2BKPA

Structure analysis of unknown function protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
total genus 74
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkpA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkpA02
4J90A 3RBXA 3JXOA 4L75A 4Q25A 2I0MA 4J9VA 2AEJA 2AEMA 3L4BC 4L76A 4XTTA 2AEFA 1LNQA 4EI2A 2OGUA 1T72A 4J9UE 2IIUA 4J7CA 4G65A 1VCTA 1XWMA 4L74A 2BKNA 4RO0A 4J91A 3L39A 4L73A 4GVLA 1SUMB 1T8BA 4YS2A 2FY8A 2BKOA 2OLTA 3KXDA 2BKPA 3RBZA
chains in the Genus database with same CATH superfamily
2DI4A 3CKDA 2YNGA 1YBUA 2UU9F 2NW9A 2XQ4A 3Q5WA 1U1OA 2F63A 1B7FA 1E6YA 3NL0A 2L08A 3PYFA 1YLXA 5K14B 1OEDB 3G8TA 2MY7A 2NPFA 4HFIA 3A7MA 5B0AA 2MLZA 2BVMA 3U1MA 5IM0A 3MEGA 3MM9A 4YFUA 2RS8A 1YBAA 3LANA 4G1QA 2ZNYA 2DH9A 3HSZA 4KHZF 4ID5A 5FLXY 3IS9B 2R2TA 4DEZA 3RYLA 4L3KA 1ZBTA 3K8PC 3N9UC 1N33F 2RNEA 3LWMA 1LW0B 1D0ZA 2J5AA 2V4RA 4LVNP 1HNVA 1EJ7L 1RAOA 2HFNA 4LFCT 1XDPA 4DVDA 3W1YC 4N41A 3MM8A 3BYRA 4ZHQE 5CB4E 1FFSB 2RRBA 2KI2A 2KG1A 4BCAA 2F4VF 1SI9A 4X65J 1H2UX 2ADCA 4NYOA 3FZFB 2VQFF 1XWMA 4ZI3D 1TL7A 1RDRA 4HFCA 5LG4A 3LAMA 4CH7A 5F8LA 2N3LA 2OPQB 4PUOA 4WXOA 4KPCA 4DR4J 2L41A 1K0VA 2VC1A 2UZAA 1Y5IB 1UVNA 1XIQA 3FMWA 2BQUA 2BRKA 1LK5A 2FHMA 4DR6T 3QIPB 8AT1B 1NEKA 2VG7A 3MZIA 4QWBA 3FJ2A 4FYYB 1HBNB 2QO3A 4UTGA 1YJVA 2ZC3A 3CMAS 3E8OA 1MU2A 4EZ9A 4RUBA 1RU1A 2ZVIA 2QMUB 3A13A 1MLAA 1N54B 4NRTA 1VC6A 3DRPB 3OJSA 2LEBA 5FLXU 1T9WA 2PIIA 4ZP6A 3QC9A 4NA2A 3TZZA 1RHJB 4L75A 2LXUA 4CIOA 2B3TB 3ZZYA 2X1BA 1V9DA 3BGLA 4O4GB 3ILOA 1WSRA 4P72A 1PYOB 2N4DA 2A6MA 3DGPA 2W01A 4RZRA 3EJMA 5ETVA 5JVHQ 1RWPB 2W4PA 4LF7T 2VG6A 3JTOA 3W7BA 2PFFB 4LFAJ 2IHR1 3LJCA 3D2WA 2DXDA 3HA4A 4GKJT 2BG9C 5KFFA 1IM6A 1J2VA 3NMAA 5D3GB 1Z2ZA 1H7XA 2VQET 2XAQB 4FS1A 1RYSA 1R7IA 4QR0A 4C8KA 3OR2B 2WBMA 1DLOB 2H88A 3AA1B 2B5JB 3MI7X 5JRCA 1R8AA 4X62T 2DIUA 4UEMA 1TP7A 5ABFB 2CXLA 4OYIA 3UU6A 1JNZA 2E5HA 2KDOA 3RRGA 2Z58B 2D0TA 5HSPA 1BY9A 1JLQA 1MMNA 1WYBA 1F6TA 1N0VC 4P2MA 5M2PA 5EWEA 3AE6A 3AHPA 3CJ4A 3V6KA 2OH2A 1TUVA 2FJWA 2X9YA 5HO4A 4CT9A 4RNMA 1UCUA 4H4KC 1S9FA 5FXVA 3Q9DA 2V2ZA 1S97A 2FUPA 2OIHA 1RA7A 3KK2A 2V8HA 4USUA 1NDPA 5LCYA 5A8RB 5HROA 3GN5A 1IJEB 4C91A 4DV4J 3M6VA 3MMBA 4ZEYA 1NCLA 1FE4A 2IJNA 1FRJA 4TN2A 5JDLA 2ASYA 4NXNT 5LOVE 2J0SD 2JFDA 3P6YC 1FKOB 3SOLA 2CJAA 1NKCA 3C6UB 3ZPOA 3SWHA 2CPTA 3GV8B 5F0WA 2L9WA 2AP6A 1H38A 2CQDA 2OPRA 5I42A 4H4MA 3Q23A 2FVSA 3RYCE 2E5JA 4PWWA 1CULA 3NEKA 1WHWA 2HPLA 1Q16B 7FDRA 3HKCE 1D0XA 1S6OA 1AZSA 4ZVUB 3P3DA 2KXNB 1U1NA 3R5CA 3GILA 2CPYA 3N9PA 2EK1A 1K9MT 3ZJ2A 2DCFA 2JQ9A 2V8DA 1TK8A 1N6QA 2BDPA 5CD4A 2GC8A 3IXQA 2NUHA 4J9LA 4QOTA 1BR2A 5E7OB 4CT8A 1FX2A 4EI2A 2I0XA 2V67A 1PKUA 2RQMA 4DV2F 2YNHA 2XO7A 2CPHA 3KLEB 1BXNA 1RTJA 4U74A 3H59A 2G1DA 2RVJA 2HMIA 1HKAA 2DLRA 2OSRA 1RU2A 4K4UA 3K2YA 2BJEA 4I68A 1KLNA 1RTDB 2YEVC 2UUWA 4TNOA 2E9TA 3LALA 1XMQF 5KFJA 3NWRA 3PM9A 2R7XA 1FT8A 4DX6A 3TQEA 1S7IA 1LFWA 5K8NA 1XNRT 4OZ3A 5DRKA 4WE1A 1YWXA 4Z90A 4KP3C 2LM2A 4PAGA 3HHDA 3MF5A 3N79A 3MWBA 6FD1A 3BGUA 3C14A 4ICLB 1X8DA 2VICA 3O44A 4B3RJ 2XO6A 2BM0A 1YITS 1UURA 5HEUA 3P8BB 2HFUA 5J2PB 3CCJS 4HWFA 4AD6A 1YZ6A 2EVZA 4USMA 1JNRB 3WIUA 1KHVA 1T72A 4Y6IA 3PDNA 1Q7YT 3OSPA 3NS5A 3TA0A 3ZCJA 5CA0E 4F2SA 2RQKA 2AYEA 3TA2A 4OV6A 3E0ZA 2KZMA 4DV0F 2UUBF 2R4FA 4RKUC 1QLNA 1LNQA 5KFYA 3DI6B 4QYZJ 3QT8A 3AY0A 5K9FA 4FPRA 2DPJA 1N48A 3CW2C 3KJVA 4RU9A 1T98A 2HHPA 4JI7T 3J9X1 3EPIA 4AL5A 3M8PB 3Q5EA 1S10A 2V8GA 1OSDA 1QLBA 4JOUA 4JI3F 1GMWD 1WC4A 3LK42 4RW9A 3R6GB 1R6YA 1KF6A 1T03B 5EHHA 1M7KA 4FF3A 4O3RA 3H4DA 5M2UA 2RMLA 2GQQA 3M6UA 3LW5C 1RT6A 1ZM9A 3LH2S 2MKSA 1U5PA 3V81A 1KNPA 1AYEA 3HVTA 5RUBA 3HHNB 1RQ0A 4ZJLA 4NLDA 1ZS6A 2G0UA 2QA4S 2E66A 3M9OB 3WAJA 4DSEA 2CADA 2OD4A 5GADU 2NREA 2MYFA 3PHEA 4MMOA 2CQ1A 4NL5A 3IO1A 2LSIA 5B0EA 1SKWA 2J0WA 1T0TV 3OD2A 3M2RB 2QSWA 4MK9A 2CPIA 2W61A 1LEOA 4B3SJ 1G1XA 4ED4A 3CJKA 2UUAJ 2MBGA 3BQ0A 3RYIE 2RF2B 1IR0A 3QAEA 5C42A 1MMDA 2HWIA 4HH1A 3VAKA 1EAYC 2ZDPA 2DB1A 4RO0A 3DHXA 4H9OC 3CJSA 3BR8A 3T41A 3FSIA 3IP0A 1WR0A 2YQ3A 4H9NC 4JV5T 1C4AA 5L38A 3N6MA 2QG9B 1SUQB 2EG2A 5J2PA 4EUVA 3IG1A 4DN0A 2BOPA 4ES1A 3ZZUA 3OUYA 2VOOA 1FKPA 5FDLA 3AE8A 4OLOA 3BBFA 5F3TA 2A1BA 4ZZBA 3ENVA 3I32A 1HLWA 5HEGA 3PYDA 3AA7B 2ODVA 3RAQA 4J9NA 3G71S 4TYBA 3IBPA 2DXEA 4CYUA 2XQ7A 1SQEA 1RSCA 2W62A 4UZCA 2XWXA 3IWXA 1K47A 2W7PA 3D6TB 1BD6A 1KQFB 4MK8A 4K4XA 3GFYA 3QSIA 2XZEA 1FHTA 2PFVA 3L9ZA 3I0RA 1WELA 2DNXA 3K1SA 2HMIB 2F3JA 3DNCA 1DAXA 4WIQA 2NYIA 4CN6A 4N76A 3PUGA 3QSYB 2FJAB 4JI3T 4ZA1A 2FBWA 1X5TA 1NJWA 3UVJB 2K3KA 1X0FA 3J7YI 3JSRA 3KLVA 2MHNA 3ETUA 1VQ9S 5JR9B 1QUVA 4ED2A 1VBKA 4L73A 4QXHB 3GMGA 3ZC0A 8ATCB 4FKXA 2V1DB 4PZVA 3HLUA 1VQ5S 3BSCA 2YINA 1YD8G 3QB5A 5IC4B 4KHPF 3E01A 4F7VA 5ETNA 4B3MT 3M30B 4NOHA 3MHYA 2J7KA 2UXBT 2C3OA 2X66A 5HXRA 4S0MA 1LRZA 4JEUB 5DM7Q 2AJQA 3TUPA 3VQSA 1YJWS 3HT3A 4TLQA 1KDNA 3IF8B 3K3OA 3UNYA 3RIUC 3O9XA 5EK3A 2V4JB 1OXZA 4BAYB 1RT5B 4JV0A 2CYYA 3CB4A 3Q8YA 2BKNA 5DETA 2C2MB 2HKEA 2NCKL 2DRBA 3FBFA 2BXJA 6FDRA 3BSNA 2CZ4A 1U1KA 1FRMA 2GQCA 3DMJA 1CQMA 3OL8A 3QOFA 3AXJB 4YR2A 3G82B 3GIKA 3E51A 4H63V 4N56A 3GIMA 4OHFA 3N5FA 2HAIA 5C24A 2KN4A 1HD0A 1Y3KA 2PMWA 1KTVA 2DCUB 3RIAA 1IBMF 2KL8A 3MECB 4LQ9A 1M1HA 2WHOA 4YTNA 2CNLB 3BDEA 1VK3A 3E2EA 1F1BB 3NGRA 4CI1B 2KYXA 1ITPA 2YNIB 4PJJA 2DNKA 4JI8T 3A12A 2R7WA 2VG5A 2MZ1A 3BKFA 3TW0A 4MKYA 3R6NA 1N52B 5CA5A 2CMRA 1DBDA 1FRIA 2ZBIA 2N1GA 1UPMB 3OSNA 1AUSL 1UPPA 2KVIA 4ZLLA 2GVZA 1WORA 4A8QA 2HRYA 4N8NA 1D9DA 4W98A 4PRFA 2H65B 4MHCA 3FBZA 2V8VA 2JQKA 5CA1E 1ZAWA 3PW5A 1XEZA 1IKVB 3W2WA 4XDDA 3BQ1A 4OX7A 4NCGB 2YWHA 2ZDOA 1OMSA 2YDRA 1PC5A 3OLBA 2HLTA 2XY8B 4K0KT 2DNGA 4IRCA 4RUCA 1HNXJ 5C3JA 4A56A 4DFKA 1LWFA 3DRSA 1C0TB 2FY1A 3CD6S 4WP9A 4LF9F 1VQMS 2NP9A 3KBTA 3BGRB 3AQPA 3HSJA 3V6JA 5IXUA 5JDMA 1JXVA 5J2QA 1K1QA 3UULA 2VBXA 4COFA 4WFAQ 3UFGA 3AE3A 1HFEL 3DRRB 5GAEU 2VFVA 1AA1B 4ITSA 5A2QY 4NEYA 1G2EA 1HF8A 3N5LA 4F50A 2RAQA 1YRUA 2FVPA 2F4VJ 3JAMY 2KNDA 3R1HA 2WB1D 2FJBA 3PUWF 2FUG9 4ZHRA 3SMZA 3W2VB 4DI6A 3LOUA 1K44A 3CC4S 3PNIA 5CHCB 1XNRJ 1VR6A 5LJ5Y 5LSLA 2FPHX 2ZJPQ 1FMWA 5J1NA 4P9SA 1C1CA 3ENWA 3O8WA 1WG1A 1XR7A 2XMJA 2JEFA 2KJVA 4F4WA 1VCTA 3AAIA 2MQMA 5AQUB 5AXLA 3QATA 1REGX 3SYZA 1H74A 2DH8A 2QGSA 2AZ3A 3LP0A 2VVNA 1RK8A 1DJ0A 2AJ2A 4ECRA 4U8YA 4B9VA 5L3CB 4WPAA 1UX5A 1RAJA 8RUCA 3MXZA 2ZC4A 2FJAA 1OO0B 2WQYA 1D0EA 1IQTA 4M95A 4DL3A 1SKRA 1VQ4S 2XMKA 3KYLA 3IS9A 2D9PA 4P2FA 2WSEC 1VBXA 2A3DA 2CQBA 3RU0A 4Q8FA 3X3UA 3RTVA 3OXLA 3NVOA 5BYQA 2JC1A 2BR0A 1LW2B 2DWKA 3T6JA 1VRTA 2NWBA 1K73T 3DYAB 3T8OA 5EK2A 1YJTA 4F4ZA 4PWDB 4IFVA 2UXDJ 1ZZNA 4ILBA 3UR0A 4B3TF 4PYDA 4GYRA 1V6HA 2G4BA 3LP0B 1IBKJ 4LF5T 1IR1A 3CJTA 4NUVA 3UT5E 3VAHA 2H1YA 2MZQA 3TRGA 4U7IA 2J9CA 4RW8A 3GA8A 1S7HA 4U7CA 2WBRA 1Q5YA 1JLBA 1JMTA 1FVQA 3CJ8A 2KXPB 2HG4A 3GCWP 3T5JA 3CJQA 4DR3F 3M1VB 2XQ6A 2VBWA 4PPZA 3BDPA 2B8PA 1JWWA 4DV3J 5ABGA 3KHGA 3JTPA 5EDWA 2RT3A 1EIYB 2R7RA 2K24A 1N8RT 4OYAA 4JEHB 4CLZA 4JI2T 2JEJA 1P6TA 4JUYA 2I5JA 3S4UA 4H4OA 1YKHB 4AISA 1FESA 1YGYA 5JMNA 2W0GA 4OHVA 1FK9B 5DLFA 4RUHA 5FP3A 3GPAA 4ES3A 2XY5A 2AJFE 3EGNA 1RP5A 4EYYR 3NY0A 4DV7J 2PI4A 3PV0F 3MM7B 2C2ZB 4AQYJ 4ZVQB 3RZAA 3KK2B 3IRXA 4KY3A 4YB7A 3KLFA 5AQJB 4ZVOB 3D1HA 3TUZC 1QVFR 4LJMA 2FVRA 2CJQA 2VFTA 3CJ2A 3DRYA 2QIFA 2HZCA 3T9NA 5AJ3J 2MOZA 2RU9A 1X4GA 4RR5A 1M90T 4JI7F 3AVSA 3POTB 5GVQA 2LECA 3FZKB 2CVEA 4EV6A 4M5KA 2JLFA 3FZ2A 2CCQA 1TK5A 1UEVA 3FUYA 2Y6XA 2L3LA 5FYMA 5DQGA 3VGSA 3X1DA 2W7OA 3MM7A 1YZ7A 2VPXB 3KLIB 3POTA 1L3VA 2X0LB 3ETOA 1HWKA 2LOSA 3MXHP 2YNIA 2Y1JA 2OPPA 1ZZFA 4H63H 2AV5A 4KGVB 4H4OB 2KVQE 1OWXA 2ZBQA 2EC0A 2CZVC 4O4GA 2UXBF 5FY1A 2AW0A 5DG7A 3KKFA 5AT1B 2IDOB 1FEHA 4EK2A 4XAXB 3PJ9A 3MJXA 2QEXS 2BE7D 1WEYA 2WU2A 4FBUA 2L9QA 2VKHA 1KFDA 1T95A 1DURA 2RQ4A 2WVFA 2WZHA 3RF1A 1VS3A 3DLKA 3AXJA 1JLBB 5L47A 4NZ6A 4KB7A 5LSRA 3MR2A 2VONA 1RE1B 4B17A 3M8QB 4L72B 1PSDA 1S1TB 3UCGA 2LDIA 5MAOA 1ZPWX 1CJKA 1CJUB 2YKPA 3PW4A 4GYSA 5AXKA 2P8IA 2IMWP 5LHHB 3KMQA 4HTEA 1VHIA 4I0WA 3DOMA 1HI8A 4C8NA 1SJ1A 4RJVA 3HMJG 4GKKF 3JADA 4LBIA 2UXBJ 1E6VA 2V69A 4IHJE 3ONJA 5J1EB 5ETPA 1IZNB 1PJ7A 2IM3A 5HVFA 2PEBA 2Y9HA 5F8HA 2DNZA 5IYZE 2DY1A 1NB2A 3QT7A 4JV5F 3D6MB 2IVFB 4K4VA 3V5RA 2R7TA 5IC6B 5LB7B 3BK9A 3HKZD 2F9JA 2IC3A 2IM1A 4PJMA 4TLRA 4DUYT 4ILMA 4I7FB 1TR0A 5CZXA 4CO0A 2B4VA 3DLJA 4JI4J 4ZLNA 3FEZA 4CP5A 1NK9A 4LF4T 3I96A 2Q79A 2LEAA 3OL7A 3ICLA 4FDFA 3DLLQ 1ZA1B 4Z91A 1NENA 3I5AA 3CXCR 3K5LA 3BBCA 3QBCA 3DGVA 2PA8D 5CAAA 1VCSA 5KFLA 1RHQB 1RWVB 4IH7A 1NPPA 1DY3A 3MMAA 5E33A 3KJQB 4MFBA 4NLOA 3DCAA 3PJAJ 2XZDB 4QH5A 3HT0A 1XNRF 3TVYA 3SFGA 1UVJA 2R8KA 4A8YA 2BBEA 5LXYA 1WDTA 2B7CB 2V94A 1FO1A 3TAPA 2V5HG 4HWDA 4Y2KA 4OMFG 2ZM0A 4U8VA 3ANWB 4QHOA 1D09B 2XEXA 5J2QB 3CEDA 2V7JA 4DPWA 2FVCA 3BGRA 4DS5A 3LFMA 3HX9A 4OQJA 5LA6E 2RKIA 1WSVA 4MYTA 4NYPA 4NLQA 2KMFA 3BKTA 4EBCA 2CLYB 2CQPA 3FQLA 5I3PA 3CE8A 1PYTA 2IDEA 2MLXA 3L3CA 1RWNB 1EKRA 4UUXA 1J1JA 2RE1A 3D0HE 2V6YB 4DR4F 1NBEB 2C3MA 4E8UA 2XMUA 3FXDB 4OV1A 2ZNZA 5KTQA 2QX0A 4YQWA 3KV5A 1FFGB 3G06A 3P50A 2QA7A 1X5SA 1SC6A 2ZH2A 2G9OA 2HHTA 4LRBA 3QIDA 2E2AA 2LSJA 3FCWA 4YY3T 4QIVA 2BV3A 2MKIA 3CJ5A 3TANA 1WCRA 4OHXA 5SUHA 1IWAA 1U8SA 3RB4A 1BQMA 3KDOA 4ZITA 5AQKB 3A3NB 4KHPT 4PXBA 1U2RA 5A8KB 4A8FA 3DGPB 3FK4A 2E9XA 3V5SA 2XHWA 3ETMA 3FBLA 5FMNA 1BWEA 1TK0A 3O6QA 4UW2A 5KFCA 2AX0A 3R1LA 3D6FB 3QWUA 1WG4A 4DSFA 3NLCA 2I1RA 5C24B 1N33T 4NRUA 1RJJA 3IRXB 4ZS6A 3CK6A 2A2FX 2W63A 2GHPA 2B1EA 4P1NA 2VG5B 4OJGA 3PO5A 2CHOA 3MPWA 3AVRA 1L3SA 4ELUA 2V6YA 2VG7B 4IO9Q 4AQFA 5ITHA 1UWBB 1X0PA 2BS3A 2RS2A 2DXFA 2UV8G 1VQSA 4OI0A 2WSCC 4ILRA 3AAWB 2YY3A 2QA1A 1FNMA 5C2CA 4FN5A 2E9XC 3G6YA 3G8SA 3QT6A 4PG6A 2QC3A 3LO3A 4DR5T 3MTKA 2VL0A 4X4SA 5HQLA 4PCQA 3OVSA 1J5WA 3M4XA 2LHRA 4NCBA 4DMZA 3AODA 1UFWA 1YXRA 2RPAA 4CLWA 5CYQB 4O3OA 3H2UB 3MM8B 4QIEA 3W64A 1NK7A 3L39A 2PN6A 1FDNA 1U02A 3MKDA 4IQXA 4DL2A 3J7Yq 1HTJF 2GO8A 3WX4A 1N88A 3CJ0A 3ZZPA 2DYAA 5LXTE 3J7Z5 1N34J 1X9SA 1Y10A 3DYAA 1HR0J 4CZCA 1RAEB 1ZM2A 1X31C 1JK9B 3MCNA 4O4JE 4R8UA 2MSSA 2ROPA 1AFJA 3SFDA 3RC8A 4DV6F 3KDSE 4DBRA 4GKKJ 1US7B 4PK4A 2BS2A 1UKUA 2DH7A 3CVRA 2BJ8A 2BABA 5EX0A 3HKBE 4J9UE 4YFSA 4OX9J 4WFZA 2JZ5A 1W09A 3EAMA 1G6BA 4F25A 2BOAA 2ILYA 5ETRA 3BN4A 3CCLS 2YKOA 1YIJS 5FL0A 1P1TA 2VQEF 3TQ1A 5KFGA 3ZYKA 1TU0B 2BYCA 2HHUA 2B56A 4MH8A 5HEHA 2YXLA 3L8RA 1NJZA 4QWEA 3DJBA 1FRXA 4C48A 3D54A 2RH3A 4A4JA 5KG5A 4GK0E 3H7HB 1KQKA 1IBLF 4ECXA 1SJQA 4NCAA 4ZOSA 2AX1A 2D69A 3BO4A 3KMSA 3M8YA 1N5VA 1UFKA 4LRDA 1FKAF 2QFIA 4QQBA 3GIRA 2NW7A 5KFSA 1TAQA 4HI1A 3FVYA 2VFUA 3MPUB 3SQGB 5I42B 2Z56B 1KQSR 2HYIB 5E3RA 2NOXA 4PNIA 2GFFA 5FDLB 4IR9A 4DV1F 2EXUA 1XK8A 3PVXA 1M5PC 4ZVRB 4USTA 1SUQA 5AE1A 5CYQA 1K1SA 4F3OA 3MMBB 3CQGB 4OJ3A 5IWAT 4QWDA 2V7KA 5HN0A 1FRLA 5LG3A 2CDQA 1PCAA 3H2LA 3GYNA 3CPWR 4ED1A 4WBFA 2WP9A 3QJPA 3MURP 2I0MA 4ETZA 2DNRA 1Q53A 1RI7A 2UXCF 5GMDA 2H54B 2MEWA 5KFAA 2Z2LA 2IA0A 4ED6A 2XB2D 3HPOA 3DKDA 4QH4A 1LV5A 3QNWB 2HZAA 1T8BA 3DU5A 4PABA 3UQ4A 3A8YC 1NSPA 4F04B 1L0VA 3OVUA 2DITA 4C98A 3ZT7A 4B3RT 3OKQA 4DPOA 3GLJA 5L4EA 4JI1T 4G65A 2V7LA 2GQ2A 3N9NA 3ZMVB 4RW9B 4UF4A 3MR5A 3W60A 2MMYA 4DV2T 5HBMB 4DR7J 3B54A 5IQ6A 2NXJA 4ISTA 3W15B 2FZKB 4QR1A 1T02A 3B6BA 1UJ6A 3UN2A 2NXEA 4Q44A 3Q8RB 3UD3P 2L3MA 2KYZA 1DQ9A 2GS8A 2PFDA 5AQNB 5LBMA 2UUCJ 1NJYA 1BC6A 4OJ1A 3HVRA 4F3QA 3I31A 3FBCA 4PG8A 1UW9A 4TYAA 1UMJA 4AXJA 2IRYA 3NWIA 4DUYJ 4E7SA 4JLEA 2XMAA 4BJMA 3BH6B 4FS2A 3M8PA 3DM2A 2D74B 5KMGP 1NPKA 1HBNA 2LHNA 4K50A 3CWJA 4K5RA 2R6GF 2ZMAA 2ZITA 2QFJA 3Q24A 3HULA 3ENAA 2Q9QD 5IT4A 5AQMB 4X64T 1C1BB 5D0RA 1A6LA 5EK4A 5LMNT 4TY9A 4DLGA 3R5DA 3Q8VA 3NNCA 4WF9Q 2FC8A 1KLMA 2ZH1A 2GIQA 4N78D 2R9LA 2JRKA 3ABVA 5EX3A 2GVDB 1HPZB 4NLGA 1R8BA 3M9MB 2BJ1A 1CJVB 4A46A 2OD6A 2KG0A 1WI8A 2VKJA 1YVFA 3D0TA 4ZPAA 3ANWA 4M5GA 3L7OA 2XQ3A 2DL1A 1P9YA 1PBAA 5L39A 3OXGA 1QUUA 1NB7A 2KT5A 3DOKB 2MJNA 1NDKA 2OV9A 1D8YA 5H9EK 1XMOT 3L09A 4WFBQ 4IFVB 4WK3A 3O5TB 4J9VA 1PAEX 1N32T 5ETMA 1SQFA 4QIWD 1N6QB 4MFBB 3IWLA 3AB3B 2NR0A 5HATA 1YJUA 5HANA 2QE5A 2HN1A 3MTJA 1YJRA 2ATLA 2FJDB 3NOCA 2HHVA 1AZSB 4CO5A 1RABB 1RT1B 3IFEA 2RHSB 1WD6A 1RWWB 3MGJA 4J91A 5AQFB 5KFVA 1OY6A 1O51A 3MR7A 2PGCA 3M8SA 2XCAA 3C2PA 4U9RA 3OFFA 2DNYA 4LF8F 2CPXA 1SL0A 4DUZJ 2XYHB 4B3TT 5AQTB 4DV1T 2IPOB 3THVA 1U1PA 2IJFA 3UR3C 4LF5F 3RB0A 2I38A 2OFGX 5IUXA 2E1RA 3M8QA 3HHLA 2B9YA 4F36A 5AQPB 3NWGA 1H98A 2AGPA 5D0EA 1CJVA 3NKZA 3ILJA 2QT7A 4L76A 5F8IA 3DLKB 1X9BA 2NZ4A 5HI7A 2DR9A 3H20A 4NZ0A 3E3XA 3EICA 3K3NA 3OBVE 3DC2A 2XSBA 3TNVA 1SPBP 4UZBA 4CXXA 1VI7A 1HG2A 5KT3A 4LMJA 4DN9A 5DDOC 2HHHT 2CFXA 4B08A 4M8LA 2DNQA 2HQIA 1O3XA 1UWBA 4DR6F 3W8GA 4QPXA 3ISNC 4C9DA 3T6BA 5LJMA 2XS7A 4RL1A 4J37A 2W4XA 4RW7A 2XPKA 5CYJA 4CCHA 2K1RB 2WS3A 4Q45A 3DXSX 4ZI2D 4HHJA 2XSAA 2CXDA 3TUJC 1OPZA 3MAQA 2DGUA 5I3QA 2AGQA 5IV4A 3J81U 4WBOA 4KBIA 3KG1A 1D0YA 2FB0A 2FLOA 1BHNA 1JXEA 4DPTA 2VBZA 3OTBA 3N28A 3CX7B 3A8EA 3HVTB 5AQHB 3C64A 4EOZB 1WHYA 5A8KA 4C97A 3T9ZA 4BS2A 2WK4A 1M1KT 4NCGA 3NCPA 3R5GA 5ABFA 2DNLA 4DR5J 2KZ7B 4LF8J 1BQXA 3NS6A 5BR8J 4DX7A 1YRTA 3T5HA 1RA6A 3P4RA 1XC9A 5DJQC 2ZE2A 5KG2A 2ZOMA 3KJFB 3C46A 3CD5A 1OWAA 3QLHB 3ZXWA 1SCJB 4J9KA 1UVLA 3MA9A 2J1DG 5IT9Y 4Z2XA 3GSDA 1ZHCA 4PK5A 3UCUP 3VRAA 4DHVA 3TKLB 4ENOA 3LWLA 1B64A 2X0HA 3VVUA 1FD8A 1RADB 1URNA 4ZLPA 4Q2MA 3S8SA 2DGVA 5DGBA 3C19A 4KHRA 4WZXA 2J6UA 5JDQA 4WWSA 1B99A 4E98A 2W9BB 2VOPA 2LU2A 4LF6J 3TVKA 4HDGA 1LKZA 4MTPA 1CEZA 1S9GB 2UVUA 2HQCA 2M88A 5CFBA 4ZIWA 2DR5A 3NBPB 3VRBA 4KJIA 4U2YA 3D68A 3J81j 3I82A 4GC6A 3UUBA 4G1IA 4U31A 4B6XA 5LGTB 1JNRA 2NZCA 2YWKA 3TZXA 5THWA 3SEOA 4KMCA 2WONB 1I94T 4A8OA 5C7PA 1DHMA 2BE9B 1I1GA 1TKXA 4OI1A 4KV8A 4WZQA 3NBXX 2EC2A 5ADZA 1Q0NA 3SCKE 3ZZRA 2LRLA 1G8XA 5B0GA 3Q2TC 2JNJA 2XQ8A 2IJRA 2FQQB 3HKWA 4NLVA 1T8EA 3UU8A 4Y00A 2GIRA 1SE7A 2OTLS 2DNNA 3ZZ0A 2OAUA 4DR5F 4NXMT 4TUYE 1XWLA 5HCMA 2V7IA 2HHHF 3GQCA 1GMVA 4X66J 3PV8A 4OX6A 1J5EF 1BWVA 5F9NA 3K5MA 4UT4A 2J8AA 3FGVA 3AAAB 4C8YA 2XQAA 4FYVB 4ZCIA 3LA0A 2YKSA 3R5AA 1U7LA 2QMWA 4JYAT 3NS7B 2ZD1A 3ZFVA 4JI1F 4E2FB 2ERRA 2LP4A 4MAKA 1NK0A 4UY8T 3HVAA 4KKOB 3QMQA 3Q89A 5IWAJ 1VRTB 1KD1T 5HXEA 1B0VA 4AL6A 2B43A 2GHVC 3ADAC 2V63A 2IC3B 4XPCA 1JKHA 2YNFA 5FXZA 2LDYA 4CRJA 1NH8A 1XERA 4NPPA 5D4PA 4WW0A 4DL5A 2E5IA 2AZ1A 3ZJ1A 3H0PA 2W2NP 5T14A 5HMYA 3SI8A 2MTLA 5K14A 3W2VA 4LR9A 2W9CB 2Y48B 3RQUA 4LBHA 2B76A 4IDZA 2FJBB 4H4MB 3NCRA 2J76E 3Q8SB 1S0VA 5KFZA 2KT9A 4I2PB 4IFYA 2ILZA 4EGWA 4TV8E 1V5VA 4YHHJ 2R7OA 1Y00A 1CJKB 1CJUA 4JI1J 2ALYB 4KV8B 1GAOA 2KRBA 3T5LA 3BQLA 3HSDA 2LT3A 4DR2F 4MT1A 3BKUA 4CLPA 3D3BJ 4B9UA 4DMWA 5FXWA 3FCVA 2V50A 4DU7A 3GN5B 2K06A 1TKTB 3D1QA 4YY3F 1T3NA 2X1FA 1GMWA 2HHXA 4B3SF 4F0MA 3CCRS 1SHZC 3HKEE 1S9GA 4ZI2C 1U1RA 5C42B 2KXHA 4HACB 2K5BB 4P74A 4DL7A 2W24A 3SBMA 3HHLC 3QGPA 1OY9A 1W7WA 3C6TB 4O44A 3K58A 3M3ZB 2IDLA 2VFRA 1H73A 4R0JA 3BSOA 5KFHA 5JVDE 1YTYA 4DV5J 1H72C 2EHOB 1PBUA 2VV5A 4DUTA 2E7VA 4X4NA 1X4DA 4WFXA 3LTOA 3TJ8A 3RYHE 3AB4B 3OTOT 3JSYA 2ASLA 3CC2S 1R89A 4OLPA 1DQAA 2D9DA 1MNDA 1F3FA 1I5OB 4MIAA 2AU0A 2EEYA 2WAQD 2E9XB 4YTMA 2APOA 2P9EA 2X0YA 3H3AA 3AEBA 3TOQA 2OTJS 3QZ7A 5ETQA 5HJYA 4DV3T 1R43A 4O4IE 2JQHA 4P7VA 4Z7YA 1NHKL 2H89A 3TAMA 4DJBA 4JYAF 3NRBA 4YHHF 4AUKA 4I6WA 4JI2J 5JUMA 1LVKA 4CZZB 2WY2A 3DN9A 4YSZA 3AB2B 3TLTA 2X3DA 1MIWA 2PT0A 1TTHB 1YW0A 2ZKUA 2QRRA 4KI0F 2VQEJ 3W9JA 4LUBA 4DV7T 3EDRB 5KG7A 2FLNA 1FTCA 2P5VA 3DLHA 3UUMA 3R2CJ 1N32J 4ZP7A 3SDEA 1YJ7A 3I0QA 3K89A 1KOHA 1RTIA 2BM1A 5L2LA 2F8HA 3EXYA 2HPUA 4C2MA 3GG1A 1U6ZA 2MY8A 5G4DA 4DOZA 1Y11A 4OYPA 2CXEA 2D2SA 2KFNA 2QL5B 1CC7A 1HWJA 1LFPA 2SXLA 3CQCB 2V8SV 4LFBT 2KRRA 5IT0A 3G82A 2N82B 4ZP8A 3CVKA 1BE4A 1XMQT 2UP1A 1N36J 2CAJA 2HNDB 1BR4A 4HWCA 1UTAA 2HFSA 2LQBA 1NK6A 4DV1J 2JOQA 5AQRB 2GGPB 1UEKA 4PXEA 3I0SB 3P5BP 4ZJOA 2ZH4A 3A3OB 1UVKA 2HH7A 3P4SA 1AXQA 1B7TA 3M2UA 4U6PA 3SIPB 4A8XA 1FJ7A 1FE0A 3DP7A 4U7UK 4OFZA 1OYDA 5IFMA 5LHGB 3MMAB 1HNXF 2HNZB 1VYAA 3AE9A 2EFGA 3W5YA 3MEGB 3MM9B 3R2DJ 4OHZA 2BQ3A 1Y01A 4UV8B 4Y2IA 5KXJA 3UFCX 1J5EJ 3RRKA 1J5OA 3LUYA 4R8UB 2CWXA 4HH0A 2G0JA 4CYUB 1HBOB 3OTOF 3OBIA 2V5DA 4XO0A 3D28A 3RUBL 5FVKA 3TZWA 4UOFA 2DTJA 2XGPA 3DOKA 4C4WA 3QZ8A 4KGXB 5DJBA 2G0CA 5K8OA 5HMZA 1HHQA 5IWAF 4A5XA 1L3KA 1WG5A 3K5NA 2JX2A 3J80Y 2RIJA 2CQ0A 4BLGA 5AXNA 5HP1A 1WYCA 5GAHI 3J7AN 4AE5A 3G4SS 2NTYA 2E5LF 1E6VB 3EE3A 2JVRA 3QWPA 1CULB 5J1PA 7FD1A 2HSEB 5EUHA 4WK1A 1NZ8A 2WVCA 2GCFA 3LP2A 3ZZTA 1IWGA 4LF8T 4JI0T 3JCFA 5J2UE 5H1SV 1C1BA 3PKMA 4E7ZA 1HI0P 4ZVPB 3OUYB 1LOUA 3F57A 2AT1B 2DWGA 1HWLA 2HHWA 4R5PA 2J62A 3LF0A 1VGYA 3CJRA 3W5ZA 3HD1A 1S12A 5HWXA 1YQ3A 3TYTA 2YH1A 4R0EA 2L8KA 3DM2B 3FKBA 3PHTA 2PE8A 5A8RA 2P2CB 3OTCA 2XM3A 1M5SA 2VU5A 4OZ0A 4RUAA 4LFCF 4MALA 2YWWA 5L9NA 3CUNA 4WU2A 3UU5A 3AOAA 3O1JA 4IG0B 4OYXA 3MMJA 2V26A 5G0RA 5L3BB 1RHUB 3TEGA 4WIIA 4GK5E 3TARA 1CQNA 1L3UA 4ZZCA 3QNUA 3PX0A 4P71A 2VPYB 5F8NA 1UL3A 3AAEB 2MZTA 2YX4A 4O23A 3GJTB 4WYWA 1PYSB 3UO0A 3KLIA 2AWZA 2BE2A 3DFEA 1CS4A 1HMVA 4W4MA 4DV4T 2PG8A 3CCWA 1IUJA 4C3KA 2VDIA 2HZVA 3NNHA 1IBLJ 5EGYA 3OPCA 2GMJA 2V34A 2VL8A 3JAEA 3GFZA 3V81B 5HVHA 3PW2A 2ES0A 3CWZB 1SVDA 4BC7A 3D66A 1RT6B 5DQIA 3U27A 4F4KA 3Q0AA 1KP6A 4ANJA 2WDQA 4JBCA 2BQRA 2XHEB 3NZPA 2V5CA 2OELA 3ZMSB 4K0KF 1HHTP 1T03A 2NR4A 2HS0A 2YPZA 2XASB 3TP2A 3EVMA 4ANCA 4QBUA 2HIQA 4UELA 2R8IA 2Q9QC 2OLWA 3DRPA 4NA1A 5L3FB 4CM0A 3GG0A 3RKOA 5AQOB 1MU2B 2IM0A 3HZGA 4ID8A 4ZJQA 4JYAJ 4DMVA 1R8PA 4NYZA 1TELA 4NA3A 2W4DA 4DUZF 3RIFA 1SB6A 4IDOA 4P10A 3UN3A 3CTRA 2KLQA 2KM8C 2X1AA 2CG4A 4FBTA 2ZBRA 4OK0A 3SV3A 3P5TL 2A0FB 2LOPA 4HT5A 2FLLA 2CWYA 4IFYB 2J9DA 2V4JA 4X66F 3JXOA 3SQGA 4B3ST 2Y0SD 3W8PA 1IKYA 5L3DB 3MR6A 4WE1B 3W61A 2D7SA 2FZGB 6AT1B 1RWOB 2XM1A 2BVLA 2RDJA 2FJXA 4WFNQ 5HXCA 2EFPA 1O5JA 4X4QA 4USWA 3GJSB 2RUSA 3RIUA 2YNFB 3MEKA 1D8ZA 5J2MB 2XAFB 2EW9A 2GK9A 2OMOA 4RLEA 1TKZB 5HXHA 2XAJB 1NPRA 2WZ1A 2RRAA 4DSJA 1KNRA 1F0XA 3ZN0B 1LW0A 2BEFA 3UVJA 4F0KA 3FHNA 2AYMA 2DHGA 5HVGA 2YVSA 3ZMUB 4YUDA 3B4MA 1VIXA 1Q7LB 2GX8A 3I0RB 2XS2A 1N34F 3TLVA 2C5IT 4MKAA 4G1QB 2CPDA 4WCEQ 4X4VA 2PC6A 3N6NA 2HBZB 4LRFA 4OYMA 2VFSA 1XQIA 3EX7B 3EDUA 3PJAA 3KK3B 1TZ0A 5KFQA 2DHAA 1E6YB 2IAJB 1YJ9S 4G1PA 4IDKA 3PXGa 3AEFA 3DOMB 1QAIA 3UDLA 2E9ZA 1JB0C 2YWGA 3G6ES 2FYXA 3OTOJ 4OJHA 1GXLA 1OEDC 3QFWA 1I94F 1UEUA 4ED0A 3VGUA 4OIXA 3ZT5A 3LGNA 1HNZT 4X1KE 4OZ1A 2ZOGA 2B8QA 3LK3B 4FYXB 5LOQA 1VDHA 4GRSA 3CQXC 1JXLA 3VR1A 2U2FA 4FYDA 3C50A 4ZHRB 4HFEA 1ZKEA 3OQ2A 2W7AA 3D7SB 5GAGU 5DQVA 2VJVA 3ZYMA 2VUGA 2W9BA 1K0TA 4GO7X 3CCTA 1EARA 3OTEA 3GIJA 5KFIA 4O3PA 5LJ3Y 4ILUA 4HI2A 2EFNA 2NLWA 3N0VA 1Q8KA 4DR2T 4I0UA 1GXTA 3BO3A 3EVYA 1A9NB 2Z2ZA 3HVWA 4UIGA 4Z37A 2EI5A 3N9OA 1S49A 5F41A 5KFTA 5A1LA 2B5JA 3HD2A 1C0TA 1U4QA 3H37A 1DLOA 3F41A 1LWEB 2DO4A 1ZM4A 3C4XA 3ZMZB 4MIWA 2RD5C 1I6JA 1W9RA 2NTXA 4DPXA 4HHHA 4DNDA 2ZLYA 3O1IA 4DV6T 2G0IA 3ZMTB 2R7QA 1WC5A 5DQHA 3H90A 4G63A 3N2OA 2NPIA 1BQMB 1KKHA 3QK6A 4ELTA 3THTA 3EABA 1PO6A 4P2SA 4FF1A 4DX5A 3HM9A 3MUMP 1EQMA 2RJZA 4OYWA 5JVGQ 3CDEA 1KQGB 2DEJA 2X7IA 1EX8A 4KGKA 5D3GA 3ZCIA 2WDRA 2E44A 2R8HA 1MN9A 1D1BA 4F02A 3WBZA 4XBFB 1E2AA 4ECVA 5JXSA 1XBWA 1H7WA 3PEJA 3Q8PB 5J0ZA 2NW8A 2WCXA 2Y3YA 2C42A 3UD5A 1MN7A 4M5MA 4LMKA 3NNAA 2F9DA 2Q1LA 5DZ6A 3IRWP 3DI6A 1S9EA 2Z0GA 4UUWA 1XZYA 5LP6E 5F8PA 1VBYA 2H3EB 1HS7A 3PY8A 3DLBA 3GTYX 4IIJE 3PR5B 2CQ4A 2H5EA 4K0KJ 2RKIB 3M1VA 4AKRB 1J5ET 3IR5B 1QE1B 3I9V9 2LLZA 2NYHA 3VHLA 2QLBB 4JI3J 4WU3A 5KFMA 4KH1B 5A8WB 4N5SA 1HX8A 2QA2A 4DX8H 4DUYF 3W9HA 4QX7B 3DMJB 4YHJA 3HHLB 1U1MA 3AA0B 1VRUB 5DQWA 1OS5A 1QUPA 2GHWA 2IUBA 5GMKa 1P1LA 2SPCA 1H3DA 1GTEA 2F1FA 4YOEA 4LF4F 2QYGA 3ZSTA 5IQQA 4HGAA 1F9EB 5C25A 3O3LA 3W5XA 4KAIA 2YK0A 3NKYA 1E1HB 1BR0A 3MM5B 1KOOA 1NHVA 2W67A 1Y3JA 4UOHA 1QSDA 2M6IA 2DNHA 4YB5A 2FJDA 3CD0A 4PFPA 2UUCT 2A72A 1KSPA 4R25A 4ZS3A 3KK1B 2AEFA 1S6UA 1S6PA 5MLCV 4O4HE 2ZUAA 1BMQB 4DV4F 1W2BR 2OFHX 1DARA 2XZWA 4PW8A 3CCMS 2DRAA 3I9ZA 2VKDA 3SS1A 2IC9A 3RHWA 4I7FA 4DG1A 4EXTA 4EYUA 2D0UA 1S35A 4ER8A 2KU7A 4P0BA 1SUMB 3ZEFB 1C1CB 2PTFA 2C28A 2C2NA 3CX8B 3PCOB 2UVWA 5IM0B 4ECYA 2W25A 1WKJA 3ITHB 2CVIA 2YX1A 5L1JA 2HK3A 3T1YF 2WTFA 4YLHA 3IAM9 3IR7B 5AQSB 4CLSA 2X68A 5AQVB 3Q2MA 1K8AT 4DL0C 3GE9A 3M2VA 2OPRB 3EVWA 1UX4A 2ROEA 2YNGB 4JV1A 3IA3A 2QN6B 3QPIA 2OJ3A 2MQ8A 3C6UA 2XI2A 2D41A 2IBKA 4USIA 5GONE 4L3NA 2XMWA 3BPDA 5J2NA 3MCMA 2AIRB 1XMOJ 3PRDA 4LF5J 2UU9J 1IXKA 5HAOA 4DFPA 3VAJA 1ZV4X 3PU8A 3R7NB 1CC8A 4KT0C 3ZN1B 3R27A 2O67A 2NUUG 2PEHA 3DRSB 1LWFB 3AT1B 4D3HA 4Y3CA 2H48B 2VODA 2XZTB 2IMOA 4X62F 3KVAA 3OW2R 1KNZA 5KFOA 4QW9A 5JDFA 4ZI3C 2FD2A 3RBZA 5HAXA 1NO8A 3J81Y 2XQYA 1HNXT 3OFHA 3VGTA 3OJAA 1BQNB 3DXBA 4BC9A 4N8OA 2HN2A 4ECQA 1RBOB 1DTQA 4OI3A 3QRPA 2JFKA 1IAPA 4B3TJ 1HL6A 2XMTA 2GMHA 3IHRA 3P96A 4YB1P 1JIHA 3OR2A 2YQ0A 4IOAQ 3CCQS 1BGXT 4TWHA 4ZK7M 1W0BA 4HTIA 1L5UA 5KT4A 1RTHB 3KTQA 5FXXA 4ETXA 3O2IA 4Y2CA 4OL8A 1VFJA 1T05A 3QFHA 3MMCA 4PK6A 2FLPA 1Z1ZA 1LWXA 3SRZA 4ZDNA 3JQJA 4ASKA 1KHWA 4EZHA 2V7MA 2ALZA 3RR8A 5KG3A 1WC1A 3GR0A 5L9XA 3GONA 3KLFB 1Q79A 5KFWA 1WC3A 2A10A 3CDWA 2BACA 5F8MA 2HNYA 4O3NA 1X4HA 2M8DB 2IFXA 4J9OA 3OT9A 1X4BA 3JS9A 1FK9A 2JH3A 3KJVB 2JIWA 4OI6A 2PMZD 3A8JA 2CKWA 4DS4A 1VC5A 1VRQC 3KJNB 3T1YT 3J7YU 5HXSA 3O1HA 2EBGA 5TAOA 3AA6B 1CHUA 2EFQA 4ZCKA 1A7GE 1HBUB 2HHSA 4JB8B 2VKZG 4USHA 3HL6A 2BJ9A 5L8RC 5SZTA 3C51A 1TL4A 1REVA 1H7CA 2OSQA 3LBXB 5AQQB 2UXDT 3WC2A 2WAUA 2G2OA 3CDAA 1T7PA 3QB5K 1HNIB 4AL7A 1IBKT 2OP5A 4DCOB 4X1YE 1HNVB 3QO9B 5JR9A 3MD1A 1NDCA 4DR1J 2XS5A 2OHDA 5KFBA 3GV5B 2VH7A 3PACA 1N5YA 1WHXA 1T3OA 4PWDA 1R8CA 4RW4A 1HNZJ 1PC4A 4YDDB 3KLGA 3SFUA 2XSFA 3PUVF 4KFBB 2C1EB 1LW2A 4PFOA 1KFSA 4CO4A 3QT5A 3R7BB 2VWAA 4DFMA 1Y5NB 1MROA 3HJFA 1S77D 3GMIA 3ULHA 1JQGA 3KXDA 3HXMA 2BANB 4P09A 1HBMA 1RGVA 3KLEA 2MJUA 2BBHA 1KONA 1HNWF 2CPEA 2LQ9A 3PUQA 2MLYA 1S59A 2L9NA 1SKUB 2XHCA 1FKPB 3OJUA 4EZ4A 1T94A 1SQGA 1RB0A 5L46A 2ZHBA 1SV5B 2WB4A 3ILIA 1VC0A 3C15A 3M6WA 1ZAXA 2WVBA 2M7SA 4U2ZA 2CPFA 4KR0B 1EETA 3T1AA 2X9XA 2AGOA 3EZOA 3PTWA 3LPEA 1DRZA 4HFVA 1U0SA 3RQWA 1S57A 1JJHA 1FFWB 1TV6A 3G87A 1SA0E 2ZH5A 4X66T 1CJTA 3G6VA 1QM9A 1FDDA 4ED7A 1Y64B 3NGKA 2I2YA 1RUSA 5F8JA 4H9PC 4HKAA 2V2VA 2VBYA 2RF2A 5LL6d 3NRXA 3MPDA 2ZBCA 3CJKB 1APSA 1M1GA 4PQUA 5BXIA 3O4XE 4F67A 1KFYA 3AJ2A 3M2RA 3K8VA 4U3CA 1RKJA 2ABYA 1HR0F 2LFVA 3RRCA 3MM6A 3VR9A 1JLGB 3A8IA 4UV9B 3EUHA 2EFOA 5HROB 1G4CA 1VQNS 3RGLA 4ZPWR 2NQPA 3ZLIA 1S4FA 3S1TA 3TO8A 2QL7B 1S72S 1WKKA 4FNHA 4P75A 4OZ5A 2HRTA 3FBEA 3NXZA 4XK8C 1LK7A 1FNXH 3VU7H 5GAEI 5LNKA 2M3DA 4IQMA 4BWMA 2ZH6A 4IO1A 4M5JA 3HFKA 5ETSA 1RBAA 3B13A 1ZTWA 3RBXA 4LSNB 5DDQC 1IKXA 3CCZA 2QSFA 3TR5A 1FXLA 2DGQA 4P7TA 2OEKA 5EN1A 2CZ9A 2N9DA 4J5OA 4V1Ak 2VQFJ 1JLAB 3IR6B 3CIMA 3AE2A 2LLYA 4EYIB 1GX5A 4P2XA 2WZIA 3N2GE 4AI6A 1KEKA 3R7SB 1MMAA 2VG6B 1VLYA 1SC4B 2WB5A 2L48A 5DS7A 2ZVSA 1YK9A 3PG9A 4IG3B 1MMLA 1WOSA 4HFBA 3MECA 2F8MA 2MZSA 4FVMA 1UA0A 4KHPJ 4FNIA 1WOPA 5LT5A 4RNHA 1SJFA 4IE6A 2J7WA 1VLOA 3LPYA 1YBTA 1HQ2A 3FEXB 2CJ9A 5AQIB 4LF7F 3PTRB 5CGMA 2GJIA 4MFRA 5FD1A 2LJLA 1ROFA 1VQOS 3H5SA 4CXYA 2LQ5A 3VKHA 1CUNA 3Q86A 2VJUA 2PDAA 4QXCB 3ZTSA 1X4AA 1SJ4P 4KO0A 4ECTA 2YN6A 1N5QA 3F2EA 2AMCB 4B02A 3Q8UA 1CG2A 4I55E 1ZH5A 3KG4A 3EUNA 2YKMB 3D0IE 1OIAA 2H3RA 2R8JA 1F5AA 2R2UA 4ANDA 3I9YA 3ITHA 2XGQA 2RU3A 2B9XA 2LEPA 3MUTP 5BR8F 3ILLA 3MUVP 3G9CA 3PKYA 2ZFHA 3ET6B 3W62A 4K5SA 5B0BA 4UF0A 4DZDA 4Q0BB 2LXFA 3M30A 4YB6A 3E01B 1NAQA 1M0SA 2JRSA 1IVZA 1Q8BA 4P52A 4ZP9A 1NUEA 5KT7A 4ZPCA 2XJ7A 2IMLA 2G1HA 4X4RA 4EZ6A 2UXCJ 3CCUS 1TUGB 2ZUGA 5BYRA 4HEAA 4IOBA 3FRYA 5E5NA 5HQMA 4NI2A 3FZBA 2WWUA 2J0XA 5T7LB 1NSKL 2YNHB 2MQQA 5KFEA 3LGHA 3PYGA 4C8MA 4RNFA 1X5PA 4KRWA 2J9EA 2C2DA 3MAHA 2DR8A 2FHJD 5HLFA 1SIZA 2GZOA 4K59A 4ZI7E 2B6AB 3JC6C 2M2BA 3K5OA 1D1UA 4FP9A 4K4TA 4P6QA 2R2SA 4DR7F 4MLKA 9ATCB 1BUXA 2BKPA 3WIVA 5LGUB 1MWYA 1IJFB 1F2HA 4QWCA 2GIFA 4DCPB 2PBIA 4F4YA 1P9QC 5KG1A 4GKKT 2CNKB 4YXDA 2V4QA 3P49B 3ONXA 4LFBF 3FRZA 2C2RA 5J2TE 1N36T 5E41A 4YS2A 1KEYA 4WXWA 2LKHA 2Q9QA 4ISSA 1RLCL 4TY8A 3C66A 2W2PP 1FJGF 2W2MP 1TVRA 1FDBA 3D9BA 1D9FA 3SSSA 1N4LA 1URRA 3IG1B 3PFOA 5A6WA 2QLJB 3VALA 2ZH3A 1FI4A 2MHEA 1FKOA 4KYZA 3BZQA 5KT6A 2BX6A 1R27B 4PAAA 3C4ZA 3TA1A 5A0YB 2HURA 5CJ5A 1W2IA 3HZEA 4IREA 2A3JA 2V2QA 5H9FK 4O0IA 2CNOB 3MPYA 2ACXA 2XM2A 4A48A 3QRRA 5JDNA 1IQZA 3KHHA 4IGUA 4ILLA 3H40A 2KFZA 4ILAA 4JV2A 3CO9A 2X9HA 2HGLA 1U25A 4OZLA 4H4KA 1AROP 2Y1IA 1HWIA 2JPFA 3PFEA 3VQTA 2KT3A 1IKWB 1VHFA 2B0GA 4DWIA 2LEHA 3JQKA 4OYKA 1N33J 3P4UB 3G6XA 4YDXA 2OPPB 1BLUA 3TI0A 3NRYA 5JRCB 3BB5A 3K3QC 4DSLA 3IA0A 3NZQA 5E0OA 4IDPA 1MW7A 4D3GA 3ISZA 1QSSA 4QU6A 2RA1A 1NJIT 4IT4A 2JLEA 3QJJA 3HFVA 3UDEA 1U24A 2UUAF 1YG0A 4X4TA 2EHOC 4O3QA 2MGZB 4X4UA 3WDOA 2CQ3A 4DCJB 4DR3J 5L3GB 2HWHA 2IVYA 2I6HA 1SJRA 1FWPA 5D77A 1FEEA 4IH6A 3V4IB 1DZ5A 3ZZOA 3NOGA 3ZNUA 3CULA 4LIRA 3C16B 2NS1B 2AXDS 4WJBA 3RBEA 2UUBT 1FVSA 4AKHA 3ETVA 1HNWT 3RW6A 3RW7A 5E3AA 2C5KT 1IBCB 1O8BA 1KRPA 3OFEA 2R7SA 3TX8A 2A18A 1Z4UA 1S1VA 3P4PA 4LR7A 3IGNA 1YJNS 3RKGA 1MNEA 3BGOP 1B3TA 4HLBA 2OPSA 1JJCB 4DR7T 5H6QB 5ABHA 2Y1RI 4CXWA 3QIPA 1VISA 3X1LB 3MEDA 2WSSV 1IBMJ 4BBYA 2E5LT 3M7VA 3R8YA 3EDQB 2OPQA 3RR7A 4PUOB 2ACYA 4EWTA 2ODUA 3UNGC 3UD4P 2FGCA 4IL9A 4OX9T 4KHMA 1TL7B 5IOLA 1NMEB 3BQIA 4DO0A 4LF9J 4RW8B 4WYLA 4CH1A 4GO5X 5L1LA 5K8MA 2GO9A 1RWKB 3NGTA 2JMHA 2J7UA 4A98A 1T11A 2P6SA 1UP1A 2E1MC 3AOBA 3JC6D 1JLCB 1S1XA 3B4DA 5U47A 1RT3A 3BO2A 3S01A 3C14B 4ICLA 3PZPA 1ZYQA 4ATNA 5DLGA 3A1YG 1Q8IA 4X64J 2ROGA 4K4YA 1FX4A 2LSYA 4FKYA 1WF2A 4V19X 4FI5A 3PRVA 4M5DB 3CDUA 3UFEA 1FERA 2Z2YB 3KOAA 2J9DE 1WUUA 2DJWA 4I6YA 3GZ7A 2D3OR 4NLYA 3EGVA 1M5VC 3MAAA 5CXTA 1X5OA 3KHLA 3ZC4A 1RISA 2FZCB 4YJ2E 1WTFA 4MKVA 4NLPA 3PDYA 5GAGI 3IAS9 3OL9A 2J6TA 2QL9B 4PQAA 4WYVA 5LGNB 2N4CA 2VC0A 4UF0B 4I64A 3CCSS 1RAHB 3ET6A 3HP6A 1VQ6S 2B4OA 2W2OP 1QAJA 2BRLA 2V8PA 3RX6A 3R6LB 4UXNB 2XY6A 3B57A 3PIPQ 4LVOP 2CWOA 3V5UA 5LMUJ 2AHOB 5K5MA 1YX2A 3GJRB 4J9SA 4ZVTB 2LQJA 5FY0A 5KFUA 1TL3A 4HR2A 2BG9E 3J7ZT 2A6OA 2W2UA 3Q83A 4CO2A 3DRRA 1S1VB 2AYGA 1HQEB 3BM7A 3T1HJ 4PR6A 3AEDA 1RWUA 2ATCB 4DV2J 4B3MF 1WWHA 1S1WA 4URSA 1HARA 5HK4A 4NMLA 4K7QA 1RZMA 1Q5VA 2JQQA 4ZPVR 1YDLA 2XYPB 3M9NB 4MK7A 3WAKA 4K4WA 5DABA 5CQGA 4FXVA 4OX9F 2CBIA 4LSLA 1RAGB 3K17A 4YN3B 2CDRB 2IC6A 2DY9A 1U2CA 4Q7AA 2DKOB 5JJBA 1V3ZA 2UVVA 2D3O1 3M32A 3I55S 2CIMA 3K0JA 1W0AA 4NXNF 3GFHA 2LU1A 2CUYA 2HFZA 1RCXB 4DR6J 3QYYA 4IE7A 4ALZA 1NDLA 3ZSSA 1WF0A 4OX8A 3VZHA 2GVZB 1FD2A 3BV8A 3GJQB 4DV7F 5I3UA 2KH9A 3U78A 3OL6A 1B0PA 4J9PA 1FWKA 1L3TA 1DTQB 3ELHA 4O2AE 1HQUA 1KWMA 3KNGA 4YR0A 1X9MA 4QIGA 3DDIA 3DLGB 1E7PA 4ZOLE 5LMNJ 2NXCA 5G0RB 3GYGA 4I56A 1PJ6A 3KUGA 4A8SA 3UQ7A 2ZJQQ 2JJ9A 4DV3F 2IYIA 3RG6A 2ZBPA 3W9IA 3FFIA 3F73A 4UQTA 1MIVA 3C8YA 1EB0A 2H5JB 2ZJRQ 4NLTA 4HTJA 2QLXA 2GW8A 2ZZMA 4LF7J 5DG9A 3AD9C 2WCAA 2B7BB 4LFAT 2B4PA 2AEMA 2W66A 2UXCT 1N36F 3FSXA 3NMRA 1EP4A 1SIWB 3CGIA 3FEYB 1RBLA 3T1HF 4RBTA 3GWCA 4Y65A 5KFDA 4K0UA 1HQEA 2R7UA 1ZP0A 4R5PB 1Z0PA 3EDVA 3AE7A 4AQYF 4BDPA 4IRKA 3GWHA 1F9FA 2ZH8A 2MTQA 2H4WB 4QWNB 1HNZF 2Q9QB 4O4LE 1X4CA 4X62J 3DHWC 2CA9A 1RT5A 5EZYE 1RTZA 4I4TE 1YQHA 3TUIC 2BW2A 5F9LA 1UGOA 4DV6J 1NZAA 2FGOA 3QAUA 4K8RA 2CQCA 3W66A 3L3PA 5LHIB 3PJWA 1FTRA 3AEEA 2O3DA 2B6AA 5D78A 4DG1B 2K48A 3BEGB 3EGWB 1U0HA 1U26A 4CI0B 1EKSA 3VCDA 2LYVA 5M4YA 3KWMA 2BUNA 3M65A 3MAAB 5T7LA 3EGZA 3ZKRA 1QAXA 4X65T 3DLEB 2FDNA 2HVIA 5D0GA 4NWBA 4M5HA 3W3SA 2W2QP 4OYJA 5H9EJ 3RAMA 2ZZNA 3IGVA 4TU8A 4ID5B 1NNDA 3C98B 4LF6F 4DR4T 2AKWB 4NXMJ 1RAIB 3B8HA 3K7RA 2XY7A 4NEZA 3Q8QB 1XNQT 2NXUA 2YTCA 4ADZA 3AA9A 4L0RA 4B9TA 4XTTA 2ZH9A 1N5YB 2QZ8A 4EEDA 4RW6A 3UPFA 4G3IA 4CNZA 4XIUA 4AQFC 1WEZA 2YKMA 3UQSA 1LXJA 4YT0A 1ZETA 1LWCB 2HQFA 2PO4A 5AE2A 3KV4A 1OPIA 3OVBA 1VQYA 2LKZA 2CQ2A 4LIWA 2E1AA 3MR3A 4CLLA 4JI6T 3Q22A 2RILA 1T9YA 2ZEJA 5FKYA 2O01C 2IRXA 2XSJA 2A2CA 4IUFA 4TV9E 2FHJA 1NK5A 1QD1A 1T9VA 3HHKA 5IT9U 1HA1A 2XAHB 3PUAA 3M8ZA 3D3CJ 2L9DA 2MDAA 4YMEA 2D3UA 2XAGB 2X9WA 2E29A 4ECSA 1ZPVA 1AB8A 3FFIB 5BR8T 4ECUA 2DNPA 4XAKA 3AQOA 4J9RA 5L3EB 3AD8C 4Q25A 2P6TA 5IHYA 2FJVA 1UAWA 3NCQA 2Y8DA 4FPIA 5JR9C 2Z4PA 3PRBA 4L74A 4M5IA 2CJYB 2C3UA 2EFVA 4YHHT 4QCLA 3OVAA 4ZPDA 3G2XA 2F7VA 4CI3B 4Q43A 2HW3A 2DGSA 1S6QA 3NGDA 3G86A 3C16A 5A76A 4EBDA 4OZNA 3WZ0A 4I2QA 3GYXB 4IL4A 5M2RA 2UXXB 2YU1A 4CDIA 3DLGA 4JI2F 3SCIE 4I50E 3IMQJ 2YWFA 4B9LA 4KPYA 4HHUA 3RAXA 2YKNB 3PE0A 1T9UA 3WI3A 4TXSA 1UJ5A 4Z7CA 3L7PA 4LFAF 2HFOA 1JLGA 1I94J 4NXNJ 1HYSB 4Y28C 1VK8A 4RPFA 4F0HA 2IAKA 2D1CA 3UTKA 5DDRC 4WP8A 2Q6BA 5KX5E 3TWZA 3AECA 4NX9A 3BYPA 4I1TA 1MMGA 2FHKA 1MG7A 3L95X 1IKWA 5FVLA 1JLEB 3IBCB 4LSLB 3KBUA 4USKA 3M05A 4DL6A 3CO0P 3ZZZA 5LYJE 1U6FA 4ECZA 4U72A 4GKJF 4P73A 1ZEEA 4QWAA 2C5JA 5B7WA 1O0PA 3HJVA 4X5TA 4IKAA 2C3YA 2DPIA 3KUEA 4ZVHA 3V6DB 4CTAA 1SH3A 5LJNA 2ASJA 2CQGA 4NPOA 4PYAA 1ZOYA 1GEHA 1KR4A 3KLHB 4I2PA 2CEAA 3RYFE 2Y8WA 3M2VB 4JI5T 2VKRA 1PJ5A 1Y9OA 1N56A 2C2KB 5KT5A 2YDQA 2X3GA 1S0NA 1WF1A 3A8KA 4TWDA 2OMLA 5C2GA 3DOLB 4XPEA 4X1IE 2QRXA 4HVZA 4UVCB 2MQOA 4CLKA 3C3LA 4O0NA 1S99A 1HG5A 1NM2A 1D3WA 2HQ3A 3TLWA 3VTIA 3JTNA 1JKHB 3AJDA 4DBQA 4L5GA 4JBWF 4URGA 3H5UA 1RTDA 4FVCA 1V3RA 1H6KX 3KV6A 4LFBJ 4PG7A 4YEAA 4KFBA 3GV7B 1FJCA 2EWHA 2ZHOA 5HEOA 3MFHA 4U67Q 1G73A 2FC9A 1RTJB 1OYEA 3M8WA 3FNNA 2X1GA 4X20E 4QPTA 2LA6A 4TWFA 3TVZA 4ZVSB 1S1UA 4K4SA 4DDFA 4F3MA 1X4EA 2K7JA 3LG7A 1U6BA 1QY7A 5D4OA 3UWTA 1UW4A 2F5GA 3VKGA 4FYWB 2BG9B 3OR1A 3AEAA 2M0GB 2Q43A 1Y0HA 4AIUA 5DZ7A 2XNQA 1F5CA 2HVZA 3FZLB 4H9SE 2AJ0A 4L6V3 2W9AA 4EIWA 2WOMB 1CSJA 2GJFA 2WMNA 4TZ4C 4DV0J 1R0CB 5C25B 1VMBA 5KFKA 2XC9A 3DOLA 1NWMX 1XDOA 2WW8A 1RT3B 2GAGC 3UDCA 2IIHA 5CCLA 3RRWA 3T5KA 2U1AA 1RHKB 4CLUA 3QGHA 3JSMA 4M1PA 4IH5A 4ZPBA 3U7JA 2COLA 2WONA 1R8HA 2VD3A 4KGZB 4M94A 4URQU 4OZJA 2KJWA 3HSGA 2MKCA 3CCES 3BR9A 2K7KA 4F26A 4B3RF 2LA4A 1MSWD 3GCXP 4F4AA 2KXFA 3TZYA 2DGOA 3JYTB 1R0BG 4HWIB 3N4WA 3CIZA 3VVTA 4ZPTR 4YJ3E 1XN9A 1R8IA 3MEEB 2CM0A 2ZH7A 4DQPA 2Z6EA 4CN4A 5B0FA 1UVMA 1X4FA 5FL1A 3V4IA 4DF8A 1NKBA 3NAIA 3JSBA 1EHWA 4N47A 3CT9A 2LMIA 4KH0B 5BJRA 1M5OC 4JI0J 1JLQB 4PJLA 3PO4A 1VRBA 2G2ZA 1JNZB 3K8WA 4MYUA 1C4CA 1RKIA 2I9SA 1GMUA 2F40A 2OEJA 3R3TA 2ZM8A 4JI5F 4AFFA 4HKQA 2PSZA 1SC3B 4B3OA 4B3OB 4LSNA 1SL1A 2RHQB 2V0NA 3EPGA 2I59A 2M52A 4BJNA 2MAWA 2R2RA 5DO2A 2AJ4A 4Z8XA 3LGMA 3C4WA 1TKDA 2WU5A 2NXNA 1KBRA 4X64F 2V6AA 2KWHA 4QYRA 5AJ3F 3ZO7A 2Q3PA 1LWEA 1WKLA 2FHOB 2E1CA 2QJ3A 4KSEB 3MD3A 1XMQJ 5F8GA 2G13A 4QYZK 1YRXA 3PR4A 2Z57B 1XMOF 5GAHU 2PA3A 2IVMA 3PJXA 3I56S 5L4HA 3MPVA 2H4YB 4PKDB 4GVBA 2MQNA 1RXOB 4ZCMA 3IBFB 2HS3A 4Y2AA 3IBWA 1NKEA 1U8WA 2KO1A 4TY8B 1X7VA 2RUGA 1GXUA 5HCJA 2MZRA 4M5NA 2BW7A 1JLFA 2VURA 3JYTA 1XNQJ 1TL1A 2XBPA 5KDMC 1YHQS 2I6WA 2BDEA 1W26A 1KTQA 1TMMA 3EVOA 4C3MA 4NLSA 3C15B 3H5XA 2HAFA 4TQRA 4C90A 3OR1B 3BS9A 2OKQA 2AJ1A 4CO1A 3R84B 3LP1B 3RLFF 3TEHB 4KE5A 4JI6J 4K2JA 3A4TA 3SXLA 1LWCA 3SQOP 4M1KA 2BS4A 5HL7Q 4C6AA 5L1KA 1NAFA 4FJOA 2XQCA 1NJXA 1U47A 1HBMB 3V2UC 4B3MJ 1RT1A 2IM2A 4I6AA 2C3PA 3FMBA 2GAHC 2WOMA 2CE7A 4HFDA 4HE8A 4BHQA 1MROB 4NE9C 3ESLA 2YX7A 3CDBA 5ETWA 4CLFA 4DXLA 5JDHA 1U4BA 2CJKA 2P9CA 5HLFB 4WKYA 1I51B 3FSYA 4WBNE 4F6RC 3KLGB 3T3FA 3ONLC 5LMUF 4V1Av 1FCAA 3M2UB 1XJWB 2HEKA 4TNWA 2AYBA 4GMKA 2VB6A 1OEDA 3QO9A 2UXNB 2RQCA 2ZM6F 2Q6CA 3QRQA 2CRLA 2EBEA 1Q86T 1TFYA 1VQLS 3AE1A 5J2MA 2JEIA 2N3OA 2HBYB 3CJ3A 1D9AA 4EO6A 4QKNA 1XR6A 2HLUA 2ZM2A 1HPZA 3JAFA 3D0GE 3CMLA 3QJLA 3FBBA 2KWIB 1NSAA 3PU3A 4WKRA 2VL1A 1DTTA 2MQLA 2XNRA 3H8YA 5L1IA 4YR3A 3B5MA 1ZM3A 3SCJE 2X67A 5D4LA 2LSKA 2HVHA 1M5HA 3AH6A 3SSRA 3P4QA 4JI8J 1VQ7S 5FNVE 3BSAA 1M5KC 1U1QA 4OHWA 1X79A 3L7UA 3V6DA 2HQGA 5AQLB 4GVBB 1IBLT 4EEBA 2J47A 4RX6A 1SKSA 1NXIA 1FMVA 4Y2MA 4XDCA 3G8QA 5ETKA 5KFRA 1U45A 1WFDA 3H42A 4LMZA 3PX4A 1RACB 4HFHA 4ED5A 1RAFB 1FF2A 3ZC1A 4TU7A 2CWKA 1UCNA 1QAYA 2OA5A 1MWQA 3B82A 2JL9A 2CPZA 2HVEA 4OYOA 1B4SA 4CNYA 4OI4A 4ES2A 4QR2A 2BKOA 1TQLA 1WHVA 5EWGA 2RB7A 4YSXA 5DG8A 3HI2A 2XMMA 2VDHA 3PUYF 2RP4A 5C5JA 1RTHA 4LRAA 3KINB 4MKBA 3LQVA 1IM4A 4AT1B 3UU3A 2XQ5A 1UWAA 4UOCA 3MCOA 5CD4H 3KUHA 1FJGT 4EBEA 2VZ9A 4UQGA 5D4NA 1HW8A 4WTOB 4Q5VA 3UDVA 1FXRA 2AF6A 2G2YA 3NGSA 4JI5J 4AQYT 4ZVGA 3IWNC 3ZTOA 2F4VT 1BQNA 1GX6A 1EQ0A 1HWUA 2V9KA 4C11B 3C6TA 4U7YA 2LRKA 4EFAC 2VVSA 1ULRA 1RT4B 4I2QB 1RLDA 1RT7A 3VZIA 4ZCLA 4AKLA 3MEEA 4EMDA 1WLXA 4UOGA 4PPDA 2LCWA 4RU2A 4B9NA 2EHOD 4DQQA 1NHUA 3W65A 3CNQP 1FIOA 4PWUA 5HMXA 2Z8QA 4Y0FA 1SC1B 3I4HX 1PIEA 4LFCJ 1FEWA 3CMES 3F0NA 2ACZA 1QJHA 5LXRA 2MKYA 2VIHA 4LF2A 2H7VC 4WP3A 1R31A 4DR3T 4OYZA 4N77A 2DHXA 4MJKA 1LQ9A 5D15A 2FJEB 2J6SA 5E3CA 2CG8A 4DQSA 3P7IA 5CH7B 5HP1B 1RWXB 3VAMA 4J2CA 2B51A 3H25A 4HYKA 9RUBA 3PUSA 1W25A 3RC3A 2KHCA 2BG9A 5CABA 2UUBJ 1JX4A 2RSQA 4I43B 1HNWJ 1RT2A 2EPIA 2VASA 4KKOA 2B9WA 2XCPA 5KAKA 1GTHA 3ZTPA 4HN9A 2V68A 4NLXA 3DLEA 1IBKF 4ZKAA 2Z30B 1IR2A 5CYMA 2ZD1B 1RHMB 2Y8YA 2YQ1A 4YTPA 2ZM6T 1F2GA 1FJEB 5ETLA 1J5OB 1CBKA 4TKTA 2J8SA 4C8OA 2KHDA 3OYZA 4X65F 4F2RA 1FXDA 1MWZA 1U0HB 5AQGB 4A47A 2R7VA 4DLEA 1LXNA 2C2EA 1R0AA 2VA3A 4KTQA 3FC9A 5HYAA 4O2BE 1NH7A 1N0UA 5KFPA 1QTMA 2IBOA 4NLRA 1AFIA 2R8GA 1DU2A 3NAHA 1IKYB 1KVJA 3FDSA 2EK6A 2DNOA 3DRXA 4DR2J 1RAAB 1S48A 3W63A 1HNIA 2M70A 2K3IA 1VRUA 4X4PA 2NSCA 2R42A 4KGMA 4JI6F 3ISND 3I5BA 1HCIA 2E9XD 2MYSA 3WC0A 3ZT6A 4WNKA 4LF4J 1NSQA 5CZVA 2AQ4A 1Q82T 1TL1B 2C22A 3CX6B 1HBUA 4U95A 4EU0A 2HRUA 4DL4A 1N32F 1GH8A 5JQGE 1QVGR 4NLWA 1BR1A 1IJ6A 1S9EB 3MEDB 3CD7A 4QZVB 3B78A 1RT7B 3ENQA 2IRUA 1VQ8S 1VJWA 1X9WA 1ZOTA 2DBBA 4CLYA 4DFJA 2MKHA 2OPSB 3EZ5A 3CF5Q 5KFXA 4JI8F 3F56A 3EMTA 4IDQA 1UZHA 1HQUB 4W92B 3PEHA 5DGAA 1UETA 3THPA 2W4CA 3D6HB 2HK2A 3MACA 2HBRB 2DT9A 1SJ3P 1U48A 3CC7S 2CPJA 1HMVB 4EEYA 4TN7B 1CS4B 2MQPA 2YU2A 2WRMA 5HQ8A 2DGTA 5FIIA 2DHSA 5BYSA 3NP5A 4RNNA 5ABEA 2YPYA 2M6BA 3N01A 4C8LA 3NGUA 3IEEA 4CM2A 2LE8A 2OLTA 2K3WA 2F65A 1M62A 3M32B 2MKKA 1UJ4A 4YSYA 3MZKB 4Q2LA 3FCHA 1V3SA 5KT2A 3ZNJ1 3TJ9A 4FXDA 4IR1A 4J9QA 1H0HB 1RCOB 3OHBA 3EI0A 3TLUA 1KC8T 4ED3A 2BZ2A 2ZZTA 2KKHA 3PURA 2HGMA 2J0QD 1S0MA 5KG6A 3E08A 1X60A 5J2NB 4RNOA 2X51A 4PQUB 3OPKA 4P0AA 2DO0A 4YY3J 1TUWA 1P8GA 4RBVA 2DRDA 1HI1A 2M5YA 5ETOA 5F0UA 3DDNA 1T9XA 2DEIA 3LP2B 2YOEA 1TMJA 4IDNA 2XTLA 4RBUA 3LSVA 1FDAA 3CCVS 2IA6A 3UUNA 4H9RC 4TVAB 1WC0A 3R9LA 4JP8A 4B9SA 1F5BA 4BWJA 4C0OC 1WC6A 1EZ3A 2BJ7A 4QXBB 1FA0A 2E9RX 1WOOA 5DM6Q 1TVRB 5JREA 1U1LA 1KVKA 2BVZA 2C2OB 1ELOA 3AJ1A 4CI2B 1OSCA 1S4EA 3M8RA 3V4MA 2XYGB 4B9MA 2BMBA 1HBOA 4CQIA 2W9CA 1G7CB 2XI3A 5HMWA 3OTDA 3AD7C 3CMQA 1UZDA 2V9WA 2DCLA 5D8HB 3RB6A 4N7TA 2ASDA 2QYWA 1WEXA 2YKAA 3KDNA 3KHRA 2JSXA 3HDSA 3SFEA 1R0AB 5JH7E 2CHNA 4PXCA 5FY7A 1Z2LA 1Q1KA 4IE4A 5KG0A 2JVOA 1S1UB 4DSKA 1C0UA 3AE4A 4JI7J 3JQMA 1WTBA 4USVA 4DSIA 4USJC 4C3LA 3D67A 2UU9T 1XR5A 4NI2B 2GGPA 2NSBA 1VBZA 1S6PB 3TLSA 4AQGA 5E3QA 1U49A 3IM8A 3LP1A 2YWEA 3SZ2A 3BQ2A 1RT2B 3BN7A 3OYXA 4CWBA 2HNDA 1UK5A 2CJBA 2PMHA 3LBXA 1HR0T 2O1PA 2KT2A 2K9AA 4O4RA 3AXMA 2DHRA 1KLMB 1YKEB 3RGIA 5B0CA 5T41A 1Q78A 2FJEA 3F44A 2QGFB 2BJ3A 2ZWOA 4NXMF 2KM8B 1JLCA 4RWXA 3WHIA 1OQ3A 3QUJA 2W8LA 3RB3A 3BQKA 2JLGA 3BGFA 3JB9k 1S1TA 3SDEB 3KLHA 2UXDF 5KFNA 2UUCF 4CTAB 5H6RB 4KQZA 2ZKTA 2QLFB 4DPYA 2DISA 2Z2MA 3Q5DA 1Z8UA 2BZBA 2QVAA 2JDJA 2F4FA 2XULA 3TJAA 4CH0S 4ERRA 2UUAT 4J9MA 2V6XA 2DGXA 3P45B 1LKXA 2IIUA 2UUTA 2E8IA 3KVBA 4I67A 1NK8A 5F3ZA 1XNQF 2HFVA 2CJXB 5D0HA 4DZ6A 2MGZA 3OFGA 4LR8A 3TX0A 5B0DA 4PJNA 4C8ZA 4AKIA 2FIUA 4QX8B 4JV5J 2WVDA 4A8WA 2BJDA 3VAFA 1KS2A 1HYSA 5GADI 2HGNA 5ETTA 2GMLA 4CQ1A 3TAQA 4LT6A 1IKXB 4DV5F 4CO3A 4U7UD 4M63A 1C2PA 3I9WA 4EGLA 2IW5B 3S7RA 4X2BA 1ICEB 5DDPC 2M9KA 4LREA 4U96A 4C7QA 2CBJA 2RDIA 4LRCA 3T1YJ 1S0OA 5HJXA 3U3IA 2OUGA 1YKWA 3HCXA 4O44B 2QMXA 4X4OA 3Q5XA 1RYRA 1RHRB 3I1AA 2BBJA 3GSIA 3KV9A 2QYCA 5E2QA 1UVIA 3P4WA 3UN5A 4IRDA 4EYHB 2DR6A 5I4MA 2LXIA 1AUDA 2C0SA 2YKQA 4IOCQ 3PX6A 1HX1B 3N6LA 3EWGA 1AW0A 2EKYA 1SH2A 4ED8A 1S1WB 4RW7B 3J80U 2GJ2A 4ZN1A 3CIRA 4E0DA 5KOWA 3AE5A 2LKGA 2ZM6J 4DR1T 1F60B 1VJQA 3PW7A 4QIFA 2FY8A 1N34T 2VQFT 1JJ4A 1GK8A 3AEGA 1OY8A 3N9MA 1TL3B 1JJ2R 3JSMB 3EM1A 1Y4ZB 1Y7PA 2H5IB 4ERDA 1PG5B 4LQ3A 3FQKA 4G6VB 1GQEA 1QTNB 2WMOA 1V5IB 2LM9A 3PYEA 5F5WA 5EWFA 2VHGA 4F8HA 2CXFA 3M6XA 3RH3A 1Y5LB 1TFWA 1ZA2B 3KNAA 2N7YA 2XSJB 2MKJA 3D5MA 3D1OA 2DNMA 2W00A 2MB0B 1U2FA 4NUUA 5LBQB 4TNVA 1OJ4A 4IE5A 3GIIA 4DU8A 4QH1A 5B09A 2IAJA 1WRDA 3VR8A 1LVFA 1CLFA 1Q81T 3I87A 1FRKA 2Q66A 1FWLA 3HKDE 1C0UB 3LDQB 2DIVA 1TKZA 3KK1A 3HR0A 2BANA 2A9UA 3VV2B 3QGGA 3SSQA 4M5DA 2EG1A 1B0TA 2MZJA 2HNZA 1CPZA 2HPJA 1B7YB 1G3OA 2ADBA 2FTRA 4KUMB 4EAHA 3N2KE 3EXCX 4A97A 3VHQA 5BMVE 2VK9A 1SH0A 5A2QU 2J4GA 4RW4B 2IY5B 2EKNA 2BA9A 4HDHA 1WNEA 3BF4A 3QQCD 3SV4A 4IE0A 4F4XA 1N5SA 4CN1A 2DR7A 4MBQA 4ILCA 2Y0BB 2DVIA 1Q4RA 3BH7B 1TKXB 3U02A 4GOUA 4RWWA 3UW1A 2GVDA 3AXKA 4Q0BA 4HEA9 4Y34A 2D3ZA 4PG4A 3I4PA 2Y1LB 2CA5A 3NBPA 1S79A 1KK7A 2K2PA 4ELVA 4X84A 4ANEA 1JLFB 2O5DA 2E1PA 3US5A 1U09A 4UY85 4ZVFA 4A8KA 3DDKA 2HHQA 2W1BA 1XMBA 1Q95G 2N7CA 1UA1A 2QV6A 1WR6A 3G96A 1NLKL 1JLEA 4KO0B 2UVRA 4FF2A 1S76D 5AE3A 2B9EA 5K8PA 3T19A 1PGZA 1Q8LA 3Q2SC 2UV8A 3U1LA 1NRKA 1HW9A 4O3SA 7AT1B 1HHSA 4OZ2A 4QU7A 4AXPA 1JLAA 2CNNB 2ZOFA 5A6PA 3A3PB 4NZ7A 1EP4B 2DGWA 3EYZA 2AD9A 2H9ZA 3MOZA 2ZE2B 1H2VZ 1AT1B 1CVJA 3GU0A 3TAMB 5HEJA 2E5VA 3A5XA 1RWMB 2YKNA 2P9GA 2OO4A 2E7XA 2WWVA 1A0OB 2IYGA 3ZTRA 3RJMB 4DV0T 1IKVA 3W2WB 1AJ3A 5ADXL 3MMCB 4J90A 2KINB 1WI6A 4IYQA 2XTJP 1IN0A 2KSRA 4K2XA 3K59A 3K5PA 4IG0A 2HHHJ 5C2TA 4PXDA 4DQRA 2B4UA 4YP3A 2R3VA 3IN5A 4WZMA 5I3UB 2MXYA 3N9QA 3AOCA 4JI0F 3UCZP 4TQSA 2XMVA 2O66A 5B08A 2GNKA 2HS4A 2BE2B 4EO8A 3CPZA 2K1RA 2EHOA 2JC0A 2DK2A 2LSGA 1KVIA 1GFWB 1T9TA 2QTWA 3IM9A 4FF4A 3D4JA 3I0OA 4DF4A 4MIBA 2VA2A 3VGVA 3H5YA 4PEOA 2WBLA 3HFZB 2DHHA 2LQ8A 4KIAA 3EHZA 1QSYA 2ZWPA 1UFLA 5HWYA 3AFGA 3RPUA 4LBPA 3LAKA 5GMEA 1CJTB 4NASA 1V9OA 4CLTA 3MM6B 4GIWA 3DTOA 1HIYA 2H7OA 4I4BA 3V6HA 4GKJJ 4JUZA 3P8CD 1YQ4A 1F3VA 3R5JB 1WJ9A 3SCLE 3MOJB 2WDVA 2YDSA 3UE2A 2GV1A 1WDDA 4IDKB 4ECWA 2JWNA 5C8YE 2KTQA 2F8EX 4HT7A 2A2DA 5D6GA 1YI2S 1N5TA 4AXIA 4AYBD 1TV6B 4RW6B 3KK3A 2XUEA 1GT8A 3IC1A 3HI9A 1D1CA 4ZXLA 4F8RA 4OHYA 2XLKA 1EETB 2XLJA 4LF6T 4UVBB 4LF1A 4FZVA 3OV7A 5E3PA 4H54A 5KG4A 5LM7E 4KC5A 2I8EA 3AA8A 5H9FJ 3N5BA 4GC7A 5FJ4A 1OQ6A 1PAUB 3MFIA 2E7WA 4DUZT 2YH0A 2M4MA 4DPUA 4ZN3A 1I3OB 1EZZB 2XQ9A 3MCSA 5KOXA 4A8MP 2OGUA 2PD1A 4DQIA 1HFAA 5CYMB 2PJQA 5LMNF 2W8KA 3HF5A 3HHEA 3VAIA 2FVQA 4UVAB 1SXLA 1FRHA 3VF0B 5K20B 4J7CA 1ACMB 2ZHAA 1O6XA 2DD8S 4K4ZA 3I5CA 4JI4F 2QLWA 3I6PA 4ZIVA 2KB2A 2KZZA 1P27B 3E22E 1XTZA 1IJ5A 5CCMA 4ZVEA 3BBBA 1R6VA 3MM5A 2YBVA 5J1EA 3NG8A 3ZYLA 1DFDA 3H3MA 1S5ZA 5AFUL 2V2KA 3ONQA 4HWHA 3CSKA 5JTGA 2MSTA 2VPZB 2WW4A 1KN6A 2OEMA 2E5GA 4TX5A 2P9BA 3JAMU 3PIOQ 2ACMA 3HHLD 3GP9A 1SBRA 1S1XB 3FZMB 3I0SA 1T7SA 3PUXF 1RTIB 3KFWX 3UU4A 4Q8EA 3BREA 4V19J 3FB2A 3GR1A 2D5UA 1R3NA 1TL5A 2CLYC 4TU9A 5A8WA 4DR1F 4C0HA 1FNOA 3PW0A 1D1AA 2OI2A 1REVB 3WX8A 4KX6A 1QE1A 3MK7C 2MPUA 2RRNA 4NMXA 1OEDE 2WM9A 4L9IA 4ZS2A 4G2AA 4OI2A 2JEGA 3RI5A 1VQKS 2M67A 3WQPA 4WTYA 4IG3A 3EZUA 3RBDA 5LSOA 2M8HA 4W90B 1RT4A 3H4BA 2HBQB 4OYBA 2AE9A 3VAGA 5LMUT 4FXWA 4QJVA 4C11A 2N2NA 2XG8A 1YSJA 4H9QC 1TAUA 2HNYB 2QA4G 5HBMA 1VOMA 1H2TZ 2PI5A 5J1GA 2WSFC 3QLHA 4UR9A 3F31A 3FZHB 3ZTQA 1NU4A 3KG0A 2CRBA 2JMKA 4BA9A 3T1HT 4M5LA 2HWTA 4HL9A 3U1NA 3N9LA 3L4BC 2H51B 2VKOA 1B70B 3R5BA 1MIYA 3RRHA 3OLAA 5F3JA 3OHAA 4XZCA 1IBMT 2KFYA 3H98A 3LK2B 2RDDA 2E5LJ 3O1LA 4GVLA 1QDUB 4PG5A 4C0BA 1T05B 1F9HA 1VQPS 3HO1A 1WACA 4HACA 5AXMA 3K57A 3FXEB 3GB0A 4AKGA 3HK2A 1SL2A 4QW8A 1HD1A 2CQHA 4KBMB 1UUSA 1S6QB 2XLIA 1PILA 4U33A 4LF9T 5IV3A 1NK4A 4DV5T 2POKA 1TKTA 2VPWB 4WFYA 4ZLJA 3PUZF 2AEJA 4NIQA 1ZTTA 3R97A 1J27A 2WVEA 1NEEA 4JI4T 3VWSA 2I5JB 1DQ8A 1QSLA 2HVDA 3QGIA 1ZAVA 2GA7A 3UUXB 4NLUA 3DU6A 4I69A 3BJYA 3UI3A 1S94A 5IS2A 2LVWA 2MPKA 4EB6E 3GFXA 4LMLA 1I6ZA 1DTTB 4O8SA 2HQDA 1GNKA 2JHEA 3S6EA 2VF3A 5A0YA 2JJ4D 2K8GA 5IZHA 3BPSP 3MDFA 4LSZB 2CQIA 4DIDB 3J7A1 1SV5A 1FJGJ 2D9OA 2XWYA 1VIOA 3H2VE 3OXFA 4ZMMA 2HIYA 5JDGA
chains in the Genus database with same CATH topology
4J90A 3RBXA 3JXOA 4L75A 4Q25A 2I0MA 4J9VA 2AEJA 2AEMA 3L4BC 4L76A 4XTTA 2AEFA 1LNQA 4EI2A 2OGUA 1T72A 4J9UE 2IIUA 4J7CA 4G65A 1VCTA 1XWMA 4L74A 2BKNA 4RO0A 4J91A 3L39A 4L73A 4GVLA 1SUMB 1T8BA 4YS2A 2FY8A 2BKOA 2OLTA 3KXDA 2BKPA 3RBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J90 A;  3RBX A;  3JXO A;  4L75 A;  4Q25 A;  2I0M A;  4J9V A;  2AEJ A;  2AEM A;  3L4B C;  4L76 A;  4XTT A;  2AEF A;  1LNQ A;  4EI2 A;  2OGU A;  1T72 A;  4J9U E;  2IIU A;  4J7C A;  4G65 A;  1VCT A;  1XWM A;  4L74 A;  2BKN A;  4RO0 A;  4J91 A;  3L39 A;  4L73 A;  4GVL A;  1SUM B;  1T8B A;  4YS2 A;  2FY8 A;  2BKO A;  2OLT A;  3KXD A;  2BKP A;  3RBZ A; 
#chains in the Genus database with same CATH topology
 2DI4 A;  3CKD A;  2YNG A;  1YBU A;  2UU9 F;  2NW9 A;  2