3KFWX

Uncharacterized protein rv0674 from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
SLTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVALTRMVGAGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTDARTRAALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDEAPADLAGQLWDLSGWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDPMLPAELLPADWPGAGLRAAYHDFATAMAKRRDATQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncharacterized protein Rv0674 from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07848 PaaX PaaX-like protein
X PF08223 PaaX_C PaaX-like protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kfwX01
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kfwX03
3.30.70.2650 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kfwX02
2MD5A 4B8XA 2QENA 5D6FA 2HFHA 1SAXA 3RDIA 3GEZA 3WGHA 3ABTA 2VC1A 1FSEA 5HS7A 4KA4A 4M6XA 1DPUA 2HEOA 2L01A 5IT9K 2E7XA 3I64A 1HKQA 4IVNA 4P5OA 3TKYA 3DPTA 4BH9A 4NHJA 2A6HF 2P6TA 3F6OA 2COMA 1U5TB 2ISZA 1S7AA 2E1NA 5CJ9A 2V6CA 3T5XA 3MWMA 5DUKA 1XD7A 4ESFA 1R36A 4OMYA 3NEUA 3K1MA 1FT9A 1R1VA 4RAZA 2QZ8A 2EFQA 3VODA 3K9TA 3G73A 2QLZA 3CUQC 4EJWA 2ELHA 1BC7C 2BEOA 3MFKA 2VOOA 2VBZA 2XAHA 3WTYC 4PZJA 1HW5A 3V7SA 4Q48A 3TQNA 4KDPA 1B6AA 2K7LA 3LAJA 3E5XA 4ZH4F 1OPCA 2O6GE 3TGNA 4G9YA 4EGZA 2RC4A 2MLKA 4WX9A 4PGHA 4FT8A 3LA2A 3QRFF 2RDPA 4L9VA 4LG0B 3R6SA 1LNWA 4WCGA 4A0XA 2D45A 2DPUA 1MDMA 1KYZA 2CWEA 1G3SA 1ZLKA 1MKMA 3CTAA 2GIVA 4P96A 2CFXA 2ZFWA 3WU0A 1HBXG 3GZ6A 1MGTA 3KEOA 5ILSA 2HKXA 1W7PA 4L9NA 2OU2A 1ZRCA 1ZRDA 1J9IA 1LDKB 4L5IA 2G7HA 1J75A 3I59B 2PN6A 1SFEA 1T2KA 4GXOA 4YFKF 2JTVA 1IN5A 3F8FA 3HRMA 3HSRA 1MD0A 2UZKA 5HDNA 3CDHA 1OR7A 2Y48A 2LSOA 1FP1D 4KN4X 3J80K 3IRQA 5LGTA 3I4PA 4WXDA 5L3GA 2BBYA 4BNCA 4FX0A 3LA7A 1KU7A 3T8RA 1G6NA 2GA1A 5F1RA 3LSTA 5FLXK 5BQTA 3IL2A 2R3SA 1J0RA 1RUNA 1ZRFA 2H6CA 5LEKA 2J5OA 4LLNA 2JPBA 1J2XA 4RGSA 2IW5A 3QP5A 4EGYA 1P4AA 2BYVE 4M71A 3DQVC 4OIOF 3ZMTA 4KNYA 4A5NA 1BI2A 4HF0A 4AIJA 1I1SA 1D8JA 1Z7UA 3GFMA 5E1WA 3RI4A 5D6EA 2O3FA 3I54A 3REOA 1YW7A 2M30A 5FD6A 1WWXA 2D1HA 2HKOA 4HV5A 2L4MA 4JBAA 2VE9A 3TO7A 2A68F 4KIBA 5D8LB 3C3WA 5K5RA 1QQIA 4KYWA 4HF1A 1Y0UA 1WSUA 5CVIA 4CICA 4RGUA 3B73A 3CJNA 3CUQA 2Y0MA 2W57A 4IHSA 5F64A 4Q4ZF 4XBFA 3MCZA 4FHTA 4UV8A 1LDDA 1USTA 4HOBA 2F5CA 3P9CA 2HR3A 3KEQA 5IT9Z 2E7WA 5LHGA 3K0LA 1KQ0A 1B59A 1TW3A 3HTSB 4EJOA 5D8KB 5CVJA 3RKXA 1T38A 2O0YA 1SFUA 3ZMSA 3I0TA 4I0BA 5E1XA 2IA0A 4CO8A 3U1DA 3JAMK 4P9UA 1ONVA 5BPIA 1ZAOA 1TNSA 2DI3A 3IKVA 3BWGA 4KICA 2XGXA 3C7JA 4A2UA 2K4JA 2L02A 2P5VA 5HDKA 1YQAA 4D0PA 2JPCA 3MZYA 1V3FA 2A5YB 2O8XA 5ED4A 3F22A 1XCVA 2Q8KA 1W7PB 3KP2A 3SXYA 3SFZA 1G3TA 3JAMZ 3R0AA 3E97A 2NYXA 3V4GA 5E17F 5JHUA 4R79A 1RUOA 1FNNA 3PFIA 1KGSA 4LGWA 4MNUA 1Q1HA 3WTWC 4MQVA 3E5UA 3JSOA 5A2QZ 1D8KA 1XCBA 1HXDA 2EFNA 5H6QA 2EK5A 3GO5A 2LF8A 3QU6A 2EFPA 3KLOA 1RNLA 4LLLA 1YTYA 4AWXB 3F6VA 2R7FA 1U3EM 1KYWA 1IF1A 3ERED 1HW1A 3HRUA 2A07F 3HIFA 3BOQA 3M8EA 5LBQA 2XKPA 1T6SA 3M9AA 3KFWX 4OIRF 3RPQA 3HHHA 3RJPA 2FBKA 4XLPF 4RB1A 2WWYA 1K78B 2FSWA 1LJ9A 3DV8A 3BROA 3J7AO 1ZG3A 1OKRA 4IRIA 1R58A 3R61A 2RVCA 4AD9A 4G7HF 5L3DA 3WTZA 2QWWA 4Q5SF 1LEBA 1TBXA 1YS7A 2VT2A 1I1GA 2DLLA 4IHTA 2ZCWA 2PMHA 4GCVA 3EQLF 2RKHA 5DV5A 1DPRA 3EETA 2CSOA 4NQWA 2FE3A 1XDSA 2VONA 2RN7A 2FMYA 2A3SA 1RI7A 2Z33A 4A0ZA 1XGSA 1FY7A 5JR3A 2A61A 4HQMA 1R7JA 5LRRA 4PGGA 3PQKA 2VXZA 3L2CA 1ZLJA 4RGRA 4N0BA 3FM5A 4RB3C 4UVCA 3KP6A 1H9GA 4LFUA 5HLHA 4Y15A 2YU3A 4EV0A 3HSEA 1XGNA 1XSDA 2EWNA 1E17A 1P4XA 2CW0F 1FBUA 1PUEE 2IP2A 3JTHA 3R60A 4BYYA 5JVTA 3N97A 4KMUX 1OYIA 1U2WA 3K1PA 5DCMB 4ZYHA 5L3CA 2KIFA 4U0YA 3L7WA 4BHCA 3K1NA 3ZQ7A 4WWCA 2MH2A 4KMFA 3RTRA 2ACJA 3VFZA 2YX7A 3QPTA 4HW0A 3EYYA 2FMLA 3MZHA 1QZYA 3EUHA 2DK8A 2UXNA 4BQAA 4EJVA 2WC2A 3LA3A 3QAHA 4HX7A 2X0LA 2EJRA 4HQEA 3GW2A 3H3ZA 2FBHA 1E2XA 4CZZA 3ISPA 1B9MA 3I71A 1O7FA 2XAFA 4YG2F 5L3BA 1FYLA 5FGMA 3SZTA 2M1BA 4EM2A 1XMKA 3ZMUA 4KT5C 5HOOA 1Z05A 1J5YA 3OOPA 5K1YA 2XRNA 3T0YA 2DTRA 4HA8A 2PI0A 1IN4A 4LD5A 2P8TA 1BJAA 2KJCA 3BP8A 4MTEA 3B02A 4BAYA 2J5PA 3ELKA 4UVAA 3KZYA 2KIUA 2EFWA 2P5KA 4EMSA 3WTTC 1YG2A 4ZYGA 4U7BA 4ENNA 4I7HA 4LMYA 3GXOA 1V4RA 3E6DA 2M8EA 3L00A 4U0VA 2O03A 2JSCA 5D4SA 2A6EF 3H92A 5AIQA 3ZMDA 2XKOA 2K02A 4AVPA 3HRSA 1VTNC 2YR2A 2HQNA 3DXJF 1USSA 3GWZA 2PBIA 4IJAA 1SFXA 5HLGA 5A2QK 1ZGJA 2QBYB 1QGPA 4UVBA 1S6LA 2QUFA 3U9GA 5TRDA 1WQ2A 3KP4A 4O6JA 1FC3A 3CLOA 4M6YA 2UXXA 5BOXA 1W5TA 5ILVA 3E6CC 1F9NA 1P6RA 1EH7A 3NQOA 3BJAA 1XSVA 3IWFA 3VOEA 4IXAA 1XSXA 1ZG5A 4OOIA 1DUXC 2Z99A 2F5FA 3GFJA 3J81K 4FX4A 1U6GA 4RGXA 4GO1A 1CF7B 3EDPA 1FYMA 1IAWA 3GX4X 2QBYA 4HYEA 4CXFA 3RKWA 3WTUC 4RS8A 2JZYA 2R7DA 3V8JA 1Z91A 1YS6A 3KETA 4AIHA 1BN5A 4N9HA 2XIGA 1R1TA 5J6XA 2V1DA 2VBWA 5BPDA 1WRJA 3FXUA 2ZJ2A 3HRTA 1GVJA 2XAGA 2K27A 4XRFA 5CVRA 1B9NA 2NRAC 2NNNA 1FBSA 3SHFA 2WTEA 3I53A 4YFNF 3E6BA 1I6XA 4ESJA 2MA3A 3MQ0A 5CVVA 1DDNA 1QZZA 1STZA 1FSHA 2EFOA 4LJZF 3P9IA 1TQMA 4CGZA 3IRRA 1YW9A 2CQKA 2B0LA 4ZYDA 4UV9A 2F2EA 1HW2A 5AONA 4I09A 5D5WB 2C6YA 2P6SA 5HVQC 1GHCA 2YPRA 2DT5A 2XV4S 1S29A 1PDNC 3WTVC 2GAUA 2OZUA 2VT3A 4ZZLA 4WXCA 1WI9A 3C18A 2KJBA 3ABUA 2GA2A 2IJLA 5K5QA 3FMRA 1Z9CA 2P7CB 2GQQA 3ZN1A 2D2WA 2M87A 3O2PE 1KU3A 2M5WA 3V7RA 2FA5A 5L3FA 2VBXA 4OINF 2OA4A 1UB9A 1AOYA 2XASA 2YX4A 1O3QA 1A04A 4PCQA 3L9FA 4CHUA 4ENKA 2ESHA 2W24A 1YW8A 1XMAA 2EA4A 4JQFA 4L0ZB 2X4HA 2RQPA 5KVRA 3BZ6A 1K78A 4GGGA 4H0EA 4KUMA 4S04A 5FO5A 4WK8F 4LB5A 4A0YA 3VB2A 3M1EA 5DUIA 2PEXA 1UHMA 4Y17A 3BJ6A 1LVAA 2DQRA 3CO6C 2Z9OA 1L3LA 1EH6A 1JHFA 1FZPB 2W84A 3EYIA 4WXHA 4XSXF 5DD8A 5D4RA 3SQNA 3U2RA 1CF7A 1DP7P 2VODA 1Z1DA 2HYGD 2ZNZA 4KFCA 2HS5A 3HHGA 1S3JA 2OBPA 3MEXA 3QPHA 1B1BA 3CUQB 3CO7C 2STWA 3IWZA 5K5OA 2ISYA 4A5MA 5CYVA 4EJUA 1SD7A 4ETSA 5E8GA 4UXNA 4G6QA 4ENJA 1BIAA 3HOSA 3QU3A 4MTDA 3RYRA 2PFBA 2HQRA 5CVUA 1TNTA 2RV8A 4OU0A 3DEUA 5HDGA 2BGCA 3CUOA 1OYWA 2NAZA 4LK0F 1AWCA 4Z2YA 2FEZA 4TV7A 2HGCA 3Q5FA 2V9VA 5D5VB 2F5DA 2MBFA 2JT1A 2FNPA 3GF2A 2VBYA 2KRFA 2ZKZA 5JFRA 2F5EA 4IRHA 1ZN2A 2DBBA 5HS8A 3DKWA 1UCRA 4HX8A 2ESNA 3BJOA 1MZBA 3COAC 1FOKA 5LGUA 4GYGA 3V8LA 3ULQB 1ODDA 1BI3A 5HLIA 2K4BA 3OV8A 2VE8A 2FQ3A 1TQIA 2W85A 1G4DA 3SZPA 5BS6A 4ESBA 2CG4A 1YIOA 2Z5UA 3P9KA 4LG0A 3N4MA 3HTUA 4U7DA 2XVCA 2GXBA 4L5JA 4I0AA 3ZPLA 1MDMB 2BE5F 2WV0A 4ASNA 1GXPA 1YFHA 4IF4A 2CO5A 1HSJA 2QVOA 4KIGA 2VOPA 2OAZA 1I5ZA 3D5LA 4M74A 4P9FA 3ML6A 2IT0A 1IXCA 2FXAA 3I59A 2IPQX 3DFGA 2FOKA 4HZFA 2MLGA 4F7ZA 2ZBKA 3KP7A 2PJPA 2FRHA 3TO9A 2HZTA 1F5TA 4L9JA 1JE8A 1LDJA 1FWZA 4EM0B 5CLSA 4I98B 3R4KA 1G3YA 5LRSA 1MJBA 1BI0A 1IRGA 5IT3A 3FF5A 1U78A 1BIBA 3P7NA 1R5GA 1SD6A 5J8FA 1P92A 2VN2A 1ZH5A 1CGPA 1UHWA 1PP7U 1YO5C 4MHGA 2EV0A 4G94A 4M9SA 1TW2A 3L09A 1OYYA 1S7OA 2OD5A 3GLXA 1U5TA 1PP8F 2PQ8A 2FNAA 5E20A 2V79A 4UUVA 2Y75A 4XSZF 6PAXA 1ZYRF 4OIQF 3FMQA 2VC0A 1T39A 4MQ9F 5LEJA 2V1UA 2L4AA 1QO0D 1IUYA 1K79A 2PLYA 2GXGA 4HAMA 4Y13A 1FX7A 3HYIA 1IXSB 2JRTA 4HF2A 3T8TA 2MH9A 4BXUA 4N9IA 1F4KA 1R22A 3WG9A 1ON1A 3BPXA 1HKSA 1XGOA 4OMZA 2ETHA 1P2FA 5H6RA 4XLNF 1WKMA 4M72A 3I5UA 2V1XA 4I02A 1R00A 4Q47A 5LLQA 3F21A 4NB5A 2DK5A 4PDKA 4EM1A 3TOBA 3F8MA 3TO6A 4HDVA 4OIPF 3ZP5A 1HQCA 2TDXA 4R8HA 2FU4A 2P7VB 3QP6A 1I27A 4ZZDA 2AS5F 1ZREA 4EVIA 1RIOH 3Q9SA 1BM9A 4ZYEA 1FLIA 2IRFG 2NS0A 4HX4A 3LWFA 4HBLA 4IRGA 1R1UA 1J7KA 1JXSA 3T1BA 3WGIA 1O3SA 3GZ5A 3HUGA 4S05A 4L18B 2MC3A 1TLHB 3KCCA 5E1ZB 2HOEA 1SD4A 2LKPA 2L3DA 2KKOA 1KU9A 2K86A 4QWQA 1J59A 2EA2A 2ZXJA 5DD4A 5EEHA 3DPLC 1IRFA 4DQ2A 3BDDA 2UWMA 3G3ZA 4A6DA 4G7OF 3FWEA 1ON2A 4ON0A 4EJTA 1YLFA 2LF7A 4LLGF 2DQLA 3JSPA 1ULYA 5ERIA 1O57A 1O3RA 3ZMZA 3FX3A 4YIFA 3LQQA 4HDUA 2DAOA 3F72A 1EV7A 1X3UA 4IPAA 3V8KA 2E1CA 4A12A 3M8FA 3GFLA 3O6BB 2AXLA 4HV6A 5FB2A 4KN7X 3GYHX 4U0WA 1ZGAA 1S8NA 4QLCU 5DYMA 3Q9VA 3IKTA 2HTJA 3WTXC 4I2OA 3DP7A 2IVMA 5FLXZ 1IZ1A 3TDUC 4EQQA 1HSTA 4G8XA 4ENMA 3BPVA 2FF4A 3GVAA 3KP3A 2P5LC 5E8IA 5H20A 5EEGA 3J80Z 4RB0A 4KIFA 4MEYF 3KZZA 1Z6RA 1O3TA 4B09A 1W5SA 4K2EA 1BOAA 1O7LA 1R23A 2QQAA 2H6BA 2G9WA 2LNBA 3PQJA 1SMYF 2IA2A 1KA8A 2KIMA 1KQ9A 5LHIA 4CDGA 2ZMEA 5ICEA 2M45A 1EH8A 2Z3YA 3ECOA 2CYYA 2DO7A 1U8RA 3RKYA 3WE3A 2PG4A 3V7CA 4E70A 3K69A 2NNYA 4A6EA 1H0MA 4MEXF 4O3MA 4M9ZA 4YIIA 1LEAA 1QPMA 2W25A 1SMTA 3FM3A 4WF2A 3E3VA 2DW4A 1FPQA 1XGMA 3C1DA 3F8BA 3FXQA 1K6OA 3LQRA 2ADUA 1IN8A 4AIKA 3R0JA 3HOTA 3IC7A 2PMUA 4RAYA 5LHHA 1IN7A 3RIRA 3FZVA 2G7UA 1GXQA 4L9TA 2QQBA 2Q2EA 5ICCA 4G7ZF 3E5QA 3JTGA 1HKTA 2ZNYA 2DFIA 1XDUA 5ILUA 3VEPA 2IA1A 5D5XB 1FYKA 2QQ9A 2XAJA 1JGSA 1RZ4A 5JI6A 3MAJA 1XN7A 2P4WA 1G3WA 4UHTA 5FFZA 1D3YA 1ZHFA 2CGPA 1FBQA 1MJAA 1BI1A 3TDZC 3F8NA 2HYFA 2QM3A 1BC8C 4M73A 2HDCA 3RPUA 4HLXA 2STTA 1BBYA 5DCMA 2XHKA 3GUDA 1W7PD 5AIPA 3ZMVA 5KK1A 1ZARA 3RYPA 2L54A 3KLNA 3H3UA 5ICGA 3HSFA 2RGVA 3WGGA 1NHAA 2XROA 2FBIA 3TOAA 3E6MA 1K7AA 1U5TC 3S2WA 3M7GA 1OMIA 5E18F 2OZ6A 1W4MA 3LAPA 1KQ8A 1JHHA 1F1ZA 3K2ZA 3KE2A 4HLYA 3FMSA 5J8CA 4GYIA 2OQRA 3JW4A 4MGRA 5DCFA 2GZWA 1QNTA 2EV6A 5DEQA 1TQPA 2GWRA 1IW7F 3I58A 2YSRA 2HTSA 1REPC 2HWVA 3DF8A 3ROUA 1R5HA 3F8CA 1Z6TA 2ZO4A 3NRVA 2D1VA 3WODF 2OQGA 4JK1X 3AAFA 1FP2A 4BHBA 2O61A 4LB6B 2RNJA 5FD5A 2QYOA 1SD5A 3W6JB 3D0SA 4UNOA 3W6KB 1IN6A 2DPDA 1P4WA 3KP5A 4L0YB 2ZMEB 3WE2A 3O3KA 5FFXA 4CYDA 5L3EA 2H27A 3F3XA 1TTYA 1MJ9A 4R1HA 4I01A 1UFMA 1T0FA 1L0OC 5TJJA 4BHPA 3FHZA 1H9TA 1QBJA 2DU9A 3F23A 2XAQA 4M9XA 3WTSC 5D5UB 1LQ1A 3QOPA 4P55A 4O5VA 5BMZA 3J81Z 1XB4A 2LDUA 4LK1F 1B4AA 4U88A 3IHUA 1LB2A 1D5VA 1KU2A 1IXRC 2XUBA 5F6FA 1ZG1A 5DDGA 1C0WA 2EV5A 5LGNA 3BY6A 4G6DA 3WU1B 5ICFA 4YFXF 3ECHA 2H09A 2A69F 5HS9A 2BV6A 3LFKA 1YYVA 3ZN0A 4RB2C 4DNCA 3GFIA 3FXRA 1T98A 2Q0OA 2H94A 2EB7A
chains in the Genus database with same CATH superfamily
2MD5A 1OEDA 3N9UC 3ISND 4ECUA 2JJ9A 2HFHA 4DL3A 2Y1RI 4LITA 2FJEA 4FS2A 1XNQF 5E3AA 3UVJB 2IDLA 2WDRA 3IBCB 3FXKA 2CLYC 4KFBB 4O4IE 1HLVA 5AFUL 4M6XA 1KNPA 4M5MA 3I9V2 3V81A 2ROPA 2L01A 4YR2A 2EFGA 2HVHA 2Q9QC 3FEYB 3I64A 4IVNA 4Y28C 1S97A 1A6LA 4BH9A 2A6HF 2P6TA 4LRCA 3F6OA 1QVFR 2OI2A 1RAHB 1D1BA 1WGXA 1RA7A 2E1NA 3RYFE 2F63A 3GIJA 1B4SA 4K4ZA 3MWMA 3GMEA 2XSFA 3MECB 1XD7A 1NDLA 4P74A 2ERRA 2WSCC 2NP9A 4H4KC 3ONLC 5IT4A 4LF8T 3S7RA 1JQGA 4NDLA 2QZ8A 4G65A 3V6DB 5HNHA 1X3WB 4NUVA 3E01A 3CUQC 4OZLA 1G2EA 2EIJH 1U1RA 3B54A 4U31A 4A5XA 4OK0A 2HPUA 4QIGA 3Q8SB 4LIUA 3ZCJA 4BXFA 3IBPA 4Y3CA 1ZR2A 3DM2A 3ZEFB 1V5IB 2XAHA 3WTYC 2KRBA 3BR2A 5LXYA 4CM2A 2FJDA 2CIMA 2R42A 2QV6A 3MPVA 2FQ4A 2K7LA 2KPMA 5C42A 1NSKL 4ANDA 4C8MA 1AJ3A 2GVDB 4PUOB 2UVUA 2LQ9A 1OPCA 2V7MA 1VQ7S 2O6GE 3UO0A 2YNIA 3A12A 1WJDA 1NB7A 4JEUB 2MLKA 1H72C 4HDGA 2ZJRQ 4FT8A 3EUNA 4B3RJ 3LA2A 3W9JA 3QRFF 2RDPA 4L9VA 4LG0B 3R6SA 2QYCA 4ZTJA 3FZHB 1LE8B 2EPFA 1KZHA 2VFVA 2YDQA 2D45A 2KH9A 2GMHA 3D4JA 1FOWA 3PNYA 1MDMA 1NDKA 1FEEA 4NRTA 3FXLA 1ZLKA 1OPIA 1S1WB 4DV6T 4IKFA 1FJGJ 2CG8A 1LUJB 3P96A 4RWXA 1MMDA 3TP0A 2BOAA 3GFXA 3TKLB 3GZ6A 4J2CA 1TT0A 1HARA 5AQVB 2RU3A 3TO8A 4A56A 3QPSA 1W7PA 1QVUA 3OL6A 1ZRCA 5LP6E 3N6MA 1ZRDA 1N5TA 1J9IA 4NLSA 2G7HA 1YWXA 3F0CA 2PN6A 3QYFA 1X1CA 3JRFA 4YFKF 2DNLA 2J9CA 3J81U 4OJ1A 5L3FB 3Q89A 1U9NA 3S1NJ 4KMCA 2W2UA 3PO5A 3RR8A 1T8BA 2WMOA 3HRMA 2V1NA 4ZPWR 1MD0A 5HDNA 1RAOA 4HEA9 2LP4A 3AJDA 4FQGA 1FP1D 4DR7T 2HFUA 5LGTA 3HDDA 3I4PA 2CRGA 1UWBB 2W4DA 2Q66A 4E7JA 1HYSA 4N77A 2ZXWH 4FX0A 3MFIA 1TWFJ 5EYRA 3GTKJ 5J1NA 5IOLA 2FLOA 1HNIB 1ZEEA 5IP6A 5A0YB 3DLBA 1J0RA 2YWWA 4DCJB 2KL4A 4M6VA 1RUNA 2ASJA 2H6CA 2V7KA 4DV7F 2DGOA 3G4SS 3OY9A 2W2NP 4GVBB 4CLYA 4NXMF 1UZDA 3H25A 1J2XA 4QX8B 3QP5A 5JXSA 3C98B 3QGGA 3LBXB 4CXYA 4EGYA 3EXYA 1V54H 1FTCA 1Y7PA 3LSGA 5E3LA 2VUMJ 1ZA2B 4USIA 3CDUA 3PJ9A 3DQVC 4KNYA 1IQZA 3RUBL 1BI2A 2ZZTA 4AIJA 3J7YU 4K7QA 3SV4A 1I1SA 4BEHA 2RUSA 3A1YG 5B0BA 1KR4A 2YKMB 5E1WA 4XO0A 4YR3A 3HKBE 2M9HA 1T9VA 4RW6A 2H7OA 3MD3A 3REOA 5KAFC 3RZDJ 3V4IA 2FLPA 5F0CA 5KG5A 4DV6F 2W9CB 1AFJA 3AA7B 4QWNB 2D1HA 5DZ6A 1YJWS 3CJQA 1OR7C 4JBAA 2DL1A 1HS7A 2J47A 1Y10A 3IMQJ 2H1KA 2I6WA 2WONA 1W0TA 2P9BA 1RAGB 2GAGC 1R27B 4DQPA 5F9LA 3S17J 4E4HA 2VQFF 3RLFF 1VK3A 1D9AA 4AI6A 4URSA 4RZRA 4XAKA 3CUQA 4X4TA 3I9ZA 1H89C 2LP0A 1HQEA 3MCZA 1S1VB 2OEMA 2F4VJ 3KLHB 1LDDA 3KJNB 4FF3A 5HWYA 5LHIB 1USTA 4EUVA 3P9CA 2BXYA 1WJ9A 4IE4A 2HHQA 1WFDA 3G6YA 2NUUG 1R4MB 3UD5A 2UUBT 1S9FA 4NLVA 2UUAT 2I8EA 2XGCA 2RDIA 2YPZA 3VQSA 3H0GJ 3K0LA 1Q81T 3VWBA 3FEZA 2XQ9A 4ANCA 2N7CA 3OTOT 2H9ZA 3ZYLA 1TL8A 5L46A 4CN6A 1N33T 5DG7A 5D8KB 4O3NA 1SHZC 1JNRB 4H63H 2PX9A 5AE1A 3AA1B 2W9BB 1FK9B 2ZH3A 2W4CA 5C42B 3NAUA 3V5SA 2Q6CA 3UUMA 3UR3C 2JEJA 2IA0A 4CH7A 2WCAA 4PG6A 3JAMK 3SRZA 2HI3A 5BPIA 1ZAOA 3BYPA 2MKKA 2XM2A 1OIAA 2DA1A 2CXFA 2VFUA 5F9NA 2EG2A 1QY7A 2QLWA 2YNHB 3D6FB 1IJEB 4AYBN 2R7VA 3K1SA 2W62A 1WI3A 2YKNA 4NYOA 4YTNA 3G8SA 4A2UA 2QA4S 2OJED 1J5EF 2R5YA 4LF7T 3MF5A 2V69A 4NUBA 3MZYA 3T5JA 4P52A 2BXZA 3Q2TC 2DT9A 5DZ7A 5F8PA 5MAOA 4ITVA 2A5YB 2ROEA 5LGUB 3KG1A 3OUYA 5I3UA 3R5AA 2JMHA 2DPIA 1W7PB 3LOCA 3LJCA 2YWHA 1U1MA 3SFZA 1R4NB 1DU6A 1YJRA 3I9V9 2BHZA 1AT1B 1PBAA 3OYDA 2V5HG 1G3TA 4W1UA 1S0OA 3UUNA 3C15B 1Y11A 2AX1A 3EDRB 4I4BA 4PKDB 1RUOA 1A5JA 2ZM6T 2QQ8A 4LGWA 4RM2A 4ZIWA 2CHOA 4Y2IA 3RW6A 3FVYA 2F7VA 4QWEA 3DOMA 3JSOA 2F40A 1HXDA 2G1DA 3IR6B 2EK5A 1UWBA 4PG8A 2QFJA 3QU6A 1HYSB 1VK8A 3JC6D 2B56A 2LLKA 1RNLA 3I82A 2E5NA 2R7FA 2RQ4A 4K0KJ 4X62J 2UVWA 3CCVI 4OZ2A 2DISA 5BXIA 4XOTA 3ERED 4WKYA 3BOQA 3S1RJ 2NOXA 2J0XA 4HR2A 2WMNA 1ETVA 1T6SA 3M9AA 4ZLNA 4OV1A 3AD8C 2K9SA 3RTVA 3C2GA 4OIRF 2OD4A 2DNRA 4OV6A 1W2BR 2RHQB 4KC5A 2HVIA 3US5A 4D5FA 3GONA 2WSEC 5B0FA 2FSWA 3DV8A 4Q5VA 4ZVQB 3BROA 1LWEB 2J8AA 3FC9A 4WF9Q 1OKRA 2LK2A 2XLJA 3AEGA 4JB8B 1R58A 2RVCA 4AD9A 3MI7X 1RKJA 2EQRA 2LA4A 1M1EB 4L76A 1GXTA 2NXCA 4H63V 2VL8A 2FVRA 1O4XA 5GAEI 4L75A 3GJTB 1JLFA 2DLLA 4F55A 2ZBRA 3TJAA 3MJXA 3SSSA 3EQLF 2DMNA 5DV5A 1CQTA 1DPRA 2PJQA 2RAQA 3Q0VA 3V5UA 4XN0A 4I99C 2F65A 2FE3A 4HG2A 3N5BA 2F4MB 2VONA 2VL0A 2OPQB 3DI6A 3UD4P 1RI7A 1X5OA 5JH7E 2ZFUA 4DFJA 4X64J 4QPOA 3KMQA 1XGSA 3R2CJ 4R8UB 5LB7B 1XMQT 4N78D 2AGQA 4Y2AA 2KT5A 2VV5A 2B63J 1ZM2A 4ICLA 4O0IA 5LHGB 3N28A 4XDDA 5LRRA 4W98A 3NWSA 3CSKA 4HVZA 3H98A 4U33A 3PQKA 2AJ4A 4WJBA 3L2CA 3FUYA 3E7LA 4DSKA 3EHZA 3UU4A 1GX6A 1NDCA 3FM5A 4AYBD 4RB3C 4RA2A 2NW7A 1ZTTA 1H9GA 1R6YA 5HJYA 3ZMSB 2C2KB 3PU3A 2Y1IA 2DTZA 4P72A 1KSPA 2DNXA 1UJ4A 1FRLA 3VAGA 5HLFA 3H5YA 1JJCB 2JJ7A 4J9RA 3GMGA 3A02A 4CCMA 2VKRA 2B9XA 5E0OA 2OIHA 3OHBA 3TBIA 5FRMA 1OYIA 2M8HA 1S4EA 1U2WA 4B3SJ 4AQYJ 4QPTA 4ZYHA 3HCXA 1HHTP 2COLA 3PW2A 2KIFA 3AFHA 1HOMA 4OYWA 3TQ1A 3EAMA 5KTQA 4X4RA 2ACJA 1UA1A 5GMDA 5BR8T 2AGPA 1Y00A 3TX0A 2FMLA 4WZQA 4ZDOA 2VPRA 2FBWA 4AVZA 1QZYA 4C3IJ 4M95A 1IR0A 2CPJA 4EJVA 3LA3A 3QAHA 4HX7A 1O3XA 3PUQA 1BWEA 3OIOA 1APLC 4H9OC 1WF0A 2XAGB 4IR1A 1REGX 5KFSA 2D9PA 2OTLS 3ZC4A 1B9MA 3Q5EA 2E5GA 1YOVB 4NBQA 4M5JA 2BACA 3PV0F 1O7FA 5EF6A 1FNMA 1S4FA 1FYLA 2FGCA 2F4VT 3H9GA 5B0GA 3RC3A 2Z16A 2DWGA 4EM2A 3FSIA 1N34T 3K89A 4KT5C 4OZ0A 3S1MJ 4W92B 2L0KA 2K7KA 2K8GA 1Z05A 1TL4A 1C1CA 3OOPA 5K1YA 1AUSL 1V3SA 3UFEA 3TVKA 3EWGA 2XS7A 3CQCB 4EZ9A 3EDVA 4ZVOB 1EP4A 3DOMB 5IY5H 3GQCA 3SOLA 1CLFA 4NMXA 5D15A 5ETKA 4XNFA 5DM6Q 3OFHA 2LKHA 2B4PA 3HULA 4FETA 4KHPF 1XPXA 3B02A 2QEXS 4ZI3C 2ZKUA 2AJ1A 1U24A 3IH2A 4J9SA 2VL1A 4RUHA 2XQ6A 2DA3A 4Y2CA 4E2FB 2DY9A 3G1LA 1XR5A 3GIMA 4YS2A 1MBEA 3ZT7A 4U7BA 4IO9Q 4I7HA 4B3TT 2JC1A 2MZTA 4ZDPA 3G82B 3QO9A 3CEDA 3J81Y 1GNKA 3OIPA 4HSTA 1E0EA 3P50A 5GP9A 3V4MA 4TWDA 2KJVA 5D4SA 3VKHA 4M5DB 2Y8YA 2LKXA 3Q8VA 3B6CA 4LOCA 2HGMA 4YY3F 4OI3A 5HXEA 1S6PA 3FFIB 2FVQA 1OFCX 2DT6A 4O2BE 3C46A 5J1EB 1K8AT 2HDWA 4YJ2E 1LW0B 1XERA 1Y5NB 1ZGJA 2QBYB 1SQEA 2VDHA 4BWMA 4J9PA 3MXZA 5TRDA 4JI5F 3M8RA 2K2PA 3R7NB 1YJ7A 1ZS6A 2MZSA 2WQYA 4RNNA 3W2WA 1FC3A 4AKHA 1R0BG 4IG0A 3DRYA 5BOXA 2UXXA 3RYHE 1YITS 3NWIA 4DV5F 3OLAA 1KONA 2MYFA 4KGKA 1Z7LA 3W5ZA 1P6RA 3S01A 3NQOA 1J5OA 4J9NA 3BJAA 2IGNA 5J3LA 3P7IA 3E08A 1XSVA 1RLCL 1ZM3A 4XZCA 4C90A 3UVJA 5FD1A 2PMZA 2M52A 4DV4F 3H2VE 1BW5A 1XSXA 1ZG5A 4OOIA 1BQMA 2DRDA 3LW5C 3GIIA 1YZ7A 3EUHC 3J81K 3ENQA 3CJ0A 1X9WA 3SCKE 4N4OB 1X4HA 5BYQA 4IUFA 3VV2B 5B0AA 2EBIA 3ERMA 1QE1B 4HYEA 4CCOA 1QA6A 3C6TB 1VJQA 3CMAI 2Z0GA 2XWXA 5HANA 3KV9A 2R7UA 3LK42 4L9IA 1OPZA 2V4RA 1XMOF 1YS6A 3KETA 4AC0A 3OOUA 1HR0T 2WB1D 1NJIT 2W2MP 3CESA 1RT1A 2LD5A 2BVZA 4C2TA 1NH7A 2V1DA 2OELA 5A6PA 2R7QA 4B4CA 4ECSA 3NMRA 1YJTA 4FF1A 3HRTA 2F4FA 2YINA 4PR6A 1GVJA 1RJJA 2VH7A 2ZDPA 4OHWA 4C2MA 3H7HB 4C3MA 5D8HB 3R6NA 2M0CA 1N34J 1WHUA 1B9NA 3EGWB 1AB8A 2NRAC 5K7HA 5K9FA 1IBKF 4CT8A 2ME0A 1FBSA 3KHLA 5B0DA 1NKEA 1RHUB 2K3PA 2N4DA 5IZHA 4PPDA 3N0VA 4GKKT 1VBXA 3MACA 5D4NA 3LSMA 2R7SA 2LTPA 4ESJA 4HTEA 3HGGA 2FY8A 4QR2A 2PG8A 3ZTSA 3W2VA 2XI3A 1FSHA 5LMUF 2MD0A 4CGZA 4LQ9A 2AIRB 2GHPA 1RWOB 2YDRA 3SYZA 4NPPA 2X68A 4UV9A 3FZBA 1FKAF 1QLBA 2HVQA 5GAEU 1HW2A 1K1QA 2HDDA 2NS8A 1U8SA 4DV4T 1B0TA 2ID6A 2MABA 3UU6A 2M8GX 2P6SA 4TWHA 5HVQC 3IAM2 1JI8A 2F4OB 5FL1A 2DK2A 1YJWI 1S29A 3QQCD 1PDNC 3CX6B 2NS7A 3WTVC 1SAUA 1VQLI 2Q9QA 4O44A 5A8WB 2OZUA 3O8HA 3KOAA 3HOXJ 3GYNA 5DQVA 4ZZLA 4WXCA 2C3YA 2RH3A 1WI9A 3C18A 1IXKA 2WDVA 3ILJA 4LMJA 2A3JA 3ZZRA 2CWYA 2IJLA 2Y6XA 5J4YA 1GT8A 1UFLA 2L9WA 1AROP 3HT3A 2RKIB 2BXJA 5HQMA 4Z8XA 4JI6F 2DCLA 1TAUA 2HHPA 1WLXA 4DPUA 2WW8A 4FZVA 2FHJA 2LBFA 1M1KT 2XSJB 1CULA 2ACXA 3MMYB 4V19K 2OA4A 5L2LA 2JOQA 4CO0A 2RQQA 5KG2A 3O6QA 2DDBA 1ZKEA 4MIAA 5KDMC 3F41A 3H4DA 3TZWA 1T7PA 1MMNA 3CGIA 3T3FA 3L9FA 1JUPA 4HSRA 1UVLA 4DR6J 1S1TB 2FLLA 5HEOA 1F3VA 1N5QA 3MZIA 2ESHA 3BT9A 2WAQN 2UV8A 4M5NA 1YW8A 2EA4A 1Z1ZA 1D8YA 4NLGA 1Y0NA 3UUBA 1NK3P 5AQJB 5KFTA 3VAFA 1BJZA 3WHCA 2WCXA 4PUSA 5KCMA 3PDNA 2DMUA 2MGZB 2MBGA 1HA1A 1XN9A 4GGGA 1YX2A 5KFYA 2TCTA 4A48A 1OYEA 2H65B 3M6XA 1X4FA 4KUMA 2X1AA 1XMOJ 2HFNA 1JLEA 3R5GA 3M1EA 2QL7B 3SFDA 3DXBA 2PEXA 3GTPJ 3BH7B 3FMWA 4NMLA 1F5AA 1P9QC 4Y52J 2Z9OA 1Y64B 1L3LA 2VU5A 2MZQA 2X1FA 1D0ZA 1U1KA 4F3OA 2W84A 1BMQB 5AQUB 2LE8A 3KBTA 5D0HA 3QT7A 4TWFA 3RQIA 2HOSA 4GRIA 2IMWP 4RBUA 4OAZA 2AHQA 4B3TJ 5DD8A 3SQNA 3ABMH 1N78A 2PI4A 4PWDA 4JLEA 3U2RA 3BJYA 1PCAA 2M4KA 4B3SF 3S6EA 1QE1A 2VODA 1R7IA 4G1IA 4RLEA 1Z1DA 1HMVA 2DN0A 3EGVA 2XS2A 3P4QA 1JLBB 3QYYA 4I6YA 2XY7A 4DL6A 4AUKA 4UVBB 2HS5A 2W1OA 1ZZFA 2FPHX 2OBPA 4UF0A 4IG3B 2WTFA 5EX3A 4ZP8A 2Z8QA 4PQAA 1X9MA 2HMIA 3IWZA 3LDQB 2ISYA 3L7PA 5CYVA 4B9LA 3KYCB 4Y2MA 2X67A 3I0RB 2IJRA 4OX9F 3VZIA 4Q2LA 4F4YA 3CCUS 2CUFA 2PT0A 2MKYA 3O8WA 1B72B 3KLGA 4WP3A 2FY1A 4IH5A 4MTDA 2ZM8A 3ILIA 4OYMA 4DUTA 1IBMF 1ZPVA 9ANTA 3DEUA 4QW8A 5H6RB 5HDGA 5LM7E 2BGCA 1Q5YA 3CUOA 1R8PA 2BJEA 2QTWA 4X20E 2GCFA 2NAZA 2WB5A 1WEZA 1UKUA 3VCDA 1F6TA 4Z2YA 2IBOA 2V9VA 5D5VB 2L2OA 3B6AA 2HPLA 2BQRA 2LXIA 4HWIB 3P45B 3PM9A 3QFWA 2YU9J 4ZVPB 4B08A 2GA7A 2CE7A 3EM1A 2BKOA 3H3AA 4YSZA 5HS8A 5LJNA 4QQBA 2K7JA 4N56A 4PJ0C 2YQ1A 3BO3A 4TN2A 4ECVA 5J2NB 2W2QP 1SFKA 3KLEB 2PD1A 3LP0A 3VZHA 4DR2T 3LK3B 3BR9A 4QTRA 3D1HA 2KFYA 2JWNA 4JI6J 3PEJA 1SFOJ 5LGUA 2J4GA 3OUYB 3JXOA 1Z67A 2FB0A 3ULQB 2LHRA 1VQ8I 3AEEA 1W25A 1XC9A 3WZ0A 3BPSP 2VE8A 4JYAT 3JREA 5H9FJ 2DMTA 4K50A 3SZPA 3DWLE 3M8PA 4J7CA 2KFDA 3OBVE 3AA8A 4XRSG 4DR5F 1IC8A 2VKDA 4WXWA 4QHOA 3UULA 3IS9A 1UURA 1QAIA 1WH5A 4QIWN 3HPHA 2M7AA 1UETA 2I9SA 1LXJA 3HVRA 3LSRA 3DGPB 2DHRA 4USWA 5L1JA 2GXBA 1F9EB 2VDIA 2A72A 4CLFA 1HI1A 2DGWA 5AQKB 3ZRGA 2NVXJ 3CDWA 5DETA 2HS3A 4RAGA 2BJ1A 4OLPA 4OHYA 3OFEA 3WQPA 2N3OA 5HQLA 1ZA1B 3BR0A 2XQ3A 2M7BA 1Z0PA 3UNYA 2J0QD 1N0VC 2KHMA 4M74A 2JA2A 4HDHA 2FJBA 5HVGA 3RAXA 1IXCA 2FXAA 2XMWA 1O6XA 5E33A 2W48A 5HWXA 3DRRB 1RWVB 5L3EB 3K10A 4KUMB 2YOEA 5LBQB 1PJ7A 1T0FC 1YX5A 2HZTA 5GAGI 4IKAA 1S6QB 2CQQA 1FWZA 4ZA1A 4EM0B 5CLSA 2WOMA 4A69C 2P9EA 2DHSA 1HR0J 3G1MA 2DYSH 2K5CA 4IT4A 4XKBA 3GWHA 3AB4B 2I5JA 1BI0A 4LF9J 3PO4A 4NLYA 4HNVA 5L9XA 2DGTA 3CJKA 4NLRA 1BIBA 2BG9A 2B6AA 3P7NA 4P2MA 1HNZF 2NR0A 4IIJE 1PJ6A 2XO7A 2DFHA 5J2QA 2G13A 2N82B 5T7LB 4Y34A 2NCKL 5KG6A 1TW2A 1SANA 4BY1J 2MKJA 5LXTE 2RPAA 3GLXA 1M1GA 3AKZA 1C1BA 1QSSA 4ED8A 1OEDE 3ZZYA 5E20A 4DR5T 1SJFA 4UUVA 4K59A 4BQQA 1ZYRF 5C4XJ 3MGJA 5AQGB 2Z1DA 5FDLA 1U6BA 5A8RA 2XYHB 1IUYA 1S76D 3SYTA 2GXGA 5KFEA 3MMBB 3ABVA 1SV5A 3GSIA 4NCAA 7AT1B 3OQ2A 1FX7A 3KMSA 3IRXA 1L3VA 4GOUA 2CBJA 3J7ZT 3M07A 1BW6A 2ZITA 1WKKA 4BS2A 3AG1H 2JRTA 3BCBA 3ELHA 3T8TA 2JEFA 1U02A 1V9OA 5HBMA 2HQ5A 2MH9A 2MQNA 2J6SA 1R22A 2VJJA 2LA6A 5MLCV 4DZPA 4BL0B 3ZTOA 4Q43A 1ON1A 4NLTA 4ZJLA 4UVCB 2ETHA 5H6RA 1Q8LA 4BBYA 3DC2A 4XLNF 2H1YA 2YNFA 1W2IA 4DQRA 4JI5J 1NCLA 3I5UA 2DH8A 4DPWA 2GHWA 1E7PA 2LDYA 5ABFA 5CQGA 4ZCMA 2V8SV 5LLQA 2VG6A 3F21A 3T6BA 2DK5A 5B1AH 4ZVFA 4UW2A 3F8MA 4HDVA 4ZPDA 3TX8A 1NH3A 1TL3B 3W1YC 3Q5DA 1D09B 2FU4A 4UOCA 1YI2I 1SH0A 3CQGB 1HNXJ 1OWAA 4J19A 4EVIA 4KPCA 5GTHC 3D68A 2ZBPA 3MKYB 3Q9SA 4BJTA 1FLIA 5AXKA 4KIAA 3QT6A 2OHDA 1GK8A 3QPIA 5JHFA 3PY8A 2M34A 1WSVA 5HMXA 3UR0A 3T1BA 3S32A 1H38A 5IWAJ 2GFFA 4A3JJ 2KL8A 1YQ4A 3WGIA 3TP2A 1ZBTA 1RETA 3OVUA 1U6FA 2N4CA 1TK8A 3HUGA 3KCCA 3EDQB 2AO9A 2LKGA 2W7PA 4PABA 2LKPA 5KFQA 2KKOA 3RCOA 1U1LA 3IAS9 3RGIA 4CO1A 2DI4A 3CDLA 2NXJA 1QUUA 2DEJA 1KTVA 4DR3T 3TAMA 2V5CA 1U9OA 2CPEA 1IRFA 1ROFA 2ZKTA 1WI8A 3BDDA 1EF4A 2CXLA 3MUVP 4A6DA 1IKXB 4G7OF 1NENA 2XF6A 5DG9A 3LQVA 2YTCA 2JC0A 4XN3A 2ZD1B 3KLFA 2AZ3A 1KLMA 3KYDB 3CWJA 3CQZJ 1YLFA 1U7LA 4RO0A 3W5XA 3WBZA 2DQLA 3JSPA 3H5UA 2DNPA 3GV7B 5LSOA 1SC3B 2L08A 2LR8A 2KO1A 3AXKA 1S48A 5HAXA 3ZN1B 5CJ5A 3LQQA 1UCNA 1FDDA 2K5BB 1X3UA 1JB0C 2E1CA 4H9PC 4I69A 2LOOA 3K3OA 4YUDA 1C0TA 5FROA 3CC2S 3VAMA 3LSIA 4AXIA 3IKTA 1V5VA 1FJLA 2JVHA 2J0WA 2IDEA 4I2OA 1V55H 1TKDA 3DP7A 1ETXA 1RR7A 4FTHA 2IVMA 4EQQA 4FE4A 3TDUC 4QR0A 3DBLB 1OQYA 3DRPB 1UVJA 4NLPA 5FLMJ 3KP3A 2QSFX 2EKYA 3BB5A 3M3ZB 5F0WA 5DDOC 2LHNA 4FF4A 4TXSA 1LW0A 3J80Z 1LKZA 5LL6d 3NGRA 3ABKH 4RB0A 1U48A 4KIFA 4MEYF 4CTAB 3GV5B 3IWNC 3HSZA 1JK9B 3PHEA 4HFBA 1O7LA 1R23A 3MPUB 3JRBA 4CT9A 2BS4A 4LIWA 4OYAA 3MA9A 3CC7S 1SMYF 5ITHA 3QRQA 2ZLYA 4DL4A 1C1BB 3I4HX 3JTPA 2IAJA 3LSKA 2FJXA 3CMEI 4U8VA 2C2NA 2CUJA 1UPPA 3THVA 1RT7A 2UUCF 4U7IA 2YU1A 2HOTA 5FNVE 1V5EA 1MROA 1NJWA 1EH8A 2E9XD 3T5KA 4JP8A 4RU2A 2BDPA 4XIDA 1U8RA 3U1LA 2ZOFA 2U2FA 3SEQA 4H4OA 5JMNA 3K4BA 1ETOA 4RW4B 1H0MA 4MEXF 1PO6A 4M9ZA 3M8JA 1T8IA 1WHVA 4C8OA 4OYKA 1QPMA 2E9ZA 2W25A 2MSYA 4ECTA 3PUFA 3OS2A 2OKQA 1B8IA 4RW7B 5IM0A 4QXBB 1XGMA 3F8BA 1OCZH 4EXTA 2WRMA 5DQGA 1XR6A 4ZS3A 4IDKB 1K6OA 4CI0B 3LQRA 3MVPA 1IN8A 3BR5A 2B9WA 1YHQS 3HOTA 1EQMA 2AZ1A 2ZSIB 4RAYA 1LPQA 3O9XA 1IN7A 3RIRA 3P4UB 2G7UA 4EYYR 2XQYA 4L9TA 5A8KB 4HNUA 3MEEA 2Q2EA 3MAQA 3HP6A 2DNQA 5LT5A 1NXIA 3QMQA 4ZJOA 2LDIA 1GDTA 2DFIA 4I68A 2CPTA 4P09A 2HNDA 3HSJA 3IBFB 2XSDC 3OXLA 2LREA 2AW0A 2VJ4A 2BJ3A 5F3ZA 3NOCA 2EWHA 2Y3YA 1ZM9A 2X3GA 2XAJA 4KV8A 4YHHJ 5JI6A 3MAJA 3AB3B 3EVWA 2HHUA 4A8KA 2X1DA 2P4WA 2ELKA 4L0RA 3HB9A 4UHTA 2XPUA 2R5ZB 3CCTA 2CGPA 4WP9A 1MJAA 3CCRI 2IIHA 5DGAA 3HHEA 3ZZTA 3BR3A 5EZGA 4YB5A 2LY9A 3V81B 5FJ8J 4XONA 3S3OA 1DHMA 2UUCT 2CQGA 4LSLA 1CJTB 2HAFA 2DR8A 2VFRA 4EBDA 2CQNA 5KK1A 1ZARA 3NBPA 3BR1A 3KLNA 3H3UA 4MO7A 2ODVA 2RUGA 5JRCA 2WVCA 1NHAA 1RC9A 1F3FA 1Y56A 3OS1A 3CCRS 2ZHAA 4WIQA 5H6QB 3GJSB 1U5TC 2GK9A 3GCXP 3IO1A 3RG6A 1DQUA 4I2QB 3Q0AA 5E18F 5CD4H 2OZ6A 1XMBA 1X5SA 3PW4A 2G2OA 2BABA 2YDSA 1DBDA 3K2ZA 1FJ7A 2AQEA 3KE2A 1Y6IA 3ZKRA 1DU2A 3CZ6A 4ZVUB 1VRUA 2IC3B 5J8CA 1TKXB 3BG6A 2OQRA 4CN1A 3OYBA 2HEKA 3ZR8X 1QNTA 2EV6A 1YLXA 3KLIA 1TK0A 2PEBA 4JV0A 4FKXA 3BR6A 4AQYF 3I58A 3HL6A 2L9SA 1FDAA 2XYGB 3ROUA 4PUOA 3DGVA 4QIWD 2NTYA 1BOBA 2SPCA 2VG7B 3NRVA 1F36A 1WG1A 3JSMB 3V42A 1WYCA 2HRYA 3FBBA 1RCXB 4Y6IA 3V6KA 3KZIC 1VQNI 1RT6B 2XGQA 1Y5IB 2OJ3A 3GLJA 1LE8A 4CLUA 3OYAA 4LB6B 3L2WA 2MKCA 3X2QH 2RNJA 3IH3A 1LWCA 3VAJA 5KFMA 2MKIA 1MU2A 2LXUA 2WY8Q 4IGUA 3D0SA 3BG9A 4USUA 1BGXT 4H9NC 1IN6A 2ZC4A 5KFXA 4RBOA 3KP5A 2ZMEB 2DFFA 3WE2A 4OJHA 3ULHA 1LVKA 2CJKA 5FFXA 4PEOA 3F3XA 2YEVC 1RACB 3G96A 3P8BB 4I01A 3J80Y 1T0FA 2JL9A 2Z2YB 1WTFA 1HNVB 1L0OC 2UUBJ 2FUG2 4BHPA 2CVEA 1JUMA 3GFYA 2ZMAA 1HBMA 2XAQA 2EK6A 3WC0A 3PIPQ 5D5UB 2LC2A 1LQ1A 3N9PA 2GZOA 3JCFA 3PNVA 3IUOA 3FMBA 2MXYA 2UZAA 3IHUA 4XQFA 1NZAA 1LFPA 5G0RB 3PJAA 1IBKT 1D5VA 4G1QA 1KU2A 1DLOB 1IVZA 4EBEA 2XUBA 2BBJA 4ZC3A 1ZG1A 4WZXA 2M9KA 1C0WA 3RKOA 5E3QA 1DP3A 3WHIA 2XS5A 3K5OA 3VYRB 4DGWB 2QGSA 4CDIA 3EVOA 5ICFA 1YD8G 4N8OA 5A0YA 3K2YA 2PEHA 5HS9A 3ZQLA 5KFUA 3ZZZA 2R9LA 1RT2A 5E3OA 4RB2C 4DNCA 2BHYA 4E7LA 5IV4A 3GFIA 2Z2MA 1T98A 3W64A 3PRVA 4BBSJ 1US7B 2H94A 4ED7A 1RK8A 1YJNS 2EB7A 5GAHI 4WTYA 3JAFA 3QFHA 3LBXA 2D1CA 2DOFA 2W7OA 3E1SA 2DEIA 1CBKA 1H7WA 2N1GA 2HNDB 1S9HA 1MH3A 3R97A 3S15J 3KLGB 2VC1A 3ZLIA 1FSEA 5M3MJ 5HS7A 2F8HA 3D54A 5K8OA 4CO2A 4AQGA 4WBNE 5E7OB 1HNWJ 1HKQA 4P5OA 1HDDC 1IJ6A 1JLCA 5ETLA 4NHJA 2AJ2A 3PM1A 2PJRB 4UQTA 4IO1A 1U5TB 4V1Av 2ISZA 4TNOA 3OFFA 1S7AA 1WDDA 5CJ9A 2V4QA 5E3NA 3M2VA 2DGSA 3T5XA 3NVOA 3X3UA 2C22A 3PRDA 1VZ0A 2LEAA 3CC4S 4OMYA 4FBUA 1NKCA 1KQFB 2WW4A 2JVGA 1FT9A 1U0HB 1R1VA 3FXMA 1R49A 3D0TA 2EFQA 3VODA 1KTQA 2C3PA 1SB6A 2UVRA 1ITYA 3K9TA 2J6UA 5GADJ 4OJGA 5IQ6A 3KDSE 5AQLB 4EJWA 2XZDB 2JQQA 3HX9A 1FWPA 2HFZA 2LVWA 2WAQA 3ABLH 2B3TB 1I5OB 2K40A 2BEOA 3MFKA 5LSLA 4C8YA 2APOA 4WE1B 4HRIA 3RI5A 2RDDA 4MFBA 4O23A 4MJKA 3OR2C 2XY6A 1HW5A 1CG2A 4X4UA 1K9MT 1LXNA 1DQAA 3KK2B 4ANJA 3J9X1 1JXVA 4RBVA 5EDNA 4KDPA 2W66A 3E5XA 2MSSA 1AA7A 2DJIA 3DLKA 3U7JA 1N0UA 4F92B 1C4AA 5IC4B 1GT0C 2XAFB 5EN1A 1C0UA 3KLIB 3Q83A 4WX9A 3TEDA 4PGHA 3KUGA 4C97A 1CJUB 2K06A 2W9BA 2QLJB 4TN7B 1HIYA 4BWJA 4A0XA 3G4SI 1X3ZB 3AG2H 4B43A 4A46A 5HAOA 3C16B 3HC7A 2YWKA 2DPUA 3QAEA 2D3ZA 1KYZA 1UZCA 2CWEA 4PJNA 2VG7A 1G3SA 2CJYB 2HIQA 3PACA 4C0OC 2HNZA 3WC2A 2GIVA 1T03B 2MQOA 4JV5J 2RS8A 5CABA 6FDRA 3OYCA 4UUXA 2ZFWA 3FBIB 1W1WE 2PC6A 1G73A 2E9XA 3OL8A 2HKXA 4MKVA 3DRSB 1X4PA 4PYAA 4WWSA 2XMAA 4HFVA 3UUXB 4KAIA 4MFEA 1I94J 1BR0A 1LDKB 1W36C 1QSLA 2LSYA 1Q16B 1J75A 5JJBA 1M5HA 1SFEA 4GXOA 4RW8A 2L9RA 4XPCA 2QA1A 2AT1B 3MPWA 1XG1A 3SJMA 1LW2B 3VVUA 3F8FA 2B51A 4AXPA 3N5FA 3AH6A 2UZKA 2VI6A 4LRAA 4OX9T 2HQ3A 3EABA 1ZZNA 5IV3A 2IS1A 2XAQB 3NKYA 1EQ0A 5FXVA 1XQIA 1FEXA 3CCEI 4BNCA 1MMAA 2P2CB 5LGNB 2MG4A 3B57A 3SMZA 2W61A 4DUZJ 3MM9A 3U1KA 4AYBA 5FLXK 3JSRA 3IL2A 1FJGT 1ZRFA 4JX5A 2KXFA 3D5MA 5T7LA 5IWAT 2LQ5A 3MMJA 5F8HA 1XEZA 2Y9ZA 3BZCA 4RGSA 2IW5A 3H2LA 5HXCA 3I0SB 2XJ7A 1B7FA 3MUMP 3G71S 2D0TA 4IHYA 5I42B 1ZM4A 2Y1LB 4M71A 2XHEB 4IO9F 4OIOF 3ZMTA 3VDXA 5J4VA 1FDBA 5ETPA 3K57A 1RADB 2HVDA 3GFMA 3PX6A 5AQPB 3UWTA 1G6BA 5HCMA 3I5BA 2MKHA 4XORA 2M30A 2VZ9A 4U87A 5JDQA 3AOBA 2NSBA 2FYXA 2JQ7A 2VE9A 3PIPF 3ZYMA 3TO7A 3BQ2A 4C4WA 4KIBA 1KVIA 6FD1A 3C3WA 2ASYA 1ETQA 2DB1A 2KT0A 4X4VA 5CHCB 4KE5A 2DOAA 2FJAA 3NP5A 3DMJB 2NVQJ 4HF1A 1RA6A 2PGCA 4R5PB 5CVIA 4CICA 4B3MJ 2CCQA 2XZEA 2AGOA 4IHSA 5IYZE 3RQWA 3QWPA 4XBFA 1DFDA 3U78A 2KZVA 5HN0A 4EI2A 5FLXY 1X4BA 4WFZA 1HWJA 2XSBA 1AW0A 4UV8A 2XPKA 3SWHA 5B0EA 4K0UA 1FTTA 1WKLA 3B13A 3DKYA 4HOBA 4NC6A 5AE2A 2FJVA 2F5CA 4PQUA 2F9JA 2X6YA 2HR3A 2RSQA 5IT9Z 5J2TE 3OXFA 1JJ2R 5KFRA 1WJAA 2HN1A 1PAUB 2WVDA 3OWTA 1M1HA 3SDBA 3R27A 1U1OA 1WCRA 3DN9A 5LHGA 4DNDA 1KQ0A 2CV2A 2E44A 3HTSB 1FJGF 1FIPA 3M05A 2X6OA 3RYLA 1D9DA 2V9PA 1ZOTA 3BGFA 5IWAF 3THPA 1JJ8C 2OUMA 3VWSA 1FIOA 4FYWB 1T38A 2O0YA 3TW6A 4NEZA 1SFUA 2BM0A 3ZMSA 4TLRA 2W8LA 3I0TA 3W3SA 1UWAA 4F91B 4I0BA 1JT6A 4HFEA 4ZHRA 4HWFA 1OCRH 2ID3A 1H98A 1TNSA 1REVA 3UN3A 1UHSA 3Q8PB 4ZYAA 5D77A 1H3DA 4YELA 1VQ9I 1YW0A 3BO2A 5H9EJ 1HNWT 4FXDA 3KPHA 4PSWA 5CAAA 3SFGA 2GBYA 4OYIA 3KK3B 2LYCA 3S3NA 3PKYA 1YQAA 4GFBA 4D0PA 2PDAA 5KOWA 5KG1A 3BEGB 2GS8A 1HNZT 3Q8RB 3E01B 1VQ8S 4OIXA 4KH0B 3WAKA 2VK9A 3F22A 2DO0A 3BQKA 5EK2A 1Q1VA 4XLHA 3P3DA 3GCWP 4D7MA 5IT0A 3BKUA 4DN0A 3R0AA 2Y48B 3E97A 1VOMA 4NWBA 4OZ1A 3V4GA 4DUYF 5JHUA 5D78A 5CH7B 3SSRA 3ICLA 3M8QA 4BJMA 3RKQA 2XMUA 2YNIB 4M5HA 1WJBA 4ISSA 1FNXH 2QKMB 3E5UA 1IBKJ 5A2QZ 2KISA 4ED2A 4ZPVR 1F60B 1D8KA 4FVMA 2HQCA 3MTKA 4KQZA 1C1CB 2RJZA 3O5TB 4CNZA 5A2QY 2UXBT 4KB7A 3RQ4A 2IMOA 1AHDP 3N6NA 3D1OA 1UVIA 3F6VA 2XUEA 1U3EM 2F3JA 3H9QA 3QLHA 3VTIA 5HXHA 1IF1A 4DU7A 5J1PA 3MAAA 4F2RA 1HW1A 3HRUA 3ZNJ1 4AKIA 3HIFA 2R8HA 3OSFA 1SUMB 4YLHA 2MC4A 4N8NA 1PYSB 4QYZK 1HQ2A 4LIRA 4LBIA 3KFWX 4IREA 4NIQA 2C3UA 3HHHA 1TFYA 4X6AJ 3CIZA 3ILLA 5B7WA 3CIMA 4RLQA 2IS6A 2WWYA 2KHCA 2D2SA 3PURA 3JTOA 2CPYA 3J7AO 2OPPA 4IRIA 1H0HB 4DYCA 3CCJI 2VB6A 1URRA 1HFEL 4G7HF 3WTZA 4MKYA 3AT1B 1RDRA 1LEBA 2BDEA 1TBXA 1GVDA 2XZWA 3FXJA 4A8FA 2AKWB 3M6WA 1RWNB 1WC3A 4MMOA 3OYNA 3MM7B 4IHTA 4JV1A 2OUGA 4HL9A 4JI4J 2EPIA 4L5GA 2E5LF 4DR4J 1X5PA 4ZLLA 4IOCQ 3EETA 3RGLA 1JLQA 4LFAT 3LA0A 3W6VA 2VJIA 1T56A 1XDSA 1BL0A 2A3SA 3DKXA 1S6PB 3HZEA 5J1EA 5ADXL 4OYBA 4TKTA 4ECZA 3QC9A 4M3EA 4P75A 4ISTA 4IX7A 4H4KA 4ZDNA 3QZ8A 1RAAB 4P73A 1DURA 4DR3F 4X4SA 2QMWA 2LT3A 2VA3A 4I76A 1X1PA 2EHOC 3W2WB 4GKKJ 3TEGA 3K3NA 3A4CA 1ZLJA 1M62A 2WB4A 3DLGB 2ASDA 4BEHB 2UXBF 2IJFA 3P4WA 2E66A 3KP6A 1KWMA 5HLHA 1OY8A 2WAQD 3D0HE 5D4LA 1X7VA 4AL7A 4UY8I 3MKDA 4DR1J 1WI6A 4P10A 2XQAA 4FXVA 4Y15A 4EV0A 1XGNA 1XSDA 1BQMB 4F4AA 1WZ2A 4DPTA 2DNOA 1N54B 4F8HA 1S9EB 5LOVE 1HW9A 3N97A 5F0FA 5LYJE 2ZC2A 5HCJA 2LLYA 1QZEA 3ZQ7A 4ZCIA 4WWCA 2OPTA 1BLUA 3A01B 4KMFA 2LVSA 3I4NJ 2C42A 4K0KT 1K1SA 2VICA 4J37A 1YIJS 2LY2A 4ILMA 4EB6E 1BQNB 4ZTFA 4ZI7E 2M5YA 3P5TL 4A8XA 5KAIC 3DM2B 3MZHA 2E5LT 2WY2A 4UZBA 2U1AA 2DK8A 4XKCA 2XY8B 4IE5A 4IDQA 1VRBA 1PYTA 3R5JB 5EDWA 5FKNA 2FBHA 4OL8A 2QEXI 1HBNB 1SH3A 1UZHA 5EZHA 4CZZA 1PJ5A 3I71A 4CLZA 1D9FA 5DQHA 2W9AA 4YG2F 1XIQA 2QYGA 2XRLA 2ZZNA 1FFSB 2BANA 3H59A 3SZTA 3AEFA 1UEKA 5FYMA 4OX9J 3N2GE 2B4VA 2JVOA 4OYJA 1BE4A 2L5QA 3CULA 4O4GA 1VQ6S 5LFAA 4Q0BA 2HQIA 5B08A 4EIWA 3T0YA 4HA8A 2HNHA 4X65T 2HK2A 3AFGA 4DV1J 4HE8A 1SJ3P 3WDOA 1DRZA 2K9QA 1MLAA 2WVFA 4LD5A 3TL4X 2I10A 4QWDA 3CVRA 1RWMB 3M30B 2ACMA 3BP8A 2CXDA 2RE1A 1BC6A 1NPKA 1MBGA 2IBDA 3C14B 1AXQA 4BAYA 1U8BA 1CSJA 4F26A 1U0SA 3CO0P 1R9TJ 1AA1B 3AODA 4CRJA 1GUUA 1WHYA 4EMSA 3I9YA 2D3OR 3TWZA 1S7EA 3J7A1 3P4RA 3R6LB 3L3PA 3W8GA 1WEYA 4KITB 2JA8J 4A8QA 1YKWA 3GXOA 1V4RA 3CE8A 1L3TA 1R89A 4U0VA 2RVJA 2DO4A 2JX2A 5AQIB 3L39A 3UU3A 3ZMDA 1KFSA 2CQ7A 1VYAA 2K02A 4BJ6C 3TARA 2XDVA 4AVPA 3HRSA 2D9OA 2YN6A 2IUBA 3RB4A 3PDYA 3HI2A 1W5CC 1WG4A 5LMNT 4IJAA 4CLTA 1JLAA 4NEYA 3VRAA 4ILAA 4CLPA 1WQ2A 2E9XC 4GVLA 4DW6A 5L4EA 1CQMA 1KVJA 3AAWB 3BQIA 2BMBA 4O6JA 2LEPA 3ETMA 1R0AA 3CK6A 3CLOA 3CDBA 2CQBA 2MPUA 2WVEA 3LG7A 4CIOA 1YBTA 1RHQB 1VQ4I 2WV1A 1CS4A 2GAHC 4JI0T 2XQ5A 4CCKA 4C3HJ 2YNGA 3IWFA 4Y00A 3DOLA 1GV2A 5GAEJ 1V9DA 2OAUA 1N32F 1AZSA 4ETXA 4HACB 4ZPTR 5G4DA 2BOLA 1JLGA 3W2AA 4EAHA 4EGWA 3MCNA 4I2PB 5DDRC 3SDEA 3P8CD 2V50A 3KV6A 3BYRA 5E5NA 3RH3A 1G8XA 2IFXA 4PYDA 4TVAB 2D3O1 2HQFA 3HR0A 3R84B 1Q4RA 4A3CJ 1FYMA 1IAWA 3R3TA 4IHWA 3EE3A 2YUSA 3OJAA 3RKWA 1A31A 3WTUC 1YHQI 5AQSB 1RBLA 3DDKA 4EU0A 3ZZ0A 2RDJA 2GOXB 5ETQA 3G1OA 4ECRA 5M5WJ 3RX6A 5HL7Q 3HJEA 2QCOA 7FDRA 3HVWA 4AIHA 1BN5A 4IZZA 1VIOA 3NOGA 4N9HA 3C2HA 2XIGA 1HMVB 4AD6A 2CMRA 1R1TA 4WFBQ 5FKYA 3NLCA 2DHGA 2VBWA 3GTJJ 5L1KA 5BPDA 3FXUA 2ZJ2A 1DTQB 1F2HA 1Y39A 5FMNA 2X9XA 4II2A 3UQSA 2K27A 2YPYA 2MHEA 4C30A 4OI6A 2DPJA 3NS6A 5CVRA 3S2HJ 1LWXA 1XK8A 2ACZA 4USVA 5M2PA 4USMA 2ZH7A 3TR5A 3GSDA 4U7UD 3VGVA 3KVBA 1HQUA 1HBNA 2WTEA 1FJCA 5GTIC 3E6BA 4ED1A 3GU0A 2F4IA 5LG3A 4HH0A 1NJXA 3NL0A 3HZGA 1QZZA 1RESA 1SH2A 4LJZF 3P9IA 1ZPWX 3CCJS 1C0UB 2XCAA 4JV5T 2CQKA 3A03A 3KK1A 3HHLD 2QGFB 3D6HB 3IC1A 3ZQCA 1QAXA 1CPZA 3F44A 2WWVA 5AONA 4I09A 3NAIA 5IXUA 1VRTB 4UR9A 4LFBF 2CKWA 1MIJA 2L9DA 4X4PA 2KZMA 3UU5A 2BA9A 4NLQA 4ZPBA 2YPRA 1U25A 2I0XA 2YWEA 4GK0E 4XK8C 5DRKA 1T11A 2NPFA 2GAUA 3C8YA 3FBFA 4V2FA 2LY1A 2BJ7A 4DS4A 4QU7A 3HK2A 5KFCA 4FISA 5K7ZA 4ECXA 2WWUA 4BAYB 2KJBA 2CFOA 4Z7CA 4DBRA 4DIDB 2GA2A 2EW9A 4C98A 1QAYA 1J2VA 3CJTB 4P2FA 3HO1A 4P2XA 2EVZA 2P7CB 3PUGA 3FZFB 2VG5A 1GAOA 3HEFA 2LOSA 2M87A 1B70B 2R7XA 2FC8A 3B82A 3TLWA 1E1HB 4XM3A 3LO3A 1Y0HA 4NCBA 4ZP9A 1N8RT 3VHLA 2GVZA 3B4MA 3V7RA 1YRXA 1FF2A 2O1PA 3S8PA 5FLVA 4X66T 4WNKA 4RUCA 3M32A 4YN3B 1AOYA 3ZZUA 1PIEA 2XASA 2YX4A 2QA4I 2DNHA 4OZ5A 4K2JA 3KHRA 3GIKA 3HKEE 4DJAA 4YQWA 4CHUA 4U74A 2R2SA 4KGZB 3BC8A 4ZDLA 1XMAA 5J2PB 3J7AY 3FCVA 2WB1A 3LF0A 4ZOSA 4L0ZB 5K7FA 1S10A 5KVRA 3SV3A 1VQ6I 1OQ6A 2CZ9A 3MMCB 3B4DA 4H0EA 5AQOB 3OVSA 4WK8F 4LB5A 3L1PA 3ZT5A 4L3NA 3VB2A 2IM1A 2XHCA 3H36A 2FC9A 2BKPA 5CYMA 3S8SA 1UHMA 3CCSS 4A98A 4LFBT 2X1CA 4EK2A 4ZI2C 1NJZA 4XL9A 3HZJA 1JHFA 1FZPB 4B3MT 2FVCA 2F5VA 1IDYA 5F04A 1P9YA 3QSIA 1WR0A 1T8EA 1SC6A 1S6QA 2NXNB 4LF7J 2XPWA 3DLAA 3F2EA 4QJVA 3MCOA 4XSXF 4DPOA 5D4RA 2XC7A 5EUHA 3AAIA 1N4LA 3T8OA 1U8WA 1UW4A 3E0JB 1AKHB 4IFVB 1NWMX 1XBWA 5KFIA 2I5JB 5J2MA 2HHSA 1W36D 4ZS2A 3KDOA 4U7CA 1ERDA 2HYGD 2ZNZA 1HX1B 2DY1A 4P1NA 3BH6B 1FWKA 4ZS6A 4DZDA 3X1DA 4KFCA 4X1YE 1S3JA 4CO3A 2NQPA 2EH3A 1FVQA 1FKPA 3L2VA 3MEXA 1HDPA 4TQRA 3QPHA 3R8YA 1ZOYA 1B1BA 2AV5A 3IN5A 2B5JA 1T05A 4NXMJ 3IXQA 3M2RA 3CO7C 2RT3A 4X66F 5K5OA 4DHVA 4X1EA 4OQJA 2H8WA 2RNGA 4UOHA 5AQFB 1Y3JA 4Y3OA 4UXNA 4G6QA 1JKHB 5T41A 4NXNT 1MBFA 4WFYA 4E7IA 1BIAA 3CJRA 2XPVA 2AYGA 1XTZA 2HQRA 3CDAA 3N9QA 2LH9A 4H9SE 4J5OA 4C9DA 5DLGA 1R8IA 1TKZB 4IDPA 2CPZA 3A8YC 4MKAA 1PYVA 2OFGX 4TV7A 3Q5FA 2KWIB 2XM3A 1TMMA 2F5DA 3KUEA 1B99A 1KN6A 2MBFA 4K8RA 2AX0A 4QZVB 1U26A 5M3FJ 2EZLA 3GF2A 1KFYA 4RU9A 1HBOB 1WJEA 2ZKZA 5JFRA 3Q5WA 1SVOA 3BN7A 3N79A 4O3OA 2LU2A 2F5EA 4P9SA 4IRHA 2ZJPF 3KK3A 4IFYA 2DBBA 3H37A 3DHWC 1B3TA 3DKWA 4KGVB 1UCRA 4HX8A 3M2UA 4MYTA 4M3GA 4B48A 2CUEA 3C6UB 1F9FA 1HWLA 3FNNA 3HFKA 3Q3SA 3BDPA 2YVSA 3OL9A 1DY3A 1PC5A 5JREA 2BYCA 3TOQA 1MZBA 3COAC 1A9NB 1FOKA 2GVDA 4GYGA 3V8LA 1MSEC 4HWDA 2FHOB 3X1LB 1HF8A 4ABZA 2K4BA 1TL1A 3OV8A 2R0QC 2HAIA 5ETSA 2FQ3A 2OF7A 2LKZA 1TQIA 1WHWA 2ABYA 2XF5A 1SEUA 3MTJA 4ESBA 4W97A 3I56S 2OD6A 1NU4A 2CG4A 2WADA 2UXBJ 1YIOA 3T1HJ 4ANEA 2DCUB 3N4MA 2GO9A 3P6YC 1E6VB 3BG7A 1IBLJ 4IOAF 4BE2A 5HYAA 3VGTA 5KFHA 7FD1A 5KT7A 4I0AA 3ZPLA 2BE5F 2WV0A 4UV9B 1YE9A 1GXPA 5B1BH 2KZZA 4BDZA 1YFHA 3F9KA 1X4CA 2V6YB 2NREA 3GTGJ 3OTOF 4HT5A 2CO5A 4XR6A 4BC9A 3F73A 5JR9B 2QVOA 2VOPA 1UP1A 4OLOA 4IDNA 2N7YA 2ZHBA 3W66A 1NK8A 3D5LA 3PKMA 4P9FA 4JBWF 3CJSA 2ZWPA 3RIUA 3LSPA 3ZQGA 2QF7A 5T14A 2CWKA 2X7IA 3I59A 1Q82T 2M8DB 4XLFA 1GQEA 3DFGA 2YU2A 3VGSA 5DDPC 3D5SC 2KZ7B 2I38A 2LSKA 2ZBKA 3KP7A 1IV8A 5JLXA 1R5ID 2LRLA 1ZQ3P 3BGUA 3MOJB 2MQMA 3GIRA 1JE8A 4LJMA 4I50E 4PG4A 3R2DJ 1MH4A 2MDAA 3NZQA 2M6IA 3HM5A 5HMWA 1KOOA 3R4KA 1G3YA 3UE2A 3NCQA 4X64F 2LBFB 4U7YA 4KFBA 5DLFA 2FJWA 4GYRA 2QSFA 1U78A 1RRJA 3GMIA 2XGPA 1NK4A 3BTLA 3L4BC 2YKAA 3HSGA 3J80U 2VN2A 4IR9A 1KQKA 1UHWA 1YITI 1PP7U 2FHJD 3TP3A 2UXXB 4L74A 4M9SA 5FLXU 1NO8A 4F8RA 1S7OA 4FF2A 1S7HA 5CA0E 2YKMA 2VIHA 3MEGB 3W15B 1SIZA 4RW6B 2V79A 3ZZOA 4NZ6A 1B0VA 4CTAA 2GMLA 2Y75A 4XSZF 6PAXA 4HPQA 3U1MA 1VQYA 1FKPB 4MQ9F 5LEJA 1NPRA 2L4AA 1HNXF 4ED5A 3BGRB 2UUWA 4I1TA 3GJRB 3BS9A 3OVBA 3JQJA 2VKJA 4K4XA 2TRTA 3C4XA 1MW7A 3HYIA 3TUZC 1LFWA 5FP3A 1D5YA 1H6KX 3BTCA 2O67A 2J0SD 5DM6F 2DVIA 2JLFA 4HF2A 3ET6A 4A97A 3SCLE 2DA2A 4BXUA 4LBPA 4DF8A 8RUCA 4F4WA 3BPXA 1CJVB 4LMLA 2KJWA 5FXZA 3C4WA 1TKZA 3KJVA 1X1BA 5IP9J 3OYXA 1R3NA 4M72A 3KV5A 3ZMVB 2F6CA 2NS1B 2ZJRF 1SXLA 1RYSA 4RW7A 5CYJA 1R00A 4DUYT 4ZOLE 4EM1A 2K3IA 2R2UA 3CCQS 3TO6A 1BQXA 2ELJA 3GFHA 1MBJA 4J9MA 1LNQA 1FI4A 1LVFA 3N6LA 1XDOA 4AL6A 3QP6A 2JA6J 2B9SA 1RT5A 1ZREA 4C2MJ 2IIUA 3MM8A 5IC6B 5EK4A 1S1WA 2D74B 2IRFG 4I4TE 1N6QA 1UMJA 1R1UA 3AG4H 1J7KA 2E1RA 3E51A 4OYXA 1P27B 3GCMA 3AD9C 3LL7A 1B72A 2B8QA 1VQ7I 4E8UA 4C91A 4S05A 3ZTQA 4WFAQ 2BW3B 2MC3A 4MBQA 3IBWA 3HVTA 4UUSA 2HOEA 2JRMA 2L3DA 5FKLA 2AXTC 4K5RA 1TUGB 1X31C 5EWGA 3ITHA 1G4CA 4AIDA 4I0UA 3BSCA 1M90T 4R0EA 3BSNA 5DD4A 5EEHA 1NLKL 2EILH 2IHR1 4CYUA 2WHOA 5C8YE 1S79A 1DGRM 2OMOA 1IG7A 4ZP6A 3U27A 4QSHA 4GIWA 1R31A 5SZTA 1NG6A 3QYBA 2KSRA 3FWEA 1ON2A 3MUTP 1NSAA 2JDJA 2RS2A 4IQXA 4EJTA 2LF7A 1RHJB 1UL3A 5AQMB 2V6YA 2D0UA 1ULYA 2B0GA 4NLUA 1O3RA 4JI4F 1N77A 4YIFA 4HDUA 1UEVA 4X2BA 4I2QA 5HLTA 2JFKA 2KTQA 2OFHX 1L3SA 3G86A 3V8KA 3M7VA 3QJLA 3EPGA 1UUSA 3GFLA 3GB0A 2CQIA 2BZ2A 1BUXA 2ILYA 4HV6A 3RPUD 3NNHA 1BY9A 1Q1KA 2XSJA 1CVJA 3AD7C 2R8GA 2HN2A 3OYFA 3Q9VA 2HLUA 5LJ5Y 3CNQP 5DJQC 3SFUA 2ZE2B 3W62A 3IFEA 2DHAA 5ABHA 2HTJA 3SFIA 3WTXC 2E5IA 1PUFB 2ZJQQ 1IZ1A 5JVGF 4A8OA 3TMOA 1LRZA 1TKTA 3IS9B 1OQ3A 4DR5J 3IGVA 3IR7B 3ONXA 2FF4A 2P5LC 5CFBA 2QIFA 2JSXA 4EYIB 1GMVA 2PMWA 5EEGA 2EINH 2ZVIA 4OHXA 2ZXHA 4LIVA 3JSMA 2SXLA 2CPXA 1Z6RA 2G2ZA 1O3TA 2MGZA 3VVTA 4K2EA 2IEKA 2QQAA 4PNIA 3CWZB 4O4RA 5M2RA 3RU0A 5BYSA 5DO2A 4BA9A 1RAEB 4A3BJ 2CUYA 5EX0A 4RR5A 3FEXB 1KA8A 2KIMA 4B6XA 3C51A 3U1NA 4KPYA 5LHIA 3TANA 2UP1A 2ZMEA 1JLFB 1VCTA 2M45A 4PAGA 2EC2A 4K0KF 1KNZA 2Z3YA 1R0CB 3ECOA 2CYYA 2ZH1A 4IL9A 3MHYA 1CJKA 2L8KA 5LCYA 3WE3A 2P81A 3KHHA 4MFRA 4OYZA 1HF0A 4Y4RA 4NA1A 1ZYQA 4DV7J 4O3MA 4E7KA 2KG1A 2ZH2A 1N36F 1HBMB 3OTOJ 4K4SA 1L3KA 2QMXA 3RF1A 3PUXF 2V8GA 3FM3A 5M5XJ 5BJRA 2Y8WA 2XMTA 3C1DA 1YIJI 1PAEX 4C8NA 4DV2J 2AD9A 2WVBA 4ILLA 1K73T 3GYXB 1LKXA 4AISA 1IDZA 5G0RA 5LMUJ 4DSIA 3SS1A 2LKSA 5AQTB 4FS1A 3IC7A 2PMUA 5LHHA 1T0TV 5EGOA 2HHHF 3FZVA 4USKA 3RB3A 1SPBP 4B3TF 4NRUA 4PSXA 2BW7A 2QQBA 1XWMA 5KFOA 5ICCA 2FQQB 3E5QA 2K85A 2AXDS 2JWTA 4QIVA 2ICWG 2ZNYA 3D6TB 1XDUA 1E3PA 4XMYA 3FRZA 1ZR4A 1VC5A 5D5XB 2LU1A 2I59A 2QQ9A 3DLLF 3IH4A 3MWBA 2QVAA 4LF5T 1JNZB 5ETMA 4OZJA 2DH7A 3M4OJ 3IM8A 4M3BA 1XN7A 2VPWB 4C48A 3JYTA 4DX7A 1FMWA 4FYDA 4NL5A 3ZOBA 4C11A 2VQEJ 2HYFA 4ZN3A 2QN6B 3CD0A 2HDCA 4HLXA 1KDNA 5DCMA 4TY9A 3JRCA 2M70A 2A05A 3GUDA 2BUNA 4GDFA 1P1LA 1W7PD 4JI8J 2MKSA 3T1AA 4DMZA 3K17A 2PJRA 1YJNI 2L54A 2JSPA 1FRIA 5ICGA 3HSFA 3DTIA 3WGGA 4CI1B 4LRBA 3S1TA 2FBIA 3LP0B 4KH1B 1SC4B 5FXXA 4CCNA 2JEIA 2XHWA 4CI2B 1EKSA 1FO1A 3M7GA 1OMIA 3K7AJ 4Z37A 1HWKA 3OLBA 1TC3C 2CEAA 3Q22A 3RB6A 3LAPA 3BBCA 1JHHA 1F1ZA 4I0WA 2OPRA 4IHJE 2C3OA 5LD2C 3EDUA 1KBRA 2VPLA 4F50A 4IQMA 2HZCA 4J9KA 2HQDA 5FKOA 3P4PA 3GWCA 1DTTA 2HHHT 1MIVA 3FSXA 2M2EA 3CDEA 4MGRA 1VQ5I 1XJWB 4TY8A 2N2NA 1U6ZA 2IRUA 1TQPA 2BVLA 2GWRA 3QYEA 4XAXB 1OCTC 1Z2ZA 2J76E 4JI0F 1SKWA 2LXFA 2KQRA 1HC8A 1RAJA 4KKOA 4MHCA 1X5TA 3J7YJ 5L3GB 2DWKA 2K1RB 2HWVA 2Z56B 2ZB9A 2WSFC 3EUAA 3F8CA 2E5HA 3DBHB 3D1NI 2QJ3A 2ZE2A 1S59A 3OR1C 1TWAJ 3CVKA 1PJRA 4MAKA 4KRWA 4DJBA 2OQGA 2C2MB 4YDXA 3BDEA 4CWBA 2E71A 1KP6A 5F8NA 4I6ZA 2MAWA 3NS7B 4EO6A 1SC1B 4QBUA 5KT3A 3OW2R 3RBEA 2KDZA 5FD5A 4LF4F 2OPQA 3QQAA 3LP1A 3J7AN 3DI6B 4B9SA 2M3AA 4UNOA 1DQ9A 4U67Q 1ACMB 4YFUA 3W6KB 2I2YA 2DPDA 1FERA 2NWBA 5FVLA 1EJ7L 3AXJA 5L3EA 2H27A 1TTYA 2OPSB 3DKDA 4BJNA 3N2OA 4M5DA 1RPWA 2YKOA 2V8VA 1H9TA 1OEDB 1QBJA 2DU9A 3OYLA 1TT5B 2KU7A 4YMEA 4M9XA 2DJWA 2VVNA 1R6RA 3WTSC 2I0MA 2XLKA 2MTQA 3JTNA 4B9NA 4O5VA 2C0SA 2X66A 2LQ8A 4AE5A 1OISA 2HNYA 2C3MA 5L3DB 3RRHA 2AEFA 4EBCA 3P5BP 4JI1J 1LB2A 1N48A 3EX7B 1N88A 4FNHA 3K8VA 3DNCA 1I50J 3K4LA 1T9WA 2HZAA 2A9UA 4OX8A 4FJOA 3OYZA 4ENOA 2EV5A 5LGNA 3CMAS 2R8KA 1ACIA 3WU1B 4M5LA 3LPYA 4LR7A 3MKWB 4WYVA 1J5OB 3ECHA 3NARA 3LFKA 4RAFA 4QH1A 4DX5A 2UUCJ 4X5TA 4JV5F 1U0JA 2C2EA 2Q0OA 4JI6T 3ZCIA 4YTPA 3MMBA 2AJQA 3HF5A 4UZCA 4BJ5C 1SQGA 2QX0A 2IAJB 3AE2A 4B8XA 5J0ZA 2KXHA 2RMLA 2ZJQF 3V6DA 1QU3A 3O8GA 1YQ3A 2V7IA 3CF2A 1YDLA 1S99A 4NC8A 3ABTA 4EEYA 2V2ZA 3AQPA 1OMSA 2DKOB 4KA4A 3JADA 1L3UA 2P0WA 1MNEA 2HEOA 3G06A 1WRDA 2QLFB 3PUSA 2LJLA 4DX6A 4LFCF 1IKVB 5IT9K 1RKTA 4YSYA 1OYDA 5GAGJ 1Q7LB 3JYTB 4E7HA 3LK2B 1OLTA 2CA5A 1NBEB 3H5SA 5DS7A 4QU6A 4XTTA 4RW9B 1MWYA 5M5YJ 4U2YA 1UGOA 3MXHP 2COMA 2O5DA 4GO7X 3LNQA 2IAIA 2YQ0A 2R7WA 1VF9A 4KX6A 1K0VA 4KYZA 5DUKA 4ESFA 2VQLA 2PA8D 1R36A 5ETWA 4LF1A 3PUBA 2J9DE 5JUMA 4RAZA 4KP3C 4GKJF 4GRSA 2X9DA 5K20B 2QLZA 2W2OP 4A3DJ 3C64A 3AE4A 2J6TA 2G1HA 3W2VB 1XNRJ 4Q48A 3KG4A 4B3ST 4B9TA 2JA5J 2Y9HA 1B6AA 2IA6A 2V6AA 5H2FC 4NXMT 4PK5A 4ZH4F 1GEHA 2J5AA 2DYAA 4CLKA 1SQFA 2CJBA 3KLVA 2V2VA 4K4UA 3A0BC 3TGNA 4TY8B 3CD7A 4EGZA 2Y0SD 2RC4A 5LXRA 3G82A 3BBBA 4ALZA 1HKAA 1I94T 2FHMA 3JCUC 2W4XA 1T3NA 4HN9A 2JH3A 1LK7A 3LSVA 3MECA 1RZMA 1QRYA 1LNWA 4WCGA 1XNQT 2E1PA 1F5BA 4I6AA 2X0HA 3K70D 1RTJB 1XC5A 2DDAA 5C25A 2X9WA 1YI2S 2Y0BB 4I7FB 4HWHA 1MKMA 5U47A 4P96A 4F93B 3B8HA 2CFXA 3EPZA 2FZKB 1HBXG 1MGTA 4GK5E 2NXUA 3GG1A 4Q25A 4B9MA 2M2BA 3R6GB 2JVRA 5ILSA 4L9NA 1FFGB 3MD1A 2OU2A 3HOUJ 2XSAA 5B09A 4XLAA 4L5IA 3I59B 4ECQA 2H5JB 1WOPA 3DTEA 2NR4A 4JP0A 4ZVGA 2HBRB 2KFNA 4KSEB 3OYMA 5DM7F 1KRPA 1IN5A 3H9JA 1IUJA 2B1EA 1ZK8A 3HSRA 1WF1A 3VAKA 4LF8F 4E7ZA 3OYJA 2KN4A 1W0UA 3LAMA 3PZPA 2Y48A 2LSOA 2OSQA 3J80K 1KFDA 3K4NA 3IRQA 4DLGA 5KT4A 4WXDA 3NEKA 3B6BA 2ACYA 1H73A 2W2PP 3LA7A 1KU7A 2KVQE 1G6NA 4R0JA 2GA1A 3LSTA 1K83J 1X8DA 5BQTA 3NCRA 3SCIE 5I3PA 1S0NA 1N33F 4DCOB 3CC2I 3OMYA 1VFJA 2FTRA 2J5OA 1X4DA 3FZKB 1RT3B 2OP5A 4LLNA 5IFMA 5F8LA 1YJVA 3K3QC 1NSPA 3T9ZA 1A6IA 3H35A 3ILOA 1P4AA 2I1RA 2IJNA 2MLZA 3QLHB 4OX7A 2W01A 3FJ2A 4W90B 1SUQA 4C3JJ 4QW9A 4A5NA 1WOSA 4HF0A 3J7Yq 3PW5A 1IWGA 2CDQA 4UOFA 3QB5A 3OFGA 4NOHA 2V7LA 1Z7UA 4Z91A 4DLEA 2WZHA 3RI4A 2J8SA 3I54A 5FD6A 3UDCA 2R92J 3FIWA 4MIMA 3DU5A 1VQSA 4QXCB 2KI2A 2HKOA 4HV5A 2UUZA 1TV6B 2L4MA 5A1LA 2XGEA 2OO4A 2A68F 5D8LB 3JAEA