2A3DA

Solution structure of a de novo designed single chain three-helix bundle (a3d)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
MGSWAEFKQRLAAIKTRLQALGGSEAELAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDELQAYRHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Three-helix bundle
molecule keywords PROTEIN (DE NOVO THREE-HELIX BUNDLE)
publication title Solution structure and dynamics of a de novo designed three-helix bundle protein.
pubmed doi rcsb
source organism Synthetic construct
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a3dA00
2MTQA 2A3DA
chains in the Genus database with same CATH superfamily
2WU5A 2YU2A 4YSYA 2CA5A 1MNEA 2E5VA 2YDSA 4EGWA 4UEMA 3AEBA 5JR9A 1VRBA 4AKIA 5CA0E 2V6YB 3CQCB 1XDPA 3ZMVB 5LCYA 3E0ZA 3KV4A 3B13A 3O4XE 1HR0T 4JI3T 5AQGB 2V5DA 2CRBA 4O2BE 2LHNA 5FP3A 1G73A 4G63A 4LF4T 4PAGA 2XZEA 1D0ZA 2WS3A 5IUXA 4XZCA 5JRCB 3Q5DA 3BK9A 1N32T 2JQ9A 5ETWA 2X9WA 1D1AA 3C50A 1YW0A 2EHOC 2V7LA 4AIUA 5L4EA 4OYKA 1W0AA 3FZLB 3DTOA 3X1DA 4Z8XA 4I43B 2BS2A 5HXSA 2KSRA 2V7MA 2QYWA 3ZT7A 1DU2A 4HFIA 2YEVC 4EEDA 3PUQA 2PTFA 3HL6A 1KNZA 3VKHA 3VU7H 4ZHQE 5JH7E 2VQET 5AFUL 4U2ZA 3NZQA 4NXMT 3N9NA 2X0HA 1D1CA 2GK9A 2KLQA 3ZC1A 2X67A 1WR6A 5BMVE 3IHRA 3RYHE 4DR2T 5IYZE 1UGOA 4LFBT 3UU6A 5JVDE 4GK0E 5HEJA 4YHHT 3VR8A 4X20E 3UULA 3I1AA 2FJBA 4N78D 1IBLT 4U3CA 4LF6T 5LGNB 3AE2A 4MFRA 2W66A 4H9SE 4YTNA 5LMNT 4U7YA 4BAYB 2NP9A 4TV9E 2JPFA 2WWVA 4H63V 1LVFA 1I94T 4COFA 3UUXB 4IDOA 4IDPA 2BKPA 4B3TT 1XMQT 3PJAJ 3R6NA 2V7KA 3OTOT 3F2EA 1U5PA 1WR0A 1IAPA 2CXLA 1OEDB 2BS4A 2DNXA 3S4UA 5FY0A 3AEEA 3ZT6A 3UU5A 3P8CD 4X65T 1B7TA 4EEBA 2JRKA 2XQ9A 3AE8A 4ILUA 3EI0A 4DV3T 2LSGA 4B6XA 1S94A 3FXEB 3WAKA 5GONE 5C8YE 1WFDA 5TAOA 2IIUA 1HNXT 4DMVA 2VKJA 2YU1A 4ZZBA 3UU4A 4O8SA 1Y01A 5LMUT 4NUVA 4PNIA 4WNKA 3LK3B 3RF1A 2DI4A 4OHFA 1T8BA 5LJMA 2XAFB 2XQAA 3QOFA 4KP3C 4X1KE 4WW0A 5L3GB 2PBIA 5JR9C 2VL0A 3O1IA 4H9NC 3NZPA 2WZHA 2V26A 1SUMB 4IDZA 2RPAA 3H37A 4PK5A 2K24A 3SWHA 3FZMB 3MJXA 4ZEYA 3FZKB 4YY3T 2D0UA 4DUZT 1IJ6A 4HWCA 2CXDA 2BVLA 3FB2A 4HFEA 3MZKB 3RKOA 4MBQA 5FNVE 1ZP0A 2WU2A 2JJ9A 1T7SA 4AQYT 2LT3A 2LHRA 4L0RA 3EVYA 3KV5A 2H7OA 3I0QA 3N2KE 4DV4T 4YJ3E 2LKHA 4JEHB 2CMRA 3ANWA 2AXDS 2Q9QB 5J2TE 2JIWA 3RGLA 5LG4A 2LJLA 1HX1B 2X0LB 2AE9A 5FKYA 5L3FB 2DL1A 4DBRA 3SFEA 2VK9A 5HXRA 3FBLA 4LF7T 4KUMB 4X5TA 1IBKT 3JADA 2BG9B 5AQRB 4A97A 1HCIA 5FL0A 3ESLA 4DV0T 3K3OA 3D0TA 5JDHA 5E0OA 2HN1A 3DJBA 4HFDA 3ZSSA 2KMFA 5DQVA 4MALA 1J5WA 3ZMUB 5HEOA 3NBXX 2EHOA 5LGUB 2LOSA 4LF9T 4JI1T 2H89A 1AJ3A 4WBOA 3AE4A 3QC9A 5FL1A 3PV0F 5AQUB 3ZYKA 2FJAA 2LRLA 4UR9A 3TKLB 2QA7A 2M6BA 3PUXF 3RRWA 4HWFA 3O1HA 3AEGA 4U2YA 4GIWA 4DR1T 4QKNA 4YFSA 2ODUA 2ODVA 2LSJA 5CA1E 4TWHA 3L09A 4PJNA 3KFWX 5ABFB 2ZM2A 4HWIB 5KDMC 2LLYA 5AQFB 4TNWA 1T72A 1HG2A 2XM2A 3VRBA 4ZI2C 1E1HB 1QLBA 1YXRA 4CXYA 3EAMA 1HS7A 5HCMA 4EOZB 4L5GA 2Y48B 4CQIA 3RLFF 2J4GA 3F31A 3K3QC 3PURA 3O9XA 2L3LA 4EV6A 3GN5A 3Q2MA 2X51A 3UU3A 1JNRA 2WCAA 3I0OA 3OYXA 3ZMTB 1XMOT 5C2TA 2NTXA 2A9UA 1SHZC 4QHOA 3RPUA 1Z8UA 4LF8T 1UK5A 2X9YA 5LHHB 4OK0A 4CXXA 2WDVA 3J7Yq 3LJCA 5L2LA 4ZI7E 3KBUA 3PUZF 3PUYF 4NUUA 2G0UA 5AQSB 4Z91A 3LBXA 2K48A 2W61A 3ZSTA 2B1EA 5HXEA 4AISA 2V5CA 2LSIA 3K3NA 3SOLA 3PDYA 3ZCIA 3B57A 2A3DA 4ILBA 2B76A 2UXBT 1OXZA 1UX5A 3IBPA 4DV7T 5LA6E 4ZI3C 1ZHCA 3AXJB 4ISSA 1WCRA 3ONJA 1MNDA 5L3DB 3P4SA 2JQQA 1W0BA 3RI5A 4LMJA 3RIUC 5CFBA 4ILCA 4JI7T 2M67A 2LKGA 4UF0A 2IW5B 1M62A 4IIJE 3ZMZB 4L9IA 2CBJA 3UFGA 5KX5E 2Q9QD 2M6IA 2NOXA 4DV2T 5M4YA 2XASB 1BR0A 4U74A 4HFHA 2BBHA 2C5KT 4P1NA 3JAEA 4YSZA 3P50A 3AE1A 2CE7A 5KMGP 4LF5T 4IT4A 1ZOYA 4DVDA 3RHWA 2Z6EA 4IGUA 2CLYC 4CN1A 5HYAA 3MACA 4F6RC 1W9RA 1V9DA 3ZMSB 4ZXLA 1GQEA 4A98A 1YKHB 4AQGA 3PUGA 3QNUA 5AQMB 5AQTB 4BJMA 1NENA 2LE8A 4U33A 3OYZA 4GKKT 2WWUA 5FXXA 5F5WA 2WQYA 1UCUA 5JDGA 3UUBA 2NW8A 3AE7A 3QK6A 2I6HA 4NIQA 2NR4A 2C0SA 3P4PA 5JDMA 2UU9T 3MK7C 4YXDA 5ADXL 2E9XD 2H88A 4TZ4C 2UXDT 3WI3A 2VB6A 3N9QA 2FJEA 3Q5XA 1BR4A 3PU8A 5CJ5A 3C4ZA 2YDRA 1W09A 4WYVA 1MIWA 4ADZA 5BR8T 2XY8B 4CZZB 4H9OC 4ZZCA 2X68A 2XQ5A 3K1SA 1KF6A 2XSAA 4LMLA 3HKBE 3SFDA 4PJMA 2D9DA 2V7IA 4X62T 2HPLA 4BJNA 2IC9A 4CN6A 4CXWA 2LSYA 4QX8B 3ZN1B 5L3EB 1ZEEA 3M65A 3UUNA 1HX8A 5C3JA 1KFYA 4P09A 3VR9A 4UV9B 2E9XC 3ZLIA 2VVSA 2V8SV 4B3RT 4OYJA 4O4IE 2QGSA 4IDQA 2NTYA 3CX8B 2OA5A 2ZM0A 2RA1A 2L8KA 3AA6B 2UUCT 4YJ2E 2E5LT 2XAHB 3C4WA 3FBZA 4YTMA 2LRKA 1YKEB 3HKDE 4GKJT 4QH4A 4MHCA 3VHLA 5LNKA 1M7KA 5JDFA 4PJLA 3ZJ1A 4BA9A 3AAEB 3TLVA 1UURA 3AVRA 3Q5WA 3NKZA 3P4WA 3C51A 4IE5A 1UUSA 3EABA 2W62A 1MIYA 3KINB 4UVAB 3AA7B 2SPCA 4TV8E 1VCSA 5AQHB 4U72A 3J9X1 1BR2A 3TLTA 2W00A 5AQKB 2FBWA 5LG3A 3BQLA 3AA1B 3WAJA 1IZNB 4JI6T 2DHRA 1FMWA 1HNWT 3LDQB 4DUYT 2YK0A 3ANWB 3N9MA 3CPZA 2ZLYA 2K3WA 2C5JA 4AKRB 2CHOA 1S35A 3IEEA 4LFAT 4I50E 5FMNA 4CI1B 5LGTB 4LFCT 3AAAB 1MMAA 5LBQB 3F57A 3HA4A 3HI2A 3RIUA 3AB3B 3O1JA 1MIVA 3C4XA 3CQGB 4KMCA 5ABHA 4JI4T 4HE8A 5JQGE 1YQ3A 5LB7B 3N2OA 4QWNB 1SA0E 2EHOB 3AE3A 3AEFA 2WM9A 4C91A 1Y64B 2XAGB 4WZXA 3P4QA 4HKAA 4JUYA 1XNQT 3UU8A 3UQ7A 4B3MT 3RRCA 2KZ7B 4HFBA 2IDOB 4UIGA 4IE7A 1I6ZA 4I55E 3ZPOA 3AE5A 2YOEA 2ZM6T 2XHEB 3ZKRA 5HWXA 3BQIA 3UUMA 3L39A 3I9WA 4AXPA 4KBMB 1D0XA 3LFMA 4LMKA 3N9LA 5F8PA 4GOUA 3MKDA 4K0KT 4IREA 5IWAT 2XAJB 2LSKA 3MA9A 2XJ7A 5FY7A 2OLTA 4DR7T 2XQ4A 2J47A 1JNZA 5L4HA 1WRDA 4XAXB 4CN4A 3AECA 3N9PA 3RQUA 2X9HA 4A56A 2WY2A 3N9OA 2V1DB 1KNRA 5L3CB 2Q9QA 3IA3A 2QRXA 4EZ4A 3OPCA 3PJAA 1KK7A 4JI8T 2ZMAA 4DV5T 2XQYA 4YLHA 4HGAA 4AI6A 2X66A 2CCQA 3FZFB 1OWAA 3JC6D 2MOZA 1MMDA 3CVRA 3KV9A 3MXZA 1MMGA 3RYFE 3LK42 3V5SA 4TNVA 1XDOA 3N5LA 4P0BA 4EXTA 5LHGB 3PUSA 4ISTA 3RC8A 5AQIB 3LK2B 3LBXB 3UT5E 4YHJA 5AQNB 5AQJB 2IUBA 3AE6A 2CBIA 2YINA 2P9BA 2R6GF 2KWHA 4HFVA 4HTEA 4H9RC 5DABA 2YDQA 3RIAA 4ASKA 3TLUA 2A2FX 1E2AA 3HKCE 4KI0F 3CWZB 4DO0A 2IAKA 3L8RA 1QSDA 4IHJE 2E9XA 2ZM8A 2KINB 2X0YA 2W4XA 4UF0B 2XUEA 1IBMT 5EZYE 1J1JA 1OEDC 3KBTA 3PUWF 4AKHA 5JR9B 4IE6A 4PK4A 1HNZT 2C5IT 2IHR1 2D2SA 4M1PA 3TLWA 3RIFA 3ONXA 2IC6A 3JC6C 3A5XA 3ZJ2A 2RP4A 1D0YA 2W63A 2LM9A 5J2UE 3H3AA 4DR3T 2XPKA 5L47A 3ETVA 2YKSA 3NWIA 5FYMA 2EHOD 2CPTA 5A1LA 1FJGT 2XQ6A 2HPJA 2WBLA 2CEAA 5HEHA 5CB4E 2H7VC 2Y8DA 4X1YE 4PK6A 3ZCJA 4H9QC 4DV1T 3UFEA 3VRAA 2JMKA 3V5UA 2MYSA 5EK2A 1US7B 3AVSA 3PE0A 2CWOA 4ZOLE 4OFZA 4DNDA 2I0MA 1KNPA 1SE7A 2N1GA 2XQ3A 2BG9E 2BDEA 1X79A 3AXJA 2E2AA 5AQVB 2V7JA 4TUYE 4QX7B 4AQFA 4I0UA 2UUAT 3UTKA 3ZEFB 4O4LE 4JI2T 4H9PC 2IMLA 1H7CA 4EYUA 2DLRA 4YTPA 3I9YA 5DJQC 5LXTE 2UXNB 4EYYR 3G06A 1E7PA 2VKDA 5JREA 3GA8A 4E7ZA 3T1YT 2W67A 2V6YA 2VASA 3KV6A 1MMNA 3CKDA 3FXDB 3N2GE 4NXNT 3GMIA 2Q9QC 3ZYLA 1XNRT 2UXXB 2UXCT 4HFCA 2XQ8A 2WDRA 4JEUB 3QB5A 1YD8G 1EZ3A 2BG9C 3EHZA 4PFOA 2A72A 2NW7A 3UQ4A 5JRCA 4QH1A 3FZHB 2KT9A 3SRZA 2VQFT 5LJNA 4X1IE 3ABVA 4UVBB 3IF8B 5L3BB 3ETUA 2QVAA 4YT0A 3C64A 4IDNA 3NVOA 5H6QB 1T98A 2VVNA 2HN2A 1HG5A 2ACXA 4AKGA 2L9QA 2WAUA 3Q9DA 4IL9A 3AEDA 4TX5A 4EB6E 4DV6T 4DBQA 3ZC0A 3JCFA 3CX7B 3U3IA 2KXPB 1NEKA 1LRZA 3T8OA 4DIDB 4DR6T 3PUAA 2K5BB 4JI5T 3A8YC 3RKGA 2ES0A 4ILAA 4IL4A 1J5ET 3P4RA 5LYJE 4EZHA 4C90A 1FIOA 2ACZA 2DWKA 5FXVA 1O3XA 2WMNA 4KX6A 3RX6A 5FXWA 4JBWF 4EIWA 2I59A 3PUVF 3NRXA 3U78A 4TWFA 4DR5T 2X9XA 3ZYMA 2J62A 2JQKA 3OBVE 1WYBA 2W0GA 4IE4A 3TLSA 2DCFA 4GK5E 5JDNA 2PJQA 5LOVE 3CIRA 1CHUA 2VWAA 1BR1A 5JDLA 5LBMA 3A7MA 3P7IA 3KVAA 2UUBT 1R8IA 3H3MA 2XSBA 3EUHA 5HAXA 3W15B 3M3ZB 3RQWA 4UVCB 2XTLA 2Y6XA 4HN9A 1N34T 2KWIB 5HCJA 3KVBA 2BS3A 2PFVA 3CK6A 3OKQA 1OEDA 2WZIA 4GYRA 4I4TE 2HH7A 4Z90A 2JMHA 5LHIB 4DR4T 3OVUA 3ZN0B 2D5UA 4QXBB 4B3ST 5FVLA 1Z0PA 4U31A 3FHNA 5AQOB 3AEAA 2WDQA 3LG7A 1IJ5A 5FVKA 2VKHA 3LSVA 4WBNE 4ANJA 4O4HE 5HWYA 4EAHA 2XAQB 2CLYB 4G2AA 2LOPA 2KNDA 5HXCA 4AQFC 4UXNB 1ZV4X 5J0ZA 4JYAT 2H3RA 5H6RB 4X66T 4CI2B 2MPKA 3CX6B 2J1DG 5KXJA 2XQ7A 4O2AE 4QXHB 4F8HA 2E8IA 1L0VA 5IHYA 2BKOA 1G8XA 4NPPA 2BKNA 3AE9A 2PG8A 5FY1A 3E22E 5J1GA 3JAFA 3CMLA 3AAIA 4HWDA 3ONLC 2N2NA 4U7IA 4QH5A 5EK3A 4HWHA 1WLXA 2BZBA 4ERRA 5LP6E 4JV5T 2MAWA 5AQQB 5AQPB 3K8PC 5FXZA 3Q5EA 3C98B 4ZI2D 2CXFA 5CGMA 2VKOA 4H63H 1FMVA 3AA0B 3BQKA 1HTJF 2K9AA 2F4VT 5HEUA 3QB5K 2CHNA 4PJJA 3T1HT 3SS1A 1XWMA 4YSXA 5EK4A 5JDQA 4QXCB 3GN5B 2LM2A 3KDSE 1VCTA 2FUPA 4JLEA 2BG9A 1HFAA 3RH3A 3E08A 1OEDE 2D0TA 5DQWA 2YN6A 4KHZF 3VKGA 2V6XA 3PU3A 4CI3B 2E9XB 2BBJA 3PTRB 4TN7B 5HXHA 2VURA 2LEHA 4IE0A 2WB5A 3OJAA 4AKLA 1NAFA 4DMWA 2CWYA 3ZT5A 1KEYA 3QUJA 3EDUA 4V1Av 3DP7A 2WMOA 5HEGA 4P0AA 3B5MA 5AQLB 4ZI3D 3GWHA 2NW9A 3RC3A 1NWMX 4MLKA 1N33T 1WYCA 4PW8A 3HR0A 4XBFB 1LKXA 4X64T 3EDVA 4GYSA 2WP9A 1VOMA 2BVMA 2XM1A 2MBGA 4FI5A 4UELA 1ZKEA 5ABFA 2WSSV 2JQHA 2OV9A 1UX4A 4OX9T 4PFPA 1FEWA 1X9BA 3RYIE 2DWGA 1D1BA 2NWBA 3R84B 3HKEE 1U4QA 2VL8A 4KHPT 1CUNA 1XZYA 4TWDA 1QUUA 2MTQA 4ZS3A 3CQXC 5JTGA 4J2CA 5F3JA 4Q25A 2W2UA 3L3PA 3RYCE 5ABEA 4HEAA 4K0UA 1HF8A 4JI0T 2HHHT 4A5XA 3NRYA 4FJOA 1N36T 1YQ4A 4E7SA 2N9DA 2CM0A 1LVKA 2FJDA 4O4JE 4UV8B 4ZS2A 5ABGA
chains in the Genus database with same CATH topology
3C64A 2YU2A 2C5JA 4AKRB 1S35A 2CA5A 2ODUA 1MNEA 2ODVA 3IEEA 5H6QB 1T98A 4I50E 5FMNA 1HG5A 4CI1B 2ACXA 2LSJA 5CA1E 5LGTB 3AAAB 4AKGA 1MMAA 3L09A 2L9QA 4PJNA 3KFWX 2WAUA 4UEMA 2ZM2A 5LBQB 3Q9DA 5KDMC 5JR9A 1VRBA 3F57A 3HA4A 3HI2A 3N9MA 3AB3B 3O1JA 4AKIA 5CA0E 4TX5A 4EB6E 1MIVA 3C4XA 3CQGB 4KMCA 3CQCB 3ZMVB 4DBQA 5LCYA 4HE8A 1HG2A 5JQGE 4ZI2C 3ZC0A 1E1HB 3CX7B 3U3IA 3E0ZA 3N2OA 3KV4A 4QWNB 1SA0E 2KXPB 2EHOB 1LRZA 3B13A 4CXYA 3O4XE 2WM9A 3T8OA 4C91A 1HS7A 4O2BE 3PUAA 1Y64B 2XAGB 2K5BB 4EOZB 4L5GA 2LHNA 4HKAA 5FP3A 2Y48B 4JUYA 1G73A 4G63A 4CQIA 2ES0A 3F31A 4PAGA 5LYJE 3K3QC 4EZHA 1D0ZA 3PURA 3O9XA 2L3LA 4C90A 1FIOA 2DWKA 3RRCA 3GN5A 2KZ7B 4XZCA 3Q2MA 5FXVA 2X51A 5JRCB 1O3XA 2WMNA 4UIGA 3I0OA 3BK9A 3RX6A 4IE7A 3OYXA 4I55E 5FXWA 3ZPOA 3ZMTB 5ETWA 4EIWA 2XHEB 2I59A 3U78A 2X9WA 3NRXA 1D1AA 2NTXA 2X9XA 3C50A 1SHZC 4QHOA 3RPUA 3ZYMA 5HWXA 1YW0A 3BQIA 3OBVE 1WYBA 2EHOC 2W0GA 4IE4A 2V7LA 3UUMA 2DCFA 4OYKA 4GK5E 2X9YA 3I9WA 5JDNA 2PJQA 4AXPA 5LHHB 5LOVE 3DTOA 4OK0A 2VWAA 4Z8XA 4CXXA 1BR1A 4KBMB 1D0XA 4I43B 5JDLA 3LFMA 5LBMA 3N9LA 5F8PA 4GOUA 3J7Yq 3LJCA 5L2LA 3P7IA 4ZI7E 3KVAA 5HXSA 3MKDA 3KBUA 2V7MA 3EUHA 5HAXA 4NUUA 2G0UA 2XAJB 2LSKA 3W15B 2YEVC 3PUQA 3LBXA 3MA9A 2K48A 2W61A 3HL6A 5FY7A 4UVCB 2B1EA 5HXEA 1KNZA 2XTLA 2Y6XA 4HN9A 3VKHA 3VU7H 4ZHQE 5JH7E 2LSIA 2KWIB 3K3NA 3SOLA 3PDYA 3ZCIA 3KVBA 3B57A 5AFUL 2A3DA 2PFVA 3NZQA 1OXZA 1WRDA 3N9NA 3OKQA 1D1CA 1UX5A 2GK9A 2KLQA 2X67A 1WR6A 3IBPA 4XAXB 3ZC1A 5BMVE 4GYRA 3IHRA 3N9PA 4I4TE 3RYHE 5IYZE 5LA6E 2X9HA 4A56A 4ZI3C 1ZHCA 2HH7A 2JMHA 4ISSA 5LHIB 3N9OA 5JVDE 2V1DB 4GK0E 5L3CB 1MNDA 2Q9QA 5L3DB 4X20E 2D5UA 2JQQA 4QXBB 3ZN0B 3UULA 3I1AA 4EZ4A 4N78D 1Z0PA 3FHNA 2M67A 1KK7A 5LGNB 2ZMAA 2XQYA 4YLHA 4UF0A 2IW5B 4HGAA 4MFRA 3LG7A 4AI6A 4IIJE 1IJ5A 4H9SE 3ZMZB 4L9IA 2VKHA 4WBNE 2X66A 4ANJA 2CCQA 4O4HE 5HWYA 1OWAA 4EAHA 5KX5E 2XAQB 2CLYB 2Q9QD 4G2AA 2NOXA 2LOPA 3JC6D 4BAYB 5M4YA 2MOZA 1MMDA 2NP9A 2KNDA 3CVRA 2XASB 3KV9A 1MMGA 3MXZA 4TV9E 5HXCA 3RYFE 4AQFC 1BR0A 3LK42 3V5SA 3N5LA 4P0BA 2JPFA 4U74A 1ZV4X 4UXNB 4EXTA 5LHGB 4H63V 1LVFA 2C5KT 2H3RA 3PUSA 4ISTA 5H6RB 3RC8A 3UUXB 3LK2B 3LBXB 4CI2B 2CE7A 3UT5E 3CX6B 5KMGP 4YHJA 2J1DG 4O2AE 4QXHB 3R6NA 2V7KA 4DVDA 2YINA 3F2EA 2P9BA 1U5PA 2KWHA 4HFVA 4HTEA 1IAPA 4H9RC 2E8IA 2Z6EA 5IHYA 2CXLA 4IGUA 2CLYC 2DNXA 3S4UA 1G8XA 5HYAA 5FY0A 3MACA 4F6RC 2PG8A 1V9DA 5DABA 4ASKA 5FY1A 2A2FX 3ZMSB 3P8CD 3E22E 5J1GA 1YKHB 1B7TA 3CMLA 3HKCE 4AQGA 3AAIA 3PUGA 3CWZB 4DO0A 2N2NA 2JRKA 4BJMA 2IAKA 1QSDA 4IHJE 2E9XA 2LE8A 2ZM8A 3OYZA 4ILUA 5EK3A 1WLXA 2BZBA 2KINB 4ERRA 2LSGA 2WWUA 5LP6E 4B6XA 4UF0B 5FXXA 2XUEA 1S94A 3FXEB 3WAKA 1UCUA 5GONE 5EZYE 5JDGA 3K8PC 5C8YE 3KBTA 5TAOA 5FXZA 5JR9B 4AKHA 4IE6A 3C98B 2NW8A 4PK4A 3QK6A 4ZI2D 2C5IT 2CXFA 2C0SA 5JDMA 2D2SA 4M1PA 2VKOA 4H63H 1FMVA 3AA0B 4DMVA 3MK7C 2VKJA 3BQKA 2YU1A 3ONXA 5ADXL 1HTJF 2E9XD 2IC6A 3A5XA 3JC6C 4O8SA 2K9AA 4NUVA 4PNIA 4WNKA 3LK3B 3ZJ2A 2RP4A 2DI4A 4OHFA 4TZ4C 1D0YA 3WI3A 5LJMA 2VB6A 2LM9A 2W63A 4PJJA 2XAFB 3SS1A 4KP3C 4X1KE 4WW0A 5J2UE 5L3GB 3N9QA 2PBIA 5JR9C 5EK4A 3O1IA 4H9NC 5JDQA 4QXCB 3GN5B 3H3AA 3Q5XA 1BR4A 3PU8A 3C4ZA 3ETVA 4YFSA 3KDSE 3NZPA 5FYMA 2EHOD 2V26A 4JLEA 1MIWA 4ADZA 5A1LA 1HFAA 4IDZA 3RH3A 4CZZB 3E08A 4H9OC 3H37A 2HPJA 2WBLA 2X68A 4PK5A 2K24A 3SWHA 3MJXA 2CEAA 2D0TA 5DQWA 2H7VC 2D0UA 2Y8DA 5CB4E 3VKGA 4X1YE 1IJ6A 3PU3A 4PK6A 3HKBE 3ZCJA 4CI3B 4H9QC 2E9XB 3PTRB 4TN7B 4PJMA 5HXHA 3UFEA 2V7IA 2HPLA 4BJNA 2LEHA 2CXDA 2BVLA 2IC9A 3FB2A 4IE0A 3OJAA 3MZKB 3RKOA 4MBQA 4CXWA 5FNVE 4AKLA 2LSYA 1NAFA 4QX8B 2CWYA 4DMWA 2JMKA 3V5UA 2MYSA 3ZN1B 5EK2A 1US7B 3AVSA 2JJ9A 3PE0A 2CWOA 3QUJA 4ZOLE 5L3EB 1ZEEA 4OFZA 3EDUA 4DNDA 4V1Av 3M65A 2LT3A 3DP7A 2LHRA 2WMOA 2N1GA 4P0AA 4L0RA 4ZI3D 3EVYA 3KV5A 3UUNA 1HX8A 2H7OA 3GWHA 4P09A 2NW9A 3RC3A 3I0QA 2BDEA 4UV9B 1X79A 1NWMX 3N2KE 2E9XC 4MLKA 4YJ3E 1WYCA 3ZLIA 2V7JA 4JEHB 4PW8A 2CMRA 3ANWA 3HR0A 4TUYE 4QX7B 4AQFA 4XBFB 4OYJA 4O4IE 3UTKA 2Q9QB 2QGSA 1LKXA 3ZEFB 5J2TE 4O4LE 3EDVA 2NTYA 3CX8B 4H9PC 5LG4A 2LJLA 2OA5A 2X0LB 4GYSA 5L3FB 2ZM0A 1VOMA 1H7CA 2BVMA 2RA1A 4DBRA 2MBGA 2L8KA 4FI5A 2VK9A 5HXRA 3AA6B 3FBLA 4YJ2E 4KUMB 4UELA 4EYUA 2DLRA 1ZKEA 2XAHB 3C4WA 3FBZA 3I9YA 5DJQC 5LXTE 2UXNB 2WSSV 4EYYR 1YKEB 3HKDE 4MHCA 1HCIA 2VKDA 3VHLA 1UX4A 3GA8A 4E7ZA 5LNKA 3ESLA 5JREA 3K3OA 3D0TA 5JDHA 5E0OA 3DJBA 4PFPA 5JDFA 4PJLA 1FEWA 3ZJ1A 2VASA 3KV6A 4BA9A 1MMNA 3AAEB 3RYIE 2DWGA 1D1BA 3AVRA 3CKDA 2KMFA 3FXDB 3Q5WA 2NWBA 3N2GE 5DQVA 3R84B 4MALA 3C51A 3HKEE 3GMIA 4IE5A 3ZMUB 2Q9QC 1U4QA 3ZYLA 3NBXX 2EHOA 2W62A 5LGUB 2VL8A 1MIYA 1CUNA 2LOSA 3KINB 4UVAB 3AA7B 1QUUA 2SPCA 2UXXB 2MTQA 4ZS3A 1AJ3A 4WBOA 3CQXC 4TV8E 3QC9A 4J2CA 5F3JA 4JEUB 4U72A 3J9X1 1YD8G 1EZ3A 3L3PA 3RYCE 1BR2A 4PFOA 2A72A 2W00A 4HEAA 1HF8A 4K0UA 2NW7A 5JRCA 3ZYKA 3BQLA 2KT9A 3AA1B 3WAJA 1IZNB 3NRYA 4FJOA 3TKLB 2QA7A 3SRZA 3RRWA 5LJNA 2DHRA 4E7SA 4X1IE 3O1HA 1FMWA 4UVBB 3IF8B 2N9DA 2CM0A 5L3BB 1LVKA 4GIWA 4O4JE 4QKNA 4UV8B 4ZS2A 2YK0A 3ANWB 3ETUA 3CPZA 2ZLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTQ A;  2A3D A; 
#chains in the Genus database with same CATH topology
 2WU5 A;  2YU2 A;  4YSY A;  2CA5 A;  1MNE A;  2E5V A;  2YDS A;  4EGW A;  4UEM A;  3AEB A;  5JR9 A;  1VRB A;  4AKI A;  5CA0 E;  2V6Y B;  3CQC B;  1XDP A;  3ZMV B;  5LCY A;  3E0Z A;  3KV4 A;  3B13 A;  3O4X E;  1HR0 T;  4JI3 T;  5AQG B;  2V5D A;  2CRB A;  4O2B E;  2LHN A;  5FP3 A;  1G73 A;  4G63 A;  4LF4 T;  4PAG A;  2XZE A;  1D0Z A;  2WS3 A;  5IUX A;  4XZC A;  5JRC B;  3Q5D A;  3BK9 A;  1N32 T;  2JQ9 A;  5ETW A;  2X9W A;  1D1A A;  3C50 A;  1YW0 A;  2EHO C;  2V7L A;  4AIU A;  5L4E A;  4OYK A;  1W0A A;  3FZL B;  3DTO A;  3X1D A;  4Z8X A;  4I43 B;  2BS2 A;  5HXS A;  2KSR A;  2V7M A;  2QYW A;  3ZT7 A;  1DU2 A;  4HFI A;  2YEV C;  4EED A;  3PUQ A;  2PTF A;  3HL6 A;  1KNZ A;  3VKH A;  3VU7 H;  4ZHQ E;  5JH7 E;  2VQE T;  5AFU L;  4U2Z A;  3NZQ A;  4NXM T;  3N9N A;  2X0H A;  1D1C A;  2GK9 A;  2KLQ A;  3ZC1 A;  2X67 A;  1WR6 A;  5BMV E;  3IHR A;  3RYH E;  4DR2 T;  5IYZ E;  1UGO A;  4LFB T;  3UU6 A;  5JVD E;  4GK0 E;  5HEJ A;  4YHH T;  3VR8 A;  4X20 E;  3UUL A;  3I1A A;  2FJB A;  4N78 D;  1IBL T;  4U3C A;  4LF6 T;  5LGN B;  3AE2 A;  4MFR A;  2W66 A;  4H9S E;  4YTN A;  5LMN T;  4U7Y A;  4BAY B;  2NP9 A;  4TV9 E;  2JPF A;  2WWV A;  4H63 V;  1LVF A;  1I94 T;  4COF A;  3UUX B;  4IDO A;  4IDP A;  2BKP A;  4B3T T;  1XMQ T;  3PJA J;  3R6N A;  2V7K A;  3OTO T;  3F2E A;  1U5P A;  1WR0 A;  1IAP A;  2CXL A;  1OED B;  2BS4 A;  2DNX A;  3S4U A;  5FY0 A;  3AEE A;  3ZT6 A;  3UU5 A;  3P8C D;  4X65 T;  1B7T A;  4EEB A;  2JRK A;  2XQ9 A;  3AE8 A;  4ILU A;  3EI0 A;  4DV3 T;  2LSG A;  4B6X A;  1S94 A;  3FXE B;  3WAK A;  5GON E;  5C8Y E;  1WFD A;  5TAO A;  2IIU A;  1HNX T;  4DMV A;  2VKJ A;  2YU1 A;  4ZZB A;  3UU4 A;  4O8S A;  1Y01 A;  5LMU T;  4NUV A;  4PNI A;  4WNK A;  3LK3 B;  3RF1 A;  2DI4 A;  4OHF A;  1T8B A;  5LJM A;  2XAF B;  2XQA A;  3QOF A;  4KP3 C;  4X1K E;  4WW0 A;  5L3G B;  2PBI A;  5JR9 C;  2VL0 A;  3O1I A;  4H9N C;  3NZP A;  2WZH A;  2V26 A;  1SUM B;  4IDZ A;  2RPA A;  3H37 A;  4PK5 A;  2K24 A;  3SWH A;  3FZM B;  3MJX A;  4ZEY A;  3FZK B;  4YY3 T;  2D0U A;  4DUZ T;  1IJ6 A;  4HWC A;  2CXD A;  2BVL A;  3FB2 A;  4HFE A;  3MZK B;  3RKO A;  4MBQ A;  5FNV E;  1ZP0 A;  2WU2 A;  2JJ9 A;  1T7S A;  4AQY T;  2LT3 A;  2LHR A;  4L0R A;  3EVY A;  3KV5 A;  2H7O A;  3I0Q A;  3N2K E;  4DV4 T;  4YJ3 E;  2LKH A;  4JEH B;  2CMR A;  3ANW A;  2AXD S;  2Q9Q B;  5J2T E;  2JIW A;  3RGL A;  5LG4 A;  2LJL A;  1HX1 B;  2X0L B;  2AE9 A;  5FKY A;  5L3F B;  2DL1 A;  4DBR A;  3SFE A;  2VK9 A;  5HXR A;  3FBL A;  4LF7 T;  4KUM B;  4X5T A;  1IBK T;  3JAD A;  2BG9 B;  5AQR B;  4A97 A;  1HCI A;  5FL0 A;  3ESL A;  4DV0 T;  3K3O A;  3D0T A;  5JDH A;  5E0O A;  2HN1 A;  3DJB A;  4HFD A;  3ZSS A;  2KMF A;  5DQV A;  4MAL A;  1J5W A;  3ZMU B;  5HEO A;  3NBX X;  2EHO A;  5LGU B;  2LOS A;  4LF9 T;  4JI1 T;  2H89 A;  1AJ3 A;  4WBO A;  3AE4 A;  3QC9 A;  5FL1 A;  3PV0 F;  5AQU B;  3ZYK A;  2FJA A;  2LRL A;  4UR9 A;  3TKL B;  2QA7 A;  2M6B A;  3PUX F;  3RRW A;  4HWF A;  3O1H A;  3AEG A;  4U2Y A;  4GIW A;  4DR1 T;  4QKN A;  4YFS A;  2ODU A;  2ODV A;  2LSJ A;  5CA1 E;  4TWH A;  3L09 A;  4PJN A;  3KFW X;  5ABF B;  2ZM2 A;  4HWI B;  5KDM C;  2LLY A;  5AQF B;  4TNW A;  1T72 A;  1HG2 A;  2XM2 A;  3VRB A;  4ZI2 C;  1E1H B;  1QLB A;  1YXR A;  4CXY A;  3EAM A;  1HS7 A;  5HCM A;  4EOZ B;  4L5G A;  2Y48 B;  4CQI A;  3RLF F;  2J4G A;  3F31 A;  3K3Q C;  3PUR A;  3O9X A;  2L3L A;  4EV6 A;  3GN5 A;  3Q2M A;  2X51 A;  3UU3 A;  1JNR A;  2WCA A;  3I0O A;  3OYX A;  3ZMT B;  1XMO T;  5C2T A;  2NTX A;  2A9U A;  1SHZ C;  4QHO A;  3RPU A;  1Z8U A;  4LF8 T;  1UK5 A;  2X9Y A;  5LHH B;  4OK0 A;  4CXX A;  2WDV A;  3J7Y q;  3LJC A;  5L2L A;  4ZI7 E;  3KBU A;  3PUZ F;  3PUY F;  4NUU A;  2G0U A;  5AQS B;  4Z91 A;  3LBX A;  2K48 A;  2W61 A;  3ZST A;  2B1E A;  5HXE A;  4AIS A;  2V5C A;  2LSI A;  3K3N A;  3SOL A;  3PDY A;  3ZCI A;  3B57 A;  2A3D A;  4ILB A;  2B76 A;  2UXB T;  1OXZ A;  1UX5 A;  3IBP A;  4DV7 T;  5LA6 E;  4ZI3 C;  1ZHC A;  3AXJ B;  4ISS A;  1WCR A;  3ONJ A;  1MND A;  5L3D B;  3P4S A;  2JQQ A;  1W0B A;  3RI5 A;  4LMJ A;  3RIU C;  5CFB A;  4ILC A;  4JI7 T;  2M67 A;  2LKG A;  4UF0 A;  2IW5 B;  1M62 A;  4IIJ E;  3ZMZ B;  4L9I A;  2CBJ A;  3UFG A;  5KX5 E;  2Q9Q D;  2M6I A;  2NOX A;  4DV2 T;  5M4Y A;  2XAS B;  1BR0 A;  4U74 A;  4HFH A;  2BBH A;  2C5K T;  4P1N A;  3JAE A;  4YSZ A;  3P50 A;  3AE1 A;  2CE7 A;  5KMG P;  4LF5 T;  4IT4 A;  1ZOY A;  4DVD A;  3RHW A;  2Z6E A;  4IGU A;  2CLY C;  4CN1 A;  5HYA A;  3MAC A;  4F6R C;  1W9R A;  1V9D A;  3ZMS B;  4ZXL A;  1GQE A;  4A98 A;  1YKH B;  4AQG A;  3PUG A;  3QNU A;  5AQM B;  5AQT B;  4BJM A;  1NEN A;  2LE8 A;  4U33 A;  3OYZ A;  4GKK T;  2WWU A;  5FXX A;  5F5W A;  2WQY A;  1UCU A;  5JDG A;  3UUB A;  2NW8 A;  3AE7 A;  3QK6 A;  2I6H A;  4NIQ A;  2NR4 A;  2C0S A;  3P4P A;  5JDM A;  2UU9 T;  3MK7 C;  4YXD A;  5ADX L;  2E9X D;  2H88 A;  4TZ4 C;  2UXD T;  3WI3 A;  2VB6 A;  3N9Q A;  2FJE A;  3Q5X A;  1BR4 A;  3PU8 A;  5CJ5 A;  3C4Z A;  2YDR A;  1W09 A;  4WYV A;  1MIW A;  4ADZ A;  5BR8 T;  2XY8 B;  4CZZ B;  4H9O C;  4ZZC A;  2X68 A;  2XQ5 A;  3K1S A;  1KF6 A;  2XSA A;  4LML A;  3HKB E;  3SFD A;  4PJM A;  2D9D A;  2V7I A;  4X62 T;  2HPL A;  4BJN A;  2IC9 A;  4CN6 A;  4CXW A;  2LSY A;  4QX8 B;  3ZN1 B;  5L3E B;  1ZEE A;  3M65 A;  3UUN A;  1HX8 A;  5C3J A;  1KFY A;  4P09 A;  3VR9 A;  4UV9 B;  2E9X C;  3ZLI A;  2VVS A;  2V8S V;  4B3R T;  4OYJ A;  4O4I E;  2QGS A;  4IDQ A;  2NTY A;  3CX8 B;  2OA5 A;  2ZM0 A;  2RA1 A;  2L8K A;  3AA6 B;  2UUC T;  4YJ2 E;  2E5L T;  2XAH B;  3C4W A;  3FBZ A;  4YTM A;  2LRK A;  1YKE B;  3HKD E;  4GKJ T;  4QH4 A;  4MHC A;  3VHL A;  5LNK A;  1M7K A;  5JDF A;  4PJL A;  3ZJ1 A;  4BA9 A;  3AAE B;  3TLV A;  1UUR A;  3AVR A;  3Q5W A;  3NKZ A;  3P4W A;  3C51 A;  4IE5 A;  1UUS A;  3EAB A;  2W62 A;  1MIY A;  3KIN B;  4UVA B;  3AA7 B;  2SPC A;  4TV8 E;  1VCS A;  5AQH B;  4U72 A;  3J9X 1;  1BR2 A;  3TLT A;  2W00 A;  5AQK B;  2FBW A;  5LG3 A;  3BQL A;  3AA1 B;  3WAJ A;  1IZN B;  4JI6 T;  2DHR A;  1FMW A;  1HNW T;  3LDQ B;  4DUY T;  2YK0 A;  3ANW B;  3N9M A;  3CPZ A;  2ZLY A;  2K3W A;  2C5J A;  4AKR B;  2CHO A;  1S35 A;  3IEE A;  4LFA T;  4I50 E;  5FMN A;  4CI1 B;  5LGT B;  4LFC T;  3AAA B;  1MMA A;  5LBQ B;  3F57 A;  3HA4 A;  3HI2 A;  3RIU A;  3AB3 B;  3O1J A;  1MIV A;  3C4X A;  3CQG B;  4KMC A;  5ABH A;  4JI4 T;  4HE8 A;  5JQG E;  1YQ3 A;  5LB7 B;  3N2O A;  4QWN B;  1SA0 E;  2EHO B;  3AE3 A;  3AEF A;  2WM9 A;  4C91 A;  1Y64 B;  2XAG B;  4WZX A;  3P4Q A;  4HKA A;  4JUY A;  1XNQ T;  3UU8 A;  3UQ7 A;  4B3M T;  3RRC A;  2KZ7 B;  4HFB A;  2IDO B;  4UIG A;  4IE7 A;  1I6Z A;  4I55 E;  3ZPO A;  3AE5 A;  2YOE A;  2ZM6 T;  2XHE B;  3ZKR A;  5HWX A;  3BQI A;  3UUM A;  3L39 A;  3I9W A;  4AXP A;  4KBM B;  1D0X A;  3LFM A;  4LMK A;  3N9L A;  5F8P A;  4GOU A;  3MKD A;  4K0K T;  4IRE A;  5IWA T;  2XAJ B;  2LSK A;  3MA9 A;  2XJ7 A;  5FY7 A;  2OLT A;  4DR7 T;  2XQ4 A;  2J47 A;  1JNZ A;  5L4H A;  1WRD A;  4XAX B;  4CN4 A;  3AEC A;  3N9P A;  3RQU A;  2X9H A;  4A56 A;  2WY2 A;  3N9O A;  2V1D B;  1KNR A;  5L3C B;  2Q9Q A;  3IA3 A;  2QRX A;  4EZ4 A;  3OPC A;  3PJA A;  1KK7 A;  4JI8 T;  2ZMA A;  4DV5 T;  2XQY A;  4YLH A;  4HGA A;  4AI6 A;  2X66 A;  2CCQ A;  3FZF B;  1OWA A;  3JC6 D;  2MOZ A;  1MMD A;  3CVR A;  3KV9 A;  3MXZ A;  1MMG A;  3RYF E;  3LK4 2;  3V5S A;  4TNV A;  1XDO A;  3N5L A;  4P0B A;  4EXT A;  5LHG B;  3PUS A;  4IST A;  3RC8 A;  5AQI B;  3LK2 B;  3LBX B;  3UT5 E;  4YHJ A;  5AQN B;  5AQJ B;  2IUB A;  3AE6 A;  2CBI A;  2YIN A;  2P9B A;  2R6G F;  2KWH A;  4HFV A;  4HTE A;  4H9R C;  5DAB A;  2YDQ A;  3RIA A;  4ASK A;  3TLU A;  2A2F X;  1E2A A;  3HKC E;  4KI0 F;  3CWZ B;  4DO0 A;  2IAK A;  3L8R A;  1QSD A;  4IHJ E;  2E9X A;  2ZM8 A;  2KIN B;  2X0Y A;  2W4X A;  4UF0 B;  2XUE A;  1IBM T;  5EZY E;  1J1J A;  1OED C;  3KBT A;  3PUW F;  4AKH A;  5JR9 B;  4IE6 A;  4PK4 A;  1HNZ T;  2C5I T;  2IHR 1;  2D2S A;  4M1P A;  3TLW A;  3RIF A;  3ONX A;  2IC6 A;  3JC6 C;  3A5X A;  3ZJ2 A;  2RP4 A;  1D0Y A;  2W63 A;  2LM9 A;  5J2U E;  3H3A A;  4DR3 T;  2XPK A;  5L47 A;  3ETV A;  2YKS A;  3NWI A;  5FYM A;  2EHO D;  2CPT A;  5A1L A;  1FJG T;  2XQ6 A;  2HPJ A;  2WBL A;  2CEA A;  5HEH A;  5CB4 E;  2H7V C;  2Y8D A;  4X1Y E;  4PK6 A;  3ZCJ A;  4H9Q C;  4DV1 T;  3UFE A;  3VRA A;  2JMK A;  3V5U A;  2MYS A;  5EK2 A;  1US7 B;  3AVS A;  3PE0 A;  2CWO A;  4ZOL E;  4OFZ A;  4DND A;  2I0M A;  1KNP A;  1SE7 A;  2N1G A;  2XQ3 A;  2BG9 E;  2BDE A;  1X79 A;  3AXJ A;  2E2A A;  5AQV B;  2V7J A;  4TUY E;  4QX7 B;  4AQF A;  4I0U A;  2UUA T;  3UTK A;  3ZEF B;  4O4L E;  4JI2 T;  4H9P C;  2IML A;  1H7C A;  4EYU A;  2DLR A;  4YTP A;  3I9Y A;  5DJQ C;  5LXT E;  2UXN B;  4EYY R;  3G06 A;  1E7P A;  2VKD A;  5JRE A;  3GA8 A;  4E7Z A;  3T1Y T;  2W67 A;  2V6Y A;  2VAS A;  3KV6 A;  1MMN A;  3CKD A;  3FXD B;  3N2G E;  4NXN T;  3GMI A;  2Q9Q C;  3ZYL A;  1XNR T;  2UXX B;  2UXC T;  4HFC A;  2XQ8 A;  2WDR A;  4JEU B;  3QB5 A;  1YD8 G;  1EZ3 A;  2BG9 C;  3EHZ A;  4PFO A;  2A72 A;  2NW7 A;  3UQ4 A;  5JRC A;  4QH1 A;  3FZH B;  2KT9 A;  3SRZ A;  2VQF T;  5LJN A;  4X1I E;  3ABV A;  4UVB B;  3IF8 B;  5L3B B;  3ETU A;  2QVA A;  4YT0 A;  3C64 A;  4IDN A;  3NVO A;  5H6Q B;  1T98 A;  2VVN A;  2HN2 A;  1HG5 A;  2ACX A;  4AKG A;  2L9Q A;  2WAU A;  3Q9D A;  4IL9 A;  3AED A;  4TX5 A;  4EB6 E;  4DV6 T;  4DBQ A;  3ZC0 A;  3JCF A;  3CX7 B;  3U3I A;  2KXP B;  1NEK A;  1LRZ A;  3T8O A;  4DID B;  4DR6 T;  3PUA A;  2K5B B;  4JI5 T;  3A8Y C;  3RKG A;  2ES0 A;  4ILA A;  4IL4 A;  1J5E T;  3P4R A;  5LYJ E;  4EZH A;  4C90 A;  1FIO A;  2ACZ A;  2DWK A;  5FXV A;  1O3X A;  2WMN A;  4KX6 A;  3RX6 A;  5FXW A;  4JBW F;  4EIW A;  2I59 A;  3PUV F;  3NRX A;  3U78 A;  4TWF A;  4DR5 T;  2X9X A;  3ZYM A;  2J62 A;  2JQK A;  3OBV E;  1WYB A;  2W0G A;  4IE4 A;  3TLS A;  2DCF A;  4GK5 E;  5JDN A;  2PJQ A;  5LOV E;  3CIR A;  1CHU A;  2VWA A;  1BR1 A;  5JDL A;  5LBM A;  3A7M A;  3P7I A;  3KVA A;  2UUB T;  1R8I A;  3H3M A;  2XSB A;  3EUH A;  5HAX A;  3W15 B;  3M3Z B;  3RQW A;  4UVC B;  2XTL A;  2Y6X A;  4HN9 A;  1N34 T;  2KWI B;  5HCJ A;  3KVB A;  2BS3 A;  2PFV A;  3CK6 A;  3OKQ A;  1OED A;  2WZI A;  4GYR A;  4I4T E;  2HH7 A;  4Z90 A;  2JMH A;  5LHI B;  4DR4 T;  3OVU A;  3ZN0 B;  2D5U A;  4QXB B;  4B3S T;  5FVL A;  1Z0P A;  4U31 A;  3FHN A;  5AQO B;  3AEA A;  2WDQ A;  3LG7 A;  1IJ5 A;  5FVK A;  2VKH A;  3LSV A;  4WBN E;  4ANJ A;  4O4H E;  5HWY A;  4EAH A;  2XAQ B;  2CLY B;  4G2A A;  2LOP A;  2KND A;  5HXC A;  4AQF C;  4UXN B;  1ZV4 X;  5J0Z A;  4JYA T;  2H3R A;  5H6R B;  4X66 T;  4CI2 B;  2MPK A;  3CX6 B;  2J1D G;  5KXJ A;  2XQ7 A;  4O2A E;  4QXH B;  4F8H A;  2E8I A;  1L0V A;  5IHY A;  2BKO A;  1G8X A;  4NPP A;  2BKN A;  3AE9 A;  2PG8 A;  5FY1 A;  3E22 E;  5J1G A;  3JAF A;  3CML A;  3AAI A;  4HWD A;  3ONL C;  2N2N A;  4U7I A;  4QH5 A;  5EK3 A;  4HWH A;  1WLX A;  2BZB A;  4ERR A;  5LP6 E;  4JV5 T;  2MAW A;  5AQQ B;  5AQP B;  3K8P C;  5FXZ A;  3Q5E A;  3C98 B;  4ZI2 D;  2CXF A;  5CGM A;  2VKO A;  4H63 H;  1FMV A;  3AA0 B;  3BQK A;  1HTJ F;  2K9A A;  2F4V T;  5HEU A;  3QB5 K;  2CHN A;  4PJJ A;  3T1H T;  3SS1 A;  1XWM A;  4YSX A;  5EK4 A;  5JDQ A;  4QXC B;  3GN5 B;  2LM2 A;  3KDS E;  1VCT A;  2FUP A;  4JLE A;  2BG9 A;  1HFA A;  3RH3 A;  3E08 A;  1OED E;  2D0T A;  5DQW A;  2YN6 A;  4KHZ F;  3VKG A;  2V6X A;  3PU3 A;  4CI3 B;  2E9X B;  2BBJ A;  3PTR B;  4TN7 B;  5HXH A;  2VUR A;  2LEH A;  4IE0 A;  2WB5 A;  3OJA A;  4AKL A;  1NAF A;  4DMW A;  2CWY A;  3ZT5 A;  1KEY A;  3QUJ A;  3EDU A;  4V1A v;  3DP7 A;  2WMO A;  5HEG A;  4P0A A;  3B5M A;  5AQL B;  4ZI3 D;  3GWH A;  2NW9 A;  3RC3 A;  1NWM X;  4MLK A;  1N33 T;  1WYC A;  4PW8 A;  3HR0 A;  4XBF B;  1LKX A;  4X64 T;  3EDV A;  4GYS A;  2WP9 A;  1VOM A;  2BVM A;  2XM1 A;  2MBG A;  4FI5 A;  4UEL A;  1ZKE A;  5ABF A;  2WSS V;  2JQH A;  2OV9 A;  1UX4 A;  4OX9 T;  4PFP A;  1FEW A;  1X9B A;  3RYI E;  2DWG A;  1D1B A;  2NWB A;  3R84 B;  3HKE E;  1U4Q A;  2VL8 A;  4KHP T;  1CUN A;  1XZY A;  4TWD A;  1QUU A;  2MTQ A;  4ZS3 A;  3CQX C;  5JTG A;  4J2C A;  5F3J A;  4Q25 A;  2W2U A;  3L3P A;  3RYC E;  5ABE A;  4HEA A;  4K0U A;  1HF8 A;  4JI0 T;  2HHH T;  4A5X A;  3NRY A;  4FJO A;  1N36 T;  1YQ4 A;  4E7S A;  2N9D A;  2CM0 A;  1LVK A;  2FJD A;  4O4J E;  4UV8 B;  4ZS2 A;  5ABG A; 
#chains in the Genus database with same CATH homology
 3C64 A;  2YU2 A;  2C5J A;  4AKR B;  1S35 A;  2CA5 A;  2ODU A;  1MNE A;  2ODV A;  3IEE A;  5H6Q B;  1T98 A;  4I50 E;  5FMN A;  1HG5 A;  4CI1 B;  2ACX A;  2LSJ A;  5CA1 E;  5LGT B;  3AAA B;  4AKG A;  1MMA A;  3L09 A;  2L9Q A;  4PJN A;  3KFW X;  2WAU A;  4UEM A;  2ZM2 A;  5LBQ B;  3Q9D A;  5KDM C;  5JR9 A;  1VRB A;  3F57 A;  3HA4 A;  3HI2 A;  3N9M A;  3AB3 B;  3O1J A;  4AKI A;  5CA0 E;  4TX5 A;  4EB6 E;  1MIV A;  3C4X A;  3CQG B;  4KMC A;  3CQC B;  3ZMV B;  4DBQ A;  5LCY A;  4HE8 A;  1HG2 A;  5JQG E;  4ZI2 C;  3ZC0 A;  1E1H B;  3CX7 B;  3U3I A;  3E0Z A;  3N2O A;  3KV4 A;  4QWN B;  1SA0 E;  2KXP B;  2EHO B;  1LRZ A;  3B13 A;  4CXY A;  3O4X E;  2WM9 A;  3T8O A;  4C91 A;  1HS7 A;  4O2B E;  3PUA A;  1Y64 B;  2XAG B;  2K5B B;  4EOZ B;  4L5G A;  2LHN A;  4HKA A;  5FP3 A;  2Y48 B;  4JUY A;  1G73 A;  4G63 A;  4CQI A;  2ES0 A;  3F31 A;  4PAG A;  5LYJ E;  3K3Q C;  4EZH A;  1D0Z A;  3PUR A;  3O9X A;  2L3L A;  4C90 A;  1FIO A;  2DWK A;  3RRC A;  3GN5 A;  2KZ7 B;  4XZC A;  3Q2M A;  5FXV A;  2X51 A;  5JRC B;  1O3X A;  2WMN A;  4UIG A;  3I0O A;  3BK9 A;  3RX6 A;  4IE7 A;  3OYX A;  4I55 E;  5FXW A;  3ZPO A;  3ZMT B;  5ETW A;  4EIW A;  2XHE B;  2I59 A;  3U78 A;  2X9W A;  3NRX A;  1D1A A;  2NTX A;  2X9X A;  3C50 A;  1SHZ C;  4QHO A;  3RPU A;  3ZYM A;  5HWX A;  1YW0 A;  3BQI A;  3OBV E;  1WYB A;  2EHO C;  2W0G A;  4IE4 A;  2V7L A;  3UUM A;  2DCF A;  4OYK A;  4GK5 E;  2X9Y A;  3I9W A;  5JDN A;  2PJQ A;  4AXP A;  5LHH B;  5LOV E;  3DTO A;  4OK0 A;  2VWA A;  4Z8X A;  4CXX A;  1BR1 A;  4KBM B;  1D0X A;  4I43 B;  5JDL A;  3LFM A;  5LBM A;  3N9L A;  5F8P A;  4GOU A;  3J7Y q;  3LJC A;  5L2L A;  3P7I A;  4ZI7 E;  3KVA A;  5HXS A;  3MKD A;  3KBU A;  2V7M A;  3EUH A;  5HAX A;  4NUU A;  2G0U A;  2XAJ B;  2LSK A;  3W15 B;  2YEV C;  3PUQ A;  3LBX A;  3MA9 A;  2K48 A;  2W61 A;  3HL6 A;  5FY7 A;  4UVC B;  2B1E A;  5HXE A;  1KNZ A;  2XTL A;  2Y6X A;  4HN9 A;  3VKH A;  3VU7 H;  4ZHQ E;  5JH7 E;  2LSI A;  2KWI B;  3K3N A;  3SOL A;  3PDY A;  3ZCI A;  3KVB A;  3B57 A;  5AFU L;  2A3D A;  2PFV A;  3NZQ A;  1OXZ A;  1WRD A;  3N9N A;  3OKQ A;  1D1C A;  1UX5 A;  2GK9 A;  2KLQ A;  2X67 A;  1WR6 A;  3IBP A;  4XAX B;  3ZC1 A;  5BMV E;  4GYR A;  3IHR A;  3N9P A;  4I4T E;  3RYH E;  5IYZ E;  5LA6 E;  2X9H A;  4A56 A;  4ZI3 C;  1ZHC A;  2HH7 A;  2JMH A;  4ISS A;  5LHI B;  3N9O A;  5JVD E;  2V1D B;  4GK0 E;  5L3C B;  1MND A;  2Q9Q A;  5L3D B;  4X20 E;  2D5U A;  2JQQ A;  4QXB B;  3ZN0 B;  3UUL A;  3I1A A;  4EZ4 A;  4N78 D;  1Z0P A;  3FHN A;  2M67 A;  1KK7 A;  5LGN B;  2ZMA A;  2XQY A;  4YLH A;  4UF0 A;  2IW5 B;  4HGA A;  4MFR A;  3LG7 A;  4AI6 A;  4IIJ E;  1IJ5 A;  4H9S E;  3ZMZ B;  4L9I A;  2VKH A;  4WBN E;  2X66 A;  4ANJ A;  2CCQ A;  4O4H E;  5HWY A;  1OWA A;  4EAH A;  5KX5 E;  2XAQ B;  2CLY B;  2Q9Q D;  4G2A A;  2NOX A;  2LOP A;  3JC6 D;  4BAY B;  5M4Y A;  2MOZ A;  1MMD A;  2NP9 A;  2KND A;  3CVR A;  2XAS B;  3KV9 A;  1MMG A;  3MXZ A;  4TV9 E;  5HXC A;  3RYF E;  4AQF C;  1BR0 A;  3LK4 2;  3V5S A;  3N5L A;  4P0B A;  2JPF A;  4U74 A;  1ZV4 X;  4UXN B;  4EXT A;  5LHG B;  4H63 V;  1LVF A;  2C5K T;  2H3R A;  3PUS A;  4IST A;  5H6R B;  3RC8 A;  3UUX B;  3LK2 B;  3LBX B;  4CI2 B;  2CE7 A;  3UT5 E;  3CX6 B;  5KMG P;  4YHJ A;  2J1D G;  4O2A E;  4QXH B;  3R6N A;  2V7K A;  4DVD A;  2YIN A;  3F2E A;  2P9B A;  1U5P A;  2KWH A;  4HFV A;  4HTE A;  1IAP A;  4H9R C;  2E8I A;  2Z6E A;  5IHY A;  2CXL A;  4IGU A;  2CLY C;  2DNX A;  3S4U A;  1G8X A;  5HYA A;  5FY0 A;  3MAC A;  4F6R C;  2PG8 A;  1V9D A;  5DAB A;  4ASK A;  5FY1 A;  2A2F X;  3ZMS B;  3P8C D;  3E22 E;  5J1G A;  1YKH B;  1B7T A;  3CML A;  3HKC E;  4AQG A;  3AAI A;  3PUG A;  3CWZ B;  4DO0 A;  2N2N A;  2JRK A;  4BJM A;  2IAK A;  1QSD A;  4IHJ E;  2E9X A;  2LE8 A;  2ZM8 A;  3OYZ A;  4ILU A;  5EK3 A;  1WLX A;  2BZB A;  2KIN B;  4ERR A;  2LSG A;  2WWU A;  5LP6 E;  4B6X A;  4UF0 B;  5FXX A;  2XUE A;  1S94 A;  3FXE B;  3WAK A;  1UCU A;  5GON E;  5EZY E;  5JDG A;  3K8P C;  5C8Y E;  3KBT A;  5TAO A;  5FXZ A;  5JR9 B;  4AKH A;  4IE6 A;  3C98 B;  2NW8 A;  4PK4 A;  3QK6 A;  4ZI2 D;  2C5I T;  2CXF A;  2C0S A;  5JDM A;  2D2S A;  4M1P A;  2VKO A;  4H63 H;  1FMV A;  3AA0 B;  4DMV A;  3MK7 C;  2VKJ A;  3BQK A;  2YU1 A;  3ONX A;  5ADX L;  1HTJ F;  2E9X D;  2IC6 A;  3A5X A;  3JC6 C;  4O8S A;  2K9A A;  4NUV A;  4PNI A;  4WNK A;  3LK3 B;  3ZJ2 A;  2RP4 A;  2DI4 A;  4OHF A;  4TZ4 C;  1D0Y A;  3WI3 A;  5LJM A;  2VB6 A;  2LM9 A;  2W63 A;  4PJJ A;  2XAF B;  3SS1 A;  4KP3 C;  4X1K E;  4WW0 A;  5J2U E;  5L3G B;  3N9Q A;  2PBI A;  5JR9 C;  5EK4 A;  3O1I A;  4H9N C;  5JDQ A;  4QXC B;  3GN5 B;  3H3A A;  3Q5X A;  1BR4 A;  3PU8 A;  3C4Z A;  3ETV A;  4YFS A;  3KDS E;  3NZP A;  5FYM A;  2EHO D;  2V26 A;  4JLE A;  1MIW A;  4ADZ A;  5A1L A;  1HFA A;  4IDZ A;  3RH3 A;  4CZZ B;  3E08 A;  4H9O C;  3H37 A;  2HPJ A;  2WBL A;  2X68 A;  4PK5 A;  2K24 A;  3SWH A;  3MJX A;  2CEA A;  2D0T A;  5DQW A;  2H7V C;  2D0U A;  2Y8D A;  5CB4 E;  3VKG A;  4X1Y E;  1IJ6 A;  3PU3 A;  4PK6 A;  3HKB E;  3ZCJ A;  4CI3 B;  4H9Q C;  2E9X B;  3PTR B;  4TN7 B;  4PJM A;  5HXH A;  3UFE A;  2V7I A;  2HPL A;  4BJN A;  2LEH A;  2CXD A;  2BVL A;  2IC9 A;  3FB2 A;  4IE0 A;  3OJA A;  3MZK B;  3RKO A;  4MBQ A;  4CXW A;  5FNV E;  4AKL A;  2LSY A;  1NAF A;  4QX8 B;  2CWY A;  4DMW A;  2JMK A;  3V5U A;  2MYS A;  3ZN1 B;  5EK2 A;  1US7 B;  3AVS A;  2JJ9 A;  3PE0 A;  2CWO A;  3QUJ A;  4ZOL E;  5L3E B;  1ZEE A;  4OFZ A;  3EDU A;  4DND A;  4V1A v;  3M65 A;  2LT3 A;  3DP7 A;  2LHR A;  2WMO A;  2N1G A;  4P0A A;  4L0R A;  4ZI3 D;  3EVY A;  3KV5 A;  3UUN A;  1HX8 A;  2H7O A;  3GWH A;  4P09 A;  2NW9 A;  3RC3 A;  3I0Q A;  2BDE A;  4UV9 B;  1X79 A;  1NWM X;  3N2K E;  2E9X C;  4MLK A;  4YJ3 E;  1WYC A;  3ZLI A;  2V7J A;  4JEH B;  4PW8 A;  2CMR A;  3ANW A;  3HR0 A;  4TUY E;  4QX7 B;  4AQF A;  4XBF B;  4OYJ A;  4O4I E;  3UTK A;  2Q9Q B;  2QGS A;  1LKX A;  3ZEF B;  5J2T E;  4O4L E;  3EDV A;  2NTY A;  3CX8 B;  4H9P C;  5LG4 A;  2LJL A;  2OA5 A;  2X0L B;  4GYS A;  5L3F B;  2ZM0 A;  1VOM A;  1H7C A;  2BVM A;  2RA1 A;  4DBR A;  2MBG A;  2L8K A;  4FI5 A;  2VK9 A;  5HXR A;  3AA6 B;  3FBL A;  4YJ2 E;  4KUM B;  4UEL A;  4EYU A;  2DLR A;  1ZKE A;  2XAH B;  3C4W A;  3FBZ A;  3I9Y A;  5DJQ C;  5LXT E;  2UXN B;  2WSS V;  4EYY R;  1YKE B;  3HKD E;  4MHC A;  1HCI A;  2VKD A;  3VHL A;  1UX4 A;  3GA8 A;  4E7Z A;  5LNK A;  3ESL A;  5JRE A;  3K3O A;  3D0T A;  5JDH A;  5E0O A;  3DJB A;  4PFP A;  5JDF A;  4PJL A;  1FEW A;  3ZJ1 A;  2VAS A;  3KV6 A;  4BA9 A;  1MMN A;  3AAE B;  3RYI E;  2DWG A;  1D1B A;  3AVR A;  3CKD A;  2KMF A;  3FXD B;  3Q5W A;  2NWB A;  3N2G E;  5DQV A;  3R84 B;  4MAL A;  3C51 A;  3HKE E;  3GMI A;  4IE5 A;  3ZMU B;  2Q9Q C;  1U4Q A;  3ZYL A;  3NBX X;  2EHO A;  2W62 A;  5LGU B;  2VL8 A;  1MIY A;  1CUN A;  2LOS A;  3KIN B;  4UVA B;  3AA7 B;  1QUU A;  2SPC A;  2UXX B;  2MTQ A;  4ZS3 A;  1AJ3 A;  4WBO A;  3CQX C;  4TV8 E;  3QC9 A;  4J2C A;  5F3J A;  4JEU B;  4U72 A;  3J9X 1;  1YD8 G;  1EZ3 A;  3L3P A;  3RYC E;  1BR2 A;  4PFO A;  2A72 A;  2W00 A;  4HEA A;  1HF8 A;  4K0U A;  2NW7 A;  5JRC A;  3ZYK A;  3BQL A;  2KT9 A;  3AA1 B;  3WAJ A;  1IZN B;  3NRY A;  4FJO A;  3TKL B;  2QA7 A;  3SRZ A;  3RRW A;  5LJN A;  2DHR A;  4E7S A;  4X1I E;  3O1H A;  1FMW A;  4UVB B;  3IF8 B;  2N9D A;  2CM0 A;  5L3B B;  1LVK A;  4GIW A;  4O4J E;  4QKN A;  4UV8 B;  4ZS2 A;  2YK0 A;  3ANW B;  3ETU A;  3CPZ A;  2ZLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...