3KFWX

Uncharacterized protein rv0674 from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
SLTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVALTRMVGAGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTDARTRAALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDEAPADLAGQLWDLSGWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDPMLPAELLPADWPGAGLRAAYHDFATAMAKRRDATQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncharacterized protein Rv0674 from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07848 PaaX PaaX-like protein
X PF08223 PaaX_C PaaX-like protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kfwX01
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kfwX03
3.30.70.2650 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kfwX02
4MQVA 2GQQA 3TGNA 4WWCA 1MKMA 3L09A 4RGUA 2XAGA 4CHUA 3LQQA 1A04A 2TDXA 4ZZDA 4U7DA 1HW5A 1R58A 2OZUA 2HEOA 3E97A 4LLNA 4Y17A 3I64A 3KE2A 4HX4A 3JAMZ 5ICFA 3JTGA 2K4JA 3K69A 1DUXC 2JT1A 4R1HA 5IT3A 2F5CA 3KETA 4L0ZB 2YX7A 1IUYA 2XAQA 4GGGA 3O2PE 2NAZA 3LA7A 2HQNA 3H3ZA 4XLNF 5K5RA 3TO9A 2HQRA 3V8JA 1FNNA 4ZYHA 2Z9OA 2KRFA 3R0JA 3V8KA 4XRFA 3L2CA 3HIFA 3VOEA 3E5XA 1AOYA 3WU0A 1ZRDA 1S8NA 5BMZA 2KIMA 3MFKA 2ZKZA 3ZMDA 2RC4A 2VC0A 2D2WA 1GHCA 2LSOA 2FOKA 1BC7C 4A5NA 4U0WA 1TW2A 1BI1A 4IRIA 3F6OA 1R23A 2UXNA 3F72A 5TRDA 1AWCA 4YG2F 1OYYA 1PP7U 3CTAA 2UZKA 4G7HF 4MTEA 2DPUA 2LF8A 2FSWA 3R6SA 5D4RA 1J2XA 1FY7A 1LQ1A 3TDUC 4LLGF 1QGPA 1JGSA 1QZYA 1ZH5A 1QBJA 3KEOA 5FLXZ 1J75A 3V7CA 3EETA 1U5TC 2PI0A 2H27A 3WTUC 4LLLA 1UHWA 2PFBA 2PMUA 3FM5A 4DNCA 3BZ6A 1I27A 4WF2A 2IW5A 4YIFA 5J8FA 3B02A 3BWGA 3V8LA 4I02A 1P4WA 2HOEA 4LK1F 2RVCA 4L5JA 3REOA 3J80Z 2DO7A 3T8RA 1FSEA 2L01A 3ECHA 3LA3A 1I5ZA 2CFXA 2KIUA 4OIRF 3IHUA 1XMKA 2YR2A 3L7WA 2W84A 4OOIA 3RKWA 1C0WA 3WTVC 4HF1A 5E17F 1J5YA 4EJVA 1F5TA 2VXZA 1MDMB 2O3FA 3W6JB 2OA4A 2XUBA 4P5OA 2L4MA 2QUFA 2O6GE 3BPXA 2FMLA 1USTA 2PLYA 3G3ZA 3L00A 3LAJA 2Y0MA 4Q4ZF 4KUMA 3P7NA 5LGNA 2CO5A 2O61A 5CYVA 1WI9A 2EV5A 5LEJA 2F5DA 1PDNC 3WTWC 2VBZA 1TLHB 1JHHA 1RIOH 3NRVA 3DF8A 3WE2A 5K5QA 3S2WA 1R22A 5LHGA 2XAJA 1B1BA 5D6FA 5D8KB 2EWNA 3IWZA 3D5LA 1EH7A 4RB2C 3WTTC 4A0XA 2VE8A 1O3TA 2WV0A 3MWMA 4IHSA 1ZN2A 3KZYA 4OMZA 4OIOF 1IN5A 1KGSA 3CJNA 1SFXA 4HDVA 4ZH4F 1WKMA 2O8XA 2L3DA 4MTDA 4M6XA 4G9YA 3P9IA 1S7AA 4HLXA 5ICCA 1P4XA 1T0FA 2FRHA 2QVOA 5HS9A 3E3VA 4IJAA 1IRFA 5JFRA 4RGSA 2M45A 1G3SA 3E5QA 5E20A 1U8RA 2ZNZA 2JTVA 1IW7F 4M73A 4CXFA 2NYXA 5AIPA 4ETSA 4ESJA 2K7LA 2J5OA 3LFKA 3FX3A 3HTSB 1R7JA 1S3JA 1RUOA 2Y75A 3N4MA 3FHZA 5ERIA 3KP7A 3J80K 1QQIA 1UHMA 4ESBA 5DUKA 1R1VA 1MJAA 1XSXA 2XASA 4XSZF 3T8TA 3RIRA 2NNNA 2CQKA 3JAMK 3KLNA 2EJRA 3KP2A 4LFUA 2HGCA 3K0LA 1BN5A 4M71A 3TDZC 2KIFA 2P5LC 2F5FA 3Q5FA 1FYLA 4IRHA 1Z9CA 1YW8A 5CLSA 1FBQA 4NQWA 3E6MA 2RKHA 1IF1A 1WSUA 1UFMA 2EA2A 1OYIA 1O57A 3Q9SA 5D5XB 1DP7P 3I54A 1D8KA 1BI2A 1U6GA 4FT8A 3JSOA 5FLXK 4HV6A 2A3SA 1YG2A 4I09A 3MAJA 1FBUA 2HR3A 1LB2A 1HQCA 4KNYA 3KFWX 4L5IA 3TO7A 2XVCA 1BM9A 3T0YA 4PZJA 1XGMA 3F21A 1S7OA 1TQMA 4H0EA 6PAXA 3NQOA 3GZ5A 1MZBA 1PUEE 2P4WA 2A6HF 2H09A 3G73A 1R1UA 3ZMZA 4WXCA 3HYIA 2P7VB 1FOKA 1BIAA 3EQLF 4MQ9F 3U9GA 3JW4A 4U7BA 2HKOA 2FNPA 1IAWA 2EFWA 3KLOA 5DEQA 2O03A 2ZFWA 4YFNF 1SD5A 3U1DA 4EQQA 1SMYF 4ENKA 2V79A 1LDJA 2XKPA 4BNCA 1SMTA 4L18B 1TNSA 3CDHA 3C7JA 2FQ3A 5LGTA 3VEPA 2BEOA 1KA8A 1OMIA 3KP3A 1L3LA 1DPRA 4R8HA 2FBIA 3IKTA 4S05A 3R4KA 4F7ZA 3GLXA 3C3WA 4D0PA 3ZP5A 1FBSA 5A2QK 3CO6C 1K79A 3TKYA 3VFZA 1XB4A 4WXHA 2V1DA 2Z3YA 1LNWA 4KIGA 4CYDA 4EGYA 5HLHA 1ZLKA 3ELKA 4R79A 5E1XA 3I58A 1RZ4A 1DDNA 4U0VA 4RGRA 4K2EA 2P8TA 3SXYA 1YIOA 3GYHX 4EJUA 3GFMA 1OYWA 5DCFA 4MEYF 4LJZF 3M8EA 4PGHA 2W85A 1WQ2A 2XGXA 2VC1A 2COMA 4MNUA 4GCVA 3WTSC 2C6YA 4JK1X 4ASNA 1B59A 1SFUA 2JPCA 2P7CB 2AXLA 1O7FA 2STWA 3C18A 5LRSA 1XN7A 3GEZA 3ERED 1HSJA 1FP2A 1Y0UA 4BHPA 1IN7A 3OOPA 3GZ6A 2GA2A 4MEXF 3SZTA 1BJAA 1Z05A 5JI6A 3ML6A 1KU3A 3W6KB 3KP4A 2IA1A 1R1TA 1ZGJA 2VBWA 1IZ1A 2MH2A 1BC8C 4GYIA 5CVIA 4P55A 4EGZA 5ILVA 1HKSA 2DK8A 3IRQA 4HAMA 4KN4X 1Z6RA 3J7AO 5H6RA 5BS6A 2A68F 3DFGA 1FPQA 2VONA 2ZNYA 2CG4A 1R5HA 1G6NA 3KP5A 2YU3A 1MJBA 5HDNA 1ODDA 1XSDA 1YW7A 1YW9A 5CVRA 3K1MA 3J81Z 1LDKB 1WWXA 2P5KA 2QQ9A 2YPRA 3O6BB 4IVNA 3T1BA 1J59A 2IA2A 2QBYB 4ENNA 2VBXA 4NB5A 1ZG5A 1O3SA 3FWEA 5E18F 1TTYA 1XCBA 3QU6A 2D45A 1HKTA 2DTRA 5L3CA 2GAUA 4OINF 3RYPA 2XRNA 1JHFA 2IPQX 1K7AA 4I2OA 2RGVA 4L9VA 3BDDA 4RAYA 4HX7A 1JXSA 5HLGA 3ISPA 3P9CA 3DP7A 3WGIA 2HYFA 2B0LA 4HA8A 1SFEA 2K02A 3QAHA 1K6OA 3TOAA 3ZQ7A 3F8CA 3EYYA 2E1NA 2K86A 3GXOA 2V6CA 2GZWA 2JSCA 2R7DA 2FA5A 1ONVA 2IRFG 1ZRCA 2UWMA 4I98B 1XDSA 3COAC 5BPIA 1CF7B 3GFJA 2ZJ2A 1FSHA 1U5TB 4M72A 2BV6A 4FX0A 2XAFA 4QWQA 2EV0A 2GXBA 5LHIA 2XV4S 2ZXJA 1ZRFA 5L3GA 1HSTA 4L9JA 3CO7C 4GYGA 2FBKA 3GWZA 2HFHA 3MEXA 1J7KA 3PFIA 2XIGA 4KFCA 3FMSA 2ESHA 4NHJA 3FM3A 1ZG1A 5FD6A 2X4HA 3I5UA 3RDIA 4CICA 5CVVA 1U78A 2PG4A 1HW2A 2M30A 4WX9A 1XD7A 4M9XA 2OAZA 1SD7A 2OQGA 2GWRA 1EH8A 3J81K 5HVQC 2A6EF 3I4PA 1I1GA 2Z99A 1YLFA 1E17A 1RNLA 3I53A 3O3KA 1J9IA 2R7FA 1Z1DA 1GXQA 2QZ8A 4Q5SF 1KYZA 4A6EA 5DD4A 4HV5A 4CDGA 1KQ9A 4N0BA 4UXNA 2STTA 4OIPF 1TBXA 4MHGA 1LEBA 3H3UA 1IRGA 2OQRA 3HRMA 4LB5A 3F22A 4WXDA 3R60A 3HOSA 4B8XA 1B4AA 1FZPB 3CUOA 3JTHA 2GA1A 1U5TA 4PDKA 3MZYA 5FB2A 2H6BA 4M74A 3WODF 4XBFA 1H9GA 4PGGA 4KA4A 1QO0D 1W5SA 4OU0A 1W5TA 3BPVA 4LK0F 2FXAA 4I0AA 2QQBA 1YS6A 2X0LA 1KYWA 2CYYA 3WGGA 4KIFA 2DAOA 4AIKA 1V3FA 2HDCA 2EFQA 2G7HA 3DKWA 4LB6B 2FE3A 2LNBA 2W57A 4EM2A 5ED4A 2NS0A 5LLQA 1XSVA 3GFIA 3IRRA 3QOPA 2KKOA 1W4MA 2J5PA 3M1EA 5EEGA 1O7LA 3HRTA 3HSFA 4A2UA 2Q2EA 5D5WB 2DPDA 3F8MA 5ILUA 3B73A 5AONA 2M1BA 1P4AA 4ZZLA 1Z6TA 2QWWA 3FXQA 2ELHA 1P92A 1UCRA 4O6JA 2V1UA 2HZTA 2G9WA 3IWFA 4IF4A 3QRFF 3E6DA 2R3SA 4OMYA 4Y15A 3KCCA 5DCMB 2XROA 3Q9VA 4UHTA 4UUVA 4ENMA 1Z7UA 3PQKA 2HTJA 2VODA 5HDKA 3BP8A 1W7PB 2MLGA 1U2WA 3F3XA 5LHHA 3I0TA 3IL2A 4G7OF 2H6CA 2DQRA 4HYEA 3ZMTA 2JZYA 2IP2A 1K78B 4KYWA 1ZG3A 5FO5A 2E7XA 2ISZA 4KN7X 2IT0A 5DV5A 3SHFA 4O5VA 1T2KA 4M9SA 2FBHA 3RPUA 5BOXA 5J6XA 1ZARA 3T5XA 3BJAA 3DPLC 3IC7A 1E2XA 1T6SA 3EUHA 1B9NA 3CUQA 1ZYRF 2VT2A 3HHGA 1T39A 5ICEA 1HXDA 3E5UA 3FF5A 5H6QA 2QBYA 4FX4A 4LMYA 1Z91A 2PEXA 5LEKA 2QYOA 4G94A 4ZYDA 3RYRA 2IA0A 1D5VA 1TQIA 3ROUA 3ZN0A 2ACJA 3D0SA 3N97A 1F1ZA 2O0YA 4CZZA 3KP6A 1W7PD 2OD5A 3H92A 3LSTA 3RPQA 3V4GA 2CW0F 3R0AA 1LJ9A 1EV7A 2GXGA 1LDDA 2YSRA 3IKVA 5H20A 3M8FA 5D5VB 2UXXA 2EFPA 2XKOA 4TV7A 1G3WA 3LA2A 1YTYA 3HOTA 3MZHA 3RJPA 3WTYC 4OIQF 1STZA 1ZLJA 2ZMEA 1S6LA 3CUQC 4HZFA 5HDGA 5K5OA 3QPHA 5JVTA 4ESFA 2EFNA 2D1VA 1FC3A 5LGUA 4Y13A 1IN4A 3K9TA 4M9ZA 2M87A 2P5VA 3BJ6A 3SFZA 1P2FA 3OV8A 4EMSA 2L02A 5HLIA 2A5YB 2XHKA 2F2EA 1YO5C 5CVUA 4RS8A 3E6BA 2PJPA 3VODA 1L0OC 4KIBA 3MQ0A 1XDUA 5D8LB 2VBYA 4YFKF 4YIIA 2Q8KA 5IT9Z 2EB7A 1GVJA 3HSEA 4ZYGA 2PMHA 1YYVA 2PQ8A 3QPTA 2K27A 4DQ2A 4A12A 1LEAA 1CGPA 2IJLA 1ZREA 2HKXA 2OBPA 4XSXF 4MGRA 2BBYA 1XCVA 2L4AA 1IN6A 3WTXC 1H9TA 3ECOA 5J8CA 1ULYA 2HTSA 3R61A 3HRUA 3M9AA 4L0YB 3GF2A 3F8FA 1BI3A 2VN2A 1G3TA 3BOQA 3QP6A 2F5EA 1YFHA 5L3EA 5F6FA 5E1WA 2VOOA 2PN6A 2EA4A 1PP8F 2KJCA 1KQ8A 1R36A 3CUQB 4BH9A 4UNOA 4N9HA 4U0YA 2ZBKA 1ZHFA 4EJTA 5K1YA 5L3FA 3WG9A 4HW0A 1KQ0A 4B09A 2LDUA 3HSRA 2DK5A 5EEHA 1DPUA 2NRAC 5HOOA 2YX4A 1ON1A 2CWEA 2EV6A 4ON0A 4I01A 5D6EA 3JSPA 5A2QZ 1QZZA 3QU3A 4EM1A 5FFXA 1QNTA 5BPDA 2DI3A 4BXUA 3ZN1A 2RDPA 4LGWA 1JE8A 2OZ6A 2ETHA 1BI0A 3K1NA 4N9IA 3ZPLA 5F64A 4GO1A 5JHUA 4S04A 4KDPA 4EV0A 2H94A 3SQNA 4HDUA 1MGTA 3DXJF 5HS8A 3MCZA 5TJJA 4AWXB 1QPMA 2MA3A 2GIVA 3TQNA 3I71A 4BQAA 4CGZA 3FXUA 2QQAA 5KK1A 5CVJA 1ON2A 4ENJA 2OU2A 2W25A 1P6RA 2FU4A 3GO5A 4BHCA 2AS5F 1B9MA 4HQEA 4RAZA 4G6QA 3P9KA 3GW2A 1USSA 1FX7A 1T38A 1W7PA 1V4RA 2PBIA 2MD5A 3HHHA 5DYMA 2ESNA 1MJ9A 4AIHA 1BOAA 5DCMA 1G3YA 2BYVE 2P6TA 3WGHA 2DW4A 2K4BA 3BY6A 2MBFA 1UB9A 4LG0A 1MD0A 4RGXA 5E8GA 3DV8A 2DT5A 4EM0B 4UVBA 3TOBA 2HWVA 4P9FA 3VB2A 1HKQA 5BQTA 1FP1D 2QENA 1X3UA 5F1RA 1I1SA 3WTZA 2FMYA 2JRTA 2VT3A 4UV9A 4HLYA 2V1XA 3DEUA 3BJOA 4BHBA 1Q1HA 2JPBA 2Q0OA 4LG0B 2G7UA 1O3QA 2V9VA 5LBQA 1U3EM 1I6XA 2ZO4A 1VTNC 1HW1A 1TQPA 2E7WA 2KJBA 3I59B 2FF4A 1G4DA 1F4KA 4RB0A 1EH6A 4KMUX 5L3DA 3HTUA 1XMAA 4HOBA 4U88A 3V7SA 5E1ZB 2A07F 1OPCA 3M7GA 4HF0A 3V7RA 4O3MA 5D5UB 4IXAA 4EVIA 4HBLA 4G8XA 2A69F 1IXRC 1FLIA 4HX8A 3K1PA 1S29A 2RN7A 2A61A 4L9TA 2M8EA 2BGCA 3LQRA 1YQAA 4Z2YA 2RV8A 2P6SA 2M5WA 2LF7A 4IRGA 1J0RA 2FEZA 2RNJA 3AAFA 1RI7A 4RB1A 4P9UA 4G7ZF 2FNAA 5DUIA 2LKPA 5DD8A 1ZGAA 4A0ZA 5FD5A 1D3YA 4A5MA 1F9NA 3RKYA 1H0MA 4PCQA 4IHTA 3EDPA 2QLZA 4EJOA 3KEQA 3ABUA 3ZMVA 1RUNA 3DPTA 3RTRA 4CO8A 1GXPA 5AIQA 3CLOA 2EFOA 1SAXA 1FYMA 4AD9A 2CGPA 5ILSA 4E70A 2BE5F 3PQJA 1K78A 1HBXG 1KU9A 4WK8F 2DFIA 1SD4A 3KZZA 2VOPA 2MLKA 4XLPF 1XGNA 4UV8A 2WTEA 5D4SA 4M6YA 2RQPA 4IPAA 3E6CC 3SZPA 1YS7A 3LWFA 2Y48A 1IN8A 4QLCU 3NEUA 5LRRA 2DQLA 2ISYA 5ICGA 4Q47A 2QM3A 5KVRA 2HYGD 1CF7A 1FYKA 1TNTA 3EYIA 2NNYA 1TW3A 4FHTA 3HUGA 2EK5A 4KMFA 5FFZA 2XAHA 4WCGA 3F8NA 4A0YA 1OR7A 4AIJA 2MC3A 3LAPA 3ABTA 2ADUA 2ZCWA 2Z33A 1R00A 3FMRA 4RB3C 3F23A 3GFLA 1FT9A 4JBAA 3WE3A 4HQMA 1NHAA 3RI4A 1T98A 1FWZA 2CSOA 1O3RA 3I59A 5FGMA 2E1CA 2DBBA 4G6DA 1OKRA 3F8BA 5CJ9A 1B6AA 1D8JA 4BYYA 2IVMA 3HRSA 1XGSA 5DDGA 2D1HA 4ZYEA 3GVAA 2WWYA 1IXSB 3FMQA 4A6DA 3C1DA 1BIBA 3L9FA 2MH9A 4YFXF 3ULQB 1XGOA 4KICA 4I7HA 2HS5A 4HF2A 3FXRA 4P96A 2W24A 5E8IA 3U2RA 5L3BA 3ZMUA 1REPC 3RKXA 3BROA 4AVPA 3TO6A 2WC2A 1KU2A 4KT5C 1IXCA 3GUDA 3FZVA 5HS7A 4LD5A 4Q48A 3WU1B 1BBYA 2DU9A 3GX4X 2ZMEB 1SD6A 3QP5A 4L9NA 5IT9K 1ZAOA 4JQFA 2VE9A 3DQVC 3K2ZA 1WRJA 4EJWA 5JR3A 2Z5UA 4UVAA 4I0BA 1MDMA 2L54A 4BAYA 4GXOA 3ZMSA 1KU7A 3F6VA 1LVAA 4UVCA 1R5GA 2DLLA
chains in the Genus database with same CATH superfamily
3JQKA 2DK2A 1CEZA 1B7TA 4L74A 3IAM2 3KJNB 4RGUA 4NE9C 5HNFA 2AYGA 3W15B 4C48A 3SQGB 4U7CA 4BA9A 3BGRA 1A04A 5ETOA 2TDXA 4XK8C 3C4XA 1JKQC 1VGYA 4FVMA 3RZAA 1ZM4A 2ZH5A 4JV1A 1J09A 1RGVA 3E97A 4HFBA 3KE2A 3PR5B 1I3OB 2NSCA 4NYPA 2LLZA 1DUXC 4C11A 2M5YA 1FJLA 2NW9A 3FRZA 2RJZA 5LOQA 3KETA 3TQ1A 2L9WA 2XAQA 2UU9J 4JV5J 1REVA 4RW4A 1XR7A 2WVEA 4R8UA 4RM2A 4DV1J 1YBUA 4ILRA 4XONA 4PR6A 5FY7A 4XLNF 4A97A 5FXZA 1UJ8A 1RKWA 1X4EA 3V8JA 4ZYHA 2V7MA 3RKGA 3HVAA 2MQPA 3R0JA 5FDLB 4ZLJA 5F9LA 4OI4A 1RHMB 2BJ3A 4LBPA 4L5GA 5KFFA 1AOYA 2GQ2A 1FO1A 3VAIA 4TYBA 1IO2A 1ZRDA 2KFNA 1N36J 4JBCA 4HSRA 4HFEA 5FIIA 5IT0A 5J2NB 2W0GA 2ZKZA 2KM8C 2RQKA 1JLGA 3AA6B 1HHSA 3FCVA 3LP1B 4JI4J 1GHCA 1XR6A 1HTJF 4KSEB 1R9TJ 5GPAA 1W7WA 1T9XA 3MEGA 4U0WA 1XWLA 5EG0B 1FK9A 3NS7B 1TW2A 2I2YA 4IRIA 4ERDA 2V6YA 3F6OA 3MUVP 1HF8A 5AQHB 2HYJA 2BR0A 2W4PA 5TRDA 4KAIA 3AE1A 3LK42 1PP7U 1CQTA 3CTAA 1WLXA 3CJRA 2RDJA 4G7HF 4P1WA 3EVOA 3SEZA 2DPUA 1SH0A 1W5CC 5LB7B 4NLWA 1LQ1A 3DLHA 1RHQB 4LLGF 2LKSA 2L7ZA 3UN5A 1QGPA 4C8NA 1NCLA 4ZP8A 1PGZA 5JRCA 2YNGB 4B3XA 4KFBA 3W9JA 1FTRA 5A1LA 1PVEA 1PJRA 2ZC4A 1HQUA 3QB5K 1HNVB 2PI0A 2H27A 4JI0F 3VGUA 4LLLA 1I6ZA 3F41A 3MMAB 3AECA 4NRTA 3IEEA 1MU2B 1I27A 1H7WA 1DAXA 2IW5A 1AU7A 2VXDA 3BWGA 5KG7A 2JJ9A 2CBJA 5LG3A 4LK1F 1H3DA 1M1KT 2RVCA 4CCMA 1WHWA 2DO7A 4ZVRB 4KGVB 1FSEA 2JPFA 4XNFA 4IIJE 2DL1A 3FZLB 2RQMA 2KIUA 4OIRF 1KF6A 2EHOC 1WHXA 3PSFA 5LGUB 5KNLA 1LKXA 2QE5A 5ETKA 4OOIA 4HF1A 2M6BA 1OSCA 4ECVA 1HA8A 2OEMA 3PNTA 3JSMA 2WU2A 1JKHB 2JVGA 4LF6T 1F5TA 4TYAA 4LQ9A 4K4VA 1MDMB 2O3FA 2AXDS 3GFYA 3W6JB 3RQUA 3QAUA 2KMUA 3FZMB 1VCSA 4JLEA 2UXCT 2CUEA 1MBKA 4FVCA 2CJKA 2LSYA 1USTA 1RT7A 2E2HJ 4WBOA 1HW8A 5JTGA 4KPYA 2XGCA 5HROA 2KXPB 3IGVA 2XS5A 4XKBA 3C19A 2H8RA 4Q4ZF 1YZ7A 2DXEA 1RT1A 3P7NA 1D1BA 1D1CA 1A6QA 3LW5C 4QBUA 3CCRS 2HAFA 1CVJA 3OYCA 2ELKA 3WTWC 2IAKA 5DLFA 4P9SA 5A8KB 3POTB 1TLHB 3L3PA 2HOSA 2EXUA 4Y65A 2FQQB 3GLLA 5JMNA 1VHIA 2RIJA 2DTJA 3N5LA 3ISNC 3ZQFA 5K5QA 4LMZA 1R22A 1X79A 3CMES 2W9AA 1R5ID 3PUBA 4LJMA 4EBCA 2C1EB 4FF1A 2CXEA 5KFLA 4BQQA 3VWBA 1Y8QB 2J47A 1ZOYA 2YDQA 3MWMA 4OMZA 1V9OA 2MKHA 4RUBA 3ZQIA 1SQEA 3JSRA 2W2UA 2O8XA 4XQFA 2I0XA 1HG5A 2EIKH 5HCMA 1P4XA 4IG3B 4OAYA 1WOSA 2CPDA 1HOMA 4I0UA 3OVSA 4LSNB 4M5DA 3MCMA 2CQ0A 2N2NA 3D6TB 4RNMA 2WHOA 1IRFA 2OUMA 5JFRA 1SH3A 4I4TE 2ZNZA 4A8WA 2XPWA 5E3AA 3JRHA 2R7ZJ 2K9SA 5AIPA 2YX1A 1GT8A 4RLEA 3I9V2 2AQ4A 1MBJA 2AJ4A 2DNOA 1QZEA 3OFFA 1R7JA 4WYLA 4N47A 1GK8A 1D8ZA 1TFYA 3FHZA 3QYEA 3UVJA 1IWGA 1I3QJ 3GILA 1BUXA 1SI9A 1RBLA 5JJBA 4X62F 1KFYA 2XCPA 2NW7A 2DKOB 2CQKA 4BBRJ 1EA3A 4J9UE 5AQRB 4DL6A 2B51A 3M2UA 5HEHA 3EYZA 1KR4A 2V7IA 4CCJA 2HBRB 4PQUA 4M71A 5K7HA 3CQGB 4WP8A 2BE9B 3NWTA 2I8EA 1HPZA 1WEXA 4ZVGA 2P5LC 2F5FA 3Q5FA 1FYLA 2BE2B 1YW8A 2M0GB 4B3RT 3UD5A 1HNWJ 1SUQA 2HQIA 4DUYT 3KOAA 3PYEA 3W3SA 4PWDB 3OBVE 1T3OA 1QD1A 1WSUA 1D5YA 5FL0A 3HHEA 4PG7A 4E7KA 4FQGA 3LFUA 3GJQB 4CNYA 1PYVA 3G06A 3PFEA 3N4WA 5AE2A 1U8BA 2HSEB 1HNZF 1JLQA 4ISTA 1D8KA 1BI2A 4HFIA 2LP0A 3WG7H 2CXLA 2ZLYA 2RT3A 2LCWA 2XEXA 1JXVA 4I09A 2FHOB 3QSYB 1LWXA 1HQCA 1X1CA 2ZUAA 2QA2A 4XM3A 1NHKL 3V6DA 1S1UA 2V2KA 3F73A 4DR5F 2K3IA 1XGMA 2ZXHA 3HLUA 4H0EA 3NBPA 4ECSA 1FJ7A 1K0TA 2Q9QB 4ZCIA 1T05A 1UW4A 3FBCA 2A6HF 1HDPA 3SCLE 3BG6A 2KXHA 2H09A 3AG4H 1RAHB 3L9ZA 3ZMZA 4B9NA 3AA8A 1RADB 3KUHA 1S1TB 3BKUA 1ZZFA 4YP3A 1CBKA 3NEKA 2CQIA 4DL4A 3CVRA 2XWYA 3UQSA 3D54A 1HBOB 1NJZA 1EIYB 3U9GA 2UUAF 4X4QA 1RAJA 4KE5A 1YJRA 4Q45A 3AAWB 1VISA 3DWLE 2KZMA 2O03A 2ZFWA 3RU0A 1ITYA 1R3NA 3N28A 4YHHJ 1ERDA 2Z0GA 1URNA 4EQQA 4ENKA 2V79A 4ZP6A 6FDRA 2OPSB 5EX3A 2XKPA 1SVMA 1SUQB 3IBFB 4OYWA 5M5WJ 1VQSA 4PJ0C 2XGQA 5C42A 3BSNA 1U2RA 2V8GA 2LK2A 2DR7A 5CD4H 1VLOA 3I9YA 3JS9A 3J80U 1VR6A 3K59A 3VEPA 4E0DA 5DG7A 3QUJA 2BEOA 3WHIA 2KG0A 3U1MA 2W9BA 3H5YA 1R6VA 2DFEA 1OQ6A 3UU4A 3N9QA 5LMUT 2V8PA 1KQFB 4YY3F 4S05A 2VDIA 1NM2A 3R4KA 3W2AA 3ZTPA 3ZQGA 2AD9A 1UELB 2IRUA 4EEBA 1POGA 3LOCA 3G96A 3NWIA 4D0PA 2MTQA 3CCSS 2E5NA 3VFZA 3OYLA 5F5WA 3H2VE 2ZJRF 2FD2A 2UV1A 5M3FJ 5KG1A 1M5HA 5FJ8J 2V1DA 2HS3A 3AB4B 5KT7A 2CW8A 2Q9QC 4O3OA 2QT7A 3DRYA 1HWUA 5M3MJ 4UVBB 4KH0B 5HLHA 2FIUA 1JQGA 3ZXSA 3MHYA 5A8RB 2UUCF 2C2NA 3J7AY 5E1XA 2PT0A 1N33F 2Q43A 3FBEA 2LSIA 4U0VA 5KHDA 2V8DA 4K2EA 2YH0A 2Y8YA 3BV8A 2YNGA 1OYWA 2ZVIA 4K5SA 3TJ9A 1T9TA 4OLOA 5LJ5Y 3UFEA 5DCFA 3NRYA 2N7YA 2KP6A 4PGHA 3MD2A 2JK3A 1A9NB 2MZSA 1ZETA 2G0UA 2AJ1A 2VL0A 1TVRA 1XMQT 1FDBA 4F50A 4BLGA 5DJQC 3VR1A 4ANEA 2VC1A 4MNUA 4UIGA 2AJFE 2C6YA 5J2MB 1UWAA 4C8ZA 5F8MA 3KG4A 1B59A 3SV4A 2MAWA 1WC1A 3M8YA 1SFUA 1SJFA 2QEXS 2AXLA 2LSJA 5D77A 1O7FA 4B3RF 2DCFA 5F8PA 3KMSA 2WZ1A 3K5NA 3VKGA 2LVWA 1IZNB 4GMKA 5B0BA 2QA4S 4UUTA 3PACA 3LSVA 2RRAA 3OYHA 3GEZA 4DPYA 4YJ3E 3L3CA 2POKA 2JJ4D 5FJ4A 3QJLA 2KVQE 1L3UA 3NGSA 1Y3KA 5EDWA 5HJYA 1ZS6A 5AXLA 2Z30B 3D4JA 2HG4A 1IN7A 3OOPA 5DRKA 1HMVA 2PGCA 2GA2A 3M8PB 3OMYA 1FKPB 1PO6A 5GPCA 2DXDA 3SWHA 3SZTA 2DOAA 1KTVA 2HFNA 2UU9T 4DZ6A 4USHA 3ML6A 5EZHA 2UVVA 3K4LA 2JHEA 1KU3A 4GKKT 2RU3A 3KP4A 1S97A 1YJWS 1MMNA 1ZHCA 2L3LA 1R1TA 5CZVA 2LSGA 2VPXB 1BC8C 3H9JA 1IR1A 1FOWA 4K2JA 2FLPA 3MM7B 3OYFA 4LR7A 3RW7A 5ILVA 3EE3A 2VKDA 4ZDNA 2WAQN 4EATA 3CJTA 1Z6RA 3MPWA 1REGX 2A68F 3CIRA 1RAFB 3DFGA 5GVQA 3ZYKA 4F4ZA 1R5HA 2ALYB 3GCMA 4RBVA 3BG7A 3MK7C 3ZCIA 5B0AA 4W98A 1UMJA 1V5IB 2V2QA 2NP9A 1ODDA 3BREA 3MCOA 1XSDA 3QIPA 1SUMB 3BKFA 2IFXA 1FNOA 3A4CA 3TI0A 3J81Z 4G63A 5ETVA 3R5AA 2PJRA 3IP4B 3M8RA 4NRUA 2OH2A 1UG0A 3VYTB 2MZTA 3KV5A 1S6PB 2YPRA 2XQYA 1KTQA 2QMXA 4ED1A 3CIMA 5DS7A 2IA2A 4FF2A 2JMHA 4IUFA 4A3LJ 3FWEA 4DR6T 2MKSA 2XQ5A 1HKTA 4OHWA 1U5PA 5DM7Q 2VFUA 2BM0A 2DTRA 4DIDB 4E2FB 3AT1B 1P27B 5CYQA 2YQ1A 4BEHA 3GYGA 3BYRA 3RYPA 1Z67A 2Y31A 1JHFA 2IPQX 1K7AA 2HHWA 4CLTA 5LA6E 2X85A 4KIAA 3ZZPA 2YOEA 5BNGA 4C0BA 2CBIA 1J5WA 2M2BA 4ZZCA 3GCXP 2AGOA 4KHPT 4JI0J 4GKJT 3WGIA 2HYFA 2U2FA 3I6PA 1E2AA 3TOAA 3N5FA 1TL5A 4RO0A 3F8CA 2IS2A 3EYYA 2E1NA 2K86A 4X6AJ 3Q8QB 2GZWA 5D6GA 2BQRA 2FA5A 2YPZA 1ZKGA 3G71I 5ABEA 3ITHA 3V81B 3UUNA 5GAHJ 2WVDA 4JI7T 4U67Q 1XDSA 2QGSA 4URQU 3ESLA 2YTCA 3BT9A 1FWPA 3I1AA 3AD7C 2MZJA 2YKAA 2CPHA 3A1YA 4IX7A 4LOCA 1YGYA 3MAQA 3GFJA 3T6BA 3A8KA 1SIWB 4RPFA 3G6VA 2M0CA 1ZA1B 3Q8PB 3D7SB 3SV3A 1QAYA 2RDIA 2WA0A 1U5TB 1TVRB 2L9DA 1RWPB 2BV6A 2KMFA 2DY9A 5KFIA 4X62T 1LV5A 4NWBA 5LHIA 2XV4S 3CCQS 3ULHA 1QAIA 3LA0A 5L3GA 4N76A 4EEFG 1R8IA 4Q8FA 4ZVPB 4L9JA 4L3KA 3CO7C 3PUAA 3GWZA 2WDVA 2IBKA 3HXLA 5T41A 4OZ0A 5IWAJ 4O3PA 2DYSH 5B0EA 1X1PA 5AQTB 1IDZA 1T3NA 3GIMA 1QM9A 3ZC4A 1VBZA 5J3LA 2F6CA 2ESHA 3OW2R 1MBGA 4NHJA 3OYKA 3B78A 3K8PC 5FD6A 2X4HA 3NVOA 4F2RA 3HM5A 5J40A 1V3ZA 1RLDA 1TAQA 5K8MA 3MR3A 1U78A 5HVGA 3C14B 4M9XA 3N2OA 1SD7A 1Y11A 3JAFA 5T7LA 5AE3A 1YKWA 1KP6A 4D7MA 1H7CA 2VG6B 1YLFA 1MW7A 1RNLA 1IAPA 4X4UA 3M30B 4IG0A 2WY2A 2OD6A 4LF9F 3OPKA 2LT3A 2QZ8A 4FETA 3UKGA 2HQ5A 3HKCE 3OLBA 1KYZA 2K9QA 4MLOA 4F8HA 5DD4A 4HV5A 1Q78A 1XPXA 1CULA 2BKPA 4UXNA 4QXHB 2O5RA 3DCFA 3TAPA 1ZOTA 3NNAA 1LE8A 1HNWT 4B3RJ 3L39A 2GLOA 2FVQA 1HQUB 1LEBA 3H3UA 3MECB 2B7BB 2XS7A 2M88A 3LP2B 2OQRA 3HRMA 3F22A 3KK2B 1YKEB 3IG1B 2UXDF 3LSGA 2ALZA 2OPQA 2W2OP 2DH8A 1D0EA 4C6AA 3CUOA 3SFUA 4CN6A 3ANWB 2KLOA 2DNPA 2MQLA 5KOWA 3JTHA 3FEXB 2BY2A 4HHHA 4PDKA 4U31A 2KJWA 2H6BA 3FEZA 2JX2A 3CMEI 5ABFB 3R5JB 4Y34A 3RH3A 4DLEA 4JI6J 2QYWA 5ETNA 4XIUA 2W67A 1DY3A 4C9YA 2CQ1A 3PNIA 4PGGA 4J00A 2F3JA 4OZ1A 5L3DB 2NOJB 1KNRA 2JL9A 2BW3B 1BQXA 1XMBA 3BPVA 3HMJG 1VRBA 2FXAA 2XQ9A 4EI2A 4Z8XA 1A7GE 4CYUA 3GA8A 1E6YA 3GR0A 4H9SE 1KYWA 1TL1A 3QLHA 4JI5F 4DU8A 4CXXA 2E1RA 3ZZRA 2FPHX 2MLXA 2G0IA 5DDPC 2X67A 2KWHA 3RB0A 3KMQA 1V3FA 4O0IA 3RB3A 1DU0A 3IRWP 1SFOJ 2LNBA 2W57A 4EM2A 3DBHB 1JLFA 3IRRA 3FK4A 2LVSA 2C3YA 3QOPA 5C25A 3MMCB 1UFLA 2KKOA 2J5PA 1KVKA 4GO5X 2EWHA 2G4BA 4CYCA 4Q25A 2VI6A 2NS8A 4CM2A 4A2UA 4OHXA 1GTHA 1IBMF 3PHTA 2DPDA 4DR3J 2L9RA 2MQQA 3BG5A 3I56S 1NBEB 2X66A 2QQ8A 2QWWA 5CGMA 3D6MB 1UCRA 2G9WA 1U45A 2EH3A 4IF4A 3QRFF 4DN0A 3E6DA 4OMYA 4YHHF 2JFDA 5KT5A 1S4FA 2K9AA 1XNRT 5DG9A 3QB5A 4FE7A 1TQLA 2HQFA 2RE1A 4AQFC 2GVDB 2GIFA 2DWGA 3W2VA 5KX5E 1Z7UA 3GFHA 4LFAJ 4JI1J 3CDEA 1WELA 3ZZZA 1U0HB 2E5LF 4I2PA 2Y9YA 3VRAA 2NOXA 1YQHA 3HZJA 1U2WA 1TKXB 4DV0F 2WVCA 2OSQA 5H9EJ 2ZHOA 2HQDA 5LHHA 2OLTA 4BE1A 1VRQC 3MZIA 3KNAA 2V68A 3OWTA 3UVJB 4AYBN 1WH5A 4HYEA 2L7KA 5J1UA 2PMZD 1KKHA 4LFAT 2IP2A 2HPIA 4NDLA 5DZ7A 4TUYE 1B0TA 5HLFA 4V1Av 4NEYA 1WYBA 4KY3A 2QV6A 1FFWB 4K4UA 4FI5A 4MIBA 2ZOGA 2LR8A 2KN4A 1C0TB 4DF4A 2LREA 1S1WA 1T2KA 2MTLA 2XZDB 4LUBA 2FJWA 5GAGJ 2HQ3A 4WZMA 5BOXA 2X6OA 1HNIB 2ZUGA 3QGGA 1LWFA 2XM1A 3ERMA 1T6SA 2ID3A 2JRMA 2ZMEC 3OIQA 4NPPA 4Y3CA 2D9DA 3CUQA 3F44A 1ZYRF 1PYSB 2VG5A 3KPHA 3HHGA 1T39A 2PDAA 4K0KT 4I4BA 1CJVA 4TXSA 1VQLS 3ILIA 3JSYA 1ZZNA 2QBYA 3QGIA 3C6UB 3OL9A 3S01A 3A8JA 3DDNA 2DISA 3DNCA 2BY3A 3WX4A 1GX6A 1Y5IB 1D9DA 1VQ7S 2DPIA 2IA0A 1D5VA 1M5SA 4MK8A 2AX1A 2ACXA 4CCKA 1TQIA 3ROUA 2IRYA 3V6DB 4JV0A 3PHEA 1LWFB 3M8WA 4JI8F 1S6UA 2YNHB 5F41A 3FC9A 1WF0A 4RZRA 4O44A 3FDSA 3DTOA 2LJLA 1YJWI 3LSTA 7FD1A 3VVTA 1WHVA 1Q5YA 2XPVA 4WP3A 1LJ9A 2ZFUA 1LDDA 3J7YU 1T9WA 3OD2A 1ZAWA 1TUWA 1W2BR 1QVGR 3HVTB 4PG4A 1I94T 1SJ3P 2UXCJ 1MIYA 1U8WA 1WKKA 3WTYC 3LSJA 2FJEA 1DQ9A 4ZDOA 4NLVA 1N34T 3PW5A 1FI4A 1OMSA 3JQMA 4DQQA 3C66A 2B4UA 2FHKA 1J1JA 3GPAA 3TUJC 4NLOA 3OYGA 2ZJQQ 3QPHA 3F0CA 2RHQB 4ESFA 1HI1A 2ZJRQ 2E9ZA 2UUZA 5LGUA 4Y13A 2ZSIB 2G2OA 3M9OB 1NJYA 4OX9J 3K9TA 3CD6S 4M9ZA 4DL5A 3BJ6A 2A6TA 1P2FA 2P9GA 5I42B 1XMOF 2A5YB 2XHKA 2F2EA 4HN9A 5IUXA 1YO5C 4LVNP 2HS0A 5CVUA 3CCTA 2ZJPQ 4ED6A 1TL8A 3E6BA 3VODA 1P9QC 1YX5A 4NX9A 2BOLA 1A6IA 4YIIA 2OP5A 4QPTA 1Y00A 2ERRA 2X3GA 1T9VA 4ZYGA 2BZBA 3DTIA 1DLOB 3RF1A 3DGPA 2PMHA 2A2CA 4IOCQ 3TA2A 4WIQA 4DG1B 3MPUB 1TMJA 4X4OA 1A5JA 1YRNB 3R5CA 1WJ5A 1CGPA 1U7LA 4MYUA 2DJIA 3ZT5A 3AE3A 1ZREA 2OBPA 1YX3A 5C25B 3MWBA 2LYVA 1N0VC 1O5JA 3LMMA 4B1RA 1ZKEA 5EWEA 1C4CA 3A2KA 3HPOA 2CPTA 3BQ0A 2E36A 3R61A 5H2FC 3TWZA 4CO0A 5F8JA 4L0YB 3GF2A 1KLMA 2RQCA 4QR0A 3BR0A 3CJQB 2HOTA 1H2VZ 1BI3A 3QP6A 4N5SA 2HIQA 4TWHA 1UCUA 2RA1A 2EA4A 4DBQA 5KFYA 1GXLA 3KUGA 1YRXA 4X20E 3LL7A 1JLGB 2CW7A 1R36A 4O4JE 3BSCA 3CUQB 4EEDA 4BH9A 2DOFA 2B63J 2CCQA 3L2RA 1VFJA 1YIJS 1Q86T 2XAGB 3TKLB 3CJSA 4H4OA 3ZC1A 4LREA 3CTRA 4B3SJ 3WG9A 5L3FA 3HI9A 2FJBB 2AYEA 4LF4J 2XY8B 2JC1A 4DQPA 5EEHA 2DK5A 1XN9A 4CCOA 2NRAC 4BHQA 2CWEA 3HD2A 1I5OB 5ETWA 5HI7A 2R5ZB 1CJTB 4EXTA 1R7IA 1YG0A 3ZMSB 4ZJLA 2ZH3A 2Z56B 4HPQA 3ZMVB 1SHZC 3G4SI 2ZH4A 4IT4A 4QYRA 4DV1T 4OHYA 2P2CB 5BPDA 3PFOA 2DI3A 3F31A 4A46A 4BXUA 3ZN1A 1S72I 4NZ7A 5B08A 5AXMA 1OQ3A 1T7SA 4BQOA 3R5DA 3JTOA 1IR2A 3SSSA 5M5XJ 2TCTA 2Y1LB 3PYFA 2CWXA 1C0UB 5HNHA 1MGTA 1NSKL 3MCZA 1XIQA 4UF0B 3W63A 4AWXB 3R5GA 5G4DA 2MA3A 2GIQA 2N3LA 2MZ1A 2XS2A 3TQNA 1F5AA 2PFDA 5JVHQ 1L5UA 3QC9A 5D4PA 3G82B 3I71A 1X5OA 4GDFA 4O4HE 4ZA1A 4QPOA 3A3PB 3O9XA 4F4XA 5CVJA 4MYTA 1P6RA 2KYZA 3GO5A 4OYXA 2FLLA 5IP7J 4BHCA 4EBEA 2KT0A 2BMBA 2Z1DA 4AKHA 4TV9E 4YRVA 1DU2A 4MFDA 2X3DA 2D0UA 3CDIA 1VQNI 3K4BA 4NA1A 2R7WA 5EF6A 1TR0A 2KO1A 2PBIA 3HHHA 3RRHA 3EZOA 3SQOP 1XJWB 4F7VA 1G3YA 2Y0SA 1UZCA 1RUSA 5L3GB 4KFBB 2P6TA 3T41A 1G73A 2CNKB 2DNLA 4KKOA 3J81Y 2E1PA 2MPKA 4HNTA 3EUHC 1N48A 3EXYA 4YR3A 1R8BA 3SJMA 3JCUC 2F5VA 5A8WA 4RGXA 1PBAA 2DFHA 3QLHB 1VIOA 3TEHB 3GFXA 4QOTA 4CO3A 2HWVA 2M0MA 4P9FA 1VK3A 2V6YB 3SXLA 1HWJA 2LMIA 2K85A 2DR6A 2BV3A 4C7QA 4I7FA 2A72A 4X4PA 1HR0J 3OYBA 1FKOB 4TY9A 1I1SA 1K1QA 1OR7C 3WTZA 4ZPCA 5D0HA 2JRTA 2XHEB 4EZHA 3NKYA 1WPKA 3A3OB 4AI6A 3OTOJ 3CJ0A 2VASA 2OFGX 4CSWA 1IG7A 1BY9A 3VAHA 1Q1HA 1B0VA 2IDEA 5C4XJ 2EFVA 5JR9B 1YJ7A 4ZVEA 2BJ8A 1VTNC 2UUTA 1TQPA 4XLFA 1FJGJ 1QLBA 4JI3T 4CYUB 3BSOA 3L95X 2VKRA 3QBCA 1E7PA 5IS2A 3TP3A 2X0YA 2YNIB 4C91A 1G4DA 4P2FA 4B47A 4KMUX 2XSBA 3HTUA 2FC8A 1M5OC 4YOEA 1L3TA 4YB1P 3SMZA 3WIUA 4P52A 2DOEA 1WCRA 5F0UA 4O3MA 3J81j 4YB7A 4GFBA 1T08B 2OFHX 2ZM0A 5K14B 3W3CA 1C1BB 4DMWA 1SKWA 5KFGA 4CO2A 4H4MB 5LJNA 4FE4A 3BPDA 4IQMA 2O3DA 4MKBA 4ZVUB 4CO4A 2V0NA 1S0VA 3BQYA 5K5MA 4M3GA 3A8IA 2RN7A 1TP4A 3MECA 3U78A 4BXFA 3GG1A 3GIJA 4Y28C 5F04A 4DR5T 1YK9A 2BGCA 2NVXJ 3LQRA 2BA9A 2P6SA 3T1YF 4IFYA 2LF7A 2DT6A 2BYCA 3FK7A 2UUAJ 2EVZA 1N6QB 2LEPA 1WDDA 3MM8A 3B4MA 3OTCA 3NAIA 4IE5A 2YPYA 2KXNB 4ES3A 2GK9A 3AL0B 4HTJA 2OI2A 3GYNA 4RB1A 3MMBA 2BG9B 4AVZA 1WHUA 5LSOA 3WU2C 5EWFA 3Q86A 2FDNA 2IAIA 1Y4ZB 1HNVA 4IHVA 3DRSA 5FD5A 2CEAA 2JSXA 4IKFA 3C98B 1F9NA 5JRCB 2HHVA 3QZ8A 3WAJA 3ZQCA 2EPFA 1H0MA 4CI2B 3R1HA 1AT1B 2I9SA 1OWXA 1XX5A 2QLZA 3P8CD 2DCEA 3HULA 3KEQA 2DR5A 3NWGA 2LH9A 3SZ2A 4JI1T 4PK6A 2ZM6J 5L46A 3FZ2A 4H4KA 4G6VB 1SVOA 1H74A 4DJBA 1UEUA 5GAEI 3BG9A 2CNLB 4E70A 3AG3H 1X4DA 4NQWB 2F65A 2DFIA 2X48A 2KFZA 1X4PA 1Z8UA 3V4IB 4XLPF 2NXUA 3LG7A 3GU0A 3TQEA 1S48A 2D9PA 2IM1A 2RQPA 3ITHB 3V81A 3LF0A 1XK8A 2XQ6A 3A8EA 2UXDJ 5IY5H 3PSIA 2KJVA 4ID5A 3EGWB 2CPXA 2V69A 2ZMAA 1FE4A 1YS7A 2O1PA 1EX8A 4QLCU 4TVAB 4IQJA 4GOUA 1S1VA 4Q2MA 4BWMA 2V9PA 5A2QY 4OWRB 4ZVFA 4IDKA 1FERA 3DBRB 4OJHA 4I67A 2MJNA 1XERA 4FHTA 3QT5A 2YN6A 2HNYA 4OI1A 4Q0BA 1RR7A 2CS3A 3W9HA 4PABA 4A4JA 1N34J 1MBEA 1R8AA 2XQ8A 5LYJE 1U1RA 3F8NA 3UCGA 1KHWA 2J6UA 2ZHBA 1PAEX 2CUJA 3LAPA 4COFA 1UAWA 1Y0HA 2DHGA 3FCWA 2GQCA 2M4GA 4H4KC 1HHTP 1FT9A 4JBAA 2RUGA 2M67A 2MLYA 4U6PA 1FWZA 1I6HJ 3W8GA 5J1EB 1U1NA 1RB0A 2E60A 1T56A 4DUTA 3OR1C 2D5UA 4WNKA 1Z1ZA 1M5VC 3CWZB 4TWDA 3GTOJ 2IVMA 3C50A 1NB7A 2D1HA 2MOZA 1LWEB 3CCEI 3OT9A 5D0GA 3TLWA 2KLQA 2QGUA 5JR9C 3C8YA 4DV5J 1MROB 2XMAA 4YFXF 1VF9A 2V5DA 4L75A 2WZHA 2W7NA 4DI6A 1RTZA 2VF3A 4I7HA 1U4BA 1CG2A 3LSRA 4D3GA 3CCES 2WVBA 3CJTB 3CCYA 4P96A 2W24A 5J4YA 2Y69H 1PC5A 4CLZA 1NK6A 1WG4A 3CJ3A 2L9SA 2JEFA 3G87A 1KC8T 1WR0A 4GK0E 2CQ3A 2FTRA 5KFNA 3KEYA 4AL6A 2OV9A 4LF7J 2ZBPA 2JVOA 1REPC 3SS1A 5E3NA 2Y8DA 1NK3P 5BYSA 4KT5C 5FKKA 1IXCA 5L8RC 4NI2A 1TL7A 4PJNA 3GUDA 2JQHA 3QWLA 3HGYA 2CQXA 1BE4A 1H73A 4PAGA 2BHZA 5C4JJ 3AE7A 3HO1A 4Q48A 2CKWA 2FD5A 4KUMB 1G7CB 2B9YA 4DQSA 2F8MA 1UJ5A 4MTPA 1U1OA 1ZAOA 2M3AA 2R8HA 1VBXA 3K2ZA 3E0ZA 1VJQA 1WNEA 5LMNT 3G8TA 5KFUA 1X1AA 4MHCA 5CH7B 1J27A 4KT6A 1TP7A 3IC1A 3ZJ1A 2Z5UA 3BYPA 4U7IA 4I0BA 3N6MA 4DNDA 3PDYA 1JJ8C 3M3ZB 4CQ1A 1DBDA 1V55H 2L54A 3AEGA 2FHMA 4DX5A 4X2BA 1KU7A 3S16J 2X9WA 3CT9A 4OX7A 4O4RA 1V3RA 4AFFA 4DN9A 3W65A 3GTGJ 4KO0A 3DLGB 2JNJA 3SBMA 2KHMA 4UVCA 3H3AA 3IFEA 2HBQB 1R5GA 1YJVA 2ZHAA 2OMLA 4HGAA 4B48A 3J7A1 3I3LA 4OLPA 4MQVA 4FPIA 2VUMJ 4WWCA 2XAGA 4ECUA 4GKJJ 3UI3A 4ZZDA 1X3ZB 1UVLA 1HW5A 1R58A 2DXIA 2M4MA 3BTCA 2J7KA 4PXBA 3GWHA 2CWKA 4Y00A 4LLNA 2RDDA 3I64A 3FHNA 4ZIWA 4C8KA 3R1LA 3PRBA 1YI2S 4U3CA 5E3QA 2CPFA 2WOMA 1BR4A 2JT1A 1WFDA 3BKTA 2G13A 3KJFB 2AE9A 5KFSA 1IJ6A 2LG4A 3U3IA 2KISA 3PY8A 4R0JA 3O2PE 4GVBB 4X65F 2NAZA 4ECRA 3RRWA 3H90A 5H9EK 5CJ5A 4AIUA 1B72A 1IDYA 3AEAA 1C4AA 3I55S 1N32F 2CUFA 2JA7J 5C3EJ 3P4WA 2Z9OA 3KLGA 3HOUJ 3W61A 4LIVA 4XN3A 3IAM9 4M5GA 4XRFA 3VVUA 1WJ9A 3L2CA 2HPLA 4S0MA 3ETOA 1JLBB 3VOEA 2WCAA 3I0SB 3WAKA 3PE0A 1IBKT 2XC7A 2A18A 1PJ5A 2GXAA 3UN3A 1N77A 4DSFA 3MFKA 4NPOA 4X4TA 2OELA 3NL0A 1IRZA 4IKAA 2FOKA 3S3MA 4ZJOA 2Y6XA 3KWMA 3G2XA 4NLQA 4RNOA 2J5AA 3Q83A 1LFBA 1K83J 3N79A 3V6JA 3S32A 2UXNA 5L1JA 3F72A 2GCFA 3QAEA 4I6YA 2HVRA 1SJ1A 1RZMA 1OYYA 4NBQA 2X6WA 3TLTA 3R6SA 4QX8B 1H8AC 3CE8A 5D4RA 1SJQA 5EDNA 4J9OA 4RW8B 3Q8VA 1MSEC 4I76A 2FJAA 5GAGI 1JGSA 1ZH5A 3HCXA 1QBJA 4I43B 5FLXZ 2V4JA 3CESA 2HH7A 3TW6A 1J75A 1U5TC 1VC5A 3MEKA 3FXLA 3HDDA 1K4SA 2EZIA 1VRUA 2QA1A 2VURA 2HWHA 3BZ6A 3B13A 3D68A 2R42A 4LF8J 4QQBA 1VS3A 4YIFA 1U0SA 2L9NA 3TL4X 3AFHA 2BXYA 4MK9A 4WKRA 3DFEA 1P4WA 1UURA 3MVPA 4L5JA 3OSNA 4M3DA 1KSPA 2L01A 3ECHA 3LA3A 2CFXA 1U6BA 3IHUA 5KFPA 1XMKA 3BQKA 3N9LA 3C15A 3L7WA 1U1LA 3O2IA 1DQUA 2W84A 2MMYA 2NR4A 1HBMB 4U96A 5F8LA 4RNNA 4X1EA 3OUYB 1ETXA 1J5ET 3M6VA 5E17F 1YBAA 4CZCA 4DPOA 2W61A 4UVCB 4NMLA 2EBEA 3OOUA 1M5KC 5EGOB 1XR5A 4NZ0A 3RUBL 2N4DA 4ZLNA 1M0SA 4OYJA 2VXZA 1JLEB 3B4DA 2W63A 5LMUJ 3RB6A 1QPIA 4WPAA 3EUAA 3EUNA 4J9PA 5DQGA 1BLUA 4LFCF 3BPXA 5IM0A 3M6WA 1QJHA 3GJSB 1RBAA 3V4IA 2PLYA 1KQGB 2HN2A 4DSEA 3ZTOA 3L00A 5CFBA 2BG9A 4DV3J 4ZS6A 1G3OA 1OCTC 1F1BB 2LDIA 5CYVA 3S17J 5LEJA 2EV5A 2XYPB 2X1AA 4TNVA 1PYTA 3EZ5A 4D9JA 1PDNC 2BW7A 4DSLA 2RH3A 1NNDA 4JYKA 5C7PA 2LU1A 2VPZB 3MACA 3IG1A 4AQYJ 4UR9A 2QLBB 2LM9A 2G2YA 3OYNA 4CWBA 4X64J 3IA3A 1UP1A 2XAJA 4M3BA 2CDRB 5D8KB 4DR1J 3HA4A 3OXGA 3D5LA 2XLIA 3A03A 4FN5A 1BA5A 1OCRH 4GKKF 1X5PA 4YN3B 3JRGA 2WV0A 4CLSA 2GOXB 2CVEA 1VOMA 1ZN2A 3KZYA 4ZPWR 4OIOF 1IN5A 4LRBA 3QSIA 2DJNA 3R7SB 1SFXA 2YU2A 4X4RA 1H89C 2CM0A 4M6XA 3J7AN 4ILUA 3JREA 4ZDLA 5ICCA 3RIUC 3J9X1 2XNQA 1V6HA 3O8WA 3T9ZA 1BOBA 4DPWA 2HPMA 4MKYA 1YJTA 4OQJA 1G2EA 2M45A 1WJBA 1HNZT 2Z16A 3MTKA 3M3YJ 4HEA2 3UCZP 1W0AA 5B5EC 1VQ5S 2MB0B 4WYWA 3VSLA 2NYXA 4CXFA 4B3OA 3RRKA 4K4XA 2B8QA 2J5OA 4L0RA 1RHUB 1SC1B 3K4JA 1QUUA 1AKHA 2CQ2A 2FVCA 3KTQA 4PK5A 2JA8J 2ADCA 1RUOA 3N4MA 1R31A 5ERIA 3J80K 3DHWC 2DGUA 2D3UA 4ESBA 5DUKA 2PA3A 4X1KE 1MJAA 5DQVA 4ED7A 3QZ7A 5HN0A 3C2HA 2XASA 3GZNB 2W8KA 5FXWA 2D2SA 3FBBA 4ETZA 2V4RA 2LDYA 4IDKB 1RTDB 3D28A 1RK8A 3RC8A 2O67A 5K8NA 3KP2A 1NU4A 2GJFA 3QATA 1VNDA 4CI3B 3K0LA 4U8YA 1YDLA 4DBRA 1T9UA 3S93A 4B3AA 2EIJH 1TUGB 2KH9A 4G12A 5FKOA 2CJAA 3JB9k 2F40A 3U02A 1KOHA 2WDRA 5HROB 5CLSA 1TAUA 3D67A 1RYSA 3ZR8X 2AT1B 4WU2A 3LH2S 3BB5A 1Y5NB 4NQWA 1U6FA 4IH6A 2VFSA 4O0NA 3ET6B 5B09A 2XUEA 1KQSR 3FFIA 4DR7F 1JMTA 3IA0A 3LALA 1F3VA 4X62J 4DV2F 1NK9A 3BDPA 5A8WB 4ED3A 1Y10A 2E5LT 2DLRA 2M6IA 1O57A 4E7LA 2DGOA 2MY8A 2YKMA 2HPJA 3I54A 1UUSA 2W1BA 1XC9A 4DFMA 1FIAA 4D3HA 5FLXK 1FWLA 4HV6A 1WC5A 2IUBA 3MAJA 4TKTA 2FJVA 1FBUA 1TWFJ 2VKVA 2K3WA 5HQLA 3TO7A 2XVCA 1BM9A 3PKYA 2IS6A 4IE4A 5JDFA 3O44A 1QHHD 4LVOP 3ZXWA 1QUVA 1TQMA 1YVFA 4HDGA 2LE8A 5KFCA 3NQOA 1TKTA 1EF4A 2VPRA 1MZBA 4IFYB 4A3CJ 5J1RA 2CUZA 1PUEE 2F4VJ 2HNZA 1B7YB 1N56A 3G73A 3UULA 4MALA 4OIXA 2AF6A 4Y7NJ 1UWBA 2RU9A 4RNHA 2XHWA 4X84A 2P7VB 2H4WB 3EDRB 3VQTA 4J9MA 1NB2A 4NYOA 4O4LE 3FISA 2E7VA 3JW4A 1NUEA 3VGTA 3MA9A 4QKNA 3CJ8A 1JT6A 3OR1B 1IAWA 3M8QA 1UZDA 3QIPB 2Y0BB 3K8VA 4RBTA 4ZHQE 1Y01A 3VU7H 5DEQA 2WDQA 2X1CA 3AA7B 1SD5A 2YY3A 2ZBRA 4EUVA 2VA2A 2XF6A 2MQMA 4XKCA 2MHNA 5LMNF 1CUNA 3GG0A 1I94J 3MDFA 1SMTA 3D1QA 5EG0A 4M5MA 2XTLA 2LSKA 1HMVB 3OL6A 1VQ7I 4CNZA 2B9WA 3CJKB 1OMIA 1WTBA 3I4HX 4XKVA 1LWCA 3IP0A 2RILA 3PIPQ 2V1NA 5LSRA 1L3LA 2IYGA 3IKTA 2DODA 1PUFB 1VRTA 3M32B 2KDZA 3HPGA 4F7ZA 3UFGA 2X1FA 3C3WA 3IM8A 3RYLA 1FBSA 2C2MB 1Y0NA 2YBVA 3G6EI 4B9UA 2HDWA 1K47A 4FF3A 4PYDA 5IQQA 5KFMA 3O1LA 4KIGA 4NUUA 4CYDA 3PW4A 2YWEA 2D9OA 4EGYA 2OTJI 1N52B 1LXJA 2DWKA 2CV1A 5CYQB 5F3ZA 3ELKA 1HWIA 3LP1A 1U1MA 4YSZA 4OZLA 4R79A 1MLAA 3RBEA 1IBCB 2C3PA 3QGPA 3BR9A 5IFMA 4CIOA 3PXGa 2ASLA 1Y8RB 1DDNA 2CLYC 1NK5A 2WB4A 2OMOA 2DIUA 2WBMA 3EDVA 4PJJA 3UUXB 1N5VA 2FY1A 3BR8A 4XDCA 3PNVA 4QWBA 4EJUA 5A8RA 1BR1A 3QOFA 2F4IA 3VPRA 2FJAB 3M8EA 2J0WA 5HANA 4A8XA 2C2RA 4WTOB 5B0CA 4Q8EA 2BJDA 3GBGA 2XGXA 1R0CB 4JI7J 4QPXA 2NUUG 3QOEA 1S7IA 2VJ5A 3NRBA 4I6WA 1YLXA 1GT0C 4DG1A 4JK1X 5HK4A 1IJWC 1IR0A 1SL0A 4NUVA 1MMDA 4OHFA 2JPCA 2P7CB 4BJTA 4XR6A 1RU1A 3GN5B 3HG9A 3HGGA 3D9BA 3FZFB 3ZT6A 3ILOA 1JXEA 4CM0A 1WI3A 3ERED 3MOJB 1HSJA 1QVUA 2FJEB 2NZCA 3KV6A 3MZ8A 5AQNB 5FL1A 2UXDT 2LOSA 1YJNI 3LK2B 2QGFB 5K20B 3AAEB 4KRWA 4DUYF 3OVAA 3GZ6A 2OC6A 4DWIA 3PM9A 5J2QA 1UG2A 4MEXF 1NMEB 2ID6A 3RCOA 1KFDA 2VD3A 4DS5A 2JMWA 2CPEA 2XGPA 2E2IJ 5JI6A 1HYSB 4A8FA 1NSQA 1LK7A 2YWWA 3IS9A 3F56A 2IA1A 4J9VA 2IM0A 2CA9A 1ZGJA 2VBWA 3R6GB 3GMIA 3GMEA 2CPYA 4UB6C 2L9QA 4I0WA 4G3IA 1JT0A 4HLBA 5CVIA 3G6ES 3T5LA 3HZEA 4AYBD 4P55A 3AXJB 4JYAT 1HKSA 3KK3B 4ILMA 2V8HA 5LBMA 4EYHB 1N8RT 2AZ1A 4JI1F 5C42B 3Q8UA 4U87A 5BS6A 1FPQA 2H51B 4O23A 5DJBA 9RUBA 2RS8A 1DQAA 3KP5A 5FMNA 3HI2A 3UUMA 1JX4A 3H5SA 3PM1A 1HFEL 1X58A 2J7UA 1MJBA 5HDNA 5LXRA 3BH7B 2X1BA 5E3MA 1OY8A 1G6BA 1YW7A 3P3DA 3M6UA 3PURA 2VUGA 1QVTA 1YW9A 5CVRA 3K1MA 1IBMJ 2I5UA 3NLCA 5KFJA 2P9EA 3EGZA 1OIAA 2Z58B 3OIPA 2CAJA 3T1BA 2DA7A 3RB4A 5HEJA 2K24A 3EZUA 4ZN3A 1SE7A 4NXMF 4LF6F 2QBYB 3RBXA 2VBXA 4NB5A 3IM9A 2K5CA 1T94A 4QHOA 4ZVQB 3NY0A 5E18F 4ECTA 4X66J 2XO6A 1TTYA 3V2UC 1XCBA 1YQ4A 2D45A 3GTJJ 3SIPB 1JTYA 5L3CA 1X4FA 4LFBJ 2XBPA 4P71A 3UW1A 3LDQB 1JJ2R 2B1EA 3VKHA 3IR6B 3FZBA 2W62A 2XAHB 4TY8A 4DO0A 1YX2A 2RGVA 1RC9A 3P4RA 4IDZA 4U7YA 3BDDA 2R7TA 4JI3J 3GB0A 2BUNA 3O1IA 4HX7A 4J9SA 3BGFA 2Q6CA 4CN4A 1MBFA 3RBDA 3MGJA 1JXSA 3OR2C 3ISPA 2XQ4A 4CRJA 2LXFA 3CZ6A 1WF2A 2DRBA 3S1TA 1FIOA 1T8EA 3DXSX 3QAHA 3R5BA 3V5RA 3ZQ7A 4UTGA 3GXOA 2B4OA 1TL4A 1OJLA 3JC6C 4F4AA 2R7DA 4WFNQ 4JI6F 1IKVA 1HKAA 3K4MA 1UA1A 4FYYB 3ZGKA 3AB3B 3U1LA 1XMQJ 1QSSA 2KINB 1JTXA 4XIDA 5KXJA 4U72A 1XEZA 2ZBQA 3EXCX 5LHHB 2XULA 3H8YA 4OYBA 4KITB 5IT9Y 1FTCA 2VPWB 2AJ2A 3BPSP 1XMXA 2W00A 3KLGB 1PBUA 1Z0XA 1FSHA 1JKRC 4OX6A 4M72A 4KJIA 2HQAA 2XAFA 5LD2C 4QWQA 2ZXJA 1ZRFA 4K0UA 1QU3A 1KBRA 1AFJA 2JEJA 2LY9A 3GV5B 4V19K 2XMWA 2FBKA 3KBUA 2K7KA 5IC6B 2GHWA 1YITS 2JRSA 1N5SA 2E9XD 5AJ3J 3FKBA 1X0FA 1FE0A 2XIGA 4URSA 3AJ2A 1NK7A 3RIFA 4RL1A 3FMSA 4OYMA 3OHAA 3PRVA 2WTFA 1MNEA 2NXEA 4XO0A 2MKKA 5IOZA 4EMDA 3CC2S 3I5UA 5DQHA 1Z2LA 4QU6A 3R27A 3OPCA 3LWMA 2H5EA 2PG4A 3G71S 1HW2A 3AG2H 4M6VA 4WX9A 3UTKA 2GWRA 1SKRA 2A6EF 2IYIA 2Z99A 4XKWA 1LK5A 2CPZA 2K2PA 4XMYA 1S4EA 3O3KA 3W1YC 1J9IA 4YTNA 2YS9A 2MC4A 1DGWY 3LGNA 4DUZJ 2HXOA 2O5DA 3OL8A 1ELOA 2QVAA 3C51A 4NLTA 4PWDA 1EP4A 4K4WA 1H2UX 3V5SA 4E7ZA 4U2YA 2DO4A 3UDVA 4XAKA 2WY8Q 1VQ8S 4H9PC 2LKXA 1TBXA 1UMQA 5CYJA 4OI0A 4USJC 5L38A 2C42A 4M5JA 1FD8A 1PKUA 3RBZA 3QODA 1FMWA 3K2AA 1NPKA 3MZYA 4M74A 3RYCE 4ILLA 3AQOA 3EICA 3PIPF 1EKSA 2YKQA 2EHOD 1JGGA 1S49A 3S2HJ 3CJ2A 5G0RB 5I3QA 4KPCA 1W5SA 3DBLB 4JOMA 4LK0F 5KFXA 3FSXA 1IQTA 2QQBA 3MD1A 3MM5B 2IIHA 4JI7F 4DSKA 2X0LA 3I9ZA 3CC2I 4A47A 1HC8A 2V7LA 1WUUA 5KAKA 3M1VB 3WGGA 2FHJA 5IYBJ 4KIFA 5FVKA 4G1QB 3UFCX 4P0AA 1JUPA 4F3OA 4CCNA 2EFQA 3L1PA 1OO0B 2FE3A 4ZDPA 4HT5A 3H9GA 3TAMB 3PJAJ 1OFCX 4MKAA 2DHAA 2NS0A 1ZM2A 5LLQA 1XSVA 3MKDA 3I0OA 1X4AA 2NSBA 2BANB 1W4MA 2KSRA 1VZ0A 4ZI3D 2QLJB 1HA1A 1O7LA 3V42A 3BC8A 1MWYA 1RAEB 1QE1A 1RXOB 1U0JA 2PX9A 4DJAA 5ILUA 5CYMB 5AONA 1D3WA 2M1BA 1P4AA 4HH0A 3BDEA 1KNZA 2ELHA 1WC4A 1IBLT 1E3OC 3HK2A 2NQPA 1KONA 2Q1ZB 2NZ4A 5HQ8A 2HZTA 5KFAA 1KK7A 3VGVA 1WOPA 4R0EA 2WAQA 4FDFA 1QA6A 4Y15A 1IXKA 1B64A 3ZKRA 3KCCA 1GX5A 2XROA 1TWGJ 3Q9VA 4UHTA 2N9DA 4C8OA 3PQKA 5HDKA 1X60A 3BP8A 1OLTA 2JEGA 3I82A 3Q2SC 4FNIA 4BACA 4Y33A 4PXEA 2D3OR 3HKZA 3MUMP 2OPRA 5LMNJ 3I0TA 2MKJA 2J8SA 3PV0F 4FF4A 4FYDA 1YW0A 4H54A 2QKLB 2WVFA 1SJRA 1DRZA 4KYWA 1ZG3A 5FO5A 3FXOA 2J4GA 2W7AA 3AOCA 1IJ5A 4YDDB 3J80Y 4KN7X 2F9DA 1D8YA 3UE2A 3VGSA 4ZXLA 3RX6A 3SEQA 1RRJA 2FLOA 3ZFVA 5DV5A 1JKHA 4I68A 1N34F 3FZKB 3DPUA 3W62A 3WHBA 2EILH 4X4NA 2QL7B 2KFYA 2FBHA 1IVZA 2EK1A 5IP6A 3DYAB 4ZPDA 2JZ5A 2PJRB 1YBTA 4XN0A 4ZI7E 4KGKA 1Q8IA 1N32T 4UOCA 4GIWA 4Y2AA 2DA3A 2MXYA 3CX8B 4HI1A 2VVSA 4JI8T 4FBTA 1E2XA 4P0BA 2A05A 4J7CA 3EUHA 3KIOA 3JRBA 2Y30A 2DNYA 1B9NA 3H0DA 3FJ2A 4ABZA 3MMJA 1N4LA 1U09A 5LJ3Y 2V5CA 1NH7A 4ECYA 4AL5A 4NLPA 3TARA 4XRSG 1MSWD 2DXFA 3CCRI 2AYMA 1RT2B 2IGNA 2WAEA 3FF5A 5H6QA 2LKGA 3KVAA 4BUPA 2M2EA 2E5HA 3CD7A 3FXDB 4FX4A 2JJ7A 1IKYA 3TP0A 4BCAA 5LM7E 4MO7A 2BDPA 4OX8A 4ZYDA 3ZTQA 4XOPA 2LMDA 3DU6A 5DGAA 4HVZA 3VAJA 2GW8A 4UF0A 3A4TA 4EU0A 4DV6T 2QLFB 3SYTA 4K50A 1RTHA 3D3CJ 1T11A 4EYYR 1W25A 3VDXA 1MIVA 3NAHA 2VPYB 2NVUB 2OD5A 5HATA 5EZYE 4NCAA 1TV6B 4Z91A 1CHUA 3KVBA 3RYFE 3MURP 3U1KA 3V4GA 1AW0A 3OVUA 1SANA 1F5CA 3D5SC 1EAYC 2HGMA 2AJQA 2GXGA 5J2PB 3TAQA 2YSRA 2JA6J 3MEGB 1FT8A 3GCWP 3SEOA 1U48A 1O51A 3M8FA 4LF2A 5GAGU 5D5VB 2CJ9A 2EFPA 3AH6A 4TV7A 1PG5B 1GTEA 1NHVA 2I0MA 2J62A 3CC4S 5M5YJ 4IDNA 3PU3A 5F8IA 4LF5J 1ZLJA 1VBKA 4LFAF 4UV9B 3DLEA 4CLYA 2DGTA 2AW0A 2B9SA 3QO9B 1S6LA 2HNYB 1PIEA 4CLFA 4P09A 4B9VA 1NH3A 3ONLC 5DS9A 3LOUA 4M3EA 3AE9A 3NCRA 1S10A 3H4BA 2C3OA 4RW9A 2X6XA 2E1AA 3PW2A 4B08A 1V5GA 5D15A 2D3O1 4DOZA 5HWYA 2H5IB 1D9FA 5AJ3F 3QMQA 4MIMA 4BJ6C 3IRXA 3PZPA 1SA0E 4A3FJ 1XDUA 3KLIA 3S1NJ 2BY0A 2Q8KA 4NA2A 4DDFA 5IT9Z 1NTCA 3I5BA 3HSEA 1LOUA 5C3JA 3GQCA 2VFVA 1ROFA 2ZZTA 4DMVA 2BG9C 1UJ4A 3LWLA 4DPUA 2PQ8A 2K27A 4DQ2A 3PO3J 2E5ZA 1YWXA 3ILLA 4A12A 1LEAA 2HLUA 2HKXA 3T8OA 4ITVA 4MGRA 4WW0A 1YQ3A 1XCVA 3PEHA 5M2RA 4ZJZA 4AIDA 1H9TA 2XF5A 3CF2A 4DZDA 2UUAT 3I31A 2HTSA 3HRUA 3GFZA 3MM9A 2HK3A 4KBIA 2HQGA 1G3TA 4C30A 2CWOA 4BAYB 3NXZA 5H6QB 3IH2A 5L3EA 5F6FA 4J19A 4IREA 5E1WA 1OCZH 4ECXA 2CFOA 2PN6A 4FZVA 4DEZA 5LG4A 2WAUA 2XQ3A 2XB0X 3TW0A 4MIWA 4N7TA 3MM8B 1DJ0A 5FD1A 2N82B 1GDTA 2V7JA 1VC0A 3AODA 1JLAB 4N9HA 3KINB 4U0YA 2I5JA 1ZHFA 4QR1A 2KM8B 3M07A 5JUMA 3PTWA 5K1YA 1WI6A 3CMLA 1B99A 2R2SA 1X9BA 2XC9A 2I8DA 3ONXA 4DV3F 3QRQA 3ETMA 1N54B 1LQ9A 2LDUA 1ETVA 5F0FA 4C98A 4A69C 1XNRJ 3HSRA 1DPUA 1NXIA 1YKHB 2YX4A 1RETA 4EO6A 2I6HA 4IOAQ 3H37A 4IDOA 2CZ4A 3BO2A 1BR2A 4I01A 5LFAA 5ETLA 3S6EA 2ZB9A 5AQKB 5A2QZ 2LFVA 2CQBA 1KEKA 4EM1A 4DV7J 3H9QA 5FFXA 3ZN1B 3CVKA 3THTA 3QQCD 5GMKa 3P4QA 4RU9A 3IUOA 3VSKA 3FFIB 3MR2A 1WSVA 4HT7A 3C4ZA 3M4XA 4B9SA 3H5UA 1S1TA 3VHQA 4C3MA 4EO8A 3AG1H 1US7B 4F92B 2A6MA 2ZBCA 5J2TE 1KFSA 2HI3A 1JI8A 5KT4A 5F64A 2OTLS 4EGLA 1S1XA 1FOXA 4EV0A 3LP0A 1O6XA 3RQ4A 2K3FA 3SQNA 1SB6A 2FJBA 1SV5B 1WC6A 4HDUA 3PUYF 2HZCA 1MWZA 4YELA 5FKNA 5HS8A 5TJJA 3H98A 4DYRA 2BQ3A 1S79A 2DCUB 4DMZA 1QPMA 1IKWA 1KWMA 2R0QC 2VJIA 2HS4A 5L1KA 4BQAA 4CGZA 1E3PA 3FXUA 2FUPA 5EK3A 5D4NA 1K9MT 3L2WA 5KK1A 2VHGA 1HBMA 2W25A 4KX6A 1UAAA 2XO7A 5SUHA 1W0BA 3KV4A 5IWAF 3BCBA 2AS5F 1H88C 4AXIA 2WAQD 1HD1A 2QTWA 4UB8C 4IO9Q 4E7SA 1XZYA 2VG5B 2V7KA 2X1GA 1R0AA 4DR7T 3K0JA 3G2BA 1V4RA 5HEGA 3K3OA 3Q89A 3DI6A 2ESNA 5ETMA 2LHNA 4MFBB 1QAXA 5DCMA 5LT5A 2R7SA 4YR0A 2KT2A 1N25A 4IE0A 3H25A 1ZR4A 3CDBA 2A2FX 3S1MJ 2PO4A 4LF4F 3BY6A 1S1WB 4NC6A 3V4MA 1TT5B 1Q1KA 1UB9A 3SFDA 3VQSA 4DX7A 1QRYA 2LXIA 5E8GA 4IR9A 5CQGA 4QIWN 1JB0C 5E2QA 2X1EA 3VYRB 3R7BB 2FJDA 9ATCB 2X0LB 1YRTA 1X8DA 4UVBA 3O1HA 4CDIA 4S0HB 4QW8A 3OTDA 3PW7A 1BW5A 1N5TA 3CW2C 1EHWA 5E5NA 1ZBTA 2QRRA 2QENA 3TAMA 5F1RA 3ZYMA 3HL2A 4HFHA 2CRLA 2BVLA 3RKQA 1UL3A 1VQ6I 2CZVC 4Z6YA 2AU0A 1RESA 2D7SA 4BHBA 2JPBA 2BS4A 2Q0OA 3DXBA 1RR8C 3EPZA 1O3QA 2LBFA 3A01A 1B7FA 2V9VA 1FRMA 3KHRA 4KHPJ 2ZO4A 1ZR2A 2VJ4A 4HEA9 4LF1A 2KI2A 3P6YC 2BABA 3B57A 2KJBA 3I59B 4FKXA 2FF4A 3G6XA 2B43A 4IGUA 4PFPA 3W9IA 3E01B 4RB0A 4FYWB 2QSGX 3PJRA 4HI2A 1XMAA 3K7AJ 3NOCA 2AIRB 1NH8A 3UT5E 5HAXA 1TC3C 1OPCA 2LRKA 3V7RA 5D5UB 4EVIA 4NEZA 5LCYA 4Q0BB 1SL2A 4HX8A 1UEVA 3K1PA 3TEDA 5E79C 1S29A 4OL8A 3N6LA 1CC8A 2G0EA 4PJLA 4L9TA 3K4NA 1SJ4P 2WV1A 2KQRA 3TVKA 2RV8A 1CJVB 3LBXB 2NW8A 5GTHC 3MEEB 2UUBT 1M5PC 5L2LA 5CD4A 3NBPB 2OO4A 5D0RA 1H6KX 2WSCC 4IEJA 1JWWA 1RI7A 3D1HA 4II2A 2PEBA 5B7WA 2B3TB 4P7TA 3PO4A 2ICWG 4LIRA 4BDPA 1TFWA 1RT7B 4WE1B 3K4CA 5DD8A 3BTIA 2UXBT 3SCJE 3DRXA 4CH1A 1UVKA 3EGNA 1UGOA 4PCQA 2VQHA 3IHRA 5ABFA 4NLXA 4LF7F 4EJOA 4EWTA 2J9DE 2HVHA 2LBFB 3A01B 3RQWA 1SC3B 5EHHA 1W2IA 3VTIA 2Y9HA 2DMTA 3DPTA 4PSWA 2ZC2A 1JJ6C 4XRSA 3RTRA 4CO8A 1WR6A 5KG6A 5HL7Q 1ZAVA 3BO4A 4RNFA 1SV5A 4JI4F 1SAXA 1G4CA 2CG8A 5ILSA 2B5JA 2UVRA 4CT9A 1HBXG 1HHQA 2ZC3A 1KU9A 4WK8F 1OY6A 5B0FA 3QRPA 3K4KA 3M4OJ 1N36F 1ULRA 3KZZA 2MLKA 1J2VA 2EKNA 3Q24A 2HMIA 1Y3JA 4B9MA 1HBUB 1N75A 3RAXA 3M8SA 4A5XA 4JYAJ 2YWKA 2W4DA 3SZPA 2DNNA 5DG8A 3X3UA 3LWFA 4D1QA 2Z8QA 4JV2A 4BJ5C 3NEUA 5LRRA 3NGUA 3P49B 3VAFA 1M1EB 1FX4A 1GXTA 4Q47A 4EBDA 2QM3A 2JFKA 3PIOF 2KHCA 3CUNA 2KZGA 3H3VK 1ZPVA 5CCLA 5HLTA 1TNTA 2M4KA 4HRIA 2B4VA 4UY85 3IR5B 2E5JA 2ES0A 1WF1A 4KMFA 2PG8A 5DDQC 1JJHA 4WCGA 3A3NB 1RWKB 1LWEA 2GFFA 3DCAA 2F4FA 1N5YB 4A0YA 2YWFA 4F4WA 3LSKA 4AIJA 3BTLA 1KD1T 2ZCWA 3FIWA 1RAGB 4ZI2C 1QAJA 3F23A 3P5JA 2R4GA 4ZITA 5L3EB 4Z7YA 5KTQA 3RI4A 3U7JA 4A48A 2ASJA 2HRYA 2CSOA 1ZGWA 2E1CA 2W01A 3BH6B 5E41A 2WBRA 1JIHA 2QYCA 5DGBA 2VH7A 2HFVA 2C5JA 4A8SA 3AB2B 5CJ9A 4IG3A 4ELVA 1B6AA 2V26A 2AKWB 2G1DA 4UY8T 1D8JA 3CX7B 4QH5A 3JAEA 3AE2A 5DDGA 2VG7A 4ZMMA 1FKAF 1AA1B 2W2PP 2XMMA 1D0XA 1BIBA 4ZVSB 2E5GA 1Q5VA 2VDHA 1FXLA 2CXDA 5HYAA 2HS5A 1FKOA 3V5UA 5ETRA 4KO0B 1FK9B 1L3SA 4C8YA 2EG2A 2C5KT 2ZD1B 2I6WA 4ZHRB 1MNMC 5E8IA 1JKPC 5LNKA 4YY3T 2CUYA 3U2RA 2XQAA 5F8GA 4NUBA 2XZWA 1ETYA 5A76A 3AAAB 4TZ4C 2J9EA 3OBIA 1D09B 3ZMUA 4RDUA 1ZPWX 2DGSA 4AVPA 4EIWA 3TO6A 3H7HB 3KHHA 4DX6A 5AT1B 4ZCMA 3C2PA 2G0JA 4MFEA 3Q0UA 3IS9B 3G1LA 4LD5A 3QGHA 2ZXIA 2KT3A 3D6HB 4LSLA 2OCEA 2DU9A 3G1OA 2NS7A 3GX4X 2HOAA 5B0DA 2ZMEB 1G2HA 3UDEA 4LFCT 5IT9K 3K17A 2MGQA 3JSBA 2C5IT 3Q22A 2U1AA 5BR8F 3D0TA 3OYEA 3RG6A 3SFGA 1WG1A 3UUBA 2XI2A 1HL6A 2PMZN 3VAKA 3AEFA 1E0EA 4UVAA 2NXJA 1CC7A 1WEYA 1MDMA 4BL0B 2KZ7B 2DRAA 2RKIA 4C11B 1IBLF 3RJMB 2YEVC 1F2GA 2ASYA 4RBOA 4BAYA 4I55E 2YKOA 3JC6D 2Y0SD 3ELHA 4CI1B 2R8IA 2MW8A 2F9JA 2BKOA 3FUYA 2FUG2 1FMVA 2BRKA 2QSFX 4FXDA 1QTMA 2GO9A 4KGZB 2NPFA 4CLLA 3L09A 2F1FA 2EZLA 3PUVF 2LU2A 2GMLA 3W2VB 3PUXF 3LQQA 5KFDA 2K3KA 4NA3A 4U7DA 3V6KA 3E7LA 1KLNA 1Z0PA 2XY5A 2MSTA 3K70D 5JVDE 1OJ4A 2PEHA 1FJGF 4Y17A 5EN1A 5AQIB 4F0HA 2PMZA 4JYAF 3QYYA 2YDSA 4R1HA 1P1LA 4P7VA 3MM7A 2F5CA 4V1Ak 1IUYA 4AQYT 3UN2A 2LLYA 2CQCA 3IWLA 2BRLA 3MMCA 5K5RA 3T6JA 5DO2A 3TO9A 2HQRA 1FNNA 1NPRA 5HBMA 5E3RA 1U1KA 3V8KA 2GMJA 3BQ1A 3MAHA 3E5XA 3QO9A 2BQUA 4BE2A 4WFXA 1PUFA 2ME6A 4G2AA 1VRTB 2QX0A 5KAFC 1WDTA 3TZYA 2ZH6A 2KIMA 1GMUA 3IRXB 4DYQA 3RIUA 2R7XA 1C2PA 1VIXA 4KR0B 1H72C 4EGWA 4J91A 2D2WA 2APOA 2ZH9A 2VL8A 3BN4A 4YFUA 1KS2A 1GNKA 5LOVE 2VJJA 3HOWJ 3OL3A 4U7UK 1X9WA 4QXBB 3UU3A 2B6AA 2E19A 2CNOB 2HYIB 1BC7C 3K1SA 1WG5A 2JA5J 4X1IE 1R8HA 1BI1A 3BTJA 3HKDE 4ZOSA 4WKYA 1S94A 4C3HJ 2UZKA 3TUIC 5JXSA 5CAAA 4MTEA 3O3LA 3CCJS 2LF8A 2FSWA 3CC7I 3ADAC 2VKZG 1GMWD 1J2XA 1FY7A 2JN6A 1SC4B 3TDUC 2HAIA 5FVLA 3ETUA 2HWIA 4CXYA 2M8DB 3ABMH 1QZYA 2XAQB 1S77D 3PUZF 2BG9E 3KEOA 1WRDA 2JH3A 3IBCB 2BBHA 4TLRA 5LGTB 3EETA 4G1IA 4EOZB 4DUYJ 3MFHA 3EPGA 3HOZJ 3NGDA 3UU8A 2PMUA 4IOAF 3KZIC 4FJOA 4WF2A 1TV6A 1VI0A 4NXNJ 5J8FA 1OYDA 3V8LA 1BXNA 1TKTB 2JOQA 4IHXA 2X7IA 4I02A 3VZIA 1NKBA 3OLAA 1RWXB 3J80Z 1U24A 1P7JA 3T8RA 3B8HA 1N5YA 3MAAB 1S6OA 4OHVA 2HMIB 2MQNA 1AUDA 2HHPA 4K4TA 2N3OA 4UQTA 3OL4A 4ZOLE 2VK9A 1OYEA 2JVRA 4YB6A 3RKWA 1N32J 1C0WA 5T7LB 3WTVC 4IH7A 2AEFA 2QFJA 3SSQA 2VB6A 3CCVI 1VQ8I 2ZBIA 1J5YA 4EJVA 3L8RA 3GIIA 5F27A 2BJ7A 2K9LA 2F8HA 1VQKS 5K9FA 1RT2A 3CB4A 1BW6A 2W1OA 3FXJA 4I69A 2DNXA 2F8EX 1ETKA 2OA4A 2DNZA 4P5OA 1E6VB 3I4MJ 5GTIC 2L4MA 2QUFA 2DGWA 4BQNA 4AD6A 4U33A 1U6ZA 1K4TA 4P2XA 3HVTA 2W2MP 2FMLA 2KG1A 1W36D 1U26A 4B17A 2ZZNA 1KNPA 2X6YA 4K4YA 1VK8A 3L2UA 2FZGB 1T03A 4BDZA 1MMGA 4GKJF 3PEJA 2DGQA 1R8PA 1L3KA 4DQIA 4ZLPA 2O61A 3NKZA 2O66A 3FBIB 2QSHX 3AVRA 4JBWF 2F5DA 4B3ST 3DMJA 8RUCA 2PJQA 4QIGA 3N9PA 4C0OC 3M8PA 1SEUA 4O8SA 2B4PA 3TA0A 1RIOH 3TVZA 3WX8A 1WFXA 3CJ5A 1PJ6A 5IOLA 4IHWA 4MMOA 4F8RA 3DF8A 1J5EJ 2W9CA 1BR0A 4G6TB 3S2WA 1WJEA 3HFVA 1VQMS 1B1BA 1VYAA 2H7VC 3EDQB 3BZQA 2EWNA 3IWZA 3C6UA 2OUGA 4RB2C 5IP9J 4U2ZA 1YZ6A 3RIAA 2V9WA 1BWVA 3FNNA 4A0XA 1SKUB 2VE8A 2KRHA 3EI0A 2V9KA 1IUFA 2R5YB 1X5TA 2VVNA 3EX7B 1NK2P 3QWPA 1I94F 1KGSA 5DQWA 3G9CA 2M7BA 4Y2IA 2HRUA 4HDVA 2XMUA 4ZH4F 1HLVA 4DV4J 2ZWOA 4PW8A 3P9IA 5D8HB 1S7AA 4HLXA 3CNQP 1DURA 3OTOT 4XRMA 1X1BA 4TWFA 2M34A 2FRHA 4JI0T 4GC6A 5HS9A 1JK9B 4IJAA 5IYDJ 4X5TA 4MH8A 1G3SA 4AE5A 1T95A 4G1QA 1OEDE 2WQYA