3KFWX

Uncharacterized protein rv0674 from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
SLTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVALTRMVGAGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTDARTRAALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDEAPADLAGQLWDLSGWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDPMLPAELLPADWPGAGLRAAYHDFATAMAKRRDATQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Uncharacterized protein Rv0674 from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07848 PaaX PaaX-like protein
X PF08223 PaaX_C PaaX-like protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kfwX01
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kfwX03
3.30.70.2650 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kfwX02
2RV8A 4MEXF 5F64A 2FBKA 1B6AA 2GIVA 4ENKA 5CVRA 1XDUA 1G6NA 3OV8A 3P9CA 3RI4A 4A0YA 1C0WA 2XAHA 1V4RA 5K1YA 2A6EF 1O3SA 4G94A 2YX4A 2EFQA 2O03A 1YO5C 1IRFA 1O3RA 3LA2A 1KQ8A 5LRSA 4HDVA 1KGSA 4ESBA 5DCMA 4LLLA 1G3SA 4HYEA 3LAJA 2OQGA 3PFIA 4M6YA 2QQBA 4U0WA 3BPXA 4CGZA 5D6FA 1SFUA 1L0OC 1UHMA 3LWFA 2FEZA 3WODF 1XSDA 2UZKA 1R7JA 2NNNA 1D8JA 2ZNYA 5CJ9A 2DLLA 1D8KA 3N97A 1ZREA 1Z6TA 2NYXA 4I7HA 4UV8A 3HHHA 1X3UA 1GHCA 1J9IA 4MEYF 2F5DA 5HLGA 4L0ZB 1S8NA 1Z6RA 2PI0A 2FMYA 2OA4A 4EJUA 3KLNA 3JW4A 1F1ZA 4FX0A 3VEPA 1ZN2A 1OYIA 4RB0A 3P7NA 3J80Z 2OZUA 4ZZLA 1R1TA 3RPUA 1E2XA 3EQLF 2CW0F 3LQRA 3CO6C 2XROA 2RKHA 1LJ9A 4QLCU 2NNYA 2HWVA 3RJPA 3I53A 1ZHFA 2K86A 5F1RA 4LLNA 4L9VA 1AOYA 4MHGA 3K69A 4QWQA 1ZRCA 4ZYEA 2FU4A 3ML6A 2HTJA 4GYIA 4UVCA 5HS8A 2EWNA 3EDPA 2EB7A 3RYPA 1BC7C 4Q47A 3G73A 1MDMA 2GXBA 5BQTA 3HSRA 1W7PB 2RNJA 3IWZA 1B1BA 2ZNZA 2K02A 1BBYA 1YLFA 1DPRA 1HKSA 3E3VA 2FXAA 3DXJF 4EM0B 5HVQC 3F8CA 1FWZA 2HEOA 2A6HF 1E17A 5LGNA 1H0MA 3ELKA 2D2WA 3WGGA 5D5VB 5EEHA 4XLPF 1YW7A 1QNTA 2DFIA 3GW2A 1S6LA 3M1EA 2D1VA 4TV7A 3HOSA 3LA7A 2O0YA 4KFCA 4ESFA 1LDDA 5EEGA 1KQ0A 3EYYA 5BS6A 2P7CB 3FXRA 4XSZF 4GYGA 4EGZA 2V6CA 1R58A 1XGOA 2ZJ2A 3BP8A 4I98B 2FA5A 3O3KA 4IPAA 1DPUA 4JK1X 4OMZA 1LNWA 3IRQA 1MGTA 1PDNC 3IKVA 4U88A 4I0AA 3WG9A 2WWYA 3F8MA 4L18B 4ZYDA 2E1NA 1YG2A 2XAQA 2IRFG 1HW1A 1QBJA 3DP7A 4OMYA 3J80K 1OPCA 2VOPA 3BPVA 3B73A 2IPQX 3QP5A 3I58A 4HV6A 4LB5A 4KYWA 4HBLA 5CVUA 3TO9A 4A6EA 3ECHA 4MQVA 4YIFA 2OAZA 3TOBA 3J81Z 4FX4A 4P5OA 4A0ZA 4KIBA 5ICFA 1TLHB 2JRTA 4L9JA 5CVJA 2MD5A 4GXOA 2E1CA 2ISYA 5TRDA 1F4KA 3ZMUA 3ISPA 2VODA 1LEBA 1P4WA 1O7FA 1UFMA 4MNUA 1YW9A 1PUEE 1B59A 4HDUA 2VT3A 1XGSA 4HW0A 2GA2A 4RAZA 4LFUA 4WX9A 4IRGA 4WXDA 1HXDA 1U2WA 2M1BA 3QP6A 5FLXZ 2K27A 4ETSA 3JAMK 1SD5A 4LK0F 2CG4A 4XBFA 3CUOA 5CVIA 3H92A 3HOTA 3HRUA 4G7ZF 4HLXA 3V7RA 4KIFA 3Q9VA 1QZZA 3BDDA 1ZYRF 5HS7A 2IA0A 2LSOA 2XRNA 2P7VB 4RB1A 3I54A 4CICA 5L3CA 1NHAA 1P2FA 2QENA 4ENMA 4KNYA 5JI6A 3H3UA 2ZO4A 5E17F 2V1DA 4A6DA 3ZMDA 2H6CA 2KIFA 1R5HA 4Z2YA 1XB4A 3ZMTA 1WI9A 1WWXA 2XAGA 2D1HA 3DPTA 4HX7A 2XUBA 4KICA 4HQEA 5LHHA 2ZXJA 1UB9A 3SXYA 3DPLC 2P5VA 4IHSA 2XKPA 1OKRA 4M71A 3RKYA 3MCZA 2HQNA 5LHIA 5DCFA 1JE8A 5E20A 4HLYA 2O6GE 3HYIA 3J81K 1D5VA 3VOEA 4NHJA 3SZTA 3REOA 1CF7B 3R0JA 1IUYA 2H94A 3V8KA 3WU1B 3SQNA 3HRSA 2L4MA 2QM3A 3FM5A 4YFNF 4M9XA 5CLSA 3FHZA 2FF4A 1YIOA 2F5EA 3FMQA 3EUHA 5IT9Z 5HOOA 5CVVA 2CFXA 5L3FA 3NQOA 1STZA 2HKOA 4CDGA 1FOKA 4B09A 4UVBA 3GEZA 1IN6A 2VT2A 4UV9A 3ECOA 4K2EA 3I64A 2PFBA 4RGUA 5LRRA 2FQ3A 3D0SA 4RGXA 5E1WA 4O3MA 1O7LA 4LD5A 2XASA 4LGWA 5L3DA 2RC4A 4M74A 5E8IA 4EVIA 3JSPA 2XIGA 3VODA 3FXUA 4BHCA 5FLXK 1OR7A 4S04A 1UCRA 2NRAC 3IWFA 4XRFA 3F6OA 4R79A 3GZ5A 4IRHA 1IN8A 1L3LA 1XD7A 3K2ZA 2PMUA 1ZG5A 2FBIA 2EJRA 2YX7A 5HDNA 2DU9A 4AWXB 2ZMEA 2GZWA 5ILSA 1ON2A 4PGGA 3WTZA 2LNBA 3H3ZA 1SFXA 1YQAA 3WE3A 1IN5A 1KU2A 3CUQA 3KP5A 1K79A 1FLIA 1MKMA 4HZFA 4O6JA 5DDGA 4L5JA 1BI0A 4N0BA 3KFWX 3WTWC 2IA2A 2H27A 2V9VA 1FP1D 3TDUC 4WWCA 1XCBA 2VBYA 3WTSC 1I27A 5DCMB 1K78A 3ZN1A 1YTYA 2VE9A 3KEOA 4M72A 1SD6A 4IVNA 3CUQC 2V1XA 2L3DA 3GYHX 2AS5F 3TO6A 1J7KA 3L00A 4Q4ZF 2A68F 2MLKA 1RZ4A 2A07F 3F3XA 1XN7A 5IT9K 3PQKA 2ZKZA 2M30A 3HTSB 2GWRA 2WC2A 1FC3A 3GFMA 4ASNA 1VTNC 3KZZA 4ENNA 1SMTA 4RS8A 3GFJA 2CWEA 2PLYA 3E97A 3QPHA 1WSUA 1OMIA 1PP8F 1FBSA 1T2KA 3LA3A 1ZG1A 4OIOF 1XMKA 2PG4A 2IW5A 1J2XA 3J7AO 2A61A 4EJVA 4IXAA 1I5ZA 3TKYA 4EQQA 5J8FA 4M6XA 3HTUA 3AAFA 1TBXA 4MGRA 2DPDA 1REPC 4LLGF 1YS7A 4YFXF 4FHTA 1XGNA 2QVOA 5HS9A 2A3SA 3WE2A 2ZBKA 2JPBA 3DEUA 2LKPA 1USSA 4NQWA 4EJOA 4ZH4F 1MDMB 5ED4A 1R5GA 2DW4A 4I0BA 2L4AA 3FX3A 5LGUA 3V7SA 4UVAA 4PZJA 3ZMSA 2Z33A 3NRVA 2QYOA 3F8FA 2D45A 4N9HA 5D5UB 4G6DA 1R1UA 1RNLA 5E1ZB 3L2CA 1FX7A 2P6TA 5FFXA 5JVTA 3V8JA 1QO0D 3QU3A 2Y48A 2DQRA 3IKTA 2DT5A 1BIBA 3IC7A 2OQRA 4MQ9F 2DO7A 1J5YA 4DQ2A 1MJAA 1O3QA 1Z05A 2BEOA 2UXNA 5KK1A 2C6YA 2QQ9A 3P9IA 1ZGJA 3T8RA 1FT9A 1YS6A 3MWMA 1S3JA 2XV4S 4HX8A 3BOQA 1BC8C 1LVAA 4A5NA 1W7PA 4OIPF 1JHHA 2XKOA 1G3TA 2GA1A 2HQRA 3C3WA 5L3GA 1BOAA 4EGYA 2V1UA 3JAMZ 2UXXA 1LDJA 4EMSA 2K4BA 3RDIA 3MEXA 2YU3A 1OYYA 4KN7X 3V4GA 4ON0A 2CQKA 5AIQA 1P4XA 1MJ9A 4P9FA 4B8XA 2JZYA 3ZMVA 1FSEA 5L3BA 2VBZA 3T5XA 1ZRDA 4E70A 2VONA 4P55A 2LF8A 3CLOA 3MAJA 1R22A 2V79A 2M87A 4I09A 4UHTA 1FBQA 2WV0A 4KN4X 3GVAA 4KUMA 3F6VA 1Z7UA 3QAHA 3R61A 1AWCA 3WTUC 3KP2A 3V7CA 5FB2A 1HKTA 2E7WA 3M9AA 5ICEA 1IN7A 3U2RA 5FGMA 3KP3A 3WTXC 3BJOA 1SD7A 3WU0A 4AIJA 4ZYGA 5J8CA 2RDPA 4MTEA 1IXSB 5DD8A 1U5TA 5IT3A 4A2UA 4UXNA 2LF7A 3LQQA 1IXRC 1W5TA 2GXGA 1USTA 4HOBA 4RB2C 1IZ1A 5ILUA 4HA8A 3E6DA 1DP7P 2HFHA 1ZRFA 1ODDA 4M73A 1XDSA 2P5LC 4MTDA 1TQPA 4YFKF 2EV5A 2PQ8A 3HRTA 5DD4A 1ZLJA 1T38A 1U5TC 5LEKA 2HDCA 2W25A 1TQIA 1WKMA 2BV6A 4OU0A 2QQAA 3HRMA 2IJLA 3MZYA 2Z3YA 4L0YB 4IHTA 2CSOA 3S2WA 5DYMA 2COMA 2QUFA 5JFRA 1FPQA 3F23A 2EA2A 1RI7A 4HX4A 3GX4X 2FSWA 1U78A 4U7DA 2BGCA 3HHGA 5D6EA 5LBQA 2YSRA 1QZYA 5H20A 4XSXF 1JXSA 4LMYA 5D5XB 5HLHA 2RVCA 2R7DA 4P9UA 3FWEA 1BI2A 4A5MA 2IA1A 4YG2F 3C1DA 2MA3A 4LG0A 2O8XA 3TO7A 3EETA 2EA4A 2BE5F 2GQQA 4G7OF 4G6QA 3KE2A 2FBHA 3BJ6A 2HYGD 3COAC 5FFZA 1YFHA 2K4JA 2MH2A 4BYYA 4EJWA 2M45A 3FZVA 3LFKA 2MBFA 5K5OA 3I59A 4R8HA 2HKXA 2EFPA 3QU6A 3F8NA 4HAMA 5LGTA 1U3EM 3E5QA 3R6SA 1UHWA 2Q0OA 2DK8A 3Q9SA 3DKWA 4L9TA 4JBAA 3RKWA 4ZYHA 2YPRA 4KMUX 3VFZA 4ESJA 2CGPA 4BNCA 1FYMA 4IJAA 4IF4A 3B02A 3RIRA 3HSFA 1LDKB 1T98A 4I2OA 2EFNA 2FRHA 3F21A 5LLQA 2VXZA 3N4MA 1FYKA 1B9NA 5ICGA 3K1NA 2W24A 3JTGA 5JHUA 4AIHA 4Q48A 2KRFA 1MZBA 1OYWA 1YYVA 5F6FA 4S05A 2P8TA 2ZCWA 4L5IA 3IHUA 2W84A 3K9TA 4CHUA 2QBYB 1P4AA 3F72A 4I02A 2KJBA 1YW8A 3KCCA 3CO7C 1T6SA 2W57A 4HQMA 2FOKA 3C18A 3BJAA 3K1PA 1KU3A 4D0PA 3GZ6A 2JTVA 1GXPA 5AONA 3O2PE 3MZHA 4EJTA 5TJJA 1T39A 1SAXA 3CUQB 3CDHA 5L3EA 1RIOH 3O6BB 2NAZA 2VE8A 1HW2A 1WRJA 4RB3C 1EV7A 1P92A 2AXLA 1GVJA 4G9YA 5K5QA 1TNSA 2O61A 5A2QZ 3WGHA 2M5WA 1FP2A 5BPIA 1K78B 5DEQA 5E8GA 1XCVA 1DDNA 3QPTA 2STTA 2A5YB 1MJBA 5DUIA 1BM9A 2DBBA 2YR2A 2Z99A 2JSCA 2IT0A 5BOXA 4N9IA 2PBIA 2HZTA 5BPDA 4Y17A 3R4KA 1BJAA 3DV8A 1G4DA 2W85A 2XGXA 5AIPA 3HSEA 3E5UA 4ZZDA 4WF2A 1G3YA 4NB5A 2FNAA 2Q8KA 1DUXC 1HSTA 2Y0MA 4M9SA 3KZYA 4UNOA 3K1MA 5HLIA 3SHFA 5FD6A 3FM3A 4Q5SF 3L09A 4F7ZA 2O3FA 3F8BA 4LJZF 2ADUA 5E1XA 1K6OA 5H6RA 1J0RA 4BAYA 2Z5UA 2VBXA 4O5VA 1BN5A 4GO1A 1KA8A 5HDKA 1D3YA 2HGCA 3TDZC 3M8FA 3CJNA 2XAFA 1QPMA 2HS5A 3M7GA 3DF8A 1W5SA 2R3SA 2PJPA 5K5RA 2X4HA 3GFLA 3IL2A 4RAYA 5DV5A 3C7JA 2STWA 4YIIA 2DTRA 3ZP5A 3T1BA 2OBPA 2QLZA 2FE3A 4HF0A 2H09A 2DQLA 3FMSA 3GFIA 3GUDA 3TQNA 1O57A 2P4WA 1R36A 1BI1A 3ZPLA 5HDGA 3R60A 1QGPA 3E6BA 2CYYA 2RQPA 4KA4A 2NS0A 1B4AA 4P96A 4PCQA 4ENJA 1U8RA 1IF1A 1Z9CA 1FSHA 1O3TA 2L01A 4LK1F 4KMFA 5LEJA 3ABTA 5A2QK 1K7AA 2KJCA 3FF5A 4BXUA 2MLGA 2WTEA 1H9TA 4WK8F 1ZLKA 3LSTA 4EM2A 1HSJA 3E6CC 2G9WA 3MFKA 2KIMA 4PGHA 4WCGA 2H6BA 1GXQA 2DPUA 2Y75A 3IRRA 2IP2A 2J5PA 2P5KA 3GXOA 1F9NA 5ICCA 2EV0A 4A12A 3KLOA 4BHPA 2F5CA 3I0TA 3E6MA 4XLNF 3I5UA 2RN7A 1H9GA 1I1GA 2HYFA 1ONVA 4OINF 1U6GA 3ZN0A 4OIQF 2OZ6A 2EV6A 2DI3A 2F2EA 2HTSA 4BH9A 3EYIA 4RGRA 4UUVA 5ILVA 1HKQA 1HQCA 3KEQA 2IVMA 3QRFF 1XSXA 2BYVE 1IXCA 4U0YA 3ZMZA 2OU2A 1JGSA 5D8LB 5H6QA 1JHFA 2XHKA 2HOEA 2ACJA 3BWGA 4OIRF 3P9KA 1I6XA 2M8EA 4GGGA 4I01A 2LDUA 2TDXA 3GLXA 3HUGA 1RUNA 4KDPA 1U5TB 4FT8A 2L02A 1ZG3A 1FBUA 2XVCA 2K7LA 4EM1A 2P6SA 3WGIA 1W4MA 4BQAA 3KP4A 2B0LA 5DUKA 2OD5A 1S7OA 3W6KB 2MC3A 3W6JB 2BBYA 2Z9OA 3MQ0A 1PP7U 5ERIA 1HW5A 3RTRA 4AD9A 2MH9A 1FY7A 1BIAA 2ISZA 3VB2A 1Q1HA 1J75A 3Q5FA 3KETA 4HF2A 1TQMA 1HBXG 1ZARA 2CO5A 1ZH5A 1RUOA 2F5FA 4WXCA 2KKOA 1Y0UA 2ELHA 1EH7A 3BZ6A 2EK5A 4AVPA 1WQ2A 1I1SA 3K0LA 3SFZA 1MD0A 3GO5A 3T8TA 2DK5A 1ZGAA 2VBWA 3BROA 1FYLA 4G8XA 3FXQA 2G7HA 3ULQB 1TW3A 2KIUA 4KIGA 1XSVA 4L9NA 3RKXA 1TW2A 1CGPA 3ZQ7A 3L7WA 1KYWA 2UWMA 2JPCA 3ABUA 4A0XA 3FMRA 1ULYA 1EH6A 2QWWA 4LG0B 2RGVA 3G3ZA 2VN2A 4AIKA 2FMLA 4GCVA 2XAJA 4CXFA 3NEUA 1T0FA 2QZ8A 2Q2EA 3HIFA 1V3FA 1XMAA 3SZPA 1SD4A 3TOAA 1R1VA 4CYDA 6PAXA 3I59B 2ETHA 2E7XA 5E18F 3U1DA 3V8LA 4LB6B 1G3WA 3E5XA 1FZPB 5D8KB 1LB2A 4HF1A 1QQIA 2R7FA 3I71A 1Z91A 4R1HA 1IN4A 5FD5A 1FNNA 4OOIA 3QOPA 2GAUA 5LHGA 2ZFWA 3KP7A 4CZZA 4JQFA 1A04A 4U7BA 4DNCA 1IAWA 3GWZA 1IRGA 1R00A 3LAPA 1KQ9A 4Y15A 2ESNA 3WTYC 1S29A 3CTAA 5D4SA 4IRIA 1F5TA 2DAOA 5BMZA 3JTHA 4EV0A 3I4PA 1J59A 1IW7F 2EFOA 2VC0A 3D5LA 4H0EA 1CF7A 5KVRA 2HR3A 4M9ZA 1XGMA 3JSOA 3TGNA 1KU9A 1SFEA 2ESHA 5D4RA 3DQVC 2FNPA 2A69F 2G7UA 4G7HF 1EH8A 3ERED 1ON1A 1TNTA 5CYVA 2JT1A 2VC1A 1ZAOA 3U9GA 3T0YA 4RGSA 3F22A 5JR3A 1LEAA 4BHBA 1KU7A 3WTTC 1R23A 3BY6A 2PN6A 1LQ1A 3GF2A 4Y13A 2EFWA 1SMYF 2ZMEB 3ROUA 3RPQA 4PDKA 2PMHA 3DFGA 3L9FA 4WXHA 3M8EA 3R0AA 1W7PD 4U0VA 3RYRA 2J5OA 1P6RA 1B9MA 4HV5A 1Z1DA 5J6XA 4KT5C 1BI3A 5D5WB 2PEXA 2VOOA 2QBYA 4CO8A 2L54A 2X0LA 5FO5A 3WTVC 3PQJA 1KYZA 1TTYA 1S7AA 3OOPA 3KP6A
chains in the Genus database with same CATH superfamily
1IBLT 1YBTA 1UA1A 2JQ7A 3VGSA 1R0BG 4ENKA 4CLTA 1T7SA 4CNZA 1UX5A 1AU7A 1G6NA 4KHPT 3OV8A 1S48A 1Y8QB 1BW6A 1V4RA 1S6QB 3FBZA 2A6EF 1LW0A 3NAUA 5BNGA 3V6DA 2MKYA 1EIYB 3UU8A 2K9NA 2EFQA 2OPSA 1K61A 1MH3A 4W4MA 2RAQA 3VAJA 3HD2A 1IRFA 3RQ4A 1NDKA 2W2UA 1M1KT 3OL3A 1YBAA 4HDVA 4CN4A 1UX4A 4ESBA 4CO4A 2MOZA 2IYGA 2VA3A 3KUEA 1FI4A 2R7WA 4LLLA 2DD8S 2JC1A 5H9FJ 5FLVA 2DNHA 3PR5B 1VIXA 4BUPA 4L9IA 2LM2A 5JDHA 3CCQS 5JDFA 3VGVA 3LAJA 1S1TA 3PFIA 4K7QA 2QLXA 2V26A 1ZP0A 1J5WA 3DBLB 3VV2B 2CVIA 3KK2A 1SKSA 4CGZA 3SCJE 5D6FA 3AEDA 1UHMA 3LWFA 2VL1A 3CJ8A 4HHJA 4IRCA 4ED3A 2NNNA 1SPBP 1D8JA 3SOLA 2VIXA 3B6AA 3O9XA 1GLNA 1NM2A 5CJ9A 4CYCB 1J1JA 3RCOA 4WF9Q 4LMKA 1VBZA 4Y65A 1Z6TA 2NYXA 3P5TL 2HWTA 4A97A 1GHCA 5GPAA 3RJMB 2W7OA 2HRTA 5HLGA 4II2A 4IDPA 3BREA 3PIOQ 4BWJA 5DG7A 2JRMA 1Z6RA 1DBDA 2OA4A 3H20A 3AE4A 3FMBA 4B17A 1XNQT 3LP0A 3KLNA 2B3TB 2DI4A 2ZH6A 1ZN2A 3BN4A 1Y11A 4AKGA 1W2IA 2NVQJ 4A8MP 3VSLA 3RPUA 2HQAA 3EQLF 2RE1A 1LWEA 3HM9A 4C3KA 1HWKA 4K2JA 4OHVA 4PXDA 2GIQA 4CM0A 1I94T 3KOAA 4QLCU 5HO4A 1ZHFA 4NIQA 4M5LA 2IGKA 4MHGA 4LSLA 2ZM2A 3ZTOA 2DPIA 2FJEB 3A2KA 2FU4A 3ML6A 2HTJA 3CCLS 4YR2A 2D69A 2QGFB 1OCCH 2XYHB 3HXMA 4UVCA 5HS8A 3E3XA 4QPTA 2H89A 4C3HJ 2W1BA 1I6HJ 1H72C 1MDMA 1IKXA 2YXLA 1T0TV 4KV8B 2DHRA 2DA6A 3NBPB 1B1BA 4OYJA 3L1PA 1FNXH 3PJWA 2V94A 2XMVA 3LP2A 1N34F 3UR3C 2DT6A 3GLLA 1LKXA 1FJEB 3UDEA 4O44A 4EM0B 4NYPA 4ECVA 5KFFA 1FWZA 4LREA 2A6HF 5LGNA 3PIPQ 3FXOA 4C3IJ 4ZP8A 2ATCB 1RXOB 3EE3A 3NRBA 2GHPA 4DMZA 5JRCA 1RADB 3DGPB 3WGGA 1IV6A 5D5VB 1NJYA 2Y9YA 1YW7A 4BL0B 5K9FA 1WCMJ 3G96A 3IEEA 4KQZA 5LSOA 1WEYA 4M6VA 3KLEA 4YR3A 1JWWA 4PJNA 3LSHA 5GAEI 2YWWA 4TV7A 2D1VA 2MDAA 3FCWA 2Z1DA 3LA7A 1K4TA 2IXSA 1BWVA 3SYZA 4Q44A 3KX2A 4B3AA 3HSJA 3FZMB 2G2ZA 2W4XA 3LK2B 3FXLA 2X1AA 3ZC0A 2D3ZA 5DM7Q 2RF2B 2JQHA 1RWNB 4WFZA 3JS9A 3HM5A 9RUBA 3MMAA 3C2BA 2JMHA 3VALA 1Y6IA 3UU3A 3LAKA 2ZJ2A 3BP8A 4ZTJA 4ISTA 1E6VB 3ZXWA 4A8FA 2ZFHA 3O3KA 4QWEA 3GV5B 1HA8A 2Y69H 3NRYA 3JYTB 1NJZA 4MBQA 3HUGB 4Y52J 4F93B 3DRPA 3US5A 2FYXA 4PQAA 4ZXLA 1TMMA 1OEDB 1FIPA 3PJXA 2LR8A 1JK9B 1QZEA 1WEZA 2DMNA 3WG9A 5IXUA 2BKOA 4PJJA 5JVGF 3BBCA 1WC1A 4ZYDA 2OD6A 4AU7A 6FD1A 2YKNA 1ETXA 1RR7A 3NZQA 4DV2F 4WYVA 4RW8A 4B3TJ 2R7RA 3SFEA 5LT5A 4O4GA 3EDRB 1R3NA 1KK7A 2CPHA 1OPCA 2VOPA 3FZ2A 4CTAA 3BPVA 4KO0A 3Q5WA 2IPQX 3CJ0A 1QM9A 3BZQA 3BR1A 1FRKA 4F8RA 3W63A 4LB5A 5G0RA 1TL1B 3W8PA 2E35A 2DNQA 3B78A 2RNGA 3H0PA 2NXCA 1CJVA 5HCJA 2YK0A 4KT6A 2LRKA 5CCLA 2O3DA 1TWAJ 4P5OA 4FISA 5DG9A 1CC7A 4O2AE 1RTJA 1TLHB 4L9JA 5CVJA 3OMYA 4Y33A 4L74A 1BXNA 5A6WA 2E1CA 2JZ5A 2N82B 5TRDA 4EATA 3MEGB 1F4KA 3NP5A 1WTFA 5KXJA 3AT1B 1R49A 4MT1A 4DUYT 5KFQA 2KISA 2V7MA 4C6AA 1QVTA 3JSRA 4DN9A 2XUEA 2KZ7B 1O7FA 1GXLA 3H25A 3OS0A 3DLGA 1RKWA 5L4EA 5AE1A 1PUEE 3KUHA 3ZT7A 2ZHBA 3BGFA 1E2AA 1PCAA 3BZKA 3DCFA 1IBMF 4Z7CA 1KKHA 4HDUA 2E5LT 3D5MA 2VT3A 3NNCA 5FLMJ 4MKBA 1MU2A 3MUVP 3LSJA 5I42A 1VR6A 2NXNB 3UTKA 1MROB 4DS5A 2IY5B 3FZKB 3RX6A 2FZKB 4U7UD 2BQRA 1QD1A 4HH0A 1YBUA 1BLUA 4P52A 2M1BA 5FLXZ 4ETSA 4WPAA 2DHGA 1FE4A 1SD5A 4XBFA 2AGPA 1J5ET 1CJUA 1MBKA 1K1QA 3HOTA 2BY0A 3TEGA 5LJ5Y 1X4OA 2X6WA 3BDDA 1ZYRF 2AJQA 3GQCA 2LSOA 1ACIA 1JXEA 4OI4A 3DKDA 4OJGA 1MG7A 2M3DA 3EM1A 3HSDA 1HC8A 2OPPA 2O1PA 5IC4B 5HEUA 2R5ZA 4XIDA 3H9GA 4OZNA 1FHTA 3M8PB 3MR2A 3I54A 3A4TA 1R8HA 4WE1B 4B44A 3CPZA 1SUMB 4ZC3A 5L3CA 3FQLA 2H54B 1SVLA 2QENA 5B0BA 3FBLA 2KH9A 1EAYC 3DFEA 4WW0A 2J7KA 4DR5J 3QYYA 2ZO4A 7AT1B 5FDLB 4JI8J 4IFVB 3TQEA 3TWZA 4A6DA 2FJDB 2XSAA 2JOQA 4A8QA 2UXCT 1VQ4S 3AODA 3SZ2A 3R5AA 2KIFA 2GVZA 1R5HA 4V2FA 5KFIA 1M1HA 1WWXA 4FVMA 5A8RB 2D1HA 3FEZA 2HH7A 2KL8A 1AKHB 5A2QY 5LHGB 2QV6A 4CZZB 2LY9A 4HQEA 2EK1A 3FJ2A 3RB6A 1TV6B 1UB9A 3NGUA 1M1EB 3EGNA 3KV9A 1XZYA 1KN6A 1OKRA 3MCZA 2IHR1 3UUBA 4CLWA 3TP3A 1DJ0A 3CJTA 2W9AA 2BOLA 1U8SA 4P0AA 4ED2A 3TEDA 3J81K 4BBRJ 4M5DA 1N6QB 1D5VA 4JI5T 1X4BA 5KFSA 2BW7A 3R0JA 1IUYA 2K7JA 2DT7B 1GXTA 1Q5YA 3V5UA 3M8RA 4LFAT 3SQNA 2HLTA 2M8DB 4QH4A 2HMIA 3OSGA 1Z21A 1S7HA 4W92B 1ZAWA 3FM5A 5DM7F 4NXNF 2C2RA 1BUXA 3IF8B 2F5EA 1S72S 2MD0A 2YNFA 3IP4B 2LQ5A 3KZIC 4E8UA 2X48A 3MAAB 2NTXA 1OPIA 4R0JA 3G71I 1S7IA 2CFXA 3JRGA 1XR7A 2WAQN 2C0SA 3LG7A 3JREA 1STZA 4CDIA 4B9MA 3SWHA 3OSPA 3CMAI 2HHTA 3K70C 3M05A 4DX6A 4Q0BB 3QWUA 2HQIA 2WBRA 2IS2A 3A3PB 5C24A 2QMWA 1IN6A 2KFDA 2VT2A 3ECOA 5JLXA 2LHNA 2YWKA 4RGUA 4USHA 4K0KT 2QLWA 4RGXA 1RTHB 4AFFA 4Y34A 2QYCA 4QIWD 3S15J 2JSXA 1O7LA 1ZETA 5HNFA 3KDSE 3LSPA 3C16B 1TL8A 2LSGA 1AA1B 4F2SA 2OLWA 1CHUA 4GK5E 3VODA 2M88A 4DIDB 3AJDA 4EYIB 1VC5A 1HNZF 2H5JB 1M62A 4S04A 4LF8T 3TLVA 2X0LB 4G2AA 3IWFA 2NYIA 1SJFA 3JRDA 2HNYB 1QLNA 4IRHA 5ETTA 4OQJA 3LSGA 2PMUA 5HROA 3C4ZA 2CUFA 2FBIA 4DO0A 2LREA 4ZPTR 2YX7A 3CCES 1CBKA 2MKHA 5LFAA 4N8OA 5M4YA 3F44A 3Q0VA 4YHJA 2GZWA 2UXDT 4PGGA 3EGWB 3G6ES 5ETSA 1WJEA 1WH7A 3WTZA 4EK2A 1OISA 2WBMA 5HLTA 3ZT5A 2V4QA 5HL7Q 3SQGA 3RBZA 2DPJA 1RHJB 4ECYA 2VPRA 3JCFA 2FJXA 1YQAA 5F0FA 3CUQA 3I9V9 3V6DB 4HZFA 3VHLA 2OPSB 1BI0A 3KFWX 3WTWC 2B4OA 1OYEA 2IA2A 2ATLA 3MR6A 5TGTA 3S2HJ 1BW5A 3KJVA 2XDVA 2M34A 2YWFA 4ASKA 5KFAA 3D9BA 1XCBA 1U0SA 1ETOA 2M2EA 4M5JA 3S8PA 3GONA 3ZN1A 3H2VE 3D1HA 1U1QA 4M72A 4WTYA 4IVNA 1ZHCA 1S1TB 3CUQC 3WI3A 1XMOJ 2WW4A 2L3DA 3GYHX 4BC7A 2AS5F 3I5CA 3MFIA 4F92B 1YITS 3KK2B 2DNXA 3MVPA 3L00A 3LSVA 1AUDA 4QR0A 3GYXB 4FPIA 4GVLA 2ZKZA 4I2QB 4ZEYA 2ACZA 1S7EA 3CJ5A 3PUZF 3HX9A 4PG5A 3I6PA 3M9MB 2KT0A 1TUGB 3KZZA 2UUZA 3GJSB 4LOCA 5CGMA 1X2MA 4ENNA 5HJXA 3FFIA 5DLGA 2X6XA 4ZVTB 1YZ7A 4R0EA 3GFJA 2CWEA 4JYKA 2YKOA 4OX7A 2XO7A 2BXYA 1SHZC 4DR6J 3EX7B 1JLQB 1US7B 1WWHA 1T2KA 4AQYF 1TT5B 3LA3A 3LP0B 1WZ2A 1ZG1A 3MMCB 4FYXB 1ZM9A 5HK4A 3CULA 1UK5A 4RNNA 3J7AO 5F8PA 1J2XA 4NDLA 2VVSA 1I5ZA 3R2DJ 3H98A 2HRYA 4AIDA 5EHHA 2VXDA 3SDGA 1LWEB 2QVAA 3MPYA 5K14B 3S1NJ 4M6XA 4TQSA 3SFDA 2J9DA 2OV9A 3AAFA 2JEIA 3ILIA 3RAMA 3N5BA 4MGRA 1IJEB 2CPZA 1X4DA 2Q1ZB 4LSLB 5I3UA 1B8IB 1REPC 4YFXF 1YE9A 4OZLA 2QVOA 1UAAA 4UVCB 3MKZA 2ZBKA 1RTIA 5ABHA 4RAFA 3MURP 4C4WA 1K6YA 3EXYA 2BY3A 1MDMB 3AVRA 1T02A 1IKXB 4YLHA 2IRYA 5KT6A 2I0XA 3DMJA 5LGUA 3OVBA 1Q1KA 4PEOA 3LP2B 2QYOA 1HPZA 1VRUB 5D5UB 4G6DA 1XTZA 2MHNA 4WFBQ 5E1ZB 1VBXA 3DLLQ 1FX7A 2P6TA 3N6LA 3OBIA 4Y2AA 2G0UA 4DYQA 3CXCR 1XTAA 4IFYB 3QU3A 1R8IA 3ZKRA 4AYBD 3HVWA 3IC7A 5LOQA 2DODA 3QRQA 2MKSA 2YWHA 1APSA 5LGNB 4JI2F 1J5YA 1FJLA 4C98A 2JA6J 1JLFA 3C19A 1MN9A 3M9NB 4ZHRA 2KVQE 4U7YA 1RCXB 5H2FC 5FY1A 2L9SA 3KLEB 2QQ9A 3O1IA 4DVDA 1FT9A 2RU9A 2RHQB 4K4XA 4X0GA 3CMQA 5L4HA 2VUGA 4DYRA 2BOPA 2YQ0A 1V55H 4E98A 4A5NA 1U2RA 4OI2A 1JHHA 4DL4A 2ZWPA 2GA1A 4DV1F 2AIRB 1JI8A 2K24A 1FDBA 2UXXA 3S4UA 3OD2A 4BBYA 3G6XA 1UZHA 3MMAB 3B6BA 3N2OA 4GC7A 1NBEB 2PT0A 2Q6BA 1NJWA 2YU3A 3ETVA 1OYYA 3QWLA 4DSJA 3UN3A 4CA0A 5BMVE 4ANCA 3ZT6A 2BOAA 3W7BA 1ERDA 3UO0A 2LA4A 3IR5B 3K4MA 2KZZA 5AIQA 4BY7J 4C8LA 2DA2A 2XMWA 3DRPB 3RC3A 5ABFB 1AFIA 3CCWA 2JL9A 5H6QB 3UCZP 1TTHB 4X62J 2VBZA 1RAAB 3L7UA 3GU0A 1FRJA 1IXKA 4HSRA 1FTRA 1NH7A 2LF8A 1VS3A 3S3NA 2YKNB 5E0OA 4WFAQ 3KV4A 1OCTC 4C91A 2L9QA 1ZM3A 2YBVA 4O4GB 2HPIA 1H98A 3EZOA 2WV0A 4KN4X 4H4KA 4CTAB 1VJWA 4KUMA 3F6VA 4RA2A 1QAIA 1OWAA 2ROGA 4KO0B 1BD6A 5I3PA 2WZ1A 2WVDA 4BBSJ 4XL9A 1N34T 2QA7A 4HKAA 5G0RB 4OJ1A 4LMZA 3SFIA 3QPSA 1HKTA 3RQWA 5ICEA 3PUBA 2QGSA 1RZMA 1DFDA 3QT6A 3U78A 4DV6J 2CWKA 3H4DA 1S0NA 4F4ZA 3RKOA 1SD7A 1RTJB 4AIJA 4ZYGA 4B1RA 2XQ3A 3ET6B 1XIQA 4FETA 2EIMH 4USUA 4H4KC 3KK1A 3EI0A 3UCUP 4FYVB 3JRHA 5KFWA 2E5VA 5AQUB 1AROP 3HJVA 2ECCA 4BACA 4ZP7A 4Z37A 3EDUA 3R6LB 3LQQA 3K10A 2P9GA 3DLGB 2VQFF 1IXRC 1W5TA 1XR5A 4LF5F 1USTA 3ELHA 2HVSA 2RILA 3DLHA 3RG6A 1DP7P 1MU2B 3ZZZA 5I42B 3MM6A 3A8EA 3BQ1A 1VHFA 4MTDA 2NWBA 3FK6A 2XZWA 4L3KA 3HKZN 2E2JJ 5DZ7A 3EJMA 5DD4A 2O9LA 2CUEA 3OFFA 4A46A 3PEHA 5LEKA 1T8EA 5MLCV 3GV7B 4MO7A 4P7TA 4P0BA 5KFBA 3KMSA 4DL2A 2LDIA 3RW6A 5DGBA 2EWHA 1JJ4A 4XBFB 3AG1H 2IC3B 3UW1A 4F50A 4G3IA 2CH0A 4KGXB 3GTYX 4PJLA 1D9AA 2OPRA 4ZVUB 3UDCA 1OCZH 4IO9Q 4PYAA 1IBMJ 4M3BA 4O3SA 5CYJA 2HAFA 1R89A 2QEXS 4HX4A 1R7IA 2YQ1A 4QWAA 3GX4X 4AI6A 3VSKA 3ITHB 3VAMA 4JBCA 1POGA 2OPPB 3AA1B 2R5ZB 3MEEA 1X9MA 2L08A 5LBQA 3P6YC 2CVEA 3AEGA 4RW6A 1QZYA 3H0GJ 2X9YA 5L3CB 1JXSA 4RKUC 2CXFA 2POKA 3Q23A 5FIIA 3SS1A 4RMNA 2R7DA 2HEKA 1FA0A 3P8CD 2OTJS 1VBYA 2WHOA 4ZS2A 3SEOA 3NG8A 4YG2F 4Y2MA 3KLHA 4KTQA 3C14B 4YT0A 1Y0HA 1NPRA 2YUSA 3TVZA 2NPIA 2B6AA 4ID5B 4NYZA 2M7AA 2XC7A 2BJ9A 3PDYA 2XHCA 3MTKA 2A6OA 4N47A 3CJTB 1KQKA 3COAC 1N33F 5FFZA 3VPRA 2MH2A 2CJAA 1U09A 4UUSB 2DR6A 3OT9A 4BYYA 2AQ4A 1LPQA 3FZVA 4XN3A 1WHUA 5M2UA 2CQBA 1FXDA 3BDEA 1UWBA 4HPQA 5KFTA 3I59A 2J9CA 1NK6A 4NXMF 4G12A 2HMIB 3P4RA 2Q6CA 1Q81T 1QVFR 3H90A 4HNVA 2IIUA 4II3A 4IOAF 3KHGA 2LLZA 2VKOA 2EBEA 3FKJA 2Q0OA 1N25A 3K58A 4GKKT 2ZDOA 5H9EK 1N36T 4JBAA 1ORKA 2FJAA 2CPYA 1FNMA 3CCRS 2MYFA 5CZXA 3K0JA 3S3MA 2G2YA 2X85A 4BNCA 5C24B 4IF4A 5C7PA 4IQXA 2DGUA 3RIRA 4UUWA 4I2OA 4Y7NJ 1AYEA 3IAM2 2JMWA 3MOZA 2LSIA 3FEXB 3PRVA 3WDOA 3GPAA 2FJBB 1UG0A 2CNOB 1EARA 1FE0A 3VR9A 1FYKA 4ZP9A 2OA5A 2ZSIB 4P1NA 1FRXA 1X7VA 3C4XA 2WAUA 4DZ6A 4N78D 1R43A 5F3ZA 1OY8A 5JHUA 3G82A 1OXZA 1VCSA 4AIHA 1CS4A 3VAHA 1HBOB 3N6MA 4NI2A 1REVA 5HMWA 4A8XA 1V54H 3QB5A 1J5OA 2HQGA 1FWPA 3NLCA 4L5IA 3GP9A 4B3SJ 2Y0SA 5HROB 1GEHA 3H5XA 2QBYB 3PM9A 1P4AA 3F72A 4I02A 2CBIA 3N5LA 5L1KA 2KXPB 2ZJQQ 5AE3A 3C18A 3K1PA 4UF4A 1PBAA 2PFVA 2C3MA 5AONA 2V50A 3O2PE 3MZHA 2MZQA 3ZZUA 2CPTA 2IEKA 4EJTA 5FD1A 3SQGB 1FCAA 2UVRA 3CJQA 4EZ4A 1SAXA 2WDRA 4FI5A 1X3ZB 2YS9A 1KEKA 3CUQB 4QWBA 2W7AA 3JSYA 4OFZA 3QGIA 3UN2A 2NAZA 1IZNB 3B13A 2CQQA 2VE8A 3QRRA 1QSSA 2XQAA 5EF6A 5IWAF 1MBFA 4TLRA 1LE8A 3WGHA 3IG1A 1FP2A 2E1AA 3PW0A 5DEQA 3ZN1B 1WELA 5E8GA 3C6TA 1DDNA 2L9DA 5JMNA 1VQOI 1P1LA 4V1Av 2V6YA 2N7CA 3MZIA 4GMKA 2YR2A 4HHHA 2HOAA 2IT0A 4X6AJ 2B51A 4BWMA 2HDDA 5A8WA 4I6YA 2W85A 3FZHB 2XGXA 3GMGA 4FXWA 4FNIA 4QQBA 1HD1A 4IRKA 4NC8A 3HSEA 5AIPA 2YN6A 2W1OA 2LSYA 4DCPB 2AO9A 2M6BA 1N54B 2FNAA 2CJJA 3LSMA 2A2FX 2Y0MA 5FMNA 2UUWA 5DETA 2D2SA 3A0BC 2RJZA 3ZSTA 3K1MA 4CI2B 3GFHA 3SHFA 4Q5SF 2XMMA 3EVWA 2HHHJ 1SC3B 5L39A 2E9XB 4QWCA 3CUNA 3CJ4A 4UV8B 4YUDA 5E1XA 2AJ1A 3MPUB 4CLKA 5KFGA 5H6RA 1J0RA 3KYLA 2BKNA 4O5VA 4OV1A 2IAJA 4E7KA 4QYRA 3RR8A 3N9MA 3CJRB 1HFAA 3T5KA 3DWLE 2DY1A 3O1LA 3Q8SB 3DF8A 4OHXA 1W5SA 3R5DA 3OYMA 4RAYA 5CFBA 4U72A 2SXLA 5E3AA 3U1MA 3MCNA 4EUVA 4EEDA 1FFGB 3PXGa 1NENA 3FDYA 3WX4A 2BJEA 1R4MB 2OD4A 3N28A 1RTIB 3W61A 1H3DA 5AXKA 2UVUA 4OL8A 4CLUA 2N8GA 4NLQA 3PX6A 3G06A 3GIJA 3RIAA 5KFPA 1OSCA 1X4FA 3DMJB 5LGUB 3HHLD 3K4KA 3UFEA 2P4WA 2LSKA 3T1HJ 1BI1A 4LF1A 4N41A 4ED7A 1Y00A 2KN4A 3NKYA 3R60A 3M1CA 2ILZA 1W25A 3X2QH 3H0DA 2FOWA 1FWKA 2BE2A 2WV1A 3MI7X 2DHSA 3TL4X 1U8RA 1OY9A 4QJVA 1K47A 1O3TA 3BT9A 3NZPA 4BE0A 4ZOLE 3ABTA 2UXBJ 2HQFA 4ZHRB 1E6YA 2OMOA 3D6HB 2I59A 4USJC 3C2HA 1XNRT 2JUCA 2E5IA 1HSJA 4BE1A 2CMRA 3SQOP 3TZWA 2DNZA 4A3LJ 2PSZA 2AJFE 4NUBA 1RT6A 4AQYT 4CIOA 2JEGA 2H6BA 2DPUA 1HMVA 2Y75A 1NG6A 2UXXB 2VIHA 5B5EC 3IRRA 2R7ZJ 2B9SA 1HS7A 2BR0A 2IP2A 5MAOA 2JA5J 2P5KA 4JI2J 3ZTSA 2EIKH 4DR4T 2N1GA 5JUMA 3WAJA 2EV0A 1L0VA 3KLOA 4BHPA 2CZ4A 3DYAA 1D0ZA 2F5CA 3I0TA 1EP4B 5ETNA 1NHKL 4TNOA 2BKPA 5HQMA 2DRAA 2EI5A 1M0SA 1W0UA 4X66J 4M5NA 3E2EA 3QLHA 2WSSV 3S7RA 3NAIA 3NCPA 1TVRA 3P5JA 2N2NA 3ZN0A 4U8YA 1JKPC 2PE8A 3QGGA 1T3NA 2FVSA 1UMJA 3MOJB 3CQGB 2OZ6A 3OY9A 4ZPAA 4UZCA 1F60B 5SUHA 2VG6A 3IAS2 1PJRA 1EZZB 4K4TA 3LFUA 4UUVA 1NK2P 3DRXA 3A8IA 5AQIB 2WSEC 2IVMA 4XKVA 3RW7A 4X2BA 3GA8A 4U0YA 2XS7A 2CPJA 2O01C 3AE1A 3TAQA 4AKHA 2OU2A 1JGSA 1B7YB 5GAGI 3AG2H 4C97A 3UQ7A 3WHCA 4LRFA 3GR0A 2XHKA 2JRSA 3A8JA 2HOEA 4IH6A 3BWGA 3Q5DA 2M8EA 2ZOGA 2EKNA 2LDUA 4KE5A 3OPCA 3K5OA 1D0YA 3J81j 3K3NA 4IDZA 2ZBRA 2L02A 1N5YB 3W15B 1ZG3A 2DEIA 4F36A 2K7LA 4DF4A 4DV1T 4WFXA 3Q89A 4YB5A 5ADXL 2ZH9A 2GW8A 3WGIA 2KT5A 1RT4A 3KP4A 2MKKA 1CJKA 2OD5A 3ZZPA 1Q78A 4QR1A 3FCVA 1A35A 3F31A 3MM6B 2NXUA 3RTRA 3RF1A 2EZIA 2YNGB 2GNKA 1DRZA 3VB2A 2F1FA 2XZTB 4Z2XA 1F9FA 1JTXA 4YTMA 3D54A 2BUNA 1TK5A 3RBXA 4L76A 5LXRA 3D5RC 4JUZA 2CO5A 3ZXSA 1H2VZ 5IT9Y 4AIUA 3P50A 1LUJB 4LF5J 2KKOA 2OPRB 2ELHA 2K9QA 2KMUA 3AVSA 2XB2D 3BZ6A 1BE4A 2GBYA 4ELUA 4HNUA 2MTQA 4TWDA 1YJNS 3SFZA 2EPFA 3PUXF 1WJ5A 1W36D 2DK5A 2JVOA 2KG1A 4JI4J 1XWLA 2PDAA 5J1PA 3MM7A 3UCGA 2LT3A 5LBQB 4A69C 4G8XA 4RW6B 5C2CA 4LFBF 4BU2A 5C25B 4RWXA 2KIUA 3W2WA 4DR2F 2WADA 2LSJA 1RSCA 3RKXA 2J6TA 2HHXA 2C3OA 1ZV4X 2CJQA 3ZQ7A 1V3SA 2DTZA 2VQEF 3L7WA 2HURA 3OTEA 2E9ZA 2G0JA 1QAXA 4J9LA 4ZI3C 4ILRA 3KLHB 1ULYA 1SJQA 1EH6A 4LITA 3E0ZA 3UWTA 3W9IA 3DTOA 3CJSA 1S12A 4IO1A 1RWVB 4I67A 2B6AB 2KRRA 4B9TA 1FJ7A 2XQ7A 1S0OA 2HZVA 4IOCF 5GADU 2XAJA 3IV5A 3SSSA 3NEUA 2CNLB 4XRSA 3MMYB 2VQFT 3HIFA 3T6JA 3THTA 2WONA 1QAJA 4MYTA 4GRIA 4UF0B 5HP1B 4ECZA 3KJQB 3SZPA 3LAMA 2GQCA 3TOAA 3NWSA 1F3VA 2ZM6J 3LA0A 5LJNA 2FZCB 5EGYA 4JI0T 2B8QA 4KH1B 4BDPA 1UWBB 2VASA 3PW7A 3I59B 2F40A 1PKUA 1JKQC 1SB6A 4M1KA 3E5XA 1YIJS 4IHXA 2JQ9A 1FZPB 1S1VA 1LB2A 4TV9E 3VWBA 5E3PA 2CPDA 4LIWA 2R7FA 1JGGA 2DHXA 3U21A 3MA9A 5K7FA 2R2TA 3I71A 2HK2A 2BANB 3UFCX 2WBLA 3CCEI 1BQNA 2FJAB 1Z91A 4WFYA 5L47A 2G9OA 4FS2A 1AT1B 1N33J 1QVUA 3CF2A 2VU5A 1WI3A 2X68A 2WMNA 3M6WA 4PW8A 1IN4A 1FNNA 2LTPA 2NPFA 4KGZB 5CQGA 3I9ZA 4JQFA 4IL9A 4KPCA 4DNCA 1FEWA 3EPGA 1GT8A 4ANEA 1JNRA 4EI2A 3K3QC 4B3MT 3OFHA 2GO8A 4AT1B 1F5TA 2DAOA 4U3CA 5H9EJ 3J81U 3NVOA 3JTHA 2DYRH 4D1QA 4D5CA 1J59A 1SJ3P 1AW0A 2VC0A 5KG1A 4ECTA 3ERMA 4ABZA 2KYXA 3D67A 5F0CA 3G82B 1MSEC 3DLJA 3KBTA 2ZHOA 4NI2B 2W61A 1REVB 4CZCA 3THVA 1OJ4A 2KNDA 1J5OB 3PJ9A 2ZZMA 4L5EA 3H1CA 3R1HA 3G1LA 2VJ4A 4RBTA 2FNPA 2PEHA 1IJFB 4ZLLA 4V1Ak 4QU6A 4G7HF 1MIVA 2G0CA 1Z8UA 3EVYA 2RDJA 3CC7I 5J4YA 2JT1A 1ZAOA 3AAWB 1Y56A 5CB4E 1ZGWA 4N5SA 5DDPC 4BHBA 1FVSA 1IKVA 5IZHA 1IVZA 2ACXA 3P3DA 2W48A 2ZOMA 2FLOA 5L1JA 2OUMA 3PJAJ 3BY6A 2W7NA 3VVTA 2OEKA 2Z16A 4LIUA 4OI3A 2RREA 2HQCA 4NLRA 1ETVA 1Y1VJ 3ROUA 3MFHA 3CJQB 2DYAA 4NXMT 4PDKA 1F6TA 2WWVA 3IS9A 3DFGA 4DV7T 2E19A 5E3LA 2DGOA 5HLFA 5IP9J 1T03B 2KB2A 4U0VA 2WTFA 4OYMA 1RB0A 2ECBA 2D1CA 1P6RA 2ERRA 4BS2A 1U0HA 4HV5A 3A03A 4O0IA 3BG5A 2F8HA 2W63A 1R5ID 1BI3A 1SANA 2HVRA 3UE2A 2RQMA 2PEXA 2XYGB 5EGOA 2XHWA 3IG1B 3VRAA 2AZ1A 3K2AA 2EHOA 3CIRA 4RBVA 3WTVC 3C6TB 3QQAA 1EF4A 5J4VA 3PQJA 3I82A 2YDSA 1P8GA 4Q7AA 2LFVA 1S7AA 3C8YA 4PFOA 2O8KA 2OFGX 3QNWB 3CCMS 3WC2A 1V3RA 2V6YB 3BCAA 2RV8A 1PUFA 3OLAA 5F64A 2DXFA 2VPZB 4CLZA 3CP2A 4YDDB 3BQ2A 1TFYA 1A36A 3GIKA 3CDBA 3AEAA 1FJGT 4HHUA 1VMBA 1SJ1A 5CVRA 1X1PA 3GBGA 2WM9A 2IBDA 1XDUA 4XICA 2JIWA 3T3FA 3RYFE 1OCOH 3P9CA 3B6CA 1T9TA 2F7VA 2GS8A 5K1YA 2EHOC 3CDIA 4NLPA 4EEYA 4DV3F 3TVKA 1ZBTA 2VI6A 3OJAA 4UELA 3ZCIA 2HG4A 2IGMA 2IAIA 4OHZA 4PABA 1FRIA 2KMFA 1SVDA 4R8UA 3LA2A 2CEAA 3ZZYA 1E3HA 1SKRA 3Q83A 1Y9OA 3DU5A 1R0AA 4N8NA 1IUJA 3QWPA 1VBKA 4WTOB 4BC9A 1G3SA 4Y0FA 3SEQA 3OYLA 3HPGA 4ZHQE 3TLTA 4PKDB 3HSGA 3AAAB 2KHDA 5U47A 2R8HA 4QW8A 4M6YA 3M30A 2X9WA 2UU9T 2QQBA 1LQ9A 4S0MA 2XB5A 3BPXA 3MM8B 3I5BA 4H9QC 4KB7A 1L0OC 4ISSA 4PWDA 3AOAA 1SIWB 3WODF 3PO3J 2UZKA 2LLKA 4O8SA 5FKYA 1X9WA 5IWAT 1FMVA 2AX1A 3OTOT 3OFEA 5AQKB 3D28A 3JCUC 3OTCA 2DLLA 1XMOT 1JKHA 4N56A 1Z1ZA 1TZLA 2MB0B 3ZLIA 4HFBA 1FFWB 1X3UA 1U6BA 3DBHB 2WVCA 2F5DA 1S6PB 5E79C 2RSQA 5L46A 2Q9QB 4NPPA 3J7AY 1S8NA 3NY0A 2PI0A 2FMYA 5B7WA 4XLHA 4IE4A 1MMLA 2WAQD 3JW4A 2CUJA 1K0TA 3G8QA 4RB0A 4GKJF 3P7NA 1NDCA 4ZZLA 3QFHA 2CQGA 4RLFA 2IAKA 3IM8A 3KLIB 4GRSA 1FD8A 3PUAA 4ZPDA 2B4PA 8RUCA 5ETVA 2G2OA 2Y48B 4DSFA 2JMKA 1E6YB 1WEXA 2OPQA 4DR6T 5F1RA 4L9VA 4WZXA 1WF0A 3K69A 2RRBA 4CH1A 1KC8T 1ZRCA 4JI1J 4DU8A 1DTQA 2OELA 4ZYEA 4WWSA 5F8HA 4GYIA 2P2CB 2RD5C 3M6UA 3DCAA 4IE5A 2EWNA 1GFWB 2CQCA 1RT6B 3OXLA 3OL6A 2EXUA 3I31A 4IQJA 5LXYA 2G13A 2CJBA 2LM9A 4BJ5C 4BQQA 1HI1A 2HSEB 2BBHA 1LK5A 2L48A 4LF6F 3RB4A 4IH7A 3C2PA 1W7PB 4KITB 1YX2A 5HVFA 3IWZA 1UFKA 2X1DA 2JFDA 4J9SA 2B9YA 2K02A 1FKPB 4YTNA 4HSTA 3DYAB 2PFDA 3OQ2A 2QL5B 1HKSA 3E3VA 2LD5A 1H8AC 3LDQB 4B3RF 2DNMA 3BSAA 2FXAA 5HVQC 1G6BA 5FL0A 1J09A 1X4EA 2MQPA 3F8CA 2HEOA 1WUUA 1RWMB 1TKZA 1TVRB 2KWHA 1H0MA 3ZN0B 3OSFA 5HXCA 2V8HA 3ZMVB 4BDZA 3VYTB 3RB3A 5EEHA 3J7YI 2I8DA 5AQSB 4FS1A 1QNTA 2DFIA 3ONLC 3CJ2A 3LALA 3BSCA 4Z90A 1S77D 1VQMS 4BKXA 1W2BR 3HOSA 4DUZJ 5EWFA 5CQEA 4XPEA 1HARA 3PX4A 2DIUA 5ITHA 3VYUB 1RJJA 4W98A 5M3FJ 3QOEA 2HFNA 2CLYB 4ZVEA 1WHWA 3G9CA 2ME0A 1WI6A 5BS6A 5K8PA 2P7CB 2Z58B 2GZOA 4RBOA 1R6RA 3IBCB 4YFSA 1W0TA 3CX7B 2XMAA 4ED4A 2C2ZB 4OZ3A 3BBFA 4FTHA 5HXHA 3AXJA 4EGWA 3C66A 4I98B 1JLAA 1OY6A 1E3OC 4IPAA 4DEZA 4JK1X 4OMZA 3W60A 1RBOB 4DR1F 1LNWA 4EBCA 3PTWA 4CCJA 4D9JA 3C98B 2DJIA 2NTYA 2RPAA 4IHYA 2CQNA 2CA5A 5AXLA 6AT1B 2C22A 1UAWA 4X65F 3RIFA 2XGEA 4MYUA 4F8HA 4L18B 2LKXA 4KP3C 3A4CA 2E1NA 3IH3A 3HFVA 2XAQA 1TK8A 1HW1A 5J2UE 1CJKB 3AQOA 4XLFA 2ZKUA 4ZPVR 2AEMA 2BG9E 4DDFA 5JLWA 4OMYA 3J80K 2V5HG 3B73A 3PE0A 5D6GA 4XAXB 2F8EX 4J9MA 2AGOA 1JKOC 2JK3A 4ETXA 3TJAA 1VQLS 4JV2A 2FPHX 3R3TA 5CVUA 4RNMA 5GMKa 2MEWA 2Y30A 4HH1A 2ZZNA 3J81Z 3DLEA 4FX4A 3N01A 3LSIA 1Q79A 1JTYA 4GIWA 4I43B 4A0ZA 3AD9C 1LVFA 1RAOA 2CJYB 4WK1A 4Z7YA 4PK4A 2UUBT 1YJ7A 1SVOA 2LLYA 2CV2A 2DN0A 2F4MB 4CO2A 2K3IA 4MTPA 1FNOA 2XEXA 4X84A 2A1BA 5HBMB 5EK4A 2LDYA 5KDMC 5EN1A 2JPFA 2Y31A 2C3YA 5FXZA 4X4TA 4A8SA 2JVHA 2VODA 3KBUA 2W9CB 3BG9A 1TWCJ 3C50A 4UQGA 3PO5A 1LEBA 3MM7B 2IYIA 2C1EB 1UFMA 3NOCA 2L8KA 1VQ7I 3TR5A 2BACA 2X67A 1VYAA 1B59A 4CXWA 4FQGA 3W2WB 3RLFF 3TO8A 4HW0A 2XULA 3GMIA 2ZBIA 1HHQA 2MBGA 4Q8EA 2GA2A 2B5JA 4P2SA 2D9PA 5FKOA 2GLOA 2XSJB 3PHTA 1DQ9A 5KFOA 4WX9A 4KX6A 1RE1B 4DFJA 3UFGA 1GMUA 2BEFA 3TLWA 5DABA 2IGOA 2F4VJ 3Q8PB 3QP6A 2OSRA 4YHHF 3MXZA 3AA6B 4CWBA 1T05A 4TXSA 2GMJA 4L73A 2LOOA 2XAJB 2QA2A 4JYAF 3PSFA 2FVQA 4ZCKA 4ED8A 1EA3A 5CVIA 4OHYA 4OYKA 3JAMU 1OQYA 5CYMA 2I8EA 2GGPA 1YKEB 4H9OC 4WCEQ 3Q9VA 1QZZA 4F55A 4BCAA 4X64T 2YWEA 2JWTA 2FQQB 2XRNA 1ETWA 2QTWA 4ZI2C 4DL7A 5FKMA 1XMQF 3MMBA 3OYNA 1BA5A 4W90B 2VK9A 4EYHB 1S1VB 3CMMA 4C11A 3MM5A 1B0TA 1XPXA 1WNEA 1IJWC 4QX8B 4EV6A 3GLJA 4KNYA 5JI6A 2VJIA 3R8YA 4OJHA 3GZNB 2R5YB 3VDXA 2V1DA 4ZCLA 2X0YA 4OX9F 3ZMDA 2PIIA 2DA1A 3L3CA 1VRTA 1H74A 2X1FA 3EVMA 1XB4A 1WI9A 2XAGA 2K9AA 4AC0A 2XUBA 3KDOA 5K5MA 4IKFA 3CCUI 5LHHA 2ZXJA 4BE2A 1XDPA 3DPLC 3UU6A 2XKPA 1JNRB 3MD2A 3RKYA 4U95A 2DA5A 1SFOJ 1HF0A 2HQNA 5LHIA 4AD6A 4LFBT 1WJ9A 1JE8A 1ZR2A 4HLYA 2O6GE 1JXLA 2CWOA 3P4PA 4DQQA 5BXIA 5ETRA 2ZJRF 4F0KA 4NHJA 3SZTA 2VQET 4I64A 1UJ8A 2QSGX 1D09B 4CLFA 5CJ5A 2JN6A 3WU1B 2V0NA 2N9DA 2JHEA 3UPFA 2L4MA 5ETOA 2QM3A 4E7IA 4XR6A 2BY1A 5DM6F 1PJ5A 2EIJH 2ZE2A 1X4GA 1IM6A 3PJRA 2UV1A 1MSWD 5HOOA 5CVVA 3CD6S 5L3FA 4JI7J 3NQOA 1RWKB 3GTKJ 1QY7A 2HKOA 3CMEI 4Y2IA 1IBLF 2H48B 3PNVA 1NB7A 1KQSR 1IKVB 1AZSA 1VQSA 3AAIA 4B09A 4QH1A 1ZAVA 4UVBA 3EICA 4CLPA 4UV9A 3NNHA 1VQKI 3BJYA 3HB9A 3D0SA 2O5RA 4HI1A 5E1WA 1Q82T 4YB7A 4CRJA 1N4LA 4GDFA 4LD5A 3IS9B 2XASA 4LGWA 4NUUA 4USIA 1GNKA 3CESA 4IUFA 4KFBA 4M74A 4MALA 5HLFB 5E8IA 4OLPA 5GAEU 1KVJA 3JSPA 4LIRA 5E7OB 1HWLA 2CG8A 5L3EB 4O4IE 1M5OC 4BEHB 2DO4A 3HULA 1RKTA 2AJ2A 4O4RA 3BTJA 1WORA 5EGOB 9ANTA 4ES2A 2NRAC 3UVJA 4HTIA 3F6OA 4R79A 3GZ5A 1TR0A 3HKZD 3VAFA 2WMOA 3MMJA 2BQ3A 3PACA 2K2PA 1DU0A 5G4DA 5LA6E 3MDFA 1WKLA 3N9UC 5EX0A 5ABGA 1NB2A 3BSNA 2EJRA 3DTKA 4GOUA 2W4PA 4I7FB 3D6TB 2ZMEA 4AL7A 3HT3A 1N5TA 4ICLA 2WS3A 5D15A 2ZITA 2CXDA 5F5WA 4CCMA 5KAFC 4I6WA 2C5KT 3PUSA 2UUCJ 3H3ZA 2BW3A 2V2QA 4OV6A 1SFXA 1KU2A 4DU7A 4DQSA 1UVIA 1K79A 3CCTA 1S9HA 1MKMA 3WAKA 2J76E 4E7JA 4KIAA 1ZZFA 2GJIA 4DJAA 3JRBA 4N0BA 2AV5A 1FOWA 4QXHB 1V9DA 1OO0B 4LF4F 1SE7A 2NW8A 5A8KA 5THWA 2V9VA 3KXDA 3CDLA 3C15A 2ZMEC 4PK5A 1NCLA 2JVRA 1JKRC 2YH0A 4UOCA 2LVSA 1ITPA 4WWCA 1VF9A 2HVQA 1HHTP 4TWFA 1L3UA 1VNDA 1K78A 1YTYA 3AE7A 2C42A 2LJLA 3PNIA 1XC9A 1S6UA 2I0MA 1XNQF 2HZAA 1AB8A 1FK9A 2WSFC 2FVPA 4S0HB 3M30B 4XORA 5TAOA 2ZM8A 5FVKA 2VH7A 1X58A 3TO6A 1S6QA 1J7KA 5F04A 1NXIA 4WP3A 4PWDB 2HDWA 1UZDA 4AVZA 4Q4ZF 4COFA 4V2GA 2A68F 4FPRA 3CCVS 1I94F 5L9NA 3TZYA 5ETMA 4RL1A 1N88A 3TJ8A 4FF1A 2VFRA 4PXBA 3BBBA 4CM2A 2QKLB 4AKIA 1WC6A 3A0HC 3GFMA 1JKHB 3RRHA 2CS3A 1BY9A 2YNHA 4ASNA 4DPTA 5D78A 4WKYA 2F48A 3I9WA 3OV7A 1SMTA 3AG3H 2XLKA 1C0TA 4DPUA 2ZSHB 3C2GA 4OJ3A 4X4VA 3FRZA 2Y0SN 2VWAA 4YY3J 2PG8A 5F9NA 2JVGA 3BR3A 1FXRA 1U1RA 1HR0J 4WP9A 4UOGA 4HN9A 1S79A 2DXDA 2F6CA 5LMNF 2L41A 4IQMA 1Y8RB 5D0GA 4OIOF 1JJ8C 4XTTA 2GQ2A 5AQMB 3SXLA 3O44A 1JLGB 4EJVA 4WBNE 4IXAA 4QZVB 2QLJB 4RNFA 1SXLA 4AE5A 1JLBA 4H63H 4LQ9A 3AE5A 2YKMB 2OPQB 5IP7J 3H9QA 4CLYA 2IMLA 1U6FA 2DPDA 1XBWA 5F8NA 1SL1A 4HEA9 5FXWA 4ERDA 1CLFA 3TQ1A 4I99C 3PJAA 1YS7A 1DTQB 2GAGC 2HOSA 3HKEE 3Q0WA 1NMEB 2V67A 5HS9A 3EPIA 2A3SA 4FE4A 2J9EA 3WE2A 2V68A 4DGWB 1BR4A 1GT0C 3R6NA 3DEUA 2KHMA 1KNZA 2LKPA 4NQWA 4GKJJ 2HHVA 3TW7A 1ZOYA 1NTCA 1R5GA 5A0YA 4G1IA 4H9PC 2HBQB 2XSDC 4ECWA 3ZMSA 2Z33A 8AT1B 1TK0A 2EZHA 1GUUA 4PWWA 2H88A 4WZMA 5AFUL 2TCTA 5GONE 2LEBA 4KISA 1QO0D 4G1PA 4MLKA 2NS7A 3LP1A 3PCOB 4B9VA 3VZIA 2I5UA 2EZLA 3IKTA 3MR3A 2ZH8A 1TKZB 3PYEA 1VQNS 1K0VA 1XDOA 1NK5A 1PIEA 3CC4I 4LJMA 3T1HT 3MEKA 4XQFA 4HFVA 3PURA 1HLWA 3P4UB 4LF6J 4EOZB 2X66A 2M5YA 4IHJE 2CZVC 1NWMX 3OVUA 1Z0XA 1RT2A 1N75A 2XV4S 4JI6F 4HX8A 3UD4P 3MR5A 1BC8C 4UY8I 1LVAA 3HBLA 4EZHA 5KT3A 4OIPF 2KXHA 2VKZG 5AQPB 2QJ3A 3NGRA 3SCLE 2V63A 3TANA 4B3RJ 5L3GA 1Y7PA 3CB4A 3JAMZ 5AJ3F 4EMSA 5EZYE 5B66C 3I56I 3W64A 3KINB 2NVXJ 1P1TA 1RHQB 2IVFB 3AXJB 1X0FA 2AQFA 3V4GA 1KFYA 3QO9A 4ON0A 5JDLA 3FBNB 1JLAB 3E0JB 2ES0A 1JUSA 2OV7A 3G4SS 3SBMA 2MJNA 3U7JA 2ZXHA 3QJPA 4CO0A 1ZTRA 3SI8A 2WW8A 3AY0A 5HXRA 1YJNI 2DOFA 2JZYA 5GAHU 3T1AA 2I2YA 3PV0F 2ZBPA 2VFUA 1WSRA 4F2RA 1WSVA 3T5XA 1H73A 3IWLA 5KFCA 5KG3A 2VONA 3RBDA 5B08A 4P55A 5KFVA 3PR4A 2XAQB 4DUYF 4DV4F 3RYHE 3PVXA 2V79A 2M87A 2XC9A 3AA0B 3Q22A 1HX1B 5F0UA 1HWIA 3TYTA 4UHTA 1NKBA 3LFMA 3S6EA 3GSDA 2EFGA 2W01A 1Z7UA 1NSPA 3QAHA 2E5LF 4U87A 2HRUA 3PY8A 2GO9A 2RKIA 2LQJA 5HEGA 3V7CA 4DR1J 1ZPWX 3DI6B 5FGMA 4P71A 4C8MA 4ITVA 1Z7LA 3N9NA 1WYBA 3AE9A 3NEKA 1HA1A 1TKTA 5FXXA 2KT9A 2GIFA 2QRXA 1N5SA 4LRDA 3PM1A 4U2YA 1J5EF 4A3FJ 4UOFA 3M9OB 2W4SA 3ZFVA 3N0VA 4XIUA 4FYWB 2Y8WA 1PO6A 4RDUA 3KPHA 4J9QA 4EZ6A 2LRDA 1IZ1A 5ILUA 1TL1A 1N0VC 1YG0A 2CAJA 4HA8A 1BGXT 2BE9B 1RWWB 2P5LC 1URNA 2XQ6A 2B5JB 4ZLJA 2HKEA 4RNHA 1TQPA 3T5LA 2XY7A 2V34A 3V81A 1ZLJA 1T38A 3T9NA 4BXFA 1S35A 4I1TA 5LMUJ 4ED5A 2HDCA 4ED6A 2H3EB 2UXCF 3E22E 4BJTA 3CE8A 4FXDA 2A05A 2IC6A 3JADA 3QNUA 4OHFA 3EDQB 3GJTB 1QSYA 5GP9A 1KHVA 3GE9A 4DUTA 1T05B 4HFDA 4XRSG 1ZA1B 2FVRA 2Z3YA 3MEGA 2GVDA 4IHTA 2XQYA 1G7CB 2WY7Q 2GGPB 5DYMA 2HFSA 3KHHA 2CMPA 2QUFA 5JFRA 3P7IA 3ZC4A 4N4OB 3S93A 3RBEA 5LG4A 3F56A 3FBIB 1WJFA 1VHIA 1RI7A 1P7JA 1E3PA 4LF7J 1Y3KA 2Q2EB 2FSWA 2UP1A 2V7FA 3MMBB 3TKLB 4JI5F 1C1BA 4TN2A 3HHGA 5D6EA 3G8SA 2HWIA 4C11B 3MM5B 1A7GE 1MROA 3VVUA 4LMYA 2Y6XA 2W4DA 2V9WA 4O3QA 2A3JA 4LF9J 4JX6A 2EZKA 4MHCA 3AA9A 3FWEA 4OAZA 2V1DB 3LTOA 4CO5A 4A5MA 1YJRA 2XM3A 2EQRA 5HNHA 5LXTE 1NLKL 5CCMA 1FIOA 4I6AA 5KFLA 2MA3A 1R71A 2OCEA 1U26A 2O8XA 1RAHB 3KKFA 3OWTA 3EETA 5CH7B 4IR9A 2Y9ZA 3O2IA 2QYWA 4TUYE 5LHHB 2J6UA 1CEZA 3HK2A 2IDOB 1I5OB 5CABA 4E7ZA 2MKJA 2FBHA 3N6NA 3AHPA 3BGRB 4K8RA 4XOTA 2VJUA 3TW0A 4LBPA 2WB4A 4AKLA 3BJ6A 2XB0X 4K0KF 3C6UA 2GCFA 3IP0A 4EO8A 1SQFA 3CQXC 2FHJA 2VFSA 1X1DA 3BKFA 3MD3A 2HXIA 5E41A 4ECSA 1U8BA 3CT9A 1FKOA 2Y2ZA 1UJ4A 4EJWA 4WE1A 4A3GJ 1FO1A 4OX9J 4DSKA 3P8BB 3P4QA 1ZTTA 2DA3A 3KMQA 3DLKA 3JQKA 5IC6B 3LWMA 4R8HA 2EFPA 2XPUA 2CPEA 4HAMA 2CV0A 4PQUA 2IM0A 4LF8F 3GTJJ 2R7SA 4A8YA 4J9PA 2ZE2B 4YHHT 2H7VC 1U3EM 3E5QA 1IBKT 4ZK7M 1SV5A 2NUUG 2DK8A 3I0RA 3D7SB 4NA3A 4JYAT 4L9TA 3OYDA 5L3FB 4TQRA 2ZM6T 3FQKA 3V2UC 2CQDA 4J90A 3MR7A 2LY1A 2C5JA 5KFMA 2DMTA 1F5AA 4X4SA 1SC7A 4BJ6C 5CD4H 4X4QA 3RPUD 3BG6A 4ESJA 4DX8H 1FYMA 4DR3T 4IJAA 4UVBB 3S8SA 4UV9B 1LDKB 1T98A 4FYYB 2XMTA 2EFNA 3F21A 1WGXA 1XMQT 5C2TA 4PUOB 2CE7A 1KFDA 2ZEJA 4KFBB 1U1KA 4Y3OA 1B9NA 3MTJA 1LWCA 3BGOP 4X20E 3Q24A 4RLEA 2OF7A 4MK7A 2QGUA 2Y0BB 4ZN1A 3S17J 1I6ZA 2UVVA 1B7FA 1YD8G 1DHMA 2QIFA 3BZCA 4NCAA 2OJED 1IBLJ 3MHYA 2A5WA 3MAAA 1RAJA 2HBYB 2O67A 3UVJB 1RHMB 1X4PA 5F6FA 1JJCB 5EWGA 4S05A 1WFDA 2ZCWA 1R8BA 3IHUA 1KQFB 2W84A 4HT5A 2CXEA 4JI3T 2Z8QA 4Q0BA 4WFNQ 4M8LA 1U9OA 3KCCA 3CO7C 4KHPJ 1YXRA 2WOMA 5LM7E 4HQMA 2B7EA 3NGKA 1RHUB 4J5OA 2FOKA 2V7JA 3CTRA 3BJAA 5L1IA 4ICLB 2KRCA 3OLBA 5J1EB 2BJ7A 1GXPA 1VI7A 2BZ2A 3W9JA 1T39A 2BW3B 1G4CA 3ZCJA 4M94A 4ZJZA 2R7TA 1H0HB 3KG1A 4ILCA 1GX5A 3O6BB 2E34A 2M7BA 1FOXA 1Q95G 3I87A 1SL2A 3RB0A 1IWAA 4RB3C 1IKWB 2HNYA 4JV0A 3D3BJ 1YHQI 3CMYA 3C15B 1GVJA 5K5QA 3OHBA 1NDLA 2RIJA 2X3DA 2LKHA 2KFYA 5F41A 2JH3A 5B1BH 1K78B 1RT3A 3C3LA 4CI3B 1YJWS 1S5ZA 3QPTA 3GMEA 2NXJA 2XS2A 4B6XA 3CC2S 3X3UA 1FK9B 4BS9A 2A5YB 3FBEA 4PJMA 2DBBA 2HNZA 2Y1IA 3HA4A 5BOXA 3MPDA 2KLOA 3BV8A 4C7QA 2PBIA 2HZTA 2X3GA 3VF0B 1TL7A 2XNQA 2FD5A 2J7WA 2XGPA 2HW3A 2V4JA 2X1BA 2MQOA 3E5UA 4ZZDA 4P75A 4WF2A 2BS4A 2A2DA 4E7LA 4M3GA 5AQHB 3ESWB 2Q8KA 2XQ4A 1HSTA 4WNKA 2YNHB 1QE1A 4N4NB 3KZYA 3ZO7A 2CADA 2AKWB 2ZLYA 1X31C 1C0TB 4O4LE 5IYDJ 4MKAA 3AB2B 1N5VA 1XNQJ 4F4WA 1S9GA 5FD6A 2ZD1A 3FM3A 1HI8A 2BMBA 2QRRA 2ELKA 3CCJI 3L09A 3FHNA 4F7ZA 2O3FA 3F8BA 1KQGB 2J8SA 4LJZF 2ROEA 2M8HA 4O3PA 3T6BA 2DCUB 1BR2A 1WKKA 2MSYA 3LGNA 2V4JC 3FSIA 4BAYA 2Z5UA 3V4IA 4K4WA 1BN5A 4G63A 1SJRA 1D3YA 3BQYA 2E1OA 3E51A 2XAUA 5IOYA 3NCQA 3ZC1A 3M8FA 2OH2A 1QPMA 4LQ3A 2R7VA 1JLBB 2R3SA 1HNWT 4CP5A 1L3TA 2PJPA 2ZH4A 2X4HA 1LOUA 1XERA 4I2QA 5B0FA 1HBUA 3D1QA 3IL2A 1OEDE 4LF4T 1VQ6I 2L9RA 1HD0A 5DG8A 1UA0A 3HHEA 2GC8A 1F5CA 3IH4A 1IV8A 3ZP5A 2ACMA 1VQPI 2IBOA 3T1BA 5CHCB 2FE3A 1S9FA 4HF0A 3P4SA 3IHRA 3PUWF 4NQWB 1UW9A 3GCXP 2O7OA 2QCOA 1JLQA 1KS2A 5A0YB 1U02A 1SAUA 1N48A 3OL7A 2RH3A 3TQNA 1O57A 5GMDA 3ZMSB 3MMCA 2E5ZA 2H65B 2MTLA 2K3WA 1UVJA 4IDNA 2Y3YA 4IDKA 3E6BA 3BTIA 5K14A 2LXUA 2BYCA 3LP1B 4A48A 2HPLA 3R5GA 2NS0A 5EYRA 2K9SA 4ENJA 3GTLJ 3A1YG 4C9YA 1B8IA 2QT7A 2EKYA 5GMEA 4C0HA 2QF7A 2X6OA 5A2QK 3OTDA 1K7AA 3CWJA 3T1YF 3FF5A 4OZ5A 2MLGA 2WTEA 4M63A 2LMIA 3DBRB 2LVWA 4ED1A 3H3VK 4WK8F 2VQGA 3EMTA 1T56A 3BS9A 3I4HX 3J7AN 1RT2B 2EG2A 1WVRA 1NUEA 3I0SA 4P7VA 2RDDA 3MFKA 4F6RC 5L3GB 2F8MA 2D5VA 5LMNT 1VRUA 1LFBA 1K9MT 1H7XA 3I55S 3T19A 4ILMA 3ZCOA 2IVYA 2Z0GA 2J5PA 5J2NA 1LK7A 4IFYA 1D5YA 1UWAA 3QO9B 2IA6A 1CQNA 3VKGA 2IJRA 2XYPB 3VU7H 2AYEA 1YJTA 2RN7A 4C8ZA 2HVHA 3ABKH 1UHSA 4OIXA 1V9OA 4WK3A 3LJCA 1ONVA 2WCAA 3M32A 4OINF 4KGKA 4ZVSB 5FLXY 2XCPA 2KZVA 3K70D 4TVAB 2Z2MA 1X19A 4MIAA 1S57A 3CD0A 2E5JA 4ZVOB 3OYJA 1JLEB 5T14A 2LQ8A 2J0XA 3UDVA 5IQQA 2CWXA 3QOFA 3Q8QB 3I9YA 1UVNA 3MM9B 3EYIA 4HEAA 1GMWA 4LFCT 2RKIB 1HKQA 3S32A 1V5EA 4IHWA 2RB7A 5J1RA 2D9DA 3MAQA 3HMJG 4I68A 5DRKA 4DS4A 5IV4A 5C44J 2DFHA 5EK2A 2DO0A 2IM2A 3H5AA 2DNYA 1W7WA 5D0EA 3QATA 1S10A 4USMA 3LSRA 3OW2R 5D8LB 5ABFA 1Y5NB 5H6QA 1JHFA 1TKTB 4XM3A 1U1OA 2QL9B 3K2YA 4J7CA 3GN5B 5ABEA 1I6XA 1IRXA 5FKNA 4GGGA 4I01A 2TDXA 1M5KC 3GLXA 4IX7A 1RUNA 2XNRA 3DGVA 2PC6A 4CH7A 4YSYA 1APLC 1RR8C 1WR0A 1T72A 2E5LJ 4JI6T 1DTTA 3OS1A 1T33A 4C8NA 1S76D 5J1UA 2HLUA 4O4JE 1UTAA 3L7PA 3NAHA 2DR5A 4IR1A 3J80U 1W4MA 2CPFA 3SFUA 4YJ3E 4UZBA 1S7OA 4AISA 3QT8A 1HNXT 2DGSA 2OIHA 5KFHA 1UVLA 3W6JB 4DV5T 2BBYA 1RLDA 3SRZA 1T9VA 4IG3B 2XPWA 1PP7U 1BC6A 5ERIA 2E44A 2MZRA 4AD9A 4ZMMA 2ELJA 2MH9A 3V81B 2ACYA 4KI0F 2ROPA 2ISZA 1J75A 3Q5FA 1GDTA 4ILLA 2IS4A 1KTVA 3ET6A 4U2ZA 3S01A 3H9JA 4U74A 2M8GX 3HVRA 2GVDB 2U2FA 3KVAA 1RUOA 3VQSA 4WXCA 4DR7F 4WJBA 4DV4T 1Y0UA 1T9UA 1XS9A 4XPCA 1EH7A 3L95X 4ZDNA 5AQNB 1WQ2A 1M5PC 3FC9A 3GO5A 2PMZA 2V6AA 5JDGA 3EGVA 1VDHA 3T8TA 1S1UA 4X4NA 4NRUA 1HLVA 3V6JA 2X9HA 4H4OA 1C1BB 3QAUA 1NJIT 4OWRB 2X1EA 3UI3A 1UURA 3BROA 3FXQA 1VQ8I 2G7HA 5L1LA 1TAUA 3PIOF 2UXCJ 3ULQB 2MLYA 1TP7A 1RPWA 2OUGA 5LSRA 4JV1A 3RRKA 2H8WA 2HVIA 3CD6I 4QKNA 3ABUA 4A0XA 4IQ4A 3JAEA 1X5OA 1B0PA 2QWWA 4PAGA 2IC3A 4GKKF 1S9EB 1N36F 4IL4A 2Y1JA 5D3GA 2V2KA 2DNPA 4MFBA 1KTQA 3KDNA 4QOTA 3JRIA 4EEBA 1OLTA 2F9DA 4JI5J 3KYCB 2E2IJ 2FLPA 2YWGA 1M90T 1NG7A 1TC3C 3C6UB 3ITHA 4LFAJ 1Q0NA 4U7UK 1S49A 1FKOB 3DKXA 4CYDA 3FB2A 5DQVA 2LMDA 1E1HB 1WHYA 3MPVA 2OMLA 2HK3A 2E7XA 3OIPA 1CPZA 1U0JA 4NZ6A 1CC8A 3DLKB 2W2OP 4IH5A 2BG9B 5B1AH 4A3DJ 1MWYA 4ES3A 4KJIA 2CQPA 3GG1A 2EC2A 2XO6A 4CH0S 4PQUB 1URRA 1FEHA 2BHZA 3C14A 2KP6A 1ZA2B 2Q79A 2RRNA 1RACB 5HEJA 4AL6A 1P9QC 1SV5B 3BGLA 3I0RB 3IGNA 3AKZA 2QSFA 3D0GE 3QT5A 5F8JA 4ID5A 4FKYA 3PIPF 3S16J 5ADZA 1I6JA 4OOIA 5KMGP 4LF2A 4L75A 3KP7A 3NL0A 3LL7A 4DBRA 1RQ0A 4YEJA 2CQHA 2XI2A 1IRGA 3EUKL 1R00A 5AQLB 3LAPA 4UUSA 1IM4A 4HEA2 3WTYC 4AUKA 3BO2A 3S3OA 5D4SA 3CIMA 3JRAA 3ZOBA 3UR0A 1LWCB 4B9NA 3I4PA 3C46A 5HAXA 2IPOB 1Z3YA 2K48A 5GVQA 4H0EA 3JTOA 5KVRA 5J3LA 2HR3A 1WHXA 4JV5J 3ISNC 1XGMA 2AWZA 3D6MB 1U4BA 3JSOA 2AW0A 3ONQA 5DJQC 3TGNA 1KU9A 4ZVRB 3ONXA 2UXDJ 3GWHA 1ZPVA 4P72A 1MN7A 3N9QA 3HJEA 2G7UA 1Z2ZA 1EH8A 2VB6A 3ERED 2WOMB 1ON1A 2CPIA 2IFXA 5A6PA 5CYVA 3CDWA 4P2FA 4UT4A 3F22A 4UUTA 1P27B 3QMQA 2FJBA 1KU7A 5KFXA 1R23A 3OYIA 1S99A 3ZQFA 4IE0A 4KKOB 2QC3A 5EDNA 2CPXA 1LQ1A 4Y13A 4QPXA 2EFWA 4EYYR 3RPQA 5FKLA 1HG2A 1VQ9I 3KG4A 3AD8C 2RQCA 3SDEA 3QYBA 4M5GA 5IFMA 1NPPA 1GVDA 2W8KA 4WXHA 3TAPA 3GYNA 1YJUA 4JI7T 1R8PA 3R0AA 1HBOA 3OL9A 2J5OA 4O23A 5HWXA 3W6VA 3K4BA 2UUAT 1SQEA 2W0GA 4XAKA 4ES1A 5J6XA 5CA5A 4KT5C 1S0VA 1L3SA 3M8JA 2QBYA 2L54A 3GIMA 1RT3B 4DHVA 1HBNB 1Q8KA 2AYBA 1TTYA 2A2CA 2IJNA 3KP6A 4MEXF 2DDBA 2W9BA 4X4RA 2HNZB 5B0AA 2GIVA 1LKZA 2NVYJ 3TLUA 2FUG2 3BQ0A 4B47A 1TL7B 2M6IA 1SKUB 3TVYA 4Q8FA 2N3OA 4M5HA 1WJBA 4XNFA 4KBMB 2V4JB 3G71S 1KDNA 1C0WA 4B3XA 3Q3SA 3K4LA 4F25A 3V6HA 1NEKA 3IC1A 3NS7B 2JC0A 3HO1A 1Z67A 2YX4A 1QE1B 2H3RA 2B63J 2XQCA 4DXLA 2D3UA 3S1RJ 3LK42 1YO5C 2DEJA 3CCZA 1S9GB 3B54A 5BR8T 4QIFA 2ZD1B 5H9FK 3UKGA 1O3RA 1QPIA 4NC6A 4C90A 1IR0A 5LG3A 5LRSA 3HOZJ 2NREA 4PG6A 2HI3A 2J0WA 1PC4A 5JDQA 5IM0B 2UUCT 4BAYB 3V4IB 2GX8A 3CCSI 3ZQQA 3RAXA 1RWPB 4HYEA 2DWKA 4A3BJ 1LWFB 2WQYA 1CVJA 4NA1A 5C3JA 4NLSA 2OQGA 4DV0T 1UW4A 2IDEA 1FKAF 2F63A 2HU9A 2CNNB 3P5BP 4MK8A 3AB3B 3GCWP 4U0WA 2LKGA 5KOXA 1MBEA 2I10A 2IW5B 2DR9A 1SFUA 2IIHA 3HOYJ 2QMUB 1HBUB 4QSHA 1MIYA 3VHQA 2HHQA 1XSDA 2VKEA 1H2TZ 2JDJA 1R7JA 3CX8B 5GADI 4ZN3A 2FHOB 1KD1T 1XNRF 1YKWA 2OEMA 1D8KA 4OLOA 4HE8A 2E9XA 1KVIA 5F9LA 4UV8A 1I3QJ 2WVFA 3PG9A 1UCUA 4MEYF 3GR1A 2HS4A 4L0ZB 3LK3B 2XMUA 3CJRA 2LC2A 4W1UA 4IDKB 3QJJA 3IWXA 1UMQA 4DR4F 5KT2A 2OKQA 4RW7B 1F1ZA 4UVAB 1CQMA 3GZ7A 3J80Z 2MSTA 4J9KA 5LL6d 3HCXA 4RUAA 4HR2A 1E2XA 2CW0F 3VYSB 2E9XC 3OUYA 3LQRA 3CO6C 2XROA 2RKHA 2AXDS 1EKRA 1S97A 2GK9A 1U49A 2AD9A 2NNYA 1KZHA 3I53A 2V7IA 1WJDA 3HDDA 1AOYA 2R92J 3N9OA 4TNVA 2XY6A 4L5GA 1QSLA 1RWUA 1HBMA 3I0SB 3EDPA 2K3KA 3Q5XA 2DXIA 2BS3A 2HYIB 2A10A 4ZVQB 2A6TA 3G73A 2GXBA 4U96A 1BWEA 2VDHA 2B4VA 1L5UA 5J2NB 2RNJA 3PV8A 1YQ4A 3CX6B 4RM2A 2I5JA 1LVKA 3IN5A 1YLFA 5ETWA 1DPRA 3P96A 2Y9HA 5KFUA 1JXVA 3B82A 4OZJA 4QPOA 5KCMA 4ZCIA 3DXJF 2L0KA 2KJVA 1Q16B 3KNGA 1JT0A 1E17A 4HGAA 3M32B 1TELA 3OYEA 5EWEA 3HJFA 2A72A 1QJHA 2HQDA 2D2WA 4ALZA 3ZTPA 1N34J 1F3FA 4RPFA 3J7ZT 3SCKE 3M6VA 2VQCA 3GTOJ 4DZJA 4BA9A 3GW2A 1HNVA 4EMDA 5HMXA 3L2WA 1NK8A 2PI5A 1RK8A 3SYTA 2ZBCA 4ESFA 2E2HJ 3NGSA 2VZ9A 4CCKA 2OLTA 1FDAA 2W82A 1KQ0A 2M2BA 1KLMA 3EYYA 5F0WA 3FXRA 1EP4A 1U5PA 4XSZF 4GYGA 1DQAA 2DL1A 2V6CA 1XGOA 4TV8E 2FA5A 5EG0A 5IT4A 2B43A 3EUNA 2JUGA 2BVMA 4RNOA 2OTLI 3T1YT 3CNQP 1CQTA 4CXYA