The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
74
|
sequence length |
193
|
structure length |
193
|
Chain Sequence |
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb |
source organism |
Pyrococcus horikoshii
|
molecule tags |
Hypothetical protein
|
molecule keywords |
HYPOTHETICAL PROTEIN PH0236
|
total genus |
74
|
structure length |
193
|
sequence length |
193
|
ec nomenclature | |
pdb deposition date | 2005-02-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01895 | PhoU | PhoU domain |
A | PF02080 | TrkA_C | TrkA-C domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Methane Monooxygenase Hydroxylase; Chain G, domain 1 | Phosphate transport system protein phou homolog 2; domain 2 | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Regulator of K+ conductance, C-terminal domain |
#chains in the Genus database with same CATH superfamily 1T72 A; 4GVL A; 2BKP A; 4YS2 A; 2IIU A; 1T8B A; 2OGU A; 1XWM A; 4J9U E; 2AEM A; 3KXD A; 2BKO A; 4J9V A; 4L75 A; 1VCT A; 3RBX A; 1SUM B; 2AEF A; 2OLT A; 2AEJ A; 3L4B C; 4G65 A; 4J90 A; 4L74 A; 2I0M A; 3L39 A; 4J7C A; 4RO0 A; 4Q25 A; 4XTT A; 4L76 A; 2FY8 A; 1LNQ A; 4L73 A; 4J91 A; 3RBZ A; 2BKN A; 3JXO A; 4EI2 A; #chains in the Genus database with same CATH topology 2YKP A; 3R5B A; 3SFE A; 4ILC A; 4ITS A; 2MZ1 A; 4