2A3DA

Solution structure of a de novo designed single chain three-helix bundle (a3d)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
b'MGSWAEFKQRLAAIKTRLQALGGSEAELAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDELQAYRHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (DE NOVO THREE-HELIX BUNDLE)
molecule tags Three-helix bundle
source organism Synthetic construct
publication title Solution structure and dynamics of a de novo designed three-helix bundle protein.
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a3dA00
2MTQA 2A3DA
chains in the Genus database with same CATH superfamily
3M3ZB 2Y48B 4DBRA 3R84B 2H89A 2YN6A 4DV0T 2UUAT 4H9QC 4N78D 3K3NA 2FBWA 2LSJA 3HA4A 4U2YA 1XDPA 2C0SA 3O1JA 3OYXA 4UF0A 2DNXA 4HWHA 4CI1B 5KXJA 1HFAA 4LF7T 3QB5A 2XASB 3FXEB 4CI2B 3N5LA 4EIWA 5C2TA 5LHIB 1N33T 3LK2B 5LXTE 2IW5B 3PUYF 2K9AA 5JR9A 5LBQB 3UU6A 3V5UA 1Z0PA 3ONLC 2XAQB 3WAKA 3OKQA 5HXRA 1XZYA 1WYBA 3QK6A 3G06A 3HKEE 5FVKA 3ZT6A 1D0YA 3AEGA 3N9MA 4JI0T 3I1AA 5HXEA 1KEYA 4GYSA 2YDQA 1OXZA 3AE4A 2XAHB 3N2KE 3OPCA 4IDQA 2K5BB 2NTXA 3FBLA 3K8PC 3N9NA 4GK5E 4F8HA 3NRYA 4A5XA 5ABEA 1MNEA 5HXHA 1WR0A 5DQVA 5KX5E 3RYHE 3ZEFB 5LGUB 1QSDA 2X9YA 3LBXA 4HFHA 4DR4T 2UXBT 4EB6E 1XDOA 2VKHA 3PJAJ 3PUAA 2P9BA 3AAEB 1B7TA 2W2UA 1WYCA 1YW0A 2GK9A 2J47A 3KINB 2LSKA 3JAFA 2XQ9A 4U3CA 3Q2MA 3U78A 2XSBA 3VKHA 2I59A 3RIUA 2XZEA 3ABVA 5BR8T 2BBJA 4PJMA 4NIQA 4ZZBA 4IE0A 5CFBA 1JNRA 4YFSA 3RX6A 4KHZF 3RF1A 4ILCA 1IZNB 3RIFA 2CWYA 1ZKEA 2V7IA 2E9XA 2YU1A 4EYYR 1HG5A 4I43B 2FJEA 3SFEA 4DV4T 4JEUB 2N2NA 4TV9E 3RYCE 4ZZCA 4DO0A 2WU5A 4DR3T 3BQKA 5JDQA 3O9XA 3AA0B 3C4XA 3RLFF 1N32T 4CXXA 4IDZA 3L39A 4CXWA 2CLYC 2MBGA 1W0BA 3Q5DA 5LMNT 2EHOA 5LHGB 2W4XA 2DWGA 3ZJ1A 2JMHA 2V6YB 3FZMB 5FMNA 3VRAA 2W63A 2CM0A 2VQET 1S94A 4PK5A 4QX8B 4TV8E 4Z8XA 4JI7T 2LE8A 2C5JA 2BVLA 4DV3T 2IAKA 4WYVA 4ZHQE 2WY2A 1U4QA 1YD8G 3TLVA 5LG4A 3WAJA 1DU2A 3I9YA 3C98B 5E0OA 4P0BA 1I94T 3P50A 2KWHA 4AKHA 2R6GF 3O1HA 2UXCT 3ZSTA 3C4WA 1W09A 1SA0E 3FBZA 2PBIA 2PFVA 3HKBE 1HF8A 3QUJA 2X66A 2CMRA 2K24A 3F2EA 3UTKA 4TWFA 4YY3T 4B3MT 4QXCB 4BAYB 4U31A 1MNDA 3E22E 2X68A 4MLKA 2BG9C 3RHWA 2KLQA 3MACA 4HN9A 4COFA 3A5XA 2Q9QB 1X9BA 2JQ9A 3P8CD 4A98A 4EXTA 4E7ZA 2JIWA 4O8SA 5IUXA 4ZI7E 3MKDA 5L3BB 2ZLYA 1JNZA 5TAOA 5AQFB 4OX9T 1CHUA 2CE7A 5L47A 3ZYLA 2A72A 1M7KA 4CN6A 2WMOA 4AXPA 5LHHB 4DUYT 4XZCA 2XQ5A 5FXVA 2KXPB 5FY0A 1KNPA 1IJ6A 2XQAA 3IBPA 2CA5A 5HWYA 5JRCB 3ANWA 5DJQC 2MTQA 2MYSA 3ZC1A 2ZM8A 3LBXB 2QGSA 2FUPA 2Q9QD 3EABA 2CCQA 2VB6A 3LK42 2KSRA 3PUWF 2FJAA 2E9XC 5AQJB 4E7SA 5LP6E 1J5WA 2QVAA 3O1IA 3RC3A 2XQ7A 4B6XA 4HFVA 3ZSSA 3P4RA 3ZMVB 3B13A 5IWAT 2V1DB 2CRBA 3A7MA 4MFRA 5FY1A 5LA6E 2M6IA 2M67A 2DLRA 2V5CA 3K3OA 3PJAA 4G63A 2CPTA 3UU3A 4AQGA 1R8IA 4ZEYA 5CJ5A 2HHHT 1MIVA 2V7MA 4H9OC 1HG2A 1OEDB 3DJBA 2XQ6A 3Q5EA 4AISA 4LF4T 4DV6T 3BQLA 2V7LA 2HH7A 3AAAB 4ILBA 3SFDA 4CN4A 3UUXB 4JYAT 3ZT7A 1XWMA 4HFEA 1GQEA 3CK6A 3CQXC 3EI0A 4NUUA 5KMGP 4EEBA 5LYJE 3AXJB 3U3IA 5LMUT 1U5PA 3HKCE 4ASKA 3ETUA 5L4EA 2Y8DA 1G73A 4IL4A 3GA8A 4IL9A 4U33A 4HFIA 2WDQA 2W0GA 3AE8A 3D0TA 5AQHB 5AQKB 4EV6A 5LJNA 4LF6T 1FMVA 3EAMA 3L3PA 4FJOA 5CGMA 2XM2A 2XPKA 4MBQA 3HL6A 2JJ9A 2Q9QC 2WP9A 3H3AA 2NWBA 2LRLA 3N2OA 5FYMA 2ODUA 3IEEA 4PJLA 3K3QC 4YJ2E 5ADXL 2CEAA 1X79A 2IC9A 2BS4A 1MIYA 2PJQA 4OK0A 3JC6C 1ZV4X 4QH5A 2IC6A 4CZZB 5CA0E 4XBFB 3CPZA 4I50E 4IE4A 3PUGA 3NZPA 4TX5A 3T8OA 3FZHB 5L3GB 3W15B 5FXZA 1LKXA 4PFOA 3AA7B 4UVAB 3RQUA 4PAGA 2CHNA 4ILAA 2DHRA 2F4VT 2E5VA 2ZM0A 5C8YE 2IMLA 1MMAA 3P7IA 3UFEA 2E9XB 2XQ8A 3EHZA 3FHNA 4DV5T 2YKSA 5FKYA 1S35A 2WDVA 3TLTA 2VVSA 5LNKA 3C50A 2XAFB 1ZEEA 2LHRA 4KHPT 2XJ7A 3CQGB 1IBKT 4O4IE 5AQRB 4UVCB 2HPLA 2WCAA 2H3RA 2BG9A 3FZKB 4IHJE 3X1DA 4ANJA 1BR2A 3MZKB 4BA9A 2XTLA 4BJMA 1Y64B 3UU4A 3B57A 4A56A 5LBMA 4HFDA 5DQWA 3KVBA 2SPCA 3AEAA 4G2AA 4YHHT 3AXJA 3N2GE 3SWHA 4TNVA 3RKGA 4NPPA 3TKLB 4YXDA 3VHLA 5JDFA 5LB7B 4DV2T 2NR4A 2RP4A 2JRKA 2VK9A 2KT9A 1OEDA 2E9XD 4O4JE 4ADZA 2CHOA 2DI4A 3LSVA 3M65A 4DV7T 5FXWA 4LF8T 1Z8UA 3O4XE 3LK3B 1XNRT 1KNRA 1HNZT 4EEDA 2X9XA 2XUEA 4HWCA 5HXCA 3RYIE 1N36T 2LSIA 2J1DG 3I0OA 5H6QB 5CA1E 5L4HA 4DR1T 5HAXA 3KV9A 2YK0A 5F3JA 2IIUA 2XQ3A 4PK6A 4AIUA 2J62A 1E1HB 1MMGA 3AVSA 2LHNA 5JTGA 4HGAA 3J9X1 4JV5T 4AKIA 3HI2A 3UFGA 3KDSE 1XMOT 2UXNB 5AQIB 5JRCA 4QX7B 2NP9A 3A8YC 3LJCA 2BS2A 2W62A 3ZYMA 2E2AA 3RI5A 4NXNT 3FZLB 4QKNA 2WDRA 2WS3A 4HE8A 3CMLA 5JDNA 2BG9E 4JBWF 3BQIA 1MMDA 2WAUA 3CVRA 4HWDA 3AEBA 4UEMA 3ZC0A 4O4LE 3JADA 4CI3B 5LGTB 2BBHA 4YHJA 2HN1A 2YOEA 3ONJA 3RH3A 2BKNA 2ACZA 2W61A 2KINB 4X65T 2BKPA 2W66A 3L8RA 4IGUA 4DMVA 5AQVB 2C5IT 4WBNE 4X62T 2CWOA 2YDSA 2Z6EA 3EVYA 4QHOA 1FMWA 2LKGA 3SOLA 3WI3A 4H9PC 5A1LA 1HS7A 2CBIA 4EZ4A 2HN2A 5EK3A 4B3TT 1CUNA 3GN5B 3QB5K 4H9SE 2RA1A 3AE5A 4GIWA 2X0HA 5L3FB 2W00A 3E0ZA 5L3DB 3UU8A 1KNZA 2V8SV 3RYFE 3NZQA 5ABHA 4KX6A 2WM9A 3CX6B 4HFBA 5JDLA 2D2SA 5LJMA 3ZCIA 2AXDS 4ZOLE 2BG9B 2UUCT 3Q9DA 2XQYA 3AE1A 2V6YA 1YQ3A 1FJGT 2WZIA 3NBXX 4Z91A 2AE9A 3KVAA 1HNXT 4IE6A 4GKKT 2X0YA 4JI8T 3E08A 2ZM6T 4H63V 1HX1B 3OTOT 2XAGB 2UXDT 3TLUA 5FL0A 1G8XA 1OEDC 2EHOB 3MXZA 3N9QA 4PJJA 4HWFA 4DR2T 2UU9T 3ETVA 5L3EB 2LJLA 3CX8B 4K0KT 4TWHA 1LVFA 4QXHB 4U7YA 4ISSA 1VCSA 3UQ7A 3AAIA 1EZ3A 2A3DA 2B1EA 2DCFA 4YTPA 4I55E 4O4HE 1YXRA 4U7IA 2MOZA 1YKHB 4YTNA 5HEOA 4ZXLA 3IA3A 4GKJT 1WRDA 3VKGA 4CQIA 1UUSA 2JQQA 3DTOA 4IE7A 2FJBA 4OHFA 5M4YA 4P0AA 3H37A 2X51A 2UUBT 5EK2A 1NAFA 2BS3A 4ZS2A 2JMKA 5IHYA 1OEDE 3ANWB 2NW7A 5HEUA 3ZMUB 4AKGA 2VVNA 2OV9A 3T1YT 1SHZC 3VR9A 1IAPA 2VASA 2H88A 2JQKA 4UVBB 5ABFB 2Y6XA 2FJDA 5LCYA 3C4ZA 4XAXB 5AQLB 3B5MA 1QUUA 1L0VA 4EAHA 3NWIA 3OBVE 4WBOA 1YQ4A 2LM2A 4I0UA 2LKHA 2IDOB 4NUVA 4TNWA 4GYRA 4X1YE 5FY7A 4O2BE 4AQFA 2BKOA 2CBJA 1J1JA 4AQFC 1WR6A 2DL1A 1NEKA 1ZOYA 2LOSA 2VURA 3MA9A 1WCRA 2H7VC 2W67A 3HKDE 5AQPB 4ZI2C 1HX8A 3AE2A 3AE6A 4PW8A 1XNQT 3HR0A 3RIAA 5C3JA 3ESLA 1NENA 2V7JA 3OVUA 4OFZA 2WWVA 2VQFT 5JDGA 3AE9A 2WB5A 3P4WA 2NOXA 3S4UA 3C64A 2X0LB 5EZYE 5F8PA 2XY8B 4LMJA 3ZN1B 2OA5A 2I0MA 5LOVE 4J2CA 3AE7A 3K1SA 3AA1B 3UUNA 2JPFA 3TLWA 3VRBA 3ZMZB 5AQUB 2I6HA 3NKZA 3OJAA 5FNVE 3QOFA 2WQYA 1BR0A 4HEAA 5AQTB 3JAEA 5L3CB 4YLHA 1D1CA 3OYZA 5EK4A 3TLSA 4QH1A 2X9WA 2WSSV 4C91A 3N9OA 4HFCA 5FL1A 5H6RB 4TZ4C 4Z90A 4UV9B 4YTMA 4DVDA 3CQCB 2E8IA 5JVDE 5HWXA 4M1PA 3F57A 1J5ET 1HNWT 4IDPA 2LM9A 2XM1A 3NRXA 2NTYA 3FXDB 5ABFA 4B3RT 1BR1A 4HTEA 3QC9A 4IT4A 3RKOA 3JCFA 4UR9A 1AJ3A 3AEDA 2NW9A 4X1IE 3J7Yq 4LFBT 2NW8A 3AEFA 3R6NA 4ISTA 5HYAA 4K0UA 4ERRA 2RPAA 4L9IA 1BR4A 3DP7A 4AKRB 5ETWA 1FEWA 4UV8B 3KV6A 4FI5A 5GONE 2L9QA 4X66T 2N1GA 2LT3A 3PTRB 3L09A 1O3XA 1T8BA 1E7PA 2K48A 1FIOA 4H9RC 3MK7C 3UUMA 1IBLT 4DR6T 4EYUA 5BMVE 2XQ4A 3VR8A 3UU5A 3T1HT 4ZI3C 4JI1T 4U72A 4LFAT 4WZXA 3LG7A 1US7B 2V7KA 2WZHA 5AQGB 4X64T 2KMFA 3Q5WA 4X5TA 2XSAA 3PV0F 1UGOA 3ONXA 4TUYE 5AQSB 4MHCA 1D0ZA 1T98A 3RRCA 1WFDA 3N9PA 3ZMTB 4EZHA 5FVLA 4EOZB 5JDHA 5HEGA 2ES0A 3PU8A 4WW0A 2D0UA 3ZJ2A 1VRBA 2VL8A 3PUQA 4C90A 3AVRA 2C5KT 5HXSA 4JI2T 2CXFA 3VU7H 1VCTA 3N9LA 3RIUC 4KI0F 3F31A 3UQ4A 4QXBB 3EDUA 4JEHB 1SE7A 2LLYA 1IJ5A 2X9HA 3FB2A 5DABA 3SRZA 3P4QA 3ZMSB 2YDRA 1Y01A 4AKLA 4DIDB 4LF9T 4H63H 2A9UA 4DMWA 5HCMA 2LRKA 3ZLIA 4BJNA 4LF5T 1I6ZA 4IDOA 4L0RA 4CXYA 3ZN0B 1KK7A 4YSZA 3JC6D 1NWMX 4KBMB 4NXMT 1KF6A 1D1AA 2MAWA 3I9WA 3KBTA 4Q25A 2N9DA 2YU2A 3PUVF 3KV4A 4PJNA 2LEHA 2ZMAA 5AQQB 4DV1T 4UF0B 4U2ZA 2VL0A 4UXNB 4WNKA 1H7CA 3PURA 4IE5A 1MIWA 4ILUA 4PNIA 4YJ3E 4YSXA 1M62A 1UX4A 1W9RA 2LSYA 2PTFA 5LG3A 2E5LT 2A2FX 4EGWA 1D1BA 4I4TE 5LGNB 1D0XA 2EHOD 1OWAA 3ZKRA 2KNDA 1ZHCA 5ABGA 3RGLA 4JI4T 3SS1A 1QLBA 4GOUA 3H3MA 2LSGA 5JR9C 2QYWA 1IBMT 4UELA 1LVKA 5IYZE 1XMQT 2HPJA 4V1Av 4DBQA 2Q9QA 4OYKA 2LOPA 3CX7B 1N34T 2J4GA 4GK0E 2X67A 4HWIB 4X20E 5JREA 3QNUA 3P4SA 3ZT5A 5AQOB 2V5DA 5AQNB 5F5WA 5CB4E 2CXLA 2BZBA 2OLTA 4H9NC 2WBLA 2VWAA 3AE3A 1E2AA 2MPKA 2YEVC 4LMKA 5JR9B 4U74A 3BK9A 4X1KE 2QA7A 3C51A 4IREA 3IHRA 2ACXA 4AQYT 5AQMB 4PK4A 5JH7E 5KDMC 5FXXA 4JUYA 3AA6B 3GWHA 1UX5A 1ZP0A 1UK5A 3IF8B 4P1NA 1HR0T 4IDNA 2D5UA 5L2LA 4DR7T 2WMNA 3KV5A 1VOMA 3PDYA 2V6XA 4KP3C 3AECA 5JDMA 1T72A 2EHOC 3NVOA 2XAJB 3RQWA 4ZI3D 3PUZF 2DWKA 3MJXA 2WWUA 2VKOA 2BVMA 3CIRA 3LDQB 3PUXF 4KUMB 4UIGA 1KFYA 5J1GA 4P09A 3AEEA 3EDVA 2ODVA 4TN7B 4DUZT 2XHEB 3AB3B 3RPUA 1T7SA 2KWIB 2UXXB 3EUHA 2BDEA 2L8KA 3UT5E 3Q5XA 4ZS3A 2CLYB 2H7OA 4KMCA 1W0AA 2K3WA 5J2TE 3UULA 2WU2A 5J0ZA 1WLXA 3KFWX 4CN1A 4QH4A 4LMLA 2QRXA 2YINA 2D9DA 1LRZA 2IUBA 3GN5A 3P4PA 2IHR1 3KBUA 4ZI2D 3ZYKA 4JI3T 4AI6A 2B76A 2CXDA 5FP3A 3RC8A 3PUSA 4A97A 5HEHA 2ZM2A 4QWNB 4HKAA 3CKDA 3ZCJA 3CWZB 4MALA 1SUMB 5JQGE 2V26A 4DNDA 2JQHA 4F6RC 4JLEA 3ZPOA 5HEJA 4L5GA 4TWDA 1V9DA 3I0QA 3RRWA 4YT0A 4JI6T 2D0TA 2VKJA 1UCUA 3GMIA 4O2AE 4DR5T 4IIJE 2PG8A 4PFPA 5HCJA 1HCIA 4JI5T 2M6BA 3FZFB 4LFCT 3LFMA 4B3ST 2KZ7B 1MMNA 3UUBA 3PE0A 2L3LA 1YKEB 2VKDA 4OYJA 3V5SA 1UURA 4YSYA 5AFUL 5J2UE 3PU3A 1HTJF 2G0UA
chains in the Genus database with same CATH topology
2Y48B 4DBRA 3R84B 4H9QC 4N78D 3K3NA 2LSJA 3HA4A 2C0SA 3O1JA 3OYXA 4UF0A 4CI1B 2DNXA 1HFAA 2XASB 3FXEB 4CI2B 3N5LA 4EIWA 5LHIB 3LK2B 5LXTE 2IW5B 5LBQB 2K9AA 5JR9A 3V5UA 1Z0PA 3WAKA 2XAQB 3OKQA 5HXRA 1WYBA 3QK6A 3HKEE 1D0YA 3N9MA 3I1AA 5HXEA 4GYSA 4YJ3E 1OXZA 3N2KE 2XAHB 2K5BB 2NTXA 3FBLA 3K8PC 3N9NA 4GK5E 3NRYA 1MNEA 5HXHA 5DQVA 5KX5E 3RYHE 3ZEFB 5LGUB 1QSDA 2X9YA 3LBXA 4EB6E 2VKHA 3PUAA 2P9BA 3AAEB 1B7TA 1WYCA 1YW0A 2GK9A 3KINB 2LSKA 3U78A 3Q2MA 3VKHA 2I59A 4PJMA 4IE0A 4YFSA 3RX6A 1IZNB 2CWYA 1ZKEA 2V7IA 2E9XA 2YU1A 4EYYR 1HG5A 4I43B 4JEUB 2N2NA 4TV9E 3RYCE 4DO0A 3BQKA 5JDQA 3O9XA 3AA0B 3C4XA 4CXXA 4IDZA 4CXWA 2CLYC 2MBGA 2EHOA 5LHGB 2DWGA 3ZJ1A 2JMHA 5FMNA 2W63A 2CM0A 1S94A 4PK5A 4QX8B 4TV8E 4Z8XA 2LE8A 2C5JA 2BVLA 2IAKA 4ZHQE 1U4QA 1YD8G 5LG4A 3WAJA 3I9YA 3C98B 5E0OA 4P0BA 2KWHA 4AKHA 3O1HA 3FBZA 3C4WA 1SA0E 4ISSA 2PBIA 2PFVA 3HKBE 1HF8A 3QUJA 2X66A 2CMRA 2K24A 3F2EA 3UTKA 4QXCB 4BAYB 1MNDA 3E22E 2X68A 4MLKA 2KLQA 3MACA 4HN9A 3A5XA 2Q9QB 4E7ZA 3P8CD 4EXTA 4O8SA 4ZI7E 3MKDA 5L3BB 2ZLYA 5TAOA 2CE7A 3ZYLA 2A72A 2WMOA 4AXPA 5LHHB 4XZCA 5FXVA 2KXPB 5FY0A 1IJ6A 3IBPA 2CA5A 5HWYA 5JRCB 3ANWA 5DJQC 2MTQA 2MYSA 3ZC1A 2ZM8A 3LBXB 2QGSA 4DBQA 2Q9QD 3LK42 2CCQA 2VB6A 4E7SA 3RC8A 5LP6E 2E9XC 3RC3A 4B6XA 3O1IA 4HFVA 3ZMVB 3B13A 2V1DB 4MFRA 5FY1A 5LA6E 2M67A 2DLRA 3K3OA 4G63A 4AQGA 1MIVA 2V7MA 4H9OC 1HG2A 3DJBA 3BQLA 2V7LA 2HH7A 3AAAB 3UUXB 5KMGP 3CQXC 5LYJE 4NUUA 3U3IA 1U5PA 3HKCE 4ASKA 3ETUA 2Y8DA 1G73A 3GA8A 5LJNA 2W0GA 3D0TA 1FMVA 4FJOA 3L3PA 4MBQA 3HL6A 2JJ9A 2Q9QC 3H3AA 2NWBA 3N2OA 5FYMA 2ODUA 3IEEA 4PJLA 3K3QC 4YJ2E 5ADXL 2CEAA 1X79A 2IC9A 2PJQA 1MIYA 4OK0A 4CZZB 3JC6C 1ZV4X 5CA0E 2IC6A 4XBFB 3CPZA 4I50E 4IE4A 3PUGA 3NZPA 4TX5A 3T8OA 5L3GB 3W15B 5FXZA 1LKXA 4PFOA 3AA7B 4UVAB 4PAGA 2DHRA 2ZM0A 5C8YE 1MMAA 3P7IA 3UFEA 2E9XB 3FHNA 1S35A 5LNKA 3C50A 2XAFB 1ZEEA 2LHRA 3CQGB 4O4IE 4UVCB 2HPLA 2H3RA 4IHJE 4ANJA 1BR2A 3MZKB 4BA9A 2XTLA 4BJMA 1Y64B 3B57A 4A56A 5LBMA 5DQWA 3KVBA 2SPCA 4G2AA 3N2GE 3TKLB 3VHLA 5JDFA 2RP4A 2JRKA 2VK9A 2E9XD 2KT9A 4O4JE 4ADZA 2DI4A 3M65A 5FXWA 3O4XE 3LK3B 2X9XA 2XUEA 5HXCA 3RYIE 2LSIA 2J1DG 3I0OA 5H6QB 5CA1E 5HAXA 3KV9A 2YK0A 5F3JA 4PK6A 1E1HB 1MMGA 3AVSA 2LHNA 4HGAA 3J9X1 3HI2A 3KDSE 2UXNB 5JRCA 4QX7B 2NP9A 3LJCA 2W62A 3ZYMA 4QKNA 4HE8A 3CMLA 5JDNA 3BQIA 1MMDA 2WAUA 3CVRA 4UEMA 3ZC0A 4O4LE 4CI3B 5LGTB 4YHJA 3RH3A 2W61A 2KINB 4IGUA 4DMVA 2C5IT 4WBNE 2CWOA 2Z6EA 3EVYA 4QHOA 1FMWA 3SOLA 3WI3A 4H9PC 5A1LA 1HS7A 4EZ4A 5EK3A 1CUNA 3GN5B 4H9SE 2RA1A 4GIWA 5L3FB 2W00A 3E0ZA 5L3DB 1KNZA 3RYFE 3NZQA 2WM9A 3CX6B 5JDLA 2D2SA 5LJMA 3ZCIA 4ZOLE 3Q9DA 2XQYA 3NBXX 3KVAA 4IE6A 3E08A 4H63V 2XAGB 1G8XA 3MXZA 2EHOB 3N9QA 4PJJA 3ETVA 5L3EB 2LJLA 3CX8B 1LVFA 4QXHB 3AAIA 1EZ3A 2A3DA 2B1EA 2DCFA 4I55E 4O4HE 2MOZA 1YKHB 1WRDA 3VKGA 4CQIA 2JQQA 3DTOA 4IE7A 4OHFA 5M4YA 3H37A 2X51A 5EK2A 1NAFA 4ZS2A 2JMKA 5IHYA 3ANWB 2NW7A 3ZMUB 4AKGA 1SHZC 4P0AA 1IAPA 2VASA 4UVBB 2Y6XA 5LCYA 3C4ZA 4XAXB 4EAHA 1QUUA 3OBVE 4WBOA 4NUVA 4GYRA 4X1YE 5FY7A 4O2BE 4AQFA 4AQFC 1WR6A 3MA9A 2LOSA 2H7VC 3HKDE 4ZI2C 1HX8A 4PW8A 3HR0A 4AI6A 3ESLA 4OFZA 2V7JA 5JDGA 2NOXA 3S4UA 3C64A 2X0LB 5EZYE 5F8PA 3ZN1B 2OA5A 5LOVE 4J2CA 3AA1B 3UUNA 2JPFA 3ZMZB 3OJAA 5FNVE 1BR0A 4HEAA 5L3CB 4YLHA 1D1CA 3OYZA 5EK4A 2X9WA 2WSSV 4C91A 3N9OA 5H6RB 4TZ4C 4UV9B 4DVDA 3CQCB 2E8IA 5JVDE 5HWXA 4M1PA 3F57A 2LM9A 3NRXA 2NTYA 3FXDB 1BR1A 4HTEA 3QC9A 3RKOA 1AJ3A 2NW9A 4X1IE 3J7Yq 2NW8A 3R6NA 4ISTA 5HYAA 4K0UA 4ERRA 4L9IA 1BR4A 3DP7A 4AKRB 5ETWA 1FEWA 4UV8B 3KV6A 4FI5A 5GONE 2L9QA 2N1GA 2LT3A 3PTRB 3L09A 1O3XA 4H9RC 2K48A 1FIOA 3MK7C 3UUMA 4EYUA 5BMVE 4ZI3C 4U72A 3LG7A 1US7B 2V7KA 2KMFA 3Q5WA 3ONXA 4TUYE 3RRCA 4MHCA 1D0ZA 1T98A 3ZMTB 3N9PA 4EZHA 4EOZB 5JDHA 2ES0A 3PU8A 4WW0A 2D0UA 3ZJ2A 1VRBA 2VL8A 3PUQA 4C90A 3AVRA 2C5KT 5HXSA 2CXFA 3VU7H 3N9LA 3F31A 4QXBB 3EDUA 4JEHB 5DABA 4AKIA 1IJ5A 2X9HA 3FB2A 4AKLA 3SRZA 3ZMSB 4H63H 4DMWA 3ZLIA 4BJNA 4L0RA 4CXYA 3ZN0B 1KK7A 3JC6D 1NWMX 4KBMB 3KBTA 1D1AA 3I9WA 2N9DA 2YU2A 3KV4A 4PJNA 2LEHA 2ZMAA 4UF0B 4UXNB 4WNKA 1H7CA 3PURA 4IE5A 1MIWA 4ILUA 4PNIA 1UX4A 2LSYA 2A2FX 1D1BA 4I4TE 5LGNB 1D0XA 2EHOD 1OWAA 2KNDA 1ZHCA 3SS1A 4GOUA 2LSGA 5JR9C 4UELA 1LVKA 5IYZE 2HPJA 4V1Av 2Q9QA 4OYKA 2LOPA 3CX7B 4GK0E 2X67A 4X20E 5JREA 3SWHA 5CB4E 2CXLA 2BZBA 4H9NC 2WBLA 2VWAA 2YEVC 5JR9B 4U74A 3BK9A 4X1KE 2QA7A 3C51A 3IHRA 2ACXA 4PK4A 5JH7E 5KDMC 5FXXA 4JUYA 3AA6B 3GWHA 1UX5A 3IF8B 2D5UA 5L2LA 2WMNA 3KV5A 1VOMA 3PDYA 4KP3C 5JDMA 2EHOC 2XAJB 4ZI3D 2DWKA 3MJXA 2WWUA 2VKOA 2BVMA 4KUMB 4UIGA 5J1GA 4P09A 4TN7B 3EDVA 2ODVA 2XHEB 3AB3B 3RPUA 2KWIB 2UXXB 3EUHA 2BDEA 2L8KA 3UT5E 3Q5XA 4ZS3A 2CLYB 2H7OA 4KMCA 5J2TE 3UULA 1WLXA 3KFWX 2YINA 1LRZA 3GN5A 4ZI2D 3KBUA 3ZYKA 2CXDA 5FP3A 3PUSA 2ZM2A 4QWNB 4HKAA 3CKDA 3ZCJA 3CWZB 4MALA 5JQGE 2V26A 4DNDA 4F6RC 4JLEA 3ZPOA 4L5GA 1V9DA 3I0QA 3RRWA 2D0TA 2VKJA 1UCUA 3GMIA 4O2AE 4IIJE 2PG8A 4PFPA 1HCIA 3LFMA 2KZ7B 1MMNA 3PE0A 2L3LA 1YKEB 2VKDA 4OYJA 3V5SA 5AFUL 5J2UE 3PU3A 1HTJF 2G0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTQ A;  2A3D A; 
#chains in the Genus database with same CATH topology
 3M3Z B;  2Y48 B;  4DBR A;  3R84 B;  2H89 A;  2YN6 A;  4DV0 T;  2UUA T;  4H9Q C;  4N78 D;  3K3N A;  2FBW A;  2LSJ A;  3HA4 A;  4U2Y A;  1XDP A;  2C0S A;  3O1J A;  3OYX A;  4UF0 A;  2DNX A;  4HWH A;  4CI1 B;  5KXJ A;  1HFA A;  4LF7 T;  3QB5 A;  2XAS B;  3FXE B;  4CI2 B;  3N5L A;  4EIW A;  5C2T A;  5LHI B;  1N33 T;  3LK2 B;  5LXT E;  2IW5 B;  3PUY F;  2K9A A;  5JR9 A;  5LBQ B;  3UU6 A;  3V5U A;  1Z0P A;  3ONL C;  2XAQ B;  3WAK A;  3OKQ A;  5HXR A;  1XZY A;  1WYB A;  3QK6 A;  3G06 A;  3HKE E;  5FVK A;  3ZT6 A;  1D0Y A;  3AEG A;  3N9M A;  4JI0 T;  3I1A A;  5HXE A;  1KEY A;  4GYS A;  2YDQ A;  1OXZ A;  3AE4 A;  2XAH B;  3N2K E;  3OPC A;  4IDQ A;  2K5B B;  2NTX A;  3FBL A;  3K8P C;  3N9N A;  4GK5 E;  4F8H A;  3NRY A;  4A5X A;  5ABE A;  1MNE A;  5HXH A;  1WR0 A;  5DQV A;  5KX5 E;  3RYH E;  3ZEF B;  5LGU B;  1QSD A;  2X9Y A;  3LBX A;  4HFH A;  4DR4 T;  2UXB T;  4EB6 E;  1XDO A;  2VKH A;  3PJA J;  3PUA A;  2P9B A;  3AAE B;  1B7T A;  2W2U A;  1WYC A;  1YW0 A;  2GK9 A;  2J47 A;  3KIN B;  2LSK A;  3JAF A;  2XQ9 A;  4U3C A;  3Q2M A;  3U78 A;  2XSB A;  3VKH A;  2I59 A;  3RIU A;  2XZE A;  3ABV A;  5BR8 T;  2BBJ A;  4PJM A;  4NIQ A;  4ZZB A;  4IE0 A;  5CFB A;  1JNR A;  4YFS A;  3RX6 A;  4KHZ F;  3RF1 A;  4ILC A;  1IZN B;  3RIF A;  2CWY A;  1ZKE A;  2V7I A;  2E9X A;  2YU1 A;  4EYY R;  1HG5 A;  4I43 B;  2FJE A;  3SFE A;  4DV4 T;  4JEU B;  2N2N A;  4TV9 E;  3RYC E;  4ZZC A;  4DO0 A;  2WU5 A;  4DR3 T;  3BQK A;  5JDQ A;  3O9X A;  3AA0 B;  3C4X A;  3RLF F;  1N32 T;  4CXX A;  4IDZ A;  3L39 A;  4CXW A;  2CLY C;  2MBG A;  1W0B A;  3Q5D A;  5LMN T;  2EHO A;  5LHG B;  2W4X A;  2DWG A;  3ZJ1 A;  2JMH A;  2V6Y B;  3FZM B;  5FMN A;  3VRA A;  2W63 A;  2CM0 A;  2VQE T;  1S94 A;  4PK5 A;  4QX8 B;  4TV8 E;  4Z8X A;  4JI7 T;  2LE8 A;  2C5J A;  2BVL A;  4DV3 T;  2IAK A;  4WYV A;  4ZHQ E;  2WY2 A;  1U4Q A;  1YD8 G;  3TLV A;  5LG4 A;  3WAJ A;  1DU2 A;  3I9Y A;  3C98 B;  5E0O A;  4P0B A;  1I94 T;  3P50 A;  2KWH A;  4AKH A;  2R6G F;  3O1H A;  2UXC T;  3ZST A;  3C4W A;  1W09 A;  1SA0 E;  3FBZ A;  2PBI A;  2PFV A;  3HKB E;  1HF8 A;  3QUJ A;  2X66 A;  2CMR A;  2K24 A;  3F2E A;  3UTK A;  4TWF A;  4YY3 T;  4B3M T;  4QXC B;  4BAY B;  4U31 A;  1MND A;  3E22 E;  2X68 A;  4MLK A;  2BG9 C;  3RHW A;  2KLQ A;  3MAC A;  4HN9 A;  4COF A;  3A5X A;  2Q9Q B;  1X9B A;  2JQ9 A;  3P8C D;  4A98 A;  4EXT A;  4E7Z A;  2JIW A;  4O8S A;  5IUX A;  4ZI7 E;  3MKD A;  5L3B B;  2ZLY A;  1JNZ A;  5TAO A;  5AQF B;  4OX9 T;  1CHU A;  2CE7 A;  5L47 A;  3ZYL A;  2A72 A;  1M7K A;  4CN6 A;  2WMO A;  4AXP A;  5LHH B;  4DUY T;  4XZC A;  2XQ5 A;  5FXV A;  2KXP B;  5FY0 A;  1KNP A;  1IJ6 A;  2XQA A;  3IBP A;  2CA5 A;  5HWY A;  5JRC B;  3ANW A;  5DJQ C;  2MTQ A;  2MYS A;  3ZC1 A;  2ZM8 A;  3LBX B;  2QGS A;  2FUP A;  2Q9Q D;  3EAB A;  2CCQ A;  2VB6 A;  3LK4 2;  2KSR A;  3PUW F;  2FJA A;  2E9X C;  5AQJ B;  4E7S A;  5LP6 E;  1J5W A;  2QVA A;  3O1I A;  3RC3 A;  2XQ7 A;  4B6X A;  4HFV A;  3ZSS A;  3P4R A;  3ZMV B;  3B13 A;  5IWA T;  2V1D B;  2CRB A;  3A7M A;  4MFR A;  5FY1 A;  5LA6 E;  2M6I A;  2M67 A;  2DLR A;  2V5C A;  3K3O A;  3PJA A;  4G63 A;  2CPT A;  3UU3 A;  4AQG A;  1R8I A;  4ZEY A;  5CJ5 A;  2HHH T;  1MIV A;  2V7M A;  4H9O C;  1HG2 A;  1OED B;  3DJB A;  2XQ6 A;  3Q5E A;  4AIS A;  4LF4 T;  4DV6 T;  3BQL A;  2V7L A;  2HH7 A;  3AAA B;  4ILB A;  3SFD A;  4CN4 A;  3UUX B;  4JYA T;  3ZT7 A;  1XWM A;  4HFE A;  1GQE A;  3CK6 A;  3CQX C;  3EI0 A;  4NUU A;  5KMG P;  4EEB A;  5LYJ E;  3AXJ B;  3U3I A;  5LMU T;  1U5P A;  3HKC E;  4ASK A;  3ETU A;  5L4E A;  2Y8D A;  1G73 A;  4IL4 A;  3GA8 A;  4IL9 A;  4U33 A;  4HFI A;  2WDQ A;  2W0G A;  3AE8 A;  3D0T A;  5AQH B;  5AQK B;  4EV6 A;  5LJN A;  4LF6 T;  1FMV A;  3EAM A;  3L3P A;  4FJO A;  5CGM A;  2XM2 A;  2XPK A;  4MBQ A;  3HL6 A;  2JJ9 A;  2Q9Q C;  2WP9 A;  3H3A A;  2NWB A;  2LRL A;  3N2O A;  5FYM A;  2ODU A;  3IEE A;  4PJL A;  3K3Q C;  4YJ2 E;  5ADX L;  2CEA A;  1X79 A;  2IC9 A;  2BS4 A;  1MIY A;  2PJQ A;  4OK0 A;  3JC6 C;  1ZV4 X;  4QH5 A;  2IC6 A;  4CZZ B;  5CA0 E;  4XBF B;  3CPZ A;  4I50 E;  4IE4 A;  3PUG A;  3NZP A;  4TX5 A;  3T8O A;  3FZH B;  5L3G B;  3W15 B;  5FXZ A;  1LKX A;  4PFO A;  3AA7 B;  4UVA B;  3RQU A;  4PAG A;  2CHN A;  4ILA A;  2DHR A;  2F4V T;  2E5V A;  2ZM0 A;  5C8Y E;  2IML A;  1MMA A;  3P7I A;  3UFE A;  2E9X B;  2XQ8 A;  3EHZ A;  3FHN A;  4DV5 T;  2YKS A;  5FKY A;  1S35 A;  2WDV A;  3TLT A;  2VVS A;  5LNK A;  3C50 A;  2XAF B;  1ZEE A;  2LHR A;  4KHP T;  2XJ7 A;  3CQG B;  1IBK T;  4O4I E;  5AQR B;  4UVC B;  2HPL A;  2WCA A;  2H3R A;  2BG9 A;  3FZK B;  4IHJ E;  3X1D A;  4ANJ A;  1BR2 A;  3MZK B;  4BA9 A;  2XTL A;  4BJM A;  1Y64 B;  3UU4 A;  3B57 A;  4A56 A;  5LBM A;  4HFD A;  5DQW A;  3KVB A;  2SPC A;  3AEA A;  4G2A A;  4YHH T;  3AXJ A;  3N2G E;  3SWH A;  4TNV A;  3RKG A;  4NPP A;  3TKL B;  4YXD A;  3VHL A;  5JDF A;  5LB7 B;  4DV2 T;  2NR4 A;  2RP4 A;  2JRK A;  2VK9 A;  2KT9 A;  1OED A;  2E9X D;  4O4J E;  4ADZ A;  2CHO A;  2DI4 A;  3LSV A;  3M65 A;  4DV7 T;  5FXW A;  4LF8 T;  1Z8U A;  3O4X E;  3LK3 B;  1XNR T;  1KNR A;  1HNZ T;  4EED A;  2X9X A;  2XUE A;  4HWC A;  5HXC A;  3RYI E;  1N36 T;  2LSI A;  2J1D G;  3I0O A;  5H6Q B;  5CA1 E;  5L4H A;  4DR1 T;  5HAX A;  3KV9 A;  2YK0 A;  5F3J A;  2IIU A;  2XQ3 A;  4PK6 A;  4AIU A;  2J62 A;  1E1H B;  1MMG A;  3AVS A;  2LHN A;  5JTG A;  4HGA A;  3J9X 1;  4JV5 T;  4AKI A;  3HI2 A;  3UFG A;  3KDS E;  1XMO T;  2UXN B;  5AQI B;  5JRC A;  4QX7 B;  2NP9 A;  3A8Y C;  3LJC A;  2BS2 A;  2W62 A;  3ZYM A;  2E2A A;  3RI5 A;  4NXN T;  3FZL B;  4QKN A;  2WDR A;  2WS3 A;  4HE8 A;  3CML A;  5JDN A;  2BG9 E;  4JBW F;  3BQI A;  1MMD A;  2WAU A;  3CVR A;  4HWD A;  3AEB A;  4UEM A;  3ZC0 A;  4O4L E;  3JAD A;  4CI3 B;  5LGT B;  2BBH A;  4YHJ A;  2HN1 A;  2YOE A;  3ONJ A;  3RH3 A;  2BKN A;  2ACZ A;  2W61 A;  2KIN B;  4X65 T;  2BKP A;  2W66 A;  3L8R A;  4IGU A;  4DMV A;  5AQV B;  2C5I T;  4WBN E;  4X62 T;  2CWO A;  2YDS A;  2Z6E A;  3EVY A;  4QHO A;  1FMW A;  2LKG A;  3SOL A;  3WI3 A;  4H9P C;  5A1L A;  1HS7 A;  2CBI A;  4EZ4 A;  2HN2 A;  5EK3 A;  4B3T T;  1CUN A;  3GN5 B;  3QB5 K;  4H9S E;  2RA1 A;  3AE5 A;  4GIW A;  2X0H A;  5L3F B;  2W00 A;  3E0Z A;  5L3D B;  3UU8 A;  1KNZ A;  2V8S V;  3RYF E;  3NZQ A;  5ABH A;  4KX6 A;  2WM9 A;  3CX6 B;  4HFB A;  5JDL A;  2D2S A;  5LJM A;  3ZCI A;  2AXD S;  4ZOL E;  2BG9 B;  2UUC T;  3Q9D A;  2XQY A;  3AE1 A;  2V6Y A;  1YQ3 A;  1FJG T;  2WZI A;  3NBX X;  4Z91 A;  2AE9 A;  3KVA A;  1HNX T;  4IE6 A;  4GKK T;  2X0Y A;  4JI8 T;  3E08 A;  2ZM6 T;  4H63 V;  1HX1 B;  3OTO T;  2XAG B;  2UXD T;  3TLU A;  5FL0 A;  1G8X A;  1OED C;  2EHO B;  3MXZ A;  3N9Q A;  4PJJ A;  4HWF A;  4DR2 T;  2UU9 T;  3ETV A;  5L3E B;  2LJL A;  3CX8 B;  4K0K T;  4TWH A;  1LVF A;  4QXH B;  4U7Y A;  4ISS A;  1VCS A;  3UQ7 A;  3AAI A;  1EZ3 A;  2A3D A;  2B1E A;  2DCF A;  4YTP A;  4I55 E;  4O4H E;  1YXR A;  4U7I A;  2MOZ A;  1YKH B;  4YTN A;  5HEO A;  4ZXL A;  3IA3 A;  4GKJ T;  1WRD A;  3VKG A;  4CQI A;  1UUS A;  2JQQ A;  3DTO A;  4IE7 A;  2FJB A;  4OHF A;  5M4Y A;  4P0A A;  3H37 A;  2X51 A;  2UUB T;  5EK2 A;  1NAF A;  2BS3 A;  4ZS2 A;  2JMK A;  5IHY A;  1OED E;  3ANW B;  2NW7 A;  5HEU A;  3ZMU B;  4AKG A;  2VVN A;  2OV9 A;  3T1Y T;  1SHZ C;  3VR9 A;  1IAP A;  2VAS A;  2H88 A;  2JQK A;  4UVB B;  5ABF B;  2Y6X A;  2FJD A;  5LCY A;  3C4Z A;  4XAX B;  5AQL B;  3B5M A;  1QUU A;  1L0V A;  4EAH A;  3NWI A;  3OBV E;  4WBO A;  1YQ4 A;  2LM2 A;  4I0U A;  2LKH A;  2IDO B;  4NUV A;  4TNW A;  4GYR A;  4X1Y E;  5FY7 A;  4O2B E;  4AQF A;  2BKO A;  2CBJ A;  1J1J A;  4AQF C;  1WR6 A;  2DL1 A;  1NEK A;  1ZOY A;  2LOS A;  2VUR A;  3MA9 A;  1WCR A;  2H7V C;  2W67 A;  3HKD E;  5AQP B;  4ZI2 C;  1HX8 A;  3AE2 A;  3AE6 A;  4PW8 A;  1XNQ T;  3HR0 A;  3RIA A;  5C3J A;  3ESL A;  1NEN A;  2V7J A;  3OVU A;  4OFZ A;  2WWV A;  2VQF T;  5JDG A;  3AE9 A;  2WB5 A;  3P4W A;  2NOX A;  3S4U A;  3C64 A;  2X0L B;  5EZY E;  5F8P A;  2XY8 B;  4LMJ A;  3ZN1 B;  2OA5 A;  2I0M A;  5LOV E;  4J2C A;  3AE7 A;  3K1S A;  3AA1 B;  3UUN A;  2JPF A;  3TLW A;  3VRB A;  3ZMZ B;  5AQU B;  2I6H A;  3NKZ A;  3OJA A;  5FNV E;  3QOF A;  2WQY A;  1BR0 A;  4HEA A;  5AQT B;  3JAE A;  5L3C B;  4YLH A;  1D1C A;  3OYZ A;  5EK4 A;  3TLS A;  4QH1 A;  2X9W A;  2WSS V;  4C91 A;  3N9O A;  4HFC A;  5FL1 A;  5H6R B;  4TZ4 C;  4Z90 A;  4UV9 B;  4YTM A;  4DVD A;  3CQC B;  2E8I A;  5JVD E;  5HWX A;  4M1P A;  3F57 A;  1J5E T;  1HNW T;  4IDP A;  2LM9 A;  2XM1 A;  3NRX A;  2NTY A;  3FXD B;  5ABF A;  4B3R T;  1BR1 A;  4HTE A;  3QC9 A;  4IT4 A;  3RKO A;  3JCF A;  4UR9 A;  1AJ3 A;  3AED A;  2NW9 A;  4X1I E;  3J7Y q;  4LFB T;  2NW8 A;  3AEF A;  3R6N A;  4IST A;  5HYA A;  4K0U A;  4ERR A;  2RPA A;  4L9I A;  1BR4 A;  3DP7 A;  4AKR B;  5ETW A;  1FEW A;  4UV8 B;  3KV6 A;  4FI5 A;  5GON E;  2L9Q A;  4X66 T;  2N1G A;  2LT3 A;  3PTR B;  3L09 A;  1O3X A;  1T8B A;  1E7P A;  2K48 A;  1FIO A;  4H9R C;  3MK7 C;  3UUM A;  1IBL T;  4DR6 T;  4EYU A;  5BMV E;  2XQ4 A;  3VR8 A;  3UU5 A;  3T1H T;  4ZI3 C;  4JI1 T;  4U72 A;  4LFA T;  4WZX A;  3LG7 A;  1US7 B;  2V7K A;  2WZH A;  5AQG B;  4X64 T;  2KMF A;  3Q5W A;  4X5T A;  2XSA A;  3PV0 F;  1UGO A;  3ONX A;  4TUY E;  5AQS B;  4MHC A;  1D0Z A;  1T98 A;  3RRC A;  1WFD A;  3N9P A;  3ZMT B;  4EZH A;  5FVL A;  4EOZ B;  5JDH A;  5HEG A;  2ES0 A;  3PU8 A;  4WW0 A;  2D0U A;  3ZJ2 A;  1VRB A;  2VL8 A;  3PUQ A;  4C90 A;  3AVR A;  2C5K T;  5HXS A;  4JI2 T;  2CXF A;  3VU7 H;  1VCT A;  3N9L A;  3RIU C;  4KI0 F;  3F31 A;  3UQ4 A;  4QXB B;  3EDU A;  4JEH B;  1SE7 A;  2LLY A;  1IJ5 A;  2X9H A;  3FB2 A;  5DAB A;  3SRZ A;  3P4Q A;  3ZMS B;  2YDR A;  1Y01 A;  4AKL A;  4DID B;  4LF9 T;  4H63 H;  2A9U A;  4DMW A;  5HCM A;  2LRK A;  3ZLI A;  4BJN A;  4LF5 T;  1I6Z A;  4IDO A;  4L0R A;  4CXY A;  3ZN0 B;  1KK7 A;  4YSZ A;  3JC6 D;  1NWM X;  4KBM B;  4NXM T;  1KF6 A;  1D1A A;  2MAW A;  3I9W A;  3KBT A;  4Q25 A;  2N9D A;  2YU2 A;  3PUV F;  3KV4 A;  4PJN A;  2LEH A;  2ZMA A;  5AQQ B;  4DV1 T;  4UF0 B;  4U2Z A;  2VL0 A;  4UXN B;  4WNK A;  1H7C A;  3PUR A;  4IE5 A;  1MIW A;  4ILU A;  4PNI A;  4YJ3 E;  4YSX A;  1M62 A;  1UX4 A;  1W9R A;  2LSY A;  2PTF A;  5LG3 A;  2E5L T;  2A2F X;  4EGW A;  1D1B A;  4I4T E;  5LGN B;  1D0X A;  2EHO D;  1OWA A;  3ZKR A;  2KND A;  1ZHC A;  5ABG A;  3RGL A;  4JI4 T;  3SS1 A;  1QLB A;  4GOU A;  3H3M A;  2LSG A;  5JR9 C;  2QYW A;  1IBM T;  4UEL A;  1LVK A;  5IYZ E;  1XMQ T;  2HPJ A;  4V1A v;  4DBQ A;  2Q9Q A;  4OYK A;  2LOP A;  3CX7 B;  1N34 T;  2J4G A;  4GK0 E;  2X67 A;  4HWI B;  4X20 E;  5JRE A;  3QNU A;  3P4S A;  3ZT5 A;  5AQO B;  2V5D A;  5AQN B;  5F5W A;  5CB4 E;  2CXL A;  2BZB A;  2OLT A;  4H9N C;  2WBL A;  2VWA A;  3AE3 A;  1E2A A;  2MPK A;  2YEV C;  4LMK A;  5JR9 B;  4U74 A;  3BK9 A;  4X1K E;  2QA7 A;  3C51 A;  4IRE A;  3IHR A;  2ACX A;  4AQY T;  5AQM B;  4PK4 A;  5JH7 E;  5KDM C;  5FXX A;  4JUY A;  3AA6 B;  3GWH A;  1UX5 A;  1ZP0 A;  1UK5 A;  3IF8 B;  4P1N A;  1HR0 T;  4IDN A;  2D5U A;  5L2L A;  4DR7 T;  2WMN A;  3KV5 A;  1VOM A;  3PDY A;  2V6X A;  4KP3 C;  3AEC A;  5JDM A;  1T72 A;  2EHO C;  3NVO A;  2XAJ B;  3RQW A;  4ZI3 D;  3PUZ F;  2DWK A;  3MJX A;  2WWU A;  2VKO A;  2BVM A;  3CIR A;  3LDQ B;  3PUX F;  4KUM B;  4UIG A;  1KFY A;  5J1G A;  4P09 A;  3AEE A;  3EDV A;  2ODV A;  4TN7 B;  4DUZ T;  2XHE B;  3AB3 B;  3RPU A;  1T7S A;  2KWI B;  2UXX B;  3EUH A;  2BDE A;  2L8K A;  3UT5 E;  3Q5X A;  4ZS3 A;  2CLY B;  2H7O A;  4KMC A;  1W0A A;  2K3W A;  5J2T E;  3UUL A;  2WU2 A;  5J0Z A;  1WLX A;  3KFW X;  4CN1 A;  4QH4 A;  4LML A;  2QRX A;  2YIN A;  2D9D A;  1LRZ A;  2IUB A;  3GN5 A;  3P4P A;  2IHR 1;  3KBU A;  4ZI2 D;  3ZYK A;  4JI3 T;  4AI6 A;  2B76 A;  2CXD A;  5FP3 A;  3RC8 A;  3PUS A;  4A97 A;  5HEH A;  2ZM2 A;  4QWN B;  4HKA A;  3CKD A;  3ZCJ A;  3CWZ B;  4MAL A;  1SUM B;  5JQG E;  2V26 A;  4DND A;  2JQH A;  4F6R C;  4JLE A;  3ZPO A;  5HEJ A;  4L5G A;  4TWD A;  1V9D A;  3I0Q A;  3RRW A;  4YT0 A;  4JI6 T;  2D0T A;  2VKJ A;  1UCU A;  3GMI A;  4O2A E;  4DR5 T;  4IIJ E;  2PG8 A;  4PFP A;  5HCJ A;  1HCI A;  4JI5 T;  2M6B A;  3FZF B;  4LFC T;  3LFM A;  4B3S T;  2KZ7 B;  1MMN A;  3UUB A;  3PE0 A;  2L3L A;  1YKE B;  2VKD A;  4OYJ A;  3V5S A;  1UUR A;  4YSY A;  5AFU L;  5J2U E;  3PU3 A;  1HTJ F;  2G0U A; 
#chains in the Genus database with same CATH homology
 2Y48 B;  4DBR A;  3R84 B;  4H9Q C;  4N78 D;  3K3N A;  2LSJ A;  3HA4 A;  2C0S A;  3O1J A;  3OYX A;  4UF0 A;  4CI1 B;  2DNX A;  1HFA A;  2XAS B;  3FXE B;  4CI2 B;  3N5L A;  4EIW A;  5LHI B;  3LK2 B;  5LXT E;  2IW5 B;  5LBQ B;  2K9A A;  5JR9 A;  3V5U A;  1Z0P A;  3WAK A;  2XAQ B;  3OKQ A;  5HXR A;  1WYB A;  3QK6 A;  3HKE E;  1D0Y A;  3N9M A;  3I1A A;  5HXE A;  4GYS A;  4YJ3 E;  1OXZ A;  3N2K E;  2XAH B;  2K5B B;  2NTX A;  3FBL A;  3K8P C;  3N9N A;  4GK5 E;  3NRY A;  1MNE A;  5HXH A;  5DQV A;  5KX5 E;  3RYH E;  3ZEF B;  5LGU B;  1QSD A;  2X9Y A;  3LBX A;  4EB6 E;  2VKH A;  3PUA A;  2P9B A;  3AAE B;  1B7T A;  1WYC A;  1YW0 A;  2GK9 A;  3KIN B;  2LSK A;  3U78 A;  3Q2M A;  3VKH A;  2I59 A;  4PJM A;  4IE0 A;  4YFS A;  3RX6 A;  1IZN B;  2CWY A;  1ZKE A;  2V7I A;  2E9X A;  2YU1 A;  4EYY R;  1HG5 A;  4I43 B;  4JEU B;  2N2N A;  4TV9 E;  3RYC E;  4DO0 A;  3BQK A;  5JDQ A;  3O9X A;  3AA0 B;  3C4X A;  4CXX A;  4IDZ A;  4CXW A;  2CLY C;  2MBG A;  2EHO A;  5LHG B;  2DWG A;  3ZJ1 A;  2JMH A;  5FMN A;  2W63 A;  2CM0 A;  1S94 A;  4PK5 A;  4QX8 B;  4TV8 E;  4Z8X A;  2LE8 A;  2C5J A;  2BVL A;  2IAK A;  4ZHQ E;  1U4Q A;  1YD8 G;  5LG4 A;  3WAJ A;  3I9Y A;  3C98 B;  5E0O A;  4P0B A;  2KWH A;  4AKH A;  3O1H A;  3FBZ A;  3C4W A;  1SA0 E;  4ISS A;  2PBI A;  2PFV A;  3HKB E;  1HF8 A;  3QUJ A;  2X66 A;  2CMR A;  2K24 A;  3F2E A;  3UTK A;  4QXC B;  4BAY B;  1MND A;  3E22 E;  2X68 A;  4MLK A;  2KLQ A;  3MAC A;  4HN9 A;  3A5X A;  2Q9Q B;  4E7Z A;  3P8C D;  4EXT A;  4O8S A;  4ZI7 E;  3MKD A;  5L3B B;  2ZLY A;  5TAO A;  2CE7 A;  3ZYL A;  2A72 A;  2WMO A;  4AXP A;  5LHH B;  4XZC A;  5FXV A;  2KXP B;  5FY0 A;  1IJ6 A;  3IBP A;  2CA5 A;  5HWY A;  5JRC B;  3ANW A;  5DJQ C;  2MTQ A;  2MYS A;  3ZC1 A;  2ZM8 A;  3LBX B;  2QGS A;  4DBQ A;  2Q9Q D;  3LK4 2;  2CCQ A;  2VB6 A;  4E7S A;  3RC8 A;  5LP6 E;  2E9X C;  3RC3 A;  4B6X A;  3O1I A;  4HFV A;  3ZMV B;  3B13 A;  2V1D B;  4MFR A;  5FY1 A;  5LA6 E;  2M67 A;  2DLR A;  3K3O A;  4G63 A;  4AQG A;  1MIV A;  2V7M A;  4H9O C;  1HG2 A;  3DJB A;  3BQL A;  2V7L A;  2HH7 A;  3AAA B;  3UUX B;  5KMG P;  3CQX C;  5LYJ E;  4NUU A;  3U3I A;  1U5P A;  3HKC E;  4ASK A;  3ETU A;  2Y8D A;  1G73 A;  3GA8 A;  5LJN A;  2W0G A;  3D0T A;  1FMV A;  4FJO A;  3L3P A;  4MBQ A;  3HL6 A;  2JJ9 A;  2Q9Q C;  3H3A A;  2NWB A;  3N2O A;  5FYM A;  2ODU A;  3IEE A;  4PJL A;  3K3Q C;  4YJ2 E;  5ADX L;  2CEA A;  1X79 A;  2IC9 A;  2PJQ A;  1MIY A;  4OK0 A;  4CZZ B;  3JC6 C;  1ZV4 X;  5CA0 E;  2IC6 A;  4XBF B;  3CPZ A;  4I50 E;  4IE4 A;  3PUG A;  3NZP A;  4TX5 A;  3T8O A;  5L3G B;  3W15 B;  5FXZ A;  1LKX A;  4PFO A;  3AA7 B;  4UVA B;  4PAG A;  2DHR A;  2ZM0 A;  5C8Y E;  1MMA A;  3P7I A;  3UFE A;  2E9X B;  3FHN A;  1S35 A;  5LNK A;  3C50 A;  2XAF B;  1ZEE A;  2LHR A;  3CQG B;  4O4I E;  4UVC B;  2HPL A;  2H3R A;  4IHJ E;  4ANJ A;  1BR2 A;  3MZK B;  4BA9 A;  2XTL A;  4BJM A;  1Y64 B;  3B57 A;  4A56 A;  5LBM A;  5DQW A;  3KVB A;  2SPC A;  4G2A A;  3N2G E;  3TKL B;  3VHL A;  5JDF A;  2RP4 A;  2JRK A;  2VK9 A;  2E9X D;  2KT9 A;  4O4J E;  4ADZ A;  2DI4 A;  3M65 A;  5FXW A;  3O4X E;  3LK3 B;  2X9X A;  2XUE A;  5HXC A;  3RYI E;  2LSI A;  2J1D G;  3I0O A;  5H6Q B;  5CA1 E;  5HAX A;  3KV9 A;  2YK0 A;  5F3J A;  4PK6 A;  1E1H B;  1MMG A;  3AVS A;  2LHN A;  4HGA A;  3J9X 1;  3HI2 A;  3KDS E;  2UXN B;  5JRC A;  4QX7 B;  2NP9 A;  3LJC A;  2W62 A;  3ZYM A;  4QKN A;  4HE8 A;  3CML A;  5JDN A;  3BQI A;  1MMD A;  2WAU A;  3CVR A;  4UEM A;  3ZC0 A;  4O4L E;  4CI3 B;  5LGT B;  4YHJ A;  3RH3 A;  2W61 A;  2KIN B;  4IGU A;  4DMV A;  2C5I T;  4WBN E;  2CWO A;  2Z6E A;  3EVY A;  4QHO A;  1FMW A;  3SOL A;  3WI3 A;  4H9P C;  5A1L A;  1HS7 A;  4EZ4 A;  5EK3 A;  1CUN A;  3GN5 B;  4H9S E;  2RA1 A;  4GIW A;  5L3F B;  2W00 A;  3E0Z A;  5L3D B;  1KNZ A;  3RYF E;  3NZQ A;  2WM9 A;  3CX6 B;  5JDL A;  2D2S A;  5LJM A;  3ZCI A;  4ZOL E;  3Q9D A;  2XQY A;  3NBX X;  3KVA A;  4IE6 A;  3E08 A;  4H63 V;  2XAG B;  1G8X A;  3MXZ A;  2EHO B;  3N9Q A;  4PJJ A;  3ETV A;  5L3E B;  2LJL A;  3CX8 B;  1LVF A;  4QXH B;  3AAI A;  1EZ3 A;  2A3D A;  2B1E A;  2DCF A;  4I55 E;  4O4H E;  2MOZ A;  1YKH B;  1WRD A;  3VKG A;  4CQI A;  2JQQ A;  3DTO A;  4IE7 A;  4OHF A;  5M4Y A;  3H37 A;  2X51 A;  5EK2 A;  1NAF A;  4ZS2 A;  2JMK A;  5IHY A;  3ANW B;  2NW7 A;  3ZMU B;  4AKG A;  1SHZ C;  4P0A A;  1IAP A;  2VAS A;  4UVB B;  2Y6X A;  5LCY A;  3C4Z A;  4XAX B;  4EAH A;  1QUU A;  3OBV E;  4WBO A;  4NUV A;  4GYR A;  4X1Y E;  5FY7 A;  4O2B E;  4AQF A;  4AQF C;  1WR6 A;  3MA9 A;  2LOS A;  2H7V C;  3HKD E;  4ZI2 C;  1HX8 A;  4PW8 A;  3HR0 A;  4AI6 A;  3ESL A;  4OFZ A;  2V7J A;  5JDG A;  2NOX A;  3S4U A;  3C64 A;  2X0L B;  5EZY E;  5F8P A;  3ZN1 B;  2OA5 A;  5LOV E;  4J2C A;  3AA1 B;  3UUN A;  2JPF A;  3ZMZ B;  3OJA A;  5FNV E;  1BR0 A;  4HEA A;  5L3C B;  4YLH A;  1D1C A;  3OYZ A;  5EK4 A;  2X9W A;  2WSS V;  4C91 A;  3N9O A;  5H6R B;  4TZ4 C;  4UV9 B;  4DVD A;  3CQC B;  2E8I A;  5JVD E;  5HWX A;  4M1P A;  3F57 A;  2LM9 A;  3NRX A;  2NTY A;  3FXD B;  1BR1 A;  4HTE A;  3QC9 A;  3RKO A;  1AJ3 A;  2NW9 A;  4X1I E;  3J7Y q;  2NW8 A;  3R6N A;  4IST A;  5HYA A;  4K0U A;  4ERR A;  4L9I A;  1BR4 A;  3DP7 A;  4AKR B;  5ETW A;  1FEW A;  4UV8 B;  3KV6 A;  4FI5 A;  5GON E;  2L9Q A;  2N1G A;  2LT3 A;  3PTR B;  3L09 A;  1O3X A;  4H9R C;  2K48 A;  1FIO A;  3MK7 C;  3UUM A;  4EYU A;  5BMV E;  4ZI3 C;  4U72 A;  3LG7 A;  1US7 B;  2V7K A;  2KMF A;  3Q5W A;  3ONX A;  4TUY E;  3RRC A;  4MHC A;  1D0Z A;  1T98 A;  3ZMT B;  3N9P A;  4EZH A;  4EOZ B;  5JDH A;  2ES0 A;  3PU8 A;  4WW0 A;  2D0U A;  3ZJ2 A;  1VRB A;  2VL8 A;  3PUQ A;  4C90 A;  3AVR A;  2C5K T;  5HXS A;  2CXF A;  3VU7 H;  3N9L A;  3F31 A;  4QXB B;  3EDU A;  4JEH B;  5DAB A;  4AKI A;  1IJ5 A;  2X9H A;  3FB2 A;  4AKL A;  3SRZ A;  3ZMS B;  4H63 H;  4DMW A;  3ZLI A;  4BJN A;  4L0R A;  4CXY A;  3ZN0 B;  1KK7 A;  3JC6 D;  1NWM X;  4KBM B;  3KBT A;  1D1A A;  3I9W A;  2N9D A;  2YU2 A;  3KV4 A;  4PJN A;  2LEH A;  2ZMA A;  4UF0 B;  4UXN B;  4WNK A;  1H7C A;  3PUR A;  4IE5 A;  1MIW A;  4ILU A;  4PNI A;  1UX4 A;  2LSY A;  2A2F X;  1D1B A;  4I4T E;  5LGN B;  1D0X A;  2EHO D;  1OWA A;  2KND A;  1ZHC A;  3SS1 A;  4GOU A;  2LSG A;  5JR9 C;  4UEL A;  1LVK A;  5IYZ E;  2HPJ A;  4V1A v;  2Q9Q A;  4OYK A;  2LOP A;  3CX7 B;  4GK0 E;  2X67 A;  4X20 E;  5JRE A;  3SWH A;  5CB4 E;  2CXL A;  2BZB A;  4H9N C;  2WBL A;  2VWA A;  2YEV C;  5JR9 B;  4U74 A;  3BK9 A;  4X1K E;  2QA7 A;  3C51 A;  3IHR A;  2ACX A;  4PK4 A;  5JH7 E;  5KDM C;  5FXX A;  4JUY A;  3AA6 B;  3GWH A;  1UX5 A;  3IF8 B;  2D5U A;  5L2L A;  2WMN A;  3KV5 A;  1VOM A;  3PDY A;  4KP3 C;  5JDM A;  2EHO C;  2XAJ B;  4ZI3 D;  2DWK A;  3MJX A;  2WWU A;  2VKO A;  2BVM A;  4KUM B;  4UIG A;  5J1G A;  4P09 A;  4TN7 B;  3EDV A;  2ODV A;  2XHE B;  3AB3 B;  3RPU A;  2KWI B;  2UXX B;  3EUH A;  2BDE A;  2L8K A;  3UT5 E;  3Q5X A;  4ZS3 A;  2CLY B;  2H7O A;  4KMC A;  5J2T E;  3UUL A;  1WLX A;  3KFW X;  2YIN A;  1LRZ A;  3GN5 A;  4ZI2 D;  3KBU A;  3ZYK A;  2CXD A;  5FP3 A;  3PUS A;  2ZM2 A;  4QWN B;  4HKA A;  3CKD A;  3ZCJ A;  3CWZ B;  4MAL A;  5JQG E;  2V26 A;  4DND A;  4F6R C;  4JLE A;  3ZPO A;  4L5G A;  1V9D A;  3I0Q A;  3RRW A;  2D0T A;  2VKJ A;  1UCU A;  3GMI A;  4O2A E;  4IIJ E;  2PG8 A;  4PFP A;  1HCI A;  3LFM A;  2KZ7 B;  1MMN A;  3PE0 A;  2L3L A;  1YKE B;  2VKD A;  4OYJ A;  3V5S A;  5AFU L;  5J2U E;  3PU3 A;  1HTJ F;  2G0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...