B;  4HEA A;  3C4Z A;  4UVB B;  4O4J E;  4H9Q C;  2UXN B;  3LK2 B;  2BVM A;  4TV9 E;  4X1Y E;  3ZJ2 A;  3N9P A;  5JDL A;  2ODV A;  3NZQ A;  4CXY A;  1YD8 G;  4L0R A;  3LJC A;  1IAP A;  4C90 A;  2P9B A;  4ZHQ E;  2NWB A;  3O1I A;  3N9Q A;  4HFV A;  1OXZ A;  1FMV A;  3EVY A;  4TZ4 C;  2D0T A;  2NOX A;  3KBU A;  4DVD A;  2MTQ A;  2NW8 A;  4O4H E;  2X9X A;  4WBN E;  4ILU A;  1WR6 A;  3AVS A;  3GWH A;  5EK4 A;  1WRD A;  3FB2 A;  1MMN A;  1HCI A;  2W62 A;  1MND A;  3E0Z A;  3KDS E;  2LE8 A;  3O9X A;  4G63 A;  2Q9Q C;  3N9O A;  3KV9 A;  5FY1 A;  3L3P A;  4ANJ A;  4HE8 A;  4P0A A;  2WMO A;  4QX7 B;  2V7J A;  2A72 A;  5JDN A;  2W00 A;  2YIN A;  2KT9 A;  2DI4 A;  4IIJ E;  3HA4 A;  4GYS A;  5GON E;  5C8Y E;  4A56 A;  3UUN A;  2VK9 A;  3MJX A;  3NZP A;  4CQI A;  5FY7 A;  4OYJ A;  1O3X A;  5KDM C;  5LNK A;  2EHO D;  2LSK A;  3N9M A;  3LBX B;  1QUU A;  3BQI A;  3AAA B;  4YHJ A;  5DAB A;  2X9Y A;  1S35 A;  3OYX A;  4JUY A;  4AQG A;  3H3A A;  2PG8 A;  3KV4 A;  3UUX B;  5AFU L;  3KIN B;  3LBX A;  2Y48 B;  4B6X A;  2VL8 A;  4E7S A;  2CXL A;  4PK5 A;  4H9O C;  2LHR A;  3KVB A;  4XZC A;  4QKN A;  3ZMV B;  2WM9 A;  2BZB A;  2ZM0 A;  1WLX A;  2DWG A;  2IAK A;  2M67 A;  4HGA A;  5FXV A;  3BQK A;  1CUN A;  1H7C A;  4BJN A;  2IC9 A;  5BMV E;  3IHR A;  2I59 A;  1BR4 A;  5HXC A;  4BJM A;  2JPF A;  3F2E A;  2JMK A;  3AA1 B;  4PK6 A;  5F3J A;  5J2T E;  2K48 A;  1ZEE A;  5HAX A;  2NTX A;  2X0L B;  4YJ2 E;  2Q9Q B;  4IE0 A;  5CA1 E;  3HKB E;  3LK4 2;  2ZM8 A;  2WMN A;  3OJA A;  5FXZ A;  3ETV A;  5CB4 E;  2KND A;  3ZJ1 A;  4AKL A;  3CX8 B;  3SS1 A;  2LEH A;  2V26 A;  1VRB A;  3O1J A;  2Q9Q A;  4O2A E;  3ZCJ A;  4YLH A;  5IYZ E;  5JDM A;  1FIO A;  1BR1 A;  4HKA A;  4UIG A;  2B1E A;  2C0S A;  4MBQ A;  4J2C A;  3Q2M A;  4E7Z A;  1D0Y A;  3KVA A;  1HG2 A;  2X67 A;  4C91 A;  3CVR A;  1IJ5 A;  2LT3 A;  2VAS A;  3HKD E;  4G2A A;  4EB6 E;  3VKG A;  2VWA A;  4TUY E;  4ZI2 D;  4V1A v;  2A3D A;  1NWM X;  5L3G B;  2IW5 B;  5JRE A;  4H63 V;  1MMA A;  4AQF C;  1IJ6 A;  2V7I A;  2VB6 A;  4O4L E;  3AAI A;  3MA9 A;  3NRX A;  3OBV E;  4EYU A;  3N9N A;  2DWK A;  4NUU A;  2KMF A;  2RP4 A;  2WBL A;  2LOP A;  3GN5 B;  3Q9D A;  4FI5 A;  1OWA A;  2CEA A;  4ZI3 D;  1LVF A;  4ZS2 A;  5KMG P;  5LXT E;  3AVR A;  3FXE B;  4DBQ A;  5KX5 E;  3KV6 A;  1LKX A;  1BR2 A;  2ZMA A;  2DHR A;  3AA0 B;  2QGS A;  5A1L A;  3UUM A;  3C51 A;  2MYS A;  3DP7 A;  1FEW A;  3K3N A;  5JDF A;  4EZ4 A;  3PE0 A;  3ETU A;  3PUA A;  2DNX A;  4WNK A;  4PJN A;  5LGU B;  3VKH A;  4OYK A;  2IC6 A;  3IEE A;  3HR0 A;  2E9X C;  1D1B A;  2XAF B;  2KLQ A;  1Z0P A;  4UEM A;  3RKO A;  3CQC B;  4KMC A;  3I0O A;  5LHG B;  5HXH A;  4MLK A;  4CZZ B;  3WAJ A;  3I9Y A;  3KFW X;  2UXX B;  5HXE A;  3CX7 B;  2XAS B;  3PUS A;  3C98 B;  4QXC B;  4FJO A;  1UX5 A;  1B7T A;  4NUV A;  3SWH A;  3HKE E;  5JDG A;  3EDU A;  3ESL A;  3ZCI A;  5EZY E;  2XAG B;  3UTK A;  5CA0 E;  2K9A A;  2WAU A;  3U78 A;  4TX5 A;  5LP6 E;  3PUG A;  2X51 A;  1NAF A;  2ACX A;  4YFS A;  3HI2 A;  4JLE A;  3Q5X A;  4MHC A;  4GK0 E;  5E0O A;  3RH3 A;  5LGT B;  2D5U A;  1S94 A;  3L09 A;  3ZLI A;  1E1H B;  2JQQ A;  4EYY R;  4UV8 B;  4JEU B;  4UVA B;  3ZMU B;  3N2G E;  5EK2 A;  3CWZ B;  4DND A;  2D0U A;  2W63 A;  1HTJ F;  4JEH B;  4PJJ A;  4U74 A;  5JR9 C;  2NTY A;  3FHN A;  5JDQ A;  3D0T A;  2OA5 A;  5L3F B;  3DJB A;  5M4Y A;  5L3E B;  3LK3 B;  2Y8D A;  2V7L A;  4MFR A;  2E9X B;  4U72 A;  1MMG A;  2EHO C;  3GMI A;  4AKH A;  3CML A;  1MIW A;  2CLY C;  3MKD A;  4CI2 B;  1LRZ A;  4DO0 A;  2C5I T;  5HWX A;  2WWU A;  4PW8 A;  4OK0 A;  3C64 A;  2ODU A;  1IZN B;  2VKH A;  2VKO A;  4CXW A;  3LFM A;  4TN7 B;  4EIW A;  4KP3 C;  5LJN A;  2C5J A;  5DQW A;  2E8I A;  3RC8 A;  1QSD A;  3S4U A;  3RRC A;  4GYR A;  2YU2 A;  1LVK A;  2H7O A;  2PFV A;  2CXF A;  2X9H A;  4IE7 A;  3PUR A;  4UVC B;  4XAX B;  4H9P C;  1WYC A;  4F6R C;  5L3C B;  3A5X A;  3C4X A;  3C50 A;  4O4I E;  4HN9 A;  5TAO A;  1EZ3 A;  5LYJ E;  1D1C A;  2QA7 A;  4KBM B;  3ZC1 A;  2PBI A;  3VU7 H;  5LHH B;  4O8S A;  3FXD B;  2L9Q A;  4KUM B;  2XUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...