5BR8T

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5br8T00
2UUBT 1N33T 4KHPT 4LF9T 1XNRT 4K0KT 4JI3T 1IBMT 4B3ST 4DUZT 4B3TT 4NXNT 1XMQT 2UUCT 4DV1T 4JYAT 4DV5T 3OTOT 2UXBT 4DV7T 1IBLT 4LF4T 4JI7T 4JI0T 4LF8T 4DR5T 4DR1T 2UUAT 1J5ET 1HR0T 5IWAT 4LFAT 1N34T 2UU9T 4DR4T 2UXCT 4DV2T 4JI2T 2HHHT 4JI5T 1HNXT 3T1HT 4JI1T 4X66T 4DV6T 4DUYT 4DR2T 4LF7T 1FJGT 4LF6T 4YHHT 4DR6T 4DV4T 4LFBT 4X64T 5BR8T 1N36T 1I94T 2VQFT 4GKKT 4GKJT 2UXDT 4B3RT 4JI8T 4NXMT 4X65T 4DV0T 4JI4T 2ZM6T 1N32T 2E5LT 4JI6T 1HNZT 4JV5T 4AQYT 5LMNT 4DV3T 4LFCT 3T1YT 5LMUT 4LF5T 1XNQT 4DR3T 1XMOT 2F4VT 4X62T 4DR7T 1HNWT 2VQET 4OX9T 1IBKT 4YY3T 4B3MT
chains in the Genus database with same CATH superfamily
1U4QA 2C5IT 2LM2A 4KHPT 4UVBB 3UU8A 3D0TA 1IAPA 1IZNB 4JUYA 3ETVA 3F57A 3RRCA 1VCSA 4MFRA 2DNXA 3ZN1B 2AE9A 4EB6E 2D0TA 3RLFF 2J4GA 4P1NA 3SOLA 2VL0A 1N34T 5CGMA 5IHYA 3M65A 4IDPA 2IHR1 5HEHA 3KBTA 2YU1A 1OXZA 3MA9A 5EK2A 1CHUA 2CHNA 3PV0F 1Z0PA 2BBHA 4X66T 3RYFE 3RIUC 2LJLA 4WZXA 1KNRA 3JCFA 5TAOA 2W62A 2XM2A 2OLTA 4GKKT 2BS3A 3MJXA 3EUHA 4TZ4C 4JI4T 2EHOC 4QX8B 2JQQA 5H6QB 1OEDE 4GOUA 4V1Av 4HKAA 4LFCT 2VKOA 3KVAA 4DR3T 3ZMTB 4G2AA 5LJNA 2L9QA 4HWFA 5KDMC 2SPCA 1QUUA 3N2OA 4YFSA 4QH5A 1FMWA 3I9WA 3AVRA 2W4XA 3UUNA 1ZOYA 3ZYMA 4JI3T 4X1KE 1VCTA 2L8KA 2X9XA 4YTMA 3IEEA 1UGOA 3HA4A 4DBRA 3VRAA 5HAXA 1IBLT 4XZCA 2VVNA 4H9NC 4KHZF 5F3JA 4IDOA 2KWIB 2L3LA 4TV9E 3TLVA 4FJOA 3NWIA 5ADXL 1ZKEA 4TX5A 4CXXA 4HTEA 3RIFA 2B76A 4IE0A 4QKNA 1HNXT 1MIVA 2RA1A 2XQ4A 2IDOB 4CI2B 2V7JA 3FZKB 3R6NA 4CXYA 2LKGA 5JR9B 3PJAA 1T8BA 2JQ9A 5FXWA 2KNDA 4PAGA 4YHJA 5ABGA 3H3MA 3PE0A 4KBMB 5LMUT 5HEOA 3P4PA 3L8RA 1XMOT 4IE7A 3AEAA 2FJEA 4ZZBA 3P8CD 4QXHB 1DU2A 2K3WA 3PUXF 5HYAA 3KBUA 3EI0A 3ETUA 2X66A 1XNRT 3ANWA 2N2NA 3ZEFB 2LEHA 3EAMA 3QC9A 5JDFA 1X9BA 3MXZA 3UU4A 4CN4A 4NXNT 2M67A 2UUCT 2A2FX 4IREA 3EDUA 4JI7T 2I0MA 4X5TA 2YDQA 1MIWA 5JDGA 3H3AA 2UUAT 1MMNA 2H7VC 5AQOB 5L3FB 2XY8B 1ZEEA 4X20E 3NZQA 2LHRA 1D0YA 5FKYA 3UULA 2V7KA 3GWHA 4WBOA 2ES0A 3F2EA 2NP9A 4U72A 2WWVA 4IDZA 4IT4A 4EAHA 3AEFA 4HWIB 5FXZA 4PJJA 2KMFA 2VASA 3ZMSB 3AXJA 2LSYA 3UU5A 4JV5T 2BDEA 5FL0A 5L47A 4I50E 2D5UA 4EXTA 2E9XB 5BMVE 2YN6A 4A97A 2WDQA 2W63A 3GN5B 1WYCA 3ZMVB 1UX4A 3AA1B 3RI5A 3AB3B 4IL9A 4IGUA 1BR1A 1JNZA 3UFGA 2C5KT 3PJAJ 3EABA 5JR9A 5EK4A 3ZCIA 2X0YA 3LDQB 2WBLA 1VOMA 3NVOA 3C98B 2K24A 1ZV4X 2X9WA 1Z8UA 2UU9T 1LRZA 2D0UA 5L2LA 1NAFA 5JVDE 3KINB 4KX6A 1S94A 4KP3C 3KDSE 2FJBA 2YDSA 3TLTA 2XQYA 2W0GA 2V5DA 2CBIA 3PURA 5HCJA 4ISTA 4AI6A 2WU5A 3P7IA 1Y64B 1G73A 5CB4E 5LNKA 1S35A 1T7SA 4XAXB 4TWFA 4GK5E 5C3JA 3UTKA 3O1IA 4YTPA 2H89A 4QH1A 1UK5A 1KK7A 4KI0F 4GK0E 1KNZA 3PUWF 5FVLA 4YY3T 2V7LA 3N9MA 2ACZA 1FIOA 2IIUA 1HX1B 2IC6A 2JIWA 4N78D 4ANJA 3C4WA 2EHOD 4HFIA 4ILUA 3RIUA 1JNRA 3Q5XA 3ZYLA 1H7CA 4DR4T 3UUBA 2LSJA 3GN5A 2YDRA 5L3GB 2CPTA 2EHOA 2Y48B 3AVSA 2V8SV 5GONE 2LE8A 5F5WA 2QA7A 3RX6A 3ZCJA 1CUNA 4KMCA 2LOSA 5FNVE 3RYHE 3CPZA 3P50A 4GKJT 4U7IA 1YKHB 3E0ZA 3N9PA 2A9UA 5FL1A 2VURA 1UURA 3RQWA 2NW8A 5JREA 4TWHA 3T1YT 5HEGA 2W66A 4L9IA 4G63A 4OYKA 1IJ6A 3ONJA 5C2TA 3AE4A 4ILBA 3L3PA 2F4VT 2X67A 2BVLA 2CA5A 2JMHA 4ASKA 4BA9A 3ONXA 5FY0A 4Q25A 1B7TA 4YXDA 4EZ4A 2XJ7A 2NR4A 3C4ZA 1IBMT 3KVBA 5LOVE 1KNPA 4JEUB 2UXBT 2M6IA 2NW7A 4PK5A 3ESLA 4BJMA 5AQJB 4DR1T 2LLYA 4P0BA 4UR9A 5LB7B 2B1EA 2DWGA 2BG9B 3AEEA 1XDPA 3K3OA 1SE7A 2BKNA 3Q5WA 5JH7E 2LKHA 3PUQA 4DBQA 2XUEA 4AISA 5LG3A 2X68A 2V7IA 3RPUA 5A1LA 1SA0E 4YSYA 4JI8T 2G0UA 3J7Yq 4NUUA 3CWZB 4JLEA 2E5LT 2IAKA 2JPFA 4AQYT 3QB5A 2XQ9A 3JC6C 3SS1A 2VKDA 4Z91A 1SUMB 1M7KA 3ZC1A 2DI4A 1XNQT 1L0VA 3PUVF 2Q9QC 4AQFC 2VWAA 3MZKB 4PJLA 1EZ3A 5FYMA 2E9XC 4L0RA 3OVUA 4QWNB 2XASB 4O4LE 5LP6E 3VR8A 5AQFB 1XDOA 3F31A 1D0ZA 1WR0A 3KV6A 5J0ZA 4CN1A 4QXBB 3IBPA 1US7B 3HR0A 1J5WA 3CMLA 4H63V 5ABFA 4E7ZA 1X79A 4H9QC 1E2AA 1YD8G 4UV9B 1HS7A 5ABHA 5DQWA 4HFDA 2HPJA 3FZFB 2XSBA 4ZI3C 5IUXA 4PJNA 2XAGB 2CBJA 1OWAA 1HFAA 4DMWA 2FJAA 1KFYA 5LA6E 2X51A 2UXXB 4F8HA 1D1AA 3CX8B 1O3XA 3LBXB 4HWCA 2LSKA 3KV5A 2E5VA 4O4IE 4DV2T 1MNDA 3PU8A 4ZZCA 3Q2MA 3V5SA 5LCYA 3N9QA 4EIWA 4AIUA 4UXNB 4EGWA 3Q5DA 1UCUA 2KT9A 3AE5A 4DR6T 4LMKA 4LFBT 5HEJA 5JDNA 2W61A 1N32T 1FEWA 2A72A 5FMNA 4WNKA 1OEDB 3VR9A 3HI2A 2QVAA 4IL4A 2WP9A 3N5LA 1VRBA 4DNDA 2P9BA 3OBVE 4GIWA 2OA5A 4Z90A 3RHWA 4A98A 4IE4A 2CXLA 2VKJA 3EVYA 3ZT6A 4NPPA 5CA1E 2LSGA 3N2GE 3H37A 5HCMA 4K0KT 3ZKRA 3PUZF 1AJ3A 4DUZT 4B3TT 3A7MA 5F8PA 4LF4T 5FXVA 3OJAA 5FVKA 3CX7B 4MBQA 3P4SA 1J5ET 3M3ZB 2XQ8A 2M6BA 3GMIA 4HFBA 3RC8A 3B57A 4A56A 2CLYB 3TKLB 2YEVC 4YJ2E 5AQPB 1ZHCA 2BKOA 3RH3A 5L3EB 4CZZB 4LF7T 4OK0A 5AQHB 4HWHA 4EEDA 2N9DA 1MIYA 3PU3A 2QRXA 3HL6A 5HXSA 2Y8DA 4HFCA 5KXJA 4CI3B 3FHNA 2ODVA 3LG7A 4JI6T 3HKEE 5JRCB 2WQYA 4YT0A 2CEAA 2V26A 1U5PA 2XTLA 2PTFA 2YKSA 4H9PC 2VQET 1HX8A 2NW9A 1YW0A 3SRZA 3CQXC 5FP3A 3LK2B 3RQUA 3ZJ1A 2VVSA 3AECA 5FXXA 2JJ9A 2Q9QB 2VK9A 4B3ST 1IJ5A 1XMQT 3HKBE 5HWXA 3ZSTA 4UF0B 3K1SA 2MBGA 4DV7T 4YSXA 4JI0T 4EYUA 4O4HE 4LF8T 4ZS3A 1OEDA 3ABVA 3AA7B 4U33A 1HG5A 2BBJA 1V9DA 2X0LB 2BG9C 4ZI7E 5HXRA 1KEYA 4U74A 1BR4A 4YJ3E 2FBWA 3P4WA 5H6RB 3PTRB 5CA0E 4XBFB 4H9OC 5EZYE 1BR0A 3LJCA 1FJGT 5JQGE 4EZHA 2WM9A 4AQGA 2ZM2A 4WW0A 3CQCB 2LSIA 4NXMT 4X65T 4PJMA 5CFBA 3N9NA 5L3CB 3NBXX 4F6RC 4PK4A 4QX7B 2IMLA 2LM9A 2WZHA 1W9RA 3ONLC 4C91A 4Z8XA 3FXEB 3EDVA 2HH7A 2QYWA 3C64A 4WBNE 4UV8B 2CXDA 1WLXA 2WMOA 3WI3A 2CWOA 5JDMA 2BZBA 3E08A 3VRBA 4TNWA 5E0OA 4OFZA 3C4XA 1I6ZA 3N9OA 1HR0T 5DABA 4ERRA 5FY7A 1WR6A 2J47A 2Y6XA 1ZP0A 1D1CA 4J2CA 1MMAA 3GA8A 1YXRA 4JI2T 3WAKA 4ZI2C 3N2KE 2DLRA 3EHZA 4EOZB 2Q9QA 4AQFA 3QOFA 2E9XA 2XQAA 5DJQC 4X64T 4JBWF 3RC3A 4OYJA 3C51A 4ZI3D 5J2UE 4TV8E 2DWKA 4HFHA 1HNZT 4FI5A 4M1PA 2V7MA 2QGSA 4E7SA 1OEDC 5LYJE 1M62A 3K3QC 4UIGA 2V6XA 3PDYA 2NWBA 2HN2A 5FY1A 4DR7T 3MK7C 2RPAA 2YOEA 3UU3A 2H7OA 1NEKA 1BR2A 5M4YA 5AQTB 5LHIB 2UUBT 4I43B 2WDRA 4EEBA 3CIRA 4TWDA 3X1DA 5HXCA 4UVAB 5LGUB 3TLSA 5L4HA 2LRLA 1UX5A 3UQ4A 4MLKA 4JYAT 2FJDA 4ZHQE 2MYSA 2XAFB 1J1JA 3BQLA 4JEHB 3BQIA 4ZEYA 2KXPB 5DQVA 5LJMA 5AQQB 1XZYA 3UFEA 4K0UA 2JQKA 2LHNA 4P09A 4IIJE 3WAJA 5AQKB 2DL1A 2H3RA 2CLYC 3AEDA 2XQ6A 4JI1T 3LSVA 5ETWA 5AFUL 2C5JA 4LF6T 4YHHT 1UUSA 2R6GF 3IA3A 4C90A 5AQSB 5LBMA 4B3RT 2CRBA 4IHJE 2ZM6T 2NOXA 2I59A 2I6HA 2XHEB 4YLHA 3AE6A 3OPCA 4DV3T 2WDVA 2ZLYA 5HEUA 3R84B 2D9DA 3Q5EA 4OHFA 3ZMZB 3UUMA 4I0UA 2K9AA 4NUVA 3RKGA 5L4EA 3MKDA 2WSSV 2ACXA 1IBKT 1HF8A 5LHHB 4ZOLE 2XQ5A 2VKHA 3L39A 2Z6EA 4YTNA 1WRDA 4COFA 1NENA 4DVDA 1SHZC 3FBZA 5LGTB 4DV1T 4DV5T 3U3IA 3OTOT 1XWMA 2WZIA 4O8SA 2MTQA 3DTOA 2OV9A 4O2AE 1WCRA 5AQVB 4AXPA 2WAUA 5AQUB 5LG4A 4CN6A 3ZMUB 3NZPA 3ZLIA 3ANWB 5L3BB 4DO0A 1W0BA 3LK42 3VKHA 1QSDA 3UU6A 3B13A 2PG8A 2XAHB 4U31A 3JAEA 5LHGB 3FZMB 3ZSSA 2HHHT 4U7YA 4L5GA 5JDLA 4DR2T 4U2ZA 2A3DA 2PFVA 4AKGA 4PW8A 5HXHA 1GQEA 3O1HA 4LMJA 5IYZE 2ZM0A 5AQRB 1W0AA 2LRKA 5LMNT 4U2YA 5LBQB 5JTGA 5KX5E 4MALA 2V5CA 4KUMB 2WWUA 2LOPA 4DMVA 2LT3A 3RYCE 2WB5A 3I0QA 3FZHB 1HNWT 3L09A 3DJBA 1HTJF 4HEAA 3I0OA 3AXJB 1R8IA 3FZLB 2RP4A 3KV9A 4MHCA 2D2SA 3IHRA 2GK9A 3N9LA 2BG9A 2YK0A 3K8PC 1T72A 2V6YB 3HKCE 4TUYE 3BK9A 4A5XA 3QUJA 3AAAB 3CK6A 3A5XA 3AE1A 3W15B 2CWYA 5AQMB 2WS3A 4DIDB 5C8YE 2KZ7B 3RF1A 2J1DG 4I4TE 2W00A 4GYSA 4EV6A 2BS4A 3AAEB 3B5MA 2CM0A 3CX6B 2CE7A 4ZS2A 3AE2A 4QXCB 4I55E 3T1HT 4DV6T 2PJQA 5LXTE 5AQLB 3AE9A 3ZN0B 3PUSA 2JQHA 3LFMA 3AAIA 3ZT7A 4HE8A 2K48A 2ODUA 2CCQA 4LF5T 2HPLA 2WCAA 4AKIA 2X9YA 4TNVA 1YKEB 4BAYB 2E2AA 4X62T 3RIAA 3UUXB 3AE8A 4OX9T 4O4JE 2VB6A 3QB5K 1WYBA 3NRXA 1N33T 2XZEA 4U3CA 5LGNB 4ZI2D 3AA6B 3NRYA 1QLBA 3AA0B 4CQIA 3O1JA 3LBXA 3AE7A 3DP7A 2PBIA 2XAQB 5JDQA 3ZT5A 2IW5B 4O2BE 3V5UA 4LFAT 1E1HB 2UXCT 2J62A 1D0XA 2IUBA 5JDHA 2X9HA 3VU7H 1LVFA 2YINA 3JAFA 2H88A 4AKLA 2KWHA 3OYZA 2V6YA 5AQIB 2WMNA 4BJNA 2UXDT 2EHOB 2IC9A 4ILCA 2BVMA 4AKRB 1NWMX 3G06A 3ZYKA 3FXDB 3KFWX 4B6XA 3K3NA 4WYVA 2MAWA 4ADZA 3C50A 5AQGB 2KINB 3RYIE 4IDNA 1Y01A 1G8XA 4HGAA 3I9YA 3J9X1 3CQGB 2FUPA 1LVKA 2C0SA 4IE5A 2N1GA 4LF9T 1W09A 5KMGP 4GYRA 3A8YC 2ZM8A 4LMLA 2CHOA 2BKPA 5J1GA 1E7PA 3AEBA 3NKZA 2NTXA 3PUGA 3ZPOA 2JRKA 2MPKA 3ZJ2A 2BS2A 1KF6A 2NTYA 1MMDA 3FBLA 5L3DB 3CVRA 4HWDA 4TN7B 3JADA 2UXNB 3BQKA 3QK6A 3ZC0A 5JRCA 2HN1A 2XM1A 2KLQA 2XSAA 1WFDA 3VHLA 3P4QA 3JC6D 4H9RC 4EYYR 3PUAA 2VL8A 2CXFA 2V1DB 4H63H 4ISSA 2Q9QD 1I94T 2VQFT 3U78A 2E9XD 2KSRA 3OYXA 4H9SE 4DV0T 3HKDE 3SFEA 4AKHA 3UT5E 3FB2A 4HN9A 5EK3A 4QH4A 3CKDA 1YQ3A 2W67A 4IDQA 5HXEA 4UF0A 4X1IE 3I1AA 3TLUA 2DHRA 4PK6A 3UQ7A 2YU2A 5HWYA 2K5BB 3T8OA 2WY2A 1T98A 2AXDS 2MOZA 3Q9DA 4QHOA 3QNUA 2XQ3A 4NIQA 3O4XE 4UEMA 4PFOA 2X0HA 4DR5T 4HFVA 1HCIA 2CMRA 5ABEA 5IWAT 3S4UA 3AEGA 3VKGA 4PNIA 5ABFB 2BG9E 2XAJB 5CJ5A 3KV4A 4CI1B 2XQ7A 3O9XA 5JR9C 2JMKA 1MMGA 3MACA 4IE6A 4PFPA 1FMVA 3RRWA 3TLWA 4JI5T 4ILAA 4UELA 3SFDA 1MNEA 3P4RA 4DUYT 4CXWA 3LK3B 4P0AA 4DV4T 2ZMAA 1LKXA 4HFEA 5BR8T 1N36T 3AE3A 3RGLA 4UVCB 5J2TE 2XPKA 1YQ4A 4ZXLA 2E8IA 1D1BA 2W2UA 2DCFA 2WU2A 4YSZA 3OKQA 1HG2A 3PUYF 5AQNB 4X1YE 3SWHA 3RKOA 3IF8B 4B3MT 3E22E
chains in the Genus database with same CATH topology
2UUBT 1N33T 4KHPT 4LF9T 1XNRT 4K0KT 4JI3T 1IBMT 4B3ST 4DUZT 4B3TT 4NXNT 1XMQT 2UUCT 4DV1T 4JYAT 4DV5T 3OTOT 2UXBT 4DV7T 1IBLT 4LF4T 4JI7T 4JI0T 4LF8T 4DR5T 4DR1T 2UUAT 1J5ET 1HR0T 5IWAT 4LFAT 1N34T 2UU9T 4DR4T 2UXCT 4DV2T 4JI2T 2HHHT 4JI5T 1HNXT 3T1HT 4JI1T 4X66T 4DV6T 4DUYT 4DR2T 4LF7T 1FJGT 4LF6T 4YHHT 4DR6T 4DV4T 4LFBT 4X64T 5BR8T 1N36T 1I94T 2VQFT 4GKKT 4GKJT 2UXDT 4B3RT 4JI8T 4NXMT 4X65T 4DV0T 4JI4T 2ZM6T 1N32T 2E5LT 4JI6T 1HNZT 4JV5T 4AQYT 5LMNT 4DV3T 4LFCT 3T1YT 5LMUT 4LF5T 1XNQT 4DR3T 1XMOT 2F4VT 4X62T 4DR7T 1HNWT 2VQET 4OX9T 1IBKT 4YY3T 4B3MT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB T;  1N33 T;  4KHP T;  4LF9 T;  1XNR T;  4K0K T;  4JI3 T;  1IBM T;  4B3S T;  4DUZ T;  4B3T T;  4NXN T;  1XMQ T;  2UUC T;  4DV1 T;  4JYA T;  4DV5 T;  3OTO T;  2UXB T;  4DV7 T;  1IBL T;  4LF4 T;  4JI7 T;  4JI0 T;  4LF8 T;  4DR5 T;  4DR1 T;  2UUA T;  1J5E T;  1HR0 T;  5IWA T;  4LFA T;  1N34 T;  2UU9 T;  4DR4 T;  2UXC T;  4DV2 T;  4JI2 T;  2HHH T;  4JI5 T;  1HNX T;  3T1H T;  4JI1 T;  4X66 T;  4DV6 T;  4DUY T;  4DR2 T;  4LF7 T;  1FJG T;  4LF6 T;  4YHH T;  4DR6 T;  4DV4 T;  4LFB T;  4X64 T;  5BR8 T;  1N36 T;  1I94 T;  2VQF T;  4GKK T;  4GKJ T;  2UXD T;  4B3R T;  4JI8 T;  4NXM T;  4X65 T;  4DV0 T;  4JI4 T;  2ZM6 T;  1N32 T;  2E5L T;  4JI6 T;  1HNZ T;  4JV5 T;  4AQY T;  5LMN T;  4DV3 T;  4LFC T;  3T1Y T;  5LMU T;  4LF5 T;  1XNQ T;  4DR3 T;  1XMO T;  2F4V T;  4X62 T;  4DR7 T;  1HNW T;  2VQE T;  4OX9 T;  1IBK T;  4YY3 T;  4B3M T; 
#chains in the Genus database with same CATH topology
 1U4Q A;  2C5I T;  2LM2 A;  4KHP T;  4UVB B;  3UU8 A;  3D0T A;  1IAP A;  1IZN B;  4JUY A;  3ETV A;  3F57 A;  3RRC A;  1VCS A;  4MFR A;  2DNX A;  3ZN1 B;  2AE9 A;  4EB6 E;  2D0T A;  3RLF F;  2J4G A;  4P1N A;  3SOL A;  2VL0 A;  1N34 T;  5CGM A;  5IHY A;  3M65 A;  4IDP A;  2IHR 1;  5HEH A;  3KBT A;  2YU1 A;  1OXZ A;  3MA9 A;  5EK2 A;  1CHU A;  2CHN A;  3PV0 F;  1Z0P A;  2BBH A;  4X66 T;  3RYF E;  3RIU C;  2LJL A;  4WZX A;  1KNR A;  3JCF A;  5TAO A;  2W62 A;  2XM2 A;  2OLT A;  4GKK T;  2BS3 A;  3MJX A;  3EUH A;  4TZ4 C;  4JI4 T;  2EHO C;  4QX8 B;  2JQQ A;  5H6Q B;  1OED E;  4GOU A;  4V1A v;  4HKA A;  4LFC T;  2VKO A;  3KVA A;  4DR3 T;  3ZMT B;  4G2A A;  5LJN A;  2L9Q A;  4HWF A;  5KDM C;  2SPC A;  1QUU A;  3N2O A;  4YFS A;  4QH5 A;  1FMW A;  3I9W A;  3AVR A;  2W4X A;  3UUN A;  1ZOY A;  3ZYM A;  4JI3 T;  4X1K E;  1VCT A;  2L8K A;  2X9X A;  4YTM A;  3IEE A;  1UGO A;  3HA4 A;  4DBR A;  3VRA A;  5HAX A;  1IBL T;  4XZC A;  2VVN A;  4H9N C;  4KHZ F;  5F3J A;  4IDO A;  2KWI B;  2L3L A;  4TV9 E;  3TLV A;  4FJO A;  3NWI A;  5ADX L;  1ZKE A;  4TX5 A;  4CXX A;  4HTE A;  3RIF A;  2B76 A;  4IE0 A;  4QKN A;  1HNX T;  1MIV A;  2RA1 A;  2XQ4 A;  2IDO B;  4CI2 B;  2V7J A;  3FZK B;  3R6N A;  4CXY A;  2LKG A;  5JR9 B;  3PJA A;  1T8B A;  2JQ9 A;  5FXW A;  2KND A;  4PAG A;  4YHJ A;  5ABG A;  3H3M A;  3PE0 A;  4KBM B;  5LMU T;  5HEO A;  3P4P A;  3L8R A;  1XMO T;  4IE7 A;  3AEA A;  2FJE A;  4ZZB A;  3P8C D;  4QXH B;  1DU2 A;  2K3W A;  3PUX F;  5HYA A;  3KBU A;  3EI0 A;  3ETU A;  2X66 A;  1XNR T;  3ANW A;  2N2N A;  3ZEF B;  2LEH A;  3EAM A;  3QC9 A;  5JDF A;  1X9B A;  3MXZ A;  3UU4 A;  4CN4 A;  4NXN T;  2M67 A;  2UUC T;  2A2F X;  4IRE A;  3EDU A;  4JI7 T;  2I0M A;  4X5T A;  2YDQ A;  1MIW A;  5JDG A;  3H3A A;  2UUA T;  1MMN A;  2H7V C;  5AQO B;  5L3F B;  2XY8 B;  1ZEE A;  4X20 E;  3NZQ A;  2LHR A;  1D0Y A;  5FKY A;  3UUL A;  2V7K A;  3GWH A;  4WBO A;  2ES0 A;  3F2E A;  2NP9 A;  4U72 A;  2WWV A;  4IDZ A;  4IT4 A;  4EAH A;  3AEF A;  4HWI B;  5FXZ A;  4PJJ A;  2KMF A;  2VAS A;  3ZMS B;  3AXJ A;  2LSY A;  3UU5 A;  4JV5 T;  2BDE A;  5FL0 A;  5L47 A;  4I50 E;  2D5U A;  4EXT A;  2E9X B;  5BMV E;  2YN6 A;  4A97 A;  2WDQ A;  2W63 A;  3GN5 B;  1WYC A;  3ZMV B;  1UX4 A;  3AA1 B;  3RI5 A;  3AB3 B;  4IL9 A;  4IGU A;  1BR1 A;  1JNZ A;  3UFG A;  2C5K T;  3PJA J;  3EAB A;  5JR9 A;  5EK4 A;  3ZCI A;  2X0Y A;  3LDQ B;  2WBL A;  1VOM A;  3NVO A;  3C98 B;  2K24 A;  1ZV4 X;  2X9W A;  1Z8U A;  2UU9 T;  1LRZ A;  2D0U A;  5L2L A;  1NAF A;  5JVD E;  3KIN B;  4KX6 A;  1S94 A;  4KP3 C;  3KDS E;  2FJB A;  2YDS A;  3TLT A;  2XQY A;  2W0G A;  2V5D A;  2CBI A;  3PUR A;  5HCJ A;  4IST A;  4AI6 A;  2WU5 A;  3P7I A;  1Y64 B;  1G73 A;  5CB4 E;  5LNK A;  1S35 A;  1T7S A;  4XAX B;  4TWF A;  4GK5 E;  5C3J A;  3UTK A;  3O1I A;  4YTP A;  2H89 A;  4QH1 A;  1UK5 A;  1KK7 A;  4KI0 F;  4GK0 E;  1KNZ A;  3PUW F;  5FVL A;  4YY3 T;  2V7L A;  3N9M A;  2ACZ A;  1FIO A;  2IIU A;  1HX1 B;  2IC6 A;  2JIW A;  4N78 D;  4ANJ A;  3C4W A;  2EHO D;  4HFI A;  4ILU A;  3RIU A;  1JNR A;  3Q5X A;  3ZYL A;  1H7C A;  4DR4 T;  3UUB A;  2LSJ A;  3GN5 A;  2YDR A;  5L3G B;  2CPT A;  2EHO A;  2Y48 B;  3AVS A;  2V8S V;  5GON E;  2LE8 A;  5F5W A;  2QA7 A;  3RX6 A;  3ZCJ A;  1CUN A;  4KMC A;  2LOS A;  5FNV E;  3RYH E;  3CPZ A;  3P50 A;  4GKJ T;  4U7I A;  1YKH B;  3E0Z A;  3N9P A;  2A9U A;  5FL1 A;  2VUR A;  1UUR A;  3RQW A;  2NW8 A;  5JRE A;  4TWH A;  3T1Y T;  5HEG A;  2W66 A;  4L9I A;  4G63 A;  4OYK A;  1IJ6 A;  3ONJ A;  5C2T A;  3AE4 A;  4ILB A;  3L3P A;  2F4V T;  2X67 A;  2BVL A;  2CA5 A;  2JMH A;  4ASK A;  4BA9 A;  3ONX A;  5FY0 A;  4Q25 A;  1B7T A;  4YXD A;  4EZ4 A;  2XJ7 A;  2NR4 A;  3C4Z A;  1IBM T;  3KVB A;  5LOV E;  1KNP A;  4JEU B;  2UXB T;  2M6I A;  2NW7 A;  4PK5 A;  3ESL A;  4BJM A;  5AQJ B;  4DR1 T;  2LLY A;  4P0B A;  4UR9 A;  5LB7 B;  2B1E A;  2DWG A;  2BG9 B;  3AEE A;  1XDP A;  3K3O A;  1SE7 A;  2BKN A;  3Q5W A;  5JH7 E;  2LKH A;  3PUQ A;  4DBQ A;  2XUE A;  4AIS A;  5LG3 A;  2X68 A;  2V7I A;  3RPU A;  5A1L A;  1SA0 E;  4YSY A;  4JI8 T;  2G0U A;  3J7Y q;  4NUU A;  3CWZ B;  4JLE A;  2E5L T;  2IAK A;  2JPF A;  4AQY T;  3QB5 A;  2XQ9 A;  3JC6 C;  3SS1 A;  2VKD A;  4Z91 A;  1SUM B;  1M7K A;  3ZC1 A;  2DI4 A;  1XNQ T;  1L0V A;  3PUV F;  2Q9Q C;  4AQF C;  2VWA A;  3MZK B;  4PJL A;  1EZ3 A;  5FYM A;  2E9X C;  4L0R A;  3OVU A;  4QWN B;  2XAS B;  4O4L E;  5LP6 E;  3VR8 A;  5AQF B;  1XDO A;  3F31 A;  1D0Z A;  1WR0 A;  3KV6 A;  5J0Z A;  4CN1 A;  4QXB B;  3IBP A;  1US7 B;  3HR0 A;  1J5W A;  3CML A;  4H63 V;  5ABF A;  4E7Z A;  1X79 A;  4H9Q C;  1E2A A;  1YD8 G;  4UV9 B;  1HS7 A;  5ABH A;  5DQW A;  4HFD A;  2HPJ A;  3FZF B;  2XSB A;  4ZI3 C;  5IUX A;  4PJN A;  2XAG B;  2CBJ A;  1OWA A;  1HFA A;  4DMW A;  2FJA A;  1KFY A;  5LA6 E;  2X51 A;  2UXX B;  4F8H A;  1D1A A;  3CX8 B;  1O3X A;  3LBX B;  4HWC A;  2LSK A;  3KV5 A;  2E5V A;  4O4I E;  4DV2 T;  1MND A;  3PU8 A;  4ZZC A;  3Q2M A;  3V5S A;  5LCY A;  3N9Q A;  4EIW A;  4AIU A;  4UXN B;  4EGW A;  3Q5D A;  1UCU A;  2KT9 A;  3AE5 A;  4DR6 T;  4LMK A;  4LFB T;  5HEJ A;  5JDN A;  2W61 A;  1N32 T;  1FEW A;  2A72 A;  5FMN A;  4WNK A;  1OED B;  3VR9 A;  3HI2 A;  2QVA A;  4IL4 A;  2WP9 A;  3N5L A;  1VRB A;  4DND A;  2P9B A;  3OBV E;  4GIW A;  2OA5 A;  4Z90 A;  3RHW A;  4A98 A;  4IE4 A;  2CXL A;  2VKJ A;  3EVY A;  3ZT6 A;  4NPP A;  5CA1 E;  2LSG A;  3N2G E;  3H37 A;  5HCM A;  4K0K T;  3ZKR A;  3PUZ F;  1AJ3 A;  4DUZ T;  4B3T T;  3A7M A;  5F8P A;  4LF4 T;  5FXV A;  3OJA A;  5FVK A;  3CX7 B;  4MBQ A;  3P4S A;  1J5E T;  3M3Z B;  2XQ8 A;  2M6B A;  3GMI A;  4HFB A;  3RC8 A;  3B57 A;  4A56 A;  2CLY B;  3TKL B;  2YEV C;  4YJ2 E;  5AQP B;  1ZHC A;  2BKO A;  3RH3 A;  5L3E B;  4CZZ B;  4LF7 T;  4OK0 A;  5AQH B;  4HWH A;  4EED A;  2N9D A;  1MIY A;  3PU3 A;  2QRX A;  3HL6 A;  5HXS A;  2Y8D A;  4HFC A;  5KXJ A;  4CI3 B;  3FHN A;  2ODV A;  3LG7 A;  4JI6 T;  3HKE E;  5JRC B;  2WQY A;  4YT0 A;  2CEA A;  2V26 A;  1U5P A;  2XTL A;  2PTF A;  2YKS A;  4H9P C;  2VQE T;  1HX8 A;  2NW9 A;  1YW0 A;  3SRZ A;  3CQX C;  5FP3 A;  3LK2 B;  3RQU A;  3ZJ1 A;  2VVS A;  3AEC A;  5FXX A;  2JJ9 A;  2Q9Q B;  2VK9 A;  4B3S T;  1IJ5 A;  1XMQ T;  3HKB E;  5HWX A;  3ZST A;  4UF0 B;  3K1S A;  2MBG A;  4DV7 T;  4YSX A;  4JI0 T;  4EYU A;  4O4H E;  4LF8 T;  4ZS3 A;  1OED A;  3ABV A;  3AA7 B;  4U33 A;  1HG5 A;  2BBJ A;  1V9D A;  2X0L B;  2BG9 C;  4ZI7 E;  5HXR A;  1KEY A;  4U74 A;  1BR4 A;  4YJ3 E;  2FBW A;  3P4W A;  5H6R B;  3PTR B;  5CA0 E;  4XBF B;  4H9O C;  5EZY E;  1BR0 A;  3LJC A;  1FJG T;  5JQG E;  4EZH A;  2WM9 A;  4AQG A;  2ZM2 A;  4WW0 A;  3CQC B;  2LSI A;  4NXM T;  4X65 T;  4PJM A;  5CFB A;  3N9N A;  5L3C B;  3NBX X;  4F6R C;  4PK4 A;  4QX7 B;  2IML A;  2LM9 A;  2WZH A;  1W9R A;  3ONL C;  4C91 A;  4Z8X A;  3FXE B;  3EDV A;  2HH7 A;  2QYW A;  3C64 A;  4WBN E;  4UV8 B;  2CXD A;  1WLX A;  2WMO A;  3WI3 A;  2CWO A;  5JDM A;  2BZB A;  3E08 A;  3VRB A;  4TNW A;  5E0O A;  4OFZ A;  3C4X A;  1I6Z A;  3N9O A;  1HR0 T;  5DAB A;  4ERR A;  5FY7 A;  1WR6 A;  2J47 A;  2Y6X A;  1ZP0 A;  1D1C A;  4J2C A;  1MMA A;  3GA8 A;  1YXR A;  4JI2 T;  3WAK A;  4ZI2 C;  3N2K E;  2DLR A;  3EHZ A;  4EOZ B;  2Q9Q A;  4AQF A;  3QOF A;  2E9X A;  2XQA A;  5DJQ C;  4X64 T;  4JBW F;  3RC3 A;  4OYJ A;  3C51 A;  4ZI3 D;  5J2U E;  4TV8 E;  2DWK A;  4HFH A;  1HNZ T;  4FI5 A;  4M1P A;  2V7M A;  2QGS A;  4E7S A;  1OED C;  5LYJ E;  1M62 A;  3K3Q C;  4UIG A;  2V6X A;  3PDY A;  2NWB A;  2HN2 A;  5FY1 A;  4DR7 T;  3MK7 C;  2RPA A;  2YOE A;  3UU3 A;  2H7O A;  1NEK A;  1BR2 A;  5M4Y A;  5AQT B;  5LHI B;  2UUB T;  4I43 B;  2WDR A;  4EEB A;  3CIR A;  4TWD A;  3X1D A;  5HXC A;  4UVA B;  5LGU B;  3TLS A;  5L4H A;  2LRL A;  1UX5 A;  3UQ4 A;  4MLK A;  4JYA T;  2FJD A;  4ZHQ E;  2MYS A;  2XAF B;  1J1J A;  3BQL A;  4JEH B;  3BQI A;  4ZEY A;  2KXP B;  5DQV A;  5LJM A;  5AQQ B;  1XZY A;  3UFE A;  4K0U A;  2JQK A;  2LHN A;  4P09 A;  4IIJ E;  3WAJ A;  5AQK B;  2DL1 A;  2H3R A;  2CLY C;  3AED A;  2XQ6 A;  4JI1 T;  3LSV A;  5ETW A;  5AFU L;  2C5J A;  4LF6 T;  4YHH T;  1UUS A;  2R6G F;  3IA3 A;  4C90 A;  5AQS B;  5LBM A;  4B3R T;  2CRB A;  4IHJ E;  2ZM6 T;  2NOX A;  2I59 A;  2I6H A;  2XHE B;  4YLH A;  3AE6 A;  3OPC A;  4DV3 T;  2WDV A;  2ZLY A;  5HEU A;  3R84 B;  2D9D A;  3Q5E A;  4OHF A;  3ZMZ B;  3UUM A;  4I0U A;  2K9A A;  4NUV A;  3RKG A;  5L4E A;  3MKD A;  2WSS V;  2ACX A;  1IBK T;  1HF8 A;  5LHH B;  4ZOL E;  2XQ5 A;  2VKH A;  3L39 A;  2Z6E A;  4YTN A;  1WRD A;  4COF A;  1NEN A;  4DVD A;  1SHZ C;  3FBZ A;  5LGT B;  4DV1 T;  4DV5 T;  3U3I A;  3OTO T;  1XWM A;  2WZI A;  4O8S A;  2MTQ A;  3DTO A;  2OV9 A;  4O2A E;  1WCR A;  5AQV B;  4AXP A;  2WAU A;  5AQU B;  5LG4 A;  4CN6 A;  3ZMU B;  3NZP A;  3ZLI A;  3ANW B;  5L3B B;  4DO0 A;  1W0B A;  3LK4 2;  3VKH A;  1QSD A;  3UU6 A;  3B13 A;  2PG8 A;  2XAH B;  4U31 A;  3JAE A;  5LHG B;  3FZM B;  3ZSS A;  2HHH T;  4U7Y A;  4L5G A;  5JDL A;  4DR2 T;  4U2Z A;  2A3D A;  2PFV A;  4AKG A;  4PW8 A;  5HXH A;  1GQE A;  3O1H A;  4LMJ A;  5IYZ E;  2ZM0 A;  5AQR B;  1W0A A;  2LRK A;  5LMN T;  4U2Y A;  5LBQ B;  5JTG A;  5KX5 E;  4MAL A;  2V5C A;  4KUM B;  2WWU A;  2LOP A;  4DMV A;  2LT3 A;  3RYC E;  2WB5 A;  3I0Q A;  3FZH B;  1HNW T;  3L09 A;  3DJB A;  1HTJ F;  4HEA A;  3I0O A;  3AXJ B;  1R8I A;  3FZL B;  2RP4 A;  3KV9 A;  4MHC A;  2D2S A;  3IHR A;  2GK9 A;  3N9L A;  2BG9 A;  2YK0 A;  3K8P C;  1T72 A;  2V6Y B;  3HKC E;  4TUY E;  3BK9 A;  4A5X A;  3QUJ A;  3AAA B;  3CK6 A;  3A5X A;  3AE1 A;  3W15 B;  2CWY A;  5AQM B;  2WS3 A;  4DID B;  5C8Y E;  2KZ7 B;  3RF1 A;  2J1D G;  4I4T E;  2W00 A;  4GYS A;  4EV6 A;  2BS4 A;  3AAE B;  3B5M A;  2CM0 A;  3CX6 B;  2CE7 A;  4ZS2 A;  3AE2 A;  4QXC B;  4I55 E;  3T1H T;  4DV6 T;  2PJQ A;  5LXT E;  5AQL B;  3AE9 A;  3ZN0 B;  3PUS A;  2JQH A;  3LFM A;  3AAI A;  3ZT7 A;  4HE8 A;  2K48 A;  2ODU A;  2CCQ A;  4LF5 T;  2HPL A;  2WCA A;  4AKI A;  2X9Y A;  4TNV A;  1YKE B;  4BAY B;  2E2A A;  4X62 T;  3RIA A;  3UUX B;  3AE8 A;  4OX9 T;  4O4J E;  2VB6 A;  3QB5 K;  1WYB A;  3NRX A;  1N33 T;  2XZE A;  4U3C A;  5LGN B;  4ZI2 D;  3AA6 B;  3NRY A;  1QLB A;  3AA0 B;  4CQI A;  3O1J A;  3LBX A;  3AE7 A;  3DP7 A;  2PBI A;  2XAQ B;  5JDQ A;  3ZT5 A;  2IW5 B;  4O2B E;  3V5U A;  4LFA T;  1E1H B;  2UXC T;  2J62 A;  1D0X A;  2IUB A;  5JDH A;  2X9H A;  3VU7 H;  1LVF A;  2YIN A;  3JAF A;  2H88 A;  4AKL A;  2KWH A;  3OYZ A;  2V6Y A;  5AQI B;  2WMN A;  4BJN A;  2UXD T;  2EHO B;  2IC9 A;  4ILC A;  2BVM A;  4AKR B;  1NWM X;  3G06 A;  3ZYK A;  3FXD B;  3KFW X;  4B6X A;  3K3N A;  4WYV A;  2MAW A;  4ADZ A;  3C50 A;  5AQG B;  2KIN B;  3RYI E;  4IDN A;  1Y01 A;  1G8X A;  4HGA A;  3I9Y A;  3J9X 1;  3CQG B;  2FUP A;  1LVK A;  2C0S A;  4IE5 A;  2N1G A;  4LF9 T;  1W09 A;  5KMG P;  4GYR A;  3A8Y C;  2ZM8 A;  4LML A;  2CHO A;  2BKP A;  5J1G A;  1E7P A;  3AEB A;  3NKZ A;  2NTX A;  3PUG A;  3ZPO A;  2JRK A;  2MPK A;  3ZJ2 A;  2BS2 A;  1KF6 A;  2NTY A;  1MMD A;  3FBL A;  5L3D B;  3CVR A;  4HWD A;  4TN7 B;  3JAD A;  2UXN B;  3BQK A;  3QK6 A;  3ZC0 A;  5JRC A;  2HN1 A;  2XM1 A;  2KLQ A;  2XSA A;  1WFD A;  3VHL A;  3P4Q A;  3JC6 D;  4H9R C;  4EYY R;  3PUA A;  2VL8 A;  2CXF A;  2V1D B;  4H63 H;  4ISS A;  2Q9Q D;  1I94 T;  2VQF T;  3U78 A;  2E9X D;  2KSR A;  3OYX A;  4H9S E;  4DV0 T;  3HKD E;  3SFE A;  4AKH A;  3UT5 E;  3FB2 A;  4HN9 A;  5EK3 A;  4QH4 A;  3CKD A;  1YQ3 A;  2W67 A;  4IDQ A;  5HXE A;  4UF0 A;  4X1I E;  3I1A A;  3TLU A;  2DHR A;  4PK6 A;  3UQ7 A;  2YU2 A;  5HWY A;  2K5B B;  3T8O A;  2WY2 A;  1T98 A;  2AXD S;  2MOZ A;  3Q9D A;  4QHO A;  3QNU A;  2XQ3 A;  4NIQ A;  3O4X E;  4UEM A;  4PFO A;  2X0H A;  4DR5 T;  4HFV A;  1HCI A;  2CMR A;  5ABE A;  5IWA T;  3S4U A;  3AEG A;  3VKG A;  4PNI A;  5ABF B;  2BG9 E;  2XAJ B;  5CJ5 A;  3KV4 A;  4CI1 B;  2XQ7 A;  3O9X A;  5JR9 C;  2JMK A;  1MMG A;  3MAC A;  4IE6 A;  4PFP A;  1FMV A;  3RRW A;  3TLW A;  4JI5 T;  4ILA A;  4UEL A;  3SFD A;  1MNE A;  3P4R A;  4DUY T;  4CXW A;  3LK3 B;  4P0A A;  4DV4 T;  2ZMA A;  1LKX A;  4HFE A;  5BR8 T;  1N36 T;  3AE3 A;  3RGL A;  4UVC B;  5J2T E;  2XPK A;  1YQ4 A;  4ZXL A;  2E8I A;  1D1B A;  2W2U A;  2DCF A;  2WU2 A;  4YSZ A;  3OKQ A;  1HG2 A;  3PUY F;  5AQN B;  4X1Y E;  3SWH A;  3RKO A;  3IF8 B;  4B3M T;  3E22 E; 
#chains in the Genus database with same CATH homology
 2UUB T;  1N33 T;  4KHP T;  4LF9 T;  1XNR T;  4K0K T;  4JI3 T;  1IBM T;  4B3S T;  4DUZ T;  4B3T T;  4NXN T;  1XMQ T;  2UUC T;  4DV1 T;  4JYA T;  4DV5 T;  3OTO T;  2UXB T;  4DV7 T;  1IBL T;  4LF4 T;  4JI7 T;  4JI0 T;  4LF8 T;  4DR5 T;  4DR1 T;  2UUA T;  1J5E T;  1HR0 T;  5IWA T;  4LFA T;  1N34 T;  2UU9 T;  4DR4 T;  2UXC T;  4DV2 T;  4JI2 T;  2HHH T;  4JI5 T;  1HNX T;  3T1H T;  4JI1 T;  4X66 T;  4DV6 T;  4DUY T;  4DR2 T;  4LF7 T;  1FJG T;  4LF6 T;  4YHH T;  4DR6 T;  4DV4 T;  4LFB T;  4X64 T;  5BR8 T;  1N36 T;  1I94 T;  2VQF T;  4GKK T;  4GKJ T;  2UXD T;  4B3R T;  4JI8 T;  4NXM T;  4X65 T;  4DV0 T;  4JI4 T;  2ZM6 T;  1N32 T;  2E5L T;  4JI6 T;  1HNZ T;  4JV5 T;  4AQY T;  5LMN T;  4DV3 T;  4LFC T;  3T1Y T;  5LMU T;  4LF5 T;  1XNQ T;  4DR3 T;  1XMO T;  2F4V T;  4X62 T;  4DR7 T;  1HNW T;  2VQE T;  4OX9 T;  1IBK T;  4YY3 T;  4B3M T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...