2A3DA

Solution structure of a de novo designed single chain three-helix bundle (a3d)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
MGSWAEFKQRLAAIKTRLQALGGSEAELAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDELQAYRHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of a de novo designed three-helix bundle protein.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Three-helix bundle
molecule keywords PROTEIN (DE NOVO THREE-HELIX BUNDLE)
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a3dA00
2A3DA 2MTQA
chains in the Genus database with same CATH superfamily
4GKKT 2VASA 4PW8A 2XAFB 4X64T 4AKIA 4DUYT 1WLXA 3N9QA 4KMCA 2K24A 2K5BB 3SFEA 1MMGA 3C51A 5HEHA 1KFYA 2K3WA 2NTYA 2WMNA 2XAHB 3KVAA 4CN4A 4HWHA 3H3MA 4TV9E 3RIAA 3PU3A 2H89A 5FVLA 3TKLB 3I9WA 2JRKA 5C2TA 4UIGA 5F3JA 3O4XE 3B13A 2V6YB 1BR0A 2ZM0A 3AVSA 2WCAA 3MK7C 2VVNA 1Z0PA 2E9XB 5LG4A 4DV3T 4DR5T 4LF8T 2CBIA 3JAFA 5FP3A 3UU5A 1KNRA 1JNRA 3IHRA 2NTXA 3X1DA 1OEDA 1UCUA 2CXFA 1V9DA 5HWYA 4F8HA 3HKEE 2LOPA 2FUPA 2EHOA 3CX7B 4GK0E 2Y48B 4IDOA 4FI5A 2CXDA 2QA7A 4TX5A 4ZOLE 2OLTA 3F31A 2CM0A 4Q25A 3N9LA 4U3CA 1N33T 3DJBA 3LBXA 2WM9A 3H3AA 4DVDA 2YDQA 4CXXA 1D1BA 3IEEA 3AE1A 4DMVA 5AQOB 5TAOA 3BQIA 3ETUA 2JQHA 5FMNA 3AEEA 2UUCT 2XASB 2XM1A 4XBFB 2FBWA 1MIYA 1T98A 3CPZA 3JAEA 4I4TE 1W0AA 2DLRA 2V5DA 3AE5A 3UT5E 5HYAA 2YKSA 4JI7T 5JDHA 2IC6A 5ADXL 4O8SA 2Q9QC 1O3XA 5HXEA 3J7Yq 2UUBT 4TNWA 5AQRB 5AFUL 2C0SA 2BKPA 3KV5A 1LRZA 4EOZB 3L39A 1WFDA 4H63H 3UU4A 3GN5A 4ZS2A 3JC6C 5AQUB 2F4VT 4G63A 1M7KA 3EUHA 4EAHA 3RHWA 3P50A 1I6ZA 3N2OA 3PUGA 3ZYMA 1W0BA 5DABA 4PJJA 4YT0A 4WZXA 4AXPA 2BBHA 2Y8DA 4ADZA 4DIDB 1E1HB 2XQ9A 5LBMA 5FVKA 2AXDS 2KLQA 5AQPB 4HWCA 4Z90A 2KWHA 5JR9B 1D0XA 2BVMA 5DJQC 4PK5A 2WDRA 2BG9B 4OX9T 4DUZT 4F6RC 4UF0B 2KXPB 4GK5E 4PK6A 4EIWA 5ABFA 5J2UE 1YQ3A 4A56A 4O4HE 5EZYE 2PTFA 2IAKA 2UXNB 2VL8A 3B57A 4IE4A 1WYBA 5GONE 2LE8A 4IT4A 3ZMVB 4QXBB 3RLFF 2I0MA 1VOMA 4YFSA 3K3QC 4X20E 3RYCE 4LF6T 3G06A 3I0QA 3RQWA 5JDLA 1YD8G 4P09A 4DR3T 4DR2T 3NRYA 2XQ8A 5JREA 1R8IA 2E9XD 3QNUA 4DR1T 2YDSA 3ZJ2A 4XZCA 4O4IE 2R6GF 3C64A 1D1AA 1QLBA 5LMNT 2FJBA 2CE7A 3O9XA 3QB5A 2DHRA 1MIWA 2XSBA 4N78D 5AQSB 2IW5B 4U2YA 3ZMZB 2NWBA 2X68A 2VB6A 2DL1A 4ILBA 4M1PA 4JV5T 2WWUA 4BAYB 3DTOA 4ASKA 4LF7T 4AI6A 3Q5DA 1ZEEA 5L3GB 2CLYC 1E2AA 2CMRA 4X1YE 5HAXA 5JH7E 4DV2T 1EZ3A 2X51A 4Z91A 4JEHB 4ZS3A 2JMKA 2BS2A 2WZHA 5FY0A 1HF8A 1WR0A 3AA7B 2DNXA 3PJAA 4XAXB 3UFEA 5L3EB 5IWAT 3CKDA 5J0ZA 4U7IA 2CA5A 4EZHA 3UQ7A 4H9QC 4IE6A 1XZYA 5HEJA 4YXDA 3AXJB 5KDMC 3EI0A 3LSVA 4IE0A 3SFDA 2YU1A 3ZT7A 1OEDC 1S35A 4WNKA 2IIUA 3TLSA 5JDQA 2LHRA 2BBJA 3D0TA 5J2TE 4AKHA 3VKHA 4HTEA 3RYIE 2LKHA 4JI4T 1JNZA 1WR6A 3N2KE 3GMIA 1CHUA 2B76A 3OVUA 4HKAA 3VR8A 3PJAJ 4QH4A 3SS1A 1UURA 4A5XA 2RP4A 4HGAA 4C90A 5JQGE 5ABHA 3QK6A 4H9NC 2D0UA 3OBVE 4QX7B 1KEYA 5AQLB 3FHNA 3TLTA 4JI6T 4LF4T 3VU7H 2Q9QB 5JDGA 1US7B 3UU3A 5L3DB 2BZBA 2YK0A 4MHCA 4LFBT 2UUAT 5AQQB 5JR9A 3ZN0B 3I0OA 3LK42 2YEVC 5HWXA 4LF5T 3KVBA 4QKNA 5JDNA 3TLVA 2W63A 3RRWA 1H7CA 2JJ9A 2CBJA 2XQ7A 3UU6A 2ES0A 2ZLYA 3CIRA 3O1IA 4NUUA 1HG5A 4WYVA 4LF9T 5CB4E 4X1IE 1BR2A 1ZV4X 3N9OA 4EEDA 2FJEA 5JDFA 4EV6A 1D1CA 5DQVA 5BMVE 2V6XA 5LHHB 1HX1B 4IL4A 5JR9C 1I94T 4JI0T 1LVKA 3ZSSA 2CWYA 3AEFA 4L0RA 4BA9A 3HKCE 3ZCIA 2OA5A 2CEAA 4MALA 3N9MA 2BDEA 5H6QB 3RC8A 5HEUA 3PURA 3J9X1 3SWHA 3M3ZB 3CX6B 5L3CB 2I59A 4QH5A 2D2SA 2XPKA 2BKOA 4PJLA 1KF6A 3MXZA 2MBGA 2E9XA 3C98B 3ZC1A 5CGMA 3P7IA 2XZEA 2QRXA 1HG2A 1XDOA 2CLYB 4I43B 4G2AA 2JQKA 4K0UA 2IUBA 5HEGA 2J47A 3PUVF 2W67A 4B3MT 1HX8A 5FYMA 4PFPA 4YHHT 2WZIA 3ZYKA 2IC9A 3RF1A 5LHIB 2QVAA 1OXZA 2XY8B 3PE0A 5IUXA 3KBUA 2N2NA 4X5TA 3ZT6A 3RRCA 4TZ4C 2V6YA 2HHHT 2WU5A 3CX8B 1IBKT 3R84B 2K48A 2VK9A 4HN9A 4NIQA 4DV6T 3U78A 3L3PA 4ISSA 2W62A 2ZM6T 2ODVA 4X1KE 4KHZF 3RIUA 1YKHB 1KNPA 2H7OA 4HFVA 1Y64B 3AB3B 1X79A 3L8RA 1B7TA 4J2CA 1VCTA 3FXEB 3PUXF 4V1Av 2VKHA 3AE7A 3N9PA 3W15B 2PJQA 3LFMA 2VWAA 3NKZA 2XQYA 1SUMB 4HWDA 3KBTA 3RH3A 2VKOA 4QX8B 3R6NA 4O4JE 3LK3B 3Q5WA 3UUNA 1QSDA 1D0ZA 2L8KA 2ZM2A 5HCMA 3ANWB 5KX5E 2NOXA 3BK9A 3ZMUB 3PUAA 1NWMX 4GKJT 4JEUB 2CXLA 5L47A 5H6RB 1M62A 3IA3A 3RI5A 4AIUA 2W0GA 3JCFA 3MJXA 5M4YA 2W2UA 2P9BA 2JQ9A 2Q9QA 2E8IA 2LSKA 2CWOA 5AQMB 2V7MA 2NR4A 2KNDA 3A5XA 3C4ZA 3ZSTA 1FJGT 4HFDA 1YKEB 2WDQA 2XM2A 3VHLA 3FZKB 3HI2A 3GWHA 5LBQB 2XUEA 4TN7B 4KUMB 1N34T 1FMVA 4L5GA 1BR4A 1T8BA 1Z8UA 3AVRA 5ABGA 3P8CD 4U2ZA 1SHZC 5C3JA 1FMWA 2UXXB 4IIJE 3I1AA 2V7JA 3LG7A 3P4WA 2VQFT 3AEGA 4DO0A 3ONJA 4JUYA 4BJNA 2WP9A 1MIVA 5F8PA 4HFHA 3EDUA 2M67A 3E08A 4WBOA 1XDPA 3CVRA 2WSSV 1L0VA 4AQGA 3C50A 2V7LA 4ZHQE 2WU2A 3VRAA 2HPLA 4FJOA 2WWVA 4U74A 2EHOD 3EAMA 4O2AE 4P0BA 5AQGB 1UX5A 5LGTB 5LYJE 2C5KT 5L4EA 4YTNA 2H88A 2ODUA 3ZPOA 4ZZCA 1HR0T 1ZKEA 2M6IA 2CHNA 2M6BA 2LRLA 4HFBA 5LMUT 2MTQA 4UVBB 4YY3T 3P4PA 1NEKA 2NW7A 4U33A 4CI2B 3MACA 1XWMA 2K9AA 2HN1A 2X9XA 5LJNA 4ZZBA 4X66T 3IBPA 2X0YA 2D9DA 5JTGA 2SPCA 3AA6B 3RKOA 4JI1T 3O1HA 2WAUA 2KWIB 3UUBA 2LOSA 3T1HT 4EYUA 4PK4A 3LDQB 4E7ZA 4AQFA 2HH7A 3ZN1B 4ANJA 3PUYF 2E5LT 4DR6T 2A72A 1YQ4A 1HNXT 3AECA 3VRBA 4KP3C 2J1DG 2VKJA 1IZNB 2WB5A 2ZMAA 2V7IA 1G8XA 2WQYA 3AXJA 4NUVA 3PUQA 5FXZA 3WI3A 4AISA 4YSZA 4ZEYA 3EHZA 4Z8XA 4B6XA 5LGUB 3ESLA 4KX6A 4YTMA 1U4QA 2D5UA 2VKDA 3Q5EA 3ZMTB 5ABEA 4CI1B 2YINA 4TV8E 3QB5K 1W9RA 1ZP0A 2KMFA 2KT9A 2QYWA 2N1GA 3UULA 2W4XA 4OFZA 2DWGA 2LSGA 3ONXA 2I6HA 4JYAT 3F57A 1HCIA 1AJ3A 3T1YT 3HL6A 5ETWA 3RYFE 5FL1A 1MNEA 5LG3A 3Q2MA 4I0UA 3AE8A 2B1EA 2XQ3A 3C4XA 3RX6A 1QUUA 5HXSA 2IMLA 2V8SV 4IE5A 1N32T 2L3LA 4ZI2C 2X67A 3M65A 3PUWF 5J1GA 4COFA 2RPAA 5LNKA 4OK0A 3H37A 3GN5B 3CQCB 4DNDA 3CMLA 2UXCT 4H9RC 3AE4A 1HFAA 5LA6E 2LM9A 2W66A 3PDYA 3MA9A 5JVDE 3MKDA 4UXNB 3C4WA 3AE9A 2V26A 4YHJA 3ZCJA 3KFWX 4LMLA 3L09A 4WBNE 3N5LA 1LVFA 3A7MA 1UUSA 3CWZB 4L9IA 5AQVB 3UUXB 4H9PC 3JADA 2FJDA 2LRKA 3AE6A 5IYZE 4ILAA 4DV7T 4A98A 4DR7T 3FBLA 2XQ6A 1DU2A 1VCSA 3KINB 2NP9A 1FEWA 5LHGB 4JI8T 2W00A 2XAGB 2XSAA 3AA0B 3DP7A 2X9WA 3LBXB 5LXTE 3KDSE 3GA8A 2NW9A 5AQFB 4QXCB 2RA1A 4QH1A 4GYRA 4PJNA 2GK9A 2X66A 3F2EA 5FXWA 1WYCA 3UTKA 4CZZB 4B3RT 4TUYE 3BQKA 4IDNA 4PAGA 4UV9B 2UXDT 4GYSA 2W61A 3UUMA 2DI4A 3QUJA 1SA0E 3RKGA 5FXXA 3BQLA 3UQ4A 3ZC0A 4PNIA 3AE2A 1SE7A 2Y6XA 3RYHE 3UU8A 3VKGA 4EB6E 1IBMT 5EK2A 3OYZA 2VVSA 3LK2B 1CUNA 4OHFA 3N9NA 5FY1A 4YJ2E 1XMOT 2MAWA 2YDRA 3EABA 2D0TA 5E0OA 4NXNT 3EDVA 3KV4A 1J5WA 3P4QA 4ZXLA 3S4UA 3QOFA 5BR8T 2XQAA 1OEDB 3AEDA 4YSXA 4HFCA 4EGWA 4JI3T 5EK3A 2EHOB 2LT3A 4HFIA 4MFRA 5FY7A 1KK7A 1G73A 2WBLA 5C8YE 2JPFA 2LLYA 4H9OC 4OYKA 2DWKA 3OKQA 4IDQA 2CHOA 2JQQA 4EYYR 3NRXA 4CN1A 5LGNB 3HKDE 4K0KT 2BG9A 1W09A 2A2FX 3WAKA 4KHPT 4CQIA 3RIFA 3AE3A 3AAEB 5ABFB 4YSYA 5L3BB 2XQ5A 4UF0A 3FZHB 4IDPA 3CK6A 4AQFC 5AQIB 1HTJF 5FL0A 2UU9T 4NXMT 4YLHA 1S94A 2KSRA 3RQUA 4UR9A 5LJMA 2L9QA 3VR9A 2A3DA 4O2BE 1IAPA 2BG9E 2YOEA 3ZEFB 4HFEA 2WDVA 4CI3B 4ILCA 4CN6A 2BVLA 3ZYLA 4X62T 4I50E 4KBMB 4O4LE 1KNZA 1HS7A 2IHR1 2VL0A 3Q9DA 3WAJA 4IDZA 2C5JA 5HCJA 1X9BA 3AAAB 2V1DB 1NENA 1UGOA 3IF8B 3OJAA 3OYXA 3QC9A 2LJLA 3ONLC 1YXRA 1Y01A 4I55E 4LMJA 1UK5A 2ACXA 4AKGA 4H63V 1NAFA 4EXTA 1T7SA 4DR4T 2LSIA 2JMHA 5AQKB 1WCRA 3Q5XA 4QXHB 3NZPA 2WS3A 5CA1E 1HNWT 5CA0E 2DCFA 5HEOA 2E2AA 5F5WA 4DBRA 2ZM8A 2FJAA 4DV4T 5FKYA 4HE8A 5HXRA 1FIOA 3AA1B 2LSJA 3KV9A 2MPKA 4YTPA 4IL9A 3OTOT 3V5UA 4X65T 1J5ET 1ZHCA 2JIWA 2NW8A 2OV9A 2YU2A 1YW0A 3FZMB 4TNVA 3OPCA 4JLEA 4WW0A 4YJ3E 3RGLA 3RIUC 3PUSA 3O1JA 2BS3A 4ISTA 4TWFA 1BR1A 3TLWA 1T72A 4JI5T 4JBWF 3SOLA 5KMGP 3P4RA 1U5PA 2XQ4A 5AQTB 5FNVE 4HWFA 4P1NA 4AKLA 1HNZT 4B3TT 4LFAT 5JRCA 3SRZA 1MMAA 2HPJA 4ZI7E 3E0ZA 1OEDE 2CCQA 2X0LB 4KI0F 1MMNA 3UFGA 3A8YC 4NPPA 2MYSA 2WMOA 4TWHA 2CRBA 3ABVA 4UEMA 2LEHA 5LOVE 4ERRA 2BS4A 2EHOC 4PJMA 3K1SA 4GOUA 2A9UA 3AEAA 1D0YA 3U3IA 4CXWA 3HR0A 4U31A 2LSYA 1ZOYA 3EVYA 4HEAA 2VURA 4U7YA 3JC6D 3ZT5A 3CQGB 2PG8A 3N2GE 3P4SA 5IHYA 5EK4A 2AE9A 3I9YA 3NVOA 4IE7A 4IGUA 2H3RA 2J4GA 3ETVA 4TWDA 4E7SA 3V5SA 3ZJ1A 5L4HA 4BJMA 2LKGA 1XNQT 2KINB 1IJ6A 3TLUA 5CJ5A 3FZLB 2X0HA 4ZI3D 4C91A 1GQEA 1MNDA 4UV8B 4B3ST 3FXDB 4GIWA 2XTLA 4DV0T 3MZKB 2IDOB 3RPUA 4MLKA 4DMWA 5L2LA 2V7KA 4UELA 4AQYT 4LMKA 2E5VA 4PFOA 1MMDA 2BKNA 3NBXX 4H9SE 4QHOA 2PBIA 2XHEB 3ANWA 2ACZA 3K8PC 4EEBA 2LM2A 2E9XC 4DV1T 2XAQB 4IHJE 3RC3A 2X9YA 4EZ4A 5CFBA 5HXHA 3PUZF 4DBQA 4CXYA 1XNRT 5AQJB 2MOZA 2Q9QD 2BG9C 2X9HA 3NWIA 4MBQA 2H7VC 2WY2A 4DV5T 2N9DA 3KV6A 1WRDA 1IBLT 4LFCT 4IREA 4P0AA 2PFVA 2YN6A 4ZI3C 3ZMSB 2CPTA 5HXCA 1E7PA 3HKBE 3FBZA 5L3FB 3K3NA 4JI2T 4UVAB 2V5CA 3PTRB 4ILUA 3ZLIA 1XMQT 3HA4A 2J62A 5LCYA 2G0UA 4QWNB 4ZI2D 1N36T 5AQNB 2LHNA 3AEBA 2XAJB 5AQHB 1J1JA 5FXVA 3T8OA 5JRCB 3AAIA 2HN2A 2QGSA 5KXJA 4AKRB 1UX4A 3E22E 1LKXA 3FB2A 5DQWA 3B5MA 3K3OA 2UXBT 3LJCA 5LB7B 2C5IT 4UVCB 3PV0F 2KZ7B 3CQXC 3ZKRA 5LP6E 2VQET 4OYJA 5A1LA 4A97A 4U72A 3NZQA 4HWIB 3PU8A 1VRBA 1IJ5A 5JDMA 2XJ7A 1OWAA 3FZFB 2Z6EA
chains in the Genus database with same CATH topology
2VASA 4PW8A 2XAFB 4AKIA 1WLXA 3N9QA 4KMCA 2K24A 2K5BB 1MMGA 3C51A 4E7SA 2WMNA 2NTYA 2XAHB 3KVAA 4TV9E 3PU3A 5F3JA 3TKLB 3I9WA 2JRKA 4UIGA 3O4XE 3B13A 1BR0A 2ZM0A 3AVSA 3MK7C 1Z0PA 2E9XB 5LG4A 5FP3A 3IHRA 2NTXA 1UCUA 2CXFA 1V9DA 5HWYA 3HKEE 2LOPA 3CX7B 2EHOA 4GK0E 4TX5A 2Y48B 4FI5A 2CXDA 2QA7A 4ZOLE 3F31A 2CM0A 3N9LA 3DJBA 3LBXA 2WM9A 3H3AA 4DVDA 4CXXA 1D1BA 3IEEA 4DMVA 5TAOA 3BQIA 3ETUA 5FMNA 4XBFB 2XASB 1MIYA 1T98A 3CPZA 4I4TE 2DLRA 3UT5E 5HYAA 5JDHA 2IC6A 5ADXL 4O8SA 2Q9QC 1O3XA 5HXEA 3J7Yq 5AFUL 2C0SA 3KV5A 1LRZA 4EOZB 4H63H 3GN5A 4ZS2A 3JC6C 4G63A 3EUHA 4EAHA 3N2OA 3PUGA 3ZYMA 5DABA 4PJJA 4AXPA 2Y8DA 4ADZA 5JRCA 1E1HB 5LBMA 2KLQA 2KWHA 5JR9B 1D0XA 2BVMA 5DJQC 4PK5A 4F6RC 4UF0B 2KXPB 4GK5E 4PK6A 4EIWA 5J2UE 4A56A 4O4HE 5EZYE 3B57A 2IAKA 2UXNB 2VL8A 4IE4A 1WYBA 5GONE 2LE8A 3ZMVB 4QXBB 1VOMA 4YFSA 3K3QC 4X20E 3RYCE 3I0QA 5JDLA 1YD8G 4P09A 3NRYA 5JREA 2E9XD 3ZJ2A 4XZCA 4O4IE 3C64A 1D1AA 2CE7A 3O9XA 2DHRA 1MIWA 4N78D 2IW5B 3ZMZB 2NWBA 2X68A 2VB6A 4M1PA 2WWUA 4BAYB 3DTOA 4ASKA 4AI6A 5L3GB 1ZEEA 2CLYC 2CMRA 4X1YE 5HAXA 5JH7E 1EZ3A 2X51A 4ZS3A 4JEHB 5FY0A 2JMKA 1HF8A 3AA7B 2DNXA 5L3EB 4XAXB 3UFEA 3CKDA 2CA5A 4EZHA 4H9QC 4IE6A 5KDMC 4IE0A 2YU1A 1S35A 4WNKA 5JDQA 2LHRA 3D0TA 4AKHA 3VKHA 4HTEA 3RYIE 1WR6A 3N2KE 3GMIA 4HKAA 4C90A 3SS1A 2RP4A 4HGAA 5JQGE 3QK6A 4H9NC 2D0UA 3OBVE 4QX7B 3FHNA 3VU7H 2Q9QB 5JDGA 1US7B 5L3DB 2BZBA 2YK0A 4MHCA 5JR9A 3ZN0B 3I0OA 3LK42 2YEVC 5HWXA 3KVBA 4QKNA 5JDNA 2W63A 3RRWA 1H7CA 2JJ9A 2ES0A 2ZLYA 3O1IA 4NUUA 1HG5A 5CB4E 4X1IE 1BR2A 1ZV4X 3N9OA 5BMVE 5LHHB 5JDFA 1D1CA 5DQVA 5JR9C 1LVKA 4BA9A 2CWYA 4L0RA 3HKCE 3ZCIA 2OA5A 2CEAA 4MALA 3N9MA 2BDEA 5H6QB 3RC8A 3PURA 3J9X1 3SWHA 3CX6B 5L3CB 2I59A 2D2SA 4PJLA 3MXZA 2MBGA 2E9XA 3C98B 3P7IA 1HG2A 4I43B 2CLYB 4G2AA 4K0UA 1HX8A 5FYMA 4PFPA 3ZYKA 2IC9A 5LHIB 1OXZA 3PE0A 3KBUA 2N2NA 3RRCA 4TZ4C 3CX8B 3R84B 2K48A 2VK9A 4HN9A 3U78A 3L3PA 4ISSA 2W62A 2ODVA 4X1KE 1YKHB 2H7OA 4HFVA 1Y64B 3AB3B 1X79A 4J2CA 1B7TA 4V1Av 3FXEB 3W15B 3ZC1A 5JDMA 2VKHA 3N9PA 2PJQA 3LFMA 2VWAA 2XQYA 3KBTA 3RH3A 2VKOA 4QX8B 3R6NA 4O4JE 3LK3B 3Q5WA 3UUNA 1QSDA 1D0ZA 2L8KA 2ZM2A 3ANWB 5KX5E 2NOXA 3BK9A 3ZMUB 3PUAA 1NWMX 4JEUB 2CXLA 5H6RB 2W0GA 3MJXA 5M4YA 2P9BA 2E8IA 2LSKA 2Q9QA 2CWOA 2V7MA 3A5XA 2KNDA 3C4ZA 1YKEB 3VHLA 3HI2A 3GWHA 5LBQB 2XUEA 4TN7B 4KUMB 1FMVA 4L5GA 1BR4A 3AVRA 3P8CD 1SHZC 1FMWA 2UXXB 4IIJE 3I1AA 2V7JA 3LG7A 4DO0A 4JUYA 4BJNA 1MIVA 5F8PA 3EDUA 2M67A 3E08A 4WBOA 3CVRA 2WSSV 4AQGA 3C50A 2V7LA 4ZHQE 2HPLA 4FJOA 4U74A 2EHOD 4O2AE 4P0BA 5LYJE 1UX5A 5LGTB 2C5KT 2ODUA 1ZKEA 2MTQA 4UVBB 2NW7A 4CI2B 3MACA 2K9AA 2X9XA 5LJNA 3IBPA 2SPCA 3AA6B 3RKOA 3O1HA 2WAUA 2KWIB 2LOSA 4EYUA 4PK4A 4E7ZA 4AQFA 2HH7A 3ZN1B 4ANJA 2A72A 4KP3C 2J1DG 2VKJA 1IZNB 2ZMAA 2V7IA 1G8XA 4NUVA 5FXZA 3PUQA 3WI3A 4Z8XA 4B6XA 5LGUB 3ESLA 1U4QA 2D5UA 2VKDA 3ZMTB 4CI1B 2YINA 4TV8E 2KMFA 2KT9A 2N1GA 3UULA 4OFZA 2DWGA 2LSGA 3ONXA 3F57A 1HCIA 1AJ3A 3HL6A 5ETWA 3RYFE 1MNEA 3Q2MA 3RX6A 2B1EA 3C4XA 1QUUA 5HXSA 4IE5A 2L3LA 4ZI2C 2X67A 3M65A 5J1GA 5LNKA 4OK0A 3H37A 3GN5B 3CQCB 4DNDA 3CMLA 4H9RC 1HFAA 5LA6E 2LM9A 3PDYA 3MA9A 5JVDE 3MKDA 4UXNB 3C4WA 4YHJA 2V26A 3ZCJA 3KFWX 3L09A 4WBNE 3N5LA 1LVFA 3CWZB 4L9IA 3UUXB 4H9PC 5IYZE 3FBLA 3KINB 2NP9A 1FEWA 5LHGB 2W00A 2XAGB 3AA0B 3DP7A 2X9WA 3LBXB 5LXTE 3KDSE 3GA8A 2NW9A 4QXCB 2RA1A 4CZZB 4GYRA 4PJNA 3F2EA 2GK9A 2X66A 5FXWA 1WYCA 3UTKA 4TUYE 3BQKA 4PAGA 4UV9B 4GYSA 2W61A 3UUMA 2DI4A 3QUJA 1SA0E 5FXXA 3BQLA 3ZC0A 4PNIA 2Y6XA 3RYHE 3VKGA 4EB6E 5EK2A 3OYZA 3LK2B 1CUNA 4OHFA 3N9NA 5FY1A 4YJ2E 2D0TA 5E0OA 3EDVA 3KV4A 3S4UA 5EK3A 2EHOB 2LT3A 4MFRA 5FY7A 1KK7A 1G73A 2WBLA 5C8YE 2JPFA 4H9OC 4OYKA 2DWKA 3OKQA 4EYYR 2JQQA 3NRXA 5LGNB 3HKDE 3WAKA 2A2FX 4CQIA 3AAEB 5L3BB 4UF0A 4AQFC 1HTJF 4YLHA 1S94A 5LJMA 2L9QA 2A3DA 4O2BE 1IAPA 3ZEFB 4CI3B 2BVLA 3ZYLA 4I50E 4KBMB 4O4LE 1KNZA 1HS7A 3Q9DA 3WAJA 4IDZA 2C5JA 3AAAB 2V1DB 3IF8B 3OJAA 3OYXA 3QC9A 2LJLA 4AKGA 4I55E 2ACXA 4H63V 1NAFA 4EXTA 2LSIA 2JMHA 3Q5XA 4QXHB 3NZPA 5CA1E 5CA0E 2DCFA 4DBRA 2ZM8A 4HE8A 5HXRA 1FIOA 3AA1B 2LSJA 3KV9A 3V5UA 1ZHCA 2NW8A 2YU2A 4YJ3E 1YW0A 4JLEA 4WW0A 5J2TE 3ZPOA 3PUSA 3O1JA 4ISTA 1BR1A 3SOLA 5KMGP 1U5PA 5FNVE 4AKLA 3SRZA 1MMAA 2HPJA 4ZI7E 3E0ZA 2CCQA 2X0LB 1MMNA 2MYSA 2WMOA 4ERRA 4UEMA 2LEHA 5LOVE 2EHOC 4PJMA 4GOUA 3U3IA 1D0YA 4CXWA 3HR0A 2LSYA 3EVYA 4HEAA 3JC6D 3CQGB 2PG8A 3N2GE 5IHYA 5EK4A 3I9YA 4IE7A 4IGUA 2H3RA 3ETVA 3V5SA 3ZJ1A 4BJMA 2KINB 1IJ6A 4ZI3D 4C91A 1MNDA 4UV8B 3FXDB 4GIWA 2XTLA 3MZKB 3RPUA 5L2LA 4MLKA 4DMWA 2V7KA 4UELA 4PFOA 1MMDA 3NBXX 4H9SE 4QHOA 2PBIA 2XHEB 3ANWA 3K8PC 2E9XC 2XAQB 4IHJE 3RC3A 2X9YA 4EZ4A 5HXHA 4DBQA 4CXYA 2MOZA 2Q9QD 2X9HA 4MBQA 2H7VC 2N9DA 3KV6A 1WRDA 4P0AA 2PFVA 4ZI3C 3ZMSB 5HXCA 3HKBE 3FBZA 5L3FB 3K3NA 4UVAB 3ZLIA 3PTRB 4ILUA 3HA4A 5LCYA 2G0UA 4QWNB 4ZI2D 2LHNA 2XAJB 5JRCB 5FXVA 3T8OA 3AAIA 2QGSA 4AKRB 1UX4A 3E22E 1LKXA 3FB2A 5DQWA 3K3OA 3LJCA 2C5IT 4UVCB 5LP6E 2KZ7B 3CQXC 4OYJA 5A1LA 4U72A 3NZQA 3PU8A 1VRBA 1IJ5A 1OWAA 2Z6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3D A;  2MTQ A; 
#chains in the Genus database with same CATH topology
 4GKK T;  2VAS A;  4PW8 A;  2XAF B;  4X64 T;  4AKI A;  4DUY T;  1WLX A;  3N9Q A;  4KMC A;  2K24 A;  2K5B B;  3SFE A;  1MMG A;  3C51 A;  5HEH A;  1KFY A;  2K3W A;  2NTY A;  2WMN A;  2XAH B;  3KVA A;  4CN4 A;  4HWH A;  3H3M A;  4TV9 E;  3RIA A;  3PU3 A;  2H89 A;  5FVL A;  3TKL B;  3I9W A;  2JRK A;  5C2T A;  4UIG A;  5F3J A;  3O4X E;  3B13 A;  2V6Y B;  1BR0 A;  2ZM0 A;  3AVS A;  2WCA A;  3MK7 C;  2VVN A;  1Z0P A;  2E9X B;  5LG4 A;  4DV3 T;  4DR5 T;  4LF8 T;  2CBI A;  3JAF A;  5FP3 A;  3UU5 A;  1KNR A;  1JNR A;  3IHR A;  2NTX A;  3X1D A;  1OED A;  1UCU A;  2CXF A;  1V9D A;  5HWY A;  4F8H A;  3HKE E;  2LOP A;  2FUP A;  2EHO A;  3CX7 B;  4GK0 E;  2Y48 B;  4IDO A;  4FI5 A;  2CXD A;  2QA7 A;  4TX5 A;  4ZOL E;  2OLT A;  3F31 A;  2CM0 A;  4Q25 A;  3N9L A;  4U3C A;  1N33 T;  3DJB A;  3LBX A;  2WM9 A;  3H3A A;  4DVD A;  2YDQ A;  4CXX A;  1D1B A;  3IEE A;  3AE1 A;  4DMV A;  5AQO B;  5TAO A;  3BQI A;  3ETU A;  2JQH A;  5FMN A;  3AEE A;  2UUC T;  2XAS B;  2XM1 A;  4XBF B;  2FBW A;  1MIY A;  1T98 A;  3CPZ A;  3JAE A;  4I4T E;  1W0A A;  2DLR A;  2V5D A;  3AE5 A;  3UT5 E;  5HYA A;  2YKS A;  4JI7 T;  5JDH A;  2IC6 A;  5ADX L;  4O8S A;  2Q9Q C;  1O3X A;  5HXE A;  3J7Y q;  2UUB T;  4TNW A;  5AQR B;  5AFU L;  2C0S A;  2BKP A;  3KV5 A;  1LRZ A;  4EOZ B;  3L39 A;  1WFD A;  4H63 H;  3UU4 A;  3GN5 A;  4ZS2 A;  3JC6 C;  5AQU B;  2F4V T;  4G63 A;  1M7K A;  3EUH A;  4EAH A;  3RHW A;  3P50 A;  1I6Z A;  3N2O A;  3PUG A;  3ZYM A;  1W0B A;  5DAB A;  4PJJ A;  4YT0 A;  4WZX A;  4AXP A;  2BBH A;  2Y8D A;  4ADZ A;  4DID B;  1E1H B;  2XQ9 A;  5LBM A;  5FVK A;  2AXD S;  2KLQ A;  5AQP B;  4HWC A;  4Z90 A;  2KWH A;  5JR9 B;  1D0X A;  2BVM A;  5DJQ C;  4PK5 A;  2WDR A;  2BG9 B;  4OX9 T;  4DUZ T;  4F6R C;  4UF0 B;  2KXP B;  4GK5 E;  4PK6 A;  4EIW A;  5ABF A;  5J2U E;  1YQ3 A;  4A56 A;  4O4H E;  5EZY E;  2PTF A;  2IAK A;  2UXN B;  2VL8 A;  3B57 A;  4IE4 A;  1WYB A;  5GON E;  2LE8 A;  4IT4 A;  3ZMV B;  4QXB B;  3RLF F;  2I0M A;  1VOM A;  4YFS A;  3K3Q C;  4X20 E;  3RYC E;  4LF6 T;  3G06 A;  3I0Q A;  3RQW A;  5JDL A;  1YD8 G;  4P09 A;  4DR3 T;  4DR2 T;  3NRY A;  2XQ8 A;  5JRE A;  1R8I A;  2E9X D;  3QNU A;  4DR1 T;  2YDS A;  3ZJ2 A;  4XZC A;  4O4I E;  2R6G F;  3C64 A;  1D1A A;  1QLB A;  5LMN T;  2FJB A;  2CE7 A;  3O9X A;  3QB5 A;  2DHR A;  1MIW A;  2XSB A;  4N78 D;  5AQS B;  2IW5 B;  4U2Y A;  3ZMZ B;  2NWB A;  2X68 A;  2VB6 A;  2DL1 A;  4ILB A;  4M1P A;  4JV5 T;  2WWU A;  4BAY B;  3DTO A;  4ASK A;  4LF7 T;  4AI6 A;  3Q5D A;  1ZEE A;  5L3G B;  2CLY C;  1E2A A;  2CMR A;  4X1Y E;  5HAX A;  5JH7 E;  4DV2 T;  1EZ3 A;  2X51 A;  4Z91 A;  4JEH B;  4ZS3 A;  2JMK A;  2BS2 A;  2WZH A;  5FY0 A;  1HF8 A;  1WR0 A;  3AA7 B;  2DNX A;  3PJA A;  4XAX B;  3UFE A;  5L3E B;  5IWA T;  3CKD A;  5J0Z A;  4U7I A;  2CA5 A;  4EZH A;  3UQ7 A;  4H9Q C;  4IE6 A;  1XZY A;  5HEJ A;  4YXD A;  3AXJ B;  5KDM C;  3EI0 A;  3LSV A;  4IE0 A;  3SFD A;  2YU1 A;  3ZT7 A;  1OED C;  1S35 A;  4WNK A;  2IIU A;  3TLS A;  5JDQ A;  2LHR A;  2BBJ A;  3D0T A;  5J2T E;  4AKH A;  3VKH A;  4HTE A;  3RYI E;  2LKH A;  4JI4 T;  1JNZ A;  1WR6 A;  3N2K E;  3GMI A;  1CHU A;  2B76 A;  3OVU A;  4HKA A;  3VR8 A;  3PJA J;  4QH4 A;  3SS1 A;  1UUR A;  4A5X A;  2RP4 A;  4HGA A;  4C90 A;  5JQG E;  5ABH A;  3QK6 A;  4H9N C;  2D0U A;  3OBV E;  4QX7 B;  1KEY A;  5AQL B;  3FHN A;  3TLT A;  4JI6 T;  4LF4 T;  3VU7 H;  2Q9Q B;  5JDG A;  1US7 B;  3UU3 A;  5L3D B;  2BZB A;  2YK0 A;  4MHC A;  4LFB T;  2UUA T;  5AQQ B;  5JR9 A;  3ZN0 B;  3I0O A;  3LK4 2;  2YEV C;  5HWX A;  4LF5 T;  3KVB A;  4QKN A;  5JDN A;  3TLV A;  2W63 A;  3RRW A;  1H7C A;  2JJ9 A;  2CBJ A;  2XQ7 A;  3UU6 A;  2ES0 A;  2ZLY A;  3CIR A;  3O1I A;  4NUU A;  1HG5 A;  4WYV A;  4LF9 T;  5CB4 E;  4X1I E;  1BR2 A;  1ZV4 X;  3N9O A;  4EED A;  2FJE A;  5JDF A;  4EV6 A;  1D1C A;  5DQV A;  5BMV E;  2V6X A;  5LHH B;  1HX1 B;  4IL4 A;  5JR9 C;  1I94 T;  4JI0 T;  1LVK A;  3ZSS A;  2CWY A;  3AEF A;  4L0R A;  4BA9 A;  3HKC E;  3ZCI A;  2OA5 A;  2CEA A;  4MAL A;  3N9M A;  2BDE A;  5H6Q B;  3RC8 A;  5HEU A;  3PUR A;  3J9X 1;  3SWH A;  3M3Z B;  3CX6 B;  5L3C B;  2I59 A;  4QH5 A;  2D2S A;  2XPK A;  2BKO A;  4PJL A;  1KF6 A;  3MXZ A;  2MBG A;  2E9X A;  3C98 B;  3ZC1 A;  5CGM A;  3P7I A;  2XZE A;  2QRX A;  1HG2 A;  1XDO A;  2CLY B;  4I43 B;  4G2A A;  2JQK A;  4K0U A;  2IUB A;  5HEG A;  2J47 A;  3PUV F;  2W67 A;  4B3M T;  1HX8 A;  5FYM A;  4PFP A;  4YHH T;  2WZI A;  3ZYK A;  2IC9 A;  3RF1 A;  5LHI B;  2QVA A;  1OXZ A;  2XY8 B;  3PE0 A;  5IUX A;  3KBU A;  2N2N A;  4X5T A;  3ZT6 A;  3RRC A;  4TZ4 C;  2V6Y A;  2HHH T;  2WU5 A;  3CX8 B;  1IBK T;  3R84 B;  2K48 A;  2VK9 A;  4HN9 A;  4NIQ A;  4DV6 T;  3U78 A;  3L3P A;  4ISS A;  2W62 A;  2ZM6 T;  2ODV A;  4X1K E;  4KHZ F;  3RIU A;  1YKH B;  1KNP A;  2H7O A;  4HFV A;  1Y64 B;  3AB3 B;  1X79 A;  3L8R A;  1B7T A;  4J2C A;  1VCT A;  3FXE B;  3PUX F;  4V1A v;  2VKH A;  3AE7 A;  3N9P A;  3W15 B;  2PJQ A;  3LFM A;  2VWA A;  3NKZ A;  2XQY A;  1SUM B;  4HWD A;  3KBT A;  3RH3 A;  2VKO A;  4QX8 B;  3R6N A;  4O4J E;  3LK3 B;  3Q5W A;  3UUN A;  1QSD A;  1D0Z A;  2L8K A;  2ZM2 A;  5HCM A;  3ANW B;  5KX5 E;  2NOX A;  3BK9 A;  3ZMU B;  3PUA A;  1NWM X;  4GKJ T;  4JEU B;  2CXL A;  5L47 A;  5H6R B;  1M62 A;  3IA3 A;  3RI5 A;  4AIU A;  2W0G A;  3JCF A;  3MJX A;  5M4Y A;  2W2U A;  2P9B A;  2JQ9 A;  2Q9Q A;  2E8I A;  2LSK A;  2CWO A;  5AQM B;  2V7M A;  2NR4 A;  2KND A;  3A5X A;  3C4Z A;  3ZST A;  1FJG T;  4HFD A;  1YKE B;  2WDQ A;  2XM2 A;  3VHL A;  3FZK B;  3HI2 A;  3GWH A;  5LBQ B;  2XUE A;  4TN7 B;  4KUM B;  1N34 T;  1FMV A;  4L5G A;  1BR4 A;  1T8B A;  1Z8U A;  3AVR A;  5ABG A;  3P8C D;  4U2Z A;  1SHZ C;  5C3J A;  1FMW A;  2UXX B;  4IIJ E;  3I1A A;  2V7J A;  3LG7 A;  3P4W A;  2VQF T;  3AEG A;  4DO0 A;  3ONJ A;  4JUY A;  4BJN A;  2WP9 A;  1MIV A;  5F8P A;  4HFH A;  3EDU A;  2M67 A;  3E08 A;  4WBO A;  1XDP A;  3CVR A;  2WSS V;  1L0V A;  4AQG A;  3C50 A;  2V7L A;  4ZHQ E;  2WU2 A;  3VRA A;  2HPL A;  4FJO A;  2WWV A;  4U74 A;  2EHO D;  3EAM A;  4O2A E;  4P0B A;  5AQG B;  1UX5 A;  5LGT B;  5LYJ E;  2C5K T;  5L4E A;  4YTN A;  2H88 A;  2ODU A;  3ZPO A;  4ZZC A;  1HR0 T;  1ZKE A;  2M6I A;  2CHN A;  2M6B A;  2LRL A;  4HFB A;  5LMU T;  2MTQ A;  4UVB B;  4YY3 T;  3P4P A;  1NEK A;  2NW7 A;  4U33 A;  4CI2 B;  3MAC A;  1XWM A;  2K9A A;  2HN1 A;  2X9X A;  5LJN A;  4ZZB A;  4X66 T;  3IBP A;  2X0Y A;  2D9D A;  5JTG A;  2SPC A;  3AA6 B;  3RKO A;  4JI1 T;  3O1H A;  2WAU A;  2KWI B;  3UUB A;  2LOS A;  3T1H T;  4EYU A;  4PK4 A;  3LDQ B;  4E7Z A;  4AQF A;  2HH7 A;  3ZN1 B;  4ANJ A;  3PUY F;  2E5L T;  4DR6 T;  2A72 A;  1YQ4 A;  1HNX T;  3AEC A;  3VRB A;  4KP3 C;  2J1D G;  2VKJ A;  1IZN B;  2WB5 A;  2ZMA A;  2V7I A;  1G8X A;  2WQY A;  3AXJ A;  4NUV A;  3PUQ A;  5FXZ A;  3WI3 A;  4AIS A;  4YSZ A;  4ZEY A;  3EHZ A;  4Z8X A;  4B6X A;  5LGU B;  3ESL A;  4KX6 A;  4YTM A;  1U4Q A;  2D5U A;  2VKD A;  3Q5E A;  3ZMT B;  5ABE A;  4CI1 B;  2YIN A;  4TV8 E;  3QB5 K;  1W9R A;  1ZP0 A;  2KMF A;  2KT9 A;  2QYW A;  2N1G A;  3UUL A;  2W4X A;  4OFZ A;  2DWG A;  2LSG A;  3ONX A;  2I6H A;  4JYA T;  3F57 A;  1HCI A;  1AJ3 A;  3T1Y T;  3HL6 A;  5ETW A;  3RYF E;  5FL1 A;  1MNE A;  5LG3 A;  3Q2M A;  4I0U A;  3AE8 A;  2B1E A;  2XQ3 A;  3C4X A;  3RX6 A;  1QUU A;  5HXS A;  2IML A;  2V8S V;  4IE5 A;  1N32 T;  2L3L A;  4ZI2 C;  2X67 A;  3M65 A;  3PUW F;  5J1G A;  4COF A;  2RPA A;  5LNK A;  4OK0 A;  3H37 A;  3GN5 B;  3CQC B;  4DND A;  3CML A;  2UXC T;  4H9R C;  3AE4 A;  1HFA A;  5LA6 E;  2LM9 A;  2W66 A;  3PDY A;  3MA9 A;  5JVD E;  3MKD A;  4UXN B;  3C4W A;  3AE9 A;  2V26 A;  4YHJ A;  3ZCJ A;  3KFW X;  4LML A;  3L09 A;  4WBN E;  3N5L A;  1LVF A;  3A7M A;  1UUS A;  3CWZ B;  4L9I A;  5AQV B;  3UUX B;  4H9P C;  3JAD A;  2FJD A;  2LRK A;  3AE6 A;  5IYZ E;  4ILA A;  4DV7 T;  4A98 A;  4DR7 T;  3FBL A;  2XQ6 A;  1DU2 A;  1VCS A;  3KIN B;  2NP9 A;  1FEW A;  5LHG B;  4JI8 T;  2W00 A;  2XAG B;  2XSA A;  3AA0 B;  3DP7 A;  2X9W A;  3LBX B;  5LXT E;  3KDS E;  3GA8 A;  2NW9 A;  5AQF B;  4QXC B;  2RA1 A;  4QH1 A;  4GYR A;  4PJN A;  2GK9 A;  2X66 A;  3F2E A;  5FXW A;  1WYC A;  3UTK A;  4CZZ B;  4B3R T;  4TUY E;  3BQK A;  4IDN A;  4PAG A;  4UV9 B;  2UXD T;  4GYS A;  2W61 A;  3UUM A;  2DI4 A;  3QUJ A;  1SA0 E;  3RKG A;  5FXX A;  3BQL A;  3UQ4 A;  3ZC0 A;  4PNI A;  3AE2 A;  1SE7 A;  2Y6X A;  3RYH E;  3UU8 A;  3VKG A;  4EB6 E;  1IBM T;  5EK2 A;  3OYZ A;  2VVS A;  3LK2 B;  1CUN A;  4OHF A;  3N9N A;  5FY1 A;  4YJ2 E;  1XMO T;  2MAW A;  2YDR A;  3EAB A;  2D0T A;  5E0O A;  4NXN T;  3EDV A;  3KV4 A;  1J5W A;  3P4Q A;  4ZXL A;  3S4U A;  3QOF A;  5BR8 T;  2XQA A;  1OED B;  3AED A;  4YSX A;  4HFC A;  4EGW A;  4JI3 T;  5EK3 A;  2EHO B;  2LT3 A;  4HFI A;  4MFR A;  5FY7 A;  1KK7 A;  1G73 A;  2WBL A;  5C8Y E;  2JPF A;  2LLY A;  4H9O C;  4OYK A;  2DWK A;  3OKQ A;  4IDQ A;  2CHO A;  2JQQ A;  4EYY R;  3NRX A;  4CN1 A;  5LGN B;  3HKD E;  4K0K T;  2BG9 A;  1W09 A;  2A2F X;  3WAK A;  4KHP T;  4CQI A;  3RIF A;  3AE3 A;  3AAE B;  5ABF B;  4YSY A;  5L3B B;  2XQ5 A;  4UF0 A;  3FZH B;  4IDP A;  3CK6 A;  4AQF C;  5AQI B;  1HTJ F;  5FL0 A;  2UU9 T;  4NXM T;  4YLH A;  1S94 A;  2KSR A;  3RQU A;  4UR9 A;  5LJM A;  2L9Q A;  3VR9 A;  2A3D A;  4O2B E;  1IAP A;  2BG9 E;  2YOE A;  3ZEF B;  4HFE A;  2WDV A;  4CI3 B;  4ILC A;  4CN6 A;  2BVL A;  3ZYL A;  4X62 T;  4I50 E;  4KBM B;  4O4L E;  1KNZ A;  1HS7 A;  2IHR 1;  2VL0 A;  3Q9D A;  3WAJ A;  4IDZ A;  2C5J A;  5HCJ A;  1X9B A;  3AAA B;  2V1D B;  1NEN A;  1UGO A;  3IF8 B;  3OJA A;  3OYX A;  3QC9 A;  2LJL A;  3ONL C;  1YXR A;  1Y01 A;  4I55 E;  4LMJ A;  1UK5 A;  2ACX A;  4AKG A;  4H63 V;  1NAF A;  4EXT A;  1T7S A;  4DR4 T;  2LSI A;  2JMH A;  5AQK B;  1WCR A;  3Q5X A;  4QXH B;  3NZP A;  2WS3 A;  5CA1 E;  1HNW T;  5CA0 E;  2DCF A;  5HEO A;  2E2A A;  5F5W A;  4DBR A;  2ZM8 A;  2FJA A;  4DV4 T;  5FKY A;  4HE8 A;  5HXR A;  1FIO A;  3AA1 B;  2LSJ A;  3KV9 A;  2MPK A;  4YTP A;  4IL9 A;  3OTO T;  3V5U A;  4X65 T;  1J5E T;  1ZHC A;  2JIW A;  2NW8 A;  2OV9 A;  2YU2 A;  1YW0 A;  3FZM B;  4TNV A;  3OPC A;  4JLE A;  4WW0 A;  4YJ3 E;  3RGL A;  3RIU C;  3PUS A;  3O1J A;  2BS3 A;  4IST A;  4TWF A;  1BR1 A;  3TLW A;  1T72 A;  4JI5 T;  4JBW F;  3SOL A;  5KMG P;  3P4R A;  1U5P A;  2XQ4 A;  5AQT B;  5FNV E;  4HWF A;  4P1N A;  4AKL A;  1HNZ T;  4B3T T;  4LFA T;  5JRC A;  3SRZ A;  1MMA A;  2HPJ A;  4ZI7 E;  3E0Z A;  1OED E;  2CCQ A;  2X0L B;  4KI0 F;  1MMN A;  3UFG A;  3A8Y C;  4NPP A;  2MYS A;  2WMO A;  4TWH A;  2CRB A;  3ABV A;  4UEM A;  2LEH A;  5LOV E;  4ERR A;  2BS4 A;  2EHO C;  4PJM A;  3K1S A;  4GOU A;  2A9U A;  3AEA A;  1D0Y A;  3U3I A;  4CXW A;  3HR0 A;  4U31 A;  2LSY A;  1ZOY A;  3EVY A;  4HEA A;  2VUR A;  4U7Y A;  3JC6 D;  3ZT5 A;  3CQG B;  2PG8 A;  3N2G E;  3P4S A;  5IHY A;  5EK4 A;  2AE9 A;  3I9Y A;  3NVO A;  4IE7 A;  4IGU A;  2H3R A;  2J4G A;  3ETV A;  4TWD A;  4E7S A;  3V5S A;  3ZJ1 A;  5L4H A;  4BJM A;  2LKG A;  1XNQ T;  2KIN B;  1IJ6 A;  3TLU A;  5CJ5 A;  3FZL B;  2X0H A;  4ZI3 D;  4C91 A;  1GQE A;  1MND A;  4UV8 B;  4B3S T;  3FXD B;  4GIW A;  2XTL A;  4DV0 T;  3MZK B;  2IDO B;  3RPU A;  4MLK A;  4DMW A;  5L2L A;  2V7K A;  4UEL A;  4AQY T;  4LMK A;  2E5V A;  4PFO A;  1MMD A;  2BKN A;  3NBX X;  4H9S E;  4QHO A;  2PBI A;  2XHE B;  3ANW A;  2ACZ A;  3K8P C;  4EEB A;  2LM2 A;  2E9X C;  4DV1 T;  2XAQ B;  4IHJ E;  3RC3 A;  2X9Y A;  4EZ4 A;  5CFB A;  5HXH A;  3PUZ F;  4DBQ A;  4CXY A;  1XNR T;  5AQJ B;  2MOZ A;  2Q9Q D;  2BG9 C;  2X9H A;  3NWI A;  4MBQ A;  2H7V C;  2WY2 A;  4DV5 T;  2N9D A;  3KV6 A;  1WRD A;  1IBL T;  4LFC T;  4IRE A;  4P0A A;  2PFV A;  2YN6 A;  4ZI3 C;  3ZMS B;  2CPT A;  5HXC A;  1E7P A;  3HKB E;  3FBZ A;  5L3F B;  3K3N A;  4JI2 T;  4UVA B;  2V5C A;  3PTR B;  4ILU A;  3ZLI A;  1XMQ T;  3HA4 A;  2J62 A;  5LCY A;  2G0U A;  4QWN B;  4ZI2 D;  1N36 T;  5AQN B;  2LHN A;  3AEB A;  2XAJ B;  5AQH B;  1J1J A;  5FXV A;  3T8O A;  5JRC B;  3AAI A;  2HN2 A;  2QGS A;  5KXJ A;  4AKR B;  1UX4 A;  3E22 E;  1LKX A;  3FB2 A;  5DQW A;  3B5M A;  3K3O A;  2UXB T;  3LJC A;  5LB7 B;  2C5I T;  4UVC B;  3PV0 F;  2KZ7 B;  3CQX C;  3ZKR A;  5LP6 E;  2VQE T;  4OYJ A;  5A1L A;  4A97 A;  4U72 A;  3NZQ A;  4HWI B;  3PU8 A;  1VRB A;  1IJ5 A;  5JDM A;  2XJ7 A;  1OWA A;  3FZF B;  2Z6E A; 
#chains in the Genus database with same CATH homology
 2VAS A;  4PW8 A;  2XAF B;  4AKI A;  1WLX A;  3N9Q A;  4KMC A;  2K24 A;  2K5B B;  1MMG A;  3C51 A;  4E7S A;  2WMN A;  2NTY A;  2XAH B;  3KVA A;  4TV9 E;  3PU3 A;  5F3J A;  3TKL B;  3I9W A;  2JRK A;  4UIG A;  3O4X E;  3B13 A;  1BR0 A;  2ZM0 A;  3AVS A;  3MK7 C;  1Z0P A;  2E9X B;  5LG4 A;  5FP3 A;  3IHR A;  2NTX A;  1UCU A;  2CXF A;  1V9D A;  5HWY A;  3HKE E;  2LOP A;  3CX7 B;  2EHO A;  4GK0 E;  4TX5 A;  2Y48 B;  4FI5 A;  2CXD A;  2QA7 A;  4ZOL E;  3F31 A;  2CM0 A;  3N9L A;  3DJB A;  3LBX A;  2WM9 A;  3H3A A;  4DVD A;  4CXX A;  1D1B A;  3IEE A;  4DMV A;  5TAO A;  3BQI A;  3ETU A;  5FMN A;  4XBF B;  2XAS B;  1MIY A;  1T98 A;  3CPZ A;  4I4T E;  2DLR A;  3UT5 E;  5HYA A;  5JDH A;  2IC6 A;  5ADX L;  4O8S A;  2Q9Q C;  1O3X A;  5HXE A;  3J7Y q;  5AFU L;  2C0S A;  3KV5 A;  1LRZ A;  4EOZ B;  4H63 H;  3GN5 A;  4ZS2 A;  3JC6 C;  4G63 A;  3EUH A;  4EAH A;  3N2O A;  3PUG A;  3ZYM A;  5DAB A;  4PJJ A;  4AXP A;  2Y8D A;  4ADZ A;  5JRC A;  1E1H B;  5LBM A;  2KLQ A;  2KWH A;  5JR9 B;  1D0X A;  2BVM A;  5DJQ C;  4PK5 A;  4F6R C;  4UF0 B;  2KXP B;  4GK5 E;  4PK6 A;  4EIW A;  5J2U E;  4A56 A;  4O4H E;  5EZY E;  3B57 A;  2IAK A;  2UXN B;  2VL8 A;  4IE4 A;  1WYB A;  5GON E;  2LE8 A;  3ZMV B;  4QXB B;  1VOM A;  4YFS A;  3K3Q C;  4X20 E;  3RYC E;  3I0Q A;  5JDL A;  1YD8 G;  4P09 A;  3NRY A;  5JRE A;  2E9X D;  3ZJ2 A;  4XZC A;  4O4I E;  3C64 A;  1D1A A;  2CE7 A;  3O9X A;  2DHR A;  1MIW A;  4N78 D;  2IW5 B;  3ZMZ B;  2NWB A;  2X68 A;  2VB6 A;  4M1P A;  2WWU A;  4BAY B;  3DTO A;  4ASK A;  4AI6 A;  5L3G B;  1ZEE A;  2CLY C;  2CMR A;  4X1Y E;  5HAX A;  5JH7 E;  1EZ3 A;  2X51 A;  4ZS3 A;  4JEH B;  5FY0 A;  2JMK A;  1HF8 A;  3AA7 B;  2DNX A;  5L3E B;  4XAX B;  3UFE A;  3CKD A;  2CA5 A;  4EZH A;  4H9Q C;  4IE6 A;  5KDM C;  4IE0 A;  2YU1 A;  1S35 A;  4WNK A;  5JDQ A;  2LHR A;  3D0T A;  4AKH A;  3VKH A;  4HTE A;  3RYI E;  1WR6 A;  3N2K E;  3GMI A;  4HKA A;  4C90 A;  3SS1 A;  2RP4 A;  4HGA A;  5JQG E;  3QK6 A;  4H9N C;  2D0U A;  3OBV E;  4QX7 B;  3FHN A;  3VU7 H;  2Q9Q B;  5JDG A;  1US7 B;  5L3D B;  2BZB A;  2YK0 A;  4MHC A;  5JR9 A;  3ZN0 B;  3I0O A;  3LK4 2;  2YEV C;  5HWX A;  3KVB A;  4QKN A;  5JDN A;  2W63 A;  3RRW A;  1H7C A;  2JJ9 A;  2ES0 A;  2ZLY A;  3O1I A;  4NUU A;  1HG5 A;  5CB4 E;  4X1I E;  1BR2 A;  1ZV4 X;  3N9O A;  5BMV E;  5LHH B;  5JDF A;  1D1C A;  5DQV A;  5JR9 C;  1LVK A;  4BA9 A;  2CWY A;  4L0R A;  3HKC E;  3ZCI A;  2OA5 A;  2CEA A;  4MAL A;  3N9M A;  2BDE A;  5H6Q B;  3RC8 A;  3PUR A;  3J9X 1;  3SWH A;  3CX6 B;  5L3C B;  2I59 A;  2D2S A;  4PJL A;  3MXZ A;  2MBG A;  2E9X A;  3C98 B;  3P7I A;  1HG2 A;  4I43 B;  2CLY B;  4G2A A;  4K0U A;  1HX8 A;  5FYM A;  4PFP A;  3ZYK A;  2IC9 A;  5LHI B;  1OXZ A;  3PE0 A;  3KBU A;  2N2N A;  3RRC A;  4TZ4 C;  3CX8 B;  3R84 B;  2K48 A;  2VK9 A;  4HN9 A;  3U78 A;  3L3P A;  4ISS A;  2W62 A;  2ODV A;  4X1K E;  1YKH B;  2H7O A;  4HFV A;  1Y64 B;  3AB3 B;  1X79 A;  4J2C A;  1B7T A;  4V1A v;  3FXE B;  3W15 B;  3ZC1 A;  5JDM A;  2VKH A;  3N9P A;  2PJQ A;  3LFM A;  2VWA A;  2XQY A;  3KBT A;  3RH3 A;  2VKO A;  4QX8 B;  3R6N A;  4O4J E;  3LK3 B;  3Q5W A;  3UUN A;  1QSD A;  1D0Z A;  2L8K A;  2ZM2 A;  3ANW B;  5KX5 E;  2NOX A;  3BK9 A;  3ZMU B;  3PUA A;  1NWM X;  4JEU B;  2CXL A;  5H6R B;  2W0G A;  3MJX A;  5M4Y A;  2P9B A;  2E8I A;  2LSK A;  2Q9Q A;  2CWO A;  2V7M A;  3A5X A;  2KND A;  3C4Z A;  1YKE B;  3VHL A;  3HI2 A;  3GWH A;  5LBQ B;  2XUE A;  4TN7 B;  4KUM B;  1FMV A;  4L5G A;  1BR4 A;  3AVR A;  3P8C D;  1SHZ C;  1FMW A;  2UXX B;  4IIJ E;  3I1A A;  2V7J A;  3LG7 A;  4DO0 A;  4JUY A;  4BJN A;  1MIV A;  5F8P A;  3EDU A;  2M67 A;  3E08 A;  4WBO A;  3CVR A;  2WSS V;  4AQG A;  3C50 A;  2V7L A;  4ZHQ E;  2HPL A;  4FJO A;  4U74 A;  2EHO D;  4O2A E;  4P0B A;  5LYJ E;  1UX5 A;  5LGT B;  2C5K T;  2ODU A;  1ZKE A;  2MTQ A;  4UVB B;  2NW7 A;  4CI2 B;  3MAC A;  2K9A A;  2X9X A;  5LJN A;  3IBP A;  2SPC A;  3AA6 B;  3RKO A;  3O1H A;  2WAU A;  2KWI B;  2LOS A;  4EYU A;  4PK4 A;  4E7Z A;  4AQF A;  2HH7 A;  3ZN1 B;  4ANJ A;  2A72 A;  4KP3 C;  2J1D G;  2VKJ A;  1IZN B;  2ZMA A;  2V7I A;  1G8X A;  4NUV A;  5FXZ A;  3PUQ A;  3WI3 A;  4Z8X A;  4B6X A;  5LGU B;  3ESL A;  1U4Q A;  2D5U A;  2VKD A;  3ZMT B;  4CI1 B;  2YIN A;  4TV8 E;  2KMF A;  2KT9 A;  2N1G A;  3UUL A;  4OFZ A;  2DWG A;  2LSG A;  3ONX A;  3F57 A;  1HCI A;  1AJ3 A;  3HL6 A;  5ETW A;  3RYF E;  1MNE A;  3Q2M A;  3RX6 A;  2B1E A;  3C4X A;  1QUU A;  5HXS A;  4IE5 A;  2L3L A;  4ZI2 C;  2X67 A;  3M65 A;  5J1G A;  5LNK A;  4OK0 A;  3H37 A;  3GN5 B;  3CQC B;  4DND A;  3CML A;  4H9R C;  1HFA A;  5LA6 E;  2LM9 A;  3PDY A;  3MA9 A;  5JVD E;  3MKD A;  4UXN B;  3C4W A;  4YHJ A;  2V26 A;  3ZCJ A;  3KFW X;  3L09 A;  4WBN E;  3N5L A;  1LVF A;  3CWZ B;  4L9I A;  3UUX B;  4H9P C;  5IYZ E;  3FBL A;  3KIN B;  2NP9 A;  1FEW A;  5LHG B;  2W00 A;  2XAG B;  3AA0 B;  3DP7 A;  2X9W A;  3LBX B;  5LXT E;  3KDS E;  3GA8 A;  2NW9 A;  4QXC B;  2RA1 A;  4CZZ B;  4GYR A;  4PJN A;  3F2E A;  2GK9 A;  2X66 A;  5FXW A;  1WYC A;  3UTK A;  4TUY E;  3BQK A;  4PAG A;  4UV9 B;  4GYS A;  2W61 A;  3UUM A;  2DI4 A;  3QUJ A;  1SA0 E;  5FXX A;  3BQL A;  3ZC0 A;  4PNI A;  2Y6X A;  3RYH E;  3VKG A;  4EB6 E;  5EK2 A;  3OYZ A;  3LK2 B;  1CUN A;  4OHF A;  3N9N A;  5FY1 A;  4YJ2 E;  2D0T A;  5E0O A;  3EDV A;  3KV4 A;  3S4U A;  5EK3 A;  2EHO B;  2LT3 A;  4MFR A;  5FY7 A;  1KK7 A;  1G73 A;  2WBL A;  5C8Y E;  2JPF A;  4H9O C;  4OYK A;  2DWK A;  3OKQ A;  4EYY R;  2JQQ A;  3NRX A;  5LGN B;  3HKD E;  3WAK A;  2A2F X;  4CQI A;  3AAE B;  5L3B B;  4UF0 A;  4AQF C;  1HTJ F;  4YLH A;  1S94 A;  5LJM A;  2L9Q A;  2A3D A;  4O2B E;  1IAP A;  3ZEF B;  4CI3 B;  2BVL A;  3ZYL A;  4I50 E;  4KBM B;  4O4L E;  1KNZ A;  1HS7 A;  3Q9D A;  3WAJ A;  4IDZ A;  2C5J A;  3AAA B;  2V1D B;  3IF8 B;  3OJA A;  3OYX A;  3QC9 A;  2LJL A;  4AKG A;  4I55 E;  2ACX A;  4H63 V;  1NAF A;  4EXT A;  2LSI A;  2JMH A;  3Q5X A;  4QXH B;  3NZP A;  5CA1 E;  5CA0 E;  2DCF A;  4DBR A;  2ZM8 A;  4HE8 A;  5HXR A;  1FIO A;  3AA1 B;  2LSJ A;  3KV9 A;  3V5U A;  1ZHC A;  2NW8 A;  2YU2 A;  4YJ3 E;  1YW0 A;  4JLE A;  4WW0 A;  5J2T E;  3ZPO A;  3PUS A;  3O1J A;  4IST A;  1BR1 A;  3SOL A;  5KMG P;  1U5P A;  5FNV E;  4AKL A;  3SRZ A;  1MMA A;  2HPJ A;  4ZI7 E;  3E0Z A;  2CCQ A;  2X0L B;  1MMN A;  2MYS A;  2WMO A;  4ERR A;  4UEM A;  2LEH A;  5LOV E;  2EHO C;  4PJM A;  4GOU A;  3U3I A;  1D0Y A;  4CXW A;  3HR0 A;  2LSY A;  3EVY A;  4HEA A;  3JC6 D;  3CQG B;  2PG8 A;  3N2G E;  5IHY A;  5EK4 A;  3I9Y A;  4IE7 A;  4IGU A;  2H3R A;  3ETV A;  3V5S A;  3ZJ1 A;  4BJM A;  2KIN B;  1IJ6 A;  4ZI3 D;  4C91 A;  1MND A;  4UV8 B;  3FXD B;  4GIW A;  2XTL A;  3MZK B;  3RPU A;  5L2L A;  4MLK A;  4DMW A;  2V7K A;  4UEL A;  4PFO A;  1MMD A;  3NBX X;  4H9S E;  4QHO A;  2PBI A;  2XHE B;  3ANW A;  3K8P C;  2E9X C;  2XAQ B;  4IHJ E;  3RC3 A;  2X9Y A;  4EZ4 A;  5HXH A;  4DBQ A;  4CXY A;  2MOZ A;  2Q9Q D;  2X9H A;  4MBQ A;  2H7V C;  2N9D A;  3KV6 A;  1WRD A;  4P0A A;  2PFV A;  4ZI3 C;  3ZMS B;  5HXC A;  3HKB E;  3FBZ A;  5L3F B;  3K3N A;  4UVA B;  3ZLI A;  3PTR B;  4ILU A;  3HA4 A;  5LCY A;  2G0U A;  4QWN B;  4ZI2 D;  2LHN A;  2XAJ B;  5JRC B;  5FXV A;  3T8O A;  3AAI A;  2QGS A;  4AKR B;  1UX4 A;  3E22 E;  1LKX A;  3FB2 A;  5DQW A;  3K3O A;  3LJC A;  2C5I T;  4UVC B;  5LP6 E;  2KZ7 B;  3CQX C;  4OYJ A;  5A1L A;  4U72 A;  3NZQ A;  3PU8 A;  1VRB A;  1IJ5 A;  1OWA A;  2Z6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...