5BR8T

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5br8T00
1IBLT 1HNXT 2HHHT 4AQYT 2UXBT 3T1YT 4LFCT 4DV7T 4DV6T 1N33T 4KHPT 4DR5T 4JI5T 1J5ET 1HNWT 4NXNT 4JYAT 2UXDT 4DV4T 4DR3T 2UU9T 4DR4T 2UUBT 4LF6T 4B3MT 1XNRT 2VQFT 4DUZT 2ZM6T 4DV5T 4LF7T 4DV1T 1HNZT 4B3TT 5LMNT 4LF5T 4JI7T 4DV0T 4LFAT 1FJGT 2UUAT 4DR2T 1XMQT 4DR1T 5IWAT 4JI3T 1I94T 4DR6T 4LF9T 4LFBT 4GKKT 4YY3T 2VQET 1N36T 4DR7T 2F4VT 4JI8T 4LF8T 4K0KT 4X62T 5LMUT 1IBKT 4B3RT 4JI4T 4JI0T 3OTOT 2UUCT 4NXMT 4DV2T 2UXCT 4X66T 5BR8T 4X64T 2E5LT 4JI2T 4B3ST 4JI6T 4JI1T 1HR0T 1N34T 4X65T 4OX9T 3T1HT 4YHHT 1XNQT 4DV3T 4GKJT 1XMOT 4LF4T 4JV5T 1N32T 4DUYT 1IBMT
chains in the Genus database with same CATH superfamily
4P1NA 4U7IA 2CBIA 4DVDA 3ZPOA 2PBIA 2DI4A 2CM0A 4P0BA 4OHFA 3DP7A 4ZEYA 2JIWA 4DR4T 4X1KE 1LVKA 5AQTB 2BDEA 2LSYA 2BG9A 3AE7A 4LF6T 3AVSA 2KT9A 4IDZA 1S94A 3A5XA 3ESLA 2ZM6T 4LMKA 3OJAA 3E08A 2LM2A 3PUVF 1UUSA 2BKPA 2YOEA 2PG8A 3PTRB 2D5UA 4AKGA 1SHZC 3UT5E 5FYMA 2V5CA 1WYCA 2E9XD 2V1DB 2NW7A 3LBXB 2Z6EA 3V5SA 3S4UA 3ONJA 3RF1A 1FMVA 3VRBA 2QA7A 2WM9A 3RYHE 3UUXB 5EK2A 2MBGA 4GYRA 2K48A 4U7YA 2IDOB 3MJXA 2UXCT 1WR6A 2I59A 5FKYA 2BG9E 3NZQA 3PUSA 4DMWA 5LJMA 2XAHB 3P4QA 3IF8B 1YQ3A 3AE1A 4EB6E 4LMLA 4PK4A 3FHNA 3UU4A 5JDGA 1N32T 3EUHA 5FXZA 3SWHA 2WQYA 2HH7A 1UURA 4QH1A 4TV9E 2M6BA 3ZT5A 2XAGB 3I0OA 2FJBA 2FBWA 3LFMA 4EOZB 4DBRA 3H3MA 2YEVC 2A3DA 3N2KE 1R8IA 3N9OA 3VKGA 1CUNA 2ZMAA 2WU2A 4OYKA 3AEFA 3PUXF 4XBFB 2V8SV 5JTGA 3RIAA 2X0HA 5JDMA 2E9XA 3SFDA 5FNVE 4LMJA 4ZI2D 4QXHB 3UU3A 4IIJE 4DV0T 1VOMA 1HF8A 2YDQA 5LA6E 3O1IA 2XTLA 4JUYA 4JLEA 5AQQB 4PJLA 4YY3T 5AQLB 1OEDA 4AISA 2QVAA 2YDRA 5ABFB 2WMNA 1XWMA 5TAOA 4HE8A 3ZYLA 2GK9A 5BR8T 3KV9A 3N2GE 3QC9A 1HR0T 3T1HT 3FXDB 1U5PA 3LDQB 4EEBA 4O4IE 2A2FX 4DMVA 3AA6B 2KZ7B 4L0RA 3TLVA 4XZCA 4AQYT 4UF0A 3T1YT 2EHOD 3AA1B 2J1DG 3H3AA 4AKRB 5HEGA 3M65A 2E2AA 1OEDE 3DTOA 4HFVA 3ETVA 1MIVA 3P50A 2CE7A 4MFRA 3I9YA 4CI2B 5IHYA 5AQIB 4MLKA 3ZYMA 4ADZA 3VR8A 2LEHA 5J2UE 3HI2A 2Q9QD 3RI5A 3PUAA 4YSXA 2MAWA 2LOPA 5AQOB 4AIUA 2FJAA 3TLTA 4HWDA 4WBNE 4ZZBA 4HWIB 3N5LA 3ZKRA 5IUXA 4G2AA 3RYCE 4IL9A 2YN6A 4ZZCA 2BG9C 5AFUL 5AQHB 5LMUT 2LRLA 3JCFA 4H9NC 4E7SA 2XAFB 2UUCT 2IC9A 4DV2T 4YT0A 2BBHA 5LBMA 4X1IE 5HXSA 3JADA 2KWHA 2XJ7A 4IDOA 4UV8B 4X65T 5LXTE 4U3CA 2EHOA 4ILAA 1KF6A 4IREA 2Y48B 2XM2A 2BS3A 3PV0F 4PFOA 4YHJA 4EV6A 3RQWA 2H7VC 4CXXA 2BVMA 4J2CA 2I6HA 3RHWA 2H89A 3AXJA 3F2EA 4GYSA 3UQ7A 4TN7B 1IJ5A 4F8HA 4EGWA 4DO0A 4AQFC 2Q9QA 5IYZE 5JQGE 3QB5A 4YXDA 4OYJA 5ABGA 4H9SE 4F6RC 2XSAA 4KMCA 4BAYB 3JAEA 4H9PC 5LGNB 3KVBA 3K3OA 5HXRA 5FXWA 1NEKA 4G63A 3BQLA 5L4HA 1Z8UA 1HTJF 5HEJA 4CZZB 4GKKT 5FY7A 2CPTA 2NWBA 4Q25A 5A1LA 1NENA 1XZYA 5JDQA 1WR0A 2E5LT 5J1GA 5EK3A 4JI6T 1ZOYA 1UX4A 5CA1E 2LLYA 3IHRA 3RYFE 2V6XA 3OPCA 4HFDA 2Y8DA 1MMDA 3RKGA 2LHNA 2CHNA 3OVUA 4EXTA 4C91A 2KSRA 3OBVE 1T72A 1UX5A 5JREA 4YLHA 2JMHA 4X1YE 5DJQC 4YSZA 4HWCA 4AKIA 1CHUA 3Q5WA 2FJDA 1M62A 4PK6A 4K0UA 4DIDB 2UUAT 4IT4A 2XAQB 2XASB 1T7SA 1OXZA 1I94T 2CMRA 3P4PA 2IC6A 2WDRA 4P09A 4TV8E 3OYXA 1E2AA 3K8PC 4X62T 1MNEA 5AQMB 3R6NA 5LHGB 2LE8A 2HN1A 3GN5A 3JC6D 2XM1A 2B76A 1N34T 2L9QA 1J1JA 1XMOT 4HFEA 5JR9A 1MMAA 1DU2A 4X20E 3BQIA 4H9OC 3ZJ1A 2CXDA 3QK6A 2X51A 2LRKA 4ZHQE 2X67A 4DV7T 3AEGA 5L3GB 3PE0A 1D0XA 3K3NA 2WAUA 2C5KT 2DWGA 4DV4T 2D9DA 3PUGA 3NVOA 1V9DA 4CXYA 4KX6A 2E8IA 2Y6XA 2UUBT 4L9IA 5LGUB 3KFWX 2XSBA 4ILBA 1XNRT 4H9QC 4PW8A 2SPCA 4U33A 2JRKA 3H37A 2MTQA 2W4XA 3HKBE 3SS1A 1BR2A 1EZ3A 3RC8A 1Y01A 5C3JA 4IE0A 4YJ3E 5C8YE 2BVLA 1W0BA 4PFPA 4LF9T 2YU1A 3PUZF 1D0ZA 2CRBA 3UU8A 4UEMA 3M3ZB 2YDSA 3UFGA 5AQGB 3N9MA 3OTOT 3MACA 3HL6A 2H88A 4ZI3D 5EZYE 4A56A 2VL0A 1ZEEA 3Q5EA 5L3FB 4DV3T 4I4TE 1QLBA 1IAPA 3AE2A 4IDNA 2BS2A 3VHLA 2K24A 3A7MA 3KVAA 3L09A 4WZXA 2XQAA 3ZMTB 2CBJA 1U4QA 2D2SA 3EI0A 3PURA 2PFVA 2IAKA 2ACZA 5AQSB 5JVDE 4PK5A 2JJ9A 1KEYA 2CLYC 5DABA 2V26A 1D1CA 2V6YA 1WRDA 4UIGA 2J62A 3UFEA 2WB5A 4I55E 3U3IA 1HG5A 5AQKB 4WBOA 3BK9A 5LOVE 3QUJA 2N9DA 4QX7B 2MPKA 2XUEA 3MK7C 3WI3A 4ERRA 3Q5DA 5F5WA 4U74A 3RC3A 3AE8A 4ANJA 2C0SA 3FB2A 3FZLB 2M6IA 2IMLA 2DL1A 2F4VT 5LJNA 1T98A 4NXMT 4X66T 1LRZA 1WLXA 3KINB 3UUNA 3PUYF 2OV9A 5E0OA 5FP3A 5H6RB 4YTNA 3EVYA 4GK5E 4X5TA 3EDVA 4TUYE 2G0UA 1XDPA 4EIWA 3CX6B 5L3BB 1JNZA 3NWIA 2BZBA 3UUMA 4MALA 1UGOA 2WS3A 4IDPA 1D0YA 4ILCA 1E7PA 3CMLA 2C5JA 5ADXL 2UXXB 3CK6A 3PJAJ 2DCFA 2JQHA 4EEDA 3C51A 3J7Yq 2VK9A 4DUZT 3HKDE 1AJ3A 1D1AA 2IW5B 3FBZA 2RPAA 3RIUA 4FI5A 2HN2A 2CLYB 5CJ5A 2LJLA 5L3DB 2YU2A 4U72A 5JDLA 4JI3T 4HFBA 4NIQA 3LBXA 3N9QA 1E1HB 3HR0A 1HS7A 1BR0A 2VVSA 4PJNA 4TWFA 1G8XA 4TWHA 2CHOA 2CXLA 4H63H 2XZEA 4JI0T 3B5MA 3HKEE 3SFEA 1GQEA 5LG3A 3ZSSA 5HYAA 4HN9A 2YINA 2CWYA 4AXPA 4GKJT 2WSSV 2H7OA 2X0LB 3PDYA 3PU8A 3WAJA 3KBTA 3I0QA 2C5IT 2WY2A 2X9XA 2HHHT 5KMGP 5F3JA 2V7MA 2XPKA 3T8OA 3ZCIA 4KHPT 3C4ZA 4ZOLE 3AE5A 2LSJA 3EABA 2W66A 3LG7A 5ETWA 2I0MA 2AXDS 3KV4A 1QSDA 5JRCB 3A8YC 1YKEB 5M4YA 3WAKA 3ZSTA 2LSIA 3L39A 2YKSA 2X68A 2N1GA 4QWNB 3R84B 1X9BA 3LJCA 2N2NA 5LP6E 5HXEA 2LSGA 2XQ7A 3P4WA 5KX5E 4EZHA 5CFBA 4H9RC 4UVAB 3PUQA 2CXFA 4ZI7E 3FZMB 1XDOA 3ZCJA 2X0YA 2FUPA 4O4HE 2YK0A 3I1AA 4IE5A 4TNWA 5ABFA 3AAEB 3LK3B 3PJAA 2LOSA 3CQCB 5LB7B 3KV5A 2XQ4A 1MIYA 4WNKA 2L3LA 1VRBA 4HWHA 2ODUA 2WP9A 3RYIE 3CX7B 2J4GA 2XY8B 2E9XC 2UXNB 4CI1B 4ZI3C 4AI6A 1VCSA 5HEOA 1WFDA 3O9XA 2VASA 3W15B 4HEAA 3Q5XA 4DR3T 2BG9B 3ETUA 5ABEA 1OEDC 2XQ3A 3E22E 5FMNA 4LF7T 2KINB 2WMOA 1BR4A 3ZYKA 4AKLA 4O2AE 5CB4E 1O3XA 4LF5T 2LHRA 3VKHA 5GONE 4LFAT 5L3CB 4CN1A 4DR1T 3ZT6A 2WU5A 2V7JA 1Y64B 4WW0A 2XAJB 1N36T 2NW9A 3NRXA 2L8KA 2D0UA 5JDFA 5L4EA 1WCRA 5KDMC 4K0KT 2QRXA 3FZHB 3X1DA 2ZM2A 4A98A 3AE6A 1KNZA 4UXNB 2IIUA 3NZPA 4TX5A 3RH3A 2NR4A 2XHEB 4ZI2C 2ZM0A 2PJQA 4JV5T 4I50E 2BKNA 3SOLA 2AE9A 1HCIA 4HFCA 1IBMT 2PTFA 2HPLA 1ZHCA 1J5WA 4P0AA 5BMVE 2VKDA 3L3PA 2M67A 5JRCA 4BJNA 4DV6T 1N33T 4YTMA 1MMNA 5JH7E 4PJMA 2BS4A 4O4JE 3C98B 5DQVA 5HWYA 3RKOA 3PU3A 1MMGA 2B1EA 2A9UA 3J9X1 2JQQA 2E9XB 5AQNB 3P7IA 3CPZA 4DV5T 2VKJA 1W9RA 4CQIA 1HX8A 5EK4A 3UU6A 3K3QC 4IDQA 5LMNT 4QKNA 1US7B 5H6QB 4ISTA 2JMKA 1MNDA 2LKHA 4A97A 2ODVA 2BBJA 2W2UA 1YD8G 2FJEA 3NBXX 3BQKA 3B57A 1OEDB 1FEWA 3CQXC 2XQ6A 4DR6T 2EHOC 1NWMX 2KLQA 4Z8XA 4U2ZA 3TLWA 3ONXA 2VKOA 3CIRA 4UV9B 5HCMA 3O1JA 1SUMB 4MBQA 2X9YA 1QUUA 5LGTB 2WZIA 4A5XA 1YKHB 1I6ZA 5AQRB 5LHIB 1W0AA 3C4WA 2JPFA 2Q9QC 4I0UA 3AE4A 3EAMA 2ACXA 4YFSA 2QGSA 4UF0B 4YTPA 1IBLT 3P4SA 2UXBT 2NTXA 2D0TA 3U78A 3DJBA 4IE7A 3ZN1B 2XQYA 4E7ZA 3SRZA 4Z90A 1KNRA 3N9PA 3RQUA 4KP3C 2W67A 2LM9A 4QX8B 2CEAA 2VQFT 4NUVA 4KHZF 5L47A 4HGAA 2KXPB 4EZ4A 3Q9DA 2BKOA 1YQ4A 3Q2MA 2VB6A 5LYJE 5LHHB 3ANWB 2ZLYA 3RRCA 5FXXA 4AQFA 2V7IA 5J2TE 2JQKA 3TLSA 5KXJA 2MYSA 1HG2A 1ZV4X 5L2LA 4ZXLA 3KV6A 1OWAA 4JI4T 1KNPA 4U2YA 1Z0PA 4QXBB 1YW0A 4H63V 3FXEB 4X64T 1B7TA 2CCQA 3HKCE 4JI2T 3LK42 2EHOB 3ZMVB 4CN4A 3CVRA 3LSVA 5FVLA 4B6XA 4O2BE 1YXRA 4LF4T 3F31A 4NPPA 2WCAA 4UVBB 3IBPA 3RLFF 4GIWA 3IA3A 2X66A 5FL1A 3RGLA 3AXJB 2VWAA 2WDQA 5LCYA 3P4RA 3UU5A 4QH4A 3ZC0A 1J5ET 1HNWT 2OLTA 4NXNT 4GOUA 2Q9QB 2W61A 5AQFB 3QB5K 1IZNB 2KWIB 3C64A 3FZKB 4IGUA 3RPUA 4BJMA 4DV1T 2DWKA 3UTKA 2V5DA 4TWDA 4JI7T 5FY1A 1FJGT 4DR2T 5JDNA 1XMQT 3O4XE 5IWAT 1G73A 3JAFA 3F57A 4FJOA 4GK0E 5JR9C 3N9LA 2WWVA 1UCUA 1ZKEA 3FZFB 3D0TA 2CWOA 1S35A 4B3RT 1FIOA 3RRWA 2WWUA 5HAXA 4AQGA 3B13A 4M1PA 3ABVA 3HA4A 5HEHA 5AQUB 4EYUA 4B3ST 3N9NA 5J0ZA 3ZJ2A 2LSKA 2V7KA 4YHHT 1XNQT 4PAGA 2VKHA 3MKDA 2K5BB 4EAHA 4ILUA 3AA0B 1NAFA 4HTEA 4ISSA 2WZHA 3EDUA 4MHCA 3AE3A 3AEDA 5HCJA 2NOXA 4JEUB 2MOZA 3LK2B 2KNDA 4JYAT 5FY0A 4XAXB 3VRAA 2DLRA 1LKXA 4UELA 3NRYA 3ANWA 3FBLA 2XQ9A 4BA9A 3UUBA 1MIWA 5FVKA 4WYVA 3JC6C 4IHJE 4COFA 4CXWA 2NW8A 1L0VA 4C90A 2H3RA 3VR9A 2CA5A 2W62A 4ASKA 2RP4A 2ES0A 4UR9A 1IJ6A 2V7LA 4JBWF 1SE7A 3E0ZA 3VU7H 3V5UA 4DNDA 3AB3B 3G06A 2K9AA 2IUBA 3GN5B 3MZKB 3L8RA 2NP9A 3CWZB 3O1HA 3RX6A 4AKHA 5DQWA 3TKLB 5JR9B 4OX9T 4QXCB 2P9BA 4HFHA 3AVRA 5CGMA 2KMFA 3UQ4A 5HWXA 3GMIA 2OA5A 2RA1A 4CI3B 4DUYT 1W09A 4NUUA 4UVCB 3ZT7A 2E5VA 4TNVA 2LKGA 4JEHB 4IE4A 1HX1B 4DR5T 4JI5T 1KFYA 2UXDT 2J47A 1SA0E 2A72A 1HFAA 4CN6A 3PUWF 3K1SA 3AA7B 4PNIA 5ABHA 3ZC1A 3ZN0B 1LVFA 2W00A 3AAAB 3QNUA 2HPJA 3RIFA 3AEEA 5AQVB 3EHZA 3CQGB 5HXCA 1HNZT 4QHOA 3ZMSB 4U31A 3AEAA 3I9WA 5HEUA 5CA0E 4YSYA 3KDSE 3NKZA 3TLUA 2NTYA 3C50A 1T8BA 3OYZA 3OKQA 5FXVA 4EYYR 3CX8B 3P8CD 4OFZA 4DR7T 5HXHA 3ZEFB 4HKAA 1X79A 4TZ4C 4HWFA 3ZMUB 5F8PA 3KBUA 1JNRA 4N78D 1ZP0A 2IHR1 2W0GA 4JI1T 1KK7A 2VL8A 2DHRA 3AECA 1H7CA 2QYWA 1HNXT 5LG4A 3CKDA 4LFCT 4OK0A 3RIUC 3ZMZB 3QOFA 3N2OA 1UK5A 5AQPB 3AAIA 5L3EB 2V6YB 1M7KA 2X9HA 4KI0F 2VURA 2UU9T 5C2TA 4DBQA 2X9WA 5LNKA 4B3MT 2R6GF 3MA9A 4L5GA 2ZM8A 5AQJB 2JQ9A 4O8SA 3ONLC 4V1Av 2WDVA 3AE9A 1D1BA 1BR1A 4ZS2A 4B3TT 4QH5A 3MXZA 3IEEA 4ZS3A 2XQ5A 5FL0A 3AEBA 3UULA 4IE6A 4IL4A 3ZLIA 4LFBT 2LT3A 3GWHA 4O4LE 2VQET 2WBLA 2W63A 4I43B 4Z91A 4JI8T 4YJ2E 4KUMB 4LF8T 3GA8A 1IBKT 3C4XA 1VCTA 2K3WA 2XQ8A 1WYBA 4PJJA 2VVNA 5LBQB 1FMWA 5JDHA 4KBMB 2DNXA 4HFIA
chains in the Genus database with same CATH topology
1IBLT 1HNXT 2HHHT 4AQYT 2UXBT 3T1YT 4LFCT 4DV7T 4DV6T 1N33T 4KHPT 4DR5T 4JI5T 1J5ET 1HNWT 4NXNT 4JYAT 2UXDT 4DV4T 4DR3T 2UU9T 4DR4T 2UUBT 4LF6T 4B3MT 1XNRT 2VQFT 4DUZT 2ZM6T 4DV5T 4LF7T 4DV1T 1HNZT 4B3TT 5LMNT 4LF5T 4JI7T 4DV0T 4LFAT 1FJGT 2UUAT 4DR2T 1XMQT 4DR1T 5IWAT 4JI3T 1I94T 4DR6T 4LF9T 4LFBT 4GKKT 4YY3T 2VQET 1N36T 4DR7T 2F4VT 4JI8T 4LF8T 4K0KT 4X62T 5LMUT 1IBKT 4B3RT 4JI4T 4JI0T 3OTOT 2UUCT 4NXMT 4DV2T 2UXCT 4X66T 5BR8T 4X64T 2E5LT 4JI2T 4B3ST 4JI6T 4JI1T 1HR0T 1N34T 4X65T 4OX9T 3T1HT 4YHHT 1XNQT 4DV3T 4GKJT 1XMOT 4LF4T 4JV5T 1N32T 4DUYT 1IBMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL T;  1HNX T;  2HHH T;  4AQY T;  2UXB T;  3T1Y T;  4LFC T;  4DV7 T;  4DV6 T;  1N33 T;  4KHP T;  4DR5 T;  4JI5 T;  1J5E T;  1HNW T;  4NXN T;  4JYA T;  2UXD T;  4DV4 T;  4DR3 T;  2UU9 T;  4DR4 T;  2UUB T;  4LF6 T;  4B3M T;  1XNR T;  2VQF T;  4DUZ T;  2ZM6 T;  4DV5 T;  4LF7 T;  4DV1 T;  1HNZ T;  4B3T T;  5LMN T;  4LF5 T;  4JI7 T;  4DV0 T;  4LFA T;  1FJG T;  2UUA T;  4DR2 T;  1XMQ T;  4DR1 T;  5IWA T;  4JI3 T;  1I94 T;  4DR6 T;  4LF9 T;  4LFB T;  4GKK T;  4YY3 T;  2VQE T;  1N36 T;  4DR7 T;  2F4V T;  4JI8 T;  4LF8 T;  4K0K T;  4X62 T;  5LMU T;  1IBK T;  4B3R T;  4JI4 T;  4JI0 T;  3OTO T;  2UUC T;  4NXM T;  4DV2 T;  2UXC T;  4X66 T;  5BR8 T;  4X64 T;  2E5L T;  4JI2 T;  4B3S T;  4JI6 T;  4JI1 T;  1HR0 T;  1N34 T;  4X65 T;  4OX9 T;  3T1H T;  4YHH T;  1XNQ T;  4DV3 T;  4GKJ T;  1XMO T;  4LF4 T;  4JV5 T;  1N32 T;  4DUY T;  1IBM T; 
#chains in the Genus database with same CATH topology
 4P1N A;  4U7I A;  2CBI A;  4DVD A;  3ZPO A;  2PBI A;  2DI4 A;  2CM0 A;  4P0B A;  4OHF A;  3DP7 A;  4ZEY A;  2JIW A;  4DR4 T;  4X1K E;  1LVK A;  5AQT B;  2BDE A;  2LSY A;  2BG9 A;  3AE7 A;  4LF6 T;  3AVS A;  2KT9 A;  4IDZ A;  1S94 A;  3A5X A;  3ESL A;  2ZM6 T;  4LMK A;  3OJA A;  3E08 A;  2LM2 A;  3PUV F;  1UUS A;  2BKP A;  2YOE A;  2PG8 A;  3PTR B;  2D5U A;  4AKG A;  1SHZ C;  3UT5 E;  5FYM A;  2V5C A;  1WYC A;  2E9X D;  2V1D B;  2NW7 A;  3LBX B;  2Z6E A;  3V5S A;  3S4U A;  3ONJ A;  3RF1 A;  1FMV A;  3VRB A;  2QA7 A;  2WM9 A;  3RYH E;  3UUX B;  5EK2 A;  2MBG A;  4GYR A;  2K48 A;  4U7Y A;  2IDO B;  3MJX A;  2UXC T;  1WR6 A;  2I59 A;  5FKY A;  2BG9 E;  3NZQ A;  3PUS A;  4DMW A;  5LJM A;  2XAH B;  3P4Q A;  3IF8 B;  1YQ3 A;  3AE1 A;  4EB6 E;  4LML A;  4PK4 A;  3FHN A;  3UU4 A;  5JDG A;  1N32 T;  3EUH A;  5FXZ A;  3SWH A;  2WQY A;  2HH7 A;  1UUR A;  4QH1 A;  4TV9 E;  2M6B A;  3ZT5 A;  2XAG B;  3I0O A;  2FJB A;  2FBW A;  3LFM A;  4EOZ B;  4DBR A;  3H3M A;  2YEV C;  2A3D A;  3N2K E;  1R8I A;  3N9O A;  3VKG A;  1CUN A;  2ZMA A;  2WU2 A;  4OYK A;  3AEF A;  3PUX F;  4XBF B;  2V8S V;  5JTG A;  3RIA A;  2X0H A;  5JDM A;  2E9X A;  3SFD A;  5FNV E;  4LMJ A;  4ZI2 D;  4QXH B;  3UU3 A;  4IIJ E;  4DV0 T;  1VOM A;  1HF8 A;  2YDQ A;  5LA6 E;  3O1I A;  2XTL A;  4JUY A;  4JLE A;  5AQQ B;  4PJL A;  4YY3 T;  5AQL B;  1OED A;  4AIS A;  2QVA A;  2YDR A;  5ABF B;  2WMN A;  1XWM A;  5TAO A;  4HE8 A;  3ZYL A;  2GK9 A;  5BR8 T;  3KV9 A;  3N2G E;  3QC9 A;  1HR0 T;  3T1H T;  3FXD B;  1U5P A;  3LDQ B;  4EEB A;  4O4I E;  2A2F X;  4DMV A;  3AA6 B;  2KZ7 B;  4L0R A;  3TLV A;  4XZC A;  4AQY T;  4UF0 A;  3T1Y T;  2EHO D;  3AA1 B;  2J1D G;  3H3A A;  4AKR B;  5HEG A;  3M65 A;  2E2A A;  1OED E;  3DTO A;  4HFV A;  3ETV A;  1MIV A;  3P50 A;  2CE7 A;  4MFR A;  3I9Y A;  4CI2 B;  5IHY A;  5AQI B;  4MLK A;  3ZYM A;  4ADZ A;  3VR8 A;  2LEH A;  5J2U E;  3HI2 A;  2Q9Q D;  3RI5 A;  3PUA A;  4YSX A;  2MAW A;  2LOP A;  5AQO B;  4AIU A;  2FJA A;  3TLT A;  4HWD A;  4WBN E;  4ZZB A;  4HWI B;  3N5L A;  3ZKR A;  5IUX A;  4G2A A;  3RYC E;  4IL9 A;  2YN6 A;  4ZZC A;  2BG9 C;  5AFU L;  5AQH B;  5LMU T;  2LRL A;  3JCF A;  4H9N C;  4E7S A;  2XAF B;  2UUC T;  2IC9 A;  4DV2 T;  4YT0 A;  2BBH A;  5LBM A;  4X1I E;  5HXS A;  3JAD A;  2KWH A;  2XJ7 A;  4IDO A;  4UV8 B;  4X65 T;  5LXT E;  4U3C A;  2EHO A;  4ILA A;  1KF6 A;  4IRE A;  2Y48 B;  2XM2 A;  2BS3 A;  3PV0 F;  4PFO A;  4YHJ A;  4EV6 A;  3RQW A;  2H7V C;  4CXX A;  2BVM A;  4J2C A;  2I6H A;  3RHW A;  2H89 A;  3AXJ A;  3F2E A;  4GYS A;  3UQ7 A;  4TN7 B;  1IJ5 A;  4F8H A;  4EGW A;  4DO0 A;  4AQF C;  2Q9Q A;  5IYZ E;  5JQG E;  3QB5 A;  4YXD A;  4OYJ A;  5ABG A;  4H9S E;  4F6R C;  2XSA A;  4KMC A;  4BAY B;  3JAE A;  4H9P C;  5LGN B;  3KVB A;  3K3O A;  5HXR A;  5FXW A;  1NEK A;  4G63 A;  3BQL A;  5L4H A;  1Z8U A;  1HTJ F;  5HEJ A;  4CZZ B;  4GKK T;  5FY7 A;  2CPT A;  2NWB A;  4Q25 A;  5A1L A;  1NEN A;  1XZY A;  5JDQ A;  1WR0 A;  2E5L T;  5J1G A;  5EK3 A;  4JI6 T;  1ZOY A;  1UX4 A;  5CA1 E;  2LLY A;  3IHR A;  3RYF E;  2V6X A;  3OPC A;  4HFD A;  2Y8D A;  1MMD A;  3RKG A;  2LHN A;  2CHN A;  3OVU A;  4EXT A;  4C91 A;  2KSR A;  3OBV E;  1T72 A;  1UX5 A;  5JRE A;  4YLH A;  2JMH A;  4X1Y E;  5DJQ C;  4YSZ A;  4HWC A;  4AKI A;  1CHU A;  3Q5W A;  2FJD A;  1M62 A;  4PK6 A;  4K0U A;  4DID B;  2UUA T;  4IT4 A;  2XAQ B;  2XAS B;  1T7S A;  1OXZ A;  1I94 T;  2CMR A;  3P4P A;  2IC6 A;  2WDR A;  4P09 A;  4TV8 E;  3OYX A;  1E2A A;  3K8P C;  4X62 T;  1MNE A;  5AQM B;  3R6N A;  5LHG B;  2LE8 A;  2HN1 A;  3GN5 A;  3JC6 D;  2XM1 A;  2B76 A;  1N34 T;  2L9Q A;  1J1J A;  1XMO T;  4HFE A;  5JR9 A;  1MMA A;  1DU2 A;  4X20 E;  3BQI A;  4H9O C;  3ZJ1 A;  2CXD A;  3QK6 A;  2X51 A;  2LRK A;  4ZHQ E;  2X67 A;  4DV7 T;  3AEG A;  5L3G B;  3PE0 A;  1D0X A;  3K3N A;  2WAU A;  2C5K T;  2DWG A;  4DV4 T;  2D9D A;  3PUG A;  3NVO A;  1V9D A;  4CXY A;  4KX6 A;  2E8I A;  2Y6X A;  2UUB T;  4L9I A;  5LGU B;  3KFW X;  2XSB A;  4ILB A;  1XNR T;  4H9Q C;  4PW8 A;  2SPC A;  4U33 A;  2JRK A;  3H37 A;  2MTQ A;  2W4X A;  3HKB E;  3SS1 A;  1BR2 A;  1EZ3 A;  3RC8 A;  1Y01 A;  5C3J A;  4IE0 A;  4YJ3 E;  5C8Y E;  2BVL A;  1W0B A;  4PFP A;  4LF9 T;  2YU1 A;  3PUZ F;  1D0Z A;  2CRB A;  3UU8 A;  4UEM A;  3M3Z B;  2YDS A;  3UFG A;  5AQG B;  3N9M A;  3OTO T;  3MAC A;  3HL6 A;  2H88 A;  4ZI3 D;  5EZY E;  4A56 A;  2VL0 A;  1ZEE A;  3Q5E A;  5L3F B;  4DV3 T;  4I4T E;  1QLB A;  1IAP A;  3AE2 A;  4IDN A;  2BS2 A;  3VHL A;  2K24 A;  3A7M A;  3KVA A;  3L09 A;  4WZX A;  2XQA A;  3ZMT B;  2CBJ A;  1U4Q A;  2D2S A;  3EI0 A;  3PUR A;  2PFV A;  2IAK A;  2ACZ A;  5AQS B;  5JVD E;  4PK5 A;  2JJ9 A;  1KEY A;  2CLY C;  5DAB A;  2V26 A;  1D1C A;  2V6Y A;  1WRD A;  4UIG A;  2J62 A;  3UFE A;  2WB5 A;  4I55 E;  3U3I A;  1HG5 A;  5AQK B;  4WBO A;  3BK9 A;  5LOV E;  3QUJ A;  2N9D A;  4QX7 B;  2MPK A;  2XUE A;  3MK7 C;  3WI3 A;  4ERR A;  3Q5D A;  5F5W A;  4U74 A;  3RC3 A;  3AE8 A;  4ANJ A;  2C0S A;  3FB2 A;  3FZL B;  2M6I A;  2IML A;  2DL1 A;  2F4V T;  5LJN A;  1T98 A;  4NXM T;  4X66 T;  1LRZ A;  1WLX A;  3KIN B;  3UUN A;  3PUY F;  2OV9 A;  5E0O A;  5FP3 A;  5H6R B;  4YTN A;  3EVY A;  4GK5 E;  4X5T A;  3EDV A;  4TUY E;  2G0U A;  1XDP A;  4EIW A;  3CX6 B;  5L3B B;  1JNZ A;  3NWI A;  2BZB A;  3UUM A;  4MAL A;  1UGO A;  2WS3 A;  4IDP A;  1D0Y A;  4ILC A;  1E7P A;  3CML A;  2C5J A;  5ADX L;  2UXX B;  3CK6 A;  3PJA J;  2DCF A;  2JQH A;  4EED A;  3C51 A;  3J7Y q;  2VK9 A;  4DUZ T;  3HKD E;  1AJ3 A;  1D1A A;  2IW5 B;  3FBZ A;  2RPA A;  3RIU A;  4FI5 A;  2HN2 A;  2CLY B;  5CJ5 A;  2LJL A;  5L3D B;  2YU2 A;  4U72 A;  5JDL A;  4JI3 T;  4HFB A;  4NIQ A;  3LBX A;  3N9Q A;  1E1H B;  3HR0 A;  1HS7 A;  1BR0 A;  2VVS A;  4PJN A;  4TWF A;  1G8X A;  4TWH A;  2CHO A;  2CXL A;  4H63 H;  2XZE A;  4JI0 T;  3B5M A;  3HKE E;  3SFE A;  1GQE A;  5LG3 A;  3ZSS A;  5HYA A;  4HN9 A;  2YIN A;  2CWY A;  4AXP A;  4GKJ T;  2WSS V;  2H7O A;  2X0L B;  3PDY A;  3PU8 A;  3WAJ A;  3KBT A;  3I0Q A;  2C5I T;  2WY2 A;  2X9X A;  2HHH T;  5KMG P;  5F3J A;  2V7M A;  2XPK A;  3T8O A;  3ZCI A;  4KHP T;  3C4Z A;  4ZOL E;  3AE5 A;  2LSJ A;  3EAB A;  2W66 A;  3LG7 A;  5ETW A;  2I0M A;  2AXD S;  3KV4 A;  1QSD A;  5JRC B;  3A8Y C;  1YKE B;  5M4Y A;  3WAK A;  3ZST A;  2LSI A;  3L39 A;  2YKS A;  2X68 A;  2N1G A;  4QWN B;  3R84 B;  1X9B A;  3LJC A;  2N2N A;  5LP6 E;  5HXE A;  2LSG A;  2XQ7 A;  3P4W A;  5KX5 E;  4EZH A;  5CFB A;  4H9R C;  4UVA B;  3PUQ A;  2CXF A;  4ZI7 E;  3FZM B;  1XDO A;  3ZCJ A;  2X0Y A;  2FUP A;  4O4H E;  2YK0 A;  3I1A A;  4IE5 A;  4TNW A;  5ABF A;  3AAE B;  3LK3 B;  3PJA A;  2LOS A;  3CQC B;  5LB7 B;  3KV5 A;  2XQ4 A;  1MIY A;  4WNK A;  2L3L A;  1VRB A;  4HWH A;  2ODU A;  2WP9 A;  3RYI E;  3CX7 B;  2J4G A;  2XY8 B;  2E9X C;  2UXN B;  4CI1 B;  4ZI3 C;  4AI6 A;  1VCS A;  5HEO A;  1WFD A;  3O9X A;  2VAS A;  3W15 B;  4HEA A;  3Q5X A;  4DR3 T;  2BG9 B;  3ETU A;  5ABE A;  1OED C;  2XQ3 A;  3E22 E;  5FMN A;  4LF7 T;  2KIN B;  2WMO A;  1BR4 A;  3ZYK A;  4AKL A;  4O2A E;  5CB4 E;  1O3X A;  4LF5 T;  2LHR A;  3VKH A;  5GON E;  4LFA T;  5L3C B;  4CN1 A;  4DR1 T;  3ZT6 A;  2WU5 A;  2V7J A;  1Y64 B;  4WW0 A;  2XAJ B;  1N36 T;  2NW9 A;  3NRX A;  2L8K A;  2D0U A;  5JDF A;  5L4E A;  1WCR A;  5KDM C;  4K0K T;  2QRX A;  3FZH B;  3X1D A;  2ZM2 A;  4A98 A;  3AE6 A;  1KNZ A;  4UXN B;  2IIU A;  3NZP A;  4TX5 A;  3RH3 A;  2NR4 A;  2XHE B;  4ZI2 C;  2ZM0 A;  2PJQ A;  4JV5 T;  4I50 E;  2BKN A;  3SOL A;  2AE9 A;  1HCI A;  4HFC A;  1IBM T;  2PTF A;  2HPL A;  1ZHC A;  1J5W A;  4P0A A;  5BMV E;  2VKD A;  3L3P A;  2M67 A;  5JRC A;  4BJN A;  4DV6 T;  1N33 T;  4YTM A;  1MMN A;  5JH7 E;  4PJM A;  2BS4 A;  4O4J E;  3C98 B;  5DQV A;  5HWY A;  3RKO A;  3PU3 A;  1MMG A;  2B1E A;  2A9U A;  3J9X 1;  2JQQ A;  2E9X B;  5AQN B;  3P7I A;  3CPZ A;  4DV5 T;  2VKJ A;  1W9R A;  4CQI A;  1HX8 A;  5EK4 A;  3UU6 A;  3K3Q C;  4IDQ A;  5LMN T;  4QKN A;  1US7 B;  5H6Q B;  4IST A;  2JMK A;  1MND A;  2LKH A;  4A97 A;  2ODV A;  2BBJ A;  2W2U A;  1YD8 G;  2FJE A;  3NBX X;  3BQK A;  3B57 A;  1OED B;  1FEW A;  3CQX C;  2XQ6 A;  4DR6 T;  2EHO C;  1NWM X;  2KLQ A;  4Z8X A;  4U2Z A;  3TLW A;  3ONX A;  2VKO A;  3CIR A;  4UV9 B;  5HCM A;  3O1J A;  1SUM B;  4MBQ A;  2X9Y A;  1QUU A;  5LGT B;  2WZI A;  4A5X A;  1YKH B;  1I6Z A;  5AQR B;  5LHI B;  1W0A A;  3C4W A;  2JPF A;  2Q9Q C;  4I0U A;  3AE4 A;  3EAM A;  2ACX A;  4YFS A;  2QGS A;  4UF0 B;  4YTP A;  1IBL T;  3P4S A;  2UXB T;  2NTX A;  2D0T A;  3U78 A;  3DJB A;  4IE7 A;  3ZN1 B;  2XQY A;  4E7Z A;  3SRZ A;  4Z90 A;  1KNR A;  3N9P A;  3RQU A;  4KP3 C;  2W67 A;  2LM9 A;  4QX8 B;  2CEA A;  2VQF T;  4NUV A;  4KHZ F;  5L47 A;  4HGA A;  2KXP B;  4EZ4 A;  3Q9D A;  2BKO A;  1YQ4 A;  3Q2M A;  2VB6 A;  5LYJ E;  5LHH B;  3ANW B;  2ZLY A;  3RRC A;  5FXX A;  4AQF A;  2V7I A;  5J2T E;  2JQK A;  3TLS A;  5KXJ A;  2MYS A;  1HG2 A;  1ZV4 X;  5L2L A;  4ZXL A;  3KV6 A;  1OWA A;  4JI4 T;  1KNP A;  4U2Y A;  1Z0P A;  4QXB B;  1YW0 A;  4H63 V;  3FXE B;  4X64 T;  1B7T A;  2CCQ A;  3HKC E;  4JI2 T;  3LK4 2;  2EHO B;  3ZMV B;  4CN4 A;  3CVR A;  3LSV A;  5FVL A;  4B6X A;  4O2B E;  1YXR A;  4LF4 T;  3F31 A;  4NPP A;  2WCA A;  4UVB B;  3IBP A;  3RLF F;  4GIW A;  3IA3 A;  2X66 A;  5FL1 A;  3RGL A;  3AXJ B;  2VWA A;  2WDQ A;  5LCY A;  3P4R A;  3UU5 A;  4QH4 A;  3ZC0 A;  1J5E T;  1HNW T;  2OLT A;  4NXN T;  4GOU A;  2Q9Q B;  2W61 A;  5AQF B;  3QB5 K;  1IZN B;  2KWI B;  3C64 A;  3FZK B;  4IGU A;  3RPU A;  4BJM A;  4DV1 T;  2DWK A;  3UTK A;  2V5D A;  4TWD A;  4JI7 T;  5FY1 A;  1FJG T;  4DR2 T;  5JDN A;  1XMQ T;  3O4X E;  5IWA T;  1G73 A;  3JAF A;  3F57 A;  4FJO A;  4GK0 E;  5JR9 C;  3N9L A;  2WWV A;  1UCU A;  1ZKE A;  3FZF B;  3D0T A;  2CWO A;  1S35 A;  4B3R T;  1FIO A;  3RRW A;  2WWU A;  5HAX A;  4AQG A;  3B13 A;  4M1P A;  3ABV A;  3HA4 A;  5HEH A;  5AQU B;  4EYU A;  4B3S T;  3N9N A;  5J0Z A;  3ZJ2 A;  2LSK A;  2V7K A;  4YHH T;  1XNQ T;  4PAG A;  2VKH A;  3MKD A;  2K5B B;  4EAH A;  4ILU A;  3AA0 B;  1NAF A;  4HTE A;  4ISS A;  2WZH A;  3EDU A;  4MHC A;  3AE3 A;  3AED A;  5HCJ A;  2NOX A;  4JEU B;  2MOZ A;  3LK2 B;  2KND A;  4JYA T;  5FY0 A;  4XAX B;  3VRA A;  2DLR A;  1LKX A;  4UEL A;  3NRY A;  3ANW A;  3FBL A;  2XQ9 A;  4BA9 A;  3UUB A;  1MIW A;  5FVK A;  4WYV A;  3JC6 C;  4IHJ E;  4COF A;  4CXW A;  2NW8 A;  1L0V A;  4C90 A;  2H3R A;  3VR9 A;  2CA5 A;  2W62 A;  4ASK A;  2RP4 A;  2ES0 A;  4UR9 A;  1IJ6 A;  2V7L A;  4JBW F;  1SE7 A;  3E0Z A;  3VU7 H;  3V5U A;  4DND A;  3AB3 B;  3G06 A;  2K9A A;  2IUB A;  3GN5 B;  3MZK B;  3L8R A;  2NP9 A;  3CWZ B;  3O1H A;  3RX6 A;  4AKH A;  5DQW A;  3TKL B;  5JR9 B;  4OX9 T;  4QXC B;  2P9B A;  4HFH A;  3AVR A;  5CGM A;  2KMF A;  3UQ4 A;  5HWX A;  3GMI A;  2OA5 A;  2RA1 A;  4CI3 B;  4DUY T;  1W09 A;  4NUU A;  4UVC B;  3ZT7 A;  2E5V A;  4TNV A;  2LKG A;  4JEH B;  4IE4 A;  1HX1 B;  4DR5 T;  4JI5 T;  1KFY A;  2UXD T;  2J47 A;  1SA0 E;  2A72 A;  1HFA A;  4CN6 A;  3PUW F;  3K1S A;  3AA7 B;  4PNI A;  5ABH A;  3ZC1 A;  3ZN0 B;  1LVF A;  2W00 A;  3AAA B;  3QNU A;  2HPJ A;  3RIF A;  3AEE A;  5AQV B;  3EHZ A;  3CQG B;  5HXC A;  1HNZ T;  4QHO A;  3ZMS B;  4U31 A;  3AEA A;  3I9W A;  5HEU A;  5CA0 E;  4YSY A;  3KDS E;  3NKZ A;  3TLU A;  2NTY A;  3C50 A;  1T8B A;  3OYZ A;  3OKQ A;  5FXV A;  4EYY R;  3CX8 B;  3P8C D;  4OFZ A;  4DR7 T;  5HXH A;  3ZEF B;  4HKA A;  1X79 A;  4TZ4 C;  4HWF A;  3ZMU B;  5F8P A;  3KBU A;  1JNR A;  4N78 D;  1ZP0 A;  2IHR 1;  2W0G A;  4JI1 T;  1KK7 A;  2VL8 A;  2DHR A;  3AEC A;  1H7C A;  2QYW A;  1HNX T;  5LG4 A;  3CKD A;  4LFC T;  4OK0 A;  3RIU C;  3ZMZ B;  3QOF A;  3N2O A;  1UK5 A;  5AQP B;  3AAI A;  5L3E B;  2V6Y B;  1M7K A;  2X9H A;  4KI0 F;  2VUR A;  2UU9 T;  5C2T A;  4DBQ A;  2X9W A;  5LNK A;  4B3M T;  2R6G F;  3MA9 A;  4L5G A;  2ZM8 A;  5AQJ B;  2JQ9 A;  4O8S A;  3ONL C;  4V1A v;  2WDV A;  3AE9 A;  1D1B A;  1BR1 A;  4ZS2 A;  4B3T T;  4QH5 A;  3MXZ A;  3IEE A;  4ZS3 A;  2XQ5 A;  5FL0 A;  3AEB A;  3UUL A;  4IE6 A;  4IL4 A;  3ZLI A;  4LFB T;  2LT3 A;  3GWH A;  4O4L E;  2VQE T;  2WBL A;  2W63 A;  4I43 B;  4Z91 A;  4JI8 T;  4YJ2 E;  4KUM B;  4LF8 T;  3GA8 A;  1IBK T;  3C4X A;  1VCT A;  2K3W A;  2XQ8 A;  1WYB A;  4PJJ A;  2VVN A;  5LBQ B;  1FMW A;  5JDH A;  4KBM B;  2DNX A;  4HFI A; 
#chains in the Genus database with same CATH homology
 1IBL T;  1HNX T;  2HHH T;  4AQY T;  2UXB T;  3T1Y T;  4LFC T;  4DV7 T;  4DV6 T;  1N33 T;  4KHP T;  4DR5 T;  4JI5 T;  1J5E T;  1HNW T;  4NXN T;  4JYA T;  2UXD T;  4DV4 T;  4DR3 T;  2UU9 T;  4DR4 T;  2UUB T;  4LF6 T;  4B3M T;  1XNR T;  2VQF T;  4DUZ T;  2ZM6 T;  4DV5 T;  4LF7 T;  4DV1 T;  1HNZ T;  4B3T T;  5LMN T;  4LF5 T;  4JI7 T;  4DV0 T;  4LFA T;  1FJG T;  2UUA T;  4DR2 T;  1XMQ T;  4DR1 T;  5IWA T;  4JI3 T;  1I94 T;  4DR6 T;  4LF9 T;  4LFB T;  4GKK T;  4YY3 T;  2VQE T;  1N36 T;  4DR7 T;  2F4V T;  4JI8 T;  4LF8 T;  4K0K T;  4X62 T;  5LMU T;  1IBK T;  4B3R T;  4JI4 T;  4JI0 T;  3OTO T;  2UUC T;  4NXM T;  4DV2 T;  2UXC T;  4X66 T;  5BR8 T;  4X64 T;  2E5L T;  4JI2 T;  4B3S T;  4JI6 T;  4JI1 T;  1HR0 T;  1N34 T;  4X65 T;  4OX9 T;  3T1H T;  4YHH T;  1XNQ T;  4DV3 T;  4GKJ T;  1XMO T;  4LF4 T;  4JV5 T;  1N32 T;  4DUY T;  1IBM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...