2A3DA

Solution structure of a de novo designed single chain three-helix bundle (a3d)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
MGSWAEFKQRLAAIKTRLQALGGSEAELAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDELQAYRHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (DE NOVO THREE-HELIX BUNDLE)
publication title Solution structure and dynamics of a de novo designed three-helix bundle protein.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Three-helix bundle
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a3dA00
2A3DA 2MTQA
chains in the Genus database with same CATH superfamily
1D0XA 5HEOA 3RYFE 4ZZCA 1VCTA 2LM9A 4WNKA 3PU3A 3OJAA 5LP6E 2RA1A 1B7TA 4H9RC 4PK6A 4DMVA 2J47A 4MALA 3PUXF 2OV9A 2A3DA 3CX6B 4BAYB 4JV5T 3AE1A 3UU3A 4IL9A 2YINA 4K0UA 2E5LT 4DUYT 1KNZA 4LF7T 4ZI2D 4GYSA 2VKOA 3K3QC 3JAEA 3CQXC 1W09A 4DIDB 4CN6A 4DV4T 3JC6D 5FY7A 3FZHB 3QB5K 1Z0PA 4JEHB 4UVBB 3UQ4A 4HEAA 1T8BA 1FMVA 3J9X1 2XM2A 1NENA 3C4ZA 4H9PC 4YHHT 5TAOA 2EHOD 1UX5A 4DUZT 3UUXB 2RPAA 1LVKA 3EAMA 3AEGA 3FBLA 1VRBA 2WMOA 4OFZA 2VURA 4EYYR 2NWBA 4TWDA 1U4QA 4HTEA 3K3OA 4IDQA 1MMDA 1VOMA 2XQ3A 3EABA 2NR4A 4F8HA 2V1DB 4DR3T 2VWAA 2IAKA 4CXXA 2YOEA 3PUSA 2A72A 2LHNA 5AQUB 1SUMB 5JDHA 3H3MA 2XQ9A 5LOVE 1YXRA 4QXHB 2V7KA 4O4JE 2XQYA 2Y6XA 3OTOT 2LT3A 2XQ5A 3GMIA 4IGUA 2Y48B 5F8PA 4IE4A 2JQKA 3SFEA 2HPLA 4UVCB 4UR9A 4Z8XA 2IHR1 2M6IA 4ZZBA 2HN1A 3ZN0B 4CI2B 4U7YA 4WZXA 3N5LA 3MJXA 3RYIE 2H88A 4AQFA 4O4HE 5LNKA 1IAPA 2DWGA 1UUSA 4UF0B 4KI0F 4OHFA 2ZLYA 2E9XD 3AE5A 5FNVE 2ZMAA 4AI6A 3AEEA 3LFMA 4ISTA 3FZFB 4HFVA 3RF1A 5L4HA 1ZOYA 2FJDA 3KVBA 4HFHA 4LF5T 2X9YA 2WQYA 4KHPT 5L2LA 1DU2A 4HWCA 2C5IT 3AE2A 2LOPA 2WM9A 1SA0E 3RKGA 5IYZE 3RI5A 5L3FB 4KHZF 3V5SA 3KV6A 1WR0A 3PUAA 3PUZF 3AA6B 4NUUA 4EIWA 2LKGA 2IDOB 1LKXA 1N33T 3L09A 4LF4T 4PFOA 2FJEA 3ZCJA 1WYBA 3R6NA 2PJQA 1Y01A 3Q9DA 2DI4A 4QH4A 4HFIA 1HTJF 4CN1A 5KDMC 3ZC0A 4OK0A 4ZI2C 5L3GB 3VHLA 1S94A 1W9RA 2LOSA 3RIUA 2WDRA 4YSXA 5LCYA 2JMHA 4QHOA 1W0BA 2UXXB 5CA0E 3O1IA 2WZIA 2JMKA 2Q9QD 2X0HA 2M67A 3RQUA 3AEAA 2NW7A 2F4VT 3C50A 1WRDA 3AE8A 4BA9A 4CQIA 2CE7A 3ZSTA 4H63V 4P1NA 3ABVA 5L4EA 4P09A 4I43B 3SS1A 2AE9A 3ZMVB 2B1EA 5DJQC 3LG7A 4HFEA 4AKLA 4DR7T 2W66A 2CLYC 3AXJB 4JI6T 4ERRA 3ZEFB 3HKEE 2LKHA 2BG9A 5HWXA 3ZMZB 3VR8A 3OYXA 3EVYA 4NIQA 3HKBE 3PJAJ 3OBVE 3CX7B 4HGAA 2VKJA 3UUBA 5C3JA 5JR9C 5CGMA 4UV9B 2V26A 4MFRA 3O4XE 4U2YA 5BR8T 4LFAT 4IE6A 3JADA 2D0TA 4PW8A 5FY1A 4CN4A 1HX8A 3ZYLA 3RGLA 2LSJA 2W2UA 5JDFA 2UUBT 1HNWT 5FL1A 2X66A 1IBLT 4PJLA 2BS3A 3CX8B 2CLYB 3I0QA 2E9XC 5HEUA 3F2EA 3P7IA 2CWYA 2LSKA 3SWHA 4H9QC 2D5UA 4HN9A 3Q5DA 4IIJE 3CPZA 3HKDE 2A2FX 3N2OA 2WU5A 5HXHA 3WAJA 4A97A 2DWKA 2PFVA 3FZMB 5AQGB 1QUUA 1Z8UA 3ZLIA 4FI5A 5HXEA 3T1YT 4JBWF 2V8SV 5CJ5A 3R84B 4DV1T 4CI1B 2H89A 3QK6A 5AQHB 3V5UA 4IT4A 4PK5A 4DV6T 3P50A 3RKOA 3ANWB 3T8OA 2SPCA 1HF8A 3TLUA 4B3MT 5H6RB 4GK5E 4HWFA 3TLSA 5FXVA 3MK7C 2E9XB 4DNDA 5HWYA 4KUMB 5LBQB 3TLVA 3EDUA 4QWNB 3S4UA 3ZMUB 1MIYA 3K1SA 2NW8A 5E0OA 2UXDT 2JJ9A 4LF9T 4EYUA 2XSAA 1E2AA 4X62T 4CXYA 3SFDA 3K8PC 4O4LE 4PK4A 4H63H 2FJBA 4G63A 4B3ST 2Q9QC 4UVAB 4JI0T 4ZI7E 5ETWA 2XQ6A 2CM0A 2C5JA 3PUWF 4P0AA 2R6GF 4PFPA 2XY8B 4EOZB 1YQ4A 3ZCIA 5JDGA 2FBWA 5ABEA 2WB5A 3OVUA 1M7KA 3IA3A 3B13A 4JLEA 3EHZA 1HX1B 1XWMA 4DBRA 4TN7B 3CQGB 4EZ4A 2QVAA 2QA7A 4IDZA 4AXPA 1IZNB 2YN6A 3AEBA 3T1HT 1I94T 5HYAA 4ZS2A 2I59A 3FZKB 4WBOA 2ZM6T 2WS3A 5JDMA 1YW0A 4P0BA 4U72A 2Q9QB 1HCIA 2XZEA 4ADZA 4ILAA 2YEVC 1H7CA 2VQET 3CMLA 2FUPA 3FZLB 3H37A 2B76A 4BJMA 3OYZA 4JYAT 2QRXA 3I1AA 3U78A 5AQOB 2MYSA 3RIFA 3KV9A 2V7LA 3RX6A 4PJNA 4YHJA 3PURA 4ZHQE 3L3PA 1D1CA 1HG5A 2KSRA 2BS2A 2V5CA 3ZJ2A 2DNXA 2YDSA 2E5VA 4AKRB 1ZKEA 2HHHT 5JVDE 4AISA 2XAFB 3RRCA 4EB6E 4A56A 1WLXA 1Y64B 3J7Yq 1QLBA 4N78D 2ES0A 5LGUB 1FIOA 3HI2A 5FVLA 3KBTA 3KDSE 1XMOT 3AA0B 4M1PA 2WSSV 5HEJA 4IE0A 2LRLA 2W62A 4YJ2E 4U74A 3O1HA 5JDLA 4YSZA 3ESLA 2DL1A 5LB7B 1XDPA 4PJMA 4IDNA 3H3AA 4DR5T 4K0KT 3RRWA 3ZKRA 2W0GA 4B6XA 2WU2A 4ZI3C 2DHRA 2KZ7B 5L3DB 5AQKB 2VKDA 2G0UA 1HR0T 4MLKA 3N9OA 4UF0A 2X51A 3E08A 1XMQT 1KK7A 1IJ5A 2NOXA 3ETUA 2UXBT 2JQHA 2LHRA 3L39A 4OX9T 4JI2T 2IMLA 3TLTA 1R8IA 4X20E 3RHWA 2CXFA 5FYMA 5LG3A 5JRCB 3UT5E 1J1JA 3VKHA 2JPFA 4IHJE 4DV2T 2YKSA 3E22E 3TLWA 1T72A 2KMFA 2X9HA 3BQKA 1J5WA 1JNRA 5AQFB 4X1IE 3GN5B 2XQ4A 4E7SA 3CKDA 3N9LA 3CWZB 3N9NA 2BKNA 2L9QA 3FBZA 3BK9A 5FKYA 2BDEA 4UXNB 3CIRA 3RIUC 4LMLA 3ZMSB 3LK42 5EK3A 3RC3A 5CFBA 3NVOA 1YKEB 4DV5T 2V5DA 2VK9A 4TUYE 1GQEA 3CK6A 4X66T 5DQVA 5J2UE 4YTMA 1NWMX 2XJ7A 2XQ7A 3MA9A 4EZHA 1OXZA 5AQSB 2QGSA 3AAEB 3JC6C 4H9NC 2H7VC 2OA5A 2CBIA 3Q5WA 4O2BE 4UEMA 4CXWA 2D2SA 1QSDA 5CB4E 2VL0A 3PUVF 2J1DG 1FJGT 4NPPA 4DR6T 4YSYA 3HR0A 2A9UA 1NEKA 2LM2A 4I55E 2EHOC 1KNPA 1KF6A 1WR6A 4JI8T 3MKDA 3ZMTB 2ACZA 2BG9C 2JRKA 4QX8B 4DR2T 4O8SA 3C98B 3MXZA 2LE8A 1CHUA 3ONXA 2VASA 3JCFA 2KXPB 3AXJA 2XSBA 2D9DA 5LBMA 3UFGA 4PAGA 3N2KE 5M4YA 1UGOA 4KP3C 2CHNA 3AVSA 2YK0A 5BMVE 5F3JA 1XDOA 2UU9T 2CHOA 3N9QA 4Q25A 4ZXLA 3NKZA 1AJ3A 2MOZA 1IBMT 2YU1A 3C4WA 5ABHA 2ODVA 5L3CB 3QC9A 2K5BB 2PTFA 3ZT5A 4UELA 2XUEA 4WYVA 4LF6T 4KX6A 1US7B 2EHOB 4TNWA 1ZEEA 2QYWA 4DR4T 4YY3T 5J2TE 2CRBA 2CXLA 2N2NA 3FB2A 4IREA 4YT0A 4GK0E 4JI3T 3EUHA 3G06A 3PU8A 4AQYT 4G2AA 2UUAT 3AA1B 4EEBA 2L3LA 2MTQA 4XAXB 2UXNB 4PNIA 4U33A 1WYCA 2ZM2A 3O9XA 2KLQA 2NTXA 2IW5B 3KINB 1W0AA 3P4QA 2XPKA 4NUVA 4U2ZA 5JR9A 1JNZA 4PJJA 3PDYA 2V6YB 5JDNA 2Y8DA 1OEDC 5KXJA 5JR9B 1KEYA 5AQVB 4WBNE 3N9PA 4FJOA 4IE5A 2C5KT 2BBHA 1G8XA 4OYJA 5AFUL 2WCAA 3PUQA 1OWAA 3UFEA 4E7ZA 3E0ZA 3ZJ1A 2VVNA 2ODUA 1D1BA 3ANWA 5AQIB 5LMUT 2H7OA 1MMAA 5HEGA 3ZPOA 2JQ9A 4GOUA 2E9XA 1KFYA 3LBXB 5FL0A 4HWHA 1T7SA 4TWFA 5ADXL 5LMNT 5FMNA 4QH1A 4MHCA 2UUCT 5LJMA 2E8IA 4IL4A 4X5TA 4U7IA 5L3EB 4ISSA 5LHHB 2BBJA 2BZBA 5FXZA 4TWHA 4CZZB 1UCUA 3UUNA 3NRXA 4Z90A 4C90A 5HXSA 5LJNA 2WY2A 3VKGA 1OEDB 3MZKB 4YXDA 5L3BB 2K3WA 5HXCA 3ONJA 4IE7A 2VQFT 3UULA 4A5XA 4DO0A 2CWOA 3UUMA 2X9XA 3HA4A 3KBUA 1T98A 1N36T 1D1AA 4Z91A 1OEDE 3FXDB 1S35A 3X1DA 1G73A 3W15B 1U5PA 4IDPA 4NXMT 3KFWX 2UXCT 2NW9A 4X64T 5AQMB 2KINB 4JUYA 1X9BA 4B3RT 3TKLB 2X0LB 4DV3T 4X1YE 1FEWA 3UU6A 5AQQB 5KMGP 3SRZA 4COFA 5FP3A 1IBKT 1XZYA 2KNDA 3NBXX 2KWIB 3AE4A 2Q9QA 4UV8B 1MMGA 5F5WA 3OKQA 2H3RA 3ZC1A 2WWVA 2ZM0A 2X68A 2LLYA 3LK2B 5DABA 2GK9A 3KV4A 2W67A 4HKAA 2I6HA 4ZOLE 4EAHA 4LMJA 1MNEA 4AKIA 5LYJE 3ZYMA 2E2AA 4LMKA 4LF8T 2OLTA 3P4RA 5FXWA 1V9DA 1E7PA 4ZEYA 4QXCB 4B3TT 3Q5EA 3VRAA 3WI3A 3HKCE 5LHIB 2L8KA 5ABFA 4JEUB 1HNXT 2BVLA 2HN2A 1XNRT 1IJ6A 1SHZC 5ABFB 3C51A 1YD8G 2YU2A 1MIVA 3QB5A 3IHRA 3QUJA 2VKHA 3AEFA 2CBJA 3LSVA 4TV8E 1D0ZA 3KVAA 5HCMA 4A98A 2XAGB 3O1JA 2XQ8A 4AQFC 5IUXA 4ILUA 3M65A 2JIWA 2MPKA 4GKJT 2HPJA 2CMRA 3F57A 1J5ET 2I0MA 5FY0A 3I9WA 4QKNA 2VL8A 2W63A 3N9MA 4WW0A 4QXBB 3GWHA 2X67A 5IWAT 4LFBT 4HFCA 2FJAA 5L47A 2LEHA 5JRCA 5J0ZA 1BR4A 1LRZA 2P9BA 1HFAA 3UU8A 2CCQA 1LVFA 2V7IA 4ILBA 1X79A 3AAAB 4O4IE 2XAQB 2X0YA 4JI7T 1NAFA 4ILCA 3RYHE 4EEDA 2XHEB 4EGWA 4X1KE 3GN5A 4DV0T 2W61A 3I9YA 3N2GE 4I50E 2PG8A 5JTGA 5JREA 2XAJB 1HG2A 4TV9E 3A5XA 4KMCA 3RH3A 3NWIA 1N32T 4X65T 3CVRA 4HFBA 4H9SE 3A8YC 2WWUA 1HNZT 4EV6A 3QOFA 1MNDA 3VR9A 4L5GA 1HS7A 2XM1A 3P4SA 3VU7H 2BS4A 2YDRA 5LA6E 3AE6A 2K9AA 3PE0A 3AE7A 2LJLA 4TX5A 3UQ7A 1L0VA 3OPCA 2W00A 3F31A 2HH7A 4L0RA 2N9DA 3U3IA 2CEAA 2D0UA 4DV7T 5JQGE 2VVSA 4DVDA 3ETVA 1M62A 4JI5T 2C0SA 5LGTB 3DJBA 3ZT7A 4HFDA 1YQ3A 2CA5A 2NP9A 5JH7E 2MBGA 2BKPA 5HCJA 3UU5A 3RPUA 5LXTE 5ABGA 1UX4A 3I0OA 5FVKA 4YFSA 3PUYF 1VCSA 3FHNA 2V7JA 3RQWA 2WMNA 2MAWA 5KX5E 5A1LA 4KBMB 3A7MA 3GA8A 4HWIB 3AEDA 4CI3B 3L8RA 2M6BA 4TNVA 5C8YE 1WFDA 3RC8A 4L9IA 4GYRA 3RLFF 5HEHA 5J1GA 3PV0F 2BVMA 3EDVA 4J2CA 1I6ZA 4GIWA 4O2AE 3VRBA 1BR2A 1D0YA 2J4GA 3ZN1B 4U31A 1MIWA 2PBIA 3ONLC 4OYKA 3AE3A 1KNRA 1O3XA 2EHOA 1BR0A 2IC6A 5IHYA 1E1HB 1ZV4X 3LK3B 3PJAA 1FMWA 4AKGA 3AECA 3ZSSA 1ZHCA 4U3CA 2LRKA 1EZ3A 3RIAA 5CA1E 5DQWA 4IDOA 2BG9B 4UIGA 5EZYE 4GKKT 5LHGB 4I0UA 3AVRA 3AE9A 5GONE 3AAIA 5AQPB 3P8CD 5AQJB 2WZHA 4JI1T 3FXEB 3PUGA 2WDQA 2N1GA 4BJNA 4YLHA 3IF8B 1N34T 2K48A 3NZPA 3UTKA 5JDQA 4ANJA 4JI4T 5LG4A 2DLRA 5AQTB 5C2TA 2BG9E 3C64A 2V6YA 4ZS3A 2KWHA 2K24A 5AQLB 4AIUA 3IEEA 5FXXA 3AA7B 2RP4A 3P4WA 2XASB 3QNUA 3MACA 3B57A 3BQLA 1BR1A 3PTRB 4YTPA 4TZ4C 4XBFB 2J62A 1XNQT 3RYCE 4I4TE 3LDQB 3LJCA 3D0TA 2W4XA 5AQRB 4NXNT 1WCRA 2CXDA 3B5MA 5HXRA 1UURA 4QX7B 4HWDA 3ZYKA 3DTOA 4DMWA 2WP9A 4H9OC 4AQGA 3CQCB 3LBXA 3AB3B 3UU4A 2XAHB 2IUBA 3JAFA 2V6XA 4DR1T 4V1Av 2XTLA 3M3ZB 4LFCT 1ZP0A 2XQAA 2BKOA 2AXDS 4C91A 3ZT6A 5HAXA 2X9WA 5LGNB 4DBQA 2V7MA 4F6RC 4EXTA 3NZQA 3KV5A 1OEDA 3DP7A 2LSYA 4XZCA 4ZI3D 1SE7A 4YJ3E 2ZM8A 4AKHA 2LSGA 2WBLA 2IIUA 3EI0A 2CPTA 2LSIA 3C4XA 1YKHB 2IC9A 3IBPA 1UK5A 3SOLA 4HE8A 2DCFA 3NRYA 4MBQA 2JQQA 4QH5A 3HL6A 5EK4A 3WAKA 2KT9A 3K3NA 3Q5XA 5H6QB 5AQNB 2YDQA 2VB6A 2WDVA 2Z6EA 1MMNA 3Q2MA 2ACXA 5EK2A 1CUNA 3BQIA 3P4PA 4ASKA 2WAUA 4YTNA 2NTYA
chains in the Genus database with same CATH topology
1D0XA 2E9XC 2CMRA 3F57A 3Q5WA 3RYFE 3F2EA 3P7IA 2CWYA 5FY0A 3I9WA 4O2BE 2LSKA 4UEMA 4QKNA 4CXWA 2LM9A 2D2SA 2VL8A 1QSDA 2W63A 5CB4E 3SWHA 3N9MA 4WNKA 4H9QC 3PU3A 2J1DG 3OJAA 4WW0A 2D5UA 5LP6E 2RA1A 1B7TA 4HN9A 4QXBB 3HR0A 3GWHA 4IIJE 2X67A 4I55E 2EHOC 3CPZA 4H9RC 3HKDE 4PK6A 4DMVA 2A2FX 3N2OA 5HXHA 3WAJA 2LEHA 2DWKA 4MALA 5JRCA 2PFVA 2A3DA 1WR6A 3CX6B 3MKDA 1QUUA 1BR4A 3ZMTB 2JRKA 1LRZA 2P9BA 1HFAA 4QX8B 3ZLIA 4BAYB 4O8SA 3C98B 3MXZA 4FI5A 2CCQA 2LE8A 5HXEA 3ONXA 1LVFA 2YINA 2VASA 2V7IA 2KXPB 4K0UA 1KNZA 1X79A 3AAAB 5LBMA 4ZI2D 4GYSA 4O4IE 4PAGA 2XAQB 2VKOA 3K3QC 1NAFA 3CQXC 3N2KE 3RYHE 3R84B 5M4YA 4KP3C 2XHEB 3AVSA 3JC6D 4CI1B 5FY7A 2YK0A 3QK6A 5BMVE 5F3JA 4X1KE 3V5UA 3N9QA 4PK5A 3GN5A 1Z0PA 4JEHB 4UVBB 2W61A 3I9YA 3N2GE 1AJ3A 4I50E 2MOZA 2PG8A 4HEAA 2YU1A 3C4WA 3RKOA 1FMVA 3ANWB 3T8OA 2SPCA 2ODVA 5L3CB 1HF8A 5JREA 2XAJB 3QC9A 1HG2A 3J9X1 2K5BB 4TV9E 4UELA 2XUEA 4GK5E 5H6RB 3A5XA 3C4ZA 4H9PC 5FXVA 5TAOA 3MK7C 2E9XB 4DNDA 2EHOD 4KMCA 1UX5A 3RH3A 5HWYA 3UUXB 3CVRA 4H9SE 1LVKA 4KUMB 5LBQB 3EDUA 4QWNB 3S4UA 2WWUA 3ZMUB 3FBLA 1MNDA 1MIYA 1VRBA 2NW8A 2WMOA 5E0OA 1HS7A 4L5GA 4OFZA 1US7B 2EHOB 3VU7H 1ZEEA 5LA6E 2K9AA 3PE0A 4EYYR 2JJ9A 2NWBA 4EYUA 2LJLA 1U4QA 4HTEA 3K3OA 5J2TE 4TX5A 2CXLA 4CXYA 1MMDA 2N2NA 1VOMA 3FB2A 3K8PC 4O4LE 4PK4A 2V1DB 4GK0E 2VWAA 2W00A 2IAKA 4H63H 3F31A 2HH7A 3EUHA 4L0RA 4CXXA 4G63A 2N9DA 3PU8A 3U3IA 2Q9QC 4UVAB 2CEAA 4G2AA 3AA1B 2D0UA 3PUSA 2A72A 2LHNA 4ZI7E 5ETWA 2CM0A 5JDHA 5JQGE 2C5JA 4DVDA 2L3LA 2MTQA 3ETVA 4P0AA 4XAXB 4PFPA 2UXNB 5LOVE 4EOZB 2C0SA 4QXHB 4PNIA 5LGTB 2V7KA 3DJBA 1WYCA 2ZM2A 3ZCIA 5JDGA 2CA5A 2NP9A 4O4JE 2XQYA 5JH7E 3O9XA 2MBGA 2KLQA 2NTXA 2Y6XA 2IW5B 3KINB 3B13A 3RPUA 4JLEA 5LXTE 4NUVA 2LT3A 5JR9A 1UX4A 3I0OA 4YFSA 3GMIA 4PJJA 3PDYA 4IGUA 4DBRA 5JDNA 3FHNA 2Y48B 4TN7B 2V7JA 3CQGB 4EZ4A 2Y8DA 5F8PA 2WMNA 5KX5E 4IE4A 5JR9B 2QA7A 4IDZA 4AXPA 1IZNB 3N9PA 4FJOA 4KBMB 4WBNE 5A1LA 3GA8A 4IE5A 2C5KT 4CI3B 2HPLA 5HYAA 4UVCB 5C8YE 1G8XA 4ZS2A 4OYJA 2I59A 4Z8XA 3RC8A 5AFUL 4L9IA 3PUQA 4GYRA 3ZN0B 4WBOA 1OWAA 3UFEA 4CI2B 4E7ZA 3N5LA 3MJXA 3E0ZA 3RYIE 5J1GA 4AQFA 3ZJ1A 2ODUA 1D1BA 4O4HE 3ANWA 5JDMA 1IAPA 2BVMA 2DWGA 5LNKA 3EDVA 2H7OA 1MMAA 1YW0A 4P0BA 4U72A 4UF0B 3ZPOA 4OHFA 2Q9QB 1HCIA 4J2CA 2ZLYA 4GIWA 2E9XD 4O2AE 4GOUA 2E9XA 4ADZA 1BR2A 5FNVE 3LBXB 1D0YA 2ZMAA 4AI6A 2YEVC 1H7CA 3CMLA 3H37A 3LFMA 3ZN1B 4ISTA 5FMNA 5ADXL 4BJMA 3OYZA 4MHCA 4HFVA 1MIWA 2PBIA 4OYKA 3I1AA 3U78A 5LJMA 1O3XA 2E8IA 2EHOA 5L3EB 2MYSA 4ISSA 1BR0A 3KVBA 5LHHB 2X9YA 3KV9A 2BZBA 5FXZA 2IC6A 2V7LA 5IHYA 1E1HB 4CZZB 1UCUA 3RX6A 1ZV4X 4PJNA 3NRXA 3UUNA 3LK3B 5L2LA 4YHJA 1FMWA 4AKGA 4C90A 5HXSA 1ZHCA 2C5IT 3PURA 4ZHQE 1EZ3A 2LOPA 3L3PA 5LJNA 2WM9A 1SA0E 3VKGA 1D1CA 1HG5A 5CA1E 3MZKB 5DQWA 5IYZE 5L3BB 3ZJ2A 2DNXA 4UIGA 5HXCA 5EZYE 5LHGB 4AKRB 5L3FB 3AVRA 1ZKEA 4IE7A 5GONE 3V5SA 3KV6A 3PUAA 5JVDE 4NUUA 3AA6B 3AAIA 2XAFB 4EIWA 3P8CD 3UULA 1LKXA 3RRCA 4EB6E 3FXEB 2CWOA 3PUGA 4A56A 4DO0A 1WLXA 2N1GA 1Y64B 4BJNA 4YLHA 3UUMA 3J7Yq 3L09A 4N78D 2X9XA 3IF8B 3HA4A 2ES0A 4PFOA 3KBUA 1T98A 5LGUB 1FIOA 3ZCJA 3HI2A 2K48A 3NZPA 3KBTA 1WYBA 3KDSE 1D1AA 3AA0B 3UTKA 3R6NA 2PJQA 4M1PA 5JDQA 4ANJA 3Q9DA 3FXDB 2DI4A 2WSSV 5LG4A 4IE0A 2DLRA 1S35A 2W62A 4YJ2E 3C64A 1HTJF 5KDMC 1G73A 3W15B 4U74A 4ZS3A 3ZC0A 2KWHA 2K24A 4OK0A 1U5PA 3O1HA 5JDLA 3IEEA 5FXXA 3KFWX 4ZI2C 2NW9A 3AA7B 2RP4A 3VHLA 5L3GB 3ESLA 2XASB 3MACA 1S94A 3B57A 2LOSA 1BR1A 3BQLA 3PTRB 4TZ4C 4XBFB 4PJMA 2KINB 5LCYA 4JUYA 3RYCE 3H3AA 2JMHA 4I4TE 3LJCA 4QHOA 2X0LB 3D0TA 3TKLB 3RRWA 4X1YE 2W0GA 2CXDA 4B6XA 1FEWA 2UXXB 5HXRA 5CA0E 4ZI3C 4QX7B 2DHRA 5KMGP 2KZ7B 3SRZA 3O1IA 5FP3A 3ZYKA 5L3DB 2VKDA 2G0UA 2KNDA 2JMKA 4MLKA 3NBXX 3DTOA 2Q9QD 3N9OA 4UF0A 2KWIB 2Q9QA 4UV8B 4DMWA 2X51A 1MMGA 2M67A 3E08A 3OKQA 1KK7A 1IJ5A 2NOXA 3ETUA 2NW7A 3CQCB 3LBXA 2LHRA 4H9OC 4AQGA 2H3RA 3C50A 3AB3B 3ZC1A 2XAHB 1WRDA 2ZM0A 2XTLA 4V1Av 2X68A 3LK2B 4BA9A 4CQIA 2CE7A 4X20E 5DABA 2GK9A 3KV4A 4H63V 2CXFA 4HKAA 5FYMA 5JRCB 4P09A 4ZOLE 4I43B 3SS1A 4EAHA 1MNEA 3UT5E 3ZMVB 4C91A 4AKIA 2B1EA 3VKHA 5HAXA 2X9WA 5DJQC 5LGNB 3LG7A 5LYJE 2JPFA 3ZYMA 4DBQA 2V7MA 4AKLA 4F6RC 4IHJE 2CLYC 4EXTA 3NZQA 4ERRA 3KV5A 3E22E 5FXWA 1V9DA 2KMFA 2X9HA 3BQKA 3DP7A 3ZEFB 2LSYA 4XZCA 3HKEE 4ZI3D 5HWXA 4YJ3E 4X1IE 2ZM8A 3ZMZB 4QXCB 4AKHA 2LSGA 3GN5B 3WI3A 3OYXA 4E7SA 3CKDA 3HKCE 3N9LA 2WBLA 3EVYA 5LHIB 2L8KA 3CWZB 3N9NA 3HKBE 2LSIA 2L9QA 3C4XA 3OBVE 1YKHB 3CX7B 3FBZA 4HGAA 4JEUB 3BK9A 2VKJA 2IC9A 2BDEA 4UXNB 2BVLA 3ZMSB 5JR9C 3IBPA 3LK42 3SOLA 5EK3A 4HE8A 1IJ6A 3RC3A 4UV9B 2DCFA 1SHZC 3NRYA 4MBQA 3C51A 2V26A 1YKEB 2JQQA 4MFRA 3O4XE 3HL6A 2VK9A 5EK4A 3WAKA 4TUYE 4IE6A 1YD8G 2KT9A 3K3NA 5DQVA 2YU2A 3Q5XA 1MIVA 3IHRA 3QUJA 5H6QB 2VKHA 5J2UE 2D0TA 4PW8A 5FY1A 1NWMX 4TV8E 1D0ZA 3KVAA 2VB6A 1HX8A 3ZYLA 2XAGB 3MA9A 3O1JA 2Z6EA 1MMNA 3Q2MA 2LSJA 4EZHA 2ACXA 5JDFA 1OXZA 5EK2A 2X66A 4AQFC 1CUNA 4PJLA 4ILUA 3CX8B 2CLYB 2QGSA 3AAEB 3JC6C 3M65A 4H9NC 3BQIA 3I0QA 2H7VC 2OA5A 4ASKA 2HPJA 2WAUA 2NTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3D A;  2MTQ A; 
#chains in the Genus database with same CATH topology
 1D0X A;  5HEO A;  3RYF E;  4ZZC A;  1VCT A;  2LM9 A;  4WNK A;  3PU3 A;  3OJA A;  5LP6 E;  2RA1 A;  1B7T A;  4H9R C;  4PK6 A;  4DMV A;  2J47 A;  4MAL A;  3PUX F;  2OV9 A;  2A3D A;  3CX6 B;  4BAY B;  4JV5 T;  3AE1 A;  3UU3 A;  4IL9 A;  2YIN A;  4K0U A;  2E5L T;  4DUY T;  1KNZ A;  4LF7 T;  4ZI2 D;  4GYS A;  2VKO A;  3K3Q C;  3JAE A;  3CQX C;  1W09 A;  4DID B;  4CN6 A;  4DV4 T;  3JC6 D;  5FY7 A;  3FZH B;  3QB5 K;  1Z0P A;  4JEH B;  4UVB B;  3UQ4 A;  4HEA A;  1T8B A;  1FMV A;  3J9X 1;  2XM2 A;  1NEN A;  3C4Z A;  4H9P C;  4YHH T;  5TAO A;  2EHO D;  1UX5 A;  4DUZ T;  3UUX B;  2RPA A;  1LVK A;  3EAM A;  3AEG A;  3FBL A;  1VRB A;  2WMO A;  4OFZ A;  2VUR A;  4EYY R;  2NWB A;  4TWD A;  1U4Q A;  4HTE A;  3K3O A;  4IDQ A;  1MMD A;  1VOM A;  2XQ3 A;  3EAB A;  2NR4 A;  4F8H A;  2V1D B;  4DR3 T;  2VWA A;  2IAK A;  4CXX A;  2YOE A;  3PUS A;  2A72 A;  2LHN A;  5AQU B;  1SUM B;  5JDH A;  3H3M A;  2XQ9 A;  5LOV E;  1YXR A;  4QXH B;  2V7K A;  4O4J E;  2XQY A;  2Y6X A;  3OTO T;  2LT3 A;  2XQ5 A;  3GMI A;  4IGU A;  2Y48 B;  5F8P A;  4IE4 A;  2JQK A;  3SFE A;  2HPL A;  4UVC B;  4UR9 A;  4Z8X A;  2IHR 1;  2M6I A;  4ZZB A;  2HN1 A;  3ZN0 B;  4CI2 B;  4U7Y A;  4WZX A;  3N5L A;  3MJX A;  3RYI E;  2H88 A;  4AQF A;  4O4H E;  5LNK A;  1IAP A;  2DWG A;  1UUS A;  4UF0 B;  4KI0 F;  4OHF A;  2ZLY A;  2E9X D;  3AE5 A;  5FNV E;  2ZMA A;  4AI6 A;  3AEE A;  3LFM A;  4IST A;  3FZF B;  4HFV A;  3RF1 A;  5L4H A;  1ZOY A;  2FJD A;  3KVB A;  4HFH A;  4LF5 T;  2X9Y A;  2WQY A;  4KHP T;  5L2L A;  1DU2 A;  4HWC A;  2C5I T;  3AE2 A;  2LOP A;  2WM9 A;  1SA0 E;  3RKG A;  5IYZ E;  3RI5 A;  5L3F B;  4KHZ F;  3V5S A;  3KV6 A;  1WR0 A;  3PUA A;  3PUZ F;  3AA6 B;  4NUU A;  4EIW A;  2LKG A;  2IDO B;  1LKX A;  1N33 T;  3L09 A;  4LF4 T;  4PFO A;  2FJE A;  3ZCJ A;  1WYB A;  3R6N A;  2PJQ A;  1Y01 A;  3Q9D A;  2DI4 A;  4QH4 A;  4HFI A;  1HTJ F;  4CN1 A;  5KDM C;  3ZC0 A;  4OK0 A;  4ZI2 C;  5L3G B;  3VHL A;  1S94 A;  1W9R A;  2LOS A;  3RIU A;  2WDR A;  4YSX A;  5LCY A;  2JMH A;  4QHO A;  1W0B A;  2UXX B;  5CA0 E;  3O1I A;  2WZI A;  2JMK A;  2Q9Q D;  2X0H A;  2M67 A;  3RQU A;  3AEA A;  2NW7 A;  2F4V T;  3C50 A;  1WRD A;  3AE8 A;  4BA9 A;  4CQI A;  2CE7 A;  3ZST A;  4H63 V;  4P1N A;  3ABV A;  5L4E A;  4P09 A;  4I43 B;  3SS1 A;  2AE9 A;  3ZMV B;  2B1E A;  5DJQ C;  3LG7 A;  4HFE A;  4AKL A;  4DR7 T;  2W66 A;  2CLY C;  3AXJ B;  4JI6 T;  4ERR A;  3ZEF B;  3HKE E;  2LKH A;  2BG9 A;  5HWX A;  3ZMZ B;  3VR8 A;  3OYX A;  3EVY A;  4NIQ A;  3HKB E;  3PJA J;  3OBV E;  3CX7 B;  4HGA A;  2VKJ A;  3UUB A;  5C3J A;  5JR9 C;  5CGM A;  4UV9 B;  2V26 A;  4MFR A;  3O4X E;  4U2Y A;  5BR8 T;  4LFA T;  4IE6 A;  3JAD A;  2D0T A;  4PW8 A;  5FY1 A;  4CN4 A;  1HX8 A;  3ZYL A;  3RGL A;  2LSJ A;  2W2U A;  5JDF A;  2UUB T;  1HNW T;  5FL1 A;  2X66 A;  1IBL T;  4PJL A;  2BS3 A;  3CX8 B;  2CLY B;  3I0Q A;  2E9X C;  5HEU A;  3F2E A;  3P7I A;  2CWY A;  2LSK A;  3SWH A;  4H9Q C;  2D5U A;  4HN9 A;  3Q5D A;  4IIJ E;  3CPZ A;  3HKD E;  2A2F X;  3N2O A;  2WU5 A;  5HXH A;  3WAJ A;  4A97 A;  2DWK A;  2PFV A;  3FZM B;  5AQG B;  1QUU A;  1Z8U A;  3ZLI A;  4FI5 A;  5HXE A;  3T1Y T;  4JBW F;  2V8S V;  5CJ5 A;  3R84 B;  4DV1 T;  4CI1 B;  2H89 A;  3QK6 A;  5AQH B;  3V5U A;  4IT4 A;  4PK5 A;  4DV6 T;  3P50 A;  3RKO A;  3ANW B;  3T8O A;  2SPC A;  1HF8 A;  3TLU A;  4B3M T;  5H6R B;  4GK5 E;  4HWF A;  3TLS A;  5FXV A;  3MK7 C;  2E9X B;  4DND A;  5HWY A;  4KUM B;  5LBQ B;  3TLV A;  3EDU A;  4QWN B;  3S4U A;  3ZMU B;  1MIY A;  3K1S A;  2NW8 A;  5E0O A;  2UXD T;  2JJ9 A;  4LF9 T;  4EYU A;  2XSA A;  1E2A A;  4X62 T;  4CXY A;  3SFD A;  3K8P C;  4O4L E;  4PK4 A;  4H63 H;  2FJB A;  4G63 A;  4B3S T;  2Q9Q C;  4UVA B;  4JI0 T;  4ZI7 E;  5ETW A;  2XQ6 A;  2CM0 A;  2C5J A;  3PUW F;  4P0A A;  2R6G F;  4PFP A;  2XY8 B;  4EOZ B;  1YQ4 A;  3ZCI A;  5JDG A;  2FBW A;  5ABE A;  2WB5 A;  3OVU A;  1M7K A;  3IA3 A;  3B13 A;  4JLE A;  3EHZ A;  1HX1 B;  1XWM A;  4DBR A;  4TN7 B;  3CQG B;  4EZ4 A;  2QVA A;  2QA7 A;  4IDZ A;  4AXP A;  1IZN B;  2YN6 A;  3AEB A;  3T1H T;  1I94 T;  5HYA A;  4ZS2 A;  2I59 A;  3FZK B;  4WBO A;  2ZM6 T;  2WS3 A;  5JDM A;  1YW0 A;  4P0B A;  4U72 A;  2Q9Q B;  1HCI A;  2XZE A;  4ADZ A;  4ILA A;  2YEV C;  1H7C A;  2VQE T;  3CML A;  2FUP A;  3FZL B;  3H37 A;  2B76 A;  4BJM A;  3OYZ A;  4JYA T;  2QRX A;  3I1A A;  3U78 A;  5AQO B;  2MYS A;  3RIF A;  3KV9 A;  2V7L A;  3RX6 A;  4PJN A;  4YHJ A;  3PUR A;  4ZHQ E;  3L3P A;  1D1C A;  1HG5 A;  2KSR A;  2BS2 A;  2V5C A;  3ZJ2 A;  2DNX A;  2YDS A;  2E5V A;  4AKR B;  1ZKE A;  2HHH T;  5JVD E;  4AIS A;  2XAF B;  3RRC A;  4EB6 E;  4A56 A;  1WLX A;  1Y64 B;  3J7Y q;  1QLB A;  4N78 D;  2ES0 A;  5LGU B;  1FIO A;  3HI2 A;  5FVL A;  3KBT A;  3KDS E;  1XMO T;  3AA0 B;  4M1P A;  2WSS V;  5HEJ A;  4IE0 A;  2LRL A;  2W62 A;  4YJ2 E;  4U74 A;  3O1H A;  5JDL A;  4YSZ A;  3ESL A;  2DL1 A;  5LB7 B;  1XDP A;  4PJM A;  4IDN A;  3H3A A;  4DR5 T;  4K0K T;  3RRW A;  3ZKR A;  2W0G A;  4B6X A;  2WU2 A;  4ZI3 C;  2DHR A;  2KZ7 B;  5L3D B;  5AQK B;  2VKD A;  2G0U A;  1HR0 T;  4MLK A;  3N9O A;  4UF0 A;  2X51 A;  3E08 A;  1XMQ T;  1KK7 A;  1IJ5 A;  2NOX A;  3ETU A;  2UXB T;  2JQH A;  2LHR A;  3L39 A;  4OX9 T;  4JI2 T;  2IML A;  3TLT A;  1R8I A;  4X20 E;  3RHW A;  2CXF A;  5FYM A;  5LG3 A;  5JRC B;  3UT5 E;  1J1J A;  3VKH A;  2JPF A;  4IHJ E;  4DV2 T;  2YKS A;  3E22 E;  3TLW A;  1T72 A;  2KMF A;  2X9H A;  3BQK A;  1J5W A;  1JNR A;  5AQF B;  4X1I E;  3GN5 B;  2XQ4 A;  4E7S A;  3CKD A;  3N9L A;  3CWZ B;  3N9N A;  2BKN A;  2L9Q A;  3FBZ A;  3BK9 A;  5FKY A;  2BDE A;  4UXN B;  3CIR A;  3RIU C;  4LML A;  3ZMS B;  3LK4 2;  5EK3 A;  3RC3 A;  5CFB A;  3NVO A;  1YKE B;  4DV5 T;  2V5D A;  2VK9 A;  4TUY E;  1GQE A;  3CK6 A;  4X66 T;  5DQV A;  5J2U E;  4YTM A;  1NWM X;  2XJ7 A;  2XQ7 A;  3MA9 A;  4EZH A;  1OXZ A;  5AQS B;  2QGS A;  3AAE B;  3JC6 C;  4H9N C;  2H7V C;  2OA5 A;  2CBI A;  3Q5W A;  4O2B E;  4UEM A;  4CXW A;  2D2S A;  1QSD A;  5CB4 E;  2VL0 A;  3PUV F;  2J1D G;  1FJG T;  4NPP A;  4DR6 T;  4YSY A;  3HR0 A;  2A9U A;  1NEK A;  2LM2 A;  4I55 E;  2EHO C;  1KNP A;  1KF6 A;  1WR6 A;  4JI8 T;  3MKD A;  3ZMT B;  2ACZ A;  2BG9 C;  2JRK A;  4QX8 B;  4DR2 T;  4O8S A;  3C98 B;  3MXZ A;  2LE8 A;  1CHU A;  3ONX A;  2VAS A;  3JCF A;  2KXP B;  3AXJ A;  2XSB A;  2D9D A;  5LBM A;  3UFG A;  4PAG A;  3N2K E;  5M4Y A;  1UGO A;  4KP3 C;  2CHN A;  3AVS A;  2YK0 A;  5BMV E;  5F3J A;  1XDO A;  2UU9 T;  2CHO A;  3N9Q A;  4Q25 A;  4ZXL A;  3NKZ A;  1AJ3 A;  2MOZ A;  1IBM T;  2YU1 A;  3C4W A;  5ABH A;  2ODV A;  5L3C B;  3QC9 A;  2K5B B;  2PTF A;  3ZT5 A;  4UEL A;  2XUE A;  4WYV A;  4LF6 T;  4KX6 A;  1US7 B;  2EHO B;  4TNW A;  1ZEE A;  2QYW A;  4DR4 T;  4YY3 T;  5J2T E;  2CRB A;  2CXL A;  2N2N A;  3FB2 A;  4IRE A;  4YT0 A;  4GK0 E;  4JI3 T;  3EUH A;  3G06 A;  3PU8 A;  4AQY T;  4G2A A;  2UUA T;  3AA1 B;  4EEB A;  2L3L A;  2MTQ A;  4XAX B;  2UXN B;  4PNI A;  4U33 A;  1WYC A;  2ZM2 A;  3O9X A;  2KLQ A;  2NTX A;  2IW5 B;  3KIN B;  1W0A A;  3P4Q A;  2XPK A;  4NUV A;  4U2Z A;  5JR9 A;  1JNZ A;  4PJJ A;  3PDY A;  2V6Y B;  5JDN A;  2Y8D A;  1OED C;  5KXJ A;  5JR9 B;  1KEY A;  5AQV B;  4WBN E;  3N9P A;  4FJO A;  4IE5 A;  2C5K T;  2BBH A;  1G8X A;  4OYJ A;  5AFU L;  2WCA A;  3PUQ A;  1OWA A;  3UFE A;  4E7Z A;  3E0Z A;  3ZJ1 A;  2VVN A;  2ODU A;  1D1B A;  3ANW A;  5AQI B;  5LMU T;  2H7O A;  1MMA A;  5HEG A;  3ZPO A;  2JQ9 A;  4GOU A;  2E9X A;  1KFY A;  3LBX B;  5FL0 A;  4HWH A;  1T7S A;  4TWF A;  5ADX L;  5LMN T;  5FMN A;  4QH1 A;  4MHC A;  2UUC T;  5LJM A;  2E8I A;  4IL4 A;  4X5T A;  4U7I A;  5L3E B;  4ISS A;  5LHH B;  2BBJ A;  2BZB A;  5FXZ A;  4TWH A;  4CZZ B;  1UCU A;  3UUN A;  3NRX A;  4Z90 A;  4C90 A;  5HXS A;  5LJN A;  2WY2 A;  3VKG A;  1OED B;  3MZK B;  4YXD A;  5L3B B;  2K3W A;  5HXC A;  3ONJ A;  4IE7 A;  2VQF T;  3UUL A;  4A5X A;  4DO0 A;  2CWO A;  3UUM A;  2X9X A;  3HA4 A;  3KBU A;  1T98 A;  1N36 T;  1D1A A;  4Z91 A;  1OED E;  3FXD B;  1S35 A;  3X1D A;  1G73 A;  3W15 B;  1U5P A;  4IDP A;  4NXM T;  3KFW X;  2UXC T;  2NW9 A;  4X64 T;  5AQM B;  2KIN B;  4JUY A;  1X9B A;  4B3R T;  3TKL B;  2X0L B;  4DV3 T;  4X1Y E;  1FEW A;  3UU6 A;  5AQQ B;  5KMG P;  3SRZ A;  4COF A;  5FP3 A;  1IBK T;  1XZY A;  2KND A;  3NBX X;  2KWI B;  3AE4 A;  2Q9Q A;  4UV8 B;  1MMG A;  5F5W A;  3OKQ A;  2H3R A;  3ZC1 A;  2WWV A;  2ZM0 A;  2X68 A;  2LLY A;  3LK2 B;  5DAB A;  2GK9 A;  3KV4 A;  2W67 A;  4HKA A;  2I6H A;  4ZOL E;  4EAH A;  4LMJ A;  1MNE A;  4AKI A;  5LYJ E;  3ZYM A;  2E2A A;  4LMK A;  4LF8 T;  2OLT A;  3P4R A;  5FXW A;  1V9D A;  1E7P A;  4ZEY A;  4QXC B;  4B3T T;  3Q5E A;  3VRA A;  3WI3 A;  3HKC E;  5LHI B;  2L8K A;  5ABF A;  4JEU B;  1HNX T;  2BVL A;  2HN2 A;  1XNR T;  1IJ6 A;  1SHZ C;  5ABF B;  3C51 A;  1YD8 G;  2YU2 A;  1MIV A;  3QB5 A;  3IHR A;  3QUJ A;  2VKH A;  3AEF A;  2CBJ A;  3LSV A;  4TV8 E;  1D0Z A;  3KVA A;  5HCM A;  4A98 A;  2XAG B;  3O1J A;  2XQ8 A;  4AQF C;  5IUX A;  4ILU A;  3M65 A;  2JIW A;  2MPK A;  4GKJ T;  2HPJ A;  2CMR A;  3F57 A;  1J5E T;  2I0M A;  5FY0 A;  3I9W A;  4QKN A;  2VL8 A;  2W63 A;  3N9M A;  4WW0 A;  4QXB B;  3GWH A;  2X67 A;  5IWA T;  4LFB T;  4HFC A;  2FJA A;  5L47 A;  2LEH A;  5JRC A;  5J0Z A;  1BR4 A;  1LRZ A;  2P9B A;  1HFA A;  3UU8 A;  2CCQ A;  1LVF A;  2V7I A;  4ILB A;  1X79 A;  3AAA B;  4O4I E;  2XAQ B;  2X0Y A;  4JI7 T;  1NAF A;  4ILC A;  3RYH E;  4EED A;  2XHE B;  4EGW A;  4X1K E;  3GN5 A;  4DV0 T;  2W61 A;  3I9Y A;  3N2G E;  4I50 E;  2PG8 A;  5JTG A;  5JRE A;  2XAJ B;  1HG2 A;  4TV9 E;  3A5X A;  4KMC A;  3RH3 A;  3NWI A;  1N32 T;  4X65 T;  3CVR A;  4HFB A;  4H9S E;  3A8Y C;  2WWU A;  1HNZ T;  4EV6 A;  3QOF A;  1MND A;  3VR9 A;  4L5G A;  1HS7 A;  2XM1 A;  3P4S A;  3VU7 H;  2BS4 A;  2YDR A;  5LA6 E;  3AE6 A;  2K9A A;  3PE0 A;  3AE7 A;  2LJL A;  4TX5 A;  3UQ7 A;  1L0V A;  3OPC A;  2W00 A;  3F31 A;  2HH7 A;  4L0R A;  2N9D A;  3U3I A;  2CEA A;  2D0U A;  4DV7 T;  5JQG E;  2VVS A;  4DVD A;  3ETV A;  1M62 A;  4JI5 T;  2C0S A;  5LGT B;  3DJB A;  3ZT7 A;  4HFD A;  1YQ3 A;  2CA5 A;  2NP9 A;  5JH7 E;  2MBG A;  2BKP A;  5HCJ A;  3UU5 A;  3RPU A;  5LXT E;  5ABG A;  1UX4 A;  3I0O A;  5FVK A;  4YFS A;  3PUY F;  1VCS A;  3FHN A;  2V7J A;  3RQW A;  2WMN A;  2MAW A;  5KX5 E;  5A1L A;  4KBM B;  3A7M A;  3GA8 A;  4HWI B;  3AED A;  4CI3 B;  3L8R A;  2M6B A;  4TNV A;  5C8Y E;  1WFD A;  3RC8 A;  4L9I A;  4GYR A;  3RLF F;  5HEH A;  5J1G A;  3PV0 F;  2BVM A;  3EDV A;  4J2C A;  1I6Z A;  4GIW A;  4O2A E;  3VRB A;  1BR2 A;  1D0Y A;  2J4G A;  3ZN1 B;  4U31 A;  1MIW A;  2PBI A;  3ONL C;  4OYK A;  3AE3 A;  1KNR A;  1O3X A;  2EHO A;  1BR0 A;  2IC6 A;  5IHY A;  1E1H B;  1ZV4 X;  3LK3 B;  3PJA A;  1FMW A;  4AKG A;  3AEC A;  3ZSS A;  1ZHC A;  4U3C A;  2LRK A;  1EZ3 A;  3RIA A;  5CA1 E;  5DQW A;  4IDO A;  2BG9 B;  4UIG A;  5EZY E;  4GKK T;  5LHG B;  4I0U A;  3AVR A;  3AE9 A;  5GON E;  3AAI A;  5AQP B;  3P8C D;  5AQJ B;  2WZH A;  4JI1 T;  3FXE B;  3PUG A;  2WDQ A;  2N1G A;  4BJN A;  4YLH A;  3IF8 B;  1N34 T;  2K48 A;  3NZP A;  3UTK A;  5JDQ A;  4ANJ A;  4JI4 T;  5LG4 A;  2DLR A;  5AQT B;  5C2T A;  2BG9 E;  3C64 A;  2V6Y A;  4ZS3 A;  2KWH A;  2K24 A;  5AQL B;  4AIU A;  3IEE A;  5FXX A;  3AA7 B;  2RP4 A;  3P4W A;  2XAS B;  3QNU A;  3MAC A;  3B57 A;  3BQL A;  1BR1 A;  3PTR B;  4YTP A;  4TZ4 C;  4XBF B;  2J62 A;  1XNQ T;  3RYC E;  4I4T E;  3LDQ B;  3LJC A;  3D0T A;  2W4X A;  5AQR B;  4NXN T;  1WCR A;  2CXD A;  3B5M A;  5HXR A;  1UUR A;  4QX7 B;  4HWD A;  3ZYK A;  3DTO A;  4DMW A;  2WP9 A;  4H9O C;  4AQG A;  3CQC B;  3LBX A;  3AB3 B;  3UU4 A;  2XAH B;  2IUB A;  3JAF A;  2V6X A;  4DR1 T;  4V1A v;  2XTL A;  3M3Z B;  4LFC T;  1ZP0 A;  2XQA A;  2BKO A;  2AXD S;  4C91 A;  3ZT6 A;  5HAX A;  2X9W A;  5LGN B;  4DBQ A;  2V7M A;  4F6R C;  4EXT A;  3NZQ A;  3KV5 A;  1OED A;  3DP7 A;  2LSY A;  4XZC A;  4ZI3 D;  1SE7 A;  4YJ3 E;  2ZM8 A;  4AKH A;  2LSG A;  2WBL A;  2IIU A;  3EI0 A;  2CPT A;  2LSI A;  3C4X A;  1YKH B;  2IC9 A;  3IBP A;  1UK5 A;  3SOL A;  4HE8 A;  2DCF A;  3NRY A;  4MBQ A;  2JQQ A;  4QH5 A;  3HL6 A;  5EK4 A;  3WAK A;  2KT9 A;  3K3N A;  3Q5X A;  5H6Q B;  5AQN B;  2YDQ A;  2VB6 A;  2WDV A;  2Z6E A;  1MMN A;  3Q2M A;  2ACX A;  5EK2 A;  1CUN A;  3BQI A;  3P4P A;  4ASK A;  2WAU A;  4YTN A;  2NTY A; 
#chains in the Genus database with same CATH homology
 1D0X A;  2E9X C;  2CMR A;  3F57 A;  3Q5W A;  3RYF E;  3F2E A;  3P7I A;  2CWY A;  5FY0 A;  3I9W A;  4O2B E;  2LSK A;  4UEM A;  4QKN A;  4CXW A;  2LM9 A;  2D2S A;  2VL8 A;  1QSD A;  2W63 A;  5CB4 E;  3SWH A;  3N9M A;  4WNK A;  4H9Q C;  3PU3 A;  2J1D G;  3OJA A;  4WW0 A;  2D5U A;  5LP6 E;  2RA1 A;  1B7T A;  4HN9 A;  4QXB B;  3HR0 A;  3GWH A;  4IIJ E;  2X67 A;  4I55 E;  2EHO C;  3CPZ A;  4H9R C;  3HKD E;  4PK6 A;  4DMV A;  2A2F X;  3N2O A;  5HXH A;  3WAJ A;  2LEH A;  2DWK A;  4MAL A;  5JRC A;  2PFV A;  2A3D A;  1WR6 A;  3CX6 B;  3MKD A;  1QUU A;  1BR4 A;  3ZMT B;  2JRK A;  1LRZ A;  2P9B A;  1HFA A;  4QX8 B;  3ZLI A;  4BAY B;  4O8S A;  3C98 B;  3MXZ A;  4FI5 A;  2CCQ A;  2LE8 A;  5HXE A;  3ONX A;  1LVF A;  2YIN A;  2VAS A;  2V7I A;  2KXP B;  4K0U A;  1KNZ A;  1X79 A;  3AAA B;  5LBM A;  4ZI2 D;  4GYS A;  4O4I E;  4PAG A;  2XAQ B;  2VKO A;  3K3Q C;  1NAF A;  3CQX C;  3N2K E;  3RYH E;  3R84 B;  5M4Y A;  4KP3 C;  2XHE B;  3AVS A;  3JC6 D;  4CI1 B;  5FY7 A;  2YK0 A;  3QK6 A;  5BMV E;  5F3J A;  4X1K E;  3V5U A;  3N9Q A;  4PK5 A;  3GN5 A;  1Z0P A;  4JEH B;  4UVB B;  2W61 A;  3I9Y A;  3N2G E;  1AJ3 A;  4I50 E;  2MOZ A;  2PG8 A;  4HEA A;  2YU1 A;  3C4W A;  3RKO A;  1FMV A;  3ANW B;  3T8O A;  2SPC A;  2ODV A;  5L3C B;  1HF8 A;  5JRE A;  2XAJ B;  3QC9 A;  1HG2 A;  3J9X 1;  2K5B B;  4TV9 E;  4UEL A;  2XUE A;  4GK5 E;  5H6R B;  3A5X A;  3C4Z A;  4H9P C;  5FXV A;  5TAO A;  3MK7 C;  2E9X B;  4DND A;  2EHO D;  4KMC A;  1UX5 A;  3RH3 A;  5HWY A;  3UUX B;  3CVR A;  4H9S E;  1LVK A;  4KUM B;  5LBQ B;  3EDU A;  4QWN B;  3S4U A;  2WWU A;  3ZMU B;  3FBL A;  1MND A;  1MIY A;  1VRB A;  2NW8 A;  2WMO A;  5E0O A;  1HS7 A;  4L5G A;  4OFZ A;  1US7 B;  2EHO B;  3VU7 H;  1ZEE A;  5LA6 E;  2K9A A;  3PE0 A;  4EYY R;  2JJ9 A;  2NWB A;  4EYU A;  2LJL A;  1U4Q A;  4HTE A;  3K3O A;  5J2T E;  4TX5 A;  2CXL A;  4CXY A;  1MMD A;  2N2N A;  1VOM A;  3FB2 A;  3K8P C;  4O4L E;  4PK4 A;  2V1D B;  4GK0 E;  2VWA A;  2W00 A;  2IAK A;  4H63 H;  3F31 A;  2HH7 A;  3EUH A;  4L0R A;  4CXX A;  4G63 A;  2N9D A;  3PU8 A;  3U3I A;  2Q9Q C;  4UVA B;  2CEA A;  4G2A A;  3AA1 B;  2D0U A;  3PUS A;  2A72 A;  2LHN A;  4ZI7 E;  5ETW A;  2CM0 A;  5JDH A;  5JQG E;  2C5J A;  4DVD A;  2L3L A;  2MTQ A;  3ETV A;  4P0A A;  4XAX B;  4PFP A;  2UXN B;  5LOV E;  4EOZ B;  2C0S A;  4QXH B;  4PNI A;  5LGT B;  2V7K A;  3DJB A;  1WYC A;  2ZM2 A;  3ZCI A;  5JDG A;  2CA5 A;  2NP9 A;  4O4J E;  2XQY A;  5JH7 E;  3O9X A;  2MBG A;  2KLQ A;  2NTX A;  2Y6X A;  2IW5 B;  3KIN B;  3B13 A;  3RPU A;  4JLE A;  5LXT E;  4NUV A;  2LT3 A;  5JR9 A;  1UX4 A;  3I0O A;  4YFS A;  3GMI A;  4PJJ A;  3PDY A;  4IGU A;  4DBR A;  5JDN A;  3FHN A;  2Y48 B;  4TN7 B;  2V7J A;  3CQG B;  4EZ4 A;  2Y8D A;  5F8P A;  2WMN A;  5KX5 E;  4IE4 A;  5JR9 B;  2QA7 A;  4IDZ A;  4AXP A;  1IZN B;  3N9P A;  4FJO A;  4KBM B;  4WBN E;  5A1L A;  3GA8 A;  4IE5 A;  2C5K T;  4CI3 B;  2HPL A;  5HYA A;  4UVC B;  5C8Y E;  1G8X A;  4ZS2 A;  4OYJ A;  2I59 A;  4Z8X A;  3RC8 A;  5AFU L;  4L9I A;  3PUQ A;  4GYR A;  3ZN0 B;  4WBO A;  1OWA A;  3UFE A;  4CI2 B;  4E7Z A;  3N5L A;  3MJX A;  3E0Z A;  3RYI E;  5J1G A;  4AQF A;  3ZJ1 A;  2ODU A;  1D1B A;  4O4H E;  3ANW A;  5JDM A;  1IAP A;  2BVM A;  2DWG A;  5LNK A;  3EDV A;  2H7O A;  1MMA A;  1YW0 A;  4P0B A;  4U72 A;  4UF0 B;  3ZPO A;  4OHF A;  2Q9Q B;  1HCI A;  4J2C A;  2ZLY A;  4GIW A;  2E9X D;  4O2A E;  4GOU A;  2E9X A;  4ADZ A;  1BR2 A;  5FNV E;  3LBX B;  1D0Y A;  2ZMA A;  4AI6 A;  2YEV C;  1H7C A;  3CML A;  3H37 A;  3LFM A;  3ZN1 B;  4IST A;  5FMN A;  5ADX L;  4BJM A;  3OYZ A;  4MHC A;  4HFV A;  1MIW A;  2PBI A;  4OYK A;  3I1A A;  3U78 A;  5LJM A;  1O3X A;  2E8I A;  2EHO A;  5L3E B;  2MYS A;  4ISS A;  1BR0 A;  3KVB A;  5LHH B;  2X9Y A;  3KV9 A;  2BZB A;  5FXZ A;  2IC6 A;  2V7L A;  5IHY A;  1E1H B;  4CZZ B;  1UCU A;  3RX6 A;  1ZV4 X;  4PJN A;  3NRX A;  3UUN A;  3LK3 B;  5L2L A;  4YHJ A;  1FMW A;  4AKG A;  4C90 A;  5HXS A;  1ZHC A;  2C5I T;  3PUR A;  4ZHQ E;  1EZ3 A;  2LOP A;  3L3P A;  5LJN A;  2WM9 A;  1SA0 E;  3VKG A;  1D1C A;  1HG5 A;  5CA1 E;  3MZK B;  5DQW A;  5IYZ E;  5L3B B;  3ZJ2 A;  2DNX A;  4UIG A;  5HXC A;  5EZY E;  5LHG B;  4AKR B;  5L3F B;  3AVR A;  1ZKE A;  4IE7 A;  5GON E;  3V5S A;  3KV6 A;  3PUA A;  5JVD E;  4NUU A;  3AA6 B;  3AAI A;  2XAF B;  4EIW A;  3P8C D;  3UUL A;  1LKX A;  3RRC A;  4EB6 E;  3FXE B;  2CWO A;  3PUG A;  4A56 A;  4DO0 A;  1WLX A;  2N1G A;  1Y64 B;  4BJN A;  4YLH A;  3UUM A;  3J7Y q;  3L09 A;  4N78 D;  2X9X A;  3IF8 B;  3HA4 A;  2ES0 A;  4PFO A;  3KBU A;  1T98 A;  5LGU B;  1FIO A;  3ZCJ A;  3HI2 A;  2K48 A;  3NZP A;  3KBT A;  1WYB A;  3KDS E;  1D1A A;  3AA0 B;  3UTK A;  3R6N A;  2PJQ A;  4M1P A;  5JDQ A;  4ANJ A;  3Q9D A;  3FXD B;  2DI4 A;  2WSS V;  5LG4 A;  4IE0 A;  2DLR A;  1S35 A;  2W62 A;  4YJ2 E;  3C64 A;  1HTJ F;  5KDM C;  1G73 A;  3W15 B;  4U74 A;  4ZS3 A;  3ZC0 A;  2KWH A;  2K24 A;  4OK0 A;  1U5P A;  3O1H A;  5JDL A;  3IEE A;  5FXX A;  3KFW X;  4ZI2 C;  2NW9 A;  3AA7 B;  2RP4 A;  3VHL A;  5L3G B;  3ESL A;  2XAS B;  3MAC A;  1S94 A;  3B57 A;  2LOS A;  1BR1 A;  3BQL A;  3PTR B;  4TZ4 C;  4XBF B;  4PJM A;  2KIN B;  5LCY A;  4JUY A;  3RYC E;  3H3A A;  2JMH A;  4I4T E;  3LJC A;  4QHO A;  2X0L B;  3D0T A;  3TKL B;  3RRW A;  4X1Y E;  2W0G A;  2CXD A;  4B6X A;  1FEW A;  2UXX B;  5HXR A;  5CA0 E;  4ZI3 C;  4QX7 B;  2DHR A;  5KMG P;  2KZ7 B;  3SRZ A;  3O1I A;  5FP3 A;  3ZYK A;  5L3D B;  2VKD A;  2G0U A;  2KND A;  2JMK A;  4MLK A;  3NBX X;  3DTO A;  2Q9Q D;  3N9O A;  4UF0 A;  2KWI B;  2Q9Q A;  4UV8 B;  4DMW A;  2X51 A;  1MMG A;  2M67 A;  3E08 A;  3OKQ A;  1KK7 A;  1IJ5 A;  2NOX A;  3ETU A;  2NW7 A;  3CQC B;  3LBX A;  2LHR A;  4H9O C;  4AQG A;  2H3R A;  3C50 A;  3AB3 B;  3ZC1 A;  2XAH B;  1WRD A;  2ZM0 A;  2XTL A;  4V1A v;  2X68 A;  3LK2 B;  4BA9 A;  4CQI A;  2CE7 A;  4X20 E;  5DAB A;  2GK9 A;  3KV4 A;  4H63 V;  2CXF A;  4HKA A;  5FYM A;  5JRC B;  4P09 A;  4ZOL E;  4I43 B;  3SS1 A;  4EAH A;  1MNE A;  3UT5 E;  3ZMV B;  4C91 A;  4AKI A;  2B1E A;  3VKH A;  5HAX A;  2X9W A;  5DJQ C;  5LGN B;  3LG7 A;  5LYJ E;  2JPF A;  3ZYM A;  4DBQ A;  2V7M A;  4AKL A;  4F6R C;  4IHJ E;  2CLY C;  4EXT A;  3NZQ A;  4ERR A;  3KV5 A;  3E22 E;  5FXW A;  1V9D A;  2KMF A;  2X9H A;  3BQK A;  3DP7 A;  3ZEF B;  2LSY A;  4XZC A;  3HKE E;  4ZI3 D;  5HWX A;  4YJ3 E;  4X1I E;  2ZM8 A;  3ZMZ B;  4QXC B;  4AKH A;  2LSG A;  3GN5 B;  3WI3 A;  3OYX A;  4E7S A;  3CKD A;  3HKC E;  3N9L A;  2WBL A;  3EVY A;  5LHI B;  2L8K A;  3CWZ B;  3N9N A;  3HKB E;  2LSI A;  2L9Q A;  3C4X A;  3OBV E;  1YKH B;  3CX7 B;  3FBZ A;  4HGA A;  4JEU B;  3BK9 A;  2VKJ A;  2IC9 A;  2BDE A;  4UXN B;  2BVL A;  3ZMS B;  5JR9 C;  3IBP A;  3LK4 2;  3SOL A;  5EK3 A;  4HE8 A;  1IJ6 A;  3RC3 A;  4UV9 B;  2DCF A;  1SHZ C;  3NRY A;  4MBQ A;  3C51 A;  2V26 A;  1YKE B;  2JQQ A;  4MFR A;  3O4X E;  3HL6 A;  2VK9 A;  5EK4 A;  3WAK A;  4TUY E;  4IE6 A;  1YD8 G;  2KT9 A;  3K3N A;  5DQV A;  2YU2 A;  3Q5X A;  1MIV A;  3IHR A;  3QUJ A;  5H6Q B;  2VKH A;  5J2U E;  2D0T A;  4PW8 A;  5FY1 A;  1NWM X;  4TV8 E;  1D0Z A;  3KVA A;  2VB6 A;  1HX8 A;  3ZYL A;  2XAG B;  3MA9 A;  3O1J A;  2Z6E A;  1MMN A;  3Q2M A;  2LSJ A;  4EZH A;  2ACX A;  5JDF A;  1OXZ A;  5EK2 A;  2X66 A;  4AQF C;  1CUN A;  4PJL A;  4ILU A;  3CX8 B;  2CLY B;  2QGS A;  3AAE B;  3JC6 C;  3M65 A;  4H9N C;  3BQI A;  3I0Q A;  2H7V C;  2OA5 A;  4ASK A;  2HPJ A;  2WAU A;  2NTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...