3KFWX

Uncharacterized protein rv0674 from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
b'SLTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVALTRMVGAGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTDARTRAALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDEAPADLAGQLWDLSGWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDPMLPAELLPADWPGAGLRAAYHDFATAMAKRRDATQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Uncharacterized protein Rv0674 from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07848 PaaX PaaX-like protein
X PF08223 PaaX_C PaaX-like protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kfwX01
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kfwX03
3.30.70.2650 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kfwX02
3KZYA 4U0WA 2E7WA 2RKHA 4WCGA 1IF1A 3FF5A 3C7JA 1B6AA 4ZYGA 2ZNYA 1TW3A 1XDSA 2NNYA 3CDHA 4WK8F 2DU9A 3G73A 1KYWA 1WKMA 4R79A 2OQRA 2P6TA 1Z6TA 5ILSA 1T6SA 1G4DA 4ZYDA 4PCQA 5AIQA 4KN7X 1PDNC 3SZTA 2HQNA 4KMUX 1FNNA 1ZGAA 3DV8A 1F5TA 4LG0A 3F72A 4L18B 2EV6A 2F5CA 1R36A 3V8KA 3W6JB 2O3FA 1DPUA 4ON0A 2VONA 1J9IA 4RGRA 4CHUA 2UXXA 2DFIA 3G3ZA 2EB7A 3TDUC 3W6KB 3ROUA 1FZPB 3GVAA 1XSXA 2A69F 5CVUA 1RNLA 2HKOA 2M30A 5LRRA 1EH6A 1BC8C 4PZJA 5BS6A 4Y17A 5J8CA 3HTUA 4EQQA 1X3UA 1BC7C 1C0WA 1U5TB 1XD7A 3V4GA 4FX0A 1QNTA 2EFPA 1RZ4A 2Q2EA 4BYYA 1QBJA 3KEOA 2IT0A 2JTVA 2Q0OA 1MD0A 1D8JA 1ZH5A 5BOXA 3IWFA 4WXHA 2R3SA 3S2WA 4I0BA 1SMYF 2F5EA 1O57A 1QPMA 3L7WA 2B0LA 4P5OA 3JTGA 4HV6A 4WF2A 3L00A 1HBXG 1G3SA 1YS7A 3B02A 4P55A 1R00A 2XUBA 3E6CC 1ZREA 3ZP5A 6PAXA 1P2FA 1IN6A 5E8IA 4TV7A 1DDNA 3KCCA 2IVMA 3RIRA 1FX7A 1P92A 3IKVA 2F5DA 3KEQA 2K27A 3TO7A 3CUQC 3PQKA 4JBAA 4ENJA 4I02A 1ZRCA 4U7BA 2M8EA 3SQNA 5D4RA 3K1NA 2RV8A 4JQFA 2EK5A 1T39A 1CF7B 2ZBKA 4CO8A 1K79A 2M45A 4A0ZA 5DUIA 2XKPA 3R0JA 3BJOA 2LDUA 5HDNA 3KE2A 2EWNA 2QWWA 4I0AA 2JPBA 4LLLA 5H20A 1Z7UA 3B73A 2YSRA 2CSOA 3BZ6A 2H6CA 4G6DA 4HA8A 2Z99A 2K4JA 2WV0A 2XAHA 3N4MA 3I53A 4EJWA 3MCZA 3BPVA 4AIJA 1J2XA 4WXCA 2DQRA 5FD5A 3BOQA 3GFIA 1JHFA 5JR3A 1IAWA 1KQ0A 2V1XA 2ZFWA 4IHTA 2O0YA 2VODA 1R58A 1R5HA 2NYXA 3T8TA 2FE3A 2ZO4A 5KK1A 3MWMA 4Z2YA 3V7CA 4UUVA 2PMUA 1J59A 5K5OA 4OU0A 4HQMA 2WWYA 2LF7A 2RQPA 3BPXA 4Y15A 4ESBA 3EUHA 3F22A 3SXYA 2CW0F 2IPQX 4YFNF 5IT3A 1FBUA 1J0RA 1LNWA 1BBYA 1ZARA 4XLNF 4CICA 3WE3A 4U7DA 3WODF 1D5VA 2E1NA 3NRVA 1S29A 2RVCA 3I59B 4RGUA 3M7GA 1W7PA 3TDZC 4KIGA 1HKQA 4GGGA 1OPCA 5HOOA 3BWGA 4AIHA 3WTTC 5CVRA 2BBYA 1W7PD 1ZGJA 3EETA 4M74A 2IA1A 3O2PE 3WE2A 1GVJA 2O6GE 2VBYA 1R1UA 4Q48A 4WWCA 4HQEA 4LGWA 2L4AA 3TKYA 1K78B 4IRHA 1GXPA 4HOBA 1KYZA 2PBIA 1B1BA 3CUQB 2VBZA 2XV4S 2VT2A 3RI4A 1BIAA 2O8XA 3VB2A 3NQOA 1R23A 2QQBA 3IRQA 2QLZA 3WU0A 4RAYA 3EQLF 3ZMUA 4OOIA 4G94A 2XRNA 4ASNA 3TOBA 1JGSA 3O6BB 4IRIA 4R8HA 4EV0A 1IXRC 2EA4A 3FMRA 3BROA 2XAGA 4HDUA 2XIGA 3F8MA 2ISYA 2IP2A 4IXAA 1MDMA 3NEUA 1QO0D 4N9HA 1YW8A 1F4KA 4FHTA 1IN4A 4HF1A 2ESHA 2NS0A 3PFIA 1S7OA 2ACJA 1Z9CA 2FNPA 2ZJ2A 1O3RA 2J5OA 3D0SA 4WX9A 2W85A 4Q4ZF 5HLGA 1KQ9A 1HKSA 2VE9A 4K2EA 1PP8F 3QU3A 4ZYHA 4DQ2A 5E1WA 1KA8A 1FYKA 3I5UA 4OMYA 1O3QA 2CWEA 2VT3A 5HVQC 4Q47A 1BI3A 1W5SA 1FT9A 5IT9Z 5FFXA 4UVAA 1UB9A 3QPTA 4NQWA 4BQAA 3AAFA 1FSHA 2EV0A 5IT9K 1FOKA 1EH7A 3HSFA 5D5XB 1TQMA 5F1RA 3M8FA 1A04A 3FM5A 3F21A 1IN7A 2K02A 4G6QA 2MA3A 5CYVA 3R4KA 1XN7A 1V3FA 3GEZA 2GA1A 3I4PA 4I2OA 4ZZDA 2KJCA 3L2CA 4ENKA 3U9GA 5E1XA 2O03A 2H94A 3O3KA 4CGZA 4GYIA 4YFKF 2A5YB 2L01A 3MQ0A 5H6RA 4UNOA 4L9NA 1RIOH 2Q8KA 3K69A 3RKYA 1Z1DA 3HSEA 5LEKA 5K5RA 1JXSA 5JI6A 3E6MA 4RB1A 4EJUA 4HV5A 2FOKA 1FYLA 5JVTA 2A6HF 1QQIA 3LAPA 2VE8A 2ZMEA 1IXSB 2UXNA 2LKPA 1UHWA 2R7FA 2GZWA 1HSTA 4KYWA 1S8NA 2A3SA 3CJNA 2XAFA 4KA4A 3GF2A 2JPCA 5E20A 4U0VA 1MKMA 1IW7F 4O6JA 5LHGA 2M5WA 1G6NA 1RUOA 1J7KA 3HHHA 1OYWA 3WTWC 3BP8A 1FBSA 1MJ9A 1SFEA 2H09A 4BNCA 3U2RA 3IHUA 3J81Z 5D8KB 2OZUA 4HF2A 1KQ8A 3J81K 4A0YA 5EEHA 4HZFA 5CJ9A 2IA2A 4XRFA 5L3BA 3E6DA 2V6CA 2DK8A 1O7LA 3RPQA 4EM0B 4BHPA 4MEXF 3WG9A 3REOA 4P96A 3GLXA 3KP4A 1TW2A 5LGTA 2OA4A 3GW2A 1ZAOA 3HRSA 2FEZA 5D8LB 4L0YB 2L02A 2P8TA 2P6SA 1ULYA 3I54A 3WTVC 1B59A 3J80Z 5DCMB 2IW5A 2TDXA 3J80K 1XB4A 1S6LA 1FSEA 2JRTA 1F9NA 3OOPA 3M9AA 3Q9VA 3I58A 3WTXC 2NNNA 2LSOA 5DV5A 3KETA 1KU3A 2FSWA 2Y0MA 3GO5A 3H3UA 1HQCA 3F6VA 3F3XA 2OQGA 2KKOA 2YX4A 2F2EA 5H6QA 1DP7P 2EFOA 5D5WB 2GXBA 2QBYB 1G3YA 2D45A 1XCBA 2Y48A 4UHTA 2MH2A 1FYMA 2RGVA 4S04A 3CUOA 5E1ZB 2VBWA 2HTSA 2EFNA 2YR2A 5CLSA 3ZN1A 2KIUA 4L0ZB 4G7ZF 2FXAA 2FRHA 5HLHA 2QQ9A 2DPUA 3CO7C 1PP7U 4A2UA 4I09A 2YU3A 3GZ5A 1TNSA 4AWXB 4PGGA 4XSXF 3LA2A 1LQ1A 4EJTA 1ZHFA 2P4WA 1YQAA 3V7RA 2X4HA 1BJAA 4HAMA 1JHHA 4BAYA 3Q5FA 3HUGA 4Y13A 2J5PA 4G8XA 1OR7A 4IVNA 1DPRA 3ERED 2GAUA 1YYVA 2G7UA 2HYGD 3H3ZA 1B4AA 1U78A 4LG0B 3T1BA 3GFJA 1UFMA 2QUFA 3WGIA 4EJVA 3FHZA 1TQIA 1MGTA 3KFWX 4BHBA 2V79A 3KP5A 3HHGA 3QAHA 2ETHA 5ERIA 3WTZA 2Y75A 1YIOA 3VOEA 3M1EA 3C3WA 2DO7A 1ZRDA 1Z91A 2HR3A 1ODDA 1P4WA 1AWCA 1XGOA 3E6BA 3LFKA 2W84A 2QYOA 1W4MA 4L9TA 3IWZA 4YFXF 2Z33A 5L3GA 5E17F 2HKXA 1K6OA 2VN2A 2PN6A 4HW0A 1P6RA 4UXNA 3RYRA 3JAMZ 5JFRA 2CQKA 3BJAA 1OYIA 2YPRA 3ZMDA 1RI7A 2KJBA 3JAMK 4NHJA 5ILVA 3FX3A 1FPQA 3SZPA 1EH8A 1WI9A 5AIPA 4ZZLA 1I1SA 3RKXA 3HTSB 4WXDA 5L3EA 4PDKA 4M9SA 2CFXA 3HOTA 1I6XA 2RC4A 3WTYC 2P5KA 1R22A 5L3CA 2MLKA 1ON2A 3WGGA 4L9JA 2JZYA 4CXFA 3R0AA 2DT5A 4F7ZA 4HF0A 5TRDA 3CLOA 3HRMA 1U3EM 2PLYA 3ABTA 4ESFA 3F8CA 4EJOA 1SMTA 4LB5A 1USTA 1SD4A 3E5UA 4L5JA 5ICEA 3HRTA 2MC3A 3EDPA 3GFMA 2DBBA 5FD6A 3L09A 2FBIA 3T0YA 5FGMA 1SAXA 2R7DA 4RB0A 2RDPA 4IPAA 3RTRA 5D6FA 3GXOA 3RYPA 3IC7A 1KU2A 2D1VA 1V4RA 1WRJA 3KP2A 1T98A 1T2KA 1H0MA 2V1UA 3K1MA 2BGCA 2FF4A 5BQTA 1Q1HA 1YLFA 2UZKA 2CG4A 4MNUA 3ECOA 1LDKB 2OZ6A 3K1PA 4KFCA 1XCVA 1TTYA 5FFZA 5LHHA 5HS8A 2VBXA 1FBQA 3FMSA 3FWEA 4LLNA 2ZKZA 4MQ9F 3LA3A 4GXOA 3CO6C 4ENNA 4I98B 5D4SA 3FZVA 1XSDA 4BH9A 3F8BA 5L3FA 3LQRA 3QOPA 3VEPA 3MAJA 4EGYA 2Z3YA 3DF8A 4A12A 1KU9A 1BI0A 3OV8A 2NAZA 1QZYA 2HWVA 3JSPA 2HQRA 3FXRA 4CYDA 3RPUA 5AONA 3WTSC 3ECHA 4KT5C 4MQVA 1LDJA 3I0TA 4U0YA 3D5LA 3HOSA 3K9TA 1W7PB 1LJ9A 5TJJA 5DD8A 3BDDA 2D1HA 1FY7A 3DEUA 3ZPLA 1WSUA 2BE5F 2DLLA 2W57A 4M73A 2VOPA 4KUMA 1XMKA 4EGZA 2OD5A 4P9UA 1AOYA 2MD5A 4IHSA 1HW5A 5FO5A 2HS5A 4S05A 4M6YA 2CGPA 1D8KA 2BYVE 3V8JA 1YW7A 1ZLKA 3ZMVA 2FU4A 3I71A 3ISPA 4HBLA 2HZTA 4M9ZA 2ELHA 1ZLJA 2KIFA 3QU6A 2P7CB 3R6SA 5E18F 3Q9SA 4MTDA 3HRUA 2HTJA 5D5UB 1B9NA 1U5TA 4QLCU 4AIKA 2W25A 4KNYA 4N9IA 4XBFA 4XSZF 1FLIA 1MDMB 1ZG1A 4LK1F 2H27A 5A2QZ 2IRFG 2OAZA 5DEQA 1R5GA 1S3JA 2VC1A 5FLXZ 5A2QK 3ZN0A 4NB5A 4KMFA 1OYYA 1LDDA 4KN4X 2W24A 2PEXA 5FLXK 1MZBA 2GIVA 3TO6A 4G7HF 1UHMA 3K2ZA 2L3DA 1WWXA 1T0FA 3RKWA 4HYEA 1KGSA 4EVIA 3V8LA 1D3YA 1Z05A 1IZ1A 2Z9OA 4D0PA 1BI2A 2ISZA 1IRFA 3F23A 2PJPA 4I01A 4RGSA 5L3DA 1R1TA 3QRFF 2FA5A 3F8NA 1NHAA 4KICA 1HKTA 5HDKA 1SFUA 1TNTA 1UCRA 2K4BA 1CF7A 1T38A 3HYIA 2IJLA 5BPIA 4A0XA 2KIMA 1FP2A 5D6EA 4LMYA 3P7NA 3MEXA 4UV8A 1H9TA 2PI0A 3T5XA 3RDIA 2A6EF 3E97A 3MZYA 2KRFA 3ZMTA 3C1DA 4HLXA 2X0LA 1YS6A 3P9IA 2FMLA 3CTAA 3T8RA 3COAC 4L5IA 3H92A 1RUNA 5F6FA 2GQQA 2C6YA 2VXZA 2D2WA 4FT8A 4R1HA 5ICFA 3TQNA 2FBKA 2XHKA 4LB6B 3SFZA 3EYIA 1U6GA 2IA0A 2ADUA 2XAQA 1PUEE 4OMZA 3GZ6A 4YIFA 4HLYA 3HIFA 4BXUA 1IUYA 2ZMEB 1LEBA 1ON1A 5DCFA 3IKTA 5LLQA 4B09A 1Z6RA 2M1BA 4LFUA 3KP3A 4AVPA 4ESJA 2MLGA 5LEJA 4O5VA 3I59A 4G9YA 5HS9A 5CVVA 5DDGA 4N0BA 1U8RA 2DTRA 2V9VA 4RGXA 3LAJA 3FXQA 1U2WA 2OBPA 1JE8A 1STZA 1OMIA 1IN5A 2HGCA 5CVIA 1G3WA 5ED4A 1I27A 1K78A 4H0EA 1ZYRF 3DQVC 1K7AA 2OU2A 2XAJA 3CUQA 3K0LA 1GHCA 1HSJA 3WGHA 3ML6A 2MBFA 1TQPA 2GWRA 2ZNZA 2CYYA 3U1DA 1OKRA 4LK0F 3E5XA 4KIBA 2AS5F 4IF4A 3BY6A 3E3VA 1TBXA 5LGNA 1ZN2A 3JW4A 2STTA 2L54A 1S7AA 2M87A 5D5VB 2CO5A 4M6XA 1LEAA 4ZH4F 5E8GA 4RB2C 2QZ8A 4UV9A 3BJ6A 4RS8A 4HX4A 2FQ3A 4OIQF 3E5QA 2LNBA 1SFXA 4AD9A 2XROA 3DP7A 4MEYF 4OIOF 3J7AO 2PFBA 2HYFA 3KLNA 1DUXC 2G7HA 4UVCA 4RAZA 4GYGA 4I7HA 4YG2F 2XGXA 4BHCA 5JHUA 3ULQB 2WC2A 3KP6A 4LD5A 2JT1A 3RJPA 2DI3A 2RN7A 1ZG3A 3SHFA 2UWMA 2STWA 1I1GA 2YX7A 1HW2A 5DD4A 1HXDA 1FWZA 4MTEA 4EM2A 3LWFA 4EMSA 3L9FA 2WTEA 5ICCA 3V7SA 1VTNC 1SD7A 4UVBA 2QM3A 3LQQA 2QENA 4PGHA 2GA2A 4GO1A 4KDPA 1J5YA 5FB2A 1SD6A 2XASA 2QQAA 1YW9A 1R1VA 3M8EA 5BPDA 2XKOA 5LHIA 2PG4A 4B8XA 1ONVA 4OINF 4OIRF 3I64A 3FXUA 1XGNA 1O3SA 2BEOA 4Q5SF 3TO9A 1IXCA 3KLOA 1L3LA 3HSRA 2FMYA 1ZG5A 5LGUA 2XVCA 1YTYA 2ESNA 4MHGA 2EV5A 2DK5A 4KIFA 2COMA 3VODA 4FX4A 4DNCA 3C18A 5LBQA 4O3MA 2E1CA 5LRSA 4P9FA 2K7LA 2P5VA 1P4AA 3MFKA 2HDCA 2A07F 3ZQ7A 2P5LC 4OIPF 3TOAA 3IRRA 1R7JA 2GXGA 5DYMA 1TLHB 2L4MA 3GX4X 4ENMA 1USSA 1BI1A 2HOEA 2EFWA 4YIIA 2JSCA 5BMZA 3PQJA 2MH9A 4LJZF 3ZMSA 2FBHA 3TGNA 3GUDA 1B9MA 1GXQA 4XLPF 2HEOA 3ABUA 2HFHA 2VC0A 2E7XA 4GCVA 3WU1B 3R60A 4A6EA 3DXJF 1IRGA 1I5ZA 1W5TA 1EV7A 2DAOA 3GWZA 5EEGA 1J75A 1E2XA 2ZXJA 3JTHA 3QP5A 3DPLC 4IRGA 1O7FA 1F1ZA 2LF8A 1H9GA 2FNAA 3KP7A 3P9CA 2BV6A 3GYHX 1XMAA 2QVOA 2A68F 2F5FA 4IJAA 1BIBA 3ZMZA 5KVRA 1FP1D 1XGSA 3QPHA 5K1YA 1P4XA 1BOAA 3KZZA 4A6DA 4HX8A 2EJRA 1XDUA 2PMHA 4ETSA 4CZZA 4A5NA 1L0OC 1QGPA 3DPTA 3LA7A 1LVAA 5HS7A 1YO5C 3WTUC 3FM3A 5J8FA 4M72A 3DKWA 5DCMA 2Z5UA 4M9XA 1BM9A 3R61A 3IL2A 1WQ2A 2VOOA 1QZZA 2G9WA 4E70A 1CGPA 3F8FA 3VFZA 1XSVA 3DFGA 4RB3C 3F6OA 5HLIA 1ZRFA 5DUKA 2K86A 1Y0UA 3P9KA 2EFQA 5J6XA 2P7VB 4ZYEA 4LLGF 3N97A 1FC3A 4L9VA 1KU7A 4A5MA 5ILUA 1SD5A 5F64A 1O3TA 4HDVA 1U5TC 2H6BA 1XGMA 1YG2A 2DPDA 1G3TA 2QBYA 2RNJA 3ELKA 2AXLA 1YFHA 1REPC 2ZCWA 2NRAC 2V1DA 4JK1X 3MZHA 3JSOA 1BN5A 2PQ8A 4M71A 1E17A 5CVJA 5K5QA 3GFLA 1MJAA 2DQLA 1LB2A 5HDGA 2A61A 4HX7A 4G7OF 2O61A 1MJBA 4MGRA 4CDGA 4U88A 1HW1A 4EM1A 3EYYA 4QWQA 1IN8A 3LSTA 3QP6A 5ICGA 3FMQA 2EA2A 2DW4A
chains in the Genus database with same CATH superfamily
4B9NA 4F4KA 4B3RJ 5LYJE 4U0WA 4KHPT 2E7WA 4RW6B 2XO7A 2RKHA 3MA9A 2FVQA 1MMSA 1RAAB 2CQXA 2DGOA 1EETA 1S12A 3HPHA 1YZ6A 2ZWPA 1B0VA 3HEFA 1MH4A 1VQ4I 5J2MB 3VTIA 4OHFA 5D6GA 2NNYA 1X9BA 4AL6A 8AT1B 1C2PA 3CDUA 1TT5B 4C0OC 2DU9A 3S16J 5JDNA 1X4PA 1KYWA 1YKEB 3M1VA 1WKMA 2UVVA 4DCPB 3D1HA 3HZEA 4X4SA 1HA1A 1TL7A 2MKYA 2KKHA 1JT0A 1NDPA 2BE7D 1S7EA 1XS9A 1PDNC 3MEEA 1VMBA 1C1CB 4USHA 1RISA 4KMUX 2CE7A 1ZGAA 3PR5B 4LREA 3BV8A 1W0TA 2DCLA 4ZLJA 2HHUA 1JLBB 3PFEA 1KQSR 3MKZA 4C3IJ 4DR4J 4KUMB 4RW8B 3OTOT 1IBKJ 2KQRA 3S2DJ 2IXSA 3NRXA 2XNQA 1R36A 3ILOA 3W6JB 2R7OA 5LOVE 2HVDA 3C66A 3NRYA 3J7Yq 1DPUA 2JQKA 1AU7A 2HWIA 1A35A 3W8GA 3G3ZA 3MM5A 5J1YA 3ROUA 2A69F 3RH3A 1RTZA 1IKVB 5AQFB 3FCVA 2PX9A 2G9OA 1CS4B 4L73A 4JYAT 1V54H 3AE7A 1LVFA 1YWXA 2BBHA 5KFYA 3QLHB 4NXNT 5BS6A 2ES0A 3HI9A 3C64A 4XICA 4EQQA 2DL1A 3VR9A 1Q95G 3AVSA 1FWPA 5HROB 5L1LA 1X3UA 1EJ9A 1Z1ZA 3A3NB 2Z2YB 1WH5A 2M7BA 1S6QB 2DJIA 1V5IB 1QNTA 2L7KA 1BXNA 2DOAA 1AUDA 4BYYA 1QBJA 3KEOA 3P49B 4LG3A 2Q9QC 4JI0F 4WFNQ 1ZH5A 2Q9QD 4D1QA 2ZJRQ 4XOPA 4KV8B 5BOXA 3ZXWA 2H65B 1Z0PA 1JJHA 5J1RA 1V6HA 1O57A 2ATLA 3L7WA 4TYAA 3A5XA 3BS9A 5K8NA 5KX5E 4HV6A 2B43A 2ROEA 3M2VB 1HBXG 2FHJD 3MTJA 5J1EB 3DI6B 3B02A 5K7FA 1EHWA 1K4TA 2GLOA 1V5GA 2XUBA 4DV3T 2ODUA 2D0TA 1LOUA 3MEGB 3W2AA 3GG0A 1P2FA 1KTQA 3I5BA 2W7PA 4N78D 1AUSL 5HI7A 4RUAA 2MC4A 4QIGA 3KLGB 2GAGC 2AJ2A 5FXXA 3Q86A 4KGVB 1KONA 3NWIA 1DLOB 3T1HT 4DV5F 3L7UA 3Q2TC 2LMDA 3TLSA 3KEQA 2UUCF 4ENJA 4ZPDA 4I02A 1G2HA 2XNRA 1XDOA 2H7VC 1UVNA 3AEEA 2KYZA 3SQNA 3RBZA 3WU2C 1TK8A 5D77A 5C4XJ 2AJFE 1HYSA 2X1CA 2COLA 3GCXP 2GJFA 2MZQA 3V5RA 5HMWA 3M8QA 1K79A 4UF4A 1EA3A 4CYCA 4OI1A 3JQKA 1G1XA 3FBNB 5IYBJ 4LBIA 3BJOA 2FD2A 3KE2A 4YR0A 3H90A 3GILA 3E0ZA 4LLLA 2JPBA 1TV6A 5A8RB 1UA0A 3S3NA 1LWCA 1OCZH 3VCDA 3H3AA 4CCJA 5AFUL 5LMNT 3BZ6A 3CE8A 2ZH2A 2K3IA 1QZEA 4RPFA 5ETPA 3GTKJ 5M3FJ 3SJMA 4HA8A 1YRNB 2Z99A 2WV0A 3MZIA 2AQEA 5K14B 2Z6EA 3I53A 5HLFB 3PIPQ 2P8IA 4NCBA 2N3OA 1UVIA 2G2ZA 4WXOA 2E34A 4IX7A 2YX1A 2FJVA 4UOFA 2DQRA 4QPTA 1YIJS 3BOQA 2EZIA 5JR3A 1WELA 1S72S 3M8PA 3SDGA 2CVEA 3T5LA 3Q83A 2FVCA 2MZTA 3P5TL 5F1JA 5DQVA 2HK3A 4IHTA 3I0RA 3MCSA 2ZXIA 3QO9A 2NPFA 4AKHA 5KG2A 3CDAA 1Y0NA 2PMUA 1LRZA 3RIUC 4NZ0A 4C90A 3GQCA 1K44A 2FOWA 4OU0A 1P27B 4HQMA 1X4OA 2JLEA 3EMTA 3S8PA 2LF7A 1RPWA 4IDPA 1QTNB 2RKIB 4NLOA 5JR9C 4BJTA 1T05B 5TISC 3EUHA 1F5AA 1C0UA 1DHMA 3NGKA 2CW0F 1A5JA 4NDLA 2IPQX 5IT3A 4WCEQ 3KLEA 3BH7B 1LNWA 2HNZB 2OEKA 4OI4A 3NMRA 1ZARA 4XLNF 4OZ1A 3WODF 3JRCA 2E5HA 2UXCF 4CLSA 3ZTQA 4WTYA 1S29A 3I59B 2YN6A 2IA6A 1HBOA 5I3QA 2E5LJ 3LDQB 3OFGA 1RWPB 1HKQA 4M5DA 2ZFHA 5IPAA 1S1VA 2LEAA 2UUBJ 1ETXA 4FYWB 3IA0A 5CVRA 2V7KA 5F41A 2E9XC 3GIKA 2D3ZA 2DK2A 3HZGA 3EETA 4P71A 4M74A 3NZQA 1IKYA 1MIVA 2HN2A 5AT1B 2FY1A 1DQ9A 2HHWA 4Z7YA 3WE2A 1SCJB 1OY9A 3A01A 3I0SA 4ZTFA 4Q48A 3NG8A 4HQEA 2MHEA 1GK8A 2L4AA 3TKYA 5IP7J 1K78B 2JPFA 3CKDA 1F43A 1FKPB 4HOBA 3OYZA 2N9DA 3AD9C 4D5CA 3IFEA 1H7WA 1O8BA 2YWKA 2DDBA 3HFZB 2VBZA 1SKSA 1RHJB 2XV4S 4L3NA 2KL4A 2M88A 1BIAA 1U1RA 2O8XA 2VG6B 1U9OA 3Q89A 5KT6A 2FQQB 4NLXA 2VA2A 5J47A 4FTHA 3TW6A 3ZMUA 4EK2A 4G94A 1YQ3A 2XRNA 2OPSA 3N6NA 3R7BB 4OYPA 1JGSA 2QEXS 2JVGA 3O6BB 4PAAA 2F4IA 2V1NA 3ZCOA 1XEZA 1G6BA 1H74A 2DKOB 3MDFA 2L9NA 1U48A 1IXRC 2EA4A 2DGTA 3FSYA 4WF9Q 1ACIA 3AD7C 2XIGA 3F8MA 4MKVA 2M4GA 2ISYA 3G1MA 4DIQA 3I0QA 1VQYA 4KSEB 2O1PA 3S1RJ 2ZM0A 3NEUA 4LF8J 3OMYA 4N9HA 2XMUA 4Q44A 4WP8A 5FLMJ 4KHPJ 1YBTA 4FHTA 4I6ZA 4ECTA 4HF1A 1RT4B 2ESHA 2FJBB 2NS0A 3H0DA 4KMCA 4GKKT 3IMQJ 3PFIA 4YEJA 4C91A 4DSFA 2MB0B 3J7AN 2NXNA 4PQUA 1GV2A 2ZOFA 1VQLS 2W85A 1BE4A 3BSAA 2COBA 4EGLA 2AMCB 4Q4ZF 4B3ST 5FVLA 1KLNA 5HLGA 1HKSA 2VH7A 2VKZG 4K2EA 3OYBA 2F5GA 1PP8F 2LCWA 1QE1A 1V3ZA 1XNRF 4LSLB 1QAXA 4EV6A 4RDUA 3N9LA 2CUJA 2W4DA 1Q82T 4EZ9A 2PA8D 5D0RA 3S3OA 2LOPA 3UDEA 2FJEA 4RW7B 1VHIA 4LF7F 4ILBA 3HKBE 5FFXA 4YXDA 2NR0A 5EZYE 1AHDP 3QPTA 3DLJA 5E33A 3OR1A 3VGSA 1ZTTA 5DDOC 2EV0A 1U6FA 2GAHC 2IM2A 1FOKA 3AE6A 2H4YB 3TAMA 2Z8QA 3AT1B 5FRMA 3GJRB 1UVMA 2AEJA 3OTOJ 5D5XB 2HXIA 2K06A 3M8FA 4XLFA 2VQFF 1XMOJ 3M9OB 4NXMF 2HVRA 1R3NA 1IN7A 4UVBB 1QJHA 5KFQA 4LIRA 2HMIA 2MA3A 1T95A 1B7TA 1R6VA 1DRZA 3BGRB 2E2AA 3R4KA 1XN7A 1HLVA 3A02A 1AA1B 5HEJA 4XLEA 2H1YA 5F3ZA 3F9KA 4Y2IA 3G8QA 2KT0A 3IUOA 1WCRA 1B72A 5JDHA 2Y30A 3VYTB 2F1FA 3H5UA 4JYAJ 2MGZA 5KFEA 3L2CA 1Y8RB 1JLCB 3DU5A 4WYVA 1I94T 1YJUA 3DDIA 2VQHA 3U9GA 3I1AA 2O03A 3FRZA 3BTLA 4NXNJ 2PMZN 2F63A 2CXEA 5DGAA 3B82A 2IS1A 2L01A 5H6RA 4UNOA 4ECZA 3M9MB 3SSQA 3EVOA 1JJ8C 3I4NJ 4XK8C 4WZMA 3RKYA 4I0WA 4C48A 2E36A 3HSEA 5LEKA 4K5RA 3THTA 4WTOB 4ZVSB 2W82A 1MWZA 4YTPA 3CWJA 4YR3A 2OLWA 1QUUA 1H6KX 5K5MA 2NLWA 1X2NA 4C11B 2FOKA 3G4SS 1NK4A 5EYRA 2KRRA 2X7IA 2QQ8A 2G0UA 3S14J 5HXHA 2CNNB 2QKMB 4CLLA 4K4YA 4KGMA 3MVPA 2XLIA 3P4WA 3DRPB 4C0HA 2UXNA 5JDMA 1UHWA 4DV2F 4KPCA 3OHBA 5D4PA 1A9NB 3FXDB 3JRAA 4ELVA 1HSTA 2BRLA 5DG9A 4DV3J 4MLKA 4NZ7A 3FQLA 1V5FA 2GMJA 4R5PA 4IREA 1HQ2A 3PEHA 1FF2A 4F8RA 5E20A 2FJDB 4AKLA 2A6MA 1EX8A 2WM9A 1LWFA 2NREA 3DTKA 4JI2F 2GM4A 1T0FC 2I38A 3T1HJ 3BCAA 3HHDA 4M8LA 3HKDE 1OYWA 2EPIA 2ALYB 3WTWC 2YWWA 3BP8A 2CHNA 2XDVA 2B4OA 4XDDA 4HWCA 3HSJA 1FBSA 2ASLA 3MAAA 1HIYA 5GAGJ 2G1DA 4FYYB 3PJWA 3GCMA 5HNFA 2KZGA 2UP1A 3IHUA 3ONXA 3ULHA 2Z2SB 3V5UA 4JB8B 1UVLA 5D8KB 1LXJA 4XN3A 4B3OA 4I6AA 5J3LA 1WI8A 3UQ4A 1BWVA 4H4OB 5CJ9A 1U1LA 1G73A 2V6CA 4Q8EA 3L2VA 4DR2T 4LF9T 1X79A 4I0UA 2JEJA 4ERDA 1V3RA 2D3OR 2HYIB 1PYOB 5JXSA 4PQAA 2EZLA 1S1XA 2KL8A 3BB5A 4RNNA 3B8HA 4X62F 3IRXB 4X1EA 3BG3A 1OCTC 4DUTA 1OEDA 1LW0B 1U9NA 3GW2A 1WKLA 4CLUA 1S35A 2PG8A 1ZTRA 4L0YB 2P6SA 1N77A 2E66A 5KFOA 1PGZA 2DNHA 2QT7A 3I4MJ 1TMMA 1HARA 1WACA 4HEAA 1JUMA 3KV6A 2F48A 1HW8A 4OX9T 4G1IA 1UJ6A 1S6LA 3J7ZI 1FSEA 1F9NA 4HTJA 1WOSA 2MGZB 4QPXA 1YJWI 4JX6A 2W4SA 3D6TB 4L72B 1XMQF 3M9AA 4AXIA 2IIUA 1HOMA 1DQAA 3N2KE 4I76A 4UQGA 2NS7A 2BA9A 4IYQA 2LSOA 4K0KT 3OYKA 1FJEB 3C6UA 2Y0MA 2YKSA 3GO5A 1EKRA 5IM0A 4JI5J 1MSEC 3CJ0A 1IGNA 3H4BA 4CI2B 4ICLA 3RKGA 1TQLA 4NZ6A 4OYIA 4CYUA 2MAWA 3TP2A 1JJ6C 5J1NA 2F2EA 2W01A 4FE4A 5H6QA 2DGXA 2EFOA 4X64F 2R4GA 2QBYB 3UPFA 2MQOA 4IHVA 2YU9J 3OHAA 4HACA 1N36J 3KYDB 1VOMA 1WF2A 2LHRA 2DNMA 3VV2B 2Y48A 2J0XA 4UHTA 2RGVA 1KQGB 1NSAA 2YKMB 3CUOA 3CF5F 3K3NA 1N0VC 2VBWA 4M1KA 1OQ3A 4BL0B 4DGWB 3RQWA 1N54B 2YR2A 2HQ5A 5CLSA 3R1HA 1NB7A 3TZYA 1BQNB 4LFCF 2XSJC 3UCZP 1RTIA 4ZC3A 4I2QB 3KJFB 4DV1T 1U2RA 2ACXA 2MJNA 2FRHA 5HLHA 3BR0A 1UTAA 1PP7U 2CPTA 3RAMA 3AJDA 1MLAA 4MK8A 2YU3A 5JREA 2D5UA 2L41A 1RHQB 2LBFB 1U6BA 5LP6E 1XG1A 1FI4A 4IZZA 5E3QA 1HG2A 3TW7A 2KFDA 1XNQJ 3MCOA 2P4WA 5I42B 5T14A 2OCCH 3CMMA 3TNVA 2L0KA 5ETLA 3Q5FA 3FBIB 3HUGA 2J5PA 3AE4A 4LF1A 3ZQFA 1OR7A 3IAM9 2OC6A 4KR0B 2G7UA 1EQMA 3C2PA 5LMUT 1B4AA 4TV9E 4LG0B 3WX4A 5BXIA 4PWDB 1UFMA 4KRWA 2K8GA 4F50A 2CUYA 3WGIA 3FBCA 3K70C 5GADI 4GKKJ 3FHZA 3JRBA 1TQIA 4BHBA 2WZHA 2OIHA 1PAEX 2C2MB 4K5SA 3TOQA 1WTFA 4IQMA 5DDPC 3LGHA 2VURA 3GFXA 3PKYA 4B3SJ 2CNOB 1YIOA 4DIDB 5CD4H 1JB0C 3HG9A 5AQTB 4AUKA 2WAQD 4LBPA 3ZT6A 4BQNA 1GT8A 3KG0A 3AA0B 3TZWA 4X4QA 1P4WA 2ZH4A 3B5MA 2V2KA 3K2YA 1V55H 5FIIA 3LFKA 3BSCA 2OEMA 1W4MA 5E3CA 2MLXA 2OP5A 4LVNP 4JV0A 4ILUA 3GTQJ 3NARA 2C22A 4G65A 2PN6A 3UUNA 1OCOH 3E8OA 4A8SA 2EFGA 3DLGB 3BJAA 2NSBA 3RB4A 4CQ1A 2YPRA 2XQ7A 4CYUB 3MPYA 2ZBQA 1FNMA 3SSRA 4M3BA 2Q2EB 2QMWA 3NOCA 1EP4B 1T8BA 5LSLA 2FLLA 2V8PA 4PSXA 3SZPA 2AYEA 2VFSA 1EH8A 2X6WA 4B6XA 1YHQS 2LE8A 1E6YA 2HIQA 3CZ6A 4DNDA 4AISA 4LFBF 1GTHA 1LXNA 3PW5A 1HW9A 3JADA 5EJCA 1RP5A 5L3EA 4PPZA 4M9SA 3TL4X 3DM2B 3F57A 1I6XA 2RC4A 2J6TA 3IP4B 5D4NA 1J5EF 4L6V3 1R22A 2FUPA 4IFYB 4IH7A 2BG9B 2QX0A 2JA2A 3Q8RB 4ZPAA 2VFRA 2J9DA 4L9JA 1T72A 4CXFA 3HL6A 2IDEA 1UW4A 4DQIA 2HQGA 5KFNA 1VRUB 3GYGA 4KX6A 1UVKA 1HNXF 4DZPA 4ESFA 3PDYA 3OWTA 2NTYA 2Y0BB 2KRCA 4LB5A 1USTA 4CTAA 4NCGA 1JLFB 1PJ6A 5AQNB 2IS4A 4M5LA 4MAKA 2DBBA 1X7VA 3B78A 5M2UA 2VIHA 3QRQA 3L09A 3R3TA 3JAEA 3SMZA 3KPHA 2DR7A 1FXRA 3OL7A 4CM2A 1IR0A 1LPQA 1RAEB 4FF2A 2ODVA 2I8DA 3TA0A 4TY9A 4IPAA 5G0RB 5D6FA 3UWTA 2HPLA 3QUJA 1X5SA 3AEFA 1V4RA 1QAIA 2HRYA 4NL5A 1SQGA 3BDPA 2R92J 1PG5B 3KP2A 3MHYA 3AOBA 1T98A 1T2KA 1H0MA 3CF2A 2KLOA 2VUGA 2BGCA 2NP9A 2IPOB 2W1BA 1NJYA 3AG1H 4DBRA 5IT9Y 2GOMA 1FFGB 1RWMB 3W2VA 1YLFA 5AE1A 4UOGA 3FZLB 4QH5A 2RS2A 2O8KA 4JUZA 3CJKA 2XGEA 1LDKB 2OZ6A 4KFCA 5LHHA 2C2EA 3LBXA 5FVKA 4AM3A 5CCLA 2E9TA 2CPYA 1U09A 3ZZPA 3UCGA 4Z90A 4Y6IA 4MQ9F 2HFVA 4ZP7A 3ZQIA 4NEYA 2AXDS 2NS8A 3T8OA 3FZVA 4B9VA 2QLBB 4ANCA 5ABFB 4DG1B 2BE9B 4CN6A 4NMLA 1QAYA 1JGGA 4ZHQE 3LQRA 4TLQA 3KJVB 5EGOA 4FS1A 3VEPA 1F0XA 1JI8A 1T9TA 2HHHF 4P7TA 4UUSA 2DMTA 1KU9A 1NSKL 4Q0BB 2Y3YA 2NAZA 4XPEA 3DWLE 5LXTE 2NW8A 2D3O1 1O5JA 1CQMA 3ECHA 3OPKA 2ME0A 4YSXA 3HOSA 5C8YE 1E3OC 2GXAA 2MFZA 4PWWA 2ECBA 4K4VA 1RUSA 2DY9A 5DD8A 4XNFA 3QPSA 4AU7A 2K9QA 3ZPLA 2EQRA 3NP5A 2BE5F 4OYBA 5K9FA 3SDEB 3DOLB 2QA4S 3GR1A 1X5PA 3MMCA 2VDHA 4N8NA 2PMZA 2XF6A 5ETNA 3IWNC 1XMKA 1TL1A 1GXTA 4EGZA 4IL4A 2MKHA 1RAOA 4BACA 5AXKA 3TVZA 3DYAA 1HF0A 5KDMC 4S05A 4M6YA 3CJSA 3LWMA 3PO2J 3K5LA 2JEGA 2CGPA 3HKZN 1H2VZ 1TWHJ 3EGNA 1ZLKA 2FU4A 3ISPA 4O4JE 1WJDA 2ZMAA 1R89A 1US7B 5IV3A 5DM7Q 4II3A 2KHCA 4G6TB 2KIFA 5J40A 3QU6A 2P7CB 2ROPA 1S1UA 5E18F 3Q9SA 3R97A 4UOCA 2HU9A 4DUZT 5FY0A 4PSWA 2ZMEC 3S32A 3J81Y 1B9NA 1S76D 4X4NA 3H2VE 3X1LB 2W25A 3K4BA 2V26A 1BA5A 1FLIA 5B0DA 4E98A 1ZG1A 2X9HA 5AQLB 2B6AA 4M3DA 2W9BB 4YMEA 3PV8A 4B3MF 3AHPA 2DHSA 4DV1J 2EW9A 1R5GA 4E7JA 4G63A 2O5RA 1S3JA 1WSVA 3BR8A 1MMDA 4WFBQ 2R8GA 2X1BA 1D1UA 5DDQC 2Y8DA 3EE3A 4DMWA 5EUHA 1GV5A 2XY6A 1FVQA 4JI7J 3C16A 4AD6A 1AFJA 4UY85 3C6TA 5GMEA 4EZHA 2QSFX 3FUYA 3VYUB 4P72A 3ESWB 1KC8T 2VG5B 4EVIA 1HR0T 4H9QC 1Z05A 3DHWC 3LWLA 2HIYA 4R0EA 2Z9OA 1S4EA 4D0PA 3UN3A 1IRFA 3F23A 3J80Y 2ERRA 1B0TA 3ETOA 1R7IA 2PJPA 1SVLA 4I01A 4Z8XA 4FKYA 2AU0A 1N75A 3SV4A 2LXIA 4CI3B 4FKXA 3FISA 2X1EA 3CCLS 2YINA 2MD0A 4USUA 1NSQA 5JDFA 5JRCB 1HKTA 3PUWF 3BR3A 3GWCA 4UVAB 5HDKA 2HBRB 3PUFA 4QCLA 5A2QU 3W60A 4ZDOA 4ILCA 3RYHE 3E51A 1N4LA 4PKDB 1X9MA 4F04B 1T38A 2Z4PA 3T9ZA 2FVRA 1IUFA 1RXOB 4ZJLA 1KS2A 2DEJA 5DG7A 1WR0A 2E44A 3MEXA 3O5TB 1KRPA 3BR1A 1H9TA 2GVZA 3UU3A 2RB7A 5K8PA 4NBQA 2MPUA 4OLOA 4P1NA 2R8JA 3MZYA 4PWUA 4N8OA 3HVWA 4CI0B 1S6PA 3I5CA 4O4HE 1BUXA 4ZP8A 4ED3A 4K4ZA 2UUAJ 2E60A 2X1GA 2HNYA 2XQ5A 4JV5F 3CTAA 1KVIA 3VGUA 2VQGA 3T8RA 2J0WA 4IG3A 3COAC 3BN7A 2IM0A 1TKTB 3H92A 4TLRA 5F6FA 2BHZA 4P0AA 2AYGA 2ASDA 2RQKA 4ZIVA 4IHWA 4M5KA 2CMPA 4IT4A 4LUBA 1M5VC 2VG7B 4LB6B 2JA8J 2C2KB 5HAOA 4RWXA 1H38A 4C4WA 5HLTA 1JKHA 2C0SA 2L48A 1SV5A 1CHUA 3FMBA 4DV7T 1WHVA 2DFHA 4X65T 4A3JJ 4HTEA 2XAQA 3AE3A 4ZP6A 4DL5A 3OSGA 2LP0A 2J0QD 3DRSA 3O6QA 3QNUA 3GV5B 2BJ9A 3ZQLA 3LK42 4MBQA 2BE2B 3HIFA 2JA6J 4BXUA 1U1OA 3L3CA 1IUYA 2V5CA 3QYYA 3I55S 1W9RA 2CJKA 1U49A 3ILIA 2BOAA 1VRTA 3M8SA 1D9DA 2WB1D 4B4CA 3FQKA 1FX2A 4HPQA 3D1QA 4QTRA 2XWYA 1E7PA 4M63A 1PCAA 2L5QA 3CCQI 1AZSA 1AT1B 3CC4I 4MFRA 2GGPA 5DM6F 2M1BA 4HNUA 1T08B 4PUOB 1SBRA 4KTQA 4AXPA 2Q9QA 4I55E 5IOZA 3G87A 4UUXA 4O5VA 1HNZF 1UWAA 2Y8WA 3IG1A 4ES3A 4OI2A 4GC6A 5LHGB 4O0IA 1SJRA 4ZK7M 3DC2A 5DDGA 1S7IA 1GXUA 4N0BA 1U8RA 4EEDA 3H9GA 3PIOF 4ITSA 3K4JA 2ZE2B 3LAJA 2MHNA 3TX8A 3FXQA 2ABYA 3A3OB 4C2UA 1BC6A 4DSJA 1XQIA 1U2WA 3VGVA 1STZA 3I32A 1IN5A 4ED4A 5ADXL 1R31A 2HGCA 2YY3A 3BKUA 3ILJA 3D68A 2W63A 1I27A 4A5XA 5KFSA 3C51A 2OELA 1NDLA 1ZYRF 3DQVC 3DCFA 2NPIA 2HS0A 4ILRA 5ITHA 3DDKA 3JTNA 3UQSA 5JDGA 2IM1A 4DR4F 2V4RA 3ONLC 2HAFA 3ML6A 2K5BB 2MBFA 3M30A 5FXWA 4WBFA 3W2WB 3MKLA 3CO0P 2GWRA 3VAHA 5JVGQ 5DETA 2QFJA 2BANB 4IKAA 2P9GA 3VZHA 3OXFA 1FK9A 2C2OB 4HTIA 3UFEA 3CDIA 5LJ5Y 1VQKI 5F8NA 4I1TA 3E5XA 2CQPA 1MNMC 2IAJB 4ZI3D 3N9OA 3H3VK 2WV1A 1RT6A 3DCAA 3F44A 2RQ4A 1RWUA 3DJBA 1ZN2A 3RW6A 4EMDA 3RYIE 2OPQA 4DX6A 5KFPA 1S7AA 2V7JA 2WONB 4B1RA 3M1CA 4COFA 2R8IA 3ETMA 3G1OA 3VAFA 3IAM2 1VBZA 4JYKA 4UV9A 1W2BR 1HF8A 2V4JC 3BJ6A 4ZVHA 4RS8A 2FQ3A 2V6EA 1IM6A 2FUG9 5LFAA 2LU1A 4OV1A 3E5QA 4JV2A 4LF5T 3CCES 2DISA 5EG0B 4MIWA 4R8UA 3FXKA 1SC7A 2HFSA 3K17A 5D15A 1HC8A 2LEBA 2Z2ZA 3HXLA 1M1GA 3NOGA 1SE7A 2WAQN 4BDZA 3RIUA 1DUXC 3I96A 4UVCA 2KMFA 3CSKA 3JREA 1S0OA 3LUYA 3OJUA 2QYWA 5JR9A 2X3DA 4YG2F 2N4DA 5DJQC 1P7JA 2CPDA 4BHCA 4NUVA 4ECUA 4X66T 4AKRB 1XC5A 1S9EB 4Y2AA 3M7VA 4B3XA 2DI3A 3SHFA 5A8WB 3ZLIA 2WOMA 3RYLA 4J9OA 3SCJE 1QSLA 2YH1A 5DD4A 2RDJA 3OY9A 2HBYB 1ETWA 1HXDA 3GA8A 4DR1J 3EAMA 1M5PC 1IVZA 5FROA 3LWFA 1WEYA 4NC6A 3E01A 4EMSA 1FKOA 3L9FA 1H0HB 1ELOA 3V7SA 3E3XA 2E9XA 1CPZA 4D3GA 5LG3A 4FZVA 1U5PA 2QENA 4OMFG 2GA2A 1H88C 3FBFA 4KDPA 4WXWA 5FB2A 2XMMA 3NCQA 2XASA 4D5FA 2QQAA 4WK1A 3LPEA 3OYLA 3ASOH 2DMQA 1YW9A 4H63V 2N4CA 4LF4J 5DLGA 1R1VA 2LKGA 2HHXA 3UULA 2NSCA 1M0SA 2ZM8A 2XKOA 5FKOA 3MCMA 2CZ9A 1U8SA 3MPUB 4YP3A 1REVB 4DUZJ 5A6PA 3MD2A 1YJTA 4PNIA 4IHXA 2CRBA 1NJXA 1ZG5A 4FDFA 1HI0P 4IG0A 5IXUA 2P81A 4A3GJ 3IAS9 2COMA 4E6KG 1EKEA 5FLVA 3C18A 3D7SB 5LRSA 3PO4A 1RC9A 4QXHB 3VKGA 1TUVA 2MKSA 3KK2B 2BHYA 4P9FA 4RAGA 1VQ8S 2P5VA 1KSPA 3T9NA 3ZYKA 5AQRB 4OJGA 1P4AA 1HDPA 2YNHA 3M2UB 4H9OC 1HG5A 1QVTA 4CO1A 5KFIA 4BC9A 2ZBRA 1R7JA 2WB4A 2WAFA 3V6DB 2VJUA 4ED2A 4H9SE 4IUFA 4XR6A 2BUNA 3ZZOA 3OBIA 4NPOA 2FJAB 1LKZA 3UE2A 4V19K 3ZMSA 2H1KA 2BDEA 2WS3A 1B7FA 3LF0A 4P2FA 4CLPA 4FASD 2GC8A 2GFFA 1S6OA 1RB0A 3GP9A 4RW9A 5CQEA 5L1JA 3UVJA 1QSYA 5DTDA 2CCQA 2IGMA 3GE9A 3KVBA 1BQXA 3VHLA 1FIPA 2OUMA 5KFVA 1MROA 2E5LF 2XYPB 5CKTA 3MM8B 3H7HB 2UUBF 4UVCB 3Q8UA 3GWZA 1E2XA 1KNZA 2KJVA 3M32B 5JR9B 2Z0GA 4BEHB 3UD3P 4CO0A 2AD9A 2DGWA 1FDBA 1KDNA 3DPLC 3B6BA 2LFBA 1NDCA 4IRKA 2LF8A 5F8JA 1H9GA 1SVOA 2FNAA 1X1CA 3KP7A 3P9CA 2BV6A 3CT9A 2I9SA 3ZO7A 2A68F 2D69A 2DPJA 1RWKB 2A6OA 3ZMZA 1YRTA 4IO1A 4CP5A 4FCYA 2WSEC 1YI2I 1RWVB 3D54A 3PUGA 2RF2A 4BS2A 2H8RA 2EJRA 3UKGA 2LSIA 3ESLA 3KV9A 3E01B 5J1UA 2ROGA 3UR0A 3B57A 3RI5A 1MSWD 2AX1A 2ACYA 4LOCA 2X0HA 2WSCC 4TX5A 4RNOA 3ZNJ1 2DXEA 5DCMA 2CV2A 2Z5UA 2XGDA 4DV7J 3KLFA 1JLEB 2MLYA 4ZLNA 4E70A 1AA7A 2D2SA 3R7NB 2JN6A 4KB7A 1QPIA 3CJQB 1WORA 1T8IA 2CFOA 1LVKA 1UFKA 5HLIA 5FD1A 2R7QA 1PYTA 2L9QA 2OA5A 4KT6A 3RZAA 5DUKA 2R7VA 3Q5DA 3GJSB 4P73A 4ZHRA 3NGDA 2EFQA 4HEA2 4ZVUB 3LP2A 3D5RC 1B8IA 4ZYEA 4LLGF 2V7IA 4Y65A 1HWJA 3GPAA 3HA4A 1WHUA 4A5MA 4K4SA 4KHPF 1LFPA 1KFYA 5AQIB 1WC0A 1NEEA 3BSNA 2LY9A 3AOCA 1N33T 3IS9A 3HJFA 3GV8B 2XLKA 2H6BA 2DPDA 1K61A 1G3TA 3HHLB 3UR3C 3OTBA 3QRRA 4F4YA 3ADAC 4OI0A 1JWWA 2POKA 1RT1B 5KCMA 3BQZA 1REPC 2V1DA 5KT7A 4LIWA 2QJ3A 1TP7A 4KO0A 2WZIA 3I87A 5K5QA 2OSQA 4K4WA 3DOKA 4JX5A 1LB2A 5HDGA 1Q5VA 2O61A 3IO1A 2VPRA 2AGPA 5KFDA 3PURA 4U88A 1HW1A 4EM1A 5FJ4A 1CULB 3OL6A 2OI2A 1SUQA 4FJOA 4IH6A 4KHRA 2BV3A 3FMQA 3W5ZA 1K6YA 4ZVGA 2NVYJ 3VSLA 3U7JA 4WCGA 5HVFA 1RT7B 4LIUA 1KF6A 2E5JA 3M2RA 5L9XA 3OTOF 2W7NA 4P52A 2CPFA 4ZYGA 4RBOA 4B3TT 2ZNYA 2GHVC 2W61A 3WX8A 3H40A 2QA1A 5K8OA 3GN5B 5AXMA 3N2OA 2BY0A 4NLPA 5K8MA 2QGFB 3L2WA 5GADU 3UO0A 2KRBA 1HFAA 5FLXU 3CO9A 5D8HB 1TKXA 3ETUA 2OQRA 2P6TA 1Y64B 4ZPCA 4J9UE 1Z6TA 2DNQA 1T6SA 1G4DA 4YHHT 1QY7A 4ZYDA 3HM5A 3J7ZT 4PCQA 1WG4A 4KN7X 3AEGA 4JYAF 3SZTA 2H8WA 2HQNA 1RTDB 4KI0F 4XKVA 2YDRA 2V50A 3ZMZB 1FNNA 5HEUA 1UPMB 1TL3A 3JSYA 3HZJA 4NXNF 3C3LA 3CMAS 4XKWA 1AFIA 2F3JA 5E0OA 1LWXA 3BQ0A 1F5TA 1UZDA 3F72A 1HKAA 2DA1A 4ITVA 4A69C 2V2VA 4E8UA 2EV6A 1FWKA 3CQXC 3SCKE 4AQYT 4OYKA 4U7UD 2XQ6A 4WP3A 2O3FA 4LF5J 3PG9A 1F2GA 4DR3T 1RZMA 1J9IA 4RGRA 4CA0A 3RHWA 3DRRB 2LDYA 3SYZA 2J6SA 4UY8T 2B7BB 1XC9A 2EB7A 3W6KB 3NGTA 3W66A 4GMKA 5CVUA 4YDXA 3ISND 2DHGA 2IDOB 4DO0A 1YVFA 1LW2A 3MR7A 3HB9A 1G3OA 4DV3F 3VAKA 2PE8A 4ZS2A 1S0NA 2DH8A 2YS9A 4ZVOB 3GTGJ 2D3UA 4ILLA 5J2QA 3IR5B 3NWGA 4D3HA 1YJNI 1C0WA 3FMWA 3FSIA 1U5TB 1XD7A 3V4GA 3T1HF 4UW2A 3CCJS 4ID8A 3H9QA 3AG3H 2F6CA 4J00A 1CJUA 1TK5A 2PJRB 4M5NA 3DOMA 3OQ2A 4Y2CA 3LSMA 3GSDA 3DDNA 1MMGA 1KD1T 9ANTA 3OL8A 1RADB 1GEHA 3TRGA 4KHMA 4KO0B 1T7PA 3ZN0B 1IQZA 1QPMA 4XLHA 2B0LA 4NYZA 4P5OA 1NG6A 4WF2A 5LSOA 4C9YA 3L00A 2WDQA 1G3SA 3RR7A 4NMXA 4P55A 3KHGA 4HE8A 1ZREA 2W9CA 2MGQA 2XSJA 3EGZA 1FFSB 1L0VA 5FL1A 8ATCB 2N7CA 2VL1A 4TV7A 1QTMA 4DSIA 1WG5A 4L3KA 4ZN3A 3RIRA 5LMNF 1HMVA 5FMNA 1RYRA 1KOOA 1QM9A 3SFDA 2UXCJ 1HQUA 2F5DA 1OYDA 3OL4A 2WVCA 4IFVA 1Y0HA 1RU1A 3DKYA 2IYIA 2JWNA 1HQEB 4WKRA 4U3CA 4JBAA 2LKHA 4HYKA 3EPZA 4U7BA 1Q81T 2AYMA 1GMVA 3K1NA 2RV8A 1CF7B 2EK5A 1T39A 2KWHA 4TNWA 2BABA 1QAJA 2CPEA 1RYSA 3OR2B 4LQ3A 2MYFA 2CQ0A 1CVJA 2DYRH 2M67A 2R5YA 4BXFA 1Z0XA 1VQMI 2VJIA 4KKOA 3KG4A 3W9IA 4RM2A 2ADBA 2CV1A 3ZMTB 2EWNA 2CZVC 1JNZA 1Y10A 2DH9A 2X0LB 4ZOLE 4OJ1A 5H20A 3B73A 4YJ2E 4JLEA 4OWRB 2H6CA 4G6DA 5ETRA 1RAJA 1UWBA 5D0GA 3AXJA 2XQCA 4IL9A 4KGXB 3N4MA 2K4JA 3BGLA 3WBZA 2VU5A 1YQ4A 3CJRA 2M0GB 3OYAA 3HDDA 2ZH6A 3QSYB 4TQSA 4BU2A 1UX4A 1ZP0A 2FZKB 4UF0A 1X4EA 3CCVS 1PILA 3QATA 1IZNB 2JWTA 2WAQA 5HQ8A 3MM7A 3IRWP 1KQ0A 3N6LA 4TU7A 4ZVQB 5KOXA 1L3VA 2ZBIA 2V8DA 1IR1A 2VODA 2KG1A 1R58A 1GVDA 1R5HA 4LF2A 1N36F 3GMEA 2NXEA 2LOOA 1VF9A 3MWMA 4Z2YA 1LNQA 1J59A 5K5OA 2BVMA 3UU4A 4ID5A 1PJ5A 3T1AA 5KFFA 3S1MJ 4GVLA 3BPXA 4ESBA 4IKFA 4Y15A 2ASJA 2IAIA 2W67A 4GVBB 4DL0C 4PJMA 3DU6A 3ONJA 3E1SA 2XMVA 4ISTA 4BCAA 2W00A 4LFAT 4C8ZA 1HI8A 3A7MA 4QR2A 2SPCA 1CJUB 5CYQB 1FXDA 2RAQA 2BXYA 3NRVA 3KWMA 3OYNA 2RVCA 2I6HA 4RGUA 1W7PA 3K5OA 4KIGA 5J4VA 1OPCA 3A12A 1MIYA 4LSNA 3BWGA 2LLYA 2CVIA 3HHKA 5D0HA 4AIHA 4F4XA 3WTTC 1XNRJ 2X6XA 1CJKA 1ZKEA 4A3CJ 1XNQF 3CD0A 1RR8C 3NAUA 2RAEA 2WW8A 5FDLB 3QSIA 3RR8A 1GVJA 4QH4A 4PJ0C 3O1HA 4X4RA 2DR8A 1GMUA 2J7WA 4WWCA 2YKNB 1K4SA 4LGWA 3IF8B 3CD5A 3ZJ2A 4DWIA 2I1RA 1SJFA 2XEXA 2KP6A 3Q0UA 2DNRA 3C2BA 1XR5A 4C3MA 2PBIA 1OCRH 2VL8A 1GQEA 3KLIB 4HKQA 4E7KA 2H3EB 3IH2A 4NXMJ 3H5NA 1KZHA 5C42B 3VB2A 3K10A 1N33J 1R23A 2ELJA 4GKKF 1N5YB 3DXSX 1Q8IA 4U9RA 4OZ0A 4GK0E 2H5IB 1U7LA 3VDXA 1NK9A 2QSGX 4WE1B 4HHHA 3LP0B 1XN9A 4B3SF 2R5YB 2JMHA 2E2JJ 3JSMA 3CCUI 4CN1A 3P3DA 2F9DA 4R8HA 1J5OB 1XK8A 3MR6A 1K73T 4NLUA 3LSRA 2CHOA 3BROA 3TYTA 2BQRA 4HDUA 4DX8H 2KISA 2VA3A 5HBMA 4O44B 1J5WA 1UMJA 3BG7A 4KQZA 2X68A 2MLZA 3KEYA 4DV6T 4F8HA 3CCTA 4IXAA 2DITA 3QPIA 4DQSA 1MDMA 5HVGA 2QSHX 2BM1A 4EEFG 1IN4A 4YHJA 3R8YA 2KSRA 1FJGT 3N05A 5T41A 3UFCX 2R2SA 2CWXA 2HPUA 2ZJ2A 3PUYF 3LAKA 1N8RT 3D0SA 4DYRA 4KISA 2EHOC 4RLQA 2Q6CA 1UEKA 3D0IE 1IQTA 2ACMA 3R2DJ 4ABZA 4Q45A 2MXYA 1SEUA 3TQEA 4EOZB 2JHEA 2YQ3A 2QYGA 3D3BJ 3EVWA 3BTJA 4IOBA 4TU9A 5J2NA 3N79A 4YT0A 1OIAA 3MUVP 3CQCB 3BSOA 4O2AE 4CO2A 3C8YA 1KA8A 3K8PC 3AE1A 4YN3B 3P45B 2JJ9A 4ZVFA 2NOGA 1I39A 2JEFA 2C28A 2ZFUA 1I94F 3HKWA 2BG9E 4ZPVR 1FDDA 5CB4E 1UB9A 2GCFA 5SZTA 1NK7A 2VKOA 4QQBA 1VS3A 1FSHA 1QLBA 1S9HA 4HGAA 1WJAA 3OUYA 3AFHA 1TQMA 1RDRA 1A04A 3L39A 1VK3A 5GAEI 2X6OA 5I3UB 1IG7A 1I3OB 3FEZA 2OEJA 1HBUB 4URGA 1TVRB 2YNIB 4DR3J 3NNHA 2OPRB 3I9ZA 3TWZA 3EI0A 3TJ9A 2F5VA 3W8PA 5KFLA 2HGLA 3KZIC 2V5HG 1NNDA 3N9MA 1RRJA 2I59A 4C8LA 1TU0B 1V3FA 3LANA 4U8YA 5F0WA 4Q5VA 2K3KA 2CJAA 5EX3A 1ETQA 2CH0A 1WI3A 2AXTC 2KJCA 1LEOA 3NBPA 1BLUA 5KG1A 5E1XA 5LHIB 2EKYA 2H94A 1QSDA 1SH0A 3O3KA 3VAGA 3NS6A 4BY1J 1U1QA 3TAPA 3GTYX 2R7RA 4GYIA 2YBVA 2HQIA 4CO3A 4CIOA 3HKCE 3MQ0A 4L9NA 3N9UC 1RIOH 2M70A 1R8CA 5LGUB 3A8EA 2NS1B 2ADCA 4USTA 2B9XA 5JI6A 4E7ZA 3UUXB 4HV5A 4C2TA 1HNIB 2PEBA 5JVTA 1QQIA 5MAOA 3LAPA 3LFUA 2VLAA 2ZMEA 1M5HA 3DGVA 2FGOA 1TWCJ 5CCMA 1BR0A 2DRBA 4NI2B 5EGYA 3CF5Q 1FVSA 3AB3B 3H25A 1C0TA 3JTPA 2J62A 2D5VA 1H72C 1SB6A 1Z77A 4KA4A 1C4AA 4DR2F 2F8MA 3F2EA 3MK7C 3D0GE 4J9QA 4U0VA 1MKMA 2XPKA 1IW7F 2A18A 2RREA 2HWTA 4IIJE 4F4AA 4F91B 3HHHA 2Q1LA 2FC9A 4RKUC 3H37A 4M5GA 2JK3A 4X64J 3D6FB 3ABKH 4HWIB 2QO3A 4BNCA 3BM7A 5M2RA 4L75A 2IFXA 5HP1B 2EVZA 2OZUA 3MEDB 2KHDA 4HF2A 2EK1A 3PUVF 4OX9F 5EEHA 4HZFA 1YRXA 1ZOTA 1HX8A 2IA2A 2R2TA 2ZH1A 3AA8A 4PFPA 4CH0S 4Y2MA 4LFCJ 2DK8A 5A0YA 3C14B 2DHAA 1MU2A 3T5KA 1XMBA 2XC9A 3CJ2A 3FSXA 1MBJA 4J91A 1M62A 3RCOA 1S0VA 2LVSA 5LNKA 1X4GA 4HFHA 1ZAWA 3CCWA 4K0KF 1MN9A 3D9BA 4DPTA 1TW2A 3CCSS 5LGTA 3O8HA 1S5LC 1ZAOA 2WMOA 1HBMA 4CZZB 5F0FA 2EG2A 4CO5A 1R6RA 3CCQS 3QIPA 3R5BA 2C3PA 3QWPA 3I54A 2O01C 3AFGA 2ELKA 3KHHA 4PK6A 2G2YA 2JNJA 2YEVC 4ZZCA 2TDXA 3QFHA 3MR3A 2EC0A 3KYLA 2DYAA 3BZKA 3HOUJ 4PABA 1EARA 2E5IA 3V42A 2CBIA 3N5BA 5E3PA 3QWLA 1C1BB 4I7FB 2KXPB 2XZDB 1Q7YT 1PUFB 1RT2B 2XBPA 3ZKRA 3FC9A 1NKEA 1FERA 5DV5A 4DZDA 1GH8A 4IOAF 2OTJI 2LYVA 7AT1B 4URQU 2ILZA 3E22E 4DV1F 1T9UA 2CBJA 2OPPB 3F6VA 3H5YA 2IJFA 2KKOA 3UW1A 3FKIJ 2E5GA 2KZMA 3KV5A 3JSBA 4JI7F 4DUYT 5D5WB 4JEUB 2HZDA 2L9SA 4IDOA 3HT0A 2BQUA 5B0CA 2FTRA 4D7MA 3IN5A 2E5ZA 1RHKB 5IOYA 1SFOJ 2BRKA 1U47A 2D45A 3M8ZA 5LCYA 1V9DA 5T7LB 3RYFE 3HOVJ 1TKZA 1VQKS 4NE9C 2DA2A 5CYMB 3MPDA 3UU5A 4X4UA 1EIYB 1VQ7S 4J9VA 3BZQA 4OYMA 1GLNA 2G0IA 1DTTB 1RBAA 1KWMA 4W98A 5LMUF 4G7ZF 4RA2A 3QIDA 1XIQA 4F0HA 3RC3A 2KO1A 2DPUA 1Y5LB 3CO7C 1VCSA 1T56A 1AB8A 1U0HA 1WYBA 5EDNA 3ZTOA 4MKAA 1UAWA 5J0ZA 4FBUA 2LYCA 3AE5A 2CQNA 4N7TA 2DA3A 1O6XA 5GAHJ 1E1HB 4E7IA 3I0OA 1TWGJ 1JTYA 2A10A 3LA2A 3TO8A 3K1SA 3IH3A 3KK3A 3RRGA 4KBIA 2WDVA 1VQNI 2E35A 3K8WA 4GK5E 5DQWA 1CJVB 3SZ2A 4AYBN 1SC4B 2BS3A 3NRBA 4DV6J 1DPRA 2I0XA 2HQDA 3QT8A 5EF6A 1YYVA 2O3DA 2BS2A 4Y33A 1HNXJ 2PGCA 4TVAB 5G4DA 2XS5A 1BW6A 2IVYA 3C2GA 4J01A 1IJWC 3GFJA 1JLGA 2VV5A 1W25A 4U95A 1FJGJ 5C44J 2D9OA 4HH0A 2VPLA 2CIMA 4QIEA 1VISA 5AQOB 1SH3A 4GYRA 1S10A 2NCKL 3KP5A 3LW5C 1RKTA 3OTCA 4RZRA 3QAHA 2UXXB 5CH7B 1Q8LA 5ERIA 2YKQA 4HHUA 2HBQB 4DEZA 3LSVA 5KT3A 2HH7A 2Y75A 4BY7J 2JX2A 5ETSA 3VWBA 3SYTA 1VJWA 5D4LA 3EVMA 4LBHA 4NC7A 2V4JA 1F5BA 2X1AA 1ODDA 3G8TA 3F31A 3OBVE 5LSRA 4X20E 2NZ4A 4EYHB 2CWYA 4C2MJ 2DOEA 1NH8A 1XGOA 3E6BA 4KITB 2MBGA 1RT5A 1VQOS 2D1CA 2UVWA 2N1GA 2Z33A 1SL0A 4FYDA 1N5TA 2HKXA 1K6OA 2W9AA 4OX6A 3OVSA 5GP9A 3ZC0A 4HW0A 2HVEA 4UXNA 3RYRA 5U47A 3JAMZ 5JFRA 1R8PA 1DTQA 3PM1A 1RI7A 4NC8A 1IKWB 4XORA 1X5OA 2VICA 3JAMK 3HVTA 5ILVA 2FD5A 3FX3A 3B4DA 4QPOA 3V81B 2ZHAA 1HBNA 5ABHA 1P8GA 1WI9A 4JBWF 4HFIA 4ZZLA 1W36C 4ALZA 1I1SA 5FKYA 4EIWA 3RKXA 3PFYA 1WOOA 1Y5NB 5KFXA 2EZHA 3HTSB 2QN6B 2CJQA 4PDKA 4YB1P 2M7AA 4W1UA 3BLYA 3HOTA 1V5VA 2HHTA 4G12A 2L9RA 4NLDA 2HHHJ 1WNEA 2GQ2A 2DT6A 5L3CA 2MLKA 3KG1A 5L9NA 3UN2A 4WFXA 5HSPA 4DL7A 4NOHA 2OO4A 4IDKB 1QRYA 1YJ7A 3IBWA 1N56A 1LKXA 2AKWB 3PVXA 3IHRA 1HWKA 1WFDA 4GFBA 4IDQA 4EEBA 4HI2A 1U0HB 2CXFA 3UI3A 4QWAA 1WUUA 1R4NB 2UXDT 3AB2B 3VGTA 4OHZA 1UK5A 4EJOA 2XB0X 2F40A 4OJ3A 3E5UA 4L5JA 4XK4A 2IJRA 2E8IA 2MC3A 5EK2A 4DW6A 1FD2A 2HLUA 2Z2LA 4IQXA 3EDPA 3GFMA 4RW4A 4PG7A 1LWEB 4USJC 5IS2A 1FRXA 3PL8A 1UKUA 5FGMA 4BHQA 1YE9A 4YJ3E 3E2EA 3DTEA 3PJAJ 1M5SA 4NA2A 4V1Av 3RYPA 1BD6A 3KLHA 5GPCA 1KU2A 2K3FA 5CHCB 2D1VA 1WR6A 4CXYA 1WC3A 2NVQJ 1EB0A 4ETZA 1M1EB 3ZQGA 2XULA 3GB0A 2VQCA 4OYOA 2LKSA 4DL2A 1UP1A 3I56I 3K1MA 3BQLA 5H9FK 2XAHB 5BQTA 2MQLA 3N6MA 2B7EA 2C42A 1Q1HA 5L1KA 3TLUA 1IKXA 3ET6A 3PJRA 3ECOA 5EHHA 3K1PA 2CLYB 1TTYA 3CDBA 4QBUA 4QU7A 5FFZA 2WBRA 5I4MA 3OS1A 2VBXA 4DCOB 3UCUP 2ZKZA 3LA3A 4LR7A 1V9OA 3C19A 4ENNA 5TAOA 3O3LA 4ZLPA 5FY7A 4IO9F 2UUWA 4ASKA 5IT0A 3RX6A 4OHVA 3IBCB 4MHCA 2KPMA 3G86A 4BH9A 4ZVEA 4RW6A 3GMGA 3S3MA 3QOPA 3ZNUA 2LLKA 1WJFA 1OY6A 4GOUA 4QHOA 3RW7A 4YELA 2BJDA 3N01A 2Z3YA 3QC9A 4IL6C 1APLC 2FDNA 4EO6A 5J2MA 1H7CA 2GIQA 3OV8A 2Z56B 1TK0A 3IBPA 3QYBA 2FIUA 1JKQC 2V69A 3S8SA 1JUSA 2KN4A 3JSPA 2QKLB 3FXRA 1PKUA 2Q79A 4CYDA 2WWVA 1CUNA 3WTSC 3P4SA 3HVTB 2DXIA 5FKMA 4JUYA 1OLTA 4DXLA 3I0TA 3D5LA 4U6PA 3K9TA 4HG2A 3ITHB 4IOCF 4H4MB 1C1CA 2D1HA 4X1KE 1FY7A 5ETWA 2QTWA 4PXCA 4EXTA 2CV0A 3ZZUA 1IRZA 5FXVA 2V2ZA 4O3PA 4DUZF 3RTVA 2C5JA 1JLBA 2FZGB 2OHDA 2F4VJ 1HFEL 4USMA 2NR4A 4KUMA 4JI8T 4RW8A 1IN0A 2OD5A 4BJ5C 4A8YA 2V8HA 3SQGB 2MD5A 4IHSA 2KXHA 1YOVB 3PRBA 1T8EA 2PMZD 3OYHA 1QHGA 3ZC4A 2JUCA 5FO5A 2PIIA 2RMLA 1UJ8A 2CQCA 3D5SC 2BYVE 4FS2A 2IGNA 1VI7A 2JC1A 2M9HA 4BUPA 1IKVA 2D9PA 2HZCA 4YY3T 5LB7B 5KG6A 3PO3J 1SJ1A 1CS4A 1NK0A 1ZLJA 3PW0A 3EM1A 2MSTA 3I6PA 4DUYJ 2GO8A 2QGUA 1RLCL 3QLHA 3MMBB 4FETA 2DCUB 1OCCH 4GKJT 1SKRA 4G1QA 1HR0F 1YGYA 1T0TV 5HROA 4YTNA 5DM6Q 5D5UB 4I68A 2Y1IA 3UD4P 1S6QA 2QA7A 4N9IA 1S4FA 2OCEA 3I5AA 4EBCA 3AA6B 1YX5A 4BA9A 2D74B 1NJZA 1JLAB 4CT8A 2IVFB 2DJWA 2N3LA 3PIOQ 1FCAA 3N9PA 4KV8A 4CWBA 2LA4A 5FLXZ 3TEDA 3D28A 2FJXA 4NB5A 2CXLA 4TNOA 2EKNA 4KN4X 2W24A 3M2VA 2IY5B 4CCKA 5FLXK 4DR5T 3DI6A 2GIVA 1WG1A 2BACA 5F8HA 3MEGA 3K2ZA 4HFBA 2L3DA 5IYCJ 4O4GB 3CXCR 5AQSB 4LJMA 3MEKA 2Z30B 4O0NA 4HYEA 3C98B 4OYXA 1B7YB 2QVAA 1MWYA 3KLGA 1Q0NA 2IAKA 3DEEA 2OLTA 1DLOA 1S79A 2BKOA 1P1LA 1HNZJ 2X0YA 3PV0F 2FA5A 3F8NA 3TARA 2NXUA 3MMAB 2HG4A 3HJEA 3FRYA 4KICA 4Q7AA 1JT6A 3H20A 1S9GB 1TNTA 1Z7LA 3FKJA 1MBEA 4N77A 4NQWB 4WBOA 4PYAA 2W2QP 2L7FP 3U78A 1ZZFA 4TUYE 1NH3A 3KYCB 4A0XA 4F6RC 4NRTA 4DV7F 4X65F 3H5AA 1VYAA 3E97A 2DGVA 5E3MA 2KRFA 2KFZA 1FRKA 4HLXA 2VFTA 2GVDB 3KUGA 1VQPI 4CH7A 2E1AA 5A8RA 2RRAA 3OTDA 1WGXA 2Y0SN 1LK7A 2DNGA 3J81U 2IBOA 5ADZA 1YRNA 5K14A 3S17J 2VZ9A 1RUNA 5HLFA 3MUTP 1Q8KA 2VJ4A 4EO8A 1RCOB 3MZKB 2J8AA 2GQQA 2C6YA 1FEWA 2HHSA 5M5XJ 4A93J 2VXZA 4LR9A 3K8VA 3MAHA 4GDFA 4FT8A 4R1HA 2IGOA 5ICFA 3MKWB 4USWA 2XHKA 4F67A 2EPFA 3EYIA 2UU9J 2BVZA 5E5NA 2XS7A 1X3WB 3D1NI 1U6GA 5SUHA 3K3OA 3DHXA 1TAUA 2HWHA 2OH2A 1JLQB 5DS9A 2IA0A 1YSJA 2AIRB 2GX8A 2I5JB 5EZHA 4KC5A 3CULA 2LT3A 3MMYB 4YLHA 3VF0B 3GZ6A 4F2SA 3ENVA 4MLOA 1K1QA 4U2ZA 2LM2A 2JRKA 3LNQA 2ZVSA 3PJXA 1OMSA 2RKIA 1T05A 1ZM9A 1TWAJ 3J80U 3LSPA 1LEBA 4G1QB 4PK5A 2M7SA 1NAFA 5DCFA 3J7YJ 2ZC2A 3IKTA 1ZETA 4L74A 3AXMA 1PJ7A 4ED0A 3BT9A 3KK1B 3MD1A 4U7CA 3OYDA 2HNZA 4DN0A 2WCAA 1C4CA 2BKNA 1JIHA 4LFUA 2XAFB 1VQMS 5D3GB 2WTFA 2MLGA 2CRGA 3LOUA 3Q24A 3I59A 2WRMA 2ZOMA 1W7WA 1SJ3P 5CVVA 3HOXJ 4MT1A 3HK2A 4OQJA 1UCNA 2AT1B 3DN9A 4MIBA 1WPKA 1N34T 4YOEA 2OV7A 3LH2S 2DTRA 2UXDJ 2DY1A 2HVZA 2M52A 1SC3B 3KNGA 1IJFB 2QFIA 1S1TB 2A2FX 1X0FA 5F27A 5IP6A 2JZ5A 3K0JA 3MXZA 2CQ1A 4DVDA 2WVDA 1X58A 2CJXB 3P96A 1G3WA 1S48A 1E6VB 1K78A 2XYGB 5ETOA 3FKBA 3C2HA 5DRKA 4AYBA 1FKPA 1RA6A 1K7AA 2YNGB 2OU2A 5KHDA 3EABA 3ZZZA 4DPXA 4UZBA 3RYCE 3EPIA 5AQMB 5L3BB 1W0BA 1HSJA 2LFVA 3WGHA 2VG6A 1U26A 4XDCA 3AL0C 2XF7A 3R5DA 2DHXA 4CLWA 3NNAA 1JTXA 1H73A 1X60A 4LF5F 5MLCV 4HLBA 4WIQA 5KMGP 1Y1VJ 3U1DA 3R2CJ 3T19A 1OKRA 4XN0A 1K8AT 4M95A 4TXSA 4XTTA 3O1IA 2AJQA 3PSIA 2AS5F 3CWZB 4A8KA 1FRLA 3UUBA 5GAGI 4IF4A 5DS7A 4CNYA 2R5ZB 1TBXA 3C46A 1ZELA 3EDUA 2CO5A 1VDHA 4XRMA 5H9EJ 4M6XA 4KGKA 2CQ3A 3CCYA 4ZH4F 1ZV4X 1R0CB 2F4MB 2E1OA 3EXCX 2QZ8A 3S4UA 3MR2A 3V4IB 4J9MA 1RT4A 1Q8BA 4Z2XA 2FJBA 2WADA 2YNFA 1WJBA 5IP9J 1L5UA 5E3LA 4OIQF 3MPWA 2LNBA 2NWBA 3IM8A 2HFNA 3CJTB 1ZOYA 5BMVE 4ECSA 1QDUB 4AD9A 1N52B 2K1RB 1VIOA 2JJ7A 3DP7A 4MFBB 5H1SV 3SFGA 2XY7A 4V19X 3EUHC 3FIWA 5GAEU 2JRSA 1IBMT 4CN4A 2HYFA 3U21A 2G7HA 2XPUA 2BQ3A 2CA9A 2KH9A 4JI3T 4LSLA 1OWXA 4Q43A 4GYGA 2P9CA 4U33A 2Z58B 2A2CA 5LOQA 2UXBT 5JHUA 4RW7A 2ZH7A 4OHWA 4TYBA 3G71I 2PMWA 1X2MA 3RJPA 1YIJI 2STWA 2B9SA 2RNGA 3CCUS 4JI8J 3NXZA 3W65A 3BZCA 3B13A 4USIA 3OD2A 1RTJB 3ZN1B 1VTNC 2HGMA 4U31A 1SD7A 4UVBA 2QM3A 1R4MB 3T6JA 3LQQA 3ZQCA 1U4BA 2E9XD 3BGRA 2GOXB 1H2UX 1K9MT 2JLGA 1KQKA 3TBIA 2BDPA 3GZNB 4AKIA 3ISZA 5HCJA 1NCLA 2NVUB 2CUZA 3KDOA 1JLCA 4O3SA 5B0BA 4OAZA 3IWLA 4B8XA 4LFBT 3D0HE 3EUNA 2ICWG 4GKJJ 2CM0A 3DLAA 2HVQA 1XGNA 4M3GA 1O3SA 4Q5SF 4LRFA 3KLOA 1L3LA 1S1WB 3PSFA 2FMYA 4DR7T 2XVCA 3IWXA 1NK2P 2ESNA 4BAYB 4RU2A 5E3RA 1NDKA 3SQOP 2RILA 4GO7X 4FX4A 4C11A 2XG8A 3ZTSA 1X4HA 3GJQB 4M5HA 4J9PA 3MJXA 1FT8A 2AGQA 2JMKA 5IHYA 1UETA 5JVHQ 5C4JJ 3DRPA 2A07F 3ZQ7A 3HHLC 4PG5A 2E7VA 1RKWA 3VR1A 2OKQA 2ZB9A 4OIPF 3I82A 1Z67A 2R7TA 3PYFA 2JA7J 5TGTA 1WJ9A 3R1LA 4DR5J 3GX4X 5LM7E 4IRCA 2GHPA 2CWKA 4OFZA 2XGPA 4B02A 1CJTB 1W26A 3H4DA 3DMJB 1BI1A 2HOEA 4QXBB 4IGUA 1H8AC 3OVAA 3IP0A 2FJDA 2MH9A 4E4HA 5BR8T 1SL2A 4MKYA 1GXQA 4P9SA 4IR9A 3U1MA 2YNFB 1N32T 2LY2A 2BXZA 1M1KT 2EEYA 3DNCA 3PRVA 1OCPA 4F7VA 5B1BH 5DZ6A 2E7XA 3BG5A 1HNVB 1H7XA 1MBHA 5L3GB 2QF7A 3OW2R 3JYTB 4C9DA 3CDWA 3OYMA 4PG4A 3KJQB 2HRUA 4DV0T 2JRMA 3I9V9 3BO2A 2OTLS 5AQJB 5EEGA 2BJ1A 3SCIE 3HM9A 2VDIA 4A3IJ 3PX4A 4LSZB 1F1ZA 3AAEB 4K4UA 4K59A 4H4OA 1RT3B 1NHUA 2Y1RI 1UELB 3UDCA 2BW3B 3NWSA 3HSDA 2CQIA 4IJAA 1B4SA 4UUWA 1FRMA 5KVRA 2BMBA 2EFVA 1FP1D 1XGSA 3QPHA 3IRXA 5LBMA 3HD1A 3BG9A 2DI4A 3KZZA 2ZZTA 4HX8A 1LW0A 3MUMP 3SV3A 4B43A 1D1BA 2PMHA 1VQLI 4CXWA 4C8KA 1X3ZB 1N33F 1SC6A 3N5FA 2CW7A 1DP3A 1YO5C 2F9JA 5J8FA 4F36A 3HKZD 3RAQA 1YBAA 5F08A 4U7UK 1NHVA 3UD5A 4C3HJ 3HFKA 4QWCA 4ILAA 3IL2A 1QZZA 5A2QY 3FXMA 3F8FA 2HVSA 1T03B 3EJMA 1XSVA 4NIQA 4F92B 4UQTA 3DFGA 5AJ3J 3NNCA 3LAMA 3M6VA 3PUSA 4A8WA 3RC8A 3P9KA 2WB5A 5IC4B 2IJNA 4K2XA 5J6XA 4YSZA 2P7VB 4BBSJ 4FXDA 3O4XE 1JNRB 1DY3A 2A5WA 1FNOA 1Q1VA 2U1AA 4S0MA 1SD5A 2Y2ZA 4BJ6C 1VQ9I 2KU7A 4L9IA 3RB0A 5D0EA 2B9EA 1OS5A 3C4XA 4N56A 1U5TC 1YG2A 4B3TF 1WJEA 2KT5A 4ANEA 4CCNA 2LQ9A 1L3TA 3SEZA 2ASYA 2QBYA 3H59A 3ELKA 2EBGA 4U8VA 4UR9A 3RB6A 1N34J 2XHWA 2XQYA 5B7WA 4JK1X 1H98A 3ZT7A 2GBYA 2FLOA 3A1YG 2VQET 3SFIA 1WRDA 1QU3A 4A46A 4K0UA 1SKWA 5M4YA 3ZJ1A 2CUFA 1I6ZA 4ED1A 3CC2I 4HX7A 4C8YA 2R2UA 2YKMA 3WAKA 4YHHF 4A3EJ 2QGSA 4L5GA 5CJ5A 3A8YC 3BH6B 1NU4A 1BQNA 2VPWB 3ZRGA 5B09A 1WC4A 4I2QA 3KZYA 5HN0A 3LSGA 5L3FB 3FBZA 3PUAA 1OFCX 3G4SI 2EHOB 3R5CA 2NUHA 3BQ1A 4A8FA 4JOUA 1IF1A 1RQ0A 2YH0A 3C7JA 3L9ZA 2LEHA 3KHRA 1B6AA 4C8OA 4CT9A 4AQYF 4JP8A 3V4MA 3M65A 4OZ2A 4DR3F 2J9DE 2LBFA 4B3MT 2VD3A 4U2YA 4WK8F 3DLKB 4ZJOA 2V8VA 3L95X 2E71A 3G73A 1ZHCA 3RQIA 3Q8QB 4R79A 1Z21A 2H3RA 2K3PA 5I42A 2M3DA 3W9JA 4KY3A 3BBCA 3OR2C 1AKHB 3QGGA 1YXRA 3VPRA 1U2FA 1NRKA 2C2ZB 3KJNB 4E7LA 4F4ZA 1TKDA 3BQKA 2AWZA 5LMNJ 5KAIC 1IBLT 1JJ2R 2NTXA 2XC7A 2VASA 3TVYA 5HXEA 3ANWB 4XRSG 2X3GA 2K5CA 2BBJA 4OV6A 4LG0A 4O3OA 3QAUA 4PWDA 1QHHD 3ENWA 3D66A 2BS4A 4E2FB 2F5CA 3FZKB 4B9MA 3JAFA 3ZSTA 5DJBA 2VONA 2KFYA 5E3NA 4Z91A 4DLEA 4NLSA 4CHUA 2HS3A 5EX0A 2UV1A 2DFIA 3EICA 4M3EA 4ZVRB 3PXGa 2KZVA 1T9WA 4OYJA 4TWDA 1HNWT 2XM2A 3ZMVB 1ZZNA 3GVAA 1XSXA 2V94A 1RNLA 3PX6A 2NQPA 2HKOA 3H98A 2M30A 2CUEA 2IMOA 4QYZJ 5F3TA 1X0PA 2XGQA 5JLXA 2XQ3A 3HTUA 3MM6B 3CCMS 4CCOA 2ECCA 3AY0A 1N25A 2BJ7A 3M8YA 3P5JA 1KEKA 3ZXSA 3AQPA 4M1PA 2KYXA 5IWAT 4BWMA 2BW2A 1M90T 3OYGA 4ZVPB 5IOLA 4F93B 2GIFA 1S94A 4IHJE 3DLGA 4FX0A 3CCRI 1Y11A 2LSJA 3BTCA 1DQUA 2EFPA 4XBFB 4RJVA 2Q2EA 1VQNS 1RK8A 1EP4A 2H89A 3CIZA 2VQLA 2IT0A 3MM9B 1MD0A 1D8JA 2MQ8A 1D8ZA 3MKYB 1L3SA 3HCXA 6AT1B 2LVWA 4I69A 3IWFA 4WXHA 4F55A 4I0BA 2KB2A 2W2UA 2IS2A 3JTGA 3DM2A 1Y9OA 2VKEA 5B3SH 4BE1A 3E6CC 2RD5C 4IFYA 4KJIA 1TT0A 2BG9A 3CC7I 1VGYA 5EWGA 2G0CA 3KCCA 1XMXA 2IVMA 1FX7A 2JIWA 2X51A 2LSKA 3NEKA 4FF1A 1EJ7L 4DR7J 1CBKA 3IKVA 5L3DB 4NYPA 3ZQQA 1VRUA 4B3RT 5B0FA 3VKHA 2A2DA 1TL5A 4XLAA 4TKTA 3TO7A 5FNVE 1WOPA 2L2OA 2Y9YA 4MJKA 4NYOA 1WC6A 2H88A 3RUBL 1JLFA 2LLZA 4XOTA 3RQ4A 5B0GA 2IC9A 4ZOSA 4C3LA 1NH7A 5CYJA 2ZBKA 4CO8A 4ZJZA 2M45A 1VLOA 2AJ1A 4A0ZA 5FKLA 5DUIA 2IGKA 3EZOA 4UV8B 3BR6A 2DMNA 4OAYA 1EZZB 2XKPA 3K7RA 5G0RA 3R0JA 1AJ3A 2LDUA 2DR6A 5EN1A 3MZ8A 4OI3A 1ACMB 3KNAA 2QWWA 1U0SA 4C8NA 4I0AA 4XKCA 1RAFB 4PXBA 2YSRA 2CSOA 9ATCB 1HX1B 2M34A 1WHWA 3FDYA 1PBUA 1WD6A 4EJWA 2EIJH 3MI7X 4LFAF 2I5UA 1IR2A 1KLMB 3K70D 5FD5A 1S77D 1IBKT 1UW9A 3M6XA 1JHFA 2DO4A 4QZVB 3PYDA 2BZ2A 2K7KA 1IWGA 5IY5H 2LA6A 2K40A 1ZPWX 2XUEA 4MH8A 2ZFWA 4DV0J 1WH7A 2O0YA 3DBRB 5HMXA 1NPKA 3T8TA 2ZO4A 4YR2A 1WF0A 4DG1A 5ABFA 2DXFA 3WIVA 5CZVA 4UUVA 3V7CA 1R8BA 3ZFVA 1E0EA 2XCPA 3KJVA 3DLLQ 2CPXA 2HQAA