5BR8T

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5br8T00
4DV6T 4NXNT 1XMOT 4JI8T 4DV3T 4DV7T 2ZM6T 4X66T 4LFAT 4DR6T 4AQYT 1FJGT 4LFBT 4JI2T 4DR2T 4DR1T 4LF9T 4DR5T 3T1YT 4GKKT 4B3MT 4JI3T 2VQFT 2UUBT 4JI1T 1XMQT 4DR4T 4LF7T 4JI7T 4YY3T 2UU9T 4LF6T 5LMUT 4LFCT 4DV0T 4DV2T 1N33T 4B3ST 4JV5T 4LF8T 1I94T 1XNRT 4YHHT 2UXCT 4B3TT 1HNXT 1J5ET 4K0KT 2VQET 1IBKT 2UUCT 4JI6T 4OX9T 4B3RT 4GKJT 4DUYT 2HHHT 4DR7T 1IBLT 4LF4T 1N36T 4X65T 4JI0T 4DUZT 4DV4T 4X64T 1XNQT 1N34T 1HR0T 5LMNT 4KHPT 3OTOT 1N32T 1HNZT 4DV5T 2E5LT 4JI5T 2UUAT 4JYAT 4NXMT 1HNWT 2F4VT 2UXDT 5IWAT 5BR8T 3T1HT 4LF5T 1IBMT 4JI4T 4X62T 4DR3T 2UXBT 4DV1T
chains in the Genus database with same CATH superfamily
3LK42 3G06A 3ETUA 4GK0E 2VVNA 3RIUA 4QH5A 5C2TA 4DR6T 5J2UE 2XQ3A 3C4WA 3K3OA 5LBMA 4TX5A 2E9XC 2YDSA 4CQIA 4I55E 5IHYA 5CA1E 2XM1A 2BKOA 3TLSA 3AVRA 5A1LA 3AECA 3LJCA 2NP9A 4KI0F 2E8IA 2YN6A 4GK5E 1ZP0A 2N2NA 1D0YA 1VCTA 2LKHA 2I59A 4IE6A 5AQGB 5CJ5A 2YDQA 5LYJE 2LLYA 4DUYT 3F57A 2CRBA 5JVDE 2K5BB 4TNWA 3LBXB 3H3AA 2XUEA 4KP3C 5LGNB 2ES0A 2XQ4A 4U33A 2BVLA 2YDRA 2X0HA 3PJAA 5IWAT 2YU2A 5HEJA 3ETVA 5LCYA 2KINB 4IE4A 4ASKA 4PK4A 4X66T 2E9XA 4EOZB 1NEKA 3VR9A 3RYFE 3MJXA 4PJJA 5AQSB 5JQGE 2HPLA 1B7TA 2WP9A 2NOXA 3CMLA 4YFSA 4LF9T 1WR6A 1D1AA 3AEDA 5HEUA 3PUWF 5J1GA 5KMGP 2XPKA 3CX8B 4OHFA 4U7YA 1CUNA 4YJ3E 4NPPA 2P9BA 4LF6T 2KLQA 2BG9B 4YJ2E 4CXYA 2WWVA 2VL8A 2LHRA 5F8PA 4HWCA 2XQ5A 1KEYA 2CLYB 2EHOA 4H9OC 4V1Av 3ZEFB 3E0ZA 1M62A 3X1DA 5HWXA 2JIWA 3ZJ1A 4HFHA 2K24A 3UU3A 2ZM0A 1N34T 1L0VA 4PK5A 4CI3B 4ILAA 4AKGA 1FIOA 2WZIA 3EI0A 1NWMX 1O3XA 1MMGA 5C8YE 4NXNT 1HG5A 4DV3T 4DBQA 4XAXB 3ZYKA 5JTGA 4OFZA 3CPZA 1LVFA 2A2FX 4Z90A 3CQXC 3PU8A 2Q9QA 4HWFA 5KX5E 3I0OA 4GKKT 4QXBB 2IIUA 3B57A 2V7MA 5ETWA 1SE7A 3IA3A 5JRCB 3AE3A 4PJLA 5FL1A 3UTKA 4B3ST 2KMFA 2QA7A 5LG3A 4B6XA 3T8OA 4CI2B 3UT5E 3RKGA 3BQKA 2UUCT 3J9X1 4JI6T 2D5UA 3KBUA 1X79A 1HTJF 2V6XA 4WBNE 2WS3A 3FZKB 4X65T 4DO0A 1J1JA 5AQUB 2BS2A 3TLUA 5FVLA 3SOLA 5FVKA 3L09A 2YK0A 1WRDA 4NIQA 2E5LT 3VRBA 4JYAT 3AE7A 2FUPA 4M1PA 1YQ3A 3NKZA 2I6HA 3KVBA 2N1GA 2WMOA 4WZXA 2UXBT 3MA9A 4H9NC 4AKRB 3P7IA 2W63A 5AQIB 3A7MA 5FL0A 2L3LA 3NVOA 4UELA 4X1YE 4I50E 4LFAT 3AB3B 1H7CA 4ZS3A 2XAHB 3EDVA 3K8PC 3C50A 3KV4A 4JUYA 3AXJA 2L9QA 4WW0A 3QB5A 4CZZB 3QB5K 4UF0A 3FBZA 1UURA 3HKDE 3HA4A 4MHCA 4BA9A 3AE8A 5ABHA 1HNXT 4B3TT 2WCAA 2UXNB 2W67A 4KMCA 4HGAA 2XAQB 3K3QC 5L3FB 3UUBA 4A5XA 1UGOA 3ZN0B 2QVAA 5F3JA 4AIUA 4X64T 3ZC1A 4F6RC 5LMNT 2CBIA 4UIGA 4F8HA 3ZMSB 4YTMA 5HXCA 3CWZB 4Q25A 4YTPA 3GMIA 4DMVA 2X66A 4PFPA 3O1IA 2BKNA 3N2OA 4UV9B 3ANWB 5HEOA 5FY0A 2LM2A 2IUBA 4JI8T 2CPTA 4ZS2A 4J2CA 1XWMA 4UEMA 3JCFA 5L3EB 1WLXA 5AQQB 4HFEA 1MMNA 2ZMAA 3FB2A 4O8SA 4PK6A 3ZMTB 4X1IE 4A98A 3MKDA 4H63V 2I0MA 2KNDA 4B3MT 4JI3T 4YSXA 2X51A 5AFUL 3ZMUB 3CK6A 3PU3A 5LGUB 4MFRA 3N9OA 1HCIA 2YKSA 4LF8T 2W0GA 3UUMA 1FEWA 5HCJA 4L0RA 2BBHA 4K0KT 2VQET 4TV9E 5FP3A 4L9IA 4O4JE 1UK5A 3CQGB 3JAFA 1WR0A 4GKJT 5TAOA 3L8RA 4QH4A 3ZCIA 4XBFB 4HFDA 3IF8B 2VKOA 3QNUA 2RPAA 2ACXA 5HWYA 3ONXA 3CVRA 3ZT6A 2DNXA 4LMKA 5FNVE 4QH1A 2JQKA 3DTOA 3RRWA 4KHPT 3UU6A 2WDRA 2DHRA 1AJ3A 4MLKA 5HEGA 5FY1A 2QYWA 5CA0E 3PUVF 3KFWX 2VURA 3AA1B 5DJQC 2LRLA 3I0QA 2PFVA 5AQVB 2LRKA 5JR9A 2NWBA 2D0TA 4DV7T 2V7IA 3O1JA 3R84B 2XASB 2CA5A 3BQIA 2YU1A 2EHOB 3GN5B 5J0ZA 3E08A 2W4XA 5JDLA 3N9PA 5CFBA 1LKXA 1HFAA 2V7LA 3EDUA 5LXTE 2BG9E 4TWHA 4EEDA 1IBKT 4U2ZA 4ADZA 2M6BA 3MACA 4B3RT 4GIWA 3MK7C 2XQ7A 2DWGA 1BR2A 3AE2A 2DLRA 4KX6A 2BVMA 5FXZA 1UX5A 3JC6D 4CN4A 1E2AA 3Q2MA 1CHUA 2WDQA 2XY8B 2K48A 2HN2A 4AQFA 2RP4A 2YOEA 3P8CD 4X1KE 4DBRA 4HFCA 3RLFF 1R8IA 1KF6A 3HL6A 3WAJA 2KT9A 5L3DB 2H89A 1DU2A 3ESLA 2CMRA 4AQYT 2B76A 2PJQA 1MMDA 3CX6B 3N9MA 2V7KA 1D1CA 3JAEA 4IREA 3P4PA 1HG2A 2K9AA 4E7ZA 2J4GA 4YHHT 3A8YC 5F5WA 4L5GA 5LJNA 2KZ7B 4GYSA 4C90A 4ZI3D 5H6QB 4IDPA 3FXDB 4AI6A 1G73A 4QX7B 4N78D 3J7Yq 4DV4T 1OEDB 2JMKA 5AQLB 2DWKA 2BBJA 3CIRA 3C51A 4QHOA 4ZZCA 1N32T 5HXSA 3N2KE 1EZ3A 3AE5A 3AXJB 4LF5T 2KWHA 4NUVA 5L4EA 4HWIB 1KK7A 4I4TE 3L39A 3RRCA 4BJNA 3P50A 2ZM6T 2DI4A 5HEHA 4EZ4A 4AKHA 3ZKRA 1FMWA 2VL0A 5FXWA 1IAPA 2BS4A 5L4HA 4O4IE 4JI2T 5BMVE 4DR2T 4DR1T 1MIVA 2LSGA 5FXVA 1IJ6A 4O4HE 3N5LA 2J1DG 2V6YA 3L3PA 5LG4A 4I43B 3JC6C 3IEEA 5FXXA 4DNDA 3H37A 1XNRT 2NTYA 3UQ4A 4HTEA 5HCMA 2X68A 2LHNA 1BR4A 3ZLIA 2FJBA 5E0OA 3ZMVB 4IE7A 5CGMA 2UXXB 3TKLB 5AQOB 2BG9C 4H9QC 4FI5A 3AA0B 3AVSA 2X0YA 3NZQA 5JDGA 3PUYF 1YW0A 1XNQT 5LHIB 3RQWA 4YT0A 2CLYC 2X9YA 4TWDA 4DVDA 2JJ9A 2UUAT 1YKHB 3LBXA 4ILUA 3T1HT 4DMWA 1ZEEA 4U2YA 3P4QA 4ISTA 2CBJA 1IBMT 4HWHA 5LP6E 4YLHA 4IDNA 1HS7A 3ZN1B 3W15B 5AQPB 2X9WA 3UQ7A 4C91A 2OV9A 3KBTA 1U4QA 1T7SA 3ONJA 3GA8A 1V9DA 3P4SA 3QK6A 3PUZF 2LSKA 3ZT5A 5JH7E 4ZI3C 3ZT7A 4UV8B 2JPFA 2G0UA 1MNEA 4YHJA 5HAXA 5AQMB 5LMUT 4LFCT 3KV5A 2XQAA 3BQLA 4A97A 1HX8A 2NW9A 4P09A 2E2AA 2HPJA 2C0SA 4P0AA 5EK2A 4QKNA 3OBVE 4PJNA 2L8KA 5AQNB 3LK2B 3ZPOA 3UU8A 2WU2A 5GONE 5JR9B 2SPCA 4JI0T 2XQ8A 4WNKA 3UFEA 3VRAA 1QSDA 1KNPA 5EK3A 2R6GF 4TV8E 2IAKA 4X5TA 3RF1A 4P0BA 2KXPB 3VHLA 4IDZA 3ZSTA 3HKEE 4O4LE 3Q5WA 1SUMB 1MNDA 2MTQA 4A56A 2DCFA 5FY7A 1UUSA 1LRZA 2CWOA 4TN7B 4MALA 4DV6T 4EAHA 4EV6A 4ILCA 3ZSSA 3SFDA 5HXRA 3EABA 5JDNA 2KWIB 5JDMA 3PE0A 5ABFA 3QC9A 3FHNA 2KSRA 3U78A 2HN1A 4AISA 2W61A 3MXZA 1E1HB 3RH3A 4JI1T 3RX6A 5LB7B 3HR0A 2A9UA 2IC9A 2ZM2A 3BK9A 4MBQA 1I94T 3AA6B 5JRCA 3LSVA 1KNRA 1S94A 3OPCA 3Q5EA 5M4YA 2LJLA 1HX1B 4KBMB 3VU7H 4JEUB 2X9XA 3ZYLA 3ZYMA 1KFYA 3M3ZB 1U5PA 2YEVC 3KVAA 4ERRA 3ONLC 4IIJE 2ODUA 4O2AE 3C4ZA 2H3RA 5H6RB 2EHOD 5LA6E 4COFA 2VVSA 4DV5T 2A72A 3OVUA 2V5DA 1BR0A 2D9DA 1JNRA 1MMAA 2GK9A 4CXWA 2LSYA 4H9RC 2XAJB 3RIUC 4UR9A 2PTFA 4QXCB 2MBGA 2Y8DA 4YSYA 2E9XB 3AE4A 3LG7A 3H3MA 2CXLA 2M67A 5JDHA 3HI2A 2BDEA 2BS3A 4IGUA 3N2GE 4CXXA 2B1EA 4ISSA 2WB5A 3B5MA 2LKGA 3M65A 5AQHB 2RA1A 4HE8A 2J62A 4DR5T 1WFDA 2JQQA 4AKLA 1GQEA 3KINB 5ADXL 2VQFT 5JDFA 2WU5A 3EVYA 3HKCE 4ZEYA 2CWYA 3VKGA 1Y64B 1ZV4X 3AEGA 4JV5T 2IHR1 3VKHA 3AEFA 3HKBE 1D1BA 2CEAA 4HFBA 1WCRA 2VB6A 2LOSA 2IC6A 3AA7B 3LFMA 4UVCB 1YKEB 4ZXLA 3IHRA 2CXFA 1YD8G 4U7IA 5L3BB 3UUXB 3O1HA 4ZZBA 1MIYA 2M6IA 3ZCJA 5HXHA 5JREA 4JBWF 1OEDE 1OWAA 4EXTA 3V5UA 2C5IT 4JI5T 3NRYA 5CB4E 2MPKA 3RC3A 4K0UA 4JI4T 3N9QA 2V6YB 1VCSA 4ZHQE 3RC8A 2XAFB 2D2SA 2XQ6A 4OYKA 5IYZE 1XMOT 1T98A 3Q5DA 3A5XA 4CN6A 3ANWA 2JQ9A 3SRZA 5DQVA 5FKYA 2Q9QB 2CM0A 2HH7A 2H7VC 2WZHA 4IL9A 4U31A 4AXPA 3UU5A 3C64A 2NW8A 4FJOA 4EZHA 2AXDS 3FXEB 3R6NA 2LSIA 3UULA 4JI7T 3KDSE 1WYBA 1I6ZA 2UU9T 2J47A 4DV0T 1XDPA 2EHOC 1NAFA 1N33T 2LSJA 3U3IA 4IE5A 2UXCT 2Y6XA 3PUGA 2XTLA 2N9DA 4G63A 1W9RA 2BZBA 4TUYE 3KV6A 2CHOA 3RIAA 4ANJA 4HWDA 4DUZT 2W2UA 3Q9DA 1HR0T 1W09A 1YQ4A 1Z0PA 4LMLA 2FJAA 1XZYA 1FMVA 3FBLA 3N9LA 2CE7A 3WI3A 2CHNA 1QUUA 2XHEB 4E7SA 4EIWA 2ZLYA 4HKAA 4GOUA 3RYHE 2Q9QC 4IE0A 4PNIA 1SHZC 2ACZA 5L3CB 1UCUA 1US7B 3RIFA 1QLBA 2C5JA 3O4XE 3E22E 4ZOLE 5AQRB 4UF0B 1HF8A 3I9WA 1SA0E 3GN5A 3SFEA 3PUQA 1LVKA 4DR4T 2V26A 2W66A 5L47A 4PAGA 4DV2T 2WAUA 4TZ4C 4H9SE 4ILBA 2OA5A 2V5CA 3AE9A 3AAAB 3NBXX 2V8SV 3NRXA 3PJAJ 4IDOA 4BJMA 5AQTB 2HHHT 4DR7T 5LOVE 2VASA 4AKIA 3FZFB 4LF4T 3PUAA 5FYMA 5AQKB 3UFGA 2JRKA 3FZMB 4CN1A 3IBPA 1HNZT 2LM9A 5ABFB 5LBQB 3DP7A 2W62A 2CCQA 4WYVA 5BR8T 5LGTB 1S35A 1ZOYA 2WQYA 1OEDC 4IHJE 2NTXA 4DR3T 2XAGB 3SS1A 1T8BA 4OK0A 4DV1T 4O2BE 3RQUA 2PBIA 4WBOA 1VOMA 5HYAA 2MYSA 2WY2A 2XZEA 4IL4A 3AE1A 1FJGT 5LHGB 4JLEA 4TNVA 2X9HA 2MAWA 3F2EA 3ZC0A 3SWHA 4KUMB 3EHZA 3EAMA 2X67A 4EYUA 2NW7A 4QX8B 1WYCA 2FJEA 4LMJA 4U72A 4H63H 3AAEB 4UXNB 2PG8A 3OJAA 3MZKB 3FZLB 3D0TA 4H9PC 1IZNB 1J5ET 3RI5A 4HN9A 3CQCB 4Z8XA 3PTRB 4OYJA 1N36T 4XZCA 3EUHA 1IJ5A 4P1NA 1E7PA 3PUSA 2VKDA 3KV9A 1KNZA 4HFVA 3OTOT 2BG9A 4IT4A 1OEDA 4X20E 2F4VT 3JADA 4TWFA 1VRBA 1ZKEA 2XQ9A 5L3GB 4YXDA 4QWNB 5EK4A 4PJMA 2CXDA 2VK9A 5JDQA 4U3CA 2IMLA 4ZI2D 3P4WA 2XJ7A 3I9YA 4PW8A 2V7JA 4UVAB 4GYRA 3C98B 5DQWA 3TLTA 2JQHA 1UX4A 3T1YT 2JMHA 3AEAA 4HEAA 1X9BA 3RGLA 2UUBT 3NZPA 4IDQA 4YY3T 2XQYA 2C5KT 2OLTA 5LNKA 3ABVA 3WAKA 4ZI7E 3CKDA 1BR1A 5KXJA 3PV0F 2WSSV 2YINA 3RKOA 2E9XD 1JNZA 2V1DB 3UUNA 2E5VA 2MOZA 5LHHB 3LK3B 2XM2A 3S4UA 4EYYR 3F31A 3LDQB 5ABEA 5DABA 3OKQA 3N9NA 1J5WA 3FZHB 4HFIA 3TLWA 1Z8UA 5KDMC 4AQGA 5IUXA 3I1AA 2H88A 1D0XA 3B13A 5LJMA 4CI1B 4EEBA 3UU4A 4JEHB 4EB6E 3OYXA 1YXRA 2UXDT 2Y48B 5AQJB 5JR9C 4G2AA 1D0ZA 2A3DA 1XDOA 4X62T 3GWHA 5AQFB 4DIDB 2WWUA 2AE9A 2XSAA 4BAYB 2WMNA 3P4RA 3QOFA 1Y01A 2H7OA 2VWAA 2Z6EA 4EGWA 3V5SA 2ZM8A 1W0BA 2LT3A 3RYIE 2LE8A 2XSBA 3AEEA 2FJDA 4LFBT 1OXZA 2QRXA 5EZYE 4YTNA 4UVBB 3C4XA 2QGSA 3ZJ2A 3NWIA 1MIWA 1XMQT 4LF7T 2LOPA 2WDVA 5L2LA 5J2TE 2IW5B 4KHZF 5ABGA 1G8XA 3O9XA 3VR8A 2VKHA 2K3WA 3AEBA 3RYCE 4YSZA 2D0UA 5HXEA 2DL1A 3DJBA 2W00A 2IDOB 4QXHB 3CX7B 4OX9T 2X0LB 3AE6A 3ZMZB 1IBLT 3QUJA 2WBLA 4I0UA 1M7KA 4PFOA 4ZI2C 4AQFC 1ZHCA 2Q9QD 3PURA 3OYZA 3RHWA 2VKJA 2ODVA 2NR4A 2WM9A 3RPUA 2FBWA 2LEHA 3PUXF 3TLVA 4U74A 1W0AA 4NXMT 1HNWT 3K3NA 5FMNA 3PDYA 5C3JA 4NUUA 3Q5XA 3K1SA 2BKPA 1NENA 1T72A 4Z91A 3AAIA
chains in the Genus database with same CATH topology
4DV6T 4NXNT 1XMOT 4JI8T 4DV3T 4DV7T 2ZM6T 4X66T 4LFAT 4DR6T 4AQYT 1FJGT 4LFBT 4JI2T 4DR2T 4DR1T 4LF9T 4DR5T 3T1YT 4GKKT 4B3MT 4JI3T 2VQFT 2UUBT 4JI1T 1XMQT 4DR4T 4LF7T 4JI7T 4YY3T 2UU9T 4LF6T 5LMUT 4LFCT 4DV0T 4DV2T 1N33T 4B3ST 4JV5T 4LF8T 1I94T 1XNRT 4YHHT 2UXCT 4B3TT 1HNXT 1J5ET 4K0KT 2VQET 1IBKT 2UUCT 4JI6T 4OX9T 4B3RT 4GKJT 4DUYT 2HHHT 4DR7T 1IBLT 4LF4T 1N36T 4X65T 4JI0T 4DUZT 4DV4T 4X64T 1XNQT 1N34T 1HR0T 5LMNT 4KHPT 3OTOT 1N32T 1HNZT 4DV5T 2E5LT 4JI5T 2UUAT 4JYAT 4NXMT 1HNWT 2F4VT 2UXDT 5IWAT 5BR8T 3T1HT 4LF5T 1IBMT 4JI4T 4X62T 4DR3T 2UXBT 4DV1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 T;  4NXN T;  1XMO T;  4JI8 T;  4DV3 T;  4DV7 T;  2ZM6 T;  4X66 T;  4LFA T;  4DR6 T;  4AQY T;  1FJG T;  4LFB T;  4JI2 T;  4DR2 T;  4DR1 T;  4LF9 T;  4DR5 T;  3T1Y T;  4GKK T;  4B3M T;  4JI3 T;  2VQF T;  2UUB T;  4JI1 T;  1XMQ T;  4DR4 T;  4LF7 T;  4JI7 T;  4YY3 T;  2UU9 T;  4LF6 T;  5LMU T;  4LFC T;  4DV0 T;  4DV2 T;  1N33 T;  4B3S T;  4JV5 T;  4LF8 T;  1I94 T;  1XNR T;  4YHH T;  2UXC T;  4B3T T;  1HNX T;  1J5E T;  4K0K T;  2VQE T;  1IBK T;  2UUC T;  4JI6 T;  4OX9 T;  4B3R T;  4GKJ T;  4DUY T;  2HHH T;  4DR7 T;  1IBL T;  4LF4 T;  1N36 T;  4X65 T;  4JI0 T;  4DUZ T;  4DV4 T;  4X64 T;  1XNQ T;  1N34 T;  1HR0 T;  5LMN T;  4KHP T;  3OTO T;  1N32 T;  1HNZ T;  4DV5 T;  2E5L T;  4JI5 T;  2UUA T;  4JYA T;  4NXM T;  1HNW T;  2F4V T;  2UXD T;  5IWA T;  5BR8 T;  3T1H T;  4LF5 T;  1IBM T;  4JI4 T;  4X62 T;  4DR3 T;  2UXB T;  4DV1 T; 
#chains in the Genus database with same CATH topology
 3LK4 2;  3G06 A;  3ETU A;  4GK0 E;  2VVN A;  3RIU A;  4QH5 A;  5C2T A;  4DR6 T;  5J2U E;  2XQ3 A;  3C4W A;  3K3O A;  5LBM A;  4TX5 A;  2E9X C;  2YDS A;  4CQI A;  4I55 E;  5IHY A;  5CA1 E;  2XM1 A;  2BKO A;  3TLS A;  3AVR A;  5A1L A;  3AEC A;  3LJC A;  2NP9 A;  4KI0 F;  2E8I A;  2YN6 A;  4GK5 E;  1ZP0 A;  2N2N A;  1D0Y A;  1VCT A;  2LKH A;  2I59 A;  4IE6 A;  5AQG B;  5CJ5 A;  2YDQ A;  5LYJ E;  2LLY A;  4DUY T;  3F57 A;  2CRB A;  5JVD E;  2K5B B;  4TNW A;  3LBX B;  3H3A A;  2XUE A;  4KP3 C;  5LGN B;  2ES0 A;  2XQ4 A;  4U33 A;  2BVL A;  2YDR A;  2X0H A;  3PJA A;  5IWA T;  2YU2 A;  5HEJ A;  3ETV A;  5LCY A;  2KIN B;  4IE4 A;  4ASK A;  4PK4 A;  4X66 T;  2E9X A;  4EOZ B;  1NEK A;  3VR9 A;  3RYF E;  3MJX A;  4PJJ A;  5AQS B;  5JQG E;  2HPL A;  1B7T A;  2WP9 A;  2NOX A;  3CML A;  4YFS A;  4LF9 T;  1WR6 A;  1D1A A;  3AED A;  5HEU A;  3PUW F;  5J1G A;  5KMG P;  2XPK A;  3CX8 B;  4OHF A;  4U7Y A;  1CUN A;  4YJ3 E;  4NPP A;  2P9B A;  4LF6 T;  2KLQ A;  2BG9 B;  4YJ2 E;  4CXY A;  2WWV A;  2VL8 A;  2LHR A;  5F8P A;  4HWC A;  2XQ5 A;  1KEY A;  2CLY B;  2EHO A;  4H9O C;  4V1A v;  3ZEF B;  3E0Z A;  1M62 A;  3X1D A;  5HWX A;  2JIW A;  3ZJ1 A;  4HFH A;  2K24 A;  3UU3 A;  2ZM0 A;  1N34 T;  1L0V A;  4PK5 A;  4CI3 B;  4ILA A;  4AKG A;  1FIO A;  2WZI A;  3EI0 A;  1NWM X;  1O3X A;  1MMG A;  5C8Y E;  4NXN T;  1HG5 A;  4DV3 T;  4DBQ A;  4XAX B;  3ZYK A;  5JTG A;  4OFZ A;  3CPZ A;  1LVF A;  2A2F X;  4Z90 A;  3CQX C;  3PU8 A;  2Q9Q A;  4HWF A;  5KX5 E;  3I0O A;  4GKK T;  4QXB B;  2IIU A;  3B57 A;  2V7M A;  5ETW A;  1SE7 A;  3IA3 A;  5JRC B;  3AE3 A;  4PJL A;  5FL1 A;  3UTK A;  4B3S T;  2KMF A;  2QA7 A;  5LG3 A;  4B6X A;  3T8O A;  4CI2 B;  3UT5 E;  3RKG A;  3BQK A;  2UUC T;  3J9X 1;  4JI6 T;  2D5U A;  3KBU A;  1X79 A;  1HTJ F;  2V6X A;  4WBN E;  2WS3 A;  3FZK B;  4X65 T;  4DO0 A;  1J1J A;  5AQU B;  2BS2 A;  3TLU A;  5FVL A;  3SOL A;  5FVK A;  3L09 A;  2YK0 A;  1WRD A;  4NIQ A;  2E5L T;  3VRB A;  4JYA T;  3AE7 A;  2FUP A;  4M1P A;  1YQ3 A;  3NKZ A;  2I6H A;  3KVB A;  2N1G A;  2WMO A;  4WZX A;  2UXB T;  3MA9 A;  4H9N C;  4AKR B;  3P7I A;  2W63 A;  5AQI B;  3A7M A;  5FL0 A;  2L3L A;  3NVO A;  4UEL A;  4X1Y E;  4I50 E;  4LFA T;  3AB3 B;  1H7C A;  4ZS3 A;  2XAH B;  3EDV A;  3K8P C;  3C50 A;  3KV4 A;  4JUY A;  3AXJ A;  2L9Q A;  4WW0 A;  3QB5 A;  4CZZ B;  3QB5 K;  4UF0 A;  3FBZ A;  1UUR A;  3HKD E;  3HA4 A;  4MHC A;  4BA9 A;  3AE8 A;  5ABH A;  1HNX T;  4B3T T;  2WCA A;  2UXN B;  2W67 A;  4KMC A;  4HGA A;  2XAQ B;  3K3Q C;  5L3F B;  3UUB A;  4A5X A;  1UGO A;  3ZN0 B;  2QVA A;  5F3J A;  4AIU A;  4X64 T;  3ZC1 A;  4F6R C;  5LMN T;  2CBI A;  4UIG A;  4F8H A;  3ZMS B;  4YTM A;  5HXC A;  3CWZ B;  4Q25 A;  4YTP A;  3GMI A;  4DMV A;  2X66 A;  4PFP A;  3O1I A;  2BKN A;  3N2O A;  4UV9 B;  3ANW B;  5HEO A;  5FY0 A;  2LM2 A;  2IUB A;  4JI8 T;  2CPT A;  4ZS2 A;  4J2C A;  1XWM A;  4UEM A;  3JCF A;  5L3E B;  1WLX A;  5AQQ B;  4HFE A;  1MMN A;  2ZMA A;  3FB2 A;  4O8S A;  4PK6 A;  3ZMT B;  4X1I E;  4A98 A;  3MKD A;  4H63 V;  2I0M A;  2KND A;  4B3M T;  4JI3 T;  4YSX A;  2X51 A;  5AFU L;  3ZMU B;  3CK6 A;  3PU3 A;  5LGU B;  4MFR A;  3N9O A;  1HCI A;  2YKS A;  4LF8 T;  2W0G A;  3UUM A;  1FEW A;  5HCJ A;  4L0R A;  2BBH A;  4K0K T;  2VQE T;  4TV9 E;  5FP3 A;  4L9I A;  4O4J E;  1UK5 A;  3CQG B;  3JAF A;  1WR0 A;  4GKJ T;  5TAO A;  3L8R A;  4QH4 A;  3ZCI A;  4XBF B;  4HFD A;  3IF8 B;  2VKO A;  3QNU A;  2RPA A;  2ACX A;  5HWY A;  3ONX A;  3CVR A;  3ZT6 A;  2DNX A;  4LMK A;  5FNV E;  4QH1 A;  2JQK A;  3DTO A;  3RRW A;  4KHP T;  3UU6 A;  2WDR A;  2DHR A;  1AJ3 A;  4MLK A;  5HEG A;  5FY1 A;  2QYW A;  5CA0 E;  3PUV F;  3KFW X;  2VUR A;  3AA1 B;  5DJQ C;  2LRL A;  3I0Q A;  2PFV A;  5AQV B;  2LRK A;  5JR9 A;  2NWB A;  2D0T A;  4DV7 T;  2V7I A;  3O1J A;  3R84 B;  2XAS B;  2CA5 A;  3BQI A;  2YU1 A;  2EHO B;  3GN5 B;  5J0Z A;  3E08 A;  2W4X A;  5JDL A;  3N9P A;  5CFB A;  1LKX A;  1HFA A;  2V7L A;  3EDU A;  5LXT E;  2BG9 E;  4TWH A;  4EED A;  1IBK T;  4U2Z A;  4ADZ A;  2M6B A;  3MAC A;  4B3R T;  4GIW A;  3MK7 C;  2XQ7 A;  2DWG A;  1BR2 A;  3AE2 A;  2DLR A;  4KX6 A;  2BVM A;  5FXZ A;  1UX5 A;  3JC6 D;  4CN4 A;  1E2A A;  3Q2M A;  1CHU A;  2WDQ A;  2XY8 B;  2K48 A;  2HN2 A;  4AQF A;  2RP4 A;  2YOE A;  3P8C D;  4X1K E;  4DBR A;  4HFC A;  3RLF F;  1R8I A;  1KF6 A;  3HL6 A;  3WAJ A;  2KT9 A;  5L3D B;  2H89 A;  1DU2 A;  3ESL A;  2CMR A;  4AQY T;  2B76 A;  2PJQ A;  1MMD A;  3CX6 B;  3N9M A;  2V7K A;  1D1C A;  3JAE A;  4IRE A;  3P4P A;  1HG2 A;  2K9A A;  4E7Z A;  2J4G A;  4YHH T;  3A8Y C;  5F5W A;  4L5G A;  5LJN A;  2KZ7 B;  4GYS A;  4C90 A;  4ZI3 D;  5H6Q B;  4IDP A;  3FXD B;  4AI6 A;  1G73 A;  4QX7 B;  4N78 D;  3J7Y q;  4DV4 T;  1OED B;  2JMK A;  5AQL B;  2DWK A;  2BBJ A;  3CIR A;  3C51 A;  4QHO A;  4ZZC A;  1N32 T;  5HXS A;  3N2K E;  1EZ3 A;  3AE5 A;  3AXJ B;  4LF5 T;  2KWH A;  4NUV A;  5L4E A;  4HWI B;  1KK7 A;  4I4T E;  3L39 A;  3RRC A;  4BJN A;  3P50 A;  2ZM6 T;  2DI4 A;  5HEH A;  4EZ4 A;  4AKH A;  3ZKR A;  1FMW A;  2VL0 A;  5FXW A;  1IAP A;  2BS4 A;  5L4H A;  4O4I E;  4JI2 T;  5BMV E;  4DR2 T;  4DR1 T;  1MIV A;  2LSG A;  5FXV A;  1IJ6 A;  4O4H E;  3N5L A;  2J1D G;  2V6Y A;  3L3P A;  5LG4 A;  4I43 B;  3JC6 C;  3IEE A;  5FXX A;  4DND A;  3H37 A;  1XNR T;  2NTY A;  3UQ4 A;  4HTE A;  5HCM A;  2X68 A;  2LHN A;  1BR4 A;  3ZLI A;  2FJB A;  5E0O A;  3ZMV B;  4IE7 A;  5CGM A;  2UXX B;  3TKL B;  5AQO B;  2BG9 C;  4H9Q C;  4FI5 A;  3AA0 B;  3AVS A;  2X0Y A;  3NZQ A;  5JDG A;  3PUY F;  1YW0 A;  1XNQ T;  5LHI B;  3RQW A;  4YT0 A;  2CLY C;  2X9Y A;  4TWD A;  4DVD A;  2JJ9 A;  2UUA T;  1YKH B;  3LBX A;  4ILU A;  3T1H T;  4DMW A;  1ZEE A;  4U2Y A;  3P4Q A;  4IST A;  2CBJ A;  1IBM T;  4HWH A;  5LP6 E;  4YLH A;  4IDN A;  1HS7 A;  3ZN1 B;  3W15 B;  5AQP B;  2X9W A;  3UQ7 A;  4C91 A;  2OV9 A;  3KBT A;  1U4Q A;  1T7S A;  3ONJ A;  3GA8 A;  1V9D A;  3P4S A;  3QK6 A;  3PUZ F;  2LSK A;  3ZT5 A;  5JH7 E;  4ZI3 C;  3ZT7 A;  4UV8 B;  2JPF A;  2G0U A;  1MNE A;  4YHJ A;  5HAX A;  5AQM B;  5LMU T;  4LFC T;  3KV5 A;  2XQA A;  3BQL A;  4A97 A;  1HX8 A;  2NW9 A;  4P09 A;  2E2A A;  2HPJ A;  2C0S A;  4P0A A;  5EK2 A;  4QKN A;  3OBV E;  4PJN A;  2L8K A;  5AQN B;  3LK2 B;  3ZPO A;  3UU8 A;  2WU2 A;  5GON E;  5JR9 B;  2SPC A;  4JI0 T;  2XQ8 A;  4WNK A;  3UFE A;  3VRA A;  1QSD A;  1KNP A;  5EK3 A;  2R6G F;  4TV8 E;  2IAK A;  4X5T A;  3RF1 A;  4P0B A;  2KXP B;  3VHL A;  4IDZ A;  3ZST A;  3HKE E;  4O4L E;  3Q5W A;  1SUM B;  1MND A;  2MTQ A;  4A56 A;  2DCF A;  5FY7 A;  1UUS A;  1LRZ A;  2CWO A;  4TN7 B;  4MAL A;  4DV6 T;  4EAH A;  4EV6 A;  4ILC A;  3ZSS A;  3SFD A;  5HXR A;  3EAB A;  5JDN A;  2KWI B;  5JDM A;  3PE0 A;  5ABF A;  3QC9 A;  3FHN A;  2KSR A;  3U78 A;  2HN1 A;  4AIS A;  2W61 A;  3MXZ A;  1E1H B;  3RH3 A;  4JI1 T;  3RX6 A;  5LB7 B;  3HR0 A;  2A9U A;  2IC9 A;  2ZM2 A;  3BK9 A;  4MBQ A;  1I94 T;  3AA6 B;  5JRC A;  3LSV A;  1KNR A;  1S94 A;  3OPC A;  3Q5E A;  5M4Y A;  2LJL A;  1HX1 B;  4KBM B;  3VU7 H;  4JEU B;  2X9X A;  3ZYL A;  3ZYM A;  1KFY A;  3M3Z B;  1U5P A;  2YEV C;  3KVA A;  4ERR A;  3ONL C;  4IIJ E;  2ODU A;  4O2A E;  3C4Z A;  2H3R A;  5H6R B;  2EHO D;  5LA6 E;  4COF A;  2VVS A;  4DV5 T;  2A72 A;  3OVU A;  2V5D A;  1BR0 A;  2D9D A;  1JNR A;  1MMA A;  2GK9 A;  4CXW A;  2LSY A;  4H9R C;  2XAJ B;  3RIU C;  4UR9 A;  2PTF A;  4QXC B;  2MBG A;  2Y8D A;  4YSY A;  2E9X B;  3AE4 A;  3LG7 A;  3H3M A;  2CXL A;  2M67 A;  5JDH A;  3HI2 A;  2BDE A;  2BS3 A;  4IGU A;  3N2G E;  4CXX A;  2B1E A;  4ISS A;  2WB5 A;  3B5M A;  2LKG A;  3M65 A;  5AQH B;  2RA1 A;  4HE8 A;  2J62 A;  4DR5 T;  1WFD A;  2JQQ A;  4AKL A;  1GQE A;  3KIN B;  5ADX L;  2VQF T;  5JDF A;  2WU5 A;  3EVY A;  3HKC E;  4ZEY A;  2CWY A;  3VKG A;  1Y64 B;  1ZV4 X;  3AEG A;  4JV5 T;  2IHR 1;  3VKH A;  3AEF A;  3HKB E;  1D1B A;  2CEA A;  4HFB A;  1WCR A;  2VB6 A;  2LOS A;  2IC6 A;  3AA7 B;  3LFM A;  4UVC B;  1YKE B;  4ZXL A;  3IHR A;  2CXF A;  1YD8 G;  4U7I A;  5L3B B;  3UUX B;  3O1H A;  4ZZB A;  1MIY A;  2M6I A;  3ZCJ A;  5HXH A;  5JRE A;  4JBW F;  1OED E;  1OWA A;  4EXT A;  3V5U A;  2C5I T;  4JI5 T;  3NRY A;  5CB4 E;  2MPK A;  3RC3 A;  4K0U A;  4JI4 T;  3N9Q A;  2V6Y B;  1VCS A;  4ZHQ E;  3RC8 A;  2XAF B;  2D2S A;  2XQ6 A;  4OYK A;  5IYZ E;  1XMO T;  1T98 A;  3Q5D A;  3A5X A;  4CN6 A;  3ANW A;  2JQ9 A;  3SRZ A;  5DQV A;  5FKY A;  2Q9Q B;  2CM0 A;  2HH7 A;  2H7V C;  2WZH A;  4IL9 A;  4U31 A;  4AXP A;  3UU5 A;  3C64 A;  2NW8 A;  4FJO A;  4EZH A;  2AXD S;  3FXE B;  3R6N A;  2LSI A;  3UUL A;  4JI7 T;  3KDS E;  1WYB A;  1I6Z A;  2UU9 T;  2J47 A;  4DV0 T;  1XDP A;  2EHO C;  1NAF A;  1N33 T;  2LSJ A;  3U3I A;  4IE5 A;  2UXC T;  2Y6X A;  3PUG A;  2XTL A;  2N9D A;  4G63 A;  1W9R A;  2BZB A;  4TUY E;  3KV6 A;  2CHO A;  3RIA A;  4ANJ A;  4HWD A;  4DUZ T;  2W2U A;  3Q9D A;  1HR0 T;  1W09 A;  1YQ4 A;  1Z0P A;  4LML A;  2FJA A;  1XZY A;  1FMV A;  3FBL A;  3N9L A;  2CE7 A;  3WI3 A;  2CHN A;  1QUU A;  2XHE B;  4E7S A;  4EIW A;  2ZLY A;  4HKA A;  4GOU A;  3RYH E;  2Q9Q C;  4IE0 A;  4PNI A;  1SHZ C;  2ACZ A;  5L3C B;  1UCU A;  1US7 B;  3RIF A;  1QLB A;  2C5J A;  3O4X E;  3E22 E;  4ZOL E;  5AQR B;  4UF0 B;  1HF8 A;  3I9W A;  1SA0 E;  3GN5 A;  3SFE A;  3PUQ A;  1LVK A;  4DR4 T;  2V26 A;  2W66 A;  5L47 A;  4PAG A;  4DV2 T;  2WAU A;  4TZ4 C;  4H9S E;  4ILB A;  2OA5 A;  2V5C A;  3AE9 A;  3AAA B;  3NBX X;  2V8S V;  3NRX A;  3PJA J;  4IDO A;  4BJM A;  5AQT B;  2HHH T;  4DR7 T;  5LOV E;  2VAS A;  4AKI A;  3FZF B;  4LF4 T;  3PUA A;  5FYM A;  5AQK B;  3UFG A;  2JRK A;  3FZM B;  4CN1 A;  3IBP A;  1HNZ T;  2LM9 A;  5ABF B;  5LBQ B;  3DP7 A;  2W62 A;  2CCQ A;  4WYV A;  5BR8 T;  5LGT B;  1S35 A;  1ZOY A;  2WQY A;  1OED C;  4IHJ E;  2NTX A;  4DR3 T;  2XAG B;  3SS1 A;  1T8B A;  4OK0 A;  4DV1 T;  4O2B E;  3RQU A;  2PBI A;  4WBO A;  1VOM A;  5HYA A;  2MYS A;  2WY2 A;  2XZE A;  4IL4 A;  3AE1 A;  1FJG T;  5LHG B;  4JLE A;  4TNV A;  2X9H A;  2MAW A;  3F2E A;  3ZC0 A;  3SWH A;  4KUM B;  3EHZ A;  3EAM A;  2X67 A;  4EYU A;  2NW7 A;  4QX8 B;  1WYC A;  2FJE A;  4LMJ A;  4U72 A;  4H63 H;  3AAE B;  4UXN B;  2PG8 A;  3OJA A;  3MZK B;  3FZL B;  3D0T A;  4H9P C;  1IZN B;  1J5E T;  3RI5 A;  4HN9 A;  3CQC B;  4Z8X A;  3PTR B;  4OYJ A;  1N36 T;  4XZC A;  3EUH A;  1IJ5 A;  4P1N A;  1E7P A;  3PUS A;  2VKD A;  3KV9 A;  1KNZ A;  4HFV A;  3OTO T;  2BG9 A;  4IT4 A;  1OED A;  4X20 E;  2F4V T;  3JAD A;  4TWF A;  1VRB A;  1ZKE A;  2XQ9 A;  5L3G B;  4YXD A;  4QWN B;  5EK4 A;  4PJM A;  2CXD A;  2VK9 A;  5JDQ A;  4U3C A;  2IML A;  4ZI2 D;  3P4W A;  2XJ7 A;  3I9Y A;  4PW8 A;  2V7J A;  4UVA B;  4GYR A;  3C98 B;  5DQW A;  3TLT A;  2JQH A;  1UX4 A;  3T1Y T;  2JMH A;  3AEA A;  4HEA A;  1X9B A;  3RGL A;  2UUB T;  3NZP A;  4IDQ A;  4YY3 T;  2XQY A;  2C5K T;  2OLT A;  5LNK A;  3ABV A;  3WAK A;  4ZI7 E;  3CKD A;  1BR1 A;  5KXJ A;  3PV0 F;  2WSS V;  2YIN A;  3RKO A;  2E9X D;  1JNZ A;  2V1D B;  3UUN A;  2E5V A;  2MOZ A;  5LHH B;  3LK3 B;  2XM2 A;  3S4U A;  4EYY R;  3F31 A;  3LDQ B;  5ABE A;  5DAB A;  3OKQ A;  3N9N A;  1J5W A;  3FZH B;  4HFI A;  3TLW A;  1Z8U A;  5KDM C;  4AQG A;  5IUX A;  3I1A A;  2H88 A;  1D0X A;  3B13 A;  5LJM A;  4CI1 B;  4EEB A;  3UU4 A;  4JEH B;  4EB6 E;  3OYX A;  1YXR A;  2UXD T;  2Y48 B;  5AQJ B;  5JR9 C;  4G2A A;  1D0Z A;  2A3D A;  1XDO A;  4X62 T;  3GWH A;  5AQF B;  4DID B;  2WWU A;  2AE9 A;  2XSA A;  4BAY B;  2WMN A;  3P4R A;  3QOF A;  1Y01 A;  2H7O A;  2VWA A;  2Z6E A;  4EGW A;  3V5S A;  2ZM8 A;  1W0B A;  2LT3 A;  3RYI E;  2LE8 A;  2XSB A;  3AEE A;  2FJD A;  4LFB T;  1OXZ A;  2QRX A;  5EZY E;  4YTN A;  4UVB B;  3C4X A;  2QGS A;  3ZJ2 A;  3NWI A;  1MIW A;  1XMQ T;  4LF7 T;  2LOP A;  2WDV A;  5L2L A;  5J2T E;  2IW5 B;  4KHZ F;  5ABG A;  1G8X A;  3O9X A;  3VR8 A;  2VKH A;  2K3W A;  3AEB A;  3RYC E;  4YSZ A;  2D0U A;  5HXE A;  2DL1 A;  3DJB A;  2W00 A;  2IDO B;  4QXH B;  3CX7 B;  4OX9 T;  2X0L B;  3AE6 A;  3ZMZ B;  1IBL T;  3QUJ A;  2WBL A;  4I0U A;  1M7K A;  4PFO A;  4ZI2 C;  4AQF C;  1ZHC A;  2Q9Q D;  3PUR A;  3OYZ A;  3RHW A;  2VKJ A;  2ODV A;  2NR4 A;  2WM9 A;  3RPU A;  2FBW A;  2LEH A;  3PUX F;  3TLV A;  4U74 A;  1W0A A;  4NXM T;  1HNW T;  3K3N A;  5FMN A;  3PDY A;  5C3J A;  4NUU A;  3Q5X A;  3K1S A;  2BKP A;  1NEN A;  1T72 A;  4Z91 A;  3AAI A; 
#chains in the Genus database with same CATH homology
 4DV6 T;  4NXN T;  1XMO T;  4JI8 T;  4DV3 T;  4DV7 T;  2ZM6 T;  4X66 T;  4LFA T;  4DR6 T;  4AQY T;  1FJG T;  4LFB T;  4JI2 T;  4DR2 T;  4DR1 T;  4LF9 T;  4DR5 T;  3T1Y T;  4GKK T;  4B3M T;  4JI3 T;  2VQF T;  2UUB T;  4JI1 T;  1XMQ T;  4DR4 T;  4LF7 T;  4JI7 T;  4YY3 T;  2UU9 T;  4LF6 T;  5LMU T;  4LFC T;  4DV0 T;  4DV2 T;  1N33 T;  4B3S T;  4JV5 T;  4LF8 T;  1I94 T;  1XNR T;  4YHH T;  2UXC T;  4B3T T;  1HNX T;  1J5E T;  4K0K T;  2VQE T;  1IBK T;  2UUC T;  4JI6 T;  4OX9 T;  4B3R T;  4GKJ T;  4DUY T;  2HHH T;  4DR7 T;  1IBL T;  4LF4 T;  1N36 T;  4X65 T;  4JI0 T;  4DUZ T;  4DV4 T;  4X64 T;  1XNQ T;  1N34 T;  1HR0 T;  5LMN T;  4KHP T;  3OTO T;  1N32 T;  1HNZ T;  4DV5 T;  2E5L T;  4JI5 T;  2UUA T;  4JYA T;  4NXM T;  1HNW T;  2F4V T;  2UXD T;  5IWA T;  5BR8 T;  3T1H T;  4LF5 T;  1IBM T;  4JI4 T;  4X62 T;  4DR3 T;  2UXB T;  4DV1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...