3KFWX

Uncharacterized protein rv0674 from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
234
structure length
234
Chain Sequence
SLTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVALTRMVGAGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTDARTRAALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDEAPADLAGQLWDLSGWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDPMLPAELLPADWPGAGLRAAYHDFATAMAKRRDATQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncharacterized protein Rv0674 from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 61
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07848 PaaX PaaX-like protein
X PF08223 PaaX_C PaaX-like protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kfwX01
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kfwX03
3.30.70.2650 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kfwX02
4K2EA 4HX4A 4EJWA 5F1RA 1IN7A 3R0AA 3H3ZA 3FXQA 3R6SA 3KZZA 2ADUA 5K5QA 1FBSA 5LBQA 5ICCA 4EQQA 2Z5UA 2ZNYA 1HW1A 4KIGA 4A5NA 2KJBA 1SFUA 3WE2A 1P4AA 1JHHA 1VTNC 3VEPA 2EA2A 4G94A 3HOSA 4M6YA 4A0XA 3DXJF 4IRGA 1S3JA 4HLYA 2A61A 2K86A 1R00A 4OU0A 3O6BB 2Y48A 2M30A 2UXXA 3CUOA 3TOBA 3HIFA 1LDDA 1EH8A 5D4SA 2P4WA 2W85A 2ZJ2A 5JR3A 2ZXJA 2CQKA 3Q9VA 3WE3A 1EH7A 1E2XA 3DV8A 1JGSA 1TNTA 2CSOA 1FSHA 2CG4A 4AIHA 4GXOA 3U2RA 1FNNA 1F1ZA 2ISYA 4WXCA 2F5DA 1RUNA 1BN5A 1ZRFA 3GXOA 2RV8A 2GIVA 1V4RA 1XGOA 5FO5A 2HTJA 5K5OA 3RKWA 2JSCA 1ZH5A 2G7UA 4I0BA 3SFZA 2R7FA 2AS5F 4P9UA 4KA4A 1U5TB 2EFQA 3V8JA 2EV0A 4HX8A 2GAUA 3WGIA 3S2WA 3MWMA 4G7OF 1H9GA 3FXRA 3C7JA 1FBQA 1MD0A 1SFXA 2XROA 2WV0A 4RB2C 1UFMA 1Z6RA 5D8KB 5L3DA 1J2XA 3L00A 3HHGA 1K79A 1JHFA 2IT0A 2BEOA 2Q8KA 3I58A 3KLOA 1ZREA 2YX4A 4LFUA 3ZP5A 4MTDA 4A6DA 4IJAA 3RPUA 3GZ6A 2EFPA 2KJCA 2L01A 2DBBA 1T38A 5ERIA 1ZYRF 1J59A 2ESNA 1KQ9A 2IW5A 3I59A 2RVCA 2HWVA 3BOQA 3P9IA 4B8XA 2MH2A 5J8CA 2PG4A 3BJOA 1Z1DA 2FQ3A 2L4MA 3CDHA 4WWCA 3HHHA 1BIBA 3FZVA 3KP3A 2HZTA 2O0YA 4UNOA 2YX7A 1OR7A 4JBAA 4LK1F 3M9AA 1S7OA 4RGUA 3ML6A 1TW2A 4RGXA 1T98A 1HQCA 4Y13A 1BIAA 2XKOA 1RUOA 2MH9A 1IXSB 3IL2A 1IXRC 3HTUA 3HYIA 3LQRA 5E18F 3V8LA 3D5LA 5H6QA 3U9GA 3QOPA 4Q47A 2DLLA 1YFHA 2V1DA 2JTVA 1MJBA 4XRFA 1C0WA 3RYPA 1S7AA 1Z9CA 4YFNF 2CO5A 2H6CA 2AXLA 5HDNA 1YLFA 3GLXA 3GWZA 1SD7A 4ON0A 2R7DA 3CLOA 5L3EA 3GEZA 3VB2A 2VT3A 2FSWA 1JXSA 1LJ9A 1FYLA 1KYWA 1X3UA 1LDJA 4KIBA 3SQNA 1Z91A 4L9VA 4FT8A 5D6EA 3C1DA 3WTVC 1FLIA 1QZZA 5IT9K 2H09A 3EQLF 4H0EA 1RI7A 3ABTA 1ODDA 4M73A 2Q2EA 3KEQA 2F5FA 2OA4A 4HA8A 3JAMK 3QP6A 3M8EA 4M71A 3IRRA 2OQRA 4AIJA 1K6OA 1IN4A 4IHSA 2YPRA 2PMHA 3IC7A 3WGGA 2K7LA 5J6XA 3DKWA 5CVVA 3QAHA 2Q0OA 1LEAA 3ECOA 3DEUA 4HOBA 5ICFA 1ZAOA 2RN7A 1ZLJA 3T5XA 5LGNA 3QPTA 1FWZA 3BZ6A 4I7HA 2NAZA 5LRSA 3LWFA 3G73A 4HV6A 2H6BA 1U3EM 3F6VA 4GCVA 3GO5A 4FHTA 2QWWA 3PQJA 2L4AA 3T1BA 1IXCA 2XASA 3B73A 2ELHA 3F8BA 2HKOA 4CYDA 2HQNA 3F6OA 2HFHA 3ZMUA 4BH9A 1G3WA 1XGMA 3QPHA 1PP7U 5DD4A 3ROUA 1AWCA 4LB5A 1A04A 3BROA 2IA0A 2XAFA 2E1NA 1U5TA 3ZPLA 1FYMA 3K2ZA 2P7VB 2RGVA 2E7WA 5D5WB 5HOOA 2X4HA 1O7FA 2P6SA 3IWZA 3VODA 2WWYA 4L5IA 2VBZA 1PDNC 4U88A 1LNWA 4WK8F 1BJAA 2NNYA 4EJTA 2HKXA 3JAMZ 3TDUC 1UHWA 3DQVC 1R1VA 2Z33A 3ZN0A 4LGWA 3ZMSA 1P4WA 2DT5A 2EV6A 2O3FA 3M8FA 2HTSA 4A2UA 4GGGA 3J80K 2JPBA 3KP5A 1G4DA 1IW7F 3HTSB 2OZUA 4MEYF 2FXAA 4CHUA 5HLHA 3LQQA 3ZMDA 4A0YA 3J80Z 5CVRA 4AD9A 4IXAA 5KVRA 2YU3A 1D3YA 3C18A 2LF7A 5JHUA 3TOAA 3WTXC 4HW0A 2BYVE 4I09A 4ZZLA 2STTA 1U5TC 2DQRA 1FBUA 1PUEE 1XSDA 2H27A 3MCZA 3H3UA 2XAGA 3ECHA 1TNSA 2ZNZA 3MFKA 1R1UA 4PCQA 5LEJA 2IP2A 1U78A 4OIQF 1FSEA 1RNLA 1ZARA 4RB3C 4A0ZA 1K78A 4M74A 1XGNA 2OAZA 5A2QK 2OZ6A 2GQQA 2DO7A 1MKMA 1TQPA 2D45A 1GXQA 1WI9A 2ZMEA 3GVAA 2FBIA 4YG2F 1YTYA 3EYYA 2VOPA 1SMYF 1P6RA 1FPQA 4MNUA 3EUHA 2DPUA 4M6XA 4N0BA 2VN2A 4UVBA 1T6SA 1TLHB 3E6CC 4NHJA 3MAJA 2O6GE 1H9TA 2PN6A 2RC4A 3TO6A 1WQ2A 2D2WA 5BMZA 2XIGA 4WCGA 3HSFA 4S04A 3V7CA 3WU1B 2NNNA 3FXUA 2B0LA 1KQ0A 4RAZA 4JK1X 5LEKA 3JW4A 3EDPA 4HDUA 1USTA 2EK5A 5JI6A 3R4KA 1W7PA 5HS9A 3CTAA 1MGTA 3LSTA 4KN4X 4GYGA 4YFKF 4BNCA 4XLPF 4UVAA 4ZZDA 4UXNA 2LF8A 4IF4A 2GXBA 2A6EF 2FMLA 1OYWA 4G6QA 4KT5C 3AAFA 4HF1A 2D1HA 2P5KA 3Q5FA 4I01A 1UB9A 1W4MA 3F8MA 3KP4A 1R22A 4MTEA 3F23A 3JSPA 1QQIA 1DUXC 2OQGA 3MZYA 4LK0F 2FEZA 2BE5F 3J7AO 4Q4ZF 1ZGJA 1SFEA 4AVPA 1IAWA 2CGPA 4CGZA 2VOOA 5AONA 4FX0A 2EA4A 5L3BA 3HRMA 1MZBA 1FZPB 3K1PA 4M9ZA 4BAYA 4ZYEA 2Z99A 4AWXB 4HDVA 4OIRF 4HZFA 1XMAA 4L0YB 1EH6A 3QU6A 3F72A 3FMRA 1MDMB 4FX4A 3WTTC 4UV9A 3HSRA 5DUKA 1XB4A 3KFWX 1W5SA 3MQ0A 4M72A 4KIFA 5AIPA 1YG2A 4UUVA 2L3DA 3COAC 5JVTA 5H6RA 4L0ZB 3KLNA 4ESFA 1MJ9A 4IRIA 1STZA 1DDNA 1HKTA 4ZYDA 1Q1HA 4OMYA 1ZRCA 1BC7C 1SD4A 3CUQA 2QQBA 1BC8C 2ZKZA 3MEXA 1P4XA 2EFWA 3WTZA 3F22A 4F7ZA 2W84A 2QQ9A 5FLXZ 4EMSA 4P9FA 1LDKB 3RJPA 1HXDA 3PFIA 4BHPA 4I98B 2K27A 2XKPA 2XUBA 1BI3A 5LGUA 4I0AA 3LAJA 3CUQC 2YR2A 3SHFA 3LA7A 4WF2A 4OOIA 5D6FA 2P7CB 1R1TA 3ERED 2Z3YA 3RIRA 2XVCA 3FM3A 2CFXA 5LHHA 2J5PA 2NS0A 1LB2A 3BJAA 3GF2A 1R23A 5FD6A 2HYGD 3BP8A 4A6EA 1K78B 1YYVA 3REOA 1G3SA 3N97A 2L02A 2IPQX 2ETHA 3WGHA 3E5XA 1K7AA 3NRVA 4BHCA 3JTHA 2H94A 4BHBA 1J5YA 4RS8A 2DPDA 1ZN2A 3T8TA 2MD5A 3P9KA 3GFIA 2Z9OA 2EWNA 5BPDA 2W57A 2F5CA 2M8EA 4U0YA 1TQMA 3ZN1A 3LFKA 3PQKA 3WTYC 2OBPA 2EFNA 4LD5A 1FP1D 3VOEA 3RKYA 2FE3A 5ILUA 3OV8A 2O03A 5TJJA 1J75A 3EETA 2KIUA 1E17A 1HBXG 1G3TA 1R5HA 2DW4A 2L54A 2A68F 3BJ6A 2A6HF 3K1MA 3TKYA 1FP2A 3WTWC 2VBWA 3QP5A 2O8XA 3QU3A 5E8IA 2HGCA 4WX9A 2FOKA 2FA5A 1YS7A 1B6AA 1R5GA 4HF0A 3P9CA 5DUIA 1BOAA 1QNTA 4QWQA 4RB0A 1O3QA 2A69F 4O3MA 4MQ9F 5CLSA 1FX7A 3B02A 4Q5SF 3WU0A 3JSOA 4LJZF 1ZGAA 2MA3A 2GA2A 2DI3A 2ZBKA 1REPC 3O3KA 3I71A 4ZH4F 1S8NA 2HEOA 4N9IA 2V6CA 4EM1A 5LLQA 4M9SA 4CICA 4MEXF 3ZMTA 4P55A 2BBYA 1ONVA 2QZ8A 3ZMVA 2MLKA 4R79A 3GZ5A 4L9NA 5D4RA 3K9TA 1HSTA 5E20A 5J8FA 4KNYA 3L9FA 3L2CA 1FT9A 5BPIA 1B9NA 3GFMA 2VONA 4PZJA 4XLNF 5DCMB 2HYFA 2G9WA 4ETSA 2V79A 1GXPA 4ESJA 4GYIA 4EGYA 2E1CA 2XRNA 1KU2A 2VBYA 4I02A 4I2OA 1QO0D 1F4KA 1FY7A 3HRUA 5HS8A 5L3FA 4RB1A 3DPTA 2STWA 2C6YA 2DAOA 3E6DA 1BI2A 3FX3A 2F5EA 2RNJA 5JFRA 1Z6TA 2QBYB 1BI0A 1O3SA 1YW9A 3KP7A 4HYEA 1ZLKA 2DTRA 2XAQA 3KP6A 4MHGA 1YS6A 3E5UA 1ON1A 4LB6B 3E6MA 3ABUA 5ED4A 2ESHA 4OINF 3GW2A 4E70A 2PMUA 5DCFA 1KQ8A 1KYZA 2FRHA 1F5TA 5CVIA 2IA2A 3E6BA 5KK1A 1OPCA 4CZZA 1ON2A 1I5ZA 2QYOA 1J0RA 1EV7A 1RIOH 3M1EA 4YIIA 1YW8A 4MQVA 2GWRA 4XSZF 6PAXA 4BQAA 5AIQA 1DPUA 2IJLA 2JT1A 4Y15A 4AIKA 5D5VB 1J7KA 4UHTA 1R58A 4EJUA 2K02A 2K4JA 3MZHA 2F2EA 2GXGA 1ZRDA 4WXDA 1XDUA 1I6XA 2BV6A 1Z05A 1L3LA 1FYKA 4ASNA 1IUYA 2JRTA 4EJVA 1IZ1A 3I4PA 2LKPA 3I59B 3SXYA 1DP7P 2JZYA 2ISZA 4EGZA 1QGPA 2PBIA 1Y0UA 4L9JA 4OMZA 5DDGA 3V8KA 4ENKA 4RGRA 1LEBA 1O3RA 3FF5A 1QPMA 3HOTA 1W5TA 4CXFA 1G3YA 5TRDA 1H0MA 1ZG1A 2QVOA 3C3WA 1O7LA 2DFIA 1T2KA 4B09A 4RGSA 4PDKA 2ZFWA 1LQ1A 4HV5A 4P5OA 5E1XA 4O5VA 4LG0B 1OYIA 5EEGA 4U0WA 4LLNA 2KIMA 2RQPA 1I1SA 1B4AA 3CO6C 1LVAA 4G6DA 1ZG3A 4ENNA 4HX7A 2D1VA 2WTEA 3VFZA 5DD8A 3H92A 5F64A 3N4MA 1XCVA 1J9IA 2DQLA 4KFCA 2QQAA 2V1UA 4MGRA 1L0OC 3KP2A 4Y17A 1HSJA 2RDPA 4DQ2A 4ESBA 1SD6A 5BS6A 2UXNA 2YSRA 2PFBA 1HKSA 1HKQA 1CF7B 1HW2A 5FFXA 5D8LB 1UCRA 3FWEA 2VE8A 1B9MA 2MBFA 1U6GA 1OYYA 1NHAA 2OU2A 4U7BA 4LLLA 2XHKA 4PGGA 4KUMA 1I1GA 3R0JA 1MJAA 1S29A 3KE2A 2HR3A 5FFZA 2WC2A 1TW3A 2M45A 4RAYA 4A5MA 2DU9A 3J81K 5DCMA 5ICGA 3KETA 3I64A 3R61A 2P6TA 2XAJA 2MC3A 5E1WA 3TGNA 2GA1A 1GHCA 1HW5A 2IVMA 4HBLA 1O57A 3RDIA 2DK5A 2PJPA 2EB7A 5L3CA 4KYWA 1OMIA 2ZO4A 2DK8A 1R36A 3EYIA 1BM9A 2ACJA 4NQWA 4EVIA 2W24A 2FNAA 2QLZA 3G3ZA 3K0LA 5H20A 5A2QZ 3GX4X 2PQ8A 4L18B 3DFGA 1D5VA 2QBYA 2V1XA 2IA1A 3DF8A 2CWEA 2TDXA 3ISPA 5HLGA 1YO5C 1T39A 2ZMEB 3SZTA 2HOEA 2FF4A 5IT3A 3BPVA 2LSOA 2JPCA 5CYVA 3WG9A 1ZHFA 3M7GA 4G7HF 4BYYA 3KEOA 1BI1A 4YFXF 2COMA 4HLXA 1XN7A 5ICEA 2M87A 2QUFA 1TQIA 1FOKA 1V3FA 3CJNA 4S05A 4G7ZF 1XMKA 3Q9SA 3RKXA 3IHUA 2Y0MA 5HVQC 3BY6A 5FB2A 3K1NA 4OIOF 3KZYA 4G8XA 4IHTA 3U1DA 4JQFA 2IRFG 1YQAA 5IT9Z 1QBJA 3V7SA 4NB5A 3KCCA 4N9HA 2FU4A 1W7PB 1YIOA 3F8NA 3TQNA 5E8GA 1B1BA 1TTYA 2HDCA 1WWXA 5BOXA 2VT2A 4KICA 3HSEA 2UWMA 3WTSC 3J81Z 2VC1A 1XSVA 2P5LC 2A3SA 1AOYA 2A07F 1U2WA 2XGXA 4G9YA 4D0PA 3L09A 3NEUA 2G7HA 2X0LA 3O2PE 5D5UB 3TDZC 2P8TA 4HQMA 4Z2YA 4KMUX 5LRRA 3GFLA 4BXUA 1IN5A 5E17F 1FC3A 5LGTA 1B59A 2QENA 3FMSA 3F8FA 4O6JA 3IKTA 4ZYHA 5E1ZB 1F9NA 1KA8A 1R7JA 4ZYGA 1IRGA 4LG0A 5LHIA 3IWFA 5DYMA 3FMQA 3I53A 3TO7A 1SAXA 4WXHA 3IRQA 1MDMA 2Y75A 3DPLC 2K4BA 1KU9A 1KU3A 4U7DA 1TBXA 4ENMA 4L5JA 3F21A 2PI0A 1KU7A 3SZPA 4GO1A 2KRFA 4R8HA 1YW7A 2CW0F 1WSUA 4XSXF 5EEHA 1USSA 3I5UA 5HDKA 3HRSA 1CGPA 2FMYA 3ZMZA 2A5YB 2FNPA 2FBHA 5L3GA 2HS5A 3FHZA 2EJRA 1W7PD 4M9XA 1IF1A 4ENJA 1CF7A 1XGSA 4CO8A 5K5RA 4UVCA 4XBFA 1I27A 4IRHA 1Z7UA 1U8RA 2NRAC 2W25A 2LDUA 4DNCA 3RI4A 5DEQA 4PGHA 3W6JB 3IKVA 2BGCA 2MLGA 4KDPA 4EV0A 4LLGF 1P92A 5D5XB 2XAHA 3BWGA 1QZYA 5HLIA 5CVJA 1S6LA 1G6NA 3LA2A 5HDGA 5FD5A 3RYRA 2HQRA 3P7NA 4CDGA 3V4GA 2PLYA 2J5OA 3BDDA 1IN6A 3K69A 3CO7C 1ZG5A 4R1HA 1JE8A 4P96A 5ILVA 3E97A 2EFOA 1D8JA 3JTGA 4TV7A 5LHGA 2OD5A 1XD7A 3L7WA 1IN8A 2RKHA 5DV5A 3WODF 5F6FA 3GFJA 4HQEA 3TO9A 1T0FA 3R60A 3BPXA 3GYHX 2XV4S 5FGMA 1BBYA 3T8RA 4KN7X 3LAPA 4OIPF 4LMYA 1OKRA 2O61A 5HS7A 1XSXA 4EM0B 3HRTA 1KGSA 2P5VA 1O3TA 3F3XA 1P2FA 3ULQB 2NYXA 2EV5A 2M1BA 1WRJA 3ZQ7A 3I0TA 2R3SA 2VODA 3FM5A 4A12A 3WTUC 3RTRA 3ELKA 4YIFA 3HUGA 5FLXK 4UV8A 4EJOA 3E3VA 3LA3A 3CUQB 4IPAA 4EM2A 2VE9A 4Q48A 1D8KA 5BQTA 2V9VA 1DPRA 1IRFA 5CVUA 1ULYA 3F8CA 4QLCU 1XDSA 5CJ9A 5ILSA 2VXZA 2UZKA 2LNBA 3W6KB 4L9TA 1RZ4A 4HF2A 1PP8F 2QM3A 2VBXA 2E7XA 4IVNA 3RPQA 2KIFA 1UHMA 2KKOA 4U0VA 3V7RA 1WKMA 4KMFA 4HAMA 3E5QA 3T0YA 1GVJA 3NQOA 3I54A 2GZWA 5K1YA 1XCBA 2CYYA 2PEXA 3DP7A 2ZCWA 3D0SA 2FBKA 3OOPA 2M5WA 1SD5A 3GUDA 3QRFF 1SMTA 2VC0A
chains in the Genus database with same CATH superfamily
2IIUA 5BMVE 1NEEA 1NUEA 2F5GA 3AB4B 3D6TB 3FZHB 1ACMB 4HX4A 3IR7B 2O3DA 2DR7A 1HFAA 5IV4A 3ZT7A 3JSRA 3JC6C 2DJIA 2CLYC 3TW0A 3R0AA 2DNLA 3H3ZA 5HATA 1L5UA 3FXQA 1XMXA 3W6VA 2H5IB 3LOCA 1FKOB 2ECBA 4IH5A 5BNGA 3QRRA 2R2TA 1VBKA 2XWXA 1EZ3A 1MWQA 1FBSA 3EXCX 4ZVOB 2Z5UA 4Q45A 1HW1A 2K3IA 5IT9Y 4KIGA 1KVJA 1SFUA 3WE2A 1SJRA 2M34A 2LOSA 1JHHA 1QSDA 2HVQA 5E0OA 4Y28C 2EA2A 1B8IA 3NKZA 3AA6B 4J9PA 1Z21A 3DHWC 2EFGA 4B48A 1T03A 3BN4A 4HLYA 1H0HB 3SQOP 5J40A 1B7YB 5CXTA 3LSIA 1OWXA 2OUMA 4J7CA 1X1CA 3TOBA 2LLZA 3G82B 4ER8A 2K9MA 3HIFA 3U3IA 1LDDA 1EH8A 1MBEA 4M5DB 4PZVA 3IGNA 2YNFB 2W85A 4G12A 3HF5A 1VC5A 3DCFA 5BYQA 4PJ0C 1S1VA 3WE3A 5L47A 3I9V9 1E2XA 1YJTA 4Q2LA 3K5PA 4EUVA 2CG4A 1SA0E 2LE8A 4AIHA 3AJ1A 5AQIB 4GXOA 4ED0A 1U1RA 1NLKL 4QYZJ 1FT8A 3BTCA 2XM2A 4XRMA 2V68A 3Q0VA 2DWKA 4ZJLA 2YEVC 2D3ZA 3I87A 2ACYA 3UQ7A 2OPQA 1RHKB 1UURA 3MEEB 1MIYA 3IG1B 4EYHB 4LFBT 3AAAB 1ZRFA 2GA7A 5FIIA 4QXCB 2WSEC 4K2XA 1G6BA 1XG1A 1DAXA 4JP8A 2GIVA 3UFEA 2VIXA 4ZLLA 2JVHA 1J5EF 2AJ4A 3ZMUB 3J9X1 3ZOBA 3IA0A 4X66J 3F41A 4HI1A 4DV0T 4HT5A 3UE2A 2OV9A 2EFQA 3V8JA 1T8IA 3IBWA 2GAUA 3WGIA 4B4CA 4N78D 2D9OA 1FNXH 3MWMA 2L08A 2UUBJ 3KV6A 4CZZB 2RRAA 1MD0A 5C5JA 2XROA 4KPCA 4RB2C 5GAGJ 5B66C 5AQPB 2C28A 2XM1A 4YJ2E 2W2QP 5E3MA 5HMYA 2ZXIA 4FQGA 3L00A 3J80Y 3WC2A 2XQ6A 3HHGA 3LDQB 4IFVA 1K79A 3SBMA 3LFUA 3HM9A 3P8CD 3RRCA 2H4WB 1YE9A 5E3AA 3ESLA 2Q8KA 3PFEA 2FJVA 3I58A 1HBUA 1YI2I 1ZREA 2KU7A 1POGA 4NPOA 1K73T 4MFEA 3IP0A 4MTDA 3OL9A 2VKHA 3ENVA 2EFPA 2CM0A 3ZMVB 2HFOA 5M2PA 3KLGA 1Y7PA 2KN4A 3VRBA 1YKEB 1ZYRF 3HHLC 2VVSA 2K9QA 2LA4A 3OT9A 1WC5A 2HQCA 2IW5A 3BYRA 3TZYA 4FJOA 1X1PA 3I59A 4F67A 2HWVA 4U9RA 3BOQA 3E8OA 5U47A 4L74A 1TZ0A 4I56A 4IRDA 2F7VA 2V9KA 4B8XA 5HWXA 3NRBA 3MM8B 3GWHA 2JMWA 1ZM9A 5J8CA 1J5OA 5L38A 3BJOA 3TUJC 1E3HA 1U45A 2KFNA 2GMHA 2JX2A 2W7NA 3ZCJA 2X1DA 1AJ3A 2HG4A 5C44J 1FRKA 1S94A 3H5XA 4JBAA 4OL8A 2KFZA 3AG1H 3CESA 3P6YC 1FMWA 1TW2A 1N32F 3F0NA 1T56A 1HQCA 1S48A 2I2YA 4K4XA 2UVUA 3QO9B 2UXDF 3D5RC 2V7JA 4RW9B 4HWIB 1TL3B 1RUOA 3EVOA 3ZPOA 5KFVA 2MH9A 1HFEL 4LF7F 1SC1B 2CPFA 4AL6A 1UA1A 5TGTA 2OPRB 3SQGB 2FBWA 1CJUA 3LQRA 4TYAA 3D5LA 3OSGA 1OWAA 1X19A 1VQSA 1MBHA 4EI2A 5GPAA 3FK4A 2V1DA 1MJBA 4BJ6C 3DPUA 3SMZA 3M2RB 1WVRA 1YRUA 4CA0A 1Z9CA 1URNA 2MYFA 1JTXA 1UP1A 2JH3A 3PL8A 1KF6A 2CO5A 2GJ2A 1XNRJ 1UTAA 1RTDA 4X4SA 3KYLA 4MK7A 1JLAA 4LR8A 3ERMA 3G71S 2EIMH 1Q0NA 3HULA 1RAEB 1VBXA 1FTCA 2DL1A 3GWZA 3MMCA 2XGQA 1SD7A 1Q86T 2W7AA 3CC4I 1H2TZ 2RQKA 1H74A 2DOAA 3QWLA 1NEKA 2XB2D 5FL1A 2IS4A 2VT3A 2FSWA 4F4ZA 2B5JA 1PJ7A 2E66A 1FYLA 1KYWA 4LIRA 4A47A 1ZTRA 2LMDA 4CQIA 2ZH8A 3O1IA 2UVWA 3OSNA 4DN9A 4KGXB 2DR6A 4Z8XA 3MI7X 1IBMT 1I3AA 4IKFA 3AQPA 5EGYA 3EZOA 2JA7J 3M3ZB 5C24A 3V4IA 2HGMA 4I1TA 3UKGA 5CH7B 2ZFUA 4A56A 2VJ5A 4H0EA 2UXDJ 1HOMA 3DJBA 1GDTA 2X85A 3TLVA 3MFHA 4EYIB 2I38A 2LK2A 1N5TA 5A8RA 3QP6A 3FZBA 1S1UB 2LFVA 2YWGA 2JPFA 4PG7A 3PHTA 2IEKA 4S0HB 4M71A 3A8KA 4B9SA 2OJED 4AIJA 4IQ4A 4DR4F 2GO8A 3IC7A 2KHMA 2XQ5A 5IS2A 2K7LA 4ZN1A 2KHCA 5CVVA 3QAHA 1M1HA 4B3ST 2LU1A 3VV2B 2JOQA 2EHOC 3Q0WA 1QVUA 2R5ZA 1LEAA 4HR2A 1S1VB 3A8JA 1M5OC 3H0GJ 2W7OA 4JP0A 3M05A 4FKYA 1XWMA 3C6TB 2VPRA 1YX2A 1D1AA 3BZ6A 4I7HA 1BUXA 5LRSA 5FVLA 3TL4X 2YNIB 1P9QC 4HV6A 4GCVA 1R8IA 3MEEA 4ZLJA 5HBMB 3Q5DA 3UN2A 1T0FC 4CO2A 1SJ3P 4HACB 2HKOA 4YB7A 1U1LA 2DR5A 2WA0A 3F6OA 2ZH4A 3ZMUA 2BM0A 2O5RA 1E7PA 4K4UA 2OJ3A 3OIOA 1ORKA 1AWCA 1UWBA 4LB5A 5KAFC 1NBEB 1MMSA 3BROA 5KT5A 3F56A 2FHJD 3LJCA 2XAFA 3B57A 3ZQFA 1WYCA 4C8MA 4IRCA 1RR7A 2HPIA 3WHIA 3E0ZA 2RQMA 2G2YA 3K2ZA 2P7VB 5D5WB 5KX5E 1O7FA 2P6SA 1U6ZA 2W48A 3BR0A 3VODA 3RQIA 4YELA 4O2BE 3S1MJ 2X51A 2W4PA 3HCXA 3LALA 4Q44A 1HI8A 4DBQA 2XYGB 5J2PB 1HWKA 3G1LA 2HKXA 4IR1A 1QUPA 1UHWA 2UUAJ 3DQVC 3ZRGA 4BGDA 2HZAA 2Z33A 1HNWT 2MGQA 2KM8C 2UUBF 2NVQJ 3QGHA 1V5FA 4ZS3A 3GPAA 3M8FA 1Z4UA 5CAAA 4GGGA 2DMTA 3TBIA 4ITSA 3J80K 4OHXA 3ZTRA 4B3OB 4YS2A 2CW8A 4OYMA 4X66F 2OZUA 4JI4J 4CHUA 3HKZA 5GAEJ 3EHZA 2D69A 5HLHA 2AV5A 4EO8A 4BXXJ 3AAWB 1ZTTA 3J80Z 4WKRA 1EETA 2VFUA 1Y3KA 4IXAA 5KVRA 1FRJA 3D0HE 1Z77A 3MAHA 5CKTA 2DEJA 5J2QB 4KPYA 4LT6A 3KNAA 2M7SA 4LRBA 2L0KA 4Y65A 3IH2A 3SDEA 4HW0A 2Y8DA 2BYVE 4I09A 4TKTA 4ZK7M 5L1LA 2FJXA 3N9MA 2VU5A 4CIOA 1AROP 1TKXA 2XF5A 2W4XA 2H27A 3MCZA 4NBQA 2MPUA 4BA9A 2M8HA 4L9IA 4ZPWR 2ZNZA 5DS9A 1Q81T 4Z90A 5LEJA 1OY9A 4NCGA 2AQEA 1JNZA 1UX5A 2ASJA 1Q82T 4AI6A 2AJ2A 3OS2A 1PVEA 3QO9A 4P7VA 1ZARA 4RB3C 1U2FA 4NOHA 2KQRA 4A0ZA 1K78A 2XGPA 5E3PA 1OLTA 3EPGA 4IEJA 4X64J 3H5AA 2EZLA 5A8WA 1REVB 2W7PA 3T9ZA 1BW5A 1HNIB 2V5HG 1QZEA 4IH7A 2OA5A 2C2RA 1GXQA 3KVAA 2ZMEA 1W36D 2HNHA 4PWWA 4YG2F 2EPIA 2MAWA 2FVSA 4PXCA 3NAIA 3G8QA 4JI4F 3GIKA 1VYAA 2AP6A 5J1GA 1A6IA 3NWRA 3QODA 1S7IA 1EKSA 3IRWP 2DPUA 1U25A 4N0BA 4COFA 3CLQA 4DR2T 2OLTA 2DA1A 3C46A 4ZI2C 3OVAA 5GADJ 4ANCA 4NHJA 1A35A 1FDBA 4N41A 2DT9A 2PMZD 1NHVA 3EPIA 4F4AA 2WCAA 3BQYA 4X4VA 3SWHA 4DOZA 2XPKA 3LAKA 5BMZA 2YWHA 2DMPA 3PEJA 5KFCA 3BV8A 3DLLF 2ZE2A 2E9XB 3ZCIA 2IAJB 2OFHX 3D0GE 5IY5H 1R0BG 3BQ2A 4RAZA 4JK1X 5LEKA 4RKUC 3EDPA 2Y1IA 1FHTA 3H20A 2ZOGA 2EK1A 2QLFB 1JKRC 1Y56A 3NAHA 2MOZA 1JLEB 5HS9A 3BR9A 3JRAA 4G2AA 4KN4X 3FBEA 2Y30A 4GYGA 1NNDA 2VASA 4YFKF 4BNCA 3F9KA 3CDLA 5I42B 4IF4A 5DDOC 4ILLA 1N5YA 3PUAA 4YY3T 4I01A 1UB9A 1N75A 1K1QA 4V2GA 4UIGA 1YRXA 3R6LB 4USVA 2R7XA 3KP4A 5LD2C 2NR0A 1CSJA 1VC6A 2OTJS 1QQIA 1DUXC 2OQGA 1I5OB 3BDEA 1E6VA 4LK0F 2BE5F 2LEPA 3W8PA 1E6YB 3ZSTA 2YKMA 1QA6A 2XB0X 5LGNB 4GKKT 1ZGJA 4YB5A 2FJEA 2VKVA 1VQPS 2YNIA 5AONA 5GPCA 5L3BA 5GVQA 4NUBA 4I7FB 4NI2B 1EKRA 2A10A 2K40A 5GAHJ 4CLKA 4ZZBA 3POTB 3AVRA 3MD1A 5I3UB 4Y2IA 4HZFA 1XMAA 2EWHA 2F9DA 2DGXA 2K3KA 3FMRA 1IBCB 3OJAA 2LRKA 4FX4A 1OS5A 5ABFA 3M8PB 2EBIA 4MYUA 3CCLI 3JTPA 4ZHRA 3IAM2 4H9SE 1UWBB 3MQ0A 5DG9A 4KIFA 2DMUA 4YEJA 3COAC 4E7KA 2ZXWH 5JVTA 2FJBA 5HMWA 1AA1B 2CZVC 4IG0B 3DBRB 1Q95G 2V2VA 5AQSB 4Y4RA 4CLPA 2BVMA 2KZVA 3ZMZB 2Z58B 4XM3A 1ZYQA 2K1RB 1MJ9A 2X1BA 2HWTA 3FZLB 5L3FB 1HD0A 1TL7B 2WM9A 3UD3P 1Q1HA 1VRQC 3J81Y 4OMYA 4EEFG 5KFSA 3DN9A 2QQBA 2ACZA 3BEGB 4LF6J 1BJZA 1Y5NB 4IDPA 6FDRA 2EFWA 4AKLA 1DLOB 2BY0A 4BY7J 1ZM3A 4WZMA 3OUYB 3ELHA 1LDKB 4MK9A 2UUZA 4NE9C 3RG6A 4ED1A 2K27A 3OOUA 3OMYA 3HO1A 1U9OA 5AQUB 3F57A 2YOEA 1BI3A 5LGUA 3LAJA 3CUQC 2GW8A 1RCOB 2ZXHA 2YR2A 1RAOA 5J2QA 3SHFA 1OSDA 4P1WA 3BBFA 4F8RA 4QW9A 4E7SA 2GVDA 2HPUA 5A0YA 4O2AE 2B7EA 4USJC 3MAAA 3AB2B 4HDHA 1Q8LA 5HJYA 2D9DA 2P7CB 2XHWA 2A18A 1PIEA 2Z3YA 4PEOA 2M8DB 3I96A 4BJTA 4LF7J 3I6PA 2RJZA 2XULA 4R25A 1S49A 2DNYA 1LB2A 4AFFA 3GF2A 4GKJT 2HNDB 1N32J 3NNAA 2GC8A 5GADU 4Y34A 4P2SA 2NVTJ 3VVTA 3REOA 1FDAA 3TQ1A 2L02A 1MMLA 4O3OA 4MFRA 3QGPA 5SZTA 3E5XA 3NRVA 1IDYA 2MQLA 5L1IA 2XMVA 3JTHA 5D0GA 4BJ5C 1R4MB 2H94A 4YHJA 1Y01A 4BHBA 4TN7B 3PFYA 3M6UA 1HG2A 2DPDA 2LEAA 3R2CJ 2ACMA 3TX8A 5JR9B 4ZS6A 4P2MA 3UD4P 3M30B 1SKRA 2NREA 2FC9A 2KT0A 2Z9OA 1OQ6A 5H9FJ 5KFDA 4R8UB 5BPDA 2NS7A 2X1CA 1YW0A 2VQFJ 1SFOJ 3ZN1A 3LFKA 3EGWB 2YNFA 3WTYC 4KFBB 2EFNA 4LD5A 3QK6A 2DO0A 3V81B 2E5LF 3OV8A 4OJGA 2L9VA 4F92B 5TJJA 2ERRA 3EETA 1IJ6A 3W3SA 1PJ5A 1HBXG 4RWWA 1JMTA 2DW4A 2L9NA 1UHSA 5EX0A 4XQFA 1HBOA 4A5XA 1WHUA 5C4XJ 3OFEA 5HCJA 4QBUA 4ED3A 5JDNA 4ZJZA 3MK7C 3NKYA 2BE2B 2XTLA 2E9XA 4Z7CA 1R6VA 5IFMA 3IG1A 4FCYA 2CJXB 5AE1A 3NGDA 2V8HA 3AAIA 4ZZCA 1WNEA 5LBMA 2XMAA 2HGCA 2ZM6F 4A8SA 2FA5A 2FQ4A 2KINB 1NHUA 2KDZA 3HJVA 3CC2I 3LMMA 2WVCA 4OZ1A 1ZQ3P 4BBSJ 3MMJA 2C2DA 1RWVB 4B3RJ 3H9JA 4M5HA 3ENQA 4RB0A 4HFCA 1O3QA 3Q5XA 2Z6EA 2CLYB 1Q5VA 2VB6A 3GCXP 1X7VA 4TY9A 4YR3A 3OR1A 3ZTSA 4MQ9F 4FF4A 4YDXA 3TX0A 2R7VA 5JQGE 4O4GB 4IOCQ 2NXNA 3EYZA 2ADBA 3QT8A 4L73A 4KISA 4LJZF 2B4PA 1KS2A 4GK5E 2CJQA 1E1HB 3SCKE 2CQ2A 2WWVA 1H7WA 2DA5A 4EZ9A 3JSMA 3OYZA 1BGXT 1B64A 2DI3A 1UX4A 2MSSA 3O3KA 4ZH4F 4X5TA 3AECA 2HEOA 3BH7B 1FKAF 3PO2J 4EM1A 1E6YA 4QX7B 5C8YE 4RUHA 3AFHA 4P55A 2CUJA 2HK2A 4RL1A 4CLLA 3I56I 2M88A 3ZMVA 4NI2A 3H5NA 1FIOA 3JR9A 2EHOD 3VAHA 5D4RA 1WSVA 3POTA 3K9TA 1HSTA 5E20A 5HI7A 1VQ6S 1HBNB 4KNYA 3DLKB 1TFYA 1S10A 3L9FA 2VUMJ 2FJDB 4X62J 3L2CA 3ZQQA 4I2QB 4NMLA 3OFFA 1IV8A 2FIUA 1FT9A 2L3LA 1RWPB 3IN5A 3CCYA 1N0UA 4QZVB 3QGIA 2HGLA 3GFMA 4R0EA 1B8IB 4TUYE 3Q0AA 1ZOTA 2LLYA 3M4XA 3EABA 1CPZA 4XLNF 1HLWA 1HQUA 2HYFA 2IM0A 4TWHA 1WACA 1N34F 3UR0A 4GYIA 4C3KA 2XRNA 1NRKA 3DYAB 4I2OA 1SVLA 2QJ3A 1U9NA 1TKDA 3G71I 3BQ0A 2LR8A 2FVQA 3L7PA 2WVFA 4OZJA 3FCHA 2DA2A 4EV6A 1M1EB 4R0JA 5A2QU 4XRSG 2B4UA 5K14B 3DPTA 2LQ9A 4NA3A 1E3PA 2C6YA 4YB1P 2MABA 3CD0A 4FASD 4A3DJ 5LL6d 1XNQT 1RGVA 2OPRA 4M5JA 3SQGA 2FLPA 3K70D 4A3IJ 4IDOA 2VFRA 3VALA 3MUVP 5A8KB 5EZGA 4PG6A 1O3SA 1PUFB 3KP7A 3QGGA 1PKUA 3V5SA 2V50A 4K4SA 2XAQA 3KP6A 4XONA 2H9ZA 3K5LA 1WHYA 1M5KC 2L9SA 1YBTA 2NS8A 2NSCA 2NS1B 3ENWA 1TWFJ 5ED4A 5LXTE 3HOYJ 4E70A 2X3GA 3CIZA 4DPUA 2PI4A 5DCFA 2FYXA 4J90A 2WDQA 2ZWPA 4DWIA 2D0TA 1F5TA 2RF2B 2IA2A 3EE3A 4CI1B 1ON2A 3I0OA 3ZZZA 2QYOA 3D7SB 4IGUA 4OI2A 1AUDA 2XSFA 4Y00A 5LJ5Y 1YW8A 3PJAJ 2AGPA 2XRLA 2XPUA 3IH3A 4RM3A 3PFOA 3KX2A 2J8AA 1D0XA 2X1FA 6PAXA 5AQTB 4X4NA 4IFVB 4TNWA 1WKJA 2IJLA 2V7KA 2WOMB 2JUCA 4NC7A 3RF1A 2JT1A 2X6XA 3CJKA 5D5VB 4CN4A 5KG1A 3H2VE 2FZGB 1HBUB 3HVWA 5KFUA 1AW0A 2K02A 4F4WA 2KB2A 3HHEA 4TV9E 2YNHA 3G2BA 4IE6A 1WOOA 2FY1A 3C64A 4WXDA 4IHVA 4DCPB 3M8RA 1XDUA 4J9KA 2Q2EB 2BV6A 2ZHAA 1Z05A 3AD7C 2E5NA 4X65J 4PK4A 1IUYA 4H4KC 2OHDA 5DQHA 2WAFA 1IZ1A 2LKPA 5F3JA 2X48A 3LP0B 3TAQA 1RT2A 3CEDA 1F6TA 5JR9A 2JZYA 5LA6E 2Q79A 3OYJA 3HBLA 2H5JB 2VG5B 2MKIA 3M2VA 1ZM2A 2LU2A 4NRUA 2H8RA 3H90A 5DRKA 4DUZJ 4LF9F 2K24A 3HOTA 4DBRA 2ZVSA 1KEYA 4D7MA 4CXFA 3C4ZA 3M32A 3LGHA 4DV1T 3IBCB 5I4MA 3V2UC 3ETOA 1MBKA 2QVOA 2Q66A 5KFGA 2DFIA 2CQNA 2ZH1A 2OIHA 1LFBA 1T2KA 1WRDA 2DNHA 3R5AA 2F48A 4PDKA 1VFJA 5F0UA 4DFMA 4P5OA 4A8QA 2N1GA 2NOGA 3SFIA 2HNYB 1FJCA 1OYIA 2V4QA 4DX7A 3OL7A 5FKLA 3H40A 2NXJA 1CJUB 2UVVA 2D0UA 2R8HA 4HACA 1TWHJ 5I3QA 5J2UE 1AFIA 1JT6A 2WTEA 1Y5IB 2Z30B 1S1TA 3UU8A 3BR6A 3Q3SA 2VL0A 1JWWA 3EGNA 3VRAA 4I69A 4LF8J 1FNMA 2A05A 4YDDB 2QQAA 4L0RA 1XQIA 3CCJS 4MGRA 1U4QA 5JR9C 4Y17A 4F0MA 1H7XA 4GO5X 3MMCB 3CCMI 5FMNA 5FJ4A 5L3GB 4DV4T 2QMXA 2JEFA 1FD8A 3HZJA 1KHVA 5E3OA 3HG9A 3G87A 1SD6A 5BS6A 2YSRA 2PFBA 1HKSA 1BLUA 2UU9F 2QLWA 1B9MA 1KN6A 1KRPA 3TA2A 2FHKA 2VG6B 3P8BB 1RTJA 3PTWA 4UTGA 1U6GA 4E8UA 2XY5A 4XAXB 2E2IJ 1NHAA 1JLFA 4OHZA 4HFBA 3K2YA 1JJ8C 3G06A 1WSRA 5C24B 4KUMA 1Y10A 2CQIA 4O3QA 3R0JA 1S9GB 1GMVA 3PV8A 3L7OA 4FP9A 1FIAA 3AE3A 5DABA 3HFKA 4NUUA 1I6HJ 3HKEE 3KVBA 1Q4RA 5FFZA 3DLKA 2M45A 2LRDA 1EETB 3RHWA 5ETWA 3W8GA 2V7IA 4RBUA 1XMOF 3K8PC 1S1UA 1X2MA 3B6BA 3D67A 1M1GA 4C8KA 3KHRA 1L3TA 1HHSA 3CF5Q 1R8BA 3OVBA 2J9CA 3CCZA 3TGNA 4LSLA 3QPIA 2GA1A 4RR5A 1NPPA 5E3RA 4DV6J 3DYAA 4DG1B 4ED8A 4HBLA 1F3FA 1SQGA 3GTYX 1T7SA 2KYZA 2BG9C 1KC8T 1WORA 1H72C 2R5ZB 4LF4T 1B99A 2DK5A 3LSMA 3D1QA 1OMIA 3EVYA 1O4XA 3FK6A 3LP1A 1M5SA 2H1KA 1JNZB 4DQQA 3EYIA 4RA2A 3K5OA 3VZHA 5K14A 1BM9A 2ACJA 4CO1A 4AU7A 3FIWA 2QQ8A 1ETQA 4U8YA 1K0VA 4XIUA 2DY9A 2KLQA 4PNIA 4C6AA 2ZH3A 4ZP7A 4AL7A 3CC7S 1U0HA 2Y31A 3M65A 3DFGA 2XQYA 2WTFA 1D5VA 3DF8A 1HF0A 4LMLA 4HFVA 1I3QJ 5JVGQ 3I1AA 2DMNA 4OZ5A 2K5BB 2WSCC 4PUOA 3GMIA 2CQ0A 1S12A 1KTVA 5HXCA 3WG9A 5ADZA 4AXPA 2LFBA 2DCLA 4G7HF 4NLTA 1Z0XA 1R27B 1BI1A 4YFXF 1DTTB 4M5KA 5F41A 4CCHA 2RF2A 2UV8G 1WKKA 4V19X 1HWIA 2QUFA 5ABEA 4NC6A 4DL6A 5AE3A 2ZM2A 3G6XA 4AQYT 2XBPA 3LSPA 3M8QA 1VQMS 3FKIJ 3BG7A 4S05A 4V19K 4G7ZF 2X1AA 4RW7B 3Q9SA 3RKXA 5FYMA 4UV8B 3RJMB 2BBJA 1ZV4X 2BS2A 5FB2A 5J0ZA 2HHHT 1VLOA 5E3NA 3PX6A 1IUJA 3HLUA 3CJKB 4MKYA 3UDCA 3BGUA 1QVFR 2JLFA 3X3UA 5HLFA 3ZXSA 1S97A 4XICA 3O3LA 2BHYA 3NZQA 4RAGA 5M2RA 1YQAA 2BM1A 1YJ7A 2MZQA 1TK0A 1H2VZ 2FU4A 1W7PB 1YBAA 3ET6B 3TQNA 3OYCA 2J7KA 1TL4A 1SUQA 3SOLA 5BOXA 2N3OA 2VT2A 2BW3A 2UWMA 3WTSC 4DR3J 3J81Z 1ITYA 2DA7A 1PC4A 1XEZA 1XSVA 3M8SA 3RTVA 3UFCX 1Y4ZB 3W5ZA 2A07F 1LE8B 1U2WA 2M0GB 3W62A 3R84B 3BC8A 1LWEB 3ABMH 4EBCA 1WC6A 3R1HA 4D0PA 1QRYA 2X0LA 4OYKA 1N36T 3KXDA 3TDZC 2P8TA 4HQMA 3TRGA 3OTDA 4PABA 4DCOB 2G0IA 4Z2YA 4BBRJ 3OYXA 3MKLA 1SE7A 2HOSA 5L9XA 5E7OB 3O5TB 5LRRA 2J6TA 3LK42 4BXUA 1WJEA 1QPIA 4MFBB 2E5LJ 1RT5B 2C3PA 3PJWA 2YKMB 3R97A 3A03A 2FJEB 2ZH2A 5HNFA 5JVGF 2LM9A 3RIUA 2QENA 5JTGA 3DTKA 2W2NP 4O6JA 1EARA 3IKTA 3PCOB 3OPCA 3ZKRA 1XJWB 2RDIA 4I7FA 5HAOA 4ILUA 3UD5A 4MHCA 3H9QA 5I3UA 3EM1A 4E7HA 5AXMA 3I53A 3SV3A 4JX4A 2KMFA 3RX6A 3IR6B 3EI0A 2BQRA 4JLEA 5HSPA 4GVBA 5LXYA 1X0PA 1KU9A 2VA3A 3RR8A 1I39A 3F21A 1X5SA 1MBFA 4ETXA 4USMA 1NSAA 2E29A 2BOPA 2FJBB 3KV4A 3G82A 4GO1A 2XYHB 1WSUA 2YKOA 1HNZT 1USSA 4ZI3C 4GKKF 5AE2A 3PACA 1GNKA 1Q1VA 2CJYB 1HTJF 2K1RA 4CXXA 4EU0A 1YKWA 4QQBA 4C3JJ 2EJRA 5D4NA 4M9XA 1TL7A 2ZHOA 1RESA 1UPPA 1ETXA 4ENJA 2XGDA 3JAFA 3PO4A 4IRHA 2NYHA 1U24A 2XMWA 2VG6A 1VHIA 3M9NB 5C42B 5HN0A 5F8LA 5K7ZA 2JVGA 3RI4A 2PMZA 2GHVC 2ROGA 1AYEA 3R5BA 2AZ3A 3ZR8X 1H89C 3H98A 1BY9A 3OTOT 3TLSA 2H48B 3C14B 4Z91A 1TMMA 1XR6A 2MLGA 2WAQA 4URQU 1TWAJ 2MTQA 1UETA 4YOEA 1YIJS 2C2KB 3W5YA 4ED5A 3C2HA 3BWGA 3F44A 3QIPA 3A4TA 5I42A 3NGTA 4NX9A 4O23A 5HDGA 1SJQA 5FD5A 3V4GA 2XSBA 4JI6T 4QWDA 3BDDA 3OSFA 2I59A 3ZZUA 4DG1A 4OYJA 5KFXA 4UOFA 1LW2B 4JI4T 1QTMA 3QZ8A 4F4YA 3K4MA 2OD5A 3W65A 2LLKA 1NAFA 2XC9A 2RKHA 1JLQA 5L3BB 2NVYJ 2P9BA 3GFJA 3FEZA 2WW4A 4PR6A 4OYBA 2LKGA 4WBOA 3TO9A 4JI1F 1T0FA 4BAYB 1C0UA 3GYHX 1LPQA 2CPTA 1SHZC 4DR5J 3UR3C 3HOVJ 1UVKA 5EZHA 3T8RA 2W82A 3SIPB 2N9DA 3LAPA 3ZYMA 5L4HA 3HVTB 4NLSA 4UOGA 2XG8A 2O61A 5HS7A 2YU2A 3V6HA 1J5OB 3A0HC 3F3XA 2R7TA 3RZOJ 1P2FA 4OX7A 3VTIA 3MTJA 4H4MA 2YWFA 5AQGB 1CQTA 2R7SA 1YXRA 2CUEA 4HNVA 2XC7A 4BDZA 2B9YA 4H4OB 3WZ0A 3CK6A 4LFCT 1V5EA 3AQOA 2R3SA 2CXFA 2V8GA 4BKXA 3RYIE 3K58A 1CQMA 3RTRA 4QW8A 2Q9QD 2LH9A 2D3UA 2AJ1A 3RAMA 1HBOB 4RW7A 2D2SA 2E60A 1CQNA 4OYZA 2BE2A 3H3AA 5F8JA 2RH3A 4IL6C 3HHKA 2DNZA 1T9VA 4Y3OA 3QC9A 4IPAA 3FMBA 2D7SA 4K5SA 3K3NA 4LRAA 2HQ3A 2GS8A 4CLTA 2V9VA 3OVSA 3K57A 1IRFA 3UQ4A 3CTRA 3F8CA 1SEUA 2VXZA 4D9JA 2V5CA 3Q2TC 3S1QJ 3W6KB 2UUAF 1T33A 4CCNA 1JJCB 3DEWA 4HF2A 2CJJA 1LWXA 3C6UB 3CCJI 2JRMA 3E0JB 2OTJI 2GX8A 3RPQA 1NK6A 4X62F 3BTJA 2B9SA 5IQQA 5HVGA 4U0VA 2NXNB 1Y0NA 3HPHA 3V7RA 3KV9A 1WKMA 4KMFA 1LWEA 3SJMA 4HAMA 2LDIA 1GVJA 1GFWB 2KVQE 4LFBJ 3VYRB 2DB1A 3I54A 1T9TA 2XSJC 2I10A 4CLWA 1K6YA 4KYZA 3DP7A 1FVSA 4TY8A 4I6WA 3D0SA 4DR6F 3GSDA 3GUDA 4D1QA 2YKSA 2DCEA 3KV5A 1UW9A 4XIDA 4XOTA 3KDOA 5DLGA 2BJ3A 3ZTOA 1K0TA 5F1RA 2N7CA 4JI8F 1IN7A 4I68A 4M5IA 4W98A 3KLIA 1R8AA 5AT1B 4GRSA 1NENA 1LQ9A 4HWFA 2ADUA 5K5QA 4EQQA 4OJHA 1FERA 1U5PA 3TP0A 2HQIA 2Y0BB 5ETNA 1UGOA 2XUEA 3GTLJ 1DZ5A 3GIMA 4G94A 1IKVA 4M6YA 2V6XA 3PRVA 1YD8G 1K83J 4AKHA 4X4QA 2XQCA 4RAFA 1VQ5S 2A61A 1R00A 2OTLS 3O8GA 4ZTJA 4WKYA 4JX5A 1UCUA 3ZN1B 3GA8A 5D4SA 2QL9B 4KFBA 4WJBA 4IT4A 1SL2A 3HZEA 5IM0B 2CKWA 4ILRA 3TLTA 2CZ4A 2CQQA 3NZPA 2F4VT 5T7LA 3W60A 1SJ4P 3C6TA 3JREA 3MCMA 4B3SF 3DV8A 1JGSA 1TNTA 1FSHA 1UAWA 2RDJA 4I6ZA 3U2RA 1LVFA 1FNNA 3CULA 1F1ZA 4EK2A 5CPRB 4WU3A 3MACA 1FFGB 1YRNA 1YSJA 4WXCA 5DDRC 2BBHA 1BN5A 2H7OA 5HBMA 2PMZN 3DKXA 2W4CA 3BS9A 3C19A 2GBYA 3TW6A 4IL9A 3PKMA 2M4KA 3PUYF 1V4RA 4QPTA 4KMCA 2APOA 4RO0A 5FO5A 2HTJA 4AQFC 1Y1VJ 2JSCA 2HVZA 3DOKA 1QE1B 3AJDA 1ZH5A 3MD3A 4B9LA 4JI1T 5FDLB 1U1PA 2G7UA 3UTKA 1TL1A 2B8QA 1DY3A 5E3LA 4P9UA 3BGOP 4JOUA 2VPZB 3Q8UA 2KH9A 3S2WA 2PO4A 3OR1B 4G7OF 1DU0A 2XJ7A 4ANEA 5BYRA 2IY5B 3OIQA 2EINH 4IOCF 2CV2A 1SFXA 2WV0A 4RNHA 2W62A 3EDUA 2CUYA 4C3IJ 3VGTA 1APLC 4IHYA 3ETVA 3BYPA 1RAIB 3G9CA 2J7WA 1K1SA 1N34J 1D1UA 2XI2A 2DMQA 2KJWA 2O1PA 2WU5A 4NCBA 1GMUA 2BKOA 2WOMA 1YQHA 3VR1A 3MTKA 5GONE 4NMXA 5FLVA 1QAYA 3GR1A 2PJRB 1D0YA 3D0IE 2EIJH 3SEQA 4E98A 4A6DA 4IJAA 4KJZA 2YNHB 4B3OA 1JLQB 2DXFA 2FLOA 5LSRA 3A1YG 4W4MA 2FUG9 4HN9A 1ZBTA 4C3HJ 1J59A 1RWUA 3QQCD 1ZKGA 1HBNA 3EX7B 4HHJA 1C0UB 1ERDA 4EYUA 4L6V3 3PSFA 1PYSB 3IGVA 3LK3B 4TWDA 1RT2B 3OTOF 3OSPA 4WXWA 1AHDP 3OJSA 2KZ7B 2A9UA 4MLKA 2MH2A 1S7EA 3OR2A 4CI0B 2VG5A 3M8WA 4QU6A 1HQUB 2PG4A 3PNTA 1REGX 5LP6E 4ZP8A 1Z1DA 4LF7T 2L4MA 1NDKA 4C91A 3KEYA 1F9FA 2WY2A 4CCLA 3FZVA 3KP3A 1GXTA 2R5YB 2O0YA 5BXIA 3UPFA 4P0AA 3KUGA 2A3DA 4H4OA 5M3FJ 1N32T 4HEA2 2QL5B 2QGUA 3M32B 3NCRA 1RTHB 5F8NA 2XS7A 3M9AA 5IYCJ 4FYDA 3HOXJ 3GIIA 4RGXA 1T98A 4A3FJ 3I0QA 3PU8A 1BIAA 2X9XA 2PIIA 1HNZF 1ZAWA 5G0RA 5LT5A 2W61A 3QPSA 4PW8A 3IR5B 1T9UA 1HNIA 3ZQGA 2MD0A 4UY8T 2AGQA 1SC4B 5KFNA 3PUSA 3QRQA 2DLLA 3HGGA 4QH1A 2JTVA 1BL0A 4LUBA 1I51B 3RYPA 4B3SJ 2Q6BA 1S7AA 4Y2AA 1RT7A 3CUNA 2X9DA 3KIOA 4DV1F 4C8OA 4B9TA 2CRBA 2HBRB 1W7WA 1TK8A 1IQTA 5FKOA 4CWBA 2V67A 2YU1A 5IUXA 3MZ8A 3VQTA 2DIVA 3WX8A 4CH1A 3MAQA 2C5KT 1KQSR 4ON0A 4PK5A 1WF0A 1VRTA 3CLOA 3HEFA 5L3EA 3PHEA 4TYBA 1WC1A 4C0BA 2QSGX 3VB2A 5I3PA 1JXSA 2D5UA 4PQAA 3BSCA 1Q7YT 1X3UA 3GMEA 2M6IA 1LDJA 2BZTA 3H7HB 2E9XD 3N0VA 3RSNA 5D0RA 8ATCB 3ISZA 3BBBA 2XSJB 4KIBA 4LF5F 1JLFB 8RUCA 1MSEC 3BZKA 4L9VA 2P9EA 4UY85 4CNZA 5IT9U 3S1NJ 4KUMB 5L9NA 4A98A 2ZSHB 3C1DA 3KLIB 5D15A 3EQLF 3KJQB 1GUUA 2KZZA 3GLLA 1T9WA 3SXLA 2VKDA 1ZZFA 2Q2EA 1YG0A 3S2DJ 3MZKB 5FJ8J 3C15A 3OPKA 4HA8A 5C3JA 3BH6B 3R7BB 2ASYA 2HNZA 5J1EB 4DR5T 3CJ0A 1RLDA 1XX5A 5K7FA 1WHWA 1EHWA 4UZBA 1WTBA 1V55H 5H2FC 4Y6IA 3U1LA 1S9EB 4LFBF 2IS1A 2OQRA 3H35A 2FZCB 5HQLA 4RU9A 4IHSA 3K7AJ 4MALA 2COLA 2PSZA 2P8IA 2WBLA 1HC8A 5ETSA 1X3WB 3RRWA 3DKWA 2O9LA 4LR7A 5HVFA 4M3DA 4Q25A 4Z6YA 2LXFA 3N5BA 3VYTB 2HIQA 3MEGB 1N5SA 4HOBA 4U74A 5T41A 4RUAA 4BQQA 1S72S 4FF2A 2DXIA 2JA2A 2RN7A 2AGOA 5LGNA 3TJ9A 2MZ1A 1OEDA 2EEYA 1WC0A 4TXSA 1E2AA 3Q0UA 1VQLI 4USTA 4CSWA 3MXHP 1U0HB 1EKEA 1U3EM 2BZ2A 1R8HA 5ETRA 1HIYA 4FHTA 2QWWA 2HNYA 4KHMA 2I0XA 3WI3A 2R2UA 2CPXA 1IXCA 3FHNA 3UDVA 4BE2A 1YIJI 5F04A 2ALYB 2JFDA 5HEGA 2HQNA 4JBCA 1MN9A 2HFHA 4BH9A 4UV9B 1A6LA 4WIQA 4N76A 1XGMA 2RQQA 1QE1A 4WFNQ 2BKNA 1S1TB 1XNQF 3A02A 3PUQA 4QWBA 1A04A 5FDLA 1MMNA 2CW7A 5DGAA 4TV8E 2C2NA 2WBMA 2E1NA 4B3XA 1V6HA 5LFAA 4YSXA 3NRXA 3DFEA 4B17A 2ATCB 1FYMA 5IWAF 3L1PA 5HOOA 3QAEA 4QH4A 4WYLA 2X3DA 2Y1LB 3M8QB 5HAXA 4Q8EA 2WWYA 4YQWA 1PG5B 4U88A 2QN6B 2YWEA 4E0DA 3A5XA 1BJAA 2NNYA 5J4YA 4EJTA 1GX6A 5JDQA 3PYGA 2CZ9A 4V19J 3FJ2A 4Q2MA 4RU2A 4PJJA 4MBQA 4IYQA 3W9HA 3GMGA 4IL4A 1RTJB 4DL7A 4WK1A 1D9DA 3PJXA 2O3FA 3TMOA 3RZDJ 5CCLA 4FPIA 1XDPA 2K7KA 1IW7F 3K89A 3ET6A 3R7NB 4KX6A 1VQMI 7FD1A 3US5A 4XK4A 3I3LA 2D1CA 5CVRA 4CCJA 2GMLA 1IR2A 1FWLA 4H63H 3FB2A 2L9QA 3IWLA 2RRNA 2YU3A 3LW5C 1ICEB 4V2FA 1TVRA 1QDUB 2V1NA 4F0KA 5D78A 2LF7A 2XWYA 3VVUA 2OTLI 5KFAA 5A0YB 4NLRA 5MLCV 2LM2A 4IIJE 4LBPA 1P7IA 2DQRA 4LSLB 4LOCA 2R5YA 2E36A 2PE8A 2G2OA 3BQLA 3D6MB 1VJWA 3H3UA 3ECHA 3DLGB 2L5QA 2C5IT 1GV2A 1DP3A 4NXMF 4YMEA 4O3SA 4RLEA 2KLOA 3LP1B 4ALZA 4DPTA 1M5VC 4ED4A 1U78A 3J7Z5 1RNLA 4DZDA 2WS3A 2TCTA 4QWNB 4RNOA 2YKAA 3L3CA 4FTHA 2ZDPA 2PD1A 5B3SH 4CN6A 4HSTA 3CO0P 1MIWA 2HHHF 4BXFA 3AEDA 4K50A 1TKZA 2DO7A 1CJTB 1ZPVA 1TQPA 2M7AA 4ZP9A 2D45A 3SI8A 4Q0BA 4OYIA 4E7IA 2HYIB 2FBIA 1KK7A 1N88A 4C8LA 4B1RA 4NYPA 1M7KA 4MK8A 5HROB 3HD1A 4X65F 4PUOB 2XAUA 1XR7A 4A3KJ 1FPQA 2LY2A 4R8UA 3ZYLA 4MNUA 4OLOA 1ZGWA 2CJKA 2JA5J 4DYCA 3UT5E 2FGCA 1SKWA 1EX8A 2CQGA 3BG6A 5HXRA 2HVSA 3KZIC 1YRTA 1P1TA 3MAJA 3EUAA 2O6GE 2IVFB 3KUHA 4JYAT 4LFCF 2RU9A 2PN6A 4CLUA 2RC4A 3Q83A 1A0OB 1WQ2A 4OX9T 4WPAA 5LMUT 2HS3A 3MOZA 1HNVA 5D3GA 2H1YA 4ZVSB 5LOQA 2ZBPA 3H25A 3BJYA 2H1LA 1FEWA 1S0VA 1KTQA 1W0BA 3GILA 4LF8T 1TELA 4ED7A 3RW7A 3BQIA 3C14A 1YVFA 2EK5A 4DL2A 1W7PA 3I9V2 4DX5A 2IBDA 4J19A 3C50A 3CTAA 1MNMC 2VWAA 1IBKT 4JI5F 5J1EA 2ZJRQ 2NW9A 4XLPF 2E1PA 2MJNA 1KBRA 5CYQA 4RUCA 2F4MB 1CS4A 2CS3A 2UUCF 1GAOA 2GXBA 2A6EF 2FMLA 1OYWA 1WC4A 2V9PA 3AAFA 2H3RA 5CFBA 2GIFA 4YSZA 3IP4B 2ZKTA 5C2TA 1U26A 2WZHA 2V9WA 2RE1A 2X0LB 3A7MA 2BEFA 3DRPA 3UCZP 2LD5A 4F36A 4KR0B 4UOCA 3F23A 2QLBB 1ENHA 3JSPA 1F60B 2MKHA 2UXCF 4NYOA 8AT1B 2HWIA 1Z1ZA 1LK7A 3MEGA 4MFBA 1IG7A 3C66A 5AQQB 4BBYA 4OHFA 1YJNS 4B9MA 3ISND 2HKEA 1SFEA 2DJNA 1IAWA 1BXNA 1V5GA 2CGPA 4CGZA 4MTPA 4GRIA 1XMQF 2VOOA 4XRSA 4FX0A 2KKHA 3CP2A 3AEFA 3FUYA 2ZUGA 2JLEA 1FZPB 3RYLA 3VYSB 3K1PA 3DXBA 1U1NA 4DQIA 4WTYA 3OJUA 3QB5A 1R43A 4BAYA 1RWNB 4AWXB 1QHGA 1HPZB 4R5PA 5MAOA 2FJDA 2LOOA 2YDRA 2VFTA 4L0YB 3AOAA 1EH6A 3JXOA 3VGSA 2GVZB 2E5GA 3QU6A 4J9SA 2UZAA 3VR9A 3QMQA 1MDMB 5H9EK 4UV9A 4C2MJ 4B9UA 3HSRA 2HHWA 3PUVF 1W0TA 3HHNB 4M72A 5AIPA 4X2BA 4BDPA 2R8GA 4H4MB 4UUVA 3VYUB 3UNYA 5C7PA 4NLVA 1OMSA 4HEAA 1NPRA 1WUUA 2X1GA 4IX7A 2KG1A 1B7TA 2CG8A 2I1RA 4O44B 4RWXA 4HHHA 2OF7A 2MY8A 1S6QB 4PFPA 2VKJA 3HUGB 2CPYA 2H51B 3RCOA 3KG0A 3NCQA 4CO5A 1HKTA 2AEFA 1P9YA 1NG7A 4J9QA 3MDFA 2UXCT 4BLGA 1NB7A 1SD4A 3BGFA 1JQGA 3CD7A 2UU9J 5DDPC 2ZKZA 2OLWA 2QRXA 4ZCKA 2HYJA 1YX5A 4C98A 5A8KA 2RD5C 4F7ZA 3WBZA 1LFUP 1EJ9A 4UB8C 2W84A 2MKYA 5FLXZ 4WW0A 1H6KX 4EMSA 2XAQB 7AT1B 3T5HA 5FD1A 4P9FA 1VBYA 2E1OA 5JDGA 2DR8A 4QWEA 4BHPA 4QHOA 4I98B 2MQ8A 3E51A 2CDRB 2M9HA 3OYMA 1N33T 4NLWA 1CC8A 3CF5F 4OHWA 1F43A 1OCRH 3FXMA 4LSZB 3QIPB 4M3FA 2FJ1A 4UB6C 2YDQA 3A4CA 4BUPA 3HVAA 5E79C 2DH8A 1W0AA 4WF2A 2RNEA 4ZPDA 1NJZA 1NWMX 2C3YA 5D6FA 2HVRA 2YY3A 2XO6A 1R1TA 1RPWA 4PPDA 1ETKA 3PRDA 2K9LA 2R92J 3FBZA 1Y0HA 1N36F 2VK9A 2BXYA 3QIDA 4DV0F 3DLGA 4A8FA 4OMFG 4WFXA 1RKIA 1OXZA 5FXWA 1LW2A 1JI8A 2IYGA 5LMNF 3BJAA 1RU2A 2KT2A 2DA3A 1DU2A 1R23A 4O4HE 1T08B 3C4WA 5KHDA 1LEOA 2ZUAA 3BPDA 3BP8A 4U96A 1KOHA 2WBRA 1G3SA 4EMDA 3N97A 2CEAA 2HPLA 3K4BA 4EB6E 4A3CJ 2ETHA 2NVUB 1AKHA 2BW7A 3GTOJ 2FJWA 2QKMB 4Y0FA 5JDLA 4BL0B 3T19A 1BWVA 2DH9A 3I4MJ 1IKVB 4HDGA 1ZN2A 2R4GA 4BDYA 4DR3F 1SL1A 4EAHA 4DZPA 3N9PA 3HVTA 3PYEA 3ZTQA 2MD5A 3GFIA 4PXDA 2EWNA 2MEWA 5BR8T 3QBCA 2W57A 2M8EA 5F3ZA 1V54H 1TQMA 4ZDPA 3PQKA 1R89A 2E5JA 1WJ9A 4WK3A 3PW7A 3VOEA 3RKYA 4LITA 2RKIA 2R7ZJ 4Y52J 1RWKB 1J75A 1IKYB 5M3MJ 3UVJA 2HFNA 2CE7A 5F8HA 2HRUA 2KG0A 4QPXA 5CA1E 3K5NA 3ILJA 4CXYA 3GJTB 1G3TA 3EZ5A 1R5HA 2HVHA 4KV8B 2L54A 1U47A 3R1LA 1WOPA 1M5HA 2WU2A 2QA1A 3QOEA 1BR1A 1KLMB 3T8OA 5D3GB 1FP2A 1IDZA 2VXDA 2O8XA 1T95A 3NNCA 5E8IA 2HQAA 1WKLA 3HD2A 3CVKA 1Y1WJ 1UVJA 1B6AA 3U1KA 1S4EA 1WCMJ 2RNGA 5KG0A 3LGNA 1QNTA 1TL1B 2E2AA 2JC1A 3EVWA 1IAPA 3I9YA 3BK9A 2L9DA 2A69F 5CYQB 1PC5A 4OX9F 2GOMA 3C6UA 1NMEB 2DPIA 4I6AA 1IBLT 2EC2A 4JYAF 1FX7A 4Q5SF 2KL8A 2W2PP 2V8VA 1JB0C 1UA0A 3PYFA 3K6GA 3GN5A 1FTZA 3B5MA 3BQZA 1ZGAA 1RT4A 1YLXA 4QX8B 2HDDA 4F04B 3G86A 2GA2A 4F3QA 2ZBKA 3CX8B 1REPC 3VAFA 4TY8B 4KHPF 2MW8A 4K2JA 4KE5A 2JEIA 4ILCA 2MYSA 1PAEX 2V6CA 2V2QA 3HKWA 1X3ZB 2J0WA 4DR1J 2Y9ZA 5DJQC 1FXLA 2PJRA 2BJ9A 4MEXF 3M1CA 5CQEA 2BBYA 2V94A 1S9GA 2H89A 2VPLA 3J7ZT 4L9NA 4IKAA 2HAFA 2KFDA 5H9FK 2LKHA 2AKWB 4GIWA 1V5IB 3KDSE 2PX9A 4JI6J 3CCEI 1WFDA 2GVZA 2NR4A 5BPIA 1B9NA 3Q89A 4AD6A 4BE0A 1F36A 2VONA 2BJ1A 4IREA 3AL0C 1X4PA 1V3ZA 3AEEA 1DQUA 2IHR1 2XAJB 4X84A 1SKUB 4MFDA 4IE0A 5FXZA 3NBPB 3GJQB 4I02A 1QY7A 3RPUD 3MECA 2F1FA 2VKRA 5IM0A 5LB7B 4O44A 4I67A 2LREA 3CCSI 2ABYA 4G1QB 5AQNB 4XKCA 4TNVA 5T7LB 3HRUA 1S6QA 2DYSH 1D9AA 2GFFA 2DR9A 4LMZA 4YRVA 1RP5A 3OR1C 2QKLB 3P7IA 2EI5A 4Q43A 5EF6A 4UR9A 3Q8RB 2R3VA 3AL0B 5FY7A 5SUHA 2RNJA 4LF8F 4IH6A 3M3YJ 3NVOA 4OI0A 5KFOA 2ID3A 1XMBA 1X2NA 4NIQA 5LJ3Y 4I2PB 4HYEA 2NW7A 3AXKA 1JLCA 3P96A 1RT7B 2I8EA 1ON1A 2LTPA 2F3JA 2RU3A 4LB6B 4LFCJ 4GK0E 2Q9QC 2M5YA 3JRHA 1FOYA 3VSKA 5L4EA 3HDSA 2PMUA 5LOVE 1R3NA 4RW8B 2E8IA 3SSQA 4ZI2D 1O0PA 1KQ8A 3MHYA 1F0XA 4ECUA 2WONA 2I9SA 1DTTA 4ATNA 1SI9A 4ECYA 3E6BA 5KK1A 5L3EB 1VRTB 1OPCA 2PDAA 1A9NB 1I5ZA 4XN0A 2EG1A 4DVDA 2KZGA 1EV7A 1CJKA 1RIOH 4OFZA 5FKNA 3GP9A 1E0EA 2IBKA 2KYXA 3CMYA 3WU2C 3QNWB 4XPCA 4MQVA 3RGLA 1FOXA 4FBUA 4BQAA 2BJ7A 4N77A 1WPKA 1D1BA 2BRLA 2XF6A 5AIQA 1GTHA 2FJAA 4ZMMA 3G6VA 2IJFA 5FLMJ 2LSGA 4Y15A 2M0MA 1VQYA 4AIKA 1D0ZA 3HK2A 5F8PA 1J5EJ 3FK7A 3PNVA 2K4JA 2ZVIA 2JK3A 2NOXA 1ZRDA 2DO4A 2MQQA 3FEYB 4D5CA 2G1DA 2V2ZA 2ZBIA 1SUQB 3T5JA 2DT7B 2E9ZA 5DS7A 5CYMB 1N8RT 3LAMA 3SXYA 1S1XA 4RUBA 2P0WA 4USWA 1S9EA 5KFWA 3HL6A 1BQXA 1X31C 3OR2B 3C8YA 2AHQA 4DU7A 3CW2C 1ZETA 2HQGA 2HHTA 2WCXA 3IFEA 2HHSA 2IBOA 4EZ4A 1SQEA 3BKTA 1A7GE 4DV2F 4RGRA 2LSIA 1LEBA 1O3RA 2RKIB 2IMLA 3TYTA 2M0CA 1W5TA 4DV5F 4HG2A 3FBNB 1YHQI 3UVJB 5TRDA 5K8NA 3M07A 1H0MA 3PW4A 1RT5A 4ETZA 1UEVA 3JTNA 3KJFB 4JBWF 2V34A 1ZG1A 3L9ZA 4UW2A 3JRGA 2KWHA 3C3WA 3KHGA 2R0QC 2YQ3A 3D28A 4MIMA 4XOPA 4AQFA 1HWUA 3PO5A 3CCQI 5E1XA 4D5FA 5G0RB 3CD5A 4AL5A 5LHIB 1VQ8S 2PJQA 4I0UA 5EEGA 4U0WA 2KIMA 4O3RA 3SYTA 1I1SA 1B4AA 3CO6C 2UXBF 3CNQP 4NLGA 2H65B 3O44A 2EVZA 1O51A 1X4DA 3K17A 4JI5J 5HODA 3PUZF 4ENNA 2X68A 2JVOA 5KT4A 4ZJQA 4HX7A 1VZ0A 4PK6A 4GVBB 4MKBA 1HNXF 1HW9A 5DD8A 4P09A 3AOCA 3MD2A 2NW8A 4D3HA 2BACA 5F64A 3N4MA 3QNUA 4IQMA 2RUSA 3KLFA 4DSIA 1UEKA 3Q23A 1IQZA 2LP4A 2DYAA 3KTQA 2P9CA 3KOAA 3CJQB 3X1DA 4KHZF 1HSJA 3RQWA 4ECXA 5M5WJ 4B3AA 4FF1A 1D1CA 3BF4A 3S15J 2DNMA 4H4KA 2RAEA 3F0CA 2CQCA 4TU9A 5DLFA 2X9WA 4U87A 3P4SA 3B6AA 1P27B 4JB8B 1HKQA 1CF7B 4F8HA 3U7JA 1RCXB 5D8LB 3FWEA 1UZCA 3ZC4A 2GGPB 1XNRT 2GLOA 2CV0A 3V6DB 5CHCB 3ZN0B 3HFZB 2M6BA 3O1LA 4DV7T 3K7RA 5C42A 1HCRA 3S17J 2WHOA 1PYTA 2FY8A 1C4AA 2OU2A 1WEYA 1I1GA 3EGZA 4M3EA 1MG7A 3KNGA 4XLHA 2KXFA 2CJBA 2MZJA 1O5JA 1J5WA 3FC9A 3MGJA 4K0UA 2WC2A 3FXDB 3D2WA 4NZ7A 3B8HA 2VJJA 4UQTA 3GFHA 5AQRB 4FXWA 3PO3J 2DPJA 5HXEA 5IP6A 2HNZB 3UDLA 2BMBA 2KM8B 3DLLQ 1W25A 2IYIA 4PFOA 1WH7A 5LSLA 2KRRA 5J1PA 4YP3A 5ICGA 3SFGA 3R61A 1Q8IA 1T02A 2P6TA 3RIUC 2XAJA 3QUJA 5E1WA 1VCSA 1P8GA 2WZIA 3VZIA 3RQUA 4FNIA 5E5NA 4OZ0A 3PUFA 3MECB 2JA6J 1TZLA 4IO9Q 4IHJE 2IGOA 1FEHA 2CPIA 4B3TT 4RZRA 2MHNA 4G1QA 2DK8A 3CDEA 1LW0A 1U8WA 3FCVA 4PXBA 5KFHA 1R36A 3PDNA 3S1TA 3I4NJ 1OEDB 4J9NA 3N9LA 2CPZA 2HHPA 4QWAA 4G63A 4P9SA 4IOBA 2VPXB 2J1DG 2QLZA 4ASKA 4W97A 2PQ8A 5C3EJ 1TKZB 2QBYA 2V1XA 4L75A 2IA1A 2QGSA 1FJGF 4Q0BB 3H2LA 2TDXA 5HLGA 2LEBA 2HVEA 4U7IA 5J1UA 2GMJA 2LSOA 4B43A 4KSEB 3HA4A 1Y6IA 1ZHFA 2C3MA 4K4VA 1WJDA 4BYYA 3GJRB 3ISNC 3EVMA 4X20E 3K70C 1YJWI 1G73A 4ERDA 4CLZA 2XEXA 2MJUA 5BJRA 2XZWA 2BR0A 5GAGU 5HEHA 4HLXA 1XN7A 5ICEA 2M87A 2B0GA 1TQIA 4DSLA 1WDDA 2CVIA 3AFGA 2OKQA 5KCMA 3AE5A 3VCDA 3GCWP 4YB6A 5CA0E 3IHUA 3CDUA 1HX8A 1OCPA 1ZR2A 3PE0A 2DCUB 3K1NA 3GLJA 2XQ8A 3EUKL 4OIOF 4IHTA 3H9GA 1A36A 3NGUA 3R6GB 1YJ9S 2WDVA 4C90A 4JQFA 1GT8A 5EJCA 2AYEA 4K4WA 3N5LA 3ANWB 4X62T 2RRBA 5IT9Z 2R7QA 1QBJA 3TARA 3F8NA 4QJVA 5E8GA 2NSBA 4ABZA 3MMBA 2YN6A 1RAHB 3Q2SC 1UUSA 2MB0B 3HSEA 1MBGA 1CS4B 2CJ9A 1MNEA 1RKTA 3EICA 2HK3A 2ZMAA 4EEDA 4DFKA 1BMQB 2E5HA 4F91B 2XGXA 1MH3A 3FKBA 3ZLIA 3LK2B 3NEUA 2G7HA 2FGOA 4YUDA 1WG4A 2LYVA 4DR6J 2GQ2A 2HBZB 1HNXT 2HGNA 3D66A 1WYBA 5KDMC 2CQ1A 4QR1A 1ZZNA 3UU5A 3M2UA 3GFLA 3OTOJ 3CQGB 1XPXA 2OEKA 2DHSA 3WIVA 3L2WA 1WWHA 5A2QY 4KT6A 2SPCA 2AU0A 3BLYA 3L2VA 3DTEA 2PFFB 3PNYA 2QX0A 1RTZA 3GTGJ 4WNKA 3F8FA 3HHDA 4Y2MA 2JC0A 4ZYHA 1E3OC 2HQFA 3GIRA 4HVZA 1U8BA 3ONJA 2NTXA 3RKGA 1BQMA 5GMDA 3S8PA 4YR2A 1OJLA 2ACXA 5LHIA 2NTYA 1TMJA 3CCTA 3CWZB 3CJ8A 5FXVA 5DYMA 3UU4A 3FMQA 5FROA 4DNDA 1X4FA 3N2OA 2X6YA 3JB9k 1Z0PA 4DUYF 2HEKA 1RT6B 4M1PA 1SAXA 3LSVA 2ELJA 3LGMA 4ED6A 1MDMA 3DPLC 2X0HA 2K4BA 4L3KA 3HKZD 1TBXA 4NEZA 5EG0A 1S72I 3W2VB 4DR6T 4M8LA 2Y48B 4KBIA 1YKHB 4GDFA 3GFYA 3WHCA 1HNXJ 3NNHA 2KRFA 4R8HA 1YW7A 1XN9A 4LG3A 2M8GX 2XS2A 4EOZB 1CGPA 2FMYA 2FB0A 2A5YB 2WAQD 2FNPA 1XR5A 2KISA 2FBHA 1RHMB 2DHRA 2W0GA 1VNDA 1HKAA 4OZ3A 2HS5A 3SSSA 2MGZA 1CF7A 4CO8A 5E3CA 3ZO7A 2QFIA 1Z7UA 2B9EA 4FE7A 3V6DA 1YRNB 1R9TJ 2HDWA 4Y3CA 5F0CA 2QLXA 2NRAC 2W25A 2CADA 3T41A 2FVRA 2LDUA 4NLUA 5DEQA 4PGHA 1MWYA 3M4OJ 2PA3A 1RYRA 4NCAA 3ETMA 4LMKA 3C16B 2B7BB 2BGCA 2LG4A 5B1AH 3HR0A 2KRCA 4DR5F 3DOKB 4YLHA 5HEJA 3DDIA 4LLGF 1P92A 3AVSA 5D5XB 1ZA1B 2EC0A 1S6UA 2HSEB 2Z57B 1FX2A 3BTLA 2ATLA 4CM2A 1FJEB 4UXNB 5HLIA 1JLBA 4HFDA 4DQPA 5CVJA 3SFEA 1VGYA 2MLXA 2DNKA 3EWGA 1RACB 3LA2A 1I94F 2HQRA 2LMIA 1SAUA 3N79A 2PLYA 2F65A 4CH7A 2I5JA 4R1HA 3B4MA 2LYCA 4P74A 4YN3B 3PY8A 2BZBA 5ILVA 1TP7A 7FDRA 3E97A 2FHMA 1WI3A 3ZZPA 3SRZA 5KOWA 1D8JA 2NLWA 3RBZA 2K5CA 4JI2F 3JTGA 2AX1A 4ID5B 1AT1B 2BRKA 4TNOA 2B51A 4GOUA 4OHVA 1FJGT 1IN8A 2VQCA 5K5MA 5DV5A 3AE1A 3WODF 4ZVEA 3CMAI 5FLXU 1EZZB 1U2CA 2HFZA 1QTNB 2W8LA 4J9VA 1GTEA 2V6YA 3NWTA 3FZKB 3R60A 4YR0A 4I99C 3BPXA 1GXLA 4WE1A 4BWJA 1S77D 4JI0T 2XV4S 2WB1A 1HPZA 4R5PB 4NXMT 3CWJA 1S59A 4YTMA 2E5IA 3QPLA 4OIPF 3RB4A 1T11A 2G9OA 4CT8A 2Z4PA 3C2PA 4GFBA 2YK0A 2OC6A 4I4BA 4EM0B 5EWEA 5L8RC 3IO1A 1T7PA 3RBXA 1VQOS 2IDOB 1NJWA 2E1RA 3MKDA 3DMJA 5AXLA 2KNDA 2LCWA 1KDNA 2QV6A 2X67A 5JLXA 3SCJE 2JMKA 3R5CA 2QTWA 1WRJA 2CRGA 5KNLA 3K4JA 2VUGA 2DK2A 1T8EA 1RTHA 3AG3H 4DUYT 3FM5A 4A12A 2HOTA 3FSYA 3WTUC 3ELKA 2DDBA 2JL9A 1A5JA 4G6VB 1X5OA 5LG3A 2BJEA 2B7CB 3P4RA 4TZ4C 2ZOMA 3HUGA 5FLXK 4P73A 3M6VA 3VHLA 2ZOFA 5ETOA 2IRUA 3DC2A 4MH8A 1X1DA 3LQVA 1KSPA 3Q22A 4CZCA 2VE9A 5KFKA 2W2UA 4PAGA 2M3DA 2BQ3A 4GO7X 1DPRA 1GXUA 1RTIA 3ANWA 2LVSA 1ULYA 3OKQA 1AU7A 3E1SA 4BEHB 1XDSA 2B4VA 1Z2LA 2JQ9A 2QEXS 3ZZYA 4M95A 4L9TA 4XMYA 4LF6T 2RUGA 4U6PA 2B43A 4A8WA 2GAHC 1R5ID 1U4BA 3BDPA 1FKPB 2J5AA 3BSNA 2DHXA 4ZP6A 2QM3A 3MR5A 2E7XA 4X0GA 2WB5A 3NY0A 2KIFA 2KFYA 4A4JA 3RC8A 1X1BA 2KKOA 5K9FA 4HEA9 3TR5A 1HA8A 3GN5B 4DV6T 2R7OA 4A97A 3AY0A 3FDSA 3T0YA 1F9HA 4NUVA 3NWGA 2X66A 3GTPJ 1UL3A 2DGUA 3GCMA 3PVXA 2ZCWA 3MUTP 3M2UB 2FBKA 3OOPA 4X1KE 1OY6A 1SD5A 3K4KA 3AG4H 3G2XA 4EGWA 1SMTA 4DDFA 5EYRA 2CWXA 2XSJA 2DRBA 3ZMTB 1DGRM 3I5CA 1JJ2R 1UMJA 1LFWA 2JQ7A 2ELKA 3ESWB 2XDVA 3KZZA 3AT1B 2RB7A 5HMXA 3O9XA 1T0TV 4KAIA 1AKHB 3C15B 3OFHA 2CUFA 2LA6A 2E35A 2IS6A 5DM6F 4A5NA 2KJBA 2JIWA 2IFXA 1P4AA 1MBJA 2N8GA 1XIQA 3VEPA 4F26A 4KKOA 1HMVA 3HOSA 1PSDA 4A0XA 3MPWA 3DXJF 4CTAB 3NG8A 4LR9A 3ZNUA 6FD1A 5DG8A 2Z2ZA 5EG0B 1M62A 3FBCA 3W2VA 2W2MP 3W2WA 2LOPA 1TK5A 1N77A 3O6BB 2Y48A 5DQWA 2QO3A 3PIPQ 4BU2A 1WR0A 1SBRA 3BR1A 3PW5A 5LNKA 1VQKI 4ZPCA 3HJEA 1UJ6A 4UF0B 3CVRA 1KQGB 1SVDA 2FD2A 2ZXJA 3H0DA 3C51A 1PCAA 1IKYA 4ZPAA 4BS9A 1TV6A 2BANA 1LWFB 2XQ4A 1NK5A 1BC6A 4ZC3A 2CSOA 3O8WA 4KV8A 1IRXA 2Q1ZB 2UUTA 1GH8A 5EK3A 4NLOA 4ZVHA 1R0AB 1Y8QB 4MAKA 4URGA 2P9GA 2F5DA 1RUNA 1FOWA 1YJ9I 3H5UA 3GXOA 2XZTB 4I2PA 3CXCR 4DL5A 3S3NA 4LQ9A 2R93J 4LFAF 4AIUA 2DDAA 2Y9YA 3C16A 3A3PB 3D3BJ 1XGOA 2DHHA 4IQJA 3RKWA 2R8JA 3HC7A 4DR3T 3ZQIA 4USHA 2EBEA 4O4RA 2DNOA 3BN7A 4WP8A 1J2VA 4JV5F 4I0BA 2R7FA 2AS5F 4WZQA 1LKXA 1U5TB 3WDOA 2EV0A 1XK8A 2WONB 1DQ9A 1JLBB 1X4CA 4TQSA 1H9GA 3FXRA 1QLBA 4P10A 1FBQA 2O8KA 1N5QA 1KR4A 3BO4A 1UFMA 3C4XA 2EZIA 1Z6RA 3Q24A 1ZAVA 1IJEB 5D8KB 4ISTA 2E5LT 3QYFA 1IR1A 4QIGA 3MCOA 4I64A 2IC6A 2LC2A 4FVCA 3HJFA 3D1NI 3GONA 2W2OP 5F0WA 4GC7A 2G0CA 1NDCA 1R8CA 1WOSA 3J7AN 2Q3PA 2CH0A 1NZ8A 2RAQA 1FXRA 2BEOA 4TN2A 1F2GA 4X1YE 1JTYA 2A1BA 3HKCE 3P45B 3CIRA 2YX4A 3ZP5A 5D0HA 3H3MA 3MF5A 2WAUA 3RPUA 4CO4A 3ZFVA 4N47A 2OSRA 3GE9A 5EDNA 1APSA 4LFAJ 5J2MB 5ETQA 2DBBA 5DDQC 1T38A 1Q7LB 3ASOH 3RAXA 3FXKA 1RETA 2ESNA 3QFHA 1KQ9A 2UUAT 4WE1B 1BR0A 1T3OA 3IRXA 2FVPA 1RBLA 4E6KG 2OAUA 2RVCA 2ODUA 4JV2A 1S1XB 5DQVA 4WFBQ 3P9IA 3RW6A 1TVRB 3CJSA 2JRKA 1SIZA 2HZDA 1H8AC 2BABA 3RC3A 1HBMB 2W66A 3DMJB 3CDHA 3LPEA 2DH7A 3NBPA 4UY8I 2HZTA 3HPGA 2YX7A 1PO6A 2B56A 1OR7A 4KC5A 2KWIB 4BCAA 1HW8A 3BCAA 4LK1F 3G8SA 1VMBA 1Y11A 1S7HA 1XTAA 4RGUA 3ML6A 2N82B 1OYDA 1TKTB 4OZ2A 2O5DA 4I4TE 2DFEA 3ZNJ1 4LSNA 4ZI7E 3TWZA 5AXKA 1NK9A 3ZZRA 2XKOA 5KG3A 5M4YA 4OYXA 1N56A 4DS5A 2XYPB 1IXRC 2XZEA 2DKOB 4M3BA 4ZS2A 2VF3A 1GMWA 5E18F 1IR0A 4XDCA 1CJTA 1CULA 3V6JA 3U9GA 2C3UA 2DXDA 2CUZA 3P5JA