3KFWX

Uncharacterized protein rv0674 from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
SLTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVALTRMVGAGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTDARTRAALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDEAPADLAGQLWDLSGWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDPMLPAELLPADWPGAGLRAAYHDFATAMAKRRDATQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Uncharacterized protein Rv0674 from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07848 PaaX PaaX-like protein
X PF08223 PaaX_C PaaX-like protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kfwX01
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kfwX03
3.30.70.2650 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kfwX02
2HS5A 4RB3C 1XCVA 4UNOA 2L01A 5CLSA 1Z1DA 1ULYA 2DQLA 1DDNA 3F8BA 5D5VB 2AXLA 4PZJA 4BHPA 5CVIA 2HYFA 4P96A 4S04A 1FWZA 4UUVA 3R4KA 4ESBA 4AD9A 1VTNC 1A04A 3WTUC 2EK5A 4NHJA 3BP8A 3I58A 4I98B 2D1VA 2GZWA 1JHHA 2EFOA 3KLOA 3VEPA 4AIKA 1XDSA 1R1TA 1QQIA 3T8TA 4ASNA 1MD0A 4IHTA 5CVRA 1O3TA 4RGUA 1O3RA 1HKSA 2YR2A 4GO1A 4DQ2A 1OKRA 1B1BA 4BAYA 3BPXA 4RAYA 1HSTA 4JQFA 4N0BA 1XSXA 2M45A 2QBYA 3IHUA 3SXYA 2XIGA 4UV8A 3SQNA 1MZBA 2L4MA 4CGZA 1U6GA 1J9IA 2CQKA 3GFLA 2FMLA 4AIJA 3U2RA 2STTA 4HF1A 4GYIA 4G7OF 3L09A 3GX4X 4LGWA 2JTVA 4I09A 3VFZA 4QWQA 2H6BA 3F3XA 2XV4S 1KYWA 4NB5A 3E3VA 2VBWA 1TQPA 5LRSA 1P6RA 1W7PB 3WU0A 5F64A 1B4AA 3NQOA 3IKVA 2ZCWA 1BBYA 5F6FA 3K9TA 2FBIA 4RGXA 1OMIA 3EDPA 3WTYC 2X4HA 4IRIA 3TGNA 4OMZA 3C7JA 3JSPA 2E7WA 3Q5FA 1EH6A 1O3SA 3ABUA 1EV7A 2OBPA 4HX7A 1YW7A 3HHHA 5E1WA 5E20A 2PI0A 4RB1A 3RIRA 1MGTA 4M71A 4LB5A 1K6OA 3H3UA 2OQGA 1LEBA 1Z05A 2NNYA 4OU0A 5DUIA 2RV8A 5L3GA 2E1CA 3HSFA 2G7HA 3E6MA 3LAPA 1XDUA 1IXSB 1PDNC 3I54A 3RPQA 3T8RA 4R79A 1KQ0A 3F6OA 5A2QZ 3V7CA 4HA8A 5H6RA 3MCZA 3R60A 1I6XA 3MZHA 1H9TA 1D3YA 1YO5C 3AAFA 1YLFA 2LF8A 5E17F 1GVJA 2IP2A 1KQ9A 1BI0A 2DFIA 1GXPA 1IZ1A 2PN6A 1REPC 2W84A 1Q1HA 3GO5A 3IRRA 4Y17A 4LK0F 2P7CB 3O6BB 1Z7UA 5AIQA 2ELHA 2L4AA 5LEKA 1FC3A 3QP6A 2IT0A 2HZTA 1AOYA 2F5CA 2A6EF 4WWCA 5LEJA 3ZPLA 2DLLA 5D5XB 1BI2A 4TV7A 1T38A 3WTWC 1XSDA 2FA5A 1HBXG 2WWYA 3L2CA 4L9JA 2L3DA 2K27A 2FE3A 2Y75A 1XCBA 3TO7A 2RQPA 3RTRA 3H3ZA 3HTUA 3GYHX 2EWNA 4FT8A 2FEZA 2HOEA 1FBQA 4M9SA 5HS8A 3DPLC 3QU3A 4CDGA 2V79A 3QP5A 1SAXA 1CF7B 5EEHA 4KUMA 3RKYA 2P5VA 2ADUA 2D45A 3EUHA 3ELKA 1TNTA 2OA4A 1ZRDA 3PQJA 4N9IA 4EJOA 1FBUA 3KE2A 5D5WB 4G6DA 2PLYA 2GA2A 5CYVA 1S29A 5CVJA 1ZG5A 5BOXA 2EB7A 4O6JA 2ZKZA 3E6DA 5FLXK 3J80K 3HIFA 3CJNA 5DUKA 5LLQA 2FNPA 4LG0A 1S7OA 5DEQA 1TQMA 3KZZA 1IAWA 2D1HA 4KT5C 1WSUA 4OIQF 3LFKA 1HSJA 3JTHA 3BJAA 2M1BA 3I59B 4WCGA 2HR3A 4BXUA 2KIFA 3ECOA 4R8HA 1ON2A 3ABTA 2Y0MA 3PQKA 3B02A 2WV0A 4EMSA 4KICA 1HW1A 2V6CA 1FP2A 4UHTA 2Y48A 3GZ5A 5D6EA 4AIHA 2VBYA 4ENMA 2XAFA 5ICGA 3PFIA 2K02A 3TDZC 1GXQA 4JBAA 1J2XA 2V1DA 2XHKA 2CWEA 3RKWA 2JZYA 3E5XA 5D4SA 3WGHA 3JAMK 1L0OC 2FBKA 5CJ9A 1B59A 2O61A 4GCVA 3C1DA 4DNCA 2NYXA 4KIBA 3CLOA 3KCCA 1QZZA 5FFXA 3W6JB 3T5XA 2DK5A 3GLXA 1HQCA 1IRFA 2Q0OA 2O03A 1I27A 1YIOA 3I64A 2IA0A 2HYGD 2D2WA 2EFPA 3WTSC 4O5VA 4KFCA 4M72A 1WI9A 2DW4A 2PMHA 2AS5F 1TLHB 2XASA 4KA4A 1J59A 3OOPA 1YG2A 4OIRF 2X0LA 2Z9OA 2M30A 3R6SA 1W5TA 5BPDA 3BOQA 2IA1A 4D0PA 4IVNA 3BWGA 1FYMA 3BROA 3HSEA 4A0XA 4IHSA 2P6SA 2EFQA 2C6YA 4Q5SF 1UFMA 3O2PE 2EA2A 2GXGA 3GF2A 1U5TB 4U0YA 3L7WA 5JVTA 5E1ZB 5H6QA 2ZO4A 3IKTA 3DV8A 1FOKA 3E5QA 4ON0A 1S7AA 2CYYA 5HLHA 2EV5A 1UB9A 3GEZA 2BBYA 4YG2F 4EM0B 3LQQA 2HWVA 1O57A 4MQVA 2ZNZA 3MWMA 2ZMEA 3SHFA 3LSTA 3E97A 1P4XA 1KYZA 4S05A 3C3WA 2NRAC 4GYGA 4MTDA 4JK1X 2P4WA 1W4MA 3E6BA 2H27A 5D8LB 1QO0D 1LJ9A 5LHGA 1TNSA 4EGZA 2LSOA 2OZUA 4I0AA 3KP4A 4MHGA 2HTJA 4YFKF 3DF8A 4G9YA 4OIOF 4UVBA 4AWXB 2VC1A 2QVOA 3WU1B 1LDJA 2P7VB 1YS7A 2F2EA 5F1RA 3R0JA 3P7NA 1LDKB 3GW2A 4IRGA 4ENNA 1ZLJA 4RGRA 5LGTA 4Z2YA 4ZZLA 4KNYA 5L3EA 2QM3A 4EQQA 4WXCA 4I0BA 1R5HA 4EJTA 5E8GA 2VE8A 3KP5A 1QBJA 3I5UA 4GXOA 1RNLA 2W85A 3F8FA 1TQIA 5JR3A 2PJPA 1B9NA 2A5YB 2XAGA 4UV9A 1XB4A 1OR7A 1UCRA 2Z3YA 4KDPA 4RB0A 1J7KA 1JE8A 1KU9A 2DPDA 5KK1A 2W24A 3KLNA 3ZMVA 1IXRC 2MLKA 5HVQC 1HXDA 3F23A 2VXZA 3K69A 4KIFA 2V9VA 5IT9K 1BM9A 1T6SA 3FMRA 3F8NA 2HQRA 3EQLF 1KU2A 2VOOA 2A61A 2A07F 2JPBA 2MD5A 2O3FA 1LVAA 1HKTA 1YW8A 1K78B 5DD4A 3NRVA 3DKWA 3F21A 2XROA 1BI1A 3QOPA 1FT9A 3QU6A 5BS6A 1KQ8A 2W25A 3FM3A 4ZH4F 4WXDA 5ERIA 2R3SA 1FLIA 2PG4A 4K2EA 5LBQA 4ENKA 3GVAA 5CVVA 4GGGA 2MC3A 4BNCA 3K1MA 1ZHFA 3ERED 1JGSA 3F8CA 3S2WA 3NEUA 1EH7A 2MA3A 3DFGA 4WF2A 1BN5A 5DCMA 2NNNA 5L3FA 4YFXF 2YSRA 4HYEA 1QZYA 3COAC 3ZMTA 1PUEE 5LGNA 1FNNA 2VONA 1HW2A 4EGYA 4FHTA 1ODDA 4CICA 3WTVC 1ZYRF 4OOIA 2IVMA 1USSA 2YPRA 5HLIA 1Z6TA 3FXRA 4LLGF 4WK8F 3I59A 2MBFA 4BH9A 2J5PA 3KP2A 1ZN2A 3EYYA 3CUQA 3JTGA 2A3SA 1YS6A 3HRTA 1STZA 1HKQA 3V7RA 5E8IA 3N97A 2RVCA 1T98A 4A5NA 1ZLKA 2IRFG 1QNTA 2QQBA 1P4WA 5E18F 3FZVA 2CG4A 4EJUA 1BOAA 1DPUA 3FMSA 2P8TA 2B0LA 3E6CC 3GFJA 4ZYHA 1ONVA 2ZFWA 3RJPA 2QBYB 4P55A 1XN7A 2XUBA 2ZBKA 1IRGA 3RKXA 4HQMA 4MEYF 4U88A 4FX4A 2BV6A 1YW9A 1FYKA 4HF2A 5HDNA 4CHUA 3B73A 4G8XA 1P4AA 3HRUA 4L0ZB 3TKYA 1EH8A 2UWMA 4WX9A 4PGHA 1ZAOA 3MQ0A 2P6TA 1OYYA 3JSOA 1SD7A 5J6XA 3HOTA 3I4PA 4Y13A 1G3TA 1I1GA 2M8EA 2YX4A 2XKOA 5JHUA 5L3DA 4Q4ZF 5L3BA 2KJBA 3BJOA 1U5TA 3KEOA 3K1NA 2JSCA 2H6CA 4XBFA 1YYVA 1IN5A 5ILSA 3ML6A 2O8XA 3ROUA 3EETA 1NHAA 3WTXC 1ZG1A 1K7AA 5H20A 4MTEA 1TTYA 2DAOA 2RC4A 2VODA 3KP3A 5TRDA 3K1PA 3GUDA 3N4MA 2LNBA 2FQ3A 1IW7F 3V8JA 1BI3A 2UXNA 4RB2C 4MQ9F 1LB2A 2JPCA 2DO7A 2F5FA 4U0VA 4OIPF 1X3UA 2RDPA 2YX7A 1HW5A 1R23A 2GIVA 1MDMB 1FP1D 1RI7A 4HBLA 1B6AA 2PEXA 3ZN0A 1RUNA 4I01A 2DT5A 1YQAA 3SFZA 2VT3A 5HS7A 2QQ9A 3GWZA 3VOEA 3J7AO 1IF1A 4A2UA 4WXHA 3ZN1A 4HV6A 3ISPA 2HGCA 3TO6A 2EA4A 4RGSA 1DUXC 4ZYDA 3RYRA 1FSEA 2FNAA 2QQAA 2CFXA 2KRFA 1SD5A 2QUFA 2P5KA 1J5YA 5AONA 5BMZA 2EV0A 1TW2A 5D8KB 3CUOA 4M73A 2FSWA 2M5WA 5ICFA 4LFUA 1RZ4A 1B9MA 1FBSA 2OAZA 3MZYA 4UVAA 1U78A 5BPIA 3KETA 3FHZA 3ZMUA 2WC2A 4YIFA 4BQAA 1XGMA 1GHCA 2STWA 2GWRA 5HDKA 4PCQA 1IN6A 2FXAA 3V8KA 4HDVA 1V3FA 2XRNA 2HKXA 2GXBA 3I0TA 1UHMA 1FZPB 4E70A 3HTSB 2EFWA 4BHCA 2G7UA 3TQNA 5A2QK 4XSXF 1ZREA 1WWXA 2IPQX 3IRQA 5J8FA 2PQ8A 5ICEA 1BC7C 2XAQA 3KZYA 4LG0B 3H92A 4EM1A 3P9IA 2ZJ2A 1KU3A 2VN2A 3M8EA 1V4RA 4L9VA 2CW0F 3GFIA 2XKPA 1W7PA 3TOBA 1WRJA 5J8CA 4Y15A 4O3MA 1P2FA 1OPCA 2OQRA 2QWWA 1KU7A 4KYWA 1SD4A 3O3KA 2OU2A 2EFNA 1SFXA 4I7HA 5HDGA 1XGNA 3QRFF 2GA1A 4EVIA 3V4GA 2K7LA 4OMYA 4N9HA 1J0RA 1D5VA 3KP7A 4IJAA 3J81Z 4ESFA 4UVCA 4G7ZF 1OYIA 2E1NA 1MJ9A 1P92A 1D8JA 1I1SA 3LQRA 2KIUA 1SFEA 2DTRA 2K4JA 4CZZA 2QZ8A 4L9NA 4M9ZA 4ESJA 1F4KA 3DP7A 2K4BA 5LRRA 2Q2EA 2VC0A 3HYIA 2BYVE 4IF4A 2HTSA 1FPQA 4ZYGA 1E17A 5FB2A 4HQEA 1XSVA 2QLZA 1PP8F 2G9WA 4G94A 5JI6A 4XSZF 4P9FA 2ISZA 2BE5F 2JT1A 4L5IA 4I2OA 5FLXZ 2HEOA 3J80Z 5ILUA 1ZGAA 2ISYA 1XD7A 2Z99A 2JRTA 2RNJA 2Q8KA 3F8MA 5ICCA 1TW3A 3E5UA 1R1VA 5FD6A 1LQ1A 4HLYA 3RPUA 3SZTA 4M9XA 4ZZDA 3F22A 1ZGJA 5AIPA 3CDHA 2EV6A 1MKMA 2CGPA 1H0MA 2IJLA 3ZQ7A 2LKPA 2VBXA 3REOA 4P9UA 2QYOA 2DPUA 1W7PD 4U7DA 4A0YA 1WKMA 3Q9SA 3M8FA 2HDCA 4G6QA 1SMTA 1UHWA 5FGMA 1FYLA 4IXAA 5LHIA 4L5JA 5HS9A 4FX0A 4A5MA 2IA2A 1U2WA 1K79A 5DV5A 4LD5A 3SZPA 1LNWA 4XLPF 4YFNF 1QGPA 4XLNF 2J5OA 2FBHA 3JAMZ 4HF0A 1RUOA 1O3QA 2FRHA 2ZMEB 3FMQA 2PMUA 3DEUA 1R00A 2L54A 2COMA 3BY6A 2M87A 2FF4A 1XGSA 2H09A 1R36A 2ZNYA 4MGRA 2R7FA 5DCFA 3G3ZA 1C0WA 1CF7A 3L9FA 3LA3A 4G7HF 3OV8A 3P9KA 4OINF 2Z33A 3L00A 4RAZA 1D8KA 3WE3A 1IN4A 1G3WA 2HFHA 3ZMDA 3HOSA 4HAMA 4IPAA 5EEGA 3M7GA 4KN7X 2DI3A 4KN4X 4L18B 3ZMZA 3I53A 1IN7A 1R7JA 2O0YA 2V1UA 3FXUA 3LAJA 2CO5A 3WG9A 4ENJA 3WODF 2DK8A 4HLXA 3CUQC 2WTEA 4EM2A 1ON1A 2GQQA 4LMYA 1WQ2A 3QPTA 3P9CA 2DBBA 5FD5A 3LA2A 2E7XA 3ULQB 2VT2A 1IUYA 3DQVC 3GZ6A 1ZRCA 4U7BA 1T39A 1R58A 3BZ6A 2K86A 2XVCA 5DYMA 1E2XA 1KGSA 3JW4A 1H9GA 1MDMA 1S3JA 2Z5UA 4B09A 5HOOA 1DP7P 1F9NA 1AWCA 1YFHA 3LA7A 3TO9A 2VOPA 3HHGA 4M6XA 3WTTC 2LF7A 3KEQA 4P5OA 4U0WA 4Q47A 4LLNA 1MJAA 3ECHA 1PP7U 3RYPA 3G73A 4LK1F 5DD8A 4KMFA 3WGIA 1ZARA 3HRMA 2BEOA 3MEXA 1Z9CA 4KIGA 4BHBA 2HQNA 2YU3A 3TOAA 1F1ZA 4L9TA 5K5OA 3F6VA 1Z91A 5ILVA 3IWFA 4PGGA 2V1XA 6PAXA 2L02A 1ZH5A 2XGXA 4EJVA 4HW0A 5ED4A 1YTYA 1SMYF 3FX3A 4M74A 4CO8A 3J81K 5D5UB 1Z6RA 2XAHA 1R1UA 3EYIA 2ETHA 2ESNA 3LWFA 5IT3A 3GXOA 3ZP5A 4IRHA 3HUGA 1USTA 2W57A 1U5TC 2RKHA 2OD5A 1RIOH 3W6KB 5D6FA 1SFUA 5E1XA 1BIAA 4A12A 2NAZA 1G4DA 2IW5A 3WGGA 5DCMB 4UXNA 1O7LA 3C18A 1MJBA 4LLLA 2QENA 3RDIA 1QPMA 3CO6C 2UXXA 4A0ZA 2VE9A 2MH2A 1S8NA 3HSRA 5KVRA 5IT9Z 3V7SA 1S6LA 1W5SA 5K5RA 3V8LA 1G3SA 2VBZA 1XGOA 4HV5A 4I02A 2DQRA 3WE2A 4ETSA 1SD6A 2ZXJA 5FO5A 2RGVA 3IWZA 3I71A 3MAJA 4B8XA 1R5GA 1JHFA 1OYWA 2CSOA 4CYDA 3QPHA 4KMUX 3CUQB 4YIIA 2FU4A 3BJ6A 3M9AA 4EV0A 3FF5A 5FFZA 4A6EA 2HKOA 3KFWX 4MNUA 2ACJA 2MH9A 5HLGA 4Q48A 5LHHA 1BC8C 2RN7A 3FWEA 3D0SA 5TJJA 4BYYA 4EJWA 3VB2A 3K0LA 1FY7A 3R0AA 1IXCA 4AVPA 1IN8A 3FXQA 2TDXA 3U1DA 5DDGA 2LDUA 2A68F 3IL2A 2H94A 4H0EA 2MLGA 3DPTA 4R1HA 4RS8A 2KJCA 4HOBA 3F72A 2F5EA 4XRFA 2ESHA 4M6YA 1G6NA 4F7ZA 3TDUC 2XAJA 2NS0A 1G3YA 5K1YA 2A6HF 2R7DA 3IC7A 2F5DA 3BDDA 1BJAA 4HDUA 4ZYEA 2FOKA 2OZ6A 2UZKA 5L3CA 1T0FA 2KKOA 1T2KA 4L0YB 2O6GE 1O7FA 1L3LA 1FX7A 1XMAA 2FMYA 1I5ZA 2PBIA 4A6DA 2KIMA 4CXFA 4LB6B 3QAHA 5LGUA 4HX8A 3MFKA 1K78A 1CGPA 3CO7C 5K5QA 3T1BA 2P5LC 1U8RA 3BPVA 1U3EM 2PFBA 3KP6A 1F5TA 4PDKA 4NQWA 1DPRA 3U9GA 3DXJF 5JFRA 3R61A 1J75A 3HRSA 3GFMA 2EJRA 1JXSA 3Q9VA 2DU9A 1R22A 3RI4A 3D5LA 5CVUA 3FM5A 3WTZA 1Y0UA 4QLCU 5BQTA 3ZMSA 1KA8A 1FSHA 1LDDA 1LEAA 5D4RA 1ZRFA 4HZFA 4HX4A 2GAUA 1TBXA 4MEXF 3VODA 3T0YA 4LJZF 1XMKA 2BGCA 1BIBA 3CTAA 1ZG3A 2A69F 3M1EA 3K2ZA
chains in the Genus database with same CATH superfamily
4RB3C 1XCVA 4TWFA 2XAFB 4NYPA 4OZ5A 4DV6F 1H3DA 2HHVA 1Z1DA 1GH8A 1E2AA 4DUTA 1N5YA 1LPQA 1BGXT 1ULYA 3GTPJ 4YR2A 3F8BA 3FZBA 3M65A 1UJ8A 2MKHA 5IYBJ 5T7LB 2W67A 4G3IA 2AXLA 2CQIA 2JJ9A 2UZAA 2LVWA 1S79A 4I55E 5CVIA 4OYJA 1VQ4I 2VQLA 4P9SA 5IY5H 1A04A 2CQPA 4ITVA 1S7IA 4LRAA 1KLMB 1JHHA 3RHWA 4J5OA 1WWHA 1Z0PA 4CLWA 2HK3A 1GAOA 2FC9A 2AEFA 5JDHA 3NOGA 2DOFA 2E9XD 2HQGA 1R1TA 2DNGA 3LOUA 1JLCA 1VISA 2Y2ZA 1Y01A 1JLBA 4D1QA 1EAYC 4U7UD 4IHTA 4ANEA 3Q2MA 2KHMA 4HACA 3CJQB 1W0TA 1HKSA 3S2DJ 3N6NA 1X4PA 4I6AA 5C25B 1JLAB 1QRYA 4KGMA 4YB6A 1BLUA 2C3YA 4HEAA 2UVVA 2IDEA 1KEKA 3BPXA 1HSTA 4LSLB 3TVKA 1HOMA 4N0BA 1WF1A 2PFFB 3GONA 3W3SA 1NZ8A 3WC0A 3H5SA 4M95A 4M3EA 2LFVA 5LM7E 5H6QB 4K4WA 1E3PA 3LK2B 2L4MA 4M6VA 4O4LE 3BYRA 2XLJA 4CGZA 1U6GA 1J9IA 4KO0A 3SWHA 4AIJA 4LSNA 2R3VA 3OUYB 3U2RA 2HFNA 2D1CA 3ZGKA 4RBUA 3AG4H 1YJ7A 2D5UA 2CUZA 4B47A 3UR3C 2RP4A 4B9TA 3S3NA 1FRMA 3VFZA 1NK2P 2DO4A 4QWQA 1VMBA 1UVIA 4I68A 3K2AA 4YSXA 2GVZA 3FBEA 3HJFA 2VBWA 1TT5B 1RHUB 3ZTSA 1S72S 2OA5A 5M5WJ 2GIFA 3H9JA 3OYCA 3C4WA 4X4TA 3NQOA 1ENHA 4IHVA 3IKVA 4ISTA 5K5MA 1PO6A 4RAFA 5CHCB 4DOZA 3KHHA 2YPZA 3EXCX 2MG4A 1EH6A 4A3KJ 1HX1B 3L2QA 2E7VA 1EV7A 1VLYA 1WOPA 4OFZA 4CNZA 3MEEB 3SI8A 4DSJA 2LXUA 2KRHA 2HVDA 2XSJB 3PJAA 2CQ1A 3Q8UA 4UVBB 2JJ7A 2K9QA 1F43A 1CVJA 4H4MA 4PG8A 1A6QA 1K6OA 4ECXA 3NGSA 3JRBA 3KBUA 1E6YA 3DC2A 2NNYA 3VF0B 2E2IJ 4LF9F 3HSFA 2G7HA 1M5OC 2DCFA 4MKVA 1HFAA 3K1SA 3UUXB 4XLEA 3SEOA 3CJ0A 1S6QA 1S1TB 3T8RA 4B3SF 2M6BA 2HNYA 2RAQA 2ZDOA 5A2QZ 3FZFB 4JV5T 3V7CA 4HA8A 2L08A 1VZ0A 3MJXA 1I6XA 3MZHA 4JI3F 1JLQB 1WKKA 2JVHA 1YO5C 2W2UA 3D0HE 5GMEA 2V7MA 3AAFA 1S59A 2FD2A 3ET6B 2NZ4A 4XN0A 2J6SA 1K4SA 1EJ7L 2ZHOA 3LBXB 2IP2A 1KQ9A 2MMYA 5AQTB 4C4WA 2K5CA 2BRLA 3ULHA 2IS1A 1Y5NB 2CRBA 5U47A 4DS4A 3IRRA 4BGDA 4PJLA 4F8RA 5IYZE 2GA7A 4EEBA 2HSEB 4ED4A 1C0TB 2QC3A 3JCUC 1P9YA 1Z7UA 2LD5A 1FC3A 4B02A 1RT2B 3DRSA 5JJBA 3J7ZI 3OVBA 1JTYA 3CCVS 5C3EJ 1K44A 1UG0A 2A6EF 1NXIA 3CC7S 4LITA 3ZPOA 5CH7B 1E6VB 4ECUA 5AQOB 1IKVB 3L2VA 5EWFA 3OR2B 4F67A 4RU9A 2ZSHB 3B54A 1WYCA 2N9DA 2ROGA 3CC2I 2H5IB 1KQKA 5F41A 2UU9J 4WYLA 2FE3A 4QWEA 1FEEA 1HR0F 1N5QA 5J1UA 1F3VA 4QIGA 4F25A 2FJXA 3KMQA 2NTXA 1F9FA 2A05A 3TO7A 2ZEJA 3K4CA 2M8GX 3UQ4A 5D6GA 4CI1B 3H3ZA 3LP0B 4FT8A 3BG3A 1RWNB 2FJVA 3TQEA 2JN6A 2V4RA 5I42B 4BL0B 4HWIB 5DZ7A 5KFGA 4MALA 1HBUB 3TX0A 5HS8A 3DPLC 2PFVA 2R2SA 4CDGA 3A3PB 5G0RB 2C28A 3FXLA 2V79A 4AVZA 3IBCB 5A8RA 3K7RA 1ZHCA 3NNCA 3V5UA 2M3DA 4Y28C 2XY6A 4IOCF 3GCXP 3RKYA 2P5VA 2ADUA 1U45A 3KK2A 4F91B 2B6AA 3MKYB 3BBFA 1MH3A 2VG6A 1YI2I 4TU9A 3GU0A 5D5WB 1Q95G 1PJ6A 4I56A 2GA2A 3M1VB 2XJ7A 2XY5A 2DMPA 1ZG5A 2NVXJ 4QH5A 1RTIB 2ZKZA 3E6DA 2BZTA 1CJVA 1ZOTA 4J7CA 4LG0A 1S7OA 3NBPA 3FCHA 4S0MA 2A3DA 3AL0C 2JRMA 2D1HA 1WSUA 4OIQF 2OSRA 3GWCA 4O0IA 1HSJA 2V4JC 1TVRB 4DGWB 3JTHA 3PTWA 1XMOF 4MKBA 1UVMA 5BMVE 3I59B 4I2PB 1A7GE 1ROFA 5B0BA 3PIPQ 1XMQF 3ECOA 3D6TB 3ABTA 2GJIA 2Y0MA 3PQKA 3ZCOA 5AQLB 3B02A 3G71S 2M0MA 1RXOB 1EZ3A 1H6KX 4EEDA 3ITHA 1HW1A 2HFOA 1YQ4A 2Y1IA 2Z0GA 4ZVFA 3J81Y 2BXZA 2HXIA 3GILA 3GZ5A 1HNWJ 4DMZA 2VBYA 1JUPA 1C4AA 3EPZA 3PO4A 2K02A 2W7NA 1GXQA 5CPRB 4GOUA 2GJ2A 1FMVA 3MUVP 3RKWA 2RF2A 3M8QA 3D5RC 1EQ0A 4Q2LA 1GT8A 3HL6A 5AQVB 3IF8B 4N4NB 2K9NA 1VQ5I 3CGIA 3K58A 4DNCA 5A1LA 2NYXA 2J76E 2XUEA 2QF7A 3FSIA 5KFIA 3CLOA 3W6JB 3T5XA 4ZVSB 3GLXA 1HQCA 1NJIT 2O03A 1FVSA 2YWWA 1YIOA 3I64A 4HH1A 2KNDA 3HVTA 1QE1B 2AQFA 4HFHA 4YS2A 3KV6A 1NKCA 5B0DA 4NXNJ 3O3LA 2JUGA 4P71A 5IYDJ 3LMMA 3K5PA 4M72A 2MY8A 4IO1A 2ZZTA 2PMHA 1BWEA 3QT7A 4E7LA 1J59A 4LRFA 4JI0J 3Q3SA 4TV9E 4N8OA 2MFZA 2Z9OA 2YEVC 1HNWT 1WC5A 4K0KT 3R6SA 1CHUA 1W5TA 5BPDA 2RVJA 2LQ8A 3SIPB 3S3MA 2IA1A 4IZZA 3LP1B 5IXUA 4F4ZA 2Y8YA 1NNDA 3M8WA 1OWXA 5KG7A 4KKOB 3DBLB 4C0BA 2YKMB 3QJJA 3DU5A 5EG0B 3A8EA 2M7BA 4ID8A 1NK9A 2FY1A 2ZO4A 2V2QA 3E5QA 2XB5A 1HLVA 4PJJA 7AT1B 1KHWA 4AYBN 2YKSA 1RT4B 4J19A 3W65A 1CQTA 1T11A 1Q0NA 2VJUA 2V6YA 2H1YA 4ILCA 1CS4A 3WDOA 3M9OB 4HNUA 1K1SA 1G2EA 2DOEA 3RSNA 3LQQA 2HURA 1LW2A 2EC2A 4CWBA 4DV5J 2JVRA 3FBNB 2ZMEC 4QKNA 3JSMB 2V67A 3MWMA 1IJWC 5DG7A 5JVGF 3E97A 4MIBA 1KYZA 1WJDA 3K3QC 4HNTA 2YPYA 2ZUGA 3AEFA 2EZHA 3UR0A 2F48A 3HOUJ 4JK1X 3T5LA 1FXDA 2FZCB 1HC8A 1A5JA 4H63V 2HHXA 5HBMB 3H9QA 2XM2A 1SL2A 2ZOMA 1K47A 3ZYKA 1JKRC 3P45B 4DBRA 3CCWA 4TQRA 4AKRB 4K50A 1JWWA 3M6VA 2GHPA 1LJ9A 4V19K 4X20E 2UUZA 4HE8A 4EMDA 2XBPA 3H5YA 2OIHA 3HXLA 4I0AA 4L75A 2DMUA 3HHNB 1VC5A 1T9YA 1X5PA 3GG0A 2XQ9A 4MHCA 4XKWA 3WU1B 1LDJA 1YS7A 4CLKA 4Z91A 2ZHBA 4ENNA 4TYBA 3N0VA 4NIQA 2CNNB 4C30A 2U2FA 4B3OA 2DNXA 3JC6D 3HR0A 2PFDA 3DLAA 4QTRA 4A48A 3JRFA 3M6XA 4KV8A 4BBYA 2HAIA 3PUSA 4YSYA 1N6QA 4L6V3 2FVCA 3WHCA 3NAHA 4AL7A 4WXCA 1FEHA 3TUPA 1T3NA 3HLUA 4LREA 2NVTJ 2XSBA 1QBJA 1HTJF 3ABVA 4WZQA 4AXJA 1I3QJ 2YWHA 2W85A 1PC5A 1J5WA 1TQIA 2GVDA 4KH1B 2PJPA 2D9OA 4B6XA 1TZLA 2D0TA 1WOSA 4Q8FA 2JLGA 3S1MJ 4UV9A 1OR7A 4HSRA 3VQTA 5LOVE 2BOPA 3BG9A 2MLXA 4GKKF 1CLFA 4DJBA 2FHKA 1VCTA 1WHWA 2HOAA 1XQIA 4JI4F 2MKIA 2CMPA 4IUFA 2HS3A 4D9JA 1BR0A 2XO7A 2MLKA 5HVQC 1HXDA 2HQIA 1KRPA 2CUYA 4I2QB 4NE9C 1RYRA 4DV6T 2O01C 3F23A 2XSAA 2Z1DA 4F52A 1S0MA 2OCCH 2LU2A 3EUNA 4O4IE 4QWCA 3OL8A 3FMRA 1Q1KA 3Q86A 2A61A 1VRTA 1LVAA 3RAXA 1K78B 5DD4A 3FVYA 4C11B 2JX2A 2DNPA 1U8SA 3H3MA 2XDVA 2CXDA 2Q6BA 4TV8E 2E5GA 1FKOA 3LSKA 5JREA 1S9GB 2AQEA 3SCKE 2WDQA 1S7HA 2V6AA 2XNRA 4UB6C 3FM3A 2ZFUA 3I0QA 2ZBQA 2YK0A 2J6TA 2R3SA 5HXRA 1S1UA 1FLIA 3C6TA 2BV3A 1WEXA 3ONXA 5LBQA 4RO0A 1DFDA 3ANWB 4ALZA 1U4QA 2L9DA 3M4XA 3L1PA 2YWKA 2B63J 1DGWY 1JGSA 2GQCA 3VR1A 4CCOA 3PJAJ 3BR9A 2BVMA 2QG9B 1EH7A 4OAYA 5FLVA 4DR2F 4I43B 3RRHA 1EETB 5FXZA 3DMJB 1RKTA 4HR2A 4ZLLA 4TWDA 5K7FA 3C14B 3HT0A 3NARA 3PFOA 1MNDA 3CCZA 4UQTA 1LWEB 3CJ3A 3VKHA 2PMZN 4M5NA 2YSRA 5CYMA 1QZYA 4CLYA 3TLWA 2WCAA 2LXFA 2DA6A 3W2WB 4DFJA 1FNNA 3ZYMA 3A01A 1QSSA 2HWIA 5BYQA 2DTJA 2JUCA 2CV1A 3LAKA 3P4PA 1C1BA 1VQKI 3BGOP 4Q0BA 3ZCIA 1HARA 1UGOA 3O6QA 4J9SA 3JB9k 1PCAA 1SXLA 4R8UB 5HNHA 4WYWA 4BDZA 2ME6A 4DV3F 1BQXA 2G9OA 3M32B 1USSA 2YPRA 1YJUA 4QR1A 4O4HE 5CFBA 4IFYA 3QYFA 5E3NA 2HH7A 1WCMJ 3KP2A 4WTYA 5KNLA 3E3XA 5CYQB 2H8RA 4X1YE 2B9EA 2DN0A 3UU5A 3KG4A 1HW9A 3N97A 2LSKA 1B70B 2PA8D 1DLOB 4DX7A 4A5NA 4PWWA 4ANDA 4JI3J 1P4WA 3OHBA 2CG4A 1DPUA 2J8AA 3C16B 2Q43A 3I3LA 3J81j 3M8JA 1Y11A 5DQGA 4C0OC 3D1HA 1PVEA 1NDLA 5CD4H 2B0LA 3NMAA 1X1AA 2VKZG 3OPKA 3GFJA 4QWNB 5C4JJ 3PU8A 3THTA 4Z7CA 2QBYB 5LSLA 3IS9A 4OI2A 5HSPA 1XN7A 1NAQA 2AX0A 2KLQA 5B0EA 2CQHA 3R2CJ 4B3AA 4HQMA 4MEYF 4FX4A 2XPWA 1TELA 2YU1A 4HH0A 5AQFB 3X3UA 2YNIB 4JBCA 4ZP7A 4A56A 2O3DA 4LF9T 4P0BA 3KOAA 2VL8A 2R93J 2CQCA 3AFGA 5L9NA 3TKYA 1WUUA 2FZGB 4J37A 4WX9A 5HWYA 2NYIA 4B3ST 3JAFA 3PUBA 1V5EA 1YVFA 5IFMA 5ADZA 2N8GA 1HR0J 1VQ9S 1QU3A 2VUMJ 1U25A 4OI1A 2P6TA 2GJFA 2UXBF 1RSCA 1UCUA 1SD7A 3I4PA 3T6JA 1G3TA 4KHMA 2BE9B 4I67A 4CO5A 2YX4A 1RHRB 2XM1A 4LQ9A 4USJC 3F9KA 3C4ZA 3V81A 4EZ9A 2XKOA 1HX8A 5JHUA 1U26A 2RDDA 3QAEA 4Q4ZF 2CFOA 1N0UA 2HPMA 4P72A 4NRUA 4I0UA 2VU5A 2CPTA 4DR7F 4NA2A 2YWGA 3ZO7A 1U5TA 3BR6A 2ROEA 2AX1A 3K1NA 4XN3A 2R8JA 1YYVA 4BU2A 3MMBA 2ZE2B 3C2HA 4YJ2E 3AAEB 1TKXB 2B3TB 4PJMA 1V5FA 3GFHA 4I1TA 4DUZF 4HT5A 4B9MA 1SVMA 4LBIA 4CLTA 2XO6A 4D3GA 1RKIA 1NHAA 1BQNB 4JB8B 2QA4S 1ZG1A 1FJGT 4TX5A 2QRXA 3PW4A 3I6PA 7FDRA 1BD6A 1ZR4A 4Y33A 3HOWJ 1HR0T 3I0SB 4ZVQB 2BM1A 1TTYA 1OQYA 5E3OA 5EEAA 2RC4A 3ABMH 3H5AA 3QPSA 4AQYF 4M3FA 5KFZA 3UQSA 1X60A 3K1PA 4OZNA 3V42A 2JMHA 3FFIB 2FQ3A 1IW7F 2UXNA 4RB2C 3H25A 1VI0A 3GFXA 1UA0A 2YDQA 4PYAA 2HKEA 4Y2IA 3JCFA 1SUMB 3M8YA 2XAUA 2LECA 2JA8J 4OIPF 1U24A 2IRYA 2HQ5A 2QSGX 3RTVA 5JDNA 2ZH4A 4O44A 1MDMB 3OXFA 3AQPA 2OJ3A 3PUYF 4QIEA 2J4GA 3HKZD 2LFBA 5FLMJ 3SFZA 4NXMF 2VT3A 3RUBL 2FJDA 4OYWA 4P2SA 2QQ9A 1VF9A 3GWZA 3VOEA 4LRCA 2QA2A 4WXHA 3ZN1A 4HV6A 1UHSA 1JJ8C 2R6GF 1N56A 2CPYA 2OKQA 4ELUA 2WS3A 1FSEA 4N47A 2QQAA 3OWTA 3MCOA 2HVSA 3DM2A 4CN4A 5M5YJ 1OS5A 2QUFA 2AQ4A 2W63A 2CDQA 4LRDA 1TW2A 2H65B 2R8HA 1X9SA 3IG1A 2DGQA 5BJRA 3DRXA 4LFUA 4PPDA 1XMOT 2FJBB 1B9MA 1LUJB 3DFEA 3KNAA 2OAZA 2WSEC 3RQIA 1YIJI 5BPIA 2BX6A 2OPRB 1YI2S 1HG5A 4ZI3C 1XMQT 3LAMA 2HVQA 1QM9A 1F3FA 4AXIA 1XGMA 2STWA 3OYNA 4U87A 2R5YA 2H3EB 2GGPB 2GIRA 2QA1A 2QLFB 1IN6A 3RIFA 1EA3A 1JJ4A 3FQKA 3ONQA 4U3CA 1T8BA 1LOUA 2BRKA 5E3CA 3KK3A 2B4VA 1IBLF 5KFQA 4ZN3A 3FB2A 1V3FA 2I2YA 2W0GA 4OX6A 2QRRA 4CXWA 3IWNC 2DIVA 2GXBA 3I0TA 1UHMA 2V7LA 1LE8B 1X4DA 3DLEB 5HJYA 4OX9F 4B17A 5FYMA 2UUCF 1B7YB 4DF8A 4CCLA 2VKJA 4MBQA 2LY1A 2Z2LA 5KT3A 1ICEB 3TQNA 5A2QK 2POKA 5JXSA 2E9XA 2YKNA 2ZKUA 3H2UB 2R2TA 2QSFX 1RETA 3CIZA 3IRQA 9ATCB 3HPOA 4Y4RA 4RW4A 5CYJA 3MKZA 5EDWA 4QX8B 4M5DB 3CCUI 3M8EA 3FDSA 3GFIA 4URQU 2UV8G 1SBRA 5J8CA 2OQRA 2CZ9A 3KHLA 3TAMA 2OU2A 1RTJB 2BJDA 2V4JB 2B4UA 4I7HA 3OLBA 2W48A 4BWMA 1XGNA 3RH3A 1R89A 4UZCA 3AE2A 4P10A 2W4PA 2K7LA 5J2QB 2AYMA 3ZC4A 2RRAA 4QWAA 1SKWA 1D5VA 4N76A 3KP7A 1IQTA 3J81Z 1B0VA 3HHEA 2L7KA 1LXJA 4ESFA 2DXFA 2V50A 3HCXA 2F6CA 4G7ZF 3V6KA 1D1UA 5K14B 5M4YA 2ES0A 4NBQA 2Y48B 4HL9A 2E1NA 3KLGA 3IBWA 4WFBQ 2ZM0A 3W9HA 1OJ4A 3K89A 5HI7A 5KCMA 3Q89A 2VV5A 3R1LA 4M5HA 1TV6B 3WZ0A 2V1DB 2YKPA 4CIOA 2JQ7A 2PJRB 1I1SA 4PAGA 1IUFA 1SFEA 4IRKA 2NR0A 4L9NA 3VKGA 1YD8G 3QRPA 1UZCA 1OO0B 2L9VA 2K4BA 2VPYB 5L47A 2Q2EA 4TKTA 2VC0A 4CDIA 1R31A 2ILYA 1FPQA 5JR9B 2E36A 1HBOB 1D9DA 2FHJA 3FSXA 3RYFE 3T9ZA 3VSKA 1EP4B 1GFWB 1HNVA 1YZ6A 4ZVEA 3DXSX 3T41A 1U09A 2DDAA 4WBOA 2BE5F 2JT1A 1IRZA 4ATNA 3Q2TC 4YRVA 3ZYLA 3O1LA 4NEYA 4RW8A 2HEOA 2X6XA 3QAUA 1ZGAA 2ISYA 1OR7C 2ROPA 1UZHA 4PXBA 2CQ3A 1P1LA 4BDPA 1VQ7I 3KYCB 3RC3A 1NK8A 4MJKA 5FD6A 3QRRA 2CS3A 2F4FA 3SZTA 4ZZDA 2X0LB 3TJ8A 4PRFA 1ZGJA 3DKXA 3FEYB 5CZVA 4HVZA 2L9RA 3CDHA 1DTTA 2EK1A 2W66A 4WXOA 3DLLF 2CGPA 5F8IA 3ZQ7A 2WVBA 1VQSA 4L74A 1EARA 2DPUA 4RWXA 3RGLA 1UP1A 1ELOA 3RB6A 1RJJA 1W7PD 3VDXA 4G1QB 1UEVA 1WKMA 2O8KA 3Q9SA 4OZ1A 3H42A 2OUMA 1F9HA 4X64F 5ABFA 3M8FA 3LL7A 1IN0A 2HDCA 1HI0P 4JI4J 1S12A 1FTTA 1EHWA 5HO4A 2EWHA 2NXEA 4B48A 1M62A 2LU1A 4CH1A 3TA1A 2YNFA 4XQFA 2BUNA 4L5JA 5HS9A 5FVLA 1H7WA 4A5MA 1FWLA 2ZLYA 1VR6A 3QFHA 4Z2XA 4JYAT 4YFNF 3JAMZ 2KT5A 4JI2F 1UVJA 2XGDA 4L76A 3OL9A 2ZMEB 5HVFA 3CD6I 3CJTB 5HAXA 1KQFB 4R5PB 3BY6A 5ABGA 1X1PA 4HNVA 2D5VA 2H09A 3M6UA 3M2RB 1AZSA 4M3GA 2WAQN 4E6KG 4WFAQ 1VBZA 1VQ8S 3NAUA 5SUHA 1RBAA 3TEDA 3J7AY 4V1Ak 3KNGA 4GKKT 1CC8A 2BANB 4E8UA 1QAIA 3EZ5A 4OINF 3Q5DA 3ZZPA 3G6EI 1REVA 2Z33A 4RAZA 4ED3A 3WE3A 1IN4A 1G3WA 2DHGA 4AIUA 3RGIA 4PQAA 3DOLB 4F93B 3W9JA 2CW8A 2OUGA 3EGWB 3DTIA 1MWYA 3A8KA 5EEGA 2K3KA 3VVTA 2G1HA 4FF2A 1GXUA 3BPDA 1S94A 3CF5F 3E7LA 2KWIB 4DR2J 4IHXA 3N2KE 4KN4X 5J4YA 4L18B 2BJ7A 1IN7A 5LMNF 5HXSA 2C0SA 5IT9Y 2O0YA 4U7YA 4XRSA 2JHEA 1UKUA 3C2GA 3E8OA 4EZ6A 1IKYA 3GTJJ 5KG1A 3LAJA 2CO5A 3MMJA 3MK7C 4ENJA 3KLEA 4HLXA 2ZC4A 2PC6A 2WU2A 2IUBA 1GVDA 2GQQA 5L3EB 3BO3A 1WQ2A 3MPWA 2F4VF 3P9CA 4D7NA 2KI2A 2YKQA 2K7KA 1U1OA 1KR4A 1YDLA 5CGMA 2HG4A 2OJED 4EO6A 4J9RA 2L7MP 1NG7A 1X1DA 3MVPA 2LVSA 3MEDA 5F8GA 2ZM6F 3FKBA 4FP9A 4K2XA 2ZKTA 4NPPA 3DQVC 2VQFF 4WFNQ 2E1PA 4NX9A 4CH0S 3HL2A 1FESA 4U7BA 4MK9A 2RKIB 2XCAA 2K3WA 4HHHA 4ZPDA 2HDDA 3FBBA 1TWFJ 3TBIA 2FX0A 4RNMA 3LOCA 1S3JA 1F2GA 4B09A 3HPHA 1H2VZ 4GKJT 1AUDA 4X0GA 3I4MJ 1ETVA 4C2TA 3ZMVB 3P3DA 4XPEA 2MYSA 1IKWB 4I4BA 3PZPA 3HHGA 1ETKA 2LA4A 2BDEA 1WG1A 2LF7A 3TP3A 2CQ4A 3RBZA 3KEQA 1FRKA 3VZHA 4I69A 2ECCA 4AISA 3RC8A 1PP7U 4FTHA 4ZP6A 3HDSA 1PJ5A 3LP2A 4RPFA 4UR9A 3WGIA 2DGSA 3TQ1A 2DFHA 3BG5A 4HN9A 3CCQS 3MEXA 3N9MA 1Z9CA 3TA2A 1XMXA 1AYEA 4H4KA 5AQRB 1HF0A 2XHEB 3KHGA 4D5CA 1HKAA 1REGX 3VYRB 2V7FA 2LY9A 2WZHA 4AQGA 4L9TA 5K8OA 4I6ZA 4KI0F 4OMFG 3GIJA 4LMZA 3IWFA 2LBFA 2ZMAA 2KXNB 4H9SE 3Q0VA 5A8WA 3VCDA 3LFUA 4DV3T 4HW0A 5ED4A 1YTYA 2C3PA 3EPGA 3FISA 3Q24A 4PJNA 3F56A 4QCLA 2IC6A 4XNFA 1IXKA 5D4OA 2MLZA 1Z6RA 2XAHA 3TO8A 2ETHA 1V5VA 2ERRA 1R7IA 2AU0A 2ECBA 4BEHA 3GXOA 3ZP5A 3QB5K 3N2GE 2QGUA 3I9V9 1FXLA 3RB4A 1J1JA 3P5TL 4OAZA 4XOPA 1U5TC 2UXBJ 3ZFVA 1MMGA 2NUHA 1Q86T 5CB4E 2RKHA 5CZXA 2J9EA 2AGQA 3W6KB 4NPOA 1YX2A 3FQLA 3IRXB 2RT3A 3UFEA 4KC5A 5D3GA 4GC7A 1YJTA 3WGGA 2V0NA 2HRYA 4UXNA 1O7LA 3MR6A 4OWRB 4M5IA 1J5EF 4IO9F 1E6YB 1T03B 3JSRA 3G2XA 5AXLA 2LEPA 5KFPA 4DR7J 1TKZA 2VJJA 3CO6C 2RS2A 3PRVA 2UXXA 5IPAA 4A0ZA 2A5WA 2DA3A 2VE9A 5LOQA 3DXBA 2BBJA 2XZEA 4XKVA 2EW9A 1MROA 5AFUL 1ZM9A 3V7SA 1R49A 1S6QB 3V8LA 4W90B 4DX5A 2V9KA 3I9WA 5GMDA 2DJIA 1NSQA 2O67A 1YBUA 2ZXJA 3LUYA 2BG9A 2RILA 4EATA 3ERMA 3G4SI 2IS6A 2GW8A 3C2PA 2V8GA 5HEUA 3ZTRA 5FDLA 1JNZB 2GIZA 4BWJA 3I0RA 2CSOA 1NK6A 1RR7A 2ACZA 4YIIA 3LH2S 5CA5A 2UXBT 3GJQB 1RB0A 4AQYJ 5ETWA 3DDNA 1TMMA 4IDKA 3OJSA 1AKHA 2FJ1A 4Y34A 3LSIA 2XQYA 3GTKJ 2ASYA 4IR9A 1X3WB 4FCYA 3THVA 3R6GB 3CB4A 2V5HG 4NLWA 3W64A 4WP3A 5TJJA 3QC9A 1WHXA 4QSHA 5CQEA 2ADBA 3LK42 2ZH2A 5JH7E 2HHQA 4U2ZA 4L72B 2FD5A 2OTJS 2B7EA 5LMUF 4ZVTB 4AI6A 4NXMJ 4DUZT 3J7A1 1NB2A 4LBPA 2DWGA 1MU2A 4MIWA 2R5ZA 4P6QA 3FZLB 3LDQB 2X1GA 4H0EA 4XIUA 2LTPA 2NVYJ 2ASLA 5JDLA 4HOBA 5KOXA 3PCOB 4EYHB 3U7JA 3OSPA 2F5EA 5DM6F 3PE0A 2P2CB 1G6NA 3H20A 2V7KA 3TDUC 3TJAA 4R0JA 4QJVA 4ECYA 3HZJA 5K1YA 1FWPA 2YDRA 2E5LJ 2YNHA 3O4XE 2OD6A 5F8HA 3ASNH 3QWLA 3BDDA 3AECA 4ED5A 1BJAA 4XONA 3M3YJ 3K5OA 3P96A 1UZDA 1CG2A 2HN2A 1K0VA 2XYHB 1T2KA 2HZAA 3JSBA 4DPTA 1O7FA 4NRTA 1POGA 2B6AB 2C2OB 3G87A 4V2GA 2ZH7A 2FMYA 2VG6B 5E3QA 3KKFA 1ORKA 2ZHAA 2FJEA 2YQ3A 1I5ZA 2PBIA 3LSGA 2E9XC 4CXFA 4BBRJ 4LB6B 4BY1J 2XZWA 3W60A 1V9OA 2XC7A 1IBLJ 2LJLA 3MAAA 2JVOA 5TGTA 4A3EJ 3DRPA 4HX8A 1CGPA 2NS1B 2C3MA 3L2RA 1TL7A 4DV0F 4DR4F 1N88A 2IIUA 2M4GA 2PFBA 4IHYA 1YJRA 4DPXA 1DPRA 5JFRA 4ZZBA 3U27A 4ILBA 5KAIC 5ETTA 4DSLA 2Z8QA 1XWLA 4Q2MA 2EJRA 4DYCA 3PRBA 1YJWI 3TI0A 2H1KA 5TAOA 2FGOA 2KRRA 5LG4A 4ILRA 1JJ2R 2DNHA 2DU9A 1R22A 2KP6A 1H0HB 1UA1A 1MG7A 2RH3A 3PJ9A 5CVUA 3FM5A 4CQ1A 3WI3A 3RBDA 1Q5YA 4OYZA 1FSHA 4OI6A 4EXTA 2A0FB 5AQPB 3EUKL 3SS1A 2R7SA 4HZFA 1U6BA 2GAUA 1TBXA 3BGLA 1OSDA 3OYXA 2BOAA 3P8CD 3ITHB 1HWKA 3T0YA 4WE1B 2OF7A 1X4HA 4ID5B 2A69F 2DPJA 3K2ZA 4CTAB 2MHEA 4LFCF 1JJHA 1JKQC 3OTCA 4UNOA 3KV9A 3TX8A 1AU7A 4C8MA 3PFYA 5B7WA 4NUVA 3M8QB 2DQLA 4AYBD 4X5TA 4YDDB 3QFWA 3OL4A 2XLIA 4CUGA 1N36T 2JA7J 1DJ0A 2EKNA 1V5GA 4OX9T 3BLYA 1SV5A 1XNRJ 2UUCT 2E1MC 3HHLB 3EABA 1FWZA 1H2UX 4NI2A 2RNGA 4ESBA 1VTNC 1QVTA 4RL1A 3UD3P 3K2YA 4Y0FA 5D4NA 1E1HB 4II2A 1OCOH 4UELA 2EK5A 3MA9A 3I58A 3CVRA 2F7VA 1X2MA 3AE9A 2H7VC 2JFDA 1U1QA 5LBMA 2HVIA 2GMHA 1NK3P 2QEXI 3VEPA 4AIKA 2QMUB 2L3MA 4ECZA 3AE5A 4NZ7A 8RUCA 4IH7A 1W25A 4CO4A 3B6CA 3MOJB 1GMVA 1OMSA 2C3UA 1K1QA 3CCYA 1SJ4P 2QJ3A 2W61A 1XTAA 3Q22A 2LT3A 1T0TV 5A2QU 3N9NA 2FJAB 1OPZA 2EK6A 1QQIA 3D9BA 2DOAA 2R7XA 2WB1N 4ASNA 1AA7A 3QO9A 2ACYA 4WU2A 3L95X 3GP9A 1N54B 3BH7B 3HVRA 2WVCA 4J91A 3VVUA 1OKRA 1YK9A 3CIMA 2Z2MA 3K5NA 4RNOA 4BAYA 4TUYE 1DHMA 3POTB 2MY7A 1BWVA 5KFUA 1Y8RB 4NLVA 1QAXA 2ACXA 3PYEA 1XSXA 2M45A 4ZVGA 3EVYA 1FVQA 3OTOF 3AJ2A 2KXHA 3SXYA 1RCOB 4YEAA 3UCUP 2XQ5A 3NGKA 4AKGA 1P8GA 2FMLA 3FKIJ 2LP4A 4FKXA 1OIAA 2W01A 4DV1F 3JR9A 2KINB 2R8KA 4BS9A 4ZLJA 4G7OF 3ZZRA 4X64J 3DOMA 2MKSA 4LGWA 3UCZP 2JTVA 4I09A 4AM3A 5LNKA 2LKHA 2DB1A 5B09A 3N6MA 5AQUB 1IJEB 3NGUA 2NWBA 4N41A 2IAJA 1APSA 2H6BA 4Z8XA 1HPZB 2XY8B 4O4GA 4X62F 2GNKA 4DEZA 1LW0A 2KJWA 1RT1A 2XAQB 4WXWA 1SIZA 2ZBRA 1TQPA 5M2UA 1LKXA 1ZPWX 5JVHQ 4JP0A 3C2BA 1FMWA 3IXQA 4LT6A 3MCNA 2Z6EA 4JI2J 2CM0A 3M8RA 1M5VC 4URSA 4M5JA 1IBKF 4QU6A 1ZAWA 3TANA 2CPEA 1BW5A 2X67A 2FBIA 4RGXA 1OMIA 4MYUA 2CPFA 3HKWA 2UXCT 3VAIA 1BR1A 3JSPA 2YNGA 4HEA9 5HEGA 3ABUA 3VYTB 1KVIA 3VHLA 4HX7A 3NS5A 5KFLA 3B4DA 3HHHA 2RQCA 3UU8A 3ICLA 5E20A 2M2BA 2GOXB 1HYSB 2HVRA 2ZBPA 1NHUA 2XTJP 4M71A 1RT6B 1MBKA 3RPUD 5KFFA 1Y9OA 3AKZA 4X64T 3H3UA 2OQGA 2KL4A 2CQXA 1FKPA 3NP5A 5E3PA 1ZGWA 4A8YA 2DH7A 1WHUA 1OPIA 4K5RA 1L3TA 3VYUB 2MQNA 4ED8A 2RV8A 5L3GA 4B3OB 3Q8VA 2Z4PA 2JSXA 4DUYF 3UDLA 1GMWD 3HM9A 5L1KA 1XDUA 4J9LA 1PDNC 3N6LA 3DGPA 3H2LA 1UW4A 3RPQA 3AEDA 2RIJA 1N6QB 2LEHA 1U0JA 2VFVA 4QR2A 1HFEL 2MXYA 1KQ0A 1XERA 5LMNJ 3K70D 2BKOA 1DURA 4JI1T 5J2PB 4CM0A 3K10A 4HKAA 5H1SV 5GVQA 1W09A 1H9TA 3J7YJ 3AEAA 5IOZA 4FNHA 3NGRA 4P2MA 2WB5A 4UV9B 4M3DA 2HIYA 3G1LA 1SKRA 4NCGB 1BI0A 6AT1B 1GXPA 2HZCA 4COFA 2VFTA 5AJ3F 2DYSH 4QH1A 5GPAA 3G8QA 3OFGA 4IG3B 1Q1HA 1OY8A 4K4XA 3OS0A 3AQOA 1EB0A 2OAUA 3O6BB 3UU3A 2ELHA 2Y0SN 1N78A 2L4AA 2CJJA 3A1YG 4DHVA 2ZM6J 3QP6A 2IT0A 2B56A 2PMZD 2VQFJ 2HZTA 3PHEA 4WIQA 5BR8J 1AOYA 3KV5A 2DCUB 3M9NB 1TL3B 1P7IA 4PUSA 4P74A 2WV1A 5JTGA 4H4KC 3IR7B 2UUBF 1FX4A 3MDFA 1IGNA 2KLOA 2JQQA 4HWDA 5M5XJ 1HBXG 1VS3A 2CA9A 1S1VA 4C8KA 2UVRA 2IMWP 4L9JA 1AW0A 2EG1A 3JSYA 4MIAA 5LMNT 2XMKA 3AY0A 5EX3A 1IJFB 2LKGA 4B3RF 1F5BA 1FKOB 3UKGA 4ZHRA 3NNAA 3K0JA 2DNZA 2CPDA 1Y64B 5BYRA 1K8AT 1Y00A 5DM7Q 1JXVA 2WMNA 1U1LA 6FDRA 4KFBA 2ID6A 4DR3F 4NLRA 1S1UB 4NUBA 3SMZA 3HTUA 5B08A 3K57A 2HRUA 5LBQB 2F4VT 4KGKA 4CCMA 1N34J 2HQCA 3AFHA 2HOEA 2R9LA 1I94F 3N9UC 2KZGA 5CAAA 5T14A 5LP6E 5CA0E 2X0HA 3CJRB 3HDDA 1VFCA 2VG7A 4GDFA 5KT2A 4KUMA 3ZSTA 2FTRA 3TEHB 3P4RA 3ELKA 3NRXA 3L7UA 3M05A 1TNTA 2OA4A 1ZRDA 3PQJA 3IGVA 4X4UA 1TP4A 2UP1A 3KE2A 2HPUA 5JHFA 5KAKA 4G6DA 2LG4A 4WBNE 5CYMB 1S29A 1WC1A 1BR4A 1X5SA 1US7B 4CN6A 4HYKA 3FZKB 3P50A 1I6ZA 4Y2CA 4ZI2D 4HDGA 2C5IT 4NUUA 3A01B 3FIWA 4H4OA 1MIWA 3S93A 3C50A 4IE6A 4UF4A 1QVUA 2FNPA 3BQYA 1C1BB 4LFAF 5F8PA 4Q0BB 4ED7A 1IAWA 2CXFA 3NWRA 5JVGQ 1XEZA 2DNLA 2BOLA 2NZCA 2EHOA 2OPPA 1RAIB 4ZDLA 4Q5VA 4IFYB 2BHYA 2M1BA 1W1WE 2QGFB 2DR6A 2X6WA 1MBHA 2KYZA 3EMTA 2HR3A 4P75A 4PAAA 2MGZA 3PUAA 5E79C 1I50J 4BC7A 2XQ3A 2E8IA 2CUJA 2Q79A 1VRBA 1RT5A 1HWIA 4K4SA 4II3A 1W9RA 2AJ0A 3CQXC 3HKEE 1YRNA 2B1EA 1KC8T 2LH9A 2IBKA 4AIHA 2KMUA 1F9EB 5FY0A 5ICGA 4R25A 3PFIA 4RBVA 4GMKA 2B5JA 2UV8A 4CYCA 5DGAA 2CWEA 3US5A 2JK3A 1IJ6A 4RBOA 4DQQA 3D3BJ 2JZYA 4GK5E 3E5XA 5D4SA 2MW8A 3JAMK 2X9DA 2DXEA 2ZWPA 1B59A 3CJKA 5C2GA 1RWUA 4GCVA 1YG0A 1URNA 2X85A 2CRGA 3GTOJ 1DQ8A 1HMVB 1RKJA 4JI5F 2DY9A 1J5ET 2M9KA 4IQXA 2DT7B 3KCCA 1UAWA 3V6JA 2DK5A 1WI8A 1QDUB 1IRFA 3A03A 3EAMA 3ZTPA 1I27A 2HS4A 4F2SA 4DSEA 2GLOA 3TW7A 2LOOA 1PYOB 5D0GA 1S9EB 5DQHA 4V19X 3S4UA 4RJVA 2EFPA 2K9AA 3QZ7A 1WR0A 3KHRA 1HBMA 1WKJA 3DEEA 2AZ3A 3VAMA 2I6WA 2GM4A 2DW4A 2JLEA 3MCMA 2O66A 2LSYA 3BTLA 3C66A 1S6PB 3I0OA 5F3TA 2XASA 3TW6A 4KA4A 1X9MA 4ILLA 3OOPA 3UI3A 1RAEB 4RW9B 1B72A 2JRSA 1S7EA 5E3LA 4OIRF 2IXSA 4DV4T 4IT4A 2HAFA 4LF6F 4M63A 4C8ZA 5GAGJ 3SEQA 3JC6C 3AAIA 2BYCA 2VLAA 3AE1A 4C3JJ 4D0PA 4BC9A 4P2FA 2EFVA 1B3TA 3QT8A 4A0XA 3RJMB 5FXVA 2P6SA 2EFQA 1RWPB 2C6YA 2F1FA 1JLFB 1UFMA 1SJFA 2AIRB 3QSIA 4DQIA 3O2PE 2ZM2A 2HYJA 3O8WA 4EFAC 3CDWA 2EA2A 2GXGA 1O4XA 2J5AA 1IR0A 1U5TB 4U0YA 3L7WA 2HK2A 2OI2A 4Z6YA 4PG4A 5JVTA 4ELVA 3F41A 3H5NA 2EIJH 5I3UA 1RT3A 3MMBB 4QH4A 4XO0A 1S7AA 2OHDA 4U6PA 2CYYA 2IW5B 3BG6A 5HLHA 2K48A 3DU6A 1H98A 2LR8A 3BKUA 1L3VA 3K3NA 5D4LA 4UZBA 2E1OA 5LMUT 2J0WA 3QATA 3ZZUA 4IOBA 2QL9B 2DNNA 2I9SA 5IOYA 2JL9A 1O57A 3H59A 4MQVA 2ZJPQ 4J9KA 4K4VA 3TLTA 1NK0A 4ERDA 3SHFA 4CXYA 1VDHA 1P4XA 4A8SA 3RB0A 4WTOB 2NS7A 2NRAC 4MTDA 1NEKA 2XMVA 2HYIB 2OPSA 5AQJB 4I99C 1WC0A 2UXNB 3BB5A 4FYDA 3HD1A 4EB6E 1ZKEA 2KG1A 3OYFA 2CJQA 3ONLC 2W9BB 5LHGA 2X1CA 4EGZA 3C6UA 4CLPA 2H7OA 2LSOA 2CV2A 1FHTA 3A7MA 4NC7A 1FD2A 3VSLA 1PJRA 1HQEB 4FDFA 4MHGA 4ZPAA 2HTJA 5LSRA 1WG4A 4YFKF 3MMCA 3TYTA 3SDEA 2FJDB 3DF8A 5GPCA 5LHHB 3OHAA 4AWXB 2VC1A 2QVOA 1FTRA 4LFCJ 1U5PA 3DBHB 1R71A 3RF1A 2DL1A 3CMAI 2DGTA 3RYIE 3HSGA 3GW2A 1RU1A 4IRGA 2AEJA 3H0PA 1IG7A 2VKHA 1ZLJA 4O3OA 2A72A 4DV0T 4DR4T 3FHNA 3JREA 4TNVA 2K9LA 4Z2YA 4Z90A 4B9LA 3CX7B 4KIAA 3I56S 2AMCB 5LJ3Y 2FBWA 5C4XJ 4AXPA 3MFIA 2BW3A 2EILH 2CQGA 3IG1B 4RLEA 3OFFA 5E8GA 2VE8A 5J1EA 2WDRA 3A3NB 3I5UA 4GXOA 1RNLA 2EIMH 2VD3A 1HG2A 2EC0A 1B9NA 2O9LA 1FCAA 4JV2A 2XAGA 3DOKA 1D5YA 5DZ6A 3OW2R 3MPYA 1SL1A 2CQQA 2MTLA 2Z3YA 4IDZA 5HEHA 2M88A 1J7KA 1LVKA 3CDEA 2DPDA 3L7PA 3HHKA 3KK3B 3H36A 4IRCA 4XLCA 3W9IA 1HA8A 5KK1A 2QVAA 4QX7B 4TNOA 1NH3A 2DT6A 2C2EA 4BJNA 4R0EA 2ZWOA 4X4RA 1UWBA 1Q7LB 4IE5A 4ZP8A 1JJCB 2DMNA 1S1WA 1YXRA 4KIFA 2IJRA 2V9VA 5J1GA 4IEJA 3EQLF 2DNMA 2CBIA 2KYXA 4L5GA 2LEBA 4XZCA 2A07F 2E9XB 2JPBA 2JEGA 3UVJB 1ZTWA 2O3FA 3MPVA 5LGUB 3GFZA 1YW8A 1U2RA 3CTRA 1K73T 1U9NA 3PW2A 1WJFA 1QZEA 3F31A 2RA1A 4J9QA 4ZOLE 2XROA 1YJ9I 4ZPWR 2R42A 4DCOB 4NQWB 3FXKA 1XC9A 2E5JA 4DV1J 3QOPA 4RLQA 5L1LA 1R8IA 1U6FA 1FTZA 1BC6A 5KFOA 4OX8A 1DTQB 3CCMS 1FT9A 5ADXL 4JV5F 3QU6A 5E3AA 1NHVA 4B4CA 4NLTA 4ZH4F 1B8IA 2XMTA 4WXDA 4Q25A 5ERIA 2FOWA 1LXNA 3L8RA 3MD2A 2PG4A 3IA3A 4X62J 4K2EA 2LMIA 2DMTA 2V69A 3O44A 3OBVE 4O3NA 2Q9QC 1A9NB 1TL1A 3P49B 1X1CA 2OPQB 2QTWA 3NXZA 5CVVA 1YRTA 1UVNA 4BNCA 4IOAQ 4F55A 1ZHFA 5AE3A 5GMKa 3L2UA 2K3IA 4CLUA 3C3LA 2VG5A 2JA5J 2LP0A 2K3PA 3KG1A 3AXMA 5D77A 1UL3A 3NEUA 3M8SA 3NG8A 2LLZA 4WU3A 3OOUA 4WF2A 1BN5A 3H0GJ 5DJBA 1HQUB 1OCPA 1NHKL 1Q7YT 1DARA 3UWTA 4HFEA 4YFXF 1BA5A 4G2AA 3FK6A 4ZHQE 3JYTB 1A6IA 2K85A 2I8EA 3OTOT 5IS2A 1C0UA 3PFEA 1DP3A 4DZDA 3QSYB 3S1NJ 3BEGB 5LGNA 3PSIA 1N32T 2BEFA 5DJQC 1NKBA 3GFYA 2VONA 4DV1T 2VQHA 3FBIB 2XQ4A 2NR4A 5GAEI 3QYYA 2E1MB 1HNVB 4EGYA 1T94A 4YY3F 5C24B 1ODDA 3TZZA 3IR6B 1S0NA 3KDNA 2VIHA 4ED2A 5KG5A 4CICA 3ILJA 5ETKA 3AE3A 3H5XA 3PVXA 2XZTB 4RW8B 1Z6TA 4DUYJ 3FXRA 4LLGF 2MTQA 4QOTA 1MBFA 2WCXA 3F57A 2MLYA 1ZN2A 1U0HA 4EAHA 3FSYA 2WAQD 1ZK8A 2A3SA 3HRTA 1QAJA 1HKQA 3ZZTA 4Y6IA 1T98A 2AT1B 2WMOA 2M52A 3IAM2 3G2BA 5KDMC 2PE8A 3I32A 1IBKT 1DTTB 2WOMB 3MM8A 3FZVA 1AA1B 3SDGA 1WYBA 4EJUA 2DGUA 4ED1A 2P8TA 2DISA 3OBIA 3IAM9 1D8ZA 5AJ3J 5IUXA 1JLEA 3E6CC 3KLHA 4CNYA 3TLSA 1KF6A 5ABFB 1NCLA 4B3MF 1JXEA 2QKMB 2CJXB 2DGVA 2C2ZB 4P7TA 3W5YA 3AEBA 4P55A 3G71I 4LFBT 2ACMA 2AYBA 2RS8A 1KS2A 4UV8B 2YNFB 2KMFA 3OJUA 4MFEA 3CPZA 1YW0A 2CUEA 2OEKA 4UUXA 4X1EA 1VIOA 1FJCA 5HODA 2V8VA 1HBNA 3SZGA 3DHXA 1FYKA 2KJVA 5HDNA 3P5JA 2VWAA 4DUYT 4ZIVA 3UUNA 2IIHA 3OR1A 3HRUA 2UUBJ 4PW8A 1EH8A 3WAJA 1WR6A 3IR5B 5CXTA 4ZI7E 4PGHA 1WF2A 3ZXSA 1OXZA 4J9PA 5F9NA 1HNXF 2DR9A 4OZ2A 4B3RJ 1QTNB 3MGJA 4L5EA 4A93J 5F08A 1X3ZB 4C3KA 1WC4A 3L39A 2R4GA 4H9QC 1AZSB 1KOHA 4TY8A 3JSOA 2V63A 3S01A 5KFNA 3CK6A 3BO4A 1Y8QB 1RKWA 3FK7A 1OY9A 4MK7A 1HCRA 4IG0A 3OYIA 4LF8F 5L3BA 1FKAF 5KMGP 1MBJA 5AXNA 4L3NA 3MACA 5FJ4A 2Z30B 2Y69H 3R7NB 4B3TF 2BY2A 4XBFA 4HWFA 2L8KA 2MGQA 4AL6A 4OV6A 2E5ZA 3GA8A 2MPKA 1S6OA 5IM0A 3W2VA 4QWBA 3OSGA 2V94A 2UUBT 2HLTA 2PA3A 1ZM4A 4UF0A 3ZQHA 3RI5A 1VI7A 4X4QA 4QYRA 2XHWA 1T9TA 3ENWA 3GLLA 3D1NI 1GV5A 1GMUA 1FO1A 2N1GA 5ETNA 2HFZA 2VODA 3UW1A 2MQPA 2A18A 5H6RB 2IC3A 3VRAA 3MZ8A 1TK8A 3N4MA 2LNBA 5HQLA 3H9GA 4F2RA 3RYHE 1IZNB 4DR3T 1CULB 1BI3A 4JX5A 4MQ9F 2VFSA 3AEGA 3AA7B 4DCJB 1N52B 2CJBA 4XICA 1I94T 4ZLPA 2XQ7A 2W7AA 3H0DA 1ACMB 3MXHP 2HOTA 4EI2A 1FP1D 1DQAA 5EGYA 3MPDA 1B6AA 1GX5A 3J81U 1RUNA 3ZC0A 3VAJA 3DKDA 4I01A 4ZDPA 2DT5A 1YQAA 2VKDA 4ZS2A 3BV8A 5C2TA 1ZETA 1CJUB 4TU8A 2VVSA 3UE2A 4DFPA 5A6PA 3J9X1 2E2AA 5LD2C 1TFWA 1Q82T 4O2AE 4MFBA 2WAFA 3LP2B 4KQZA 2Z2SB 2EA4A 4RGSA 3IAS9 5T41A 4QW8A 1XG1A 1KLMA 1RK8A 2TCTA 1SD5A 3CX6B 3AJDA 3QPIA 1YX5A 1LNQA 1NZAA 1J5YA 4LFAT 2V8SV 2E5IA 4JBWF 2Y0BB 5BMZA 4N7TA 4CI2B 4CO3A 4JI5J 3RR7A 3L2WA 3VGSA 4FNIA 4KGVB 4NNJA 2BJ3A 3CUOA 4M73A 2FSWA 2M5WA 5ICFA 4PXCA 2W62A 4I6YA 2J8SA 1RZ4A 3KDSE 1FOWA 2XF5A 3F0CA 5ETSA 5HVHA 3MZYA 5JRCB 2FVQA 3CJQA 4AYBA 3IO1A 2C1EB 2DXDA 4BEHB 4ILAA 2CU7A 5C25A 1JLAA 1Y5LB 5KXJA 2CKWA 4XK4A 5HEJA 4PCQA 4ICLB 3CKDA 3PW7A 1SKSA 4LSLA 3K8VA 1SL0A 2GCFA 2XRNA 2Y8DA 5LJNA 3QYEA 1NG6A 1TWHJ 2OTLS 1KDNA 4DLGA 1WRDA 5D3GB 4A46A 4CO2A 3HTSB 4LIUA 2OD4A 3OUYA 3ZT7A 2MBGA 2HZVA 2G7UA 1T33A 4XSXF 1XIQA 2ZXWH 2IPQX 4C2MJ 3R5AA 1U2CA 4NLDA 2PQ8A 3BR3A 2IBOA 2RD5C 2IRUA 5ICEA 3S15J 1IO2A 4ES1A 2CPJA 2HPJA 1BC7C 1Z67A 5E41A 4F26A 4JX6A 4NZ0A 3H92A 3IEEA 4A5XA 2L7FP 1KU3A 4L9VA 3OIPA 3NGDA 3L3PA 2CAJA 1WRJA 3JAMU 4Y15A 1RAAB 2QMWA 1P2FA 4DPWA 2XZDB 2M7SA 4CQIA 1KU7A 4KYWA 4IDNA 3PIPF 5FDLB 4X4VA 1ZTRA 4WFZA 3I0RB 3EVMA 2GA1A 4EVIA 3V4GA 3S32A 4OMYA 3V5SA 3D66A 3NKYA 4FPIA 1J0RA 2VQCA 3HF5A 4LF6T 1FX2A 4GVLA 1RWKB 1RBOB 3SFIA 1AKHB 3HXMA 4KPYA 1DY3A 3O5TB 3DLGA 2MJUA 3KLFB 2XSJA 2M4KA 1SH0A 3LSMA 2V2ZA 4ER8A 3K4JA 1AHDP 2KVQE 2AGOA 1KOOA 3H3AA 4XKBA 2X9YA 3LQRA 2DTRA 4NWBA 4M9ZA 1X4BA 5D15A 4O3QA 1SC1B 3CCSI 4ESJA 1F4KA 4EEYA 1KBRA 3ENVA 5LRRA 1RWOB 1TTHB 1R4MB 3HYIA 3ZRGA 2BYVE 4IF4A 3BSCA 2DO0A 1DRZA 2CPHA 3DRRB 2LQ5A 2BHZA 3BCBA 4HQEA 1XSVA 3CX8B 4U7IA 4YOEA 1S1TA 1PP8F 2G9WA 4MMOA 2LDIA 3LSPA 3FEZA 3BGRA 1S10A 3OIOA 1OYEA 3T3FA 4L5IA 2WDVA 1X4AA 2ALZA 1JLQA 4BDYA 4EV6A 4JEUB 5FLXZ 3K7AJ 2I6HA 3J80Z 5ILUA 2JPFA 3ET6A 1CQMA 2KQRA 5E33A 3EJMA 2AJQA 3LBXA 3SFGA 4AUKA 3CC4S 2Z99A 2RNJA 2ZC2A 2JMKA 1QVFR 3F8MA 5ICCA 4U72A 1Q81T 2ZJRQ 1XDPA 3RPUA 1JT6A 4C90A 5L1IA 3SFEA 1C0TA 4TN2A 2J9CA 2ELKA 1XNQF 2VKEA 5LYJE 3K8WA 2EV6A 4XR6A 5KG3A 2L9SA 2ABYA 2VA2A 1R9TJ 3REOA 4P9UA 1RT2A 5B0AA 2DA7A 2QYOA 1GMWA 2X1AA 3IFEA 2K5BB 1FOYA 3RCOA 2VJ4A 4ED0A 3AH6A 2F9DA 2G2YA 4G6QA 1RE1B 3JTOA 1WH7A 3MAAB 1IKVA 3MMAB 4E7IA 5EK4A 2Q66A 4U96A 1RAHB 1UHWA 4LF7T 1OY6A 5HXCA 1FYLA 3OTBA 4IXAA 1SIWB 1PAUB 3A8IA 4XAKA 5ETPA 2IA2A 1K79A 4UT4A 4LD5A 4ZDOA 1R4NB 3SZPA 1S0VA 4ABZA 4KITB 4FBTA 4PQUB 1KKHA 1VBKA 4HF0A 5EN1A 2W2PP 1SVOA 5GADI 5FKNA 3QNUA 1NWMX 4X4NA 2AO9A 3FMQA 3PM1A 3D6HB 3LP0A 4AQFA 3MZKB 1TL5A 2WB1D 2V5CA 2V9WA 2HGNA 1N4LA 2COMA 2PMZA 2H48B 4YLHA 2J0QD 1A35A 3S2HJ 1FT8A 1R36A 4USIA 1U4BA 1HBUA 1VBYA 4MGRA 2XM3A 4KTQA 5G0RA 1PSDA 3DPUA 3MZIA 2GV1A 4JV5J 4DYRA 2FHJD 4MK8A 2VUGA 3PDNA 2BXYA 4F6RC 3L7OA 3MKWB 2I10A 1FEWA 1D9FA 1WORA 2F5VA 2CJKA 2VFUA 3CMAS 1V54H 1D09B 2KG0A 2BZBA 4ILUA 4J2CA 4FISA 3UUMA 3L00A 1S35A 1SB6A 1N33T 2ZB9A 1WSVA 8ATCB 3WQPA 1Z8UA 4PUOB 2DD8S 4HAMA 2DGXA 3KLIB 3M1VA 5IV3A 4IPAA 1VQ9I 4WP9A 2LC2A 4XKCA 4PG7A 3QQAA 1WJCA 3W8GA 3I4NJ 2P8IA 1ZKGA 4ZMMA 3M7GA 1C1CB 2G4BA 2E9RX 1L3KA 3PJWA 1BQMB 1WC6A 3ILIA 3D1QA 1YOVB 2B0GA 4NI2B 3BQ1A 4DR5F 2A3JA 4CZCA 3R5CA 3T1YF 1SJ1A 2CXEA 3FNNA 5AQMB 2CE7A 4TY9A 5LGTB 4PKDB 1TVRA 2D0UA 2GOMA 1T8EA 3KUGA 5EZGA 3ZZYA 3CUNA 2WTEA 4IKAA 1IKXB 2L2OA 4NMLA 1ON1A 4I2PA 4YMEA 2ZOFA 4F4KA 1CJTB 5DDOC 4AT1B 3RG6A 4M1KA 3K5MA 3MTKA 3N01A 2ILZA 1VQYA 3D67A 5MAOA 1OEDC 1V3ZA 3QO9B 2VT2A 3M2UB 2ZH9A 4W97A 3JQMA 3E51A 5L4HA 1ZRCA 4X65F 2QA4I 1RHQB 3BZ6A 2K86A 4UUWA 3AE6A 3GWHA 4BAYB 3JW4A 1BY9A 1NDPA 1H9GA 4E4HA 2Z5UA 4AKLA 1DP7P 1F9NA 1JKHB 4U8YA 2VKOA 2OV9A 1X4FA 2AW0A 4J00A 1YJ9S 4M6XA 2NW9A 3GN5B 2OP5A 2J47A 1ZA2B 4Q47A 1M7KA 4D7MA 1A0OB 5DD8A 2F63A 2QYGA 1IWGA 2P9CA 1ZV4X 1OJLA 4KMFA 1FNMA 1WFDA 2LYVA 1ZARA 1UETA 2FPHX 5IC6B 3HRMA 5IP9J 1WJ9A 3DOMB 4BHQA 1QE1A 2A10A 3TOAA 3KJVA 2C2KB 1FJGF 3IBPA 1F1ZA 4YY3T 3EGNA 3F6VA 2CWYA 5DM6Q 2E9ZA 1KFYA 3Q83A 2L02A 4FVMA 1G59A 2XGXA 4E7KA 4RW6B 1P1TA 2ODUA 3ISND 1JIHA 4ZDNA 1RC9A 5HP1A 4X66F 3M2VB 3LSHA 1R1UA 1LFUP 3X2QH 3M30B 4QR0A 3HFKA 1KNZA 3LP1A 1SANA 4C0HA 4F0MA 1RWXB 3PURA 4YHHF 3GJTB 2Y0SD 1HNXJ 2Q9QB 2M67A 1G7CB 4DU8A 2LM2A 4YTNA 4RUHA 4KKOA 2MQMA 4DL7A 1TT0A 3MD1A 1N0VC 4PABA 1QJHA 2YKMA 2YTCA 5JDMA 3AA0B 1KN6A 2OD5A 1SHZC 4CYUA 3PX6A 3Q5WA 3C64A 3ZEFB 3HC7A 5IWAT 4DR6F 4QPQA 3UUBA 2MQOA 1G4DA 3S6EA 5DCMB 2NTYA 2L5QA 4B3MT 3LPYA 1WTFA 4LF8J 1IR1A 2VVNA 4FVCA 5KG2A 2P0WA 3BQZA 3RDIA 3MECB 4RUBA 4DV7F 3AG1H 1UCNA 1R0CB 5F0UA 2F5GA 3JSMA 5CCLA 2XPVA 4NC8A 4K59A 1S77D 2F3JA 1WJ5A 1S8NA 2AJ4A 5KVRA 3HEFA 5DS9A 4OYIA 2BY3A 4GIWA 1S6LA 4YFSA 5K5RA 1X31C 2RHSB 2IAKA 2CHOA 1TU0B 2ZBIA 2HOSA 3Q8YA 4PEOA 3LFMA 4ETSA 1F36A 3VV2B 2LQBA 1E3OC 4ZJQA 3MAJA 2OV7A 1RPWA 2G2ZA 2W2MP 5GAHI 3DDKA 1RUSA 1HNXT 3K4MA 1ZOYA 1OYWA 1KVKA 4KMUX 4DPOA 3CUQB 4FBUA 2LKXA 3CD7A 3HFVA 1HF8A 3DLKA 2GAGC 2CHNA 1NH7A 1NSKL 4E0DA 5HQ8A 2LOPA 1GDTA 3IM8A 3NCQA 4EZ4A 1W7WA 2AHQA 1T95A 1AUSL 4A6EA 3PUQA 2YUSA 4M94A 2ME0A 3OYBA 4RMNA 4MNUA 4P73A 5CJ5A 4YB7A 1XX5A 2ACJA 3KJNB 4K0KJ 2IM1A 4LF8T 1BC8C 4DL0C 3MD3A 5FKOA 4ZVUB 3LSVA 4OV1A 3OFEA 2ZSIB 1KFSA 2OEJA 4B3TT 2HVEA 3BKFA 2DIUA 4DYQA 3K0LA 2IJFA 1FY7A 1IXCA 3CMLA 4OZJA 4A3CJ 4HRIA 3WC2A 3H4BA 5EYRA 1MSWD 3FXQA 4PK6A 2PEHA 2NVUB 3KK1B 2A68F 1CPZA 3IL2A 3TARA 3HT3A 1IBMF 3PACA 4ZCKA 4NEZA 4R1HA 5L46A 4RS8A 2BBEA 3MM7B 2R7OA 4EGLA 3T19A 1LQ9A 1YKWA 4XRFA 2ZC3A 4A8MP 1N5VA 2ESHA 1FJLA 3DYAB 4KFBB 4PSXA 1M1KT 1UX5A 3VHQA 1ZZNA 2MD0A 1G3YA 3JS9A 2A6HF 2B9YA 3R8YA 2R7DA 2AXTC 4ANJA 2Y9HA 2YKAA 4HDUA 4Y65A 1FWKA 2HS0A 4GC6A 5LCYA 1T0FA 1SE7A 4LIWA 4KP3C 4KUMB 2JLFA 4L0YB 1LWFB 2O6GE 4I2QA 2WY2A 3W7BA 1L3LA 1DU0A 1ZR2A 5HROB 1FRJA 3RKQA 2KT9A 5L3DB 1O5JA 2WM9A 4X1KE 2RUSA 3E01B 5BYSA 3MTJA 3K59A 1RADB 4A6DA 1S4FA 3CCJS 1G1XA 3CJ2A 3PUVF 2EPFA 2ZJQQ 1NRKA 4X84A 2JQKA 1K78A 2E71A 5JMNA 5K5QA 1U48A 1X1BA 3T1BA 2CNOB 2FQQB 4DR1F 2P5LC 3T9NA 4H4OB 4DZ6A 3EGZA 1Q8IA 3BPVA 3KP6A 4PDKA 3FZ2A 3B6BA 2VURA 3PEJA 1T7SA 4IHJE 3DXJF 3NZQA 1J75A 2DLRA 3PYFA 2NSCA 2VB6A 1S9GA 1G6BA 3I5AA 5AT1B 1JXSA 4UOCA 2RMLA 2OPPB 4FASD 4A98A 4TXSA 3HHLD 1S76D 4M1PA 2K1RA 2NXJA 1DZ5A 1V3SA 3D5LA 3GB0A 3QODA 3WTZA 3R97A 3ANWA 1Y0UA 1CJKB 1KA8A 1X0PA 2KM8B 4NASA 4RR5A 1LDDA 4LF5T 4OHWA 2FUPA 2ATCB 3D0TA 4XDCA 4BXFA 1ZRFA 4HX4A 1BHNA 3MM5B 3SXLA 3SJMA 1RT5B 3BN7A 3OLAA 1G4CA 2XQAA 4K8RA 5A6WA 4LJZF 3A4TA 3CTAA 1ZG3A 1OISA 2LRLA 1YRNB 1EETA 1VRUB 2HS5A 3DMJA 5A8KB 3B6AA 4K0UA 3G82B 4XK8C 2DJWA 1O51A 3DI6B 5C42B 2X1FA 4CLFA 2L01A 4KJZA 2B5JB 2V34A 2XQ6A 1NEEA 1I5OB 5HLFB 2DR8A 2BVLA 5I3PA 3W2WA 5B5EC 1NU4A 4PZJA 2MZJA 4A8OA 1WFXA 3Q0UA 4ECTA 2HYFA 4S04A 5ETQA 2HWTA 3R4KA 3BSOA 4DV6J 4AD9A 1VQ8I 2MSTA 1M5PC 3A0BC 3BP8A 2HQAA 4RNNA 3D2WA 2ZVIA 2PIIA 4I98B 2K3FA 5EJCA 2D1VA 1TAUA 4R8UA 1D0XA 4JYAF 4IFVB 1JUSA 5A2QY 2R8IA 2VPXB 1WI3A 3M32A 4XDDA 1XDSA 1RGVA 1WHYA 2JA2A 5CYQA 4B43A 3UD5A 3R2DJ 4HG2A 3G86A 2H4WB 3N5BA 2K2PA 1NDKA 3ENQA 3ILLA 1KQSR 3RBEA 3T8TA 1DLOA 1MD0A 4LF4T 3RB3A 1O6XA 5CVRA 1O3TA 5DLGA 4UVAB 2HQFA 5ETRA 1A31A 2PTFA 2YR2A 1T8IA 1FIAA 4ZS6A 3ZMUB 2XYGB 5FKKA 2QGSA 3KWMA 3IMQJ 1RTZA 1FJEB 1X79A 2X1BA 3OXLA 2WRMA 4F3OA 3WU2C 2HNZB 4JQFA 3K70C 3M3ZB 4UY8I 2QBYA 4WFYA 1TWGJ 1TUWA 2N7YA 4ZA1A 2BY0A 3IHUA 1ZA1B 3BCAA 5HMYA 2XIGA 3SQNA 4JYKA 3MN2A 2JWNA 3KXDA 4OYOA 3GFLA 3J7Z5 2R7ZJ 2I59A 4J9OA 3QWPA 4WJBA 3I31A 4MAKA 3BDPA 1FXRA 7FD1A 3JRDA 5FY1A 3BZQA 4GYIA 4MTPA 3HI2A 1S9FA 2WAQA 1S57A 1U1RA 3GX4X 1QLBA 2HEKA 4UEMA 4LSZB 2VPZB 1SKUB 4ZK7M 2MSSA 1HWLA 1SUQB 3DLHA 1SC7A 1IR2A 2XV4S 2KHCA 5GAEJ 4NB5A 1YHQI 3B13A 5D0EA 4WK1A 4DL2A 3WHBA 1TUVA 3NS6A 4CM2A 1W7PB 1RLCL 1NH8A 2KT3A 2EXUA 3V4IB 3GCWP 3WU0A 4B1RA 2EH3A 4YR0A 2CZ4A 4MFDA 3CCQI 1LV5A 2FZKB 9RUBA 2GO9A 5F6FA 3WTYC 4LG3A 3N28A 3CCSS 2UVWA 1PYVA 3TGNA 4OMZA 2Y1JA 2RNEA 3Q5FA 3MI7X 4HHJA 3D54A 1GUUA 1O3SA 2XNQA 4ZP9A 3C6UB 3SBMA 1XNQT 3AODA 1YW7A 4UVCB 2O1PA 2RRBA 4GKJF 5E1WA 4HDHA 2IHR1 2PI0A 3BF4A 3HFZB 3LPEA 2W7OA 3SDEB 3SCJE 1RACB 3RIRA 2W9CB 3M8PA 3QBCA 3JTPA 3EE3A 4LB5A 4MIMA 1WOOA 3TR5A 1UPPA 1LEBA 4RM3A 2UXDT 1HCIA 4J9NA 5J1NA 2J1DG 2AJ2A 3MPUB 1RTHA 5J2NB 5KFYA 2J9DE 4MKYA 5B0FA 1VQMS 1MN7A 4CT8A 1Z0XA 2HMIB 4K4UA 3I0SA 5J2MB 5KHDA 4R79A 3EGVA 3R5DA 1FJ7A 4BJ5C 1IUJA 2LQJA 3MCZA 4I6WA 3GV8B 3BN4A 3R60A 1Z3XA 2Y6XA 5L4EA 2HQ3A 4LF9J 1J27A 2KDZA 3HJEA 5FL1A 1TL8A 2MYFA 1MNEA 1YLFA 2LF8A 1GXTA 3VAGA 2F4IA 5E17F 3DOKB 1TC3C 2DFIA 4WF9Q 1TUGB 3L4BC 4B3SJ 3HGGA 1REPC 4A97A 5FJ8J 5C8YE 2HNDA 2AHOB 4Y17A 1F1BB 1W0AA 4RW7B 4LK0F 3VWBA 1Y3KA 4FF4A 2OMOA 2N3LA 4OYKA 1WGXA