2BKPA

Structure analysis of unknown function protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hypothetical protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
total genus 74
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkpA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkpA02
2OGUA 2BKNA 4L73A 1T8BA 2AEJA 1T72A 3RBZA 2BKPA 4L76A 1VCTA 4L75A 1XWMA 1SUMB 4J7CA 4GVLA 4XTTA 2AEFA 4J91A 1LNQA 3L39A 4J90A 2AEMA 2OLTA 2I0MA 4Q25A 4L74A 4J9VA 4J9UE 3RBXA 4EI2A 3L4BC 4G65A 4RO0A 2FY8A 2IIUA 2BKOA 3KXDA 3JXOA 4YS2A
chains in the Genus database with same CATH superfamily
3MWBA 3ZZOA 1NJWA 2IM0A 4PNIA 1HNXF 3NGRA 1DQAA 4G6VB 2GIFA 2NWBA 4F36A 1QSSA 2PC6A 4RU2A 2O1PA 5HK4A 3B5MA 2AYBA 4C0BA 4IO1A 4PFOA 4UV8B 5EGYA 5A0YA 1WELA 3H5UA 5D4OA 3J81U 3P45B 1OYDA 4YJ2E 3W2VB 1VQ8S 3WZ0A 3J80Y 2UVRA 4ZPTR 1J5OA 1VI7A 5IWAT 4A8WA 4ANJA 2QEXS 2C0SA 3MPDA 3CIZA 4H4OB 3MK7C 5A6WA 1WFDA 4WTYA 4MK9A 1QDUB 2JJ9A 2FJBA 1IKXB 1IQTA 2UUCJ 5LHIB 5C8YE 1LV5A 2XY7A 4L0RA 3ETMA 2NUHA 4X4OA 1GFWB 2V2QA 1HQEA 3H0PA 2YNGA 2W9BA 5CYQB 2RHSB 1Q8IA 4IO9Q 5IQ6A 2WOMB 4HACB 4UVBB 2GK9A 3ESLA 3D7SB 4GKKT 3RJMB 3B6BA 1S9GB 4DWIA 3CC2S 1WRDA 2NS1B 4GOUA 3LP0A 2BKOA 1QUUA 4KI0F 1UVIA 2DGSA 3FQLA 1I5OB 1SJFA 1D0EA 5FDLB 2VK9A 4LQ3A 2UUAT 2E1AA 3HHEA 3W7BA 4GC7A 4L74A 5AQFB 4ZPDA 4IHJE 7FD1A 5LGUB 3ONQA 4IG3B 2KT3A 1GMVA 1ZZNA 3G4SS 3U27A 5LBQB 4JI0T 3HHLA 1RAIB 4G2AA 2KSRA 2BJ9A 3IR5B 2IRYA 5J2PB 2KYXA 2NTXA 2VG7B 4LSNB 2LE8A 1JNZA 2B51A 2ZC4A 3AD8C 4Z8XA 2AV5A 1YJRA 4HFHA 3VALA 1P27B 1RDRA 2A2DA 2KN4A 3JAFA 3VHLA 4NLQA 3D3CJ 4XPEA 2X1FA 4ZJOA 2I6WA 2ZHOA 4PEOA 2GVDB 4NRTA 1J5EF 1R0BG 2ATLA 3PUAA 4BWJA 2G0IA 5CA5A 4DJBA 3OR1A 1HTJF 3FHNA 1YZ7A 2DD8S 4JV5J 1SH2A 1HNXT 4PPZA 2DXFA 3VAGA 1UFLA 3MTKA 1LWFA 5KFBA 3KLHA 1KRPA 2IC3A 3I56S 1IQZA 1HW8A 1ZAXA 3TUPA 3PACA 4ZDNA 4L5GA 3NNHA 3P4PA 4HVZA 3MKDA 3OLAA 4QXCB 3CX7B 2YWWA 5LNKA 3B54A 3WIVA 1AB8A 2K3IA 1NNDA 4C11B 2V4JA 3SDEA 4DUZF 4U7UD 1S6OA 1HYSB 5HXSA 2A18A 2DR7A 1VCTA 1W25A 1TKTA 5GAHI 3VAMA 1E1HB 4X4QA 2XLJA 3DOKA 3HULA 1OY8A 3MURP 3LF0A 5F41A 1C4AA 5HEUA 3UUXB 3UNGC 1CQMA 4WFYA 1RHKB 1Q0NA 3AA0B 2K7JA 4F2RA 3LGNA 1O51A 3MCMA 3AE4A 4LF4J 2BQRA 5RUBA 3WQPA 4RUCA 3BGLA 4KO0B 3CJRA 3W8PA 4ED5A 4ER8A 3TANA 2BABA 4FPIA 3O1IA 2R2UA 3CULA 2J9EA 4PYAA 3K3NA 3QK6A 4NLWA 2FJEB 4AL6A 4K7QA 5IYZE 1WG4A 4R0JA 3I0SB 2OTLS 3Q0AA 4YB6A 1Y3JA 3T1HJ 1JJHA 3Q23A 1V5VA 5A2QY 2C5JA 1U5PA 4NYZA 4F02A 4DQSA 5FNVE 3MXZA 3TZWA 1M5KC 5GAHU 2XASB 3LBXA 1F9EB 1VJQA 3P8CD 4YTMA 3PW2A 1B7FA 1HBUA 2ROGA 5DG9A 1JLCA 1TUGB 3BR9A 2EBEA 5HWYA 1YBUA 5FL0A 1QJHA 5ITHA 3BO3A 2HQIA 4B17A 3GLJA 2A2FX 2BE2A 3C51A 3CD7A 3IBWA 1FD8A 3MM5A 5MAOA 2FHJD 1NK0A 3TLUA 3NLCA 3NRYA 3AOCA 1TL4A 4B9UA 1FI4A 1NPKA 1QSYA 3CTRA 3V4IB 2X9XA 4JV0A 3GJQB 5D6GA 1HL6A 4O44A 3JC6D 2ZLYA 4BJNA 3QO9B 3K7RA 2E1MC 1N36F 3MFIA 1RXOB 1NRKA 2AYEA 3SBMA 1T72A 4K4UA 1RCXB 2QGFB 4NLSA 3T3FA 1HF8A 2QT7A 5CYMA 1PBAA 3GU0A 1I94F 4OX6A 2DEIA 1LVFA 1IVZA 3QT7A 3BBFA 2RIJA 1O0PA 3TUIC 3PX4A 3KG0A 4NCGB 1WHYA 2B4OA 3HVTA 3JTPA 4CLLA 2WDRA 1FX4A 5B0EA 4B3MJ 3QGHA 3IGVA 4YT0A 3NEKA 2ALYB 2YY3A 2CEAA 1SC4B 1S7HA 2MKJA 2BR0A 2OEJA 1C1CB 2EFVA 4IREA 1F2HA 2IHR1 3JTNA 1BLUA 2CBIA 2P6TA 3EVWA 1RT7A 4KSEB 2VD3A 4HH1A 1BD6A 5AXMA 4WTOB 4MKVA 2OTJS 1DRZA 4LSLA 3OJUA 3AECA 1FKOA 1HPZB 2KHCA 1J5WA 2HBRB 2GX8A 4I4TE 3HSZA 3MM8B 4OYWA 4HEA9 1VQOS 4DV5J 2W63A 2G1HA 3Q8YA 4PFPA 4IRCA 2X51A 1VBZA 4EIWA 4DUYT 2PD1A 2VJUA 2FVQA 2XTJP 3LP2B 1TL7B 5CB4E 3RAMA 2D69A 3GG1A 2WCAA 2ZM8A 1S1UB 4QJVA 4A48A 4USIA 1HI1A 5LCYA 3D9BA 2CRLA 1SI9A 1RT5A 1IZNB 2LSYA 5HANA 2YDQA 2QSWA 3ZT7A 1RHUB 2UUCF 3EJMA 2GAHC 3SCLE 3IP0A 5AJ3J 3BSOA 1NENA 3PHEA 4DV0F 3DLKA 1TFYA 4IFVA 2V6YB 3E51A 2CQIA 5KXJA 3CCQS 5LGNB 1JLQA 2CNNB 2D74B 1QAXA 2NXEA 4WP3A 3WX8A 3MEKA 3HDSA 2OO4A 1PIEA 1M90T 2DH8A 3M2RA 5HAOA 1SH3A 2M67A 3E01A 1VRUA 2JC0A 5T41A 4ZVQB 3OYXA 1IKWB 4J7CA 4P73A 4HTEA 1Y5NB 5CZVA 2LEPA 5HROB 3TLSA 5DDPC 1N36T 5HJXA 3MF5A 3GCWP 1ICEB 1T9VA 4FDFA 4KBIA 4TY9A 1I6JA 3IA0A 3JB9k 1REVB 3C6UB 1X4HA 1U45A 3IRWP 3GYNA 4DLEA 4EEBA 3AD9C 4Z91A 2V50A 3HHDA 2JFDA 2Q6CA 4UVAB 4DDFA 4IRKA 2D9PA 4ZS6A 1IKYA 5ETLA 1MIVA 4EEDA 2IJFA 4O3QA 3TI0A 1U47A 1FTCA 3EVYA 3TEHB 4YSXA 4RUAA 3MMCA 1P9QC 1YBAA 1SJ1A 1YQ4A 4FPRA 3NXZA 2PI4A 4YEAA 4B3TT 4DVDA 2BM0A 4KKOA 3OTDA 1RBOB 3TWZA 2VPYB 5L1JA 5TAOA 3UU5A 2DKOB 4C8MA 3SSRA 1JLAA 1VK3A 4JV5F 3AEBA 1GQEA 2BJ8A 5KFJA 2X3DA 2C2NA 4DPYA 2VOOA 2J62A 3EWGA 4PXEA 1U0HB 4CQ1A 4P74A 2HFVA 1APSA 3M1VA 4DPOA 3GFHA 1S0NA 4I6WA 2VC0A 3DU5A 1NO8A 2MPUA 1NBEB 3ZZTA 1PYOB 3FMWA 4CCHA 4ZI2D 5L9NA 2CQHA 3M7VA 4ANEA 3TVZA 2FJDA 2IW5B 4USHA 1H2VZ 3ZNUA 3H40A 4EZHA 3O9XA 5ETTA 2CAJA 4NZ0A 3ZT5A 1U09A 4XAKA 2Y0BB 5JDFA 4JI7T 4NLXA 1R8AA 2JH3A 3J81j 2ZH3A 1FJCA 5KOXA 5E3RA 2GHWA 3FDSA 3OTCA 3P4WA 3PKYA 2HVIA 4LF4F 1UPPA 4USVA 2HIQA 1VQ7S 4DV0T 4A47A 1FFSB 4WE1A 4U74A 2ZBIA 1WNEA 2BVZA 3OR2B 4KH0B 4C8ZA 2A3DA 1HQUB 1Q8LA 1KOOA 2DRBA 3DRPA 4IYQA 2QA1A 3DNCA 1LRZA 1N5YB 4WJBA 1WR0A 2QE5A 2IAJB 4ZZBA 3KG4A 3OFFA 3PVXA 1XNRF 2RDIA 3VRBA 4URSA 4OL8A 1B4SA 2M6IA 4Y6IA 3ZT6A 3T1HF 3AEDA 2WW4A 3PW4A 4M5LA 2IBKA 2E9XB 2IY5B 2OPRB 5K9FA 4Q2MA 4NLDA 3PU8A 1EHWA 1NK8A 2BA9A 3FZHB 2IFXA 2WZ1A 5KDMC 2CA5A 2M8DB 5LJ5Y 4LF5J 2CJBA 4TU8A 1FVSA 4X20E 4UOCA 3VR1A 4DL4A 4K4WA 4ZLNA 2XTLA 2GO9A 1HBOB 1P1LA 1A0OB 3GV8B 4JI4T 4HTJA 1UETA 3BK9A 3ZCJA 3H4BA 4ZP6A 3SFDA 3MPUB 3P5TL 2FHMA 4OZ1A 3C19A 2OGUA 2C28A 1LXJA 2IDLA 4O3NA 2HS3A 2J7UA 2DWGA 4F4YA 3TA2A 3L39A 3HKBE 1FTRA 4I2PB 2YWFA 4HL9A 2HFOA 2OHDA 4RPFA 3TUZC 5AQTB 5HXRA 3NZQA 1YW0A 4WP8A 4X62J 5DDQC 3SCIE 4QWCA 3TW0A 1ELOA 4I4BA 2MYFA 5FMNA 2Y8YA 1C0TB 3OTBA 5K5MA 1U1PA 3KK1A 4RW9A 3L7PA 4DG1A 4RWWA 3GE9A 5HP1A 3GWCA 4FBTA 1BR0A 1LK7A 1FJGT 2GHPA 2VHGA 2I8EA 4RBTA 5EK2A 3DGPB 4OYXA 3MPWA 4DR2J 2HKEA 5F0UA 2E5LF 1CULB 2M8HA 3MMJA 1HI0P 4DPXA 1VOMA 1NPPA 2LCWA 5AQGB 3IXQA 1SC1B 1YDLA 4FYYB 5ETWA 4CI1B 1EP4A 2NYIA 4LFBJ 2FY1A 2KM8B 4Q25A 3ILJA 3SZ2A 1Z8UA 3SSQA 1S97A 3W2WB 2UVWA 5CCLA 2O67A 4LF4T 3C16A 5JDQA 4ED8A 3AEAA 1BQXA 1U6FA 4H63H 4EFAC 2I5JB 1YRTA 2V7KA 3OVSA 3FVYA 3LK42 4UUXA 2VJVA 4CO5A 5KFPA 1OQ3A 4DV5F 5LOVE 1K44A 1TKXB 1BMQB 3ONXA 4B9NA 3NGDA 3G8TA 1XNRT 4WYLA 1R8BA 3MEEA 2GHVC 5D8HB 2CQPA 2ZDPA 3P49B 3QPIA 1WF1A 1RTHB 1G1XA 4FS2A 2DNGA 2MLZA 3BQIA 1M1KT 2KB2A 2G0JA 1S1VA 4XBFB 4OJGA 3G96A 1ZV4X 1KLMB 4WIIA 1P8GA 2DNYA 4PWDB 3R6LB 2CQ1A 1S48A 2MY7A 4DX5A 2VOPA 1Y5IB 4QR0A 1U7LA 3VR8A 4UF0A 2NXNA 5AJ3F 1NJXA 3GMGA 1ZHCA 2A2CA 1XMQJ 1RWXB 4MKBA 3N6MA 1R31A 4DCOB 4EZ4A 1TKDA 4CH1A 3JS9A 2G2YA 3FJ2A 4OZNA 4MKAA 1AROP 2KT5A 1RB0A 2LEHA 1WEXA 3A8IA 1TUVA 4OYOA 4PXDA 1CEZA 1NJYA 3VAKA 1N33J 2C42A 4KHPF 4PG6A 3NGSA 3SFUA 4YR2A 4OYMA 1IBMT 4ZCIA 4Y2IA 4QIFA 2KLQA 2DNNA 2XI2A 3S01A 4DFKA 5IT9Y 1V3SA 1WHVA 2ZNZA 4ZP8A 2FVRA 4F7VA 2XQ3A 2IVMA 3T19A 3BN7A 2KZMA 4P2SA 3M6WA 2CNLB 3RB6A 1R0AB 1H7WA 3SV4A 1YZ6A 3P8BB 4J9LA 2HN2A 2V68A 2OPQB 3J7A1 1IJEB 4BA9A 5J2NA 2DO0A 1TFWA 4WKRA 1H7CA 2E5LT 2V9WA 4RBUA 4ZN1A 1BHNA 4X1YE 3RYFE 2K7KA 4ZPBA 3D68A 3PYDA 1D09B 3G9CA 6FDRA 2UXBF 3ZO7A 1JK9B 4CLTA 2ZH8A 3HI2A 5E5NA 4DF8A 2DYAA 1NH7A 1KKHA 2D3ZA 4ATNA 3EGNA 5IQQA 3CDBA 3G8SA 4ERDA 2XAJB 1UVKA 2ZH5A 3ZSSA 2E9RX 3OYZA 3UD3P 2O66A 2G0CA 2C2OB 1WG5A 5T7LA 5FXVA 2VVSA 3CXCR 5IT0A 3ANWB 4YTPA 1CUNA 2AJQA 3PDYA 1GAOA 2KH9A 3NNCA 2YVSA 2XM3A 4DV5T 4KFBB 1YKHB 3KJVA 1FK9B 4ZVTB 2C2MB 2QX0A 5KFNA 2W8KA 5C42A 4Y2CA 3KFWX 4DV3J 4YS2A 1YKEB 3K1SA 4DX6A 4O3SA 4X66T 2EFPA 3NG8A 4RW8A 1IUJA 4AXIA 3JYTA 2W4PA 4P7TA 1U1RA 2FGCA 2XYPB 5F0WA 3W1YC 4KUMB 4FXDA 5KFUA 3RYIE 4PJNA 3UUBA 3FXEB 5HATA 3I87A 5HCJA 1WC6A 4YTNA 1KD1T 2CKWA 1LOUA 4DR4J 4HR2A 2Q1LA 2XQ8A 3N4WA 3I82A 2NQPA 1H98A 5LMUJ 3MMAB 1BWEA 5JR9A 1NZ8A 3ZC0A 1ROFA 3LK3B 4DV4J 2PEBA 4Y0FA 2EWHA 2IMLA 4EO8A 3CJQA 2RT3A 2LEAA 3P4SA 2RKIB 2HIYA 2ZUGA 3C14A 2GGPA 5DJBA 2ZZNA 2YEVC 4QCLA 4NLGA 4B3OA 1NAFA 1UEUA 1U26A 2FZGB 4PJLA 2W2QP 3AE7A 1GMWA 1JXEA 1L3KA 3AXJB 3NWRA 4KHZF 3IG1B 3MCOA 1TR0A 1T3NA 4G63A 4KHPT 2OFHX 5KAKA 4F0MA 5E33A 2QLXA 5CQGA 2XMUA 1WEYA 4LF5F 2Z56B 4BHQA 2FVCA 4U8VA 2LSKA 4MMOA 4V19J 2EHOA 3BGFA 3AQPA 4JI2F 4ZI3D 4P0AA 1Q7YT 5HVGA 3DRRA 5U47A 3H25A 4DO0A 2C5IT 3C4ZA 1CBKA 2PMZD 2WSFC 2VKDA 1UFKA 2CWYA 3H90A 3G82A 5LB7B 2B8PA 1EETB 2Q9QD 4DL5A 1X7VA 2BEFA 3X1DA 3ZYMA 5KFOA 3OSNA 2UXBT 5D77A 2OPPB 2WHOA 5ETKA 1R43A 1G8XA 2WVCA 1KDNA 3AA9A 3I6PA 2XHCA 5AQRB 3EGZA 3DHXA 4X62F 3RRHA 3LAKA 5C2TA 1XR6A 2H7OA 1FDNA 4KH1B 1DARA 4UOFA 3W66A 4NMLA 1WCRA 4ID5B 2L3LA 2IVFB 2PDAA 3A3OB 4NEYA 4QWBA 1JLFA 2QA4G 2YWKA 2FYXA 2VH7A 1U2RA 2AIRB 3UVJA 1MLAA 4MFRA 4IE0A 3LWMA 3FBFA 1FIOA 4KPYA 1VRTB 2XPKA 4IH6A 4DR2F 4ED1A 2BVLA 1R3NA 3EZ5A 4C8KA 2F4VF 2MLXA 4ECZA 3M2UA 4DQQA 4JBWF 1Y11A 1OSDA 1E6VB 1CJTB 1JLGB 3BYPA 1RWOB 4O4JE 4PQUB 4FYXB 4LFBF 4DQPA 2CG4A 2C3UA 2M52A 3AE5A 4OHZA 2GFFA 4L6V3 4WK3A 5HWXA 1B0TA 1SV5A 1ZH5A 2Y1JA 3H5YA 5KFLA 2R7VA 3RW7A 4FYWB 2P9GA 2XMJA 3DOLB 2AEMA 2FJXA 1HWUA 4AL7A 2AU0A 4KX6A 2YKNB 1UCUA 3I4PA 3M8YA 5M2RA 3DXSX 2X66A 4AKGA 4WZXA 3LP1B 2HK3A 4HFBA 2RQCA 3PW0A 3MCSA 4QH4A 4P71A 3Q86A 1BY9A 2RRAA 3X3UA 2GNKA 3MAHA 4CRJA 1WSVA 1U8WA 2ZH9A 1YJTA 3C3LA 2XS2A 2X1BA 1TELA 3MM7A 5AQLB 3EHZA 1CPZA 2VF3A 3VHQA 2CWOA 3DMJB 2IMOA 4TVAB 3MAQA 4LF5T 2HHHJ 3FZ2A 5A1LA 4C97A 2V6XA 4DQIA 3MM9A 1XMOT 1EX8A 3NGUA 3ZTSA 1BGXT 1LQ9A 4JI2T 4P52A 3ZMZB 2B43A 2KWHA 2C5KT 2WB1D 4AQYJ 4Q5VA 4OMFG 4J9KA 4ECRA 2PT0A 2HBQB 4NWBA 2KXHA 4PAGA 2VKOA 1F3VA 5LJNA 3GP9A 3O5TB 1FT8A 2OLTA 3QGPA 5B0FA 3HA4A 3IF8B 2B5JA 1D8YA 3M30A 3QIDA 2ACYA 2EXUA 2F1FA 4TQSA 2RB7A 3RTVA 3KK3B 1V6HA 1NXIA 4JUZA 2U2FA 3GONA 1MNEA 2G2ZA 1N33F 3AFGA 1WOSA 4X62T 5D3GA 4GKJF 5KFFA 2LLYA 2HRUA 2X9WA 2XUEA 4NI2A 2YNFB 4MALA 3OXLA 1T03B 1O6XA 3FUYA 1WC1A 2LXFA 5L2LA 5HMZA 5EWEA 1NH8A 5ETPA 5HBMA 2YK0A 3TO8A 2DNZA 2RUSA 1W2BR 3LA0A 5A8KA 2O5DA 1DTTB 1BXNA 3ONLC 1RWMB 1ZM9A 4WYWA 3QNUA 4URQU 1BR1A 1TZ0A 4OLOA 5DM7Q 1IKVB 4O4GA 1M5VC 2F4VT 2XMWA 2L9DA 1VQLS 1VBYA 3E0ZA 2R8GA 5LGTB 3DU6A 3EICA 3CJ3A 3MI7X 3N9MA 2XHWA 4LFBT 2IC6A 3PYFA 4EEYA 4F50A 4TN7B 4A97A 1WR6A 1D1AA 2QN6B 2ACXA 1LW2B 3A7MA 1XK8A 3A4TA 4OHWA 1ZBTA 1WC3A 2AHOB 5HVFA 2JJ4D 3GV5B 4C3LA 4KE5A 2F8HA 4OHFA 3TYTA 3UU6A 1EZZB 2AWZA 4B3SF 1WDDA 4WXWA 4HHUA 5JMNA 3MDFA 4DV3F 2FJAB 3TX8A 5HCMA 1HMVB 5C7PA 1X0PA 4M63A 3ET6A 5C25B 2WS3A 5EHHA 4ES2A 2LQ5A 1SKRA 1YIJS 4YB1P 3I32A 4OZLA 2LRLA 2XQ9A 3VU7H 4I7FB 4DR4F 5L4EA 2G0UA 4ETXA 3FZLB 3R7NB 1H73A 1SKWA 3ZLIA 2IA0A 4DV4F 2HRTA 4LFAJ 1KS2A 4CTAB 2BM1A 5ABEA 3PJ9A 3BGRB 5KG1A 2CZ4A 4PWUA 4Q45A 2YOEA 3KHRA 3UD4P 1RSCA 5SZTA 4WBFA 5DS7A 2VFTA 9RUBA 3TAMB 1XNQT 2WY2A 2CPYA 4OX9F 1HD1A 3I96A 4B9MA 2HNZB 5E2QA 1S0VA 4RO0A 2J0SD 1OEDA 3AB4B 3BN4A 3FCHA 1GEHA 3PYGA 2HHPA 4RNMA 1G2EA 4YFSA 4PJMA 1WYCA 1I1GA 1N33T 1NDPA 2Y8WA 3I1AA 4GKJT 2X1GA 1U1LA 1HNWF 1RTIA 2JSXA 3PG9A 3L9ZA 4ZPWR 3C64A 1KWMA 3UFCX 4HWCA 1TL3A 2WSEC 2HNYB 3GIRA 5LHGB 5LXTE 1DQ9A 5I3UB 1WYBA 3RYHE 3QRRA 4U2ZA 2X0LB 4C98A 1TL1A 1YSJA 3KBTA 2RVJA 2E9XC 2K1RB 4DU8A 4M5DB 1VC0A 1WF0A 1YX2A 4EYHB 2DPIA 3MACA 2R6GF 3TJ9A 4AL5A 3O8WA 4C7QA 4WK1A 2VBXA 5IZHA 1U02A 3PURA 3MEGB 2W4XA 2AF6A 4C8NA 2GV1A 2ILZA 2VDIA 4MIAA 1RT4B 4U7YA 1S6QA 1T7SA 1U1OA 2XQ7A 2H9ZA 4M5GA 2WBMA 3CUNA 1PKUA 1Y00A 1CJKB 2M88A 5J2UE 2Z58B 4LBPA 5EWGA 2BV3A 3FFIB 2U1AA 2BACA 2M70A 1S59A 4B3ST 2A0FB 1SUQA 4JI8J 3FZKB 3Q89A 2KJVA 4UF4A 4DV3T 2VG6B 5K8NA 1SL1A 4DOZA 1WKJA 3SFEA 1Q8BA 2H7VC 1UP1A 4KGVB 2YH0A 3PUZF 4AUKA 9ATCB 2JEGA 4QPXA 2B8QA 3MUTP 2QG9B 3T5LA 4DR1J 5EN1A 1YTYA 2Q66A 3N9OA 3PTRB 4V19X 2WZIA 3LGMA 4DR4T 4H4OA 2DHXA 2JQHA 2H5IB 2XGPA 5K20B 3K5OA 4DV4T 4NX9A 3MEDB 4H54A 4O2AE 4KAIA 3V5RA 2VBYA 4GVBB 2DHRA 2QYWA 5L39A 4O4HE 5CYQA 2AD9A 3RKOA 3I5CA 5JJBA 1SJQA 3WAJA 1JMTA 1IJ6A 1NJZA 4H9RC 2WWVA 4OX9T 3O1JA 2N82B 4UVCB 2DO4A 4PXCA 3PTWA 4I69A 4DX7A 1S9GA 1T98A 2DGXA 4LF1A 3SQOP 2UV8A 1GXLA 2J7WA 1S99A 3FCVA 2MGZA 5GVQA 2HK2A 2HG4A 2N4CA 2HBZB 1HNWT 3I9V9 5A76A 2E7VA 4KGXB 5FDLA 2HHHF 4B3RF 4F4XA 2QA2A 5KG0A 3U7JA 3KLGB 5LMNF 4DV2T 3CB4A 4LQ9A 1FKAF 4E0DA 3KBUA 2CPHA 3NWGA 5B0AA 4RNOA 3VZHA 2KHDA 3AY0A 2BG9B 3W61A 2ROEA 2WAUA 2JOQA 3HK2A 2X0HA 3D6FB 1H74A 4YHHJ 2AW0A 3OSPA 4TYAA 4Q43A 5CFBA 2Z0GA 1RI7A 4ZP9A 2VG7A 4TY8B 5HEJA 4LSNA 2VA3A 4ANDA 1HG5A 4TU9A 3S1TA 1HI8A 4USTA 3RG6A 3RIFA 4HFIA 4Z7YA 3SCKE 3KDOA 3FZMB 4I0WA 4P10A 4K4XA 4CNYA 2AXDS 3N9LA 3LG7A 2XZWA 1QTNB 3D3BJ 1DTQA 1WF2A 4CI0B 5ETQA 5HLFB 3PUSA 3CK6A 5FYMA 2V8PA 3RRKA 4ES1A 3DLEB 3BS9A 4LF7J 4IR1A 4H4MB 2DNLA 4QH1A 4CI3B 1BQMA 3RAQA 4QKNA 2PJQA 1VQ6S 3B78A 2AKWB 3DOMB 3DRSA 3ZTRA 2V69A 3CWZB 2DCLA 2DCUB 3K8PC 3RZAA 3IRXB 2ZOGA 1X0FA 4X4SA 3PE0A 2OMLA 2WRMA 1BWVA 2NSBA 3K3OA 3FKBA 3D5MA 1OMSA 3L3PA 4YSZA 4ELVA 2ILYA 2ZHBA 3I5AA 1Y01A 1NHVA 4H4KA 2J1DG 4U33A 2C3MA 1Q53A 3AE9A 3CJKA 4UIGA 3HM9A 3EDUA 5B08A 2R7UA 3ZZUA 3EDRB 2XQYA 1UK5A 3PUWF 4FBUA 2OMOA 1RADB 1TMMA 2HVDA 3PV8A 5KG4A 1ZPVA 2BDEA 1RP5A 3M8QA 2D9OA 2Y0SD 2WBRA 3D6TB 1LW0A 1XERA 4J9PA 2I38A 4KO0A 2W9CA 3BKFA 3RR7A 2ZC3A 4AQFC 4J5OA 1PO6A 1C1BA 3T9NA 1HQ2A 3WBZA 5M2UA 2FJEA 4M5JA 4C3MA 2DTJA 1B0PA 2DR5A 4NXNF 2DNKA 1VRBA 4HKQA 3SWHA 3GJRB 5JDLA 4Q7AA 1TTHB 3GN5A 2ABYA 3CJ8A 3AE3A 1HNIB 3VGTA 1CG2A 1HQEB 3SYZA 5H6QB 2YNGB 3VVTA 4A8YA 1K47A 3OL8A 1G6BA 4QIVA 5AE1A 4B3RT 3BDEA 1IXKA 3D1QA 3BDPA 2NW8A 1UUSA 5LMNT 3R1LA 2VDHA 4KJIA 3KV6A 2BMBA 2CQ4A 4TV8E 4MLKA 4G65A 3AE6A 2GJIA 3HL6A 3FCWA 4LFAF 2L9QA 1RACB 4CLUA 3LH2S 2QJ3A 2PFDA 2XSFA 3NOGA 4KR0B 2KDOA 2YH1A 2RDDA 3V81B 3H37A 2X9YA 1T95A 3U1LA 2AEFA 1N88A 5F3JA 3D2WA 1JJ4A 5KFHA 4J9UE 4B02A 3TA1A 2RP4A 1RT1A 5B0CA 5IT9U 2FHJA 2LM9A 5CJ5A 3UCUP 2V5HG 3D6HB 5KFDA 3HPOA 2E7XA 3HHLB 4H9PC 5KT6A 1RABB 4FS1A 3OFEA 1NHKL 1MU2A 3ZTPA 2VPWB 2KKHA 4TNWA 3PO4A 5FXWA 2XNQA 3PEHA 3ZXWA 3VAJA 4YY3J 4Q0BA 5L47A 5DLFA 2Z2YB 1S0OA 4ILRA 2MOZA 4C8OA 1HNVA 3RGIA 3VF0B 4CLFA 1P1TA 2IBOA 1S4FA 2PE8A 3R84B 3M6XA 2MZQA 1D0ZA 3PR5B 2WBLA 2FC9A 3BBBA 3H3AA 3U1NA 3OLBA 2YPYA 1MROA 3HX9A 1WUUA 2XO7A 3M9NB 2APOA 2W1BA 3CMLA 1FJ7A 5HI7A 3EABA 4IE7A 1OWXA 2PO4A 1I51B 3OR1B 3NWIA 1HR0F 2R8HA 1LWFB 3NKYA 3KLHB 2NYHA 2IC3B 4DFPA 3RC8A 2LECA 4OJ1A 1RCOB 1C1CA 5J2MA 4PYDA 4PK4A 2HNDB 4RUHA 4PG4A 2WU2A 1D1CA 4PJJA 3JSBA 1XR7A 4QH5A 1FRJA 1XWLA 4HYKA 3VRAA 2LQJA 2V4JB 3SDEB 3B13A 2UUBT 1CQNA 5H6RB 4OK0A 1HPZA 1FFGB 1FEHA 5IUXA 4CLZA 1TKTB 5JUMA 3HVRA 3QC9A 1JLEA 1IN0A 2QRRA 3MM8A 1YJNS 4HTIA 4JI8F 4KRWA 4EOZB 2J7KA 1UTAA 3OTEA 1TVRA 4NXNT 1S72S 3W65A 2OAUA 4CXYA 2UXXB 5IT4A 4NLPA 4NE9C 1TL7A 4H63V 2GIQA 4DR1F 4X4UA 1S1UA 1S10A 3QZ8A 3CIMA 4NASA 2J9DE 3D0IE 3PJAJ 2GC8A 2YNIA 4Q44A 4AI6A 2OIHA 4Y00A 3A1YG 3K2YA 4LFAT 2HEKA 4FJOA 4ZVPB 1EB0A 3ZN0B 3QB5K 2OELA 4OIXA 3CDUA 2HSEB 3UN2A 3NL0A 1X5OA 2Z4PA 1FEEA 2BXJA 1EKSA 1HBUB 5G0RB 4DR6J 5FD1A 2XB2D 2DK2A 2O3DA 2CCQA 1K9MT 2EKNA 2K3KA 2HPJA 4DSEA 2XULA 2CMRA 2KYZA 1E6YB 2BUNA 4X4VA 2OPSA 4IQMA 3ZC4A 1RU2A 2DVIA 3MM5B 4JI3J 2LM2A 3CCZA 4OYZA 4KP3C 4CWBA 2XYGB 5FY7A 1FERA 4A5XA 4ECXA 2XAGB 1VHFA 2XMKA 3LJCA 2R2RA 1REVA 3P7IA 4ASKA 4OV6A 2EG2A 5LBMA 3ZZYA 3DM2B 2MQLA 5FLXY 4O44B 2WK4A 3GPAA 2HYIB 4YN3B 2DI4A 2BVMA 2V7MA 1KQKA 3C4XA 4EGWA 1P9YA 1SPBP 4U31A 4X2BA 2LEBA 4G1QB 3F41A 1WG1A 1HR0T 2ZOMA 4RUBA 4TWDA 4ICLB 2FTRA 1U0SA 3MECB 4AD6A 4MHCA 4YLHA 2V2VA 3KHGA 1MWZA 4A8OA 3DLBA 1KNPA 4KPCA 4CP5A 3HVTB 3DLGB 1H38A 1JJCB 2LMIA 1WI6A 3QYYA 4C9DA 2JEIA 1R8PA 2RQKA 2PA8D 4RNFA 2KFYA 1FHTA 3Q8PB 4DZDA 2MZ1A 4JI8T 5E41A 2HPLA 3E22E 1U0HA 1S79A 2K48A 3RGLA 1FRLA 2VL1A 4IR9A 2B6AB 3KG1A 3MXHP 5AQKB 4EBDA 4MTPA 1XDPA 3OKQA 2CRBA 1F60B 2C2DA 5D0GA 3RC3A 4LSLB 1FKOB 2J0QD 2ZZMA 2N4DA 5KG7A 3P50A 4DR1T 5HN0A 2LA6A 1F5AA 5M4YA 2CJKA 3D0HE 3OHAA 4MK8A 2VL8A 2XI3A 3HT0A 4NLRA 4OHVA 4EXTA 4ALZA 3O2IA 3Q8SB 3ZJ1A 1HBMB 5KFEA 5DO2A 2G13A 1U4BA 3RBEA 1YWXA 5KFZA 4AXJA 2JWNA 4Y28C 3W15B 3OR2A 3G71S 1HQUA 1D0YA 1YKWA 1RT5B 4EO6A 5HYAA 4CO1A 1N5YA 1H72C 4LF6T 4WXOA 2Z6EA 1FESA 2POKA 1JWWA 2ACZA 4C90A 3PM9A 4OZ0A 2ZM6J 1KFDA 3R5BA 4IFVB 2FIUA 3HFZB 2V34A 4X84A 1JLQB 3ZN1B 3IBPA 5HSPA 3FNNA 3N9NA 1XZYA 4KV8A 3NBPB 3OUYA 2VFVA 4WKYA 5AQIB 3D1OA 2LKHA 1X5SA 4P6QA 1ZM2A 3DP7A 3E01B 3PY8A 2UP1A 3EYZA 5E7OB 2CPXA 3U02A 1X4FA 4N76A 1JKHA 3IWXA 3RAXA 1VC5A 5HMWA 4X64J 4KB7A 1DAXA 1RTDA 2FVSA 2AX1A 3UUNA 3N28A 1RT2B 2AGPA 3W62A 3W5YA 1W9RA 3QBCA 4WPAA 2I0MA 5DABA 4I2PA 2R8KA 3BGUA 3MJXA 2DBBA 2HS0A 1OPIA 2ZM0A 4QW8A 3O4XE 4JB8B 3QFHA 4IL4A 3QJJA 1N6QA 2IC9A 1VISA 2YNHA 4EAHA 1FXDA 4I2QA 4LRDA 4WBOA 2C3PA 4NPPA 1ZOTA 5KFGA 3MMCB 4E2FB 3D1HA 3RB3A 3NP5A 2IJRA 1Y64B 4M5HA 2CXDA 5BJRA 4OYJA 1OO0B 1PCAA 2E5IA 1KONA 4Y3CA 3MR5A 4AKHA 5CYJA 3M6UA 1C0UA 1T8BA 1HARA 4BJMA 4KKOB 3M8PA 4URGA 4DV6J 5ETRA 2VU5A 2BJ1A 1CULA 4IRDA 4M5KA 1MMGA 2V5CA 5LG4A 2EW9A 5F8IA 3N79A 2OKQA 2MXYA 2NOXA 2D0TA 1HNZJ 4ZLJA 1SQFA 4DBQA 1EAYC 1M1HA 3QGGA 4IDOA 3AOAA 3RIUA 2MQMA 2J4GA 4PUOB 3AAEB 5EWFA 5C5JA 2XC9A 3W2WA 3FEYB 2PMHA 2QV6A 2XQ4A 3CJ5A 3KV5A 1XC9A 1TK0A 2YKQA 3PW7A 4EZ9A 2A72A 2BS3A 2AJFE 5LXRA 5F8GA 4ED4A 4NLVA 2QSFA 3NCQA 3ETUA 3V5SA 2GMJA 2C2ZB 3ZYKA 4U3CA 1KC8T 2KG0A 1PAEX 4ZI2C 1XEZA 4Z2XA 4QU7A 5JQGE 1KLNA 5ADXL 2WCXA 2J47A 4B6XA 4OHXA 2KT9A 2LSIA 2HQFA 2FUG9 3A3PB 4F26A 1N5TA 1RTHA 2DT9A 5HMXA 3HHKA 1IBKT 4XZCA 2RUGA 2LYVA 4WFAQ 1KLMA 4UT4A 2RQMA 2VASA 3DRPB 5IXUA 4PWDA 3ZYLA 4L3NA 2YWGA 4QZVB 2FLNA 3K5NA 3QJPA 4A56A 1UMJA 2DNHA 4LFCJ 4MBQA 2PGCA 4I56A 3TARA 2JPFA 4DQRA 2Y1RI 3M65A 4F4KA 4P2MA 3UULA 1Z4UA 3FBZA 3QWUA 4DSJA 4RZRA 3I9ZA 3EVMA 3SXLA 2CFXA 2ZOFA 2HHUA 2QO3A 4DR6F 1FCAA 4JV2A 3PDNA 3CMES 2ZMAA 1CVJA 3IWNC 2PTFA 3ETOA 5A8RB 1NK4A 1NKBA 3T1AA 4EB6E 2HFZA 3PU3A 3GQCA 3QT5A 3R7SB 1OEDE 4DPTA 4X4PA 2Y6XA 2QMXA 2QL7B 2DIVA 1SB6A 3CSKA 3BPDA 2DNQA 3OD2A 1S1WB 4DL2A 4DSKA 1UFWA 3R97A 2CLYC 5L46A 5L1LA 4F25A 1R0AA 1VDHA 3J7ZT 4A4JA 2YU1A 4CQIA 1GXUA 3H5XA 3OQ2A 5ABFA 1M62A 4DPWA 4X4RA 1S35A 4OJHA 2OPQA 4RNHA 5MLCV 2OSQA 3V5UA 6AT1B 4RU9A 1OJ4A 1OXZA 1KVKA 3SI8A 2UU9J 4LBIA 3KK1B 4RW9B 2UXDJ 5AQSB 1TAUA 3DTOA 2CA9A 5HP1B 2WAQD 4I0UA 2HHTA 2KFZA 2OEMA 3CQCB 3RBDA 3W5XA 2BG9C 4AKLA 4DR5T 4RW6B 4LJMA 3CT9A 1UZDA 2VC1A 3UNYA 3TVKA 4TUYE 1NU4A 2BDPA 4WBNE 2FLOA 2JZ5A 4CN6A 2H4YB 4LF9J 3QSIA 1VMBA 2QIFA 3AD7C 3L09A 4KGZB 2ZH2A 6FD1A 3PJWA 1LVKA 1W2IA 3B57A 2DHAA 3CD6S 1FK9A 1RAFB 3M05A 3UCGA 3Q8RB 4FXVA 1GNKA 3QIPB 5DG8A 1WKKA 2DNMA 2XSJA 2L9WA 4CLYA 2VFRA 3GMIA 3G06A 5GMEA 5DJQC 4JI5J 3K17A 1VQ5S 2W4DA 1IBLJ 5C24A 3AEEA 2AYMA 2MKSA 5F5WA 4CO4A 2B56A 1VQSA 2RA1A 2CG8A 4YFUA 4U95A 4NUVA 3MEEB 2XAHB 2GQ2A 3QT6A 3MMAA 3HCXA 1TAQA 1X4BA 2CQBA 4ZJQA 3CGIA 2L8KA 1R7IA 4LBHA 3HZEA 3FZBA 4X65F 2AQ4A 1S1VB 2MKYA 3BO2A 2YX4A 3QRQA 2VBWA 2RKIA 3L7UA 2KRBA 3CJTA 1NK9A 2MJNA 2VKJA 2QYGA 5HQLA 4LR7A 2V2KA 1E2AA 3K8WA 1Q95G 2CWXA 1RWWB 5FY1A 1DQ8A 2HHXA 4UF0B 2VUGA 3PKMA 1HG2A 3QAUA 3ADAC 3AXJA 3HVAA 2VPXB 4K0KJ 1OQ6A 2ZBPA 2Y1IA 3N2OA 4C6AA 3B8HA 3GIJA 2KJWA 1GT8A 2BX6A 4EI2A 3I0RB 2ES0A 3M4XA 2YDSA 4OYKA 3UD5A 4NXMJ 3AE2A 2XZDB 2X9HA 5C2CA 5D4LA 3L8RA 1S57A 4ZVGA 2UXCJ 2BZ2A 1N48A 3FK4A 3HF5A 2EK1A 2Q9QA 1TL5A 5IS2A 4HT5A 1EETA 5AT1B 3A13A 2XY8B 2CPZA 2IM2A 2B9XA 3J7YI 1DU2A 3GWHA 5LSRA 1JX4A 4TLQA 4NYOA 5LSLA 2LQ8A 3VTIA 3I5BA 2ROPA 3QLHB 2R7TA 5LJ3Y 3MPYA 2H54B 4AYBD 4H9NC 5KTQA 3L3CA 1SJ3P 4KT0C 3AE8A 1KQFB 2UZAA 3WC2A 2KTQA 5LP6E 4NRUA 3KK2B 3DYAA 2HPUA 4I55E 3MUVP 2CPTA 5J2NB 1VGYA 3JCFA 1KTVA 1Z0PA 2LA4A 1G3OA 2MAWA 1VBXA 2F7VA 4HFVA 3JSYA 3AT1B 1J5ET 4OYIA 1UW4A 3G6ES 4DL6A 4KGKA 2ASJA 1RLDA 3OTOJ 1KFSA 1FA0A 3HHLC 4NCAA 1FJEB 1JJ2R 3IFEA 2HFUA 1LEOA 2ACMA 4DV6F 3NKZA 1VRTA 1VS3A 3UT5E 3M32A 3ENQA 5T7LB 5BR8J 4ZPCA 4FF3A 2MHEA 5KFXA 4K2XA 4DCPB 1R6YA 2BJ3A 1KP6A 1DURA 2R7RA 4DR3J 1HNZF 4JYAJ 3IAM9 3T5HA 3PV0F 1M7KA 2J0XA 4DUZT 4H9QC 5HQMA 4GIWA 3M9OB 2P9CA 5C42B 3ZMSB 2K8GA 5AQNB 4C48A 2UV8G 1WORA 4ED0A 3KLEA 4RW8B 5J2QB 3TZZA 2EC2A 3W63A 2MZJA 1NUEA 3TUJC 3DOLA 1J2VA 2V2ZA 4X65T 4C2MA 2FGOA 4LR9A 4H9SE 4WNKA 3GFXA 3GR0A 2JX2A 4HWHA 3NCRA 3KV4A 2PI5A 2Z2MA 2ZEJA 4BCAA 4X4NA 2OD4A 4A8MP 5JR9B 4WWSA 2NPFA 2WVDA 5EDWA 4ZLLA 1BQNA 5CCMA 2ZDOA 1QLBA 1I6ZA 3Q5EA 5D0EA 4TX5A 1S1TB 2IVYA 5CABA 4LF2A 2ZBQA 5FJ4A 3ZTQA 2V26A 2LKGA 2GGPB 3TLTA 2XMTA 2NXJA 4QOTA 3C98B 2HS4A 4B3OB 5AXNA 4NCBA 4GKKJ 2HGNA 1KF6A 3R5JB 1PJ6A 3J9X1 3CKDA 2EFGA 5J1PA 2ZH7A 4P2XA 1US7B 4XDDA 3UR3C 4IGUA 2RE1A 1DLOA 3GFYA 5GADI 1QD1A 3R7BB 2KINB 1S6UA 2UUAJ 4KY3A 5DRKA 4LSZB 2GJFA 4QXBB 2RF2B 2EHOB 4ED3A 3C66A 2ZD1A 1UA1A 3KK3A 2XMAA 1EQ0A 2B9WA 3U3IA 3DRRB 4O0IA 2JDJA 2G9OA 1HWKA 4C4WA 2IUBA 5L3CB 1MSWD 1YG0A 3G82B 1G4CA 2XQ5A 3OV7A 4OI1A 3A5XA 1VCSA 1R8CA 3BQ0A 2JVOA 2X67A 4IDNA 2JFKA 5F8JA 1Z1ZA 4R0EA 3N6LA 2ZJQQ 4I6YA 2W0GA 1RUSA 4K5SA 1XTZA 2IM1A 4DV6T 4N7TA 1I94T 1IKVA 2XS7A 4DSLA 2UU9F 4OJ3A 3TJ8A 2OD6A 2UXDF 5AE3A 1NMEB 2XQ6A 3MMBA 2VONA 2DL1A 1HW9A 2GO8A 2LSJA 1R27B 1HNXJ 4XDCA 4UZCA 4K4SA 1VLYA 5K14B 1ULRA 5IV4A 4U9RA 4JBCA 5JRCA 3C6TA 4U67Q 3M2VA 4IOCQ 4Q8FA 5L8RC 4I50E 3KYLA 1LFWA 2ZWPA 4ID8A 3SQGA 1PBUA 4OHYA 2V6AA 3M2UB 4LF9F 2HHQA 2LOPA 2UXNB 3CE8A 3T6JA 3HO1A 1X79A 2EPIA 4DIDB 3W64A 4ZVRB 4CLSA 2H4WB 5I3PA 4ECYA 4JI6J 4ZEYA 4ISTA 2MJUA 4ELTA 1SV5B 1SA0E 2MQQA 3N2KE 1S9EB 3PFEA 4GO5X 3HFVA 3EE3A 2B7CB 4BC7A 4UQTA 1E7PA 2EC0A 4X1IE 4JI5F 1SIWB 3OT9A 3RH3A 1YI2S 2VA2A 4AE5A 2HFNA 3GA8A 1Y5LB 4KIAA 2I1RA 3T8OA 1YRXA 4ECWA 3BYRA 1OY9A 2K24A 3NS7B 1WC5A 3ZPOA 5AXKA 4DZ6A 5CD4A 1KBRA 1LKZA 1RGVA 4CTAA 3MR3A 3KKFA 1HHQA 3LW5C 2UUCT 3THPA 5JVDE 2HBYB 3CCVS 1FXRA 5ABGA 3TAMA 2OEKA 3H20A 4OI3A 2AT1B 4UTGA 3CO9A 2HNZA 3LOUA 2VQEJ 3P5BP 3CCMS 2DY9A 1MMNA 3MUMP 3RR8A 4ECTA 3RB4A 3Q5XA 2WZHA 1XMBA 4K0KF 4KBMB 4MFBA 2DHHA 1OWAA 2MQOA 2B5JB 3MR6A 3PEJA 2ZE2A 2E9XD 2HHWA 3NS5A 4NXMF 3OJAA 3DDNA 3THTA 1ZYQA 4F0HA 2E9TA 1B70B 3J7Z5 4WU2A 2UXCF 2OSRA 1D8ZA 2W7AA 2D3UA 5D3GB 4NZ7A 2WMOA 2W2OP 3ZMVB 5BYQA 2K1RA 4NI2B 4DBRA 3ZSTA 2NTYA 1YLXA 4M5DA 5F3TA 2CQ2A 3BKUA 1C4CA 2VQFJ 4BC9A 1UPMB 3MR7A 3ISNC 2LOSA 4ZLPA 5HBMB 4QR2A 5GMKa 3MEGA 4TNVA 1RT4A 4PZVA 4IFYB 2MY8A 1IM6A 4ZS3A 4O4GB 5IHYA 1FE4A 1OPZA 1H2TZ 4TV9E 2ZBCA 4OYPA 4LF9T 5I42A 3GCXP 1JLBB 4NA1A 4PG7A 3KINB 2L41A 3ISZA 4JV5T 3CCSS 3FQKA 4CXXA 2PA3A 4OZ5A 1VJWA 3ITHA 2RSQA 4LREA 1RBAA 1KNZA 3UDCA 2B7BB 5LG3A 1X4CA 1QE1A 5ETSA 4LUBA 2JHEA 5LXYA 4MK7A 2M5YA 3DJBA 4TQRA 4DR3F 4QPTA 2VFUA 4JI5T 4JYAF 1RT3B 5JDMA 5KT7A 2GVZA 3R5CA 4B3MF 3C2PA 1GMUA 1QAIA 2W62A 2WB5A 1TKZB 2VB6A 1T9XA 2XLKA 2YKAA 5KX5E 1T05A 4DUYJ 2DITA 1N5VA 1T8EA 3HP6A 1LWEA 5KFTA 1KVIA 1D9FA 4YSYA 4HE8A 3JQJA 4EK2A 1S7IA 4EYIB 4TLRA 4EMDA 4A8SA 3QT8A 1G7CB 1HA1A 1QM9A 4J2CA 2JC1A 4TNOA 5DG7A 4O3PA 3B4DA 2BRLA 2IMWP 4WCEQ 4P09A 4K0KT 2P9BA 2V63A 1JXLA 3KUHA 2XM2A 3EUHA 2CPDA 3O44A 2Q79A 1TV6B 4CO2A 3T1HT 1FX2A 1RWNB 3AODA 4L3KA 2JQ9A 2BS2A 1UVNA 2FDNA 5AFUL 3KLGA 3GG0A 4ECUA 1OEDB 3VKHA 2GQQA 3TLWA 4M95A 5KFRA 4F0KA 3R9LA 2L3MA 1AUSL 2UXCT 1RAEB 3UU4A 3KNAA 1X9WA 2LLZA 4KMCA 3HI9A 3K58A 1S94A 3RHWA 4BAYB 2CZ9A 3IO1A 2DHGA 4WZMA 3KHHA 3VGUA 1LKXA 2UUWA 2CWKA 1GX6A 1TL3B 2JMHA 1X4DA 4TZ4C 5F9NA 3RUBL 4F2SA 5KMGP 3CDWA 3AVSA 3OPCA 2EEYA 2K06A 3CQGB 1YBTA 3X1LB 2I6HA 1TL1B 4DR7J 2CDQA 1UJ6A 4CN1A 1XR5A 1Q7LB 4M8LA 2W00A 2WMNA 2LRKA 1MW7A 2J5AA 1B7TA 3DLEA 2BJDA 4CT8A 3R3TA 2E1CA 4HFDA 4COFA 2ZKUA 2XQCA 2WDVA 2NPIA 2B1EA 5HJYA 5JREA 1S6QB 2MSTA 4B3TJ 4ILBA 3H5SA 3DRXA 3SOLA 2F9DA 3HVWA 4D3HA 1QAJA 5SUHA 2W7PA 4C3KA 4WW0A 4OZ2A 4JYAT 3KDNA 4MYTA 1T9UA 2JEJA 4B3MT 5F8LA 4CYUA 2K3WA 4LT6A 2PIIA 1SUQB 4IG0B 4ZPAA 1W7WA 3DFEA 5GAGI 2PEHA 3UCZP 3VAHA 4L72B 4BLGA 4Y2MA 1URRA 2RMLA 4K4ZA 2AEJA 5DQIA 2KZZA 2D5UA 2HZCA 3EI0A 2XWYA 3AJDA 1CJUB 2YN6A 4UQGA 1HD0A 5J1EA 2XMMA 4OZ3A 4JI6F 1X5TA 4MH8A 1L3VA 3TZXA 2Y8DA 3UE2A 1NKEA 3IS9A 4JI7J 3JAEA 4EZ6A 3RRGA 2LHNA 3J80U 4ZVUB 5F8PA 4IDKA 1PYSB 4NLOA 2K5BB 5ETVA 3JSMA 3K57A 5DZ6A 3FEZA 5KG5A 4A8QA 2R7OA 3RBXA 1HNIA 3BSNA 4A8XA 1VQYA 3V6DB 3A8KA 4DV0J 4RW4A 4ETZA 1SKSA 2B4PA 4DS4A 2J9DA 2VPZB 1N32J 2NXCA 2E5VA 3MHYA 3F2EA 2CNKB 2O01C 3FC9A 1U6BA 3HD1A 1M5PC 4RJVA 3E2EA 2GAGC 5GAGU 4Y2KA 4DN0A 1RYSA 2W67A 2Q3PA 2DGTA 4KQZA 4IT4A 2MGZB 3PUQA 3V81A 1ZTTA 3TP2A 1YRUA 2HAIA 2PFVA 2XSAA 1MN9A 3BPSP 1X60A 1G73A 3DDIA 5FVKA 2QZ8A 3UFEA 2VQEF 4C91A 1W0AA 2XQAA 4ZK7M 3MOJB 3FBCA 3LALA 4IDZA 5KFSA 2V9KA 3FRYA 2CBJA 1B64A 5KT5A 3NY0A 2I9SA 4JI4J 1GXTA 3JAMY 1SIZA 3BQKA 8ATCB 3AA8A 4ZIVA 2LXUA 2KZ7B 3HKEE 4UW2A 2VG5A 2B76A 5L1IA 3GTYX 2D3O1 3FSXA 1PILA 5A8WA 3R8YA 1UWBB 1LFPA 3TEGA 2RU9A 1Q1KA 4OX7A 1FFWB 4MIWA 1TUWA 2ZITA 1S6PA 3KLIA 3VZIA 3P4UB 3GIIA 2QYCA 4LMLA 3BEGB 1DTQB 3KUEA 4ZOSA 2QGSA 2VQFF 3HSDA 2BS4A 2DXDA 4DHVA 3AOBA 4YR3A 5KFYA 4FKYA 3C15B 3OVUA 1BQMB 4QX7B 4QHOA 1UJ4A 4J9OA 2F63A 3CWJA 1F9HA 4DU7A 4QBUA 1FJGJ 1NM2A 1X9BA 3DRSB 3C46A 3N9QA 2HNDA 3ZZ0A 2E29A 3SSSA 3IBCB 3BM7A 2V7LA 3MTJA 2WONB 1VBKA 2KXPB 2WVEA 3I9WA 4PK5A 5HO4A 5E0OA 4DV1J 2XCAA 3U1MA 1M0SA 3OJSA 4JI6T 2CQCA 3CJKB 1NDCA 4IL9A 2MDAA 1YHQS 1T9YA 4OYAA 3ILLA 1HHTP 4IOAQ 5F8HA 3RF1A 4DPUA 5F9LA 5AQMB 2GZOA 3H2LA 3M8QB 2WM9A 4TU7A 4OV1A 3PCOB 1LW0B 4PRFA 3Q8VA 2FJVA 5DDOC 2HMIA 5FVLA 1OIAA 2W9CB 3R2DJ 2P9EA 3N01A 2N7YA 2IYIA 2CYYA 2XEXA 2MKCA 5FP3A 3RRWA 1C1BB 1VIOA 2NREA 4ILAA 3D6MB 4CT9A 2HAFA 5B0DA 1MMDA 1UJ5A 3SV3A 4DUYF 1XNRJ 4YOEA 4ELUA 3GN5B 3DI6A 4F3QA 4PG5A 1N56A 2CNOB 1WD6A 3IHRA 2B3TB 4GC6A 4EUVA 3MAAB 2ZHAA 2JLFA 3A3NB 2M9KA 5G0RA 2QMWA 3K0JA 3ZMTB 3PUGA 1NLKL 1RT6A 2VQET 3KJNB 2VZ9A 3PUVF 4RLEA 2GMHA 5HEGA 3HD2A 2WQYA 5A2QU 1B3TA 3M9MB 2H89A 1YGYA 3FSYA 7FDRA 1HX1B 2N3OA 3NAHA 1E6YA 3OBVE 1RAOA 4AQGA 4P7VA 1QVGR 2FHKA 1J27A 3CF5Q 3N9UC 2V67A 1RAJA 1AT1B 3AXKA 1RT1B 4PCQA 1HIYA 1Q86T 3NNAA 3IEEA 3IN5A 4F4ZA 4ECVA 5JR9C 2LVWA 1EQMA 3DM2A 3FMBA 2C2EA 2BJ7A 1MU2B 1UVJA 2NZ4A 3AEGA 2VQFT 1IBMJ 4ILLA 1XMQF 4G1QA 4Q0BB 1U4QA 3H2UB 4PK6A 4ICLA 3QWPA 1HNVB 1WC0A 3MECA 5B09A 4L9IA 1UVMA 2KU7A 3T6BA 4IE6A 4FN5A 1VQNS 2R42A 4ZPVR 5KT3A 3RPUA 5AQHB 4DR7F 3TRGA 4TYBA 3DLGA 1KEKA 1FE0A 1MROB 1KN6A 4LRCA 1GTHA 2A6OA 2E5LJ 4DV7J 4IQXA 2A1BA 3EAMA 2EHOC 3PHTA 1F6TA 3K89A 3TR5A 1AZSB 2GIRA 4B9LA 5J2MB 4OX8A 2C22A 3O3LA 4B3TF 3KLFB 4HDGA 4KTQA 2B6AA 4HGAA 2KXFA 4K4VA 2D1CA 3MM6B 4X5TA 2ASLA 1U24A 1RTJB 3FRZA 2W25A 3PX0A 3FSIA 3HHNB 1FKPA 2J0WA 2ODUA 1JB0C 4DR2T 2P5VA 2VURA 5ETMA 2DNOA 3L7OA 1JLEB 3GZ7A 4P9SA 1AXQA 4F8HA 2QLBB 1JNRA 2DH7A 2N7CA 1CJVA 3NOCA 2DNXA 2GS8A 1TVRB 1NDKA 4NUUA 1HFAA 3I31A 5D78A 4X66J 1HBMA 2BANA 2DY1A 3AAIA 2LDIA 3GR1A 4K50A 4UV9B 4TKTA 3V6JA 2ZBRA 4TXSA 3FXDB 3QMQA 1H2UX 2R8JA 2HW3A 2FB0A 3KVBA 4OI2A 2FJWA 1PJ5A 2MTLA 4ZVSB 2QFJA 3CCTA 3PFOA 4RX6A 1OYEA 2CM0A 2QC3A 2AJ0A 2YNIB 4JI7F 4K59A 5IM0B 1BE4A 1Z2LA 4HWDA 1ZAWA 1IWAA 1DZ5A 3GFZA 2E44A 1M5OC 2XZEA 2IDOB 3NGKA 4F04B 2XGQA 4Q8EA 4R8UB 5IOLA 4ZZCA 5KG6A 3V4MA 3LSVA 3BSAA 2OLWA 3LPEA 4N47A 1N32F 5LL6d 3G6YA 2YKMB 1IR0A 2XZTB 2M7SA 3NBPA 4N8OA 5L3BB 2QMUB 4LVOP 2DJWA 3EX7B 1ZZFA 2YX1A 3G87A 3JADA 4RR5A 2PMWA 3IM9A 4DEZA 1FRKA 2OPSB 3POTB 5LMUF 8RUCA 4KHPJ 2X1AA 2NW7A 5L38A 3KOAA 1JXVA 2XO6A 3UN3A 3PNIA 1K0TA 5AQJB 2H5EA 1ZEEA 1S12A 2XMVA 1XMQT 3GYGA 4DX8H 5HMYA 1RT2A 3D54A 4DMZA 3AXMA 1L3SA 3K8VA 1XJWB 2AZ3A 3AA6B 2OJ3A 1HFEL 1N5SA 4C0OC 4QYZK 1YD8G 4DR7T 3QNWB 1KNRA 4UUWA 2NR0A 1UEKA 4JI4F 3HZGA 2OP5A 2YX7A 1QSDA 1X9MA 4WFXA 2C3YA 3IMQJ 3Q24A 4CDIA 1EZ3A 3HT3A 2KVQE 2HGLA 2Y48B 2V0NA 4DFMA 3ZEFB 1WACA 1LXNA 5H9EK 3W9HA 4Z7CA 1U25A 2KL8A 1UW9A 3CIRA 3T9ZA 3A8YC 2WVFA 2UXBJ 1RWVB 1PC4A 3BGOP 4YUDA 2QL9B 1NEEA 3HMJG 5JTGA 4C8LA 4UEMA 1FDAA 2AJ1A 3MCNA 2Z2ZA 3HXMA 2ZVIA 3R5DA 1V3ZA 2KI2A 4FKXA 1NDLA 2EFNA 3LQVA 2KFNA 3MZIA 1X5PA 3CDEA 2PN6A 2W4CA 1Q78A 2Z30B 2VL0A 4PR6A 1FRXA 2YDRA 4HWIB 2RU3A 3PIPQ 2M3DA 1FDBA 2HVHA 1FJGF 1NSAA 3PRBA 2V7IA 3UO0A 2RS2A 4PUOA 3D28A 3OBIA 4ZITA 4V1Ak 5DQVA 4QR1A 1Q4RA 3ZJ2A 5BXIA 2XSBA 2HQ3A 3MPVA 2F9JA 3HFKA 2EK6A 1MIWA 4IKAA 2FBWA 4DV1F 1W26A 1D9AA 2LQ9A 2NUUG 2CADA 1B0VA 5EK3A 1NSKL 5JDGA 2A3JA 4XPCA 4E98A 2BQ3A 4FVCA 2YKOA 2I2YA 3UQ7A 4QYRA 1DFDA 5DETA 1W0BA 2E2AA 1Q16B 2ZFHA 5CXTA 3DC2A 3CCUS 2V8DA 3CJ2A 3ZZPA 5DQGA 3CQXC 4RW7B 4ANCA 1HLWA 1RHQB 1N32T 1NHUA 1SBRA 3LTOA 2RD5C 3CCES 3BH6B 3QJLA 2KMFA 2RILA 2W2MP 4JEUB 4QYZJ 3W2VA 3FB2A 2VICA 2UVUA 1KTQA 2LFVA 2DR8A 4DSFA 5E3AA 1RK8A 3GJTB 3PIOQ 4M1PA 4NEZA 3ZMUB 2KRRA 1S9FA 2IYGA 3FBEA 1KQSR 1TQLA 4LMJA 3RLFF 4ZCLA 2D7SA 3SEOA 2KNDA 5H9EJ 5LMUT 3FBLA 2WSCC 4R5PB 1IKXA 5L4HA 1FD2A 3B82A 2A6MA 5ETOA 3CEDA 1S1XB 4QU6A 4KV8B 2YQ1A 1TP7A 2FC8A 3OUYB 3VGSA 2E66A 1XMOJ 1SHZC 4JI2J 1FXLA 3PW5A 5A8RA 2BOAA 1A7GE 1BUXA 2WOMA 4LRBA 2Q43A 3BSCA 4HACA 4ZVHA 2CLYB 5H9FK 4Z90A 1JKHB 5DM6Q 2J76E 3I0OA 2XY6A 3LK2B 2MKKA 4KYZA 2MQ8A 1RTDB 3QRPA 4P0BA 3VCDA 3NVOA 3WIUA 1S1WA 4MYUA 2Z57B 3CX6B 5HXCA 3MD1A 4A98A 2WWUA 2SXLA 2WU5A 2DGWA 4O2BE 3O6QA 4AQYF 4IG3A 3NBXX 3MGJA 1N6QB 4E7SA 2YNHB 4I2QB 3F31A 5HQ8A 1IBMF 2BQUA 2FZCB 3UWTA 5J2PA 1RA6A 2ZH4A 1SL0A 4HFCA 2JRSA 1OEDC 3Q2MA 4DSIA 3K59A 1H3DA 2RDJA 1C0UB 3JSRA 3HKDE 3FGVA 4LR8A 2RPAA 4WP9A 1QTMA 3KVAA 4IE5A 3M8PB 4RW6A 1IAPA 4DMVA 4JLEA 4K8RA 5CAAA 3PR4A 1CS4B 2H51B 1MMLA 4DV7F 1HS7A 2BJEA 2F4VJ 4CLWA 3R2CJ 2GVDA 4DV1T 1WC4A 4L73A 2UUTA 3D67A 4X1KE 2MSSA 2LU1A 2ZH1A 3CD5A 2X68A 2RJZA 4UY8T 1Z2ZA 2DRDA 1H6KX 2DRAA 3TZYA 5IC6B 5LHHB 4IIJE 2HVEA 3VQTA 1RBLA 3GSDA 3QIPA 3NGTA 5KT2A 2PFFB 2N9DA 2ZWOA 4F6RC 4ZHRB 3DLHA 1LWCB 3PRDA 2W7OA 2DIUA 1ZKEA 1HBNB 3Q5WA 2HFSA 4C11A 1HYSA 3UI3A 1RA7A 3H98A 4I68A 1B7YB 5H9FJ 4V1Av 2DGQA 4O4LE 2CQ0A 3BF4A 4X66F 5CGMA 4U72A 4NOHA 2JRKA 2V8GA 5A0YB 4PQAA 2GMLA 2HHVA 1RJJA 2FUPA 2RHQB 2YXLA 5JVGQ 1KSPA 1FRIA 2E5GA 4JI1J 1F5BA 2OFGX 1IR1A 4DL7A 2HGMA 3RQWA 3C50A 3A8EA 1J5OB 3PJAA 3EXYA 4E8UA 1AFJA 3R6NA 2R2SA 2ZUAA 4USMA 1SE7A 3FZFB 1P6TA 3BO4A 3H3MA 3IR6B 2FJBB 4LRFA 5B0BA 3OXFA 2JIWA 4EBCA 3I0SA 2Y3YA 4J91A 1T94A 1T0TV 2NW9A 2QLFB 1XNQJ 4U8YA 2W9BB 1WJ9A 3I0RA 3M8ZA 3Q2TC 2KWIB 2HHHT 1EIYB 2CPIA 3PO5A 1Y7PA 1VRQC 3EM1A 1WHXA 4AQYT 3N9PA 3ENWA 3V2UC 4GKJJ 1S5ZA 2ADCA 3LP0B 3R1HA 4LF8J 2CUYA 2CHNA 2BG9E 4LRAA 3DLLQ 2P8IA 5KFIA 4A8FA 1FRHA 1RZMA 1PAUB 3QLHA 3D0TA 1WHWA 2AGQA 4CM0A 4RBVA 4ZA1A 3BQ1A 2CJ9A 5ABFB 2WDQA 3KK2A 1ZA1B 4QXHB 1GX5A 4FXWA 1N5QA 2YWEA 2PSZA 5EK4A 2MTQA 3HHLD 4DV7T 3V4IA 1YJVA 2DHSA 3US5A 4ZOLE 1HWLA 3QO9A 3EDVA 2Z8QA 1TU0B 1OY6A 4XIUA 2J6SA 4NYPA 8AT1B 1JNZB 4M1KA 1M1GA 5E3PA 4PKDB 5D0HA 3C4WA 5JVHQ 1L0VA 4O3RA 3OPKA 2EVZA 3LAMA 3GSIA 4K4YA 4WFBQ 3CW2C 5AQVB 3IC1A 2LJLA 4NCGA 2CIMA 2HVZA 4CZZB 1RWKB 3EUNA 5DZ7A 2XWXA 2F3JA 2YTCA 2R3VA 4ZHQE 4B3SJ 4USUA 2AYGA 4N77A 5KOWA 4BS2A 5KFAA 3QB5A 4YHJA 3KNGA 1RLCL 4IDQA 1Y4ZB 2RS8A 2XSJB 2UVVA 3HSJA 4F3MA 3MFHA 2XYHB 2CZVC 5J2QA 3DDKA 1U2FA 1UA0A 4K2JA 2EBGA 4ZVEA 2J6UA 1TK8A 1AYEA 1RHRB 5CD4H 5J1NA 3KXDA 5C24B 1N8RT 1W09A 1FNMA 3VAIA 3NCPA 2GA7A 3DCAA 4OFZA 2V7JA 4E7ZA 4B08A 3DGVA 1NK7A 3DOKB 3CDAA 1IWGA 5LM7E 3KWMA 4CI2B 1SH0A 2MZSA 3AVRA 5DDRC 2B4UA 1S1TA 3TAQA 2MBGA 4I6AA 2FLPA 2EKYA 5GAEI 4DUTA 2M2BA 3CC7S 4H4KC 1V9DA 4O4RA 2RAQA 2ZNYA 3LP2A 1URNA 2FZKB 4TN2A 4OX9J 1XN9A 1FMWA 4OZJA 2LT3A 3ILIA 4I1TA 3GIKA 3LO3A 2XNRA 4N5SA 5HAXA 5C3JA 1RAAB 2K2PA 2D0UA 1RWUA 1EKRA 3A8JA 2CXLA 4O0NA 3LPYA 3ZNJ1 3FBBA 1HNWJ 3EMTA 4WU3A 3JAMU 1FMVA 1MG7A 4KC5A 1CSJA 5FY0A 5L3DB 4F3OA 1DY3A 5DQWA 4DV2J 2RF2A 3H4DA 1XMOF 3G6XA 2CQ3A 2V6YA 3LBXB 3GB0A 2DH9A 3W9JA 1A9NB 2RRBA 3EXCX 1ZTWA 1JLCB 3N0VA 5EZYE 4IH5A 4O23A 3VV2B 1WWHA 2Q9QB 1KOHA 1R89A 2VKZG 2Y1LB 5GAEU 4QWDA 3WHIA 2K9AA 2BE2B 3UFGA 1IKWA 3JTOA 5I4MA 3IGNA 3NRXA 3TX0A 3M8RA 3OL6A 3E3XA 1VR6A 2XJ7A 5K8OA 3SCJE 2Z2LA 5LT5A 5HROA 3T5KA 4MJKA 3BZQA 1Y3KA 3I4HX 5EUHA 3NZPA 3LFMA 3DYAB 2E5HA 3P4RA 2H3EB 4DL0C 2X3GA 2H1YA 4CH7A 1U1MA 3C6UA 2Q6BA 4YHHF 1ZETA 2YINA 1GH8A 3Q5DA 4QWEA 3UDEA 1UX5A 3MZKB 3IWLA 2YKSA 5K14A 1PG5B 4EYUA 3E8OA 5CYMB 1Q8KA 3BB5A 4YR0A 3JC6C 5HL7Q 1FVQA 2DISA 2HURA 1XIQA 3M32B 2RH3A 4OI6A 5ABHA 4YB5A 1ZAVA 3IAS9 1X9SA 2XG8A 5HEOA 1HCIA 4D3GA 4AKIA 1RKJA 5KFCA 3Q8UA 2QRXA 4QIGA 2W24A 1UURA 4LF7F 1MN7A 3TKLB 1HHSA 3I0QA 5KFKA 4YJ3E 3H59A 3TA0A 5AE2A 3SIPB 3F0NA 1LK5A 2HQGA 4TWHA 4GK0E 5AQPB 1HWIA 1SKUB 3AQOA 2EI5A 2WSSV 2HHSA 2ASDA 2CHOA 1S9EA 4ZVFA 3KLEB 2V1DB 4JUYA 1UEVA 2ODVA 4NPOA 1RT7B 4KHMA 3S6EA 2NSCA 3RQUA 1L3TA 2CXFA 1OSCA 3Q22A 1D1BA 2ZJRQ 1WSRA 2J6TA 2EFOA 1CC7A 3GJSB 2OI2A 3QSYB 3EDQB 2IJNA 4YXDA 1F1BB 2DB1A 1BQNB 3O1LA 2FLLA 5CZXA 1NKCA 1UVLA 4DMWA 2R7QA 2KXNB 4FZVA 3GYXB 2IRXA 3THVA 4ERRA 3PUYF 1SXLA 2ALZA 2LU2A 2CVEA 4B3RJ 4JI1F 5AXLA 1QVFR 2LDYA 2YU2A 5LMNJ 4ED7A 2HZAA 2X7IA 1H7XA 5EX3A 1ZP0A 5FXZA 4J9MA 1K8AT 1FWKA 2C3OA 2E7WA 4HLBA 2H5JB 2IM3A 5CA1E 1DLOB 1F9FA 5A6PA 1XDOA 2IAJA 3ENVA 1KFYA 2BOPA 3CPZA 3V6KA 2ADBA 1NAQA 2MLYA 4QIEA 2YKPA 4J9QA 3RX6A 2AE9A 3RIAA 1ITPA 1XNQF 2E9XA 3DLKB 4C0HA 2OPRA 4JP8A 2ZD1B 4P1NA 3RU0A 2E1PA 3UTKA 1RYRA 1KHVA 4Q2LA 3ISND 2KVIA 3ZFVA 2R2TA 5C2GA 5KFWA 4S0MA 4ES3A 3M2RB 1XBWA 1HBOA 4NMXA 1VRUB 4EGLA 4ECQA 2DR9A 4LF8F 4YHHT 3TOQA 5LSOA 3VGVA 4W92B 4GMKA 2L9NA 1K1SA 3R5AA 1VQ4S 3OL9A 3UPFA 5BYRA 4HI1A 1M5HA 1T9TA 2BBHA 1R6VA 5JDHA 1T11A 3QAEA 1EARA 1N4LA 4RNNA 1NK5A 5BMVE 4IFYA 5F8MA 2BW2A 1VQKS 3PXGa 4IDPA 2WTFA 4UOHA 4W90B 3OFHA 2H3RA 3CO0P 2QLJB 3CPWR 3S8SA 3QZ7A 3MMBB 1N34J 1IKYB 4ED2A 1L5UA 1Y9OA 1RU1A 1JLBA 1D1UA 4NZ6A 1C0TA 4LF7T 4YY3F 4BDPA 2HWHA 3OXGA 4UY85 4ILCA 4HEAA 4GYSA 4O8SA 4AIUA 2XY5A 4MKYA 5JRCB 1PJ7A 3C6TB 3M2VB 1VQ9S 1S0MA 1UX4A 2DEJA 2P2CB 3CMAS 4HI2A 2CE7A 3CNQP 2W66A 2BE9B 3SQGB 2R8IA 1ZA2B 4FP9A 3H2VE 3J7Yq 5L1KA 4I67A 3DGPA 2EFQA 3JQMA 3JQKA 1NSPA 2UUBJ 2GQCA 1Q82T 1X31C 1RT3A 4X4TA 2PBIA 1VYAA 4FNIA 3EGWB 4J9VA 1JLAB 2VIHA 2COLA 4GYRA 3HJVA 1TKZA 2E5JA 1WOOA 5F8NA 2CXEA 2HQCA 3RRCA 3CJ0A 2AMCB 2DNRA 5KFQA 4NXNJ 4ZCKA 3M1VB 2F8EX 1N0UA 2B0GA 2WB4A 2YPZA 3DRYA 1D3WA 4USWA 3LANA 3VKGA 3OFGA 3LGHA 2B4VA 4JI1T 3B4MA 2OUGA 1F2GA 2FJDB 4QX8B 4L75A 1X4GA 1ZM4A 2W8LA 2VBZA 2I5JA 2AZ1A 3ELHA 3NAIA 1AFIA 1QLNA 2IIHA 5D15A 3P96A 1CHUA 1TKXA 4Y34A 2KO1A 3J81Y 4J9RA 4F4WA 4B9SA 2XHEB 1TV6A 4J90A 4ZN3A 2JLEA 2GCFA 2RQ4A 2DLRA 1SQEA 4WE1B 2AX0A 3TNVA 2IA6A 1Q81T 3T5JA 3ZZRA 3CJSA 2XM1A 4DS5A 3F57A 4UXNB 1SC6A 4GVLA 5G4DA 1J1JA 1LNQA 4G1IA 1WEZA 4MFBB 2BBEA 4C8YA 3PUXF 3SMZA 4XK8C 4ZP7A 3L4BC 4LF8T 1KK7A 4CLPA 5IV3A 4QW9A 2ZE2B 4DV2F 4FYDA 1MNDA 4DXLA 5J0ZA 1CLFA 5L3EB 1H0HB 4K0UA 2G4BA 1NJIT 2CDRB 4FF4A 3BJYA 4ZMMA 4P72A 5IFMA 2IDEA 1RQ0A 4EV6A 2LKZA 4I43B 5CA0E 3GIMA 3MR2A 3UR0A 2W9AA 4PABA 4XTTA 3KV9A 3BKTA 3UW1A 5ETNA 3V6HA 1SVDA 1HR0J 2KG1A 4JI3F 1HWJA 2QL5B 4DCJB 1FEWA 3N6NA 2V94A 4YY3T 2YBVA 2JNJA 2MEWA 2FD2A 2JQQA 4ILMA 3AB2B 4QWAA 3UU8A 1L3UA 2HWTA 5JH7E 2BRKA 2QVAA 2KT2A 5I42B 2BE7D 1WTFA 5L3GB 2D3OR 5KG3A 1JQGA 3M8SA 5CH7B 2AJ4A 5ADZA 3WDOA 4IG0A 3WI3A 1QUPA 4AQFA 3M8WA 3ITHB 4QQBA 4DG1B 1QE1B 4NA2A 2BW7A 2DR6A 4EYYR 4ZI7E 4XO0A 4WF9Q 4F67A 3HSGA 1T7PA 4DN9A 4HHJA 1K0VA 1CJUA 2WP9A 2GVZB 1N54B 1REGX 4ZCMA 3SFGA 1B99A 4J9SA 1I3OB 3ANWA 4CM2A 3ICLA 1SJRA 1T05B 2R9LA 2NR4A 4CLKA 4M5NA 1EP4B 2I59A 1LWEB 5J2TE 5D4PA 4KFBA 2XAQB 1AW0A 5K8MA 3NRBA 2HZVA 4EU0A 3V6DA 1IM4A 2VKHA 2G2OA 4UOGA 2BKNA 3C16B 3AAWB 3M3ZB 1X4AA 1F5CA 3PYEA 1S4EA 2P6SA 1IJFB 4UR9A 3RIUC 4YDXA 2KM8C 3KUGA 2R7WA 2RNEA 3PJXA 4LF6J 1ACMB 2XAFB 3M6VA 2HLTA 4PAAA 3AEFA 2DGOA 2QLWA 2ZVSA 5H1SV 3PZPA 1UL3A 1TK5A 1IR2A 3UDLA 2D2SA 5DGBA 3BR8A 4P75A 5JDNA 1YVFA 3F73A 2H48B 3H42A 2CJXB 4DR6T 4FVMA 4FF1A 1MWQA 1A6LA 2DWKA 3Q9DA 3TQEA 2CPEA 4ZXLA 2MZRA 5FL1A 2ZM6F 5AQOB 2CJQA 3IG1A 3UU3A 3RBZA 4HDHA 4NLYA 4FF2A 4GRSA 3RKGA 3R27A 4JI3T 4WZQA 4HT7A 1UWBA 5FIIA 3ABVA 2B9EA 3HKCE 2ZZTA 3RI5A 1CC8A 2J8SA 3I55S 3A12A 1SC3B 1VLOA 3CMQA 1QUVA 4NIQA 1GTEA 4A8KA 4X64F 4CIOA 3C15A 1KR4A 2H88A 3RYCE 3UQSA 2G1DA 3KJFB 1MMAA 3LWLA 3QFWA 2D9DA 4N56A 2OPPA 5K8PA 4K5RA 3KJQB 1YJUA 2WONA 2W2PP 3ENAA 5KG2A 3CX8B 1Q79A 1N34F 1QY7A 1UGOA 1FNXH 4CYUB 3W9IA 3TJAA 5LJMA 4N8NA 3OW2R 3DKDA 4EWTA 3N5FA 5B0GA 3R5GA 4ID5A 2V4RA 2YQ3A 3K5MA 3T1YJ 4UZBA 4ZJLA 1YJWS 4HKAA 4W4MA 1WI8A 4MT1A 3P6YC 3WC0A 5KT4A 2MYSA 4ZS2A 4CO0A 3QQCD 2UUBF 3G8QA 3CC4S 5JXSA 1K1QA 2W01A 1XQIA 5J1EB 2XCPA 2R7SA 3J7YU 2C2RA 1KHWA 1NEKA 5LA6E 5M2PA 3IS9B 3HLUA 4HFEA 4H9OC 1E6VA 1CJTA 3D4JA 1JLGA 3ETVA 4YB7A 4IDKB 3S7RA 4PQUA 3JSMB 4RKUC 2QTWA 3KJVB 5HVHA 1FWLA 4FYVB 1GK8A 3WX4A 4ILUA 4K4TA 1PYTA 2I0XA 1AUDA 4LMZA 4RW4B 3BH7B 2LHRA 3TAPA 1IBKJ 4KHRA 4QIWD 3JYTB 3MAAA 4CO3A 2LQBA 2F4FA 2CJAA 5LOQA 2YKNA 3N5BA 1PSDA 4M94A 4EBEA 4WFNQ 4U7UK 2QA7A 2F8MA 3OVAA 4NL5A 4LIWA 5IWAJ 3LP1A 7AT1B 4LIRA 1BC6A 3AA7B 2L48A 3VR9A 2V5DA 3Q8QB 1VQMS 1X4EA 2X0YA 2MZTA 4PXBA 4U7IA 2BZBA 2JLGA 1WOPA 1WDTA 2MHNA 4BWMA 2ZM6T 1NK6A 1RHMB 1VQPS 3DMJA 1U48A 1NZAA 1RE1B 1BR4A 3C14B 4HH0A 4ED6A 3UUMA 3DXBA 4CZCA 1O8BA 4NLUA 2N3LA 2E9ZA 2DGVA 4OI4A 2NLWA 4LFCF 1DJ0A 4DNDA 5LYJE 4GK5E 1GMWD 3F56A 5I3QA 2VG5B 4AFFA 4X64T 4R25A 5GMDA 5A8WB 3W3SA 1R8IA 1F3FA 4KGMA 2CJYB 2BYCA 2N1GA 4PG8A 4U6PA 3DHWC 2Y9HA 1S6PB 2EHOD 3KLIB 4IH7A 4ZIWA 3KLVA 4QWNB 1Y0HA 3HKWA 3EZOA 2J8AA 5CHCB 5D4NA 3T41A 3CCJS 4ITSA 1R0CB 2SPCA 4JI0J 2V8VA 2JL9A 3ILOA 5KFVA 4PPDA 1N34T 4M5MA 4CNZA 2ZM2A 5FKYA 3ZC1A 1FO1A 4ZI3C 2YNFA 2PG8A 1AZSA 1T03A 3TVYA 3AE1A 2V8HA 1U1KA 2B9YA 3KLFA 1N0VC 4DR5J 2E1RA 3EZUA 5HEHA 3PRVA 3W5ZA 2MQPA 3ZZZA 4YQWA 4O3OA 2Q9QC 1DTTA 3U78A 1F0XA 2VV5A 1FWPA 2WW8A 3MM6A 5THWA 3ZKRA 5GADU 5D0RA 1RTJA 2RRNA 1AA1B 2BBJA 4AISA 1UAWA 4MAKA 3G6VA 4PW8A 2VODA 1HNZT 2QA4S 1JLFB 3UQ4A 1FDDA 5FXXA 1RTZA 3UVJB 3OL7A 3NS6A 1DHMA 3EPIA 1SCJB 4WFZA 5HXEA 2HMIB 3TLVA 2DXEA 4NA3A 1LW2A 2CQGA 2W61A 4FNHA 2V8SV 3ZTOA 1Q5VA 1KQGB 3K5LA 3NMRA 2J9CA 5DLGA 2E8IA 4AXPA 4I64A 3BQLA 3S4UA 2IRUA 4F4AA 3QATA 4J9NA 3AA1B 2MKIA 5IM0A 1YQHA 1Y10A 1U49A 2AP6A 1RAHB 5KFMA 4WIQA 3DI6B 3CCLS 4R8UA 1WKLA 2FJAA 3I9YA 2OH2A 1RAGB 1HMVA 3P3DA 4L76A 1NWMX 1K73T 2JVRA 5DQHA 1YITS 3HKZD 2YKMA 1RT6B 1UWAA 5EX0A 5C25A 1U8SA 1VFJA 3E08A 2HWIA 1V5IB 4JEHB 1IBLF 4LF6F 2F40A 4I7FA 2JQKA 5AQQB 1YQ3A 4LVNP 3POTA 2OV9A 4LFCT 1S49A 4YP3A 1N52B 1NCLA 1YJ9S 1YK9A 2DGUA 3CCRS 2ERRA 2M0GB 4TWFA 2FY8A 3MM7B 4ZVOB 1D9DA 3IR7B 3P4QA 2FVPA 3K5PA 2QFIA 3BGRA 2BKPA 2JMKA 3G2XA 3MM9B 4OLPA 2A9UA 1YJ7A 3GILA 2F5GA 4LMKA 2CPFA 3J7AN 1O3XA 3QGIA 3QUJA 2A10A 2CPJA 1ZS6A 4IUFA 4XAXB 1M5SA 4G1PA 3ONJA 1MIYA 3UN5A 5FLXU 2AGOA 3PX6A 2YQ0A 4N78D 1PC5A 3EPGA 3M30B 3EGVA 2VWAA 4UELA 4ISSA 5L9XA 3H8YA 2HLUA 3MA9A 4WYVA 2HNYA 4OQJA 3CVRA 1UCNA 2FQQB 3CD0A 3ZCIA 1SUMB 5I3UA 3R6GB 1OS5A 1S77D 2NCKL 4BBYA 4U2YA 2IPOB 4ENOA 5E3CA 4DI6A 1C2PA 1ZPWX 2F65A 1DBDA 1HKAA 1ZOYA 2MKHA 1J5EJ 4W98A 2UU9T 4CXWA 3UDVA 2EG1A 1UKUA 3BV8A 2UXDT 2FHOB 3AB3B 4P2FA 4G3IA 2MQNA 2NP9A 3TQ1A 1HX8A 5A8KB 1R8HA 3KMQA 2HH7A 5GONE 2ATCB 4AKRB 1U1QA 1T02A 4ZKAA 4M5IA 3KTQA 1FKPB 3LUYA 3MOZA 1NB7A 3SRZA 1FRMA 4U7CA 5F3ZA 1JNRB 1CJKA 2ZH6A 4DUZJ 1CJVB 4RL1A 2HRYA 3AJ2A 3VWSA 3T1YF 3EVOA 3FFIA 3F44A 3OTOF 3BBCA 5B7WA 1QAYA 3OHBA 2FPHX 2BANB 3VVUA 1ZM3A 1FNOA 2C1EB 2VG6A 4RWXA 4RW7A 4X65J 5AQUB 1VHIA 5BR8F 2VKRA 3RB0A 4NLTA 1VK8A 4HWFA 3AHPA 5E3QA 1T9WA 5J1GA 3HR0A 2R7XA 3KMSA 3VAFA 4PWWA 3FEXB 5DGAA 3VQSA 3IM8A 3K3QC 2W2UA 1IBLT 2M4MA 4USKA 1T3OA 1NB2A 2H65B 3H7HB 2DNPA 3G86A 4DL3A 2V4QA 3CCWA 4J37A 1IBCB 4CH0S 4HHHA 4R5PA 2VVNA 1IBKF 3O1HA 4ECSA 3Q83A 2NXUA 3C8YA 1S1XA 3ET6B 3MEDA 3AJ1A 2IAKA 4YMEA 1U2CA 4DLGA 4GVBA 3IBFB 1JIHA 3N2GE 3JXOA 2L08A 4IE4A 5IWAF 1NPRA 2YWHA 2LXIA 3KHLA 2HQDA 1Q5YA 5BYSA 1WLXA 2OA5A 2MMYA 4ADZA 1PGZA 1RKIA 2W2NP 3HJFA 3MD3A 3AH6A 3KDSE 1IJ5A 1X8DA 3NMAA 1RWPB 3CVKA 1BR2A 1EJ7L 4DF4A 2XBPA 4JV1A 3RW6A 3L95X 3D66A 1V3RA 4B9TA 4GKKF 1LWXA 4NXMT 3N5LA 5IC4B 1U1NA 3Q2SC 2XLIA 4A46A 2R4FA 4OYBA 4F8RA 2M6BA 2BG9A 1S76D 2GW8A 4HN9A 4O4IE 3W8GA 2XS5A 3LDQB 1KVJA 4MIBA 1RTIB 4GO7X 1NSQA 3BQ2A 2AJ2A 2NZCA 1SJ4P 4TY8A 2UUAF 4N41A 2IIUA 3BREA 2ZJPQ 1N36J 3DLJA 2ZKTA 3GV7B 3WAKA 2JEFA 5T14A 1TMJA 3RYLA 1KEYA 1RISA 2C2KB 4U96A 1SQGA 2HN1A 1I94J 1SL2A 4B9VA 4JI0F 4FI5A 1CS4A 2CVIA 2MPKA 3OVBA 1VIXA 4AT1B 3ULHA 4OI0A 1D0XA 4YDDB 1V9OA 1XWMA 4Y65A 2D41A 1YXRA 5HLFA 3SS1A 3W60A 3T1YT 2N2NA 1WTBA 1U6ZA 1QSLA 2ASYA 3IA3A 4H4MA 4USJC 4DR5F 2VFSA 2WVBA 4JOUA 1AJ3A 2LP4A 2CQDA 3OTOT 3QOFA 5HXHA 3CJ4A 2DCFA 4IOBA 1RHJB 3D0GE 3DN9A 4Z37A 3DOMA 1UZHA 4ZHRA 3IRXA 4Y2AA 2DPJA 1LWCA 2LSGA 5BR8T 4CN4A 2GJ2A 1MWYA 2MB0B 4DFJA 1O5JA 1FF2A 1HBNA 1VC6A 3AAAB 5L3FB 4DR3T
chains in the Genus database with same CATH topology
2OGUA 2BKNA 4L73A 1T8BA 2AEJA 1T72A 3RBZA 2BKPA 4L76A 1VCTA 4L75A 1XWMA 1SUMB 4J7CA 4GVLA 4XTTA 2AEFA 4J91A 1LNQA 3L39A 4J90A 2AEMA 2OLTA 2I0MA 4Q25A 4L74A 4J9VA 4J9UE 3RBXA 4EI2A 3L4BC 4G65A 4RO0A 2FY8A 2IIUA 2BKOA 3KXDA 3JXOA 4YS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OGU A;  2BKN A;  4L73 A;  1T8B A;  2AEJ A;  1T72 A;  3RBZ A;  2BKP A;  4L76 A;  1VCT A;  4L75 A;  1XWM A;  1SUM B;  4J7C A;  4GVL A;  4XTT A;  2AEF A;  4J91 A;  1LNQ A;  3L39 A;  4J90 A;  2AEM A;  2OLT A;  2I0M A;  4Q25 A;  4L74 A;  4J9V A;  4J9U E;  3RBX A;  4EI2 A;  3L4B C;  4G65 A;  4RO0 A;  2FY8 A;  2IIU A;  2BKO A;  3KXD A;  3JXO A;  4YS2 A; 
#chains in the Genus database with same CATH topology
 3MWB A;