2BKPA

Structure analysis of unknown function protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
total genus 74
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkpA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkpA02
1T72A 4GVLA 2BKPA 4YS2A 2IIUA 1T8BA 2OGUA 1XWMA 4J9UE 2AEMA 3KXDA 2BKOA 4J9VA 4L75A 1VCTA 3RBXA 1SUMB 2AEFA 2OLTA 2AEJA 3L4BC 4G65A 4J90A 4L74A 2I0MA 3L39A 4J7CA 4RO0A 4Q25A 4XTTA 4L76A 2FY8A 1LNQA 4L73A 4J91A 3RBZA 2BKNA 3JXOA 4EI2A
chains in the Genus database with same CATH superfamily
2YKPA 3R5BA 3SFEA 4ILCA 4ITSA 2MZ1A 4NLRA 1NWMX 4UOGA 3PIOQ 1RAFB 3R5DA 1TL1B 2RU9A 2NXUA 2B76A 3SQOP 3NLCA 2P9EA 3V6KA 2C2EA 4HI1A 4PG8A 4ZOSA 2ZNYA 2IM0A 4HE8A 1FJEB 1XNQF 1D0XA 4JBCA 3PTRB 4KAIA 2C2ZB 2GS8A 4Z90A 3EYZA 2R42A 4QIWD 2K24A 4CO1A 4F8RA 2XCAA 3PURA 2KDOA 3NZPA 2D3ZA 2QRXA 1S6UA 3M9NB 1BY9A 2JQKA 1PYTA 2FTRA 2BR0A 1U4BA 4I6YA 2F7VA 1RJJA 2DH8A 5ETQA 4IRCA 1UL3A 3HT0A 2HGLA 3B78A 4A8OA 3VGUA 4B3OA 5HAOA 3R27A 1KBRA 3DGPB 2KI2A 3FZFB 1WHVA 1W2IA 4KHMA 1WYCA 1VQOS 1X79A 2B4OA 1U1LA 4Y2MA 1T7PA 2F4FA 2LM2A 4J9MA 2ZM0A 4ED1A 2QL9B 2DRDA 3L4BC 5K14A 4IE7A 1FTRA 4YT0A 3BB5A 3B82A 1WI8A 1B70B 4F7VA 4B3TJ 3ADAC 1Q53A 3H2UB 1CHUA 4DLGA 4DSLA 3J7A1 4ZPDA 2HRUA 2Y3YA 1FF2A 5AXNA 1T03A 4XAKA 1TKTA 3K17A 3BSAA 1NK8A 4LBIA 4ECSA 2BBEA 3VQSA 3ENVA 1R31A 3RBZA 5ABFB 2G1DA 2DHSA 3PYEA 2BRKA 4ANDA 4NCGA 2XO7A 4TX5A 5DDPC 1JWWA 3R9LA 3QT8A 1JLBB 2FHOB 1SVDA 2VBYA 2A72A 4ID5A 1YJWS 1BQMA 2HVZA 2G2ZA 5IM0B 3QMQA 1UW4A 1H98A 4OHWA 4C2MA 2SXLA 1YJVA 1TR0A 4JYAT 2BBJA 3KOAA 1Y4ZB 4E98A 3BGFA 5EWEA 3CIRA 1S6PB 2YKNB 3IBWA 2I8EA 4WBFA 4NIQA 4B02A 1MLAA 4ZS2A 2C2OB 3ET6A 4NA3A 2HAFA 5AQQB 5KG1A 4HVZA 2VVSA 5DLFA 4P73A 1AYEA 1RTDA 4A8WA 2JQQA 3KBUA 1JJ4A 3QK6A 2LKZA 3TAMA 2VVNA 2XASB 1CJKB 4CM2A 4DG1B 3N28A 4ZHRA 2LDIA 4ZS3A 3MMBA 4X66J 4WFBQ 3CJ4A 4F4YA 4R0JA 4CH7A 4A8SA 3PJAA 2ZJRQ 2D69A 5IS2A 5HLFB 4FXVA 3ZFVA 5LG4A 1KRPA 4U9RA 4CO0A 2ZNZA 2CPHA 2UUTA 4DV4F 2XWYA 2QT7A 1WEZA 1T9UA 1FDBA 2ZHBA 5HQLA 1HQUA 3CK6A 3DRSA 1WDDA 2OPPA 2E7VA 2MQOA 2GVDA 2CWYA 2FHKA 4ZS6A 3ZSTA 4NX9A 2N1GA 2NW9A 4DR7J 3AEBA 2HLUA 3SRZA 3G9CA 3CCLS 4I2PA 3UCZP 2CWXA 2VPZB 1NJXA 5L3GB 1OPZA 2OD6A 4J5OA 3QJPA 1K47A 4JI1F 4DNDA 2R7QA 1V3ZA 2RQCA 3GV7B 1RA6A 3FBEA 5JJBA 1Z1ZA 4OYBA 2GMJA 5AQUB 3M7VA 4A8QA 1NJIT 5IC6B 3B4MA 4ZP7A 2LLZA 4FS2A 5FXVA 3KUGA 3H2LA 3RUBL 5AQRB 3GR0A 2HPUA 3IMQJ 1NJYA 2CQHA 4MFBA 1UJ4A 4D3HA 3IC1A 4O4RA 1X5TA 2LLYA 2NQPA 1E6VB 3MEDB 3UDLA 4LF6F 2Y8YA 2HW3A 1HL6A 2VKJA 5A8KB 2IAKA 2V6YB 1OXZA 2HBRB 2ABYA 2WW4A 4K0UA 1LK5A 2A1BA 2DNKA 5A8WB 4ZA1A 1YKHB 2D0TA 5KFBA 4ASKA 2RDDA 4NCBA 2KJWA 1SI9A 5HROB 4B9TA 2JMKA 2JQ9A 4OX9F 5K8PA 1BE4A 1LQ9A 3U02A 4TU9A 3R7NB 1V9OA 2DNHA 1SQGA 3SQGB 4W4MA 4TQRA 3BR8A 3OTOT 1KVJA 4N8OA 5GMDA 1FRXA 4IDOA 2OSQA 5KFFA 4URQU 2BS3A 3J7Z5 3T3FA 4E7SA 1EETB 2VBWA 1LK7A 4NA1A 2E7WA 3R6GB 3MAQA 5DG8A 4KGKA 2DEIA 2OPSB 3P45B 1C4CA 1N8RT 3OL7A 3MM5B 3RI5A 4QWCA 3WDOA 3TAQA 1F1BB 1U5PA 5LB7B 3OFHA 4J9LA 4TVAB 4CI1B 2E5HA 2ASLA 2J7KA 3S01A 4PG7A 5HYAA 4C8YA 2HHXA 4XK8C 4JYAF 1N56A 3SI8A 2JPFA 1BWVA 1ZZFA 3G6VA 5J1EB 2UU9F 4JUYA 2JEFA 3M9OB 1QAYA 4P75A 2MLZA 3VCDA 1SJRA 2YBVA 3RGLA 1QSYA 4DWIA 3P4WA 1SC6A 2ZD1B 2HWIA 2H9ZA 2KXFA 4RL1A 2FHJD 4B9LA 4WPAA 5HCMA 4ECZA 4X5TA 5C8YE 4JI8F 1VCSA 4LSNA 4MKYA 3JSMA 1SQFA 1AUSL 4U3CA 4X4PA 4FYVB 3VAIA 1S49A 4AE5A 4B3SJ 2KHCA 4EOZB 3J80Y 1BLUA 3T1YJ 3DRSB 4DV1J 4ZVSB 2DIVA 1SL1A 2IM3A 3RYIE 2PN6A 3K2YA 4R5PA 1FI4A 2PEBA 3KDSE 3OLAA 4DPWA 5HLFA 3OTOJ 1X9WA 1YI2S 1UVLA 1R8HA 4IH7A 2ZH7A 2XMTA 3M8QA 2XM3A 2PI4A 4TZ4C 4DX5A 1U2CA 3DRRA 1L3TA 1K1QA 4FYYB 2W62A 4AKIA 2XNQA 1SBRA 1WI6A 4DL5A 4Y2CA 4LVNP 1CG2A 1S35A 5JREA 2M7SA 4LRDA 2NW7A 2BANA 3H20A 1UW9A 2IDLA 3N2GE 5D3GA 1RU2A 4RNFA 3EAMA 1DLOA 3PYDA 4Q5VA 4QR2A 1ZOTA 3H5YA 4TV8E 1N52B 1C1CA 2VKHA 4ERRA 4WYWA 3N9PA 1G8XA 3I9WA 1YIJS 4LRBA 1U2FA 1UZHA 1S0VA 3GJTB 2HHHF 4JI7F 2JC1A 1YW0A 4IDPA 4ETXA 3KV5A 4XPCA 3CJ0A 1CJVA 4HWCA 4AQYF 1S9EB 2D74B 4B9NA 3ISZA 3PRVA 5C3JA 1N32F 4UY85 4LMJA 5IWAJ 3GFZA 4G6VB 1NSQA 1R8CA 2IJRA 4HI2A 4YY3F 3I5BA 4DJBA 2I0XA 5L3CB 2OKQA 3PXGa 3OW2R 2YQ3A 5B7WA 1Z4UA 3T19A 4F4XA 4YSXA 5EX3A 1CBKA 4NZ7A 5AQOB 1YHQS 1KVIA 1B0PA 2CBJA 3MM9B 4ED6A 1US7B 3W66A 1FRJA 2HQGA 3MM8A 3HFZB 3KLFB 3VV2B 4ADZA 2F40A 4U31A 4A98A 4MKBA 4BC9A 2D0UA 3MMJA 2W8LA 1U6FA 4PKDB 3HX9A 4RKUC 2PJQA 2MZRA 1R43A 4O44A 3M8PB 3M8PA 1N48A 1DTQB 3EE3A 3OJAA 1OQ3A 1HD1A 2JHEA 1OMSA 5LP6E 3G82A 1AW0A 3D28A 3CUNA 1T95A 3MEKA 2OPSA 4QX8B 3QIPA 4YY3J 4DSFA 3OV7A 4DR3T 4I6AA 3OSPA 2LQ8A 1BHNA 4C0OC 5KAKA 2FUPA 3KJVA 3N6MA 2R9LA 5JDLA 3X1LB 2Q66A 1OYDA 3EABA 4WW0A 2BXJA 4O4IE 2RNEA 6AT1B 2EFOA 2BVZA 3FZMB 3LAMA 3QJLA 3QAUA 3H2VE 1X4DA 3AAAB 4H9NC 1SXLA 3AQPA 4K4YA 4L75A 5HVFA 3AEAA 4DL2A 3JAEA 2V5HG 4PAGA 4OX9T 3ZCIA 2RPAA 5JRCA 4HYKA 5KFJA 1H38A 1XZYA 4ZN3A 4MFRA 4L5GA 1ZZNA 5BR8F 1WC4A 1HI0P 1P1LA 3K8PC 3I31A 3OTEA 4C98A 2XS7A 3KV4A 2OTLS 3QRQA 2QRRA 5HXEA 2VG5B 4H9PC 5KMGP 1TAQA 2LHNA 1JIHA 3P7IA 5DJBA 1M1KT 4X4TA 2FJDB 2Z56B 1NMEB 1PCAA 1NRKA 1U1NA 3KDOA 2A2CA 3R5AA 4UOHA 3W7BA 2BV3A 2P5VA 1REGX 3ETOA 3KK1B 1N6QB 4ZP8A 1N6QA 5HN0A 3L3CA 3K0JA 3VR1A 1U25A 2FZKB 4DV0F 3GCWP 3ONLC 4FKXA 3ZNJ1 5CD4H 2RHQB 4LT6A 1SUQB 3U3IA 3KLGA 2JFKA 1HMVB 3DLJA 3OJUA 4OZ0A 1NAFA 3QPIA 5G4DA 3AE7A 3G86A 4CP5A 3K3OA 3CC7S 3FZLB 3BO4A 4DPUA 3K1SA 4ZK7M 4NXMT 4IG0A 4L3NA 3NCPA 3QRRA 5A2QY 5E3QA 2QEXS 3GWCA 4FPIA 1BR0A 1M5PC 2WY2A 5GAGI 2BANB 2B8PA 3DOKB 2XYHB 5IQQA 4NXMJ 2G13A 1TMMA 2EVZA 2FJAB 4I1TA 2Y48B 2IC6A 1HR0F 3WX4A 4ZVPB 3I4HX 4UV9B 1PILA 1JJHA 1JLEB 4LR8A 1BUXA 5DABA 3CSKA 3UPFA 5RUBA 3M9MB 2DCLA 4WZMA 2X66A 1NSAA 2E66A 4F25A 3UFCX 4UEMA 3FFIA 4YDXA 2H54B 4FNIA 4PYAA 2ZC4A 2N4CA 5LXTE 3OFEA 7FDRA 4UQTA 2XZWA 3RZAA 3UDVA 1VK8A 4C8KA 3TO8A 5IXUA 1SPBP 5LXYA 2HHQA 3BGUA 4WXOA 4C3MA 2B7CB 3F0NA 1M5HA 3DLHA 3MR6A 2R8JA 1U1RA 3ZC0A 1JLQB 2R4FA 4L76A 3M1VB 1JLAB 1X4HA 4ZHRB 3H3MA 4FPRA 1XNRT 4GC7A 1OSCA 1ROFA 1H2VZ 2CQIA 1X9SA 3UVJA 4X66T 2QYCA 4HWHA 3IA3A 3QT7A 3FRYA 2HFOA 3OBVE 1IKXB 2OTJS 3BH6B 3DN9A 1SJ3P 4DSJA 1S7HA 4RW9A 2FJWA 4PK5A 4GVBA 4CT9A 2HIQA 2X7IA 3UR3C 3TEHB 2A6MA 3MA9A 5CGMA 3I0SB 2OLWA 3G4SS 2E9XA 2J0SD 4M5JA 4Q0BA 5CB4E 1Q1KA 3SZ2A 5C42B 2JMHA 1KTVA 2CAJA 3CVRA 1EQ0A 2NSCA 3GMIA 2UVWA 3DRYA 3AJ2A 3SCKE 4M5IA 1UMJA 2EBEA 2K8GA 2LVWA 3LP2A 4DOZA 4I0UA 4DFKA 1I1GA 2RHSB 1TL1A 2CDQA 2PA3A 1X4BA 1PC4A 5DETA 3AAIA 1X60A 2XULA 1NKEA 2PBIA 3RQUA 1RYSA 4OX7A 4CI2B 3CCZA 4DR3J 3AOAA 2N7CA 1RWWB 2G0IA 3DMJA 1AFIA 2GJFA 3TAPA 1CULB 3R5JB 1VQ9S 1UAWA 3W62A 1HBMA 3K7RA 2XMMA 4OIXA 2C5KT 4YOEA 1ZS6A 1T98A 2ATLA 1R8AA 2QMWA 2QLXA 3CDWA 5EZYE 1FKAF 1UFLA 3IXQA 3N2OA 3CIMA 3EDUA 4BBYA 5D0EA 4NRUA 2FC8A 3OYZA 3HHLA 1J5OA 4NLGA 5K8MA 5THWA 2W2PP 2H4YB 2E1MC 3V6HA 1V6HA 3A8JA 1MIVA 1Q86T 4KFBB 1UEUA 4GKKF 4O2AE 3UULA 4QCLA 4TN7B 5A8KA 4O4HE 2BQUA 4CLSA 2ZE2B 4X4RA 5LSRA 1VRUA 1S1XA 1XQIA 4AISA 2ZM6F 4ES3A 2H51B 1K1SA 3JCFA 2HURA 4RW6B 2HMIA 2M3DA 5KT5A 2KZMA 3KJQB 4H4KA 3VKGA 1F6TA 3BQ1A 1SHZC 1IQTA 2DNXA 4C90A 5E3AA 3P50A 3AEEA 1RACB 2RE1A 3DOLB 4U7YA 3FSXA 4O4GB 4DR6T 3BPSP 3PRDA 1K73T 3QGHA 1EETA 4DR2T 4O0IA 4M94A 5HANA 2YWFA 1U49A 4MMOA 4NYZA 3PUVF 4AQYT 5FMNA 1TV6B 4TKTA 3EWGA 1U7LA 5AJ3F 3Q5DA 1DTTB 3KXDA 1T9TA 4UF0B 4DR5F 2GHWA 2B6AA 1ICEB 4ZI3D 3C14A 3LFMA 1RXOB 2Z8QA 4PEOA 4AXPA 4DV2F 3P4SA 2FGOA 3EGNA 4AI6A 4K7QA 3MOZA 1M1GA 2EHOD 2YN6A 4KIAA 4OX9J 3D0HE 1YX2A 3UN5A 2HHPA 3I4PA 3C6UA 1MROB 2LQJA 1C0UB 5LJ3Y 2DO0A 3B8HA 5CYMB 2UVRA 3L7PA 2B4VA 2LCWA 2KYXA 1QTNB 4FVMA 2DGXA 4FYXB 4ED8A 3C6TB 1N32J 1X5PA 3PV8A 4GRSA 4YMEA 4U8VA 2A9UA 1HPZB 2KT3A 2CVEA 3IRWP 4ES2A 2UUBT 3PW0A 2RRAA 2PGCA 3H3AA 4N78D 4TWHA 4M1PA 4H63H 2AZ3A 2QLBB 3V4IB 4PPDA 4PQUA 4W90B 2QA1A 2CPZA 3RX6A 2YOEA 4EBCA 3QIDA 1JK9B 4TNWA 1W9RA 1UWBA 4K0KT 1OY9A 2F4VJ 3DHWC 2QIFA 2YKMA 2AT1B 1RTZA 2CADA 3Q86A 3P5TL 1NDLA 4KH0B 2AJ2A 4DR7F 3Q5XA 4IDKB 4OX8A 5J2NB 2NXNA 4IFYB 2GMHA 2J6TA 4YFSA 1OSDA 2L08A 1S9GA 5DRKA 2H3RA 1WHYA 3JC6C 3T5HA 1KONA 3OPCA 3EZ5A 1NU4A 4UV8B 5CA1E 2WOMA 1XERA 4EMDA 3SV4A 3CQCB 3CWZB 2QTWA 4KE5A 1ZHCA 2FJEA 4PK4A 4AD6A 1YBAA 5LMUT 3G6YA 2L48A 3H0PA 2RRBA 3CCQS 1KN6A 1NK0A 3JADA 4KKOA 3QGGA 5A8RA 3JTNA 3NS6A 5HVGA 4DL7A 3GMGA 4KPCA 3RW6A 1RHUB 2W24A 1JNRA 1OO0B 3O8WA 2P8IA 4M1KA 3Q8SB 4QYZK 4MLKA 3HCXA 2C3MA 4DV7T 2N3LA 3IBPA 4RU9A 1HHTP 1HNWF 3NWIA 2OEJA 5ABHA 4YTMA 2JZ5A 2QX0A 3QO9B 1KDNA 4PG5A 1HNWJ 5IQ6A 3KJVB 2G0UA 2WVDA 1GTHA 1W09A 1EJ7L 3K5NA 1D0YA 2CXLA 2Z58B 2M9KA 2W61A 1Q8BA 1GMWD 4I7FA 5K8NA 2NYHA 1D3WA 2W9AA 4ZI2C 2F9DA 4IHJE 1T03B 4JUZA 2DTJA 1I94T 1FDDA 1ZPVA 1FVSA 1PJ6A 3W2WA 2JRSA 2XJ7A 4JI0J 1IWGA 4B08A 3NL0A 3E8OA 3MCMA 4K4SA 1S1TA 1S1TB 1XDOA 1DFDA 3ZZZA 3MDFA 4X62J 4BCAA 3BEGB 3IEEA 3AD8C 2Y8WA 5LG3A 2BG9A 4J9QA 2PO4A 5IM0A 3RB0A 5GMKa 3F73A 2W2MP 4WP3A 1T9YA 4DV5T 2CIMA 2YKAA 3U1NA 1S6QB 1HBNB 3J7YU 5DQGA 4CTAA 1UETA 4ILUA 4Y65A 2N2NA 3OJSA 3Q0AA 1PJ5A 1GAOA 4R8UB 2V67A 2LQ9A 2F4VF 2A18A 1WFDA 2E9XD 3MAAB 1SB6A 3MMBB 4IFVA 4QWEA 4QYZJ 3AVRA 3I1AA 1LWXA 3N9LA 2VUGA 5AQIB 4MIAA 2VH7A 1ZA2B 2CWOA 2LMIA 4BWJA 4H9RC 1UA1A 2HBZB 4CLYA 4M5HA 1QAJA 1UP1A 2C3OA 2W2QP 4X2BA 3N4WA 2VDIA 4JI5F 1VLOA 3CX8B 4AL5A 5F8JA 3FGVA 3B5MA 4UUXA 3SFDA 1RT5A 2CWKA 2HNDB 5LMNJ 1N5YB 4LRAA 2DY1A 2ILYA 2ZH4A 5HXSA 1X7VA 4JI4T 3N9OA 2CZ4A 2FJAA 4JEUB 2W66A 4ICLB 2H5IB 4ICLA 2V8GA 3UD5A 4ATNA 2BS4A 4CDIA 3CDEA 2FQQB 4K0KF 2ACYA 1XMQF 5AE3A 4DBQA 4ED4A 2Y1LB 4A97A 2G1HA 2KYZA 4I68A 2QL7B 5GAGU 5KG3A 1DRZA 4ECRA 2E5LJ 1NAQA 3D6TB 1P9YA 2IBOA 2JLFA 2QZ8A 1S76D 2BE9B 4DV0T 3T41A 2QA4G 5L1KA 3EICA 5ABEA 3F57A 1UVMA 4IFYA 3W61A 4WYLA 1RWOB 1SIWB 3FHNA 4DL4A 4LF5J 3TZWA 4DV5F 1RTIA 3HHKA 2O01C 3DFEA 3H98A 4D3GA 3HPOA 2HKEA 3GSIA 1Q81T 4KHPJ 2Q9QB 1UJ5A 1YJUA 5HXCA 4ZXLA 1EARA 5A6WA 3EHZA 1G7CB 4C4WA 5D4LA 1F5AA 1TL3B 3UTKA 4PXBA 4ZVEA 1KNZA 3MXZA 4QH1A 3M6XA 4ZCMA 4X64T 1V5IB 1S12A 4DU7A 2J5AA 4IR9A 3D3CJ 1HI8A 5J2MA 4OJGA 1Y5IB 1S9EA 3F41A 4GVBB 2V9WA 2AWZA 4ZJQA 3P6YC 2AU0A 3W1YC 1D1AA 1U26A 1AXQA 1JNRB 1YZ7A 2VFUA 2BE7D 1X4GA 4JI3T 3FUYA 3K5PA 4DR1F 1KQKA 3RB3A 4ZI2D 5KTQA 3LPEA 2J7UA 3WAKA 2R7UA 3R7SB 2IYGA 3L8RA 2Q3PA 2XHWA 1Y5LB 3C8YA 3PCOB 2RD5C 4IO9Q 1IBMJ 2ZUAA 5KXJA 3LP1B 1JLCB 2AGQA 2DNPA 4OYXA 1WKLA 2IRYA 1FEHA 1KLNA 4ELUA 3KLIA 2X1AA 2XQ7A 1ZA1B 1JX4A 1U2RA 2EKYA 3V5UA 2E9ZA 2ZH5A 4NEZA 4P2MA 4PJNA 4IREA 1BQMB 1XJWB 1G1XA 1RCXB 1TL7B 1VRQC 2YNHA 3MEGA 2MHNA 2CZ9A 4KV8B 2ZDOA 4JLEA 3IHRA 2EC0A 1RTJA 2XQ6A 3G6ES 3LPYA 2GIQA 2BDPA 4C8LA 4LF6J 4PG4A 1LVFA 3B57A 1IKYA 1WTFA 1IKYB 3KLHA 4DCOB 4FXWA 2ZC3A 4PR6A 1UWAA 2X68A 4EGLA 4Z2XA 4CXXA 2RP4A 1WG4A 4FS1A 4CNYA 4ILBA 2UUBF 4J9OA 1KOHA 2CE7A 4E0DA 1N36T 2VPYB 1HIYA 1JLFA 3C2PA 4KUMB 2ZD1A 2VF3A 1VRBA 1VQMS 3HI2A 4PFPA 1N5SA 5GAHU 3L39A 2HFSA 4G1QA 4IDQA 4HDHA 4MK8A 3CCUS 5HL7Q 4ZVRB 1NK7A 3G87A 4P2FA 4QWAA 4NWBA 2YK0A 3AXMA 3PW4A 3ZLIA 4OZNA 1NCLA 2HMIB 2M52A 2DY9A 1HBUB 2FUG9 1HS7A 1I94F 2FZGB 2ADBA 4WE1B 1KR4A 4NZ6A 1KQGB 4DR5J 3ZMSB 1MMLA 4PJJA 5LBMA 2I6WA 2QA4S 4MBQA 2HYIB 3Q8QB 3FCHA 4NPPA 1FIOA 5F3JA 1ZH5A 1OWAA 2M5YA 4X1KE 1FCAA 3CJSA 5LXRA 2HHTA 4TXSA 3KK3B 4WJBA 1HNVA 1RAJA 4AXIA 3P4UB 3MPYA 1TL3A 1FFGB 2V94A 2J8AA 5ETMA 2NTYA 5D3GB 1SJ4P 5L9XA 2MLYA 1S6OA 2H65B 5KFHA 2XYGB 4DR1J 3PNIA 1UFKA 3W60A 5L46A 3TEGA 3DCAA 3HA4A 5C5JA 1B64A 1HHQA 2UXCJ 3HSDA 3OLBA 4O8SA 3C4XA 1F2GA 4DMWA 2DNMA 4AQGA 4ZI3C 3RLFF 3EZOA 2XWXA 3Q5WA 5MAOA 3DYAB 1HX1B 1HD0A 5HEHA 4RX6A 3TQEA 2MZQA 2W2UA 4QHOA 4MK7A 3TARA 2RS8A 3MURP 3BDEA 2OMLA 4UZCA 3I87A 4YEAA 4UIGA 3QB5K 2YKOA 4NI2A 1T3NA 4RBTA 4ZN1A 2FD2A 2E5JA 2NUHA 5HJXA 1JXVA 1D09B 4TUYE 3W5XA 3MMAA 3MMAB 4PK6A 3EGWB 4V19J 3ZC4A 4CRJA 1K0VA 5IZHA 3HZEA 1JLGA 4I2PB 1AA1B 3W9IA 4DV0J 4PNIA 2U2FA 3SDEA 2YWGA 1QUUA 3N9NA 4OZJA 5MLCV 2QN6B 1U8SA 4ALZA 3DOMB 4B3RJ 4LF2A 2Y6XA 3HL6A 1H6KX 2IYIA 3SWHA 1B0VA 3M6UA 2QL5B 5AXMA 5KT6A 2FLOA 3BDPA 3CJKB 5EDWA 2X9HA 2UUAT 3PX6A 4DQIA 4YSZA 2VL1A 4DUZT 1SC1B 4DX6A 1FA0A 1PGZA 1P6TA 1UEKA 3E01A 1RT6B 3Q83A 4WIIA 4YFUA 1KHWA 1IVZA 2X1BA 3MM6A 1O6XA 5BJRA 2MQPA 4U6PA 3IR7B 3F56A 4WK3A 4NLUA 2M2BA 5FIIA 3HSJA 2OO4A 4GMKA 5DQWA 5LJNA 1UVJA 2XGPA 3DLGB 4H9OC 1N0VC 4NLXA 2XQ8A 3LQVA 3DM2B 2BYCA 4NCAA 3I32A 4ZCLA 5CD4A 1OY6A 4ZPCA 5LHGB 5JVHQ 4F4KA 4Y0FA 2FJDA 2VK9A 3IP0A 3PV0F 2BJ7A 1RBLA 1RK8A 2XSJB 1TKDA 2WB4A 2EC2A 3IAM9 3H25A 5KG5A 4JP8A 2E44A 2VURA 3UD3P 2NR0A 3VRBA 4DL6A 1BD6A 1DARA 1SV5B 3TA1A 2CA5A 1CJUB 1N54B 3QNWB 5B0AA 5B0GA 2AEFA 1D9DA 3VGTA 9RUBA 3OPKA 3PYGA 2JIWA 3SV3A 4NMXA 3FZKB 2CA9A 1SA0E 4YTPA 4A8FA 3HKDE 2Z30B 3ICLA 1YLXA 3ILOA 5KFEA 1LRZA 4TWFA 4ZJOA 3GN5B 2GQCA 1G4CA 4B6XA 5J1PA 2HZVA 4Q2MA 1S5ZA 3JAMU 3C51A 3HP6A 1RT2A 4O4JE 4KH1B 2ROGA 2XHCA 2XMKA 1O51A 5JDNA 2GVZA 2GGPB 2M6BA 3POTA 4I55E 2FY8A 3ZZUA 3KK3A 3K59A 2V8SV 1JLEA 1IKWB 1ZEEA 3LTOA 2FPHX 4CLWA 1SL2A 5GADI 5LMNF 3AE2A 1JNZA 3QZ7A 1O5JA 1H7XA 4CLFA 1MG7A 4FBUA 1RWKB 1X5SA 2ROEA 3PR5B 4X20E 2KM8B 1HYSB 2VICA 2AGPA 1VLYA 4EXTA 3ENAA 3W65A 2M4MA 4DR6J 2WU2A 1Z2LA 2YXLA 2FLPA 2K9AA 5EUHA 3PJAJ 3R2DJ 3CJTA 3S1TA 2WVCA 5FLXU 1BR4A 3PX4A 5EK4A 2RSQA 5J2PA 3W3SA 2RIJA 5HMWA 1S59A 5DQHA 2YWKA 3EVWA 2IW5B 2C3UA 3CO0P 3R6LB 4RNHA 4CYUA 1KEKA 3V5RA 1Z8UA 3ZTOA 3MEEA 1JLQA 3BSCA 2M6IA 4JV5T 3EVMA 1R89A 2CJ9A 4O2BE 4RLEA 1WCRA 4OHFA 4RNMA 1RABB 3IM8A 3D68A 5JTGA 5CFBA 1FNMA 4P52A 5LHHB 2IVYA 4IRDA 3K89A 2XMVA 1FWPA 1B0TA 1GK8A 1VI7A 3KG1A 4HFDA 2C3PA 2FHJA 3OL8A 4X4SA 2CQGA 3QRPA 4RWWA 2VZ9A 3GSDA 1IAPA 2P9CA 5JDQA 3T1HF 1DHMA 1VCTA 3V2UC 5C24A 5KFZA 5KDMC 3HHDA 5ETRA 1X8DA 5A0YA 1T02A 2NTXA 2VFSA 2QMXA 4UXNB 2KXHA 3FBFA 4NLYA 2WSSV 4F26A 1L3UA 2ZH1A 3H4BA 2HWTA 4KHZF 1QE1B 1WKKA 3X1DA 3DOMA 2WB1D 1F5BA 3DLGA 4LF8F 2AV5A 3MZKB 4B3MT 2ZDPA 1U6ZA 4OYKA 2IC9A 4OZ1A 3DU6A 3K8WA 1U1PA 2Z2YB 4DV7F 1OQ6A 3ZSSA 4ZLLA 1XMOJ 2KKHA 1M90T 4ISTA 4AUKA 1IJEB 5EN1A 4PWDA 3IGNA 2IA6A 2XLJA 5IHYA 3M6WA 4A8KA 2ASJA 3PYFA 4EZHA 5J2QA 2KL8A 4OI0A 3DXSX 3AD9C 4N47A 4E2FB 4IR1A 4LMZA 3ZTSA 2C5IT 3CC4S 4EZ4A 5AXLA 5L1LA 5AQJB 4YN3B 1DZ5A 4L6V3 5FVKA 3DDNA 4A46A 4U95A 2C2RA 1YQ3A 5E3CA 1QSLA 4YUDA 2F8EX 1NPKA 3FSYA 4LRCA 1CPZA 2BMBA 2IPOB 4X62F 2XLIA 2L9DA 5AQPB 4EGWA 2KB2A 1KP6A 4DEZA 4DV2T 3CCMS 1DJ0A 1E1HB 3FNNA 1LW2B 2K2PA 5D15A 2G2YA 4Q25A 1IQZA 1AB8A 2LA6A 3NWRA 2HAIA 4FKYA 2E5IA 1ZETA 2PG8A 2XAQB 2IC3B 2FJBB 2DL1A 4Z91A 4YJ2E 1I6ZA 3OXFA 2HFUA 2D2SA 2P9BA 1J1JA 3G71S 4O3RA 3OL9A 4KV8A 4K4VA 4URSA 4HEAA 4IGUA 3ZT6A 4O4GA 5CAAA 3CCWA 5EK3A 2B6AB 4YQWA 4IYQA 1U0SA 1RKIA 4Q7AA 4X64J 2OELA 3RRGA 2P2CB 3CJ8A 5D4NA 3AE3A 3AXJA 4C11A 5HEOA 3D6HB 4KHPT 3M8YA 4GYRA 1SKWA 3IR6B 1YDLA 3HHLD 3UO0A 2VFTA 3W2VA 2GW8A 4M5MA 4F36A 2HHVA 4ZLNA 3EGVA 1PBAA 4B17A 4NCGB 2LXUA 5LL6d 2W67A 1NH8A 3WI3A 2MTLA 3M32A 3PHEA 4JV2A 2MKYA 3AB2B 1YRUA 3PE0A 3OVUA 3G8QA 2DHHA 4JI4F 3ZTQA 2CQ2A 1WSRA 3JSRA 5DGAA 2MOZA 1LFPA 2XQ5A 2B4UA 2FLLA 2OGUA 3GJRB 1TZ0A 1YXRA 4ZIVA 5E2QA 2SPCA 4UVBB 3MCSA 3FMWA 1S99A 4B9MA 4ZPBA 2UUCF 4AKGA 1FX4A 1Y7PA 4IG3B 4E7ZA 3CJRA 1ZM9A 3LGHA 3NRXA 2Z0GA 3L95X 3ZZOA 1Q5VA 1UX4A 4A48A 2UXBF 1F5CA 2DHXA 2Y1RI 4TU8A 1Y3KA 2WB5A 5AQVB 3BPDA 2UXXB 4QW8A 5EGYA 4AT1B 1MROA 5KFWA 1A7GE 2AHOB 1FKPB 2HBQB 1Q0NA 5DQVA 4KO0A 1X9MA 1Y3JA 4HHHA 4EO6A 2COLA 5AE1A 2IMLA 2HNZB 3BR9A 5HP1B 2PMWA 5KT7A 3HR0A 4KBMB 2DGTA 1KSPA 4ECQA 4M5LA 2V1DB 2HZAA 1IJFB 4ZP9A 4P71A 3TANA 3Q2TC 3FXDB 5B0BA 2CJXB 3HD2A 3VF0B 3IWXA 4ZCKA 3W8GA 2L3LA 3MWBA 4PQUB 3AXKA 1T7SA 1D1CA 3MHYA 1IR2A 4HFVA 4QYRA 2YVSA 2AGOA 1FK9B 1RT4B 3A8IA 4QH5A 3CQGB 4ZVHA 1R8BA 2MKSA 3U27A 4G65A 4OV6A 4ERDA 4AFFA 1A0OB 1IJ6A 4USWA 5A6PA 2DGWA 3QFWA 3V6DB 2N9DA 1M5VC 3WC2A 3DXBA 2HWHA 3SXLA 5I42B 2B0GA 4JI6F 5FJ4A 1FO1A 1TK0A 3AB3B 4YY3T 4EYHB 5CZVA 3FCVA 5AFUL 2Z2ZA 3P8BB 4HACA 4HACB 4ECUA 5KG2A 2DR7A 5EX0A 3I5CA 3VZHA 1LFWA 4QXCB 4JI0T 2WOMB 2BRLA 3ZZRA 1G73A 1UGOA 1XTZA 5DS7A 3TLVA 3CC2S 1F0XA 3WZ0A 2XZEA 5C25A 1VC5A 3N9MA 4X1YE 2V0NA 2ZZNA 4OLOA 4DUYJ 3D66A 1WD6A 3CW2C 5KG6A 3TX8A 3QO9A 1WF0A 5HROA 3AAEB 2OPRA 1HNZT 2UV8A 3LK3B 1VBYA 2IRUA 1F9FA 1SIZA 1HG2A 4PABA 2DWKA 3OR1A 4I56A 1HARA 4BAYB 4DV3F 3AECA 1WACA 4PXDA 3D54A 3EPIA 3RR8A 4DF8A 1VRTB 2BJ1A 3H5XA 3PUYF 1RWPB 1RT6A 1JLBA 1ZTTA 4M5KA 2LQ5A 2WVBA 8ATCB 3CCVS 2R7OA 2IBKA 3TJ9A 2DD8S 3GJSB 3LAKA 3QWUA 3DLEB 3HSZA 3KTQA 1VBZA 2XMAA 1S0MA 4WFYA 5HWXA 1RAEB 2NREA 4KPYA 2LT3A 3NNAA 5F8IA 3FBBA 5KFTA 1C0TB 4EBDA 1WJ9A 2DNNA 4WWSA 1HKAA 2V2ZA 4S0MA 2UUWA 4TU7A 3RIFA 3RW7A 1HBNA 1H72C 4GYSA 1ZPWX 5L9NA 1KFYA 5JR9C 4J9PA 2DR8A 1UVKA 4WZXA 4RW7A 2ALZA 2PD1A 1RUSA 3GV5B 5HATA 3M30B 4OZ5A 1Y00A 4QXHB 2V7JA 3CXCR 5JRCB 2ZH9A 1CQMA 1KD1T 1IM6A 2YNHB 4HWFA 2AMCB 4KI0F 2BEFA 2DXDA 3FXEB 2H89A 4QW9A 2DRBA 3P8CD 2POKA 1JB0C 2EXUA 3MTKA 1UA0A 3DRRB 4IG0B 1M5KC 4KO0B 4ZPTR 2R8IA 3I56S 3ITHA 1GT8A 3FBCA 2XHEB 3V81B 1YITS 1PSDA 2R7XA 3CGIA 3N5FA 2XQCA 4H4MB 4DUTA 3RQWA 4QWBA 4FN5A 2ZH2A 1D1UA 4R25A 3TAMB 5A76A 2XG8A 5HQMA 2X3DA 3F44A 3FK4A 3QJJA 4CO5A 3C16B 1C1CB 1S4EA 2MJNA 2XI3A 2DR6A 2DRAA 3M6VA 1R6YA 5KFKA 3T1AA 4B9UA 2EPIA 4MJKA 2DNYA 3FEXB 2JEIA 2HQCA 2DI4A 4RWXA 3R8YA 4RUAA 1SC4B 4MTPA 3ULHA 1HBUA 4IOAQ 2V7IA 3MTJA 5FP3A 4DV5J 3PR4A 2BE2A 3R84B 2N4DA 4J2CA 1Q5YA 2HRYA 1WR6A 3QB5A 5L3BB 4B3TF 3PHTA 2VQET 3S4UA 2BBHA 4LREA 1SL0A 1I51B 3DOKA 4BWMA 3M1VA 3EDRB 3JQJA 2HQIA 3RHWA 2DK2A 3EM1A 1WUUA 3ETUA 2KU7A 3THVA 3GG0A 4MT1A 1YQ4A 1N34F 3PKMA 3MM8B 4FXDA 3TZZA 4IT4A 2DGOA 3FKBA 1VQ7S 4DV4T 3FBLA 2J0XA 2VA3A 4TY8B 2NPIA 2CQBA 3CDUA 2XM2A 3OVAA 3TR5A 4A8XA 4QKNA 3ETMA 5IYZE 1NK9A 1AT1B 2JJ9A 1NEEA 5GVQA 2V6YA 2N7YA 1YQHA 1JLCA 2PSZA 3KBTA 1TFWA 3NAIA 2QGFB 3OR1B 4A4JA 3ZMTB 2MXYA 2J9EA 3M2UA 4LFAF 1P27B 2WMOA 5LM7E 2A3JA 2FVRA 2IAJB 2VJUA 3VZIA 3HO1A 2LRKA 2VKRA 3ZEFB 1O8BA 1S9GB 2VQFJ 2YNFB 1IKXA 1VQ5S 4O44B 3U1LA 4DZ6A 2V5CA 1GXTA 3HVTB 1Q79A 1RLCL 3FZHB 3R6NA 4KRWA 4H4OB 4CIOA 1HW8A 3CJQA 2B9YA 3PO4A 2OFHX 4Q0BB 4ZZBA 2J8SA 5AQHB 2HVDA 4CQ1A 1V5VA 2XS2A 1SH2A 3S8SA 4ETZA 1RDRA 1QSDA 1WTBA 5DG9A 3M2VA 3AD7C 1VISA 2E8IA 2NPFA 5L3EB 3Q2MA 1L3SA 2DNLA 1HBOA 3ZT5A 2RQKA 2ZBPA 4U7CA 5BR8J 2WM9A 4LJMA 3PUWF 2WCAA 2WTFA 1RAOA 2VU5A 5EHHA 2HNYB 3N01A 2X1FA 2I2YA 2HFVA 4KFBA 5LGNB 2O5DA 2XQ9A 1ITPA 1WKJA 3NZQA 2KG1A 1XMOT 2UZAA 1HWUA 4MIWA 2PFFB 4ZVFA 2YWHA 2BX6A 1K9MT 2CJAA 1FFWB 4OFZA 3VAGA 4ZIWA 2UUBJ 1PO6A 3HHNB 2HLTA 3PU3A 4K5SA 4GKKJ 2HG4A 3QNUA 1RB0A 2IVMA 2F63A 2C22A 2H48B 1S0NA 3AE9A 2J1DG 3D6MB 4CH0S 2GQ2A 5DDRC 3M2RA 4OLPA 3BBFA 2G2OA 4H9SE 3HSGA 3NMAA 2B9EA 2Z57B 2Y1JA 3KG4A 4L74A 4KBIA 1XNRJ 3AXJB 2ACMA 2RQ4A 5J1NA 2YU2A 2FVPA 2Z2MA 1YSJA 1YK9A 4NLVA 3K8VA 3ZN0B 1IBKT 1NK6A 4ER8A 1LWEB 4WBNE 4OYOA 2OV9A 4MFBB 3GA8A 4MALA 1RISA 3O1HA 1RADB 4OYPA 3W64A 5HO4A 4FF1A 3CKDA 5ABFA 3I0OA 2XTJP 5HMYA 3T5LA 2FYXA 3T1YF 4FI5A 4PAAA 3DOLA 4O23A 3TUJC 3EMTA 3TKLB 3R97A 2RS2A 2GX8A 5A8WA 2PE8A 2R3VA 5CA0E 3JTPA 5KOXA 4ECYA 2NR4A 1MIYA 2ZWPA 2X1GA 5H6RB 3UQ4A 4ILRA 1XN9A 2XNRA 3VVTA 1BQNB 2V4JA 3KK2B 3CO9A 3PW5A 2MKHA 4MKAA 4X64F 1YG0A 3R1LA 4DPTA 2ACZA 4P6QA 1FD2A 3LJCA 4USMA 3KLEB 1IKVB 2DVIA 3BSOA 2D3O1 3LK42 1Y10A 5L3DB 2YQ1A 5CQGA 4DR4T 2W00A 4K4WA 3AB4B 4FF4A 3ZZPA 4DUYF 2B51A 4A5XA 1QM9A 3IM9A 1O0PA 2XSAA 1T9WA 3PW2A 4K4UA 2MBGA 3T8OA 3DLLQ 3LF0A 2HN1A 3IG1A 3ZXWA 5IOLA 3MPWA 3ZPOA 2ERRA 1ZBTA 3THPA 5GONE 3UDEA 4Y2KA 3DMJB 4LF7J 3DC2A 5E3PA 1MN7A 2R2RA 1SH0A 1FEEA 3VGVA 3KHGA 2A3DA 1S48A 1QVFR 2DEJA 3OTOF 5JDMA 2ZHOA 1VOMA 3LWLA 5JVDE 3NBPB 3OTCA 3UQ7A 1QAXA 2RH3A 1G6BA 5LT5A 2VG7A 4O4LE 1B7FA 4LFCT 1IBCB 1HHSA 5CXTA 3C66A 5SUHA 1U0HB 4Q2LA 4DPXA 4X4VA 3GR1A 2XZTB 1M1HA 3VRAA 5IWAF 2M88A 4BC7A 1ZM4A 5A8RB 3KK1A 5FDLB 1QAIA 1RT3B 3FRZA 4NXMF 2GIRA 1IWAA 2JJ4D 2VKDA 4P09A 1NDKA 5BYSA 4IH6A 2HHHJ 3UFGA 1HQ2A 1LWCB 3ZYKA 3I55S 3TA2A 3NNCA 5C25B 1S97A 3GTYX 3P49B 3LBXB 2YX1A 3OVSA 3ZJ1A 3MACA 2CPJA 4A8YA 1HQEA 4L72B 3LW5C 4MK9A 2YH1A 1SV5A 3KMQA 4USUA 4OYJA 2XLKA 2QJ3A 3GP9A 2OLTA 4ZI7E 5LHIB 2ZLYA 4C8ZA 3O6QA 1R8IA 4IE5A 4MYTA 1KNPA 3QOFA 2FLNA 1WF1A 1RWVB 2CDRB 3MPDA 2MQNA 1GMVA 1FT8A 3G2XA 2PT0A 4JB8B 1MSWD 2GGPA 1J5OB 2DGUA 2CQ3A 4QX7B 2OPQB 1TKXB 3RRHA 3ANWA 3ANWB 1QDUB 4YTNA 4NASA 2EFQA 2AZ1A 3R5GA 1MMNA 3K5MA 3FJ2A 4TYAA 2R2TA 4K4TA 3D3BJ 3FFIB 2CCQA 1XEZA 4O0NA 4DSIA 3Q8YA 2ZJPQ 2HFZA 1KEYA 4QR0A 2C2DA 2GIFA 1VBKA 3MOJB 4BS2A 4LSNB 5SZTA 2CKWA 2XQAA 2MTQA 4LIRA 3ZMZB 1FRMA 3MI7X 2JL9A 4RW7B 3HKEE 3SSRA 3Q2SC 5JR9A 4JI3J 4BA9A 2E7XA 4B3MF 1MWZA 3E08A 5F9LA 3SSSA 4Z37A 4LFBF 3DKDA 4V1Ak 3C6TA 3KFWX 3RYFE 1REVA 3RTVA 2NS1B 2DR5A 3FC9A 4YHJA 3K5OA 3KLEA 4O3NA 3ZC1A 1VYAA 3HVRA 1KHVA 1R0CB 3KLHB 1X31C 5ITHA 2AJQA 2B3TB 4ZOLE 3GV8B 3D0IE 4WYVA 5CYQA 4PG6A 7FD1A 3VAKA 4KJIA 3LH2S 1JKHB 3AA6B 1JKHA 1MWQA 3O9XA 2I5JB 3VAJA 1R7IA 2W7PA 2GQQA 1T8EA 2FHMA 4F0HA 5T7LA 4C48A 2KMFA 2Q79A 1W0BA 2EHOB 5LJMA 4NLSA 2J6SA 3IF8B 2ZWOA 4R5PB 1XDPA 2JEJA 2F65A 4J37A 2E9XB 2NCKL 2BUNA 3RIUA 4NLPA 1S94A 1FJGT 4ED5A 4UVCB 3EVYA 2R8GA 1YRXA 5GAEU 5KFGA 3PVXA 2DBBA 3BZQA 3MKDA 1VC6A 5D0RA 2BJEA 3CPWR 1WEYA 2GVDB 4MKVA 4USHA 4GKKT 3ZTPA 3J9X1 2V4RA 4X4NA 4F0MA 1XMQT 3C15A 4HH1A 1RWUA 4EIWA 1FRHA 1VC0A 1I5OB 5GAHI 1KS2A 2YKMB 3QZ8A 2OSRA 1IN0A 2VQFF 4PWDB 1H7CA 2RKIA 1MIWA 3JSYA 1DAXA 3NKYA 4COFA 1ZAXA 3A7MA 3ZMUB 3UUBA 2E1CA 2W2OP 2QSFA 4CH1A 3UU6A 3CT9A 4TN2A 3O1IA 2W0GA 5I3QA 2HPLA 4P0BA 2R8HA 5ADXL 5BMVE 4V19X 2EKNA 4IE0A 5DJQC 2BA9A 3JQMA 1UX5A 2NOXA 5K14B 3KV9A 1AFJA 3D0TA 2CPXA 2CFXA 3SS1A 3FQLA 5KFAA 1EIYB 2AF6A 1CJTA 2V7LA 2I9SA 1X5OA 2AKWB 1NK5A 3J81Y 4ZJLA 2KNDA 4KB7A 4Y34A 3THTA 4ELTA 4FNHA 3WQPA 1EHWA 4ANCA 1RHKB 1VQSA 3SQGA 1RHQB 3RG6A 4HFEA 4LMLA 3JSBA 1VQLS 5JXSA 3BGRB 2BKPA 1FJGF 4ZP6A 2HPJA 3AA1B 3F2EA 2VPWB 1FWLA 1Y01A 2C5JA 3NOCA 1Y64B 2V6AA 2IVFB 2LQBA 2DYAA 2BG9B 4UT4A 4TNVA 3JB9k 4ID5B 4HGAA 2ZH8A 4G1PA 2UVVA 3ZCJA 2V63A 1E6YA 3UW1A 2KG0A 2VWAA 2Q43A 2CQ0A 3GPAA 4DVDA 2KXNB 3BQIA 3IN5A 5F3ZA 4EAHA 1Z0PA 1EP4B 1YVFA 1X0PA 1Z2ZA 4R8UA 2GAGC 5FD1A 2B43A 4FDFA 2XSBA 4I2QA 4YB6A 1VQPS 2FDNA 2LEBA 2B4PA 1NSKL 4LFAJ 1REVB 2HVHA 1GX5A 3J7Yq 2QLWA 1HNXJ 2X3GA 1NUEA 1U1OA 1S7IA 3SCJE 3HHEA 4DQPA 3PZPA 4EV6A 3PEHA 2HVEA 3M30A 2LOPA 2VBXA 1W2BR 2YY3A 1WC3A 3HFKA 3VR9A 3RB6A 3W2VB 4ZLJA 5DZ6A 3SCIE 1Q82T 1WNEA 5F8PA 4J9SA 4NMLA 3UT5E 4QH4A 3RYHE 5CHCB 4P74A 2B5JA 2X0YA 4MYUA 1LXJA 3RYCE 3WIVA 2HHWA 1VR6A 3BM7A 2ZZTA 4PJLA 3NGSA 2ILZA 3LGMA 3V4IA 2WU5A 2PFVA 3ITHB 3LANA 4YXDA 1PAEX 1HBOB 1J27A 4EB6E 4DPOA 2ADCA 3PM9A 5HP1A 1UKUA 2H88A 1XR7A 2W4CA 1CUNA 2UXDJ 1RBAA 3GE9A 3KUHA 4TY9A 2KH9A 1SJ1A 1UVIA 4OJ1A 4PFOA 4CT8A 4MAKA 5KT4A 3M8SA 4CCHA 2EHOA 2DIUA 3BREA 1HMVA 4LSLB 1OY8A 5L4HA 1FKOB 3TRGA 1RYRA 1RKJA 2HNDA 1N5YA 1CJKA 4CN6A 4CWBA 4RW4A 4F2SA 4J9VA 2IMWP 4QU6A 3UUNA 2GFFA 4XTTA 2K5BB 3L09A 3CJ2A 4X4QA 3FB2A 1FJ7A 2YX4A 4P2XA 2LOSA 1RAAB 3TVKA 2WWVA 2ZH6A 3KLFA 2FJEB 3BH7B 4KY3A 4ZZCA 2C0SA 4GOUA 4W92B 3PG9A 1DLOB 2KZ7B 2KWHA 4RUHA 3DLKA 5FL1A 3OR2B 4OZLA 1XNQJ 2Y8DA 4H4KC 3N0VA 1KK7A 1FXRA 1EZ3A 4LBHA 3UCUP 3ESLA 2C42A 1YTYA 4BDPA 1G2EA 1DTTA 3ZNUA 4B9VA 2EFPA 1B99A 4M95A 2KSRA 3H7HB 1LWEA 2CRBA 3MCOA 2ODUA 2ZBIA 3ELHA 2CUYA 1I3OB 4L73A 3OXLA 4HWDA 5L1JA 4N8NA 2M8HA 4WU3A 4EEDA 4EU0A 4B3RF 2XSFA 1NNDA 2ZBQA 3GQCA 2VPXB 1NH7A 1N34J 2ZOMA 3EXCX 1OEDC 1HFAA 3OTBA 1NENA 2W1BA 1TKZA 3UU8A 4N56A 3N2KE 3PIPQ 4DSKA 1OIAA 1EZZB 2PC6A 2WVFA 1R0AB 4I4TE 1S1UA 2YPYA 2CQ1A 2D3UA 2XBPA 1TMJA 2E1AA 1VK3A 4B9SA 4HFCA 4IKAA 4YSYA 4NEYA 2EK1A 3ENQA 2D5UA 1N0UA 3T5KA 3DU5A 1UEVA 3KG0A 4I7FB 1HWKA 3D1HA 3MFIA 4LUBA 3BJYA 3U1MA 1WORA 2PEHA 3AHPA 2YPZA 2NXJA 3RAXA 2CNNB 5H9EJ 1CQNA 2HIYA 2XQYA 3MPUB 4DZDA 3SFUA 3H59A 3TP2A 2QV6A 3WBZA 5ETLA 2FVCA 4LFBT 3U7JA 2F5GA 2MSSA 3NVOA 4M5GA 2JDJA 1FNXH 4C9DA 4HL9A 2V5DA 2LU2A 2YWWA 1URNA 2MZSA 3MAHA 3AEGA 2BJ3A 3K58A 1WC0A 1NDCA 4ILAA 3ET6B 4IDKA 4N77A 2P6SA 1H0HB 2GJIA 4ZLPA 4CXWA 3HDSA 3A8YC 5JUMA 2J0WA 1FDAA 2Q9QC 2OIHA 1VDHA 4JI6T 2XY6A 3KKFA 1D0ZA 5HXHA 2WZ1A 3MK7C 5HMXA 2CPYA 4EEBA 1VQ4S 1WOPA 3MAAA 4IFVB 3AOCA 4Y3CA 2UXBJ 1XWMA 3ONJA 1XR5A 2ZZMA 4DF4A 1S57A 4TLQA 2FIUA 2IRXA 3R3TA 4C0HA 2G4BA 5I4MA 2YKSA 2YWEA 4XIUA 4ED0A 2CM0A 3UUXB 3BN4A 2LM9A 3CX7B 1D1BA 4A56A 3BYRA 1WOOA 2QYGA 1KNRA 2XMUA 1NKCA 1IBLT 1JLFB 1TU0B 2R2SA 3VU7H 2OPPB 3POTB 3E0ZA 3NGDA 3IWLA 2X0HA 2ZM2A 1FNOA 1BGXT 5L47A 3M2RB 3NGTA 4K8RA 1NPPA 3OKQA 4ECVA 4KP3C 4WTYA 2K1RB 3NGUA 1JNZB 5FXWA 4I64A 2WBMA 2R2UA 1GFWB 1D0EA 1SKSA 1TV6A 1YBUA 2WDQA 3CTRA 2JVOA 4LIWA 3VHQA 3EDVA 3TUZC 4PCQA 4O3SA 2GA7A 2JX2A 3B6BA 2KVQE 1AROP 2JNJA 4UF4A 4LF4T 3KJNB 2EK6A 3M05A 2LJLA 1HNIA 1X9BA 2F4VT 1BWEA 3UNGC 1CJVB 1HWIA 1RU1A 3NKZA 5FLXY 4LBPA 3FSIA 4QOTA 2WP9A 3UU3A 4M5DB 2LDYA 3NY0A 4JV5F 3T6BA 4IQXA 1JXLA 4LMKA 4XBFB 4RO0A 1FE0A 2B9WA 5F41A 4ANJA 1HTJF 3D6FB 1Q78A 3L3PA 2IUBA 2BE2B 4JBWF 4CLKA 2BKOA 4UOFA 2CMRA 1APSA 5M2UA 5M2RA 4NI2B 2G9OA 4QWNB 2V9KA 2KXPB 1N5TA 4K4ZA 2NUUG 4C6AA 3PEJA 1IBMF 4X65F 3HJFA 4JI6J 3HMJG 3PKYA 1I94J 4DI6A 5KT3A 3TUIC 2XMWA 3O44A 2WK4A 3BO3A 1TVRA 3QT5A 3PO5A 4E8UA 1RHRB 2ZM6T 5JH7E 3RRKA 1UWBB 1TAUA 3RRWA 3MPVA 4X66F 1HX8A 4DCJB 1AJ3A 3BQ0A 2IJNA 3B13A 4TV9E 2Q6BA 5K9FA 3IS9A 5J2MB 1LWFA 4JI8J 1U24A 4EEYA 3BSNA 1SQEA 1HNZF 2OA5A 3AA8A 3FZBA 2ZBCA 2LKGA 4U7IA 3IRXA 5LMUJ 1NSPA 2A0FB 4LFBJ 2ZVIA 2O67A 3P4RA 2XAHB 4C0BA 1MMGA 5LSOA 5F0UA 4KHPF 4QIEA 5D0HA 3I0SA 2RAQA 3I82A 5CA5A 3HJVA 2XMJA 5JVGQ 4LF5T 3M8WA 3OUYB 5C42A 2HGMA 1MMAA 3QGPA 3HVAA 2ZMAA 3KVBA 2QLFB 2HRTA 2XB2D 3E01B 4ZVQB 3GYXB 4U74A 4CN4A 4NRTA 2HS3A 2H7VC 3LP2B 5LCYA 1TK8A 2BABA 2JRKA 5E0OA 3UE2A 3DJBA 1ZAWA 3R5CA 4N76A 1IBKJ 2AJ4A 1RLDA 3OYXA 1U02A 4C8MA 1M5OC 3PDNA 3JQKA 4NXNF 4K0KJ 3GZ7A 2VQEF 4QXBB 2DWGA 3RAQA 5HEGA 1ELOA 4CLLA 3GN5A 1V3RA 1E6VA 4CXYA 4ES1A 1UUSA 5ETOA 2B56A 3A3NB 4U7UK 1N33J 1HBMB 4JI2J 5J2QB 4LQ3A 3HKWA 3LK2B 5CCLA 2LSJA 2A2FX 4NXNT 5H9FK 3BBBA 3GIMA 3RGIA 3VHLA 4B3SF 4OHVA 4CLUA 3NXZA 1NHKL 4DV6T 3MMCA 2XY8B 5JDGA 1MW7A 3BF4A 3D67A 4EWTA 1VS3A 2NXEA 2J62A 4KX6A 4FJOA 1FJCA 2W25A 4PXCA 1NDPA 3K5LA 4YB1P 3QSYB 2YKQA 4Z7YA 3BK9A 4KYZA 1NKBA 2HK2A 1RT2B 2XEXA 3LGNA 4FP9A 1UPPA 3NCRA 4TYBA 1TUWA 4JI5T 2MGZB 1NB7A 7AT1B 1RQ0A 4DV3T 5KFOA 1L5UA 2MKKA 2RF2A 2LA4A 4H54A 3WX8A 4FF2A 3FEYB 2CPTA 1S1WA 2CPDA 2ZUGA 4JI2T 1Q16B 5DDOC 5D4PA 2W8KA 1NJWA 3VKHA 4OJ3A 3MR7A 1C1BB 3CD6S 4X65J 1NM2A 1GXUA 3CJ5A 4WIQA 5FY0A 3Q22A 3Q23A 1RTDB 3RBXA 1BC6A 5G0RB 1EP4A 2MQMA 2CJKA 4N7TA 4U2ZA 3W9HA 3RRCA 1C4AA 1BQXA 3D2WA 2K48A 3Q8PB 2LSYA 4HH0A 2R7TA 2KM8C 5EK2A 2KO1A 3KHLA 4JI0F 3IBCB 4DS4A 4M63A 5AJ3J 1YD8G 1U4QA 5T41A 4CLTA 4JV1A 4LF7T 5FXXA 1UFWA 1S79A 2DNRA 1LV5A 3AEFA 2D9DA 4EZ6A 3T9NA 2J47A 4UF0A 2OEMA 1WF2A 3TI0A 1BR2A 1PYOB 4GO7X 2DB1A 2XUEA 1FWKA 3N6NA 2KT5A 3KMSA 4P9SA 3ZN1B 1F9HA 4AL6A 2R7VA 4L9IA 1QSSA 1VQ6S 1D8YA 4YLHA 3C16A 1NHVA 2MSTA 2HN2A 2IMOA 3VAFA 3LP1A 3TJAA 5CABA 2CBIA 4I50E 4U8YA 2HZCA 2R7WA 2LSGA 1C0UA 5DQIA 1V9DA 2O66A 2FZCB 4FBTA 2P6TA 2DT9A 3QATA 1ZM3A 1H2UX 1U1KA 3M3ZB 1ZYQA 4KGXB 2PFDA 3QLHA 3QLHB 4JI1J 1JLGB 4PWWA 4MHCA 3HM9A 2XAFB 1R0BG 1X4AA 4HKAA 4GKJT 4J90A 5KFXA 4OX6A 2RKIB 4QIGA 4EO8A 1SJQA 4EYUA 3KNAA 4LQ9A 1CC8A 5F5WA 2QLJB 2I1RA 2CZVC 1T8BA 4R0EA 3QGIA 3DGPA 2VQEJ 4XAXB 3AY0A 1NLKL 1IBKF 2DNZA 2V4QA 4OYWA 2IM2A 2KRBA 3HK2A 3L7OA 3EGZA 3SOLA 5K20B 1OS5A 5IT9Y 1GX6A 4C3KA 4G2AA 1U0HA 1PKUA 2W01A 1LWCA 2QFIA 2MHEA 4NUVA 2RVJA 1ZTWA 1QUPA 3HULA 2MYSA 1FE4A 2LYVA 4JI5J 4J91A 2MKIA 3M4XA 1HQEB 3M2UB 1ZV4X 1S1VB 3BQLA 4Y2AA 5AXKA 2RUSA 3C3LA 3SFGA 4Y6IA 1Y11A 2VIHA 3TOQA 2MPKA 2DHGA 4O3PA 4NYOA 1TK5A 1UTAA 3IA0A 3Q8UA 2YNFA 2LEAA 3D7SB 4ID8A 4OJHA 1Y5NB 3GILA 1F3VA 1NZ8A 4ILLA 2BOPA 1MWYA 4WP8A 2VFRA 5AT1B 2CPFA 4DO0A 2Q6CA 4EFAC 3KLVA 2CG8A 3J7AN 1UZDA 3OXGA 1UK5A 1J5EJ 1U8WA 2Y1IA 5J2TE 2Z4PA 3P96A 5LA6E 2L3MA 3NNHA 4ED2A 1YJNS 1S1UB 1RTJB 5D4OA 2WS3A 2HVIA 1LKXA 1GEHA 4WFAQ 3A1YG 4OQJA 2MZJA 3KHRA 3TQ1A 4KQZA 2YNIB 1SC3B 2R7RA 1SH3A 1SKUB 3ZYLA 5C2CA 1VIOA 5A1LA 3A4TA 2J9DA 4B3TT 5CJ5A 4LF9J 2YKNA 2F8HA 4DG1A 4C97A 1SJFA 4CI3B 2KWIB 2DNOA 3IGVA 5CYMA 1WWHA 2LKHA 3RU0A 1H2TZ 5JDFA 2X9WA 1SKRA 3NWGA 1QUVA 4P0AA 5T14A 4X62T 3G8TA 3JS9A 2V4JB 1U48A 4A47A 4ZCIA 4OV1A 3GJQB 1Y9OA 5ETVA 4F3MA 4FVCA 1S6PA 1VQNS 2VOOA 4HHJA 3CCSS 2XAJB 2QE5A 2B8QA 4ZVUB 5HAXA 1B3TA 4Q8EA 3RH3A 2UXBT 2YX7A 5LMUF 4DR4J 1R27B 5L2LA 4WK1A 1VBXA 1NK4A 3V4MA 3Q8VA 2K06A 1N36F 4DR2J 1IZNB 5CZXA 3ILIA 1HQUB 3LWMA 1RWMB 3MFHA 4YHHJ 5IT4A 4DQRA 4DBRA 2V50A 2AYEA 4NA2A 1TTHB 1LEOA 4RJVA 1UURA 2YDSA 1MN9A 4WZQA 2VKOA 3MECA 3OHAA 3MECB 3C64A 4CLZA 4IE4A 4ISSA 4OI2A 1GMUA 2QMUB 4WKYA 4G3IA 3M8RA 1X4EA 1RI7A 5LYJE 2KINB 4QZVB 2E9TA 3NBPA 3NGKA 1N88A 3W63A 4LSZB 2CQDA 3LALA 3GIIA 3TLTA 2K3KA 4USIA 2XI2A 4H4MA 2C2MB 4LF1A 2CQPA 2Y9HA 1OEDA 4HN9A 4ZPVR 2E5LF 2F9JA 1N5VA 3EUHA 1LOUA 5LMNT 3A3OB 2VG5A 3GIJA 5F8HA 2XC9A 2VA2A 2H3EB 3SEOA 4WKRA 1WR0A 3DDKA 3SIPB 4ZPWR 2E5LT 2CHNA 3UD4P 1BMQB 5HEUA 4K50A 2G0CA 3LBXA 1WLXA 3L9ZA 3GCXP 2BG9C 4DLEA 1D8ZA 3PFEA 1R6VA 3C4WA 4RBUA 2W9BB 1CC7A 3MJXA 3CMES 2M70A 2ZHAA 3HXMA 3C50A 1B7TA 1CJTB 1HG5A 2ZE2A 4CI0B 4FYDA 2VV5A 1HA1A 2NWBA 3I5AA 2XQ3A 4HHUA 3AE4A 2DXFA 1TKTB 5KFPA 3QYYA 1PIEA 3AAWB 3V6DA 2IHR1 4OI6A 2FJBA 4HLBA 2PA8D 4C91A 3UVJB 3MUMP 2V7MA 2YNIA 3AFGA 4ZMMA 4DFMA 2WRMA 3ZZYA 4NLDA 4LR7A 2W4DA 4KKOB 2M8DB 2UUCT 1DU2A 1KOOA 4DUZJ 3G82B 4X4OA 3I6PA 1IBMT 5F8GA 3QQCD 5EWFA 2EG2A 4F3QA 5TAOA 4XDDA 2CPIA 1LXNA 3I9ZA 5KFUA 5HQ8A 1FJGJ 6FDRA 4Y2IA 5F8LA 2BM1A 3BGRA 2WCXA 3BBCA 3HD1A 2KN4A 5DGBA 2WSEC 1FXDA 4F4AA 2AYBA 2XYPB 3GFHA 1VHFA 3DNCA 2AJ0A 1OEDE 3M65A 2RILA 2WONB 5AQKB 4O3QA 2BVLA 3PRBA 4CYUB 3M32B 2CXEA 5F8MA 2EI5A 3SCLE 3CPZA 1CS4A 2YNGB 1WSVA 3J7YI 2GV1A 1HR0J 2PI5A 1TFYA 5AQGB 2V69A 4UVAB 3CE8A 3ETVA 2J0QD 5HJYA 3DRPB 3MEGB 2HQDA 5J1GA 4W98A 3OUYA 2RRNA 2VASA 1S72S 5C2TA 3KINB 3DTOA 4WFZA 1LKZA 2ZBRA 3EZUA 3CD5A 2BM0A 1OWXA 4RUBA 1CSJA 1F9EB 1WC6A 2I38A 1M0SA 5HSPA 1TELA 5ETNA 4P1NA 1FKPA 3IAS9 4Q45A 4DR7T 2R6GF 1SUMB 1JJ2R 2QSWA 4NLOA 4F6RC 1KLMB 1PG5B 5HI7A 3CJ3A 4NUUA 4YJ3E 2GHPA 5GADU 4XZCA 1YKWA 2VONA 3O4XE 1OEDB 4LF9T 5LOVE 3I0QA 4QU7A 4RW4B 5DZ7A 4QQBA 2MJUA 2VG6A 1J2VA 1QD1A 4YDDB 4DSEA 4F8HA 3KDNA 3SSQA 2QA7A 3MM7B 4G1QB 2FBWA 2VC1A 4EI2A 3NP5A 5HXRA 3TJ8A 1AZSA 2IJFA 1RT4A 5H9FJ 2ALYB 2V8DA 3C15B 1HW9A 1XC9A 4HKQA 2WDVA 2WSFC 3QC9A 3VAMA 4EBEA 4PWUA 3CF5Q 2NYIA 1K0TA 2D3OR 3CCTA 4CNZA 3HHLC 2AXDS 3PUXF 4PUOB 1VJWA 1S4FA 1TKXA 2KLQA 1RTHB 1FXLA 5L3FB 4QWDA 4U33A 1Q4RA 4X65T 4AKLA 1QJHA 1NBEB 2MKCA 5KFCA 4TY8A 1WG1A 2NSBA 5ETKA 3BO2A 3CMQA 4NLWA 4ECXA 3R1HA 3GLJA 1Q7YT 4QJVA 1S9FA 3PY8A 2RF2B 2W9BA 2L8KA 3NCQA 3MXHP 3B54A 3CCJS 1IM4A 5D8HB 5B0FA 3MR5A 1CEZA 3RKOA 2KZZA 2CXFA 3NEKA 4HDGA 2DNGA 4C8NA 1WC5A 2KTQA 2B1EA 5KFSA 4DN9A 2QGSA 3A12A 3MZIA 4CO2A 2AP6A 3Q8RB 4OK0A 3KUEA 2HEKA 2CHOA 1AUDA 2F8MA 4F4ZA 4GO5X 2NXCA 2CYYA 4M5DA 5IC4B 2YDQA 1UJ6A 2XY5A 1O3XA 4ZKAA 4HT7A 4USKA 4KGZB 4LF4J 1RT1A 1XBWA 1L3KA 4RW6A 1I6JA 4RW8B 4DXLA 1VHIA 1RT7A 2IFXA 2AW0A 3KK2A 2I0MA 4DQSA 4ANEA 3PUAA 2LFVA 5DLGA 1TP7A 4ECTA 4OMFG 5IFMA 4I69A 4RW9B 4J9KA 3T1HT 1FRIA 1N33T 3GYNA 2AEJA 4B3RT 4K4XA 1XMQJ 3DI6A 2AQ4A 4DDFA 2HS0A 4LF7F 1QY7A 3BN7A 5AQMB 3NMRA 1U45A 4RBVA 4C3LA 2W4XA 3SYZA 3EX7B 3RPUA 3PDYA 2GJ2A 3T5JA 5ADZA 2XSJA 4LF4F 4DX7A 5KFLA 2NW8A 4ZPAA 2BW7A 2VOPA 2FVQA 3PUQA 3PJ9A 3VVUA 1M7KA 1VRTA 2VC0A 2NLWA 3ENWA 3BV8A 1CS4B 4P72A 2BZBA 2OFGX 1LW0A 2HK3A 3E3XA 2QYWA 2A2DA 2H1YA 4OYIA 4J9UE 1YKEB 5DO2A 3NG8A 4EZ9A 3H42A 3WIUA 2IM1A 1IJ5A 4JEHB 4JI1T 4CN1A 2ASYA 3MM6B 1HCIA 2ZOFA 3DM2A 4GVLA 1YRTA 5E41A 1IUJA 3I9V9 2N82B 2JSXA 2WBRA 1SUQA 1PBUA 4DR1T 4JI3F 3H90A 5HVHA 3RYLA 5J2UE 1XWLA 4NLQA 1WG5A 5HBMB 3UI3A 4AKHA 4I0WA 3JSMB 3J81j 1XK8A 1QTMA 5KOWA 2HNYA 2HS4A 1KVKA 3QSIA 1WDTA 2GMLA 3HHLB 3UUMA 4NYPA 2MQLA 1N34T 4WBOA 1T94A 2HNZA 2WW8A 4DV2J 2DPJA 3BQ2A 4DQQA 1KF6A 8AT1B 3AA0B 2LSIA 3PW7A 4C8OA 3ZZ0A 2XQ4A 4DV1T 1DBDA 2VG6B 3NAHA 3M8QB 2AYMA 3OD2A 4C11B 4KSEB 2YINA 2D7SA 1K44A 2LE8A 1UCUA 3W5YA 5KX5E 5J2NA 3VGSA 3O5TB 2LP4A 4M5NA 3RAMA 1YGYA 3MR3A 1KKHA 1NEKA 1WELA 1HNIB 1N5QA 3JTOA 4KGVB 3MMCB 2E1RA 1JLAA 5ETWA 3DLKB 4AL7A 5A2QU 3RF1A 3W9JA 4F04B 2BQRA 3CB4A 3I96A 5F9NA 4QIFA 4UW2A 3TA0A 1IKWA 2BZ2A 3H8YA 2XTLA 1B4SA 3IBFB 9ATCB 2EBGA 1A9NB 3ILLA 2QA2A 2ES0A 3CX6B 2V34A 2YU1A 2GO9A 2LXFA 2CG4A 2V8PA 4TWDA 5J2PB 4YB7A 1U6BA 4B3MJ 4CZZB 2LECA 2MGZA 4RW8A 1RZMA 4LVOP 1B7YB 4ZVTB 3HLUA 4DFJA 4EK2A 4U67Q 3D0GE 4IOBA 3AVSA 3QIPB 1UVNA 2DLRA 5L1IA 1H74A 3ISNC 2C28A 4XO0A 3DGVA 4X1IE 4KTQA 2CQCA 2HQ3A 3PFOA 1C1BA 2WVEA 3TNVA 3HKBE 3VALA 2EFGA 3MCNA 3CCRS 4GK5E 5B0CA 1JMTA 2W9CA 5F0WA 4TNOA 3C98B 3MM5A 1FMVA 4OYMA 4HEA9 4Y00A 4DPYA 4DL3A 3Q89A 1RP5A 5ETTA 1YJTA 4HR2A 3ISND 2DCFA 5H6QB 4DX8H 2WQYA 3FZ2A 3PUGA 5A0YB 1S0OA 5HEJA 1RAIB 4F4WA 3FCWA 5KT2A 2X9YA 3WHIA 4ZVOB 3AODA 4EYYR 2IDOB 3TYTA 4PJMA 2UVUA 2GK9A 4F0KA 4AQYJ 3J7ZT 3ONXA 5AQTB 5BYRA 3IR5B 2JLGA 3JXOA 4JI7J 2XY7A 1T05A 3OT9A 2CEAA 2UU9J 2K3WA 4CTAB 4Z8XA 3BGLA 3DDIA 2VHGA 1WOSA 4RNOA 1HF8A 3FQKA 2ZM6J 2B7BB 3RIUC 4ZEYA 3AE5A 3E22E 3UWTA 3QUJA 2RUGA 2EEYA 1MU2A 1MU2B 1RA7A 4Q44A 3CIZA 3M8ZA 3OL6A 5DM7Q 1RTIB 2L9WA 1VJQA 2V8VA 5AQNB 1P8GA 2EW9A 5EWGA 3RBEA 2U1AA 2FC9A 5HBMA 2V7KA 4L0RA 1EAYC 3HF5A 2AD9A 2YEVC 4LFAT 3A3PB 4IE6A 2XM1A 1T72A 2VG7B 2CNKB 2NZ4A 1FERA 1S77D 2UUCJ 2OUGA 3ZT7A 4BJNA 3BGOP 4JI8T 3MD1A 1W25A 1RWXB 2EWHA 3OQ2A 4IH5A 3AT1B 1Y0HA 3RC3A 1VIXA 4UUWA 4OHZA 3K3QC 2OPQA 4IIJE 2L9QA 4P7TA 3MF5A 3OVBA 2OEKA 5KFMA 4LF9F 4X84A 2IC3A 4DV1F 1L3VA 2V2KA 3NGRA 2V2QA 2FGCA 1KQSR 2UXNB 2MPUA 2VDHA 2Y0SD 3JYTA 4QBUA 4F67A 5AQFB 3PUSA 2CLYB 2DISA 2YQ0A 4Y28C 1HNVB 2V8HA 1CLFA 3BS9A 1RWNB 2FB0A 3W5ZA 3BKFA 4DR3F 2QG9B 2J6UA 3CEDA 1MNDA 2HHHT 1S1VA 4XDCA 1ZM2A 2RU3A 2KJVA 4Q8FA 2K7JA 1FEWA 2E1PA 4OZ3A 3ZYMA 5M4YA 4J9RA 5GAEI 3HT3A 5U47A 4P7VA 1ZAVA 5L8RC 5KFNA 1FDNA 2DH9A 4UELA 3T9ZA 2VKZG 4DR2F 4JYAJ 5FY7A 1H7WA 1S1WB 3EDQB 3A5XA 4P10A 3FBZA 5KFRA 3A8EA 3TVYA 3AJDA 2FJVA 2J9CA 3P4QA 1U09A 3LDQB 1RE1B 3QWPA 5HCJA 4ELVA 1KFSA 1W26A 1ZOYA 2VFVA 1ZKEA 2GO8A 2BG9E 2BS2A 3C6UB 2XGQA 4V1Av 2KVIA 4UTGA 2C3YA 1DTQA 3PJWA 4WFXA 3O2IA 2R8KA 3H40A 4IO1A 1JJCB 3J80U 3ONQA 2OH2A 5E7OB 3UQSA 2JFDA 2DNQA 5JMNA 2W9CB 2MLXA 3RC8A 1URRA 1TL4A 1FRKA 2XS5A 5AQSB 4HT5A 5JR9B 2ROPA 3P3DA 3TW0A 4USJC 2MAWA 2AX0A 3GG1A 2GHVC 3E51A 1XNRF 4DV6F 2A6OA 3Q5EA 3RR7A 1KQFB 5HWYA 3H4DA 1HI1A 3MR2A 2BVMA 4MIBA 1E7PA 1WHXA 1TUVA 2BJ8A 1HPZA 2WHOA 3N5BA 3OTDA 2WDRA 1OPIA 2VB6A 2LEPA 1QE1A 3GIRA 2Y0BB 3CULA 5T7LB 3VAHA 2YTCA 4FZVA 5M2PA 1A6LA 1VQYA 1ULRA 2UU9T 1ZP0A 3W15B 5I3UB 3B4DA 1LVKA 1QLBA 4HWIB 4JI7T 2ZOGA 4DU8A 4IUFA 1L0VA 3OR2A 4NOHA 2DGVA 3DRXA 2UXCT 1KFDA 3G06A 3RJMB 5L39A 1LNQA 2W2NP 1HR0T 5FXZA 2C1EB 1F60B 4TLRA 1AZSB 1YJRA 2HBYB 2KFNA 4YR3A 2JWNA 5KG0A 1YJ9S 1EKRA 2EG1A 3CD7A 1U47A 2DR9A 4QPTA 5DM6Q 3ABVA 5FKYA 2VJVA 3VTIA 3E2EA 4PZVA 4AKRB 3X3UA 1PAUB 4H63V 1LW2A 1TVRB 2AJ1A 2L9NA 1RTHA 3T1YT 2IA0A 1HWJA 2CNLB 2DHRA 3RKGA 1GMWA 1X4FA 2W63A 4OHXA 3TZXA 2E5GA 4K5RA 1VQKS 5B09A 1P1TA 3JAMY 2MMYA 5I42A 4URGA 2DITA 2FJXA 1VMBA 5KFDA 2DKOB 4OYAA 4QR1A 3K57A 4DR5T 2IIHA 2M67A 2OHDA 5KFYA 8RUCA 2NP9A 3I0RA 2MEWA 2E2AA 2DGQA 3HFVA 2WSCC 2EFNA 4ECWA 1N36J 5AE2A 3A8KA 3AJ1A 5JDHA 2ZVSA 2D9OA 4DR6F 1RSCA 5BR8T 4NZ0A 3C14B 3Q24A 1NB2A 2WAQD 1LW0B 2ZFHA 4GKJF 2KT2A 1PC5A 2CQ4A 5J1EA 5F3TA 2ZKTA 2CLYC 1GNKA 4Q43A 4UY8T 1YWXA 1T9VA 4J7CA 2LEHA 2D1CA 3N79A 1DQ9A 1ACMB 3QBCA 3TZYA 4WF9Q 1U1QA 2AE9A 1FRLA 4HFBA 4QPXA 5LSLA 1P9QC 3OFFA 4IL9A 2E5VA 3ZKRA 2J4GA 1VFJA 1GTEA 1EX8A 2ATCB 2W4PA 5CYQB 2F1FA 1GQEA 2WAUA 1XIQA 4PXEA 2Q1LA 2I5JA 2XPKA 5IWAT 1RT3A 5ETSA 2XAGB 1EB0A 2JH3A 5D6GA 1EQMA 5ETPA 1VQ8S 2MDAA 4G1IA 3ILJA 5C24B 2K7KA 1S6QA 4OL8A 4M8LA 3NRBA 1RT5B 2DHAA 1NZAA 5JQGE 3PTWA 3V5SA 3P4PA 3S6EA 3HKZD 2QC3A 2P9GA 3C19A 2K1RA 4RR5A 2HGNA 4F02A 3FDSA 4K59A 3KWMA 1CJUA 3OSNA 3MD3A 3D9BA 5LNKA 3L7UA 3JAFA 1NJZA 4HTEA 3KHHA 1J5EF 1IR0A 4ED7A 3GIKA 4DMVA 2W7AA 3C46A 3D4JA 2WWUA 1KC8T 5GMEA 1R8PA 3CJKA 3O3LA 2RA1A 4I67A 3VWSA 4DS5A 1DURA 3AA9A 2H5JB 2Q9QA 2CJBA 4RNNA 2KFYA 2I6HA 3V81A 1TL5A 4PPZA 2BKNA 3EI0A 2GC8A 4JV0A 4DUYT 4OI3A 4JOUA 3UN2A 2HHUA 2KHDA 4Z7CA 2I59A 5L38A 1FFSB 2DJWA 2V68A 3KNGA 4PYDA 3DYAA 2GZOA 2MY7A 5FYMA 3US5A 1FVQA 2BDEA 1UCNA 5FDLA 2DPIA 5DDQC 3C4ZA 1BXNA 2BW2A 2XZDB 1XR6A 2LRLA 3OFGA 2IY5B 1D9FA 2FVSA 1PJ7A 1KWMA 4CM0A 3SBMA 4PQAA 4WTOB 1XNQT 4ENOA 2RB7A 1OYEA 3NOGA 3N9UC 2BJ9A 1WEXA 4PUOA 4NE9C 2OJ3A 1TKZB 4JI4J 2RQMA 3D1OA 1Q7LB 2W7OA 2CJYB 2UUAF 3VR8A 2QVAA 2Q9QD 3HVWA 4DHVA 3SDEB 3PUZF 1RCOB 4K2XA 4OHYA 1R0AA 4DFPA 3TX0A 3KLIB 1RT1B 2R7SA 3ZZTA 4YHHF 3W8PA 3KYLA 3W2WB 2D41A 4CO4A 4GK0E 4CQIA 3IO1A 1FESA 2WMNA 3GFXA 4IDNA 1J5ET 1TL7A 5CCMA 5AQLB 3AH6A 4DV3J 3KVAA 3DLEA 2BJDA 3CMLA 2DXEA 1X0FA 3CDAA 2HQFA 4WCEQ 5B0DA 4MH8A 1FX2A 4I4BA 3DLBA 1NPRA 2O3DA 4DN0A 1N32T 2KFZA 1BR1A 1RHMB 4ED3A 2ASDA 1T05B 4UZBA 2D9PA 4LF5F 3HZGA 3RIAA 2EFVA 4OYZA 1VRUB 2OD4A 5DG7A 2AEMA 2H7OA 3O1JA 4AQFC 3ZMVB 4OI4A 3CNQP 1V3SA 4WP9A 4OZ2A 3M2VB 4AQFA 3H37A 1QVGR 2J9DE 2IAJA 4WFNQ 1NXIA 2E9XC 4UQGA 5L4EA 3KV6A 2WONA 3GFYA 1X4CA 3OBIA 4I6WA 2RJZA 2PMHA 2VBZA 1J5WA 4NXNJ 2G0JA 1H73A 4GIWA 4YP3A 2CRLA 2ZM8A 4PRFA 4ILMA 2YNGA 3DI6B 4PW8A 2VQFT 4ZVGA 5KFIA 1CULA 2OP5A 2ZITA 2RT3A 1S10A 4J9NA 1U1MA 3TWZA 1T9XA 3N6LA 3VQTA 4CZCA 5CH7B 3LOUA 5IV4A 3AEDA 2MB0B 3RBDA 2JVRA 1RGVA 2MYFA 4F2RA 4JV5J 3OHBA 5IUXA 2V2VA 1HFEL 2CNOB 5FY1A 4IQMA 4HFHA 4IDZA 1WC1A 3LO3A 4WE1A 2E9RX 2CPEA 1Q8IA 4YHHT 3N9QA 2X51A 3J81U 4NL5A 3AQOA 3LG7A 4CO3A 1HWLA 1IR1A 3FEZA 3MM7A 1HNWT 3EPGA 2PMZD 3CD0A 4DV7J 3GB0A 5B0EA 4GC6A 2J7WA 2GAHC 4KT0C 5IT0A 2PDAA 1K8AT 2Z2LA 3WC0A 2AJFE 4U72A 3UDCA 2HHSA 1RBOB 2N3OA 5KFQA 2EHOC 1KLMA 4KMCA 1T0TV 4LF8J 3R7BB 3I9YA 3BKUA 4DL0C 2VODA 3UCGA 4H9QC 5KFVA 4JI2F 5D77A 3O1LA 3H5UA 5C2GA 3G8SA 3SMZA 3K3NA 2OAUA 3JYTB 3MEDA 1XMBA 3MM9A 4LRFA 4KGMA 2VL0A 4HFIA 4LSLA 1BQNA 3R2CJ 1YJ7A 3T1HJ 4DIDB 4YR2A 4AIUA 3ZJ2A 3UFEA 3AA7B 2UP1A 4UR9A 1IKVA 4I43B 2PTFA 3EVOA 3A13A 2RDJA 5D78A 1C2PA 1VGYA 4LFCF 3TLSA 3HI9A 2DO4A 3EXYA 2LHRA 3GU0A 2X9XA 3N5LA 3G6XA 4YB5A 4B3ST 2WZHA 3LUYA 1IBLF 2CVIA 4U2YA 4N5SA 3GWHA 2YDRA 2ZKUA 3NS5A 1KTQA 3CCES 3LSVA 1RT7B 2V6XA 4RU2A 3LA0A 1GXLA 1W7WA 2MQQA 4FF3A 5CYJA 3V6JA 2QO3A 3BYPA 3IRXB 3LP0A 2K3IA 3AE8A 2ZEJA 4RUCA 3HVTA 4IL4A 4FYWB 2KRRA 1FHTA 4WXWA 1IBLJ 3CWJA 4C7QA 5IT9U 3DP7A 4OI1A 3NBXX 3FVYA 4DR4F 3GONA 2CXDA 2JLEA 2UUAJ 3PJXA 5FNVE 3AE1A 3HKCE 5I3UA 3UU5A 4YS2A 5H9EK 4IRKA 5I3PA 3MGJA 5LJ5Y 4NLTA 1DQAA 2BACA 3FMBA 3TVZA 2AYGA 1LWFB 5E33A 2H4WB 4H4OA 5HK4A 5B08A 1WHWA 4U7UD 4CLPA 2X0LB 3CVKA 3ZTRA 2RDIA 2XCPA 1Q8KA 1F2HA 3NS7B 1E2AA 5E3RA 2DH7A 4A8MP 1TQLA 2ZJQQ 1D9AA 1DQ8A 3IS9B 3QAEA 5E5NA 5C7PA 2C2NA 2C2KB 3U78A 6FD1A 3BKTA 2NZCA 4L3KA 1JQGA 1FTCA 4U96A 1YZ6A 1EKSA 2IDEA 2X67A 2BOAA 3PX0A 3UNYA 4WNKA 2GNKA 2UXDT 2B5JB 5F8NA 4USVA 3EJMA 4KC5A 1UPMB 3D1QA 1C0TA 1N4LA 4G63A 4GKJJ 1G3OA 3ZO7A 4B3OB 4TQSA 2YH0A 3G96A 4HTJA 3IWNC 4HTIA 3NRYA 2F3JA 3UR0A 1S1XB 2MQ8A 2LU1A 4O3OA 1R3NA 4NPOA 2E29A 2GCFA 2RMLA 3EUNA 3TUPA 3WAJA 1HNZJ 1HNXF 2HFNA 4WU2A 1TUGB 2ZH3A 2UXCF 1IXKA 5LGUB 2OI2A 4EYIB 5BXIA 2KT9A 1E6YB 4ZITA 1RAHB 1RHJB 1GH8A 2DCUB 3KLGB 4UOCA 4AXJA 2HH7A 2QFJA 2FY1A 1FKOA 2JEGA 1FD8A 1HNXT 1N33F 5H1SV 5LBQB 2DGSA 1YBTA 3PACA 2OPRB 2MY8A 1WYBA 1NHUA 5D0GA 4DMZA 4I2QB 2WZIA 3DHXA 2MZTA 2GVZB 1PYSB 3CMAS 2V26A 1SCJB 4KR0B 4N41A 3QFHA 1MNEA 3D5MA 1T11A 4DV4J 1FK9A 5KG7A 3T6JA 2MKJA 2M0GB 4LR9A 3CQXC 2UXDF 1RAGB 3I0RB 3CDBA 1H3DA 4ZHQE 2B9XA 2H5EA 2APOA 1SE7A 3H5SA 1W0AA 2JC0A 4XPEA 1HYSA 3DRPA 2AX1A 5ABGA 3S7RA 5IV3A 5BYQA 3TLWA 1T3OA 1MMDA 4DUZF 4K2JA 4P2SA 5G0RA 2ACXA 1WRDA 2OMOA 3KJFB 2PIIA 4IG3A 2J76E 2Z6EA 2CJQA 1Q8LA 4BLGA 1CVJA 2BQ3A 2ODVA 1Q95G 1XMOF 2IIUA 5LOQA 3BQKA 2WBLA 2JOQA 5K8OA 5FL0A 5KG4A 3LP0B 2L41A 1M5SA 4LF6T 4DCPB 3UU4A 4QIVA 3PU8A 1DY3A 2JQHA 3Q9DA 4F3OA 2XO6A 3MUTP 3JC6D 4IOCQ 3MUVP 3MEEB 3GYGA 5J0ZA 4ZDNA 3P5BP 5LGTB 2UV8G 4EUVA 1OJ4A 3UN3A 1JXEA 2AIRB 1HLWA 1QLNA 4BHQA 4DV6J 3QT6A 3AE6A 1NO8A 4YR0A 1M62A 3TLUA 2A10A 4AYBD 4RZRA 4F50A 4LFCJ 1F3FA 3AOBA 2O1PA 2VL8A 5K5MA 3IFEA 3IG1B 3F31A 1FMWA 4X4UA 4KHRA 5HMZA 2HSEB 4LF8T 2LXIA 4RPFA 2VD3A 4USTA 3RB4A 5FVLA 2LSKA 4BJMA
chains in the Genus database with same CATH topology
1T72A 4GVLA 2BKPA 4YS2A 2IIUA 1T8BA 2OGUA 1XWMA 4J9UE 2AEMA 3KXDA 2BKOA 4J9VA 4L75A 1VCTA 3RBXA 1SUMB 2AEFA 2OLTA 2AEJA 3L4BC 4G65A 4J90A 4L74A 2I0MA 3L39A 4J7CA 4RO0A 4Q25A 4XTTA 4L76A 2FY8A 1LNQA 4L73A 4J91A 3RBZA 2BKNA 3JXOA 4EI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T72 A;  4GVL A;  2BKP A;  4YS2 A;  2IIU A;  1T8B A;  2OGU A;  1XWM A;  4J9U E;  2AEM A;  3KXD A;  2BKO A;  4J9V A;  4L75 A;  1VCT A;  3RBX A;  1SUM B;  2AEF A;  2OLT A;  2AEJ A;  3L4B C;  4G65 A;  4J90 A;  4L74 A;  2I0M A;  3L39 A;  4J7C A;  4RO0 A;  4Q25 A;  4XTT A;  4L76 A;  2FY8 A;  1LNQ A;  4L73 A;  4J91 A;  3RBZ A;  2BKN A;  3JXO A;  4EI2 A; 
#chains in the Genus database with same CATH topology
 2YKP A;  3R5B A;  3SFE A;  4ILC A;  4ITS A;  2MZ1 A;  4