2BKPA

Structure analysis of unknown function protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
total genus 74
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkpA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkpA02
3KXDA 2BKPA 4L73A 1VCTA 2I0MA 1SUMB 2BKOA 4Q25A 4L74A 3L39A 4J90A 4YS2A 1XWMA 3RBZA 1T72A 3L4BC 4J9UE 4J9VA 4GVLA 4EI2A 2AEFA 1LNQA 2BKNA 2FY8A 4L76A 4L75A 2AEMA 4G65A 2AEJA 4RO0A 1T8BA 4XTTA 2OGUA 3JXOA 2OLTA 2IIUA 4J91A 3RBXA 4J7CA
chains in the Genus database with same CATH superfamily
3E2EA 1WCRA 2W4CA 5SZTA 4ZP7A 1QUUA 1H98A 1WC0A 2DCUB 3TRGA 2PFVA 1RI7A 4DL4A 4ZZBA 3D66A 3UU8A 3B54A 4OZ0A 3T6JA 1NHVA 2VDIA 4OYAA 4Q45A 3RGIA 2LOPA 5EDWA 4G63A 4CDIA 1RWWB 3TP2A 1H2UX 2VFTA 4LBHA 3BBBA 5LSRA 2NW8A 4BCAA 1RE1B 3R84B 1RKIA 2ROEA 3ELHA 2B7BB 2XHCA 2WVFA 1S1WA 1XWLA 2BQUA 4HHJA 1RWUA 2WSFC 4Q0BB 3A5XA 2YK0A 3FCWA 5ETVA 3TLSA 1JJCB 1D09B 3RYCE 3AD7C 3FZFB 1HBOB 4JI3F 3T3FA 5HEOA 1QE1B 2OJ3A 1E7PA 3PU8A 2HFVA 3SXLA 3BQKA 5I4MA 2M67A 3N2GE 1IKVA 1SV5B 4HHHA 4X4OA 3PJAA 4WXWA 3VV2B 2Y9HA 2W2MP 3BN7A 2BG9B 1OQ3A 2R7SA 2HNYB 2CEAA 4H4MA 3K5MA 3C4WA 1JLQB 3PUWF 4NZ6A 1CJVB 5M2UA 1FFSB 2KHDA 5J0ZA 3C8YA 3W5XA 1IKVB 2ZOGA 3VKGA 3G82A 5L1KA 3QRQA 4F6RC 2E1MC 3ENVA 1LRZA 4LF8T 5AQKB 2Q6BA 4YJ3E 3W61A 4B3OB 4CTAA 4ALZA 1VK3A 3MEGA 2R7TA 3KVAA 4HFDA 2VG5A 2XWXA 2OPPB 3GILA 2YWWA 2IVMA 3P45B 3ANWA 2YU2A 4JI8F 1C2PA 2Z2YB 4C0BA 2AIRB 3QGPA 4DMVA 1ZP0A 4ILBA 2KT5A 3RAXA 4DXLA 3IN5A 1U2FA 1I5OB 3AE9A 4ILLA 3QO9A 2HFOA 4WW0A 3U78A 3UUBA 3MMAB 4YP3A 1HWLA 2D41A 1S1TB 3ZLIA 3PZPA 4WU2A 2GK9A 4WTYA 3D1OA 4ANEA 2NCKL 2CA5A 4ZCKA 4DF4A 3I9V9 4BC9A 3LWLA 3FZKB 2N7YA 4MFBA 1HQ2A 4C3MA 5AFUL 4EZ6A 4JI0J 3L4BC 3TYTA 1L3VA 2WM9A 3M7VA 3DLGA 4K5RA 3VZHA 4V19J 1M1HA 4EFAC 1HHSA 1NO8A 3M2UB 4WPAA 2HHXA 3TLTA 4P52A 4PWDA 3NWRA 4TN7B 3G4SS 1EZ3A 3P5BP 5B08A 2VKRA 1L3UA 1S49A 3H98A 3J7ZT 2J9EA 1B64A 3HDSA 1SA0E 2MLXA 4PQAA 1TKXA 2Q9QC 2KJVA 1WEZA 3HZGA 3BM7A 4JI5J 4DR4T 2XMMA 1F6TA 4LF8J 3CCJS 4IUFA 4GK5E 3N6NA 2VFUA 2PD1A 3HHLD 2DHRA 2PI4A 5D0EA 4GC6A 1XMOJ 5D0HA 1AZSB 4HDHA 4PJMA 2Z57B 1IAPA 3N01A 3TOQA 4DL6A 1S9GB 5FYMA 5HJXA 1QDUB 2MZ1A 2HRYA 3FMWA 4TNVA 4OX6A 3GWCA 4C3LA 3QNUA 1S1VB 4QPXA 3PW7A 5KOWA 2QGSA 3MR7A 3A3PB 2Q66A 2RKIA 4F8HA 3AD8C 4J5OA 4DR7J 4USKA 3CJ8A 3CD6S 3MF5A 3OXFA 2KFZA 1VHFA 2A1BA 2ACZA 5G4DA 2HBRB 4QPTA 3K89A 4EYHB 2V63A 2VG7B 1S7HA 4M95A 2XZTB 3L3PA 1OO0B 1KNZA 3D2WA 4OX8A 2XAGB 2MEWA 1VYAA 2EFNA 4FDFA 2BVLA 3QGIA 3G6XA 3EABA 2XQ7A 4OZ3A 3L39A 4N8NA 2PC6A 2Z30B 3CDWA 3ZEFB 4N56A 1OY8A 3MXHP 4NEYA 1QUVA 2J8AA 4DV1F 3KLIA 3NKZA 2AP6A 4IFVB 2HFUA 1CJKA 2O67A 3T5LA 3AOAA 1F3FA 3G2XA 2ZEJA 2EFGA 4ECVA 3WC0A 4J9QA 3RJMB 2FHKA 1D1BA 4PFPA 1GMWA 3R5JB 2WTFA 1NKCA 4LF7T 1VQLS 4C11B 2DVIA 1ZOYA 5G0RB 4OHWA 3AEFA 3TAMB 1JIHA 4TLQA 2HIYA 1XNQT 1GMWD 2XLIA 4LFAT 1S0MA 4ERRA 3C19A 2IDOB 4JI1F 1YG0A 3LF0A 4R25A 2E7WA 4DCPB 1YJVA 2MSTA 4PYAA 4WWSA 1JNZB 3JYTA 4B17A 4DV3J 5JDLA 2NOXA 5FNVE 2ZH1A 2QE5A 3H2UB 4IOBA 5FDLB 1FRHA 1C0UB 4CLSA 4PRFA 3Q8SB 5F41A 3D6FB 3AXJA 4B3MJ 3VVTA 3KLVA 2J4GA 1P9YA 2DY1A 2NXNA 2F5GA 2NUUG 2MZJA 3AB4B 4LF6F 4YHHT 4CN4A 2CPZA 4Z2XA 3R7SB 2DCLA 2MY7A 3SBMA 3HFZB 2RMLA 2H7OA 3HVAA 4TWFA 5CB4E 2OPSB 4KBMB 3NCPA 4PXBA 4UELA 3C16B 3MEDA 3KK1A 1UZDA 4U7CA 2IC3A 2WVBA 1TUVA 2BM0A 2Y1RI 4RUBA 3UD3P 2RVJA 2ZH6A 1PYOB 3LTOA 3IA0A 5E3RA 2P9GA 3RIUC 1HFEL 1CJUA 4R0JA 2ACMA 3LP1B 3UTKA 2C1EB 1BQXA 2AJQA 3J80Y 3I9YA 5DGBA 5J2MA 1VQYA 1QVFR 4YB1P 3L95X 3BGFA 4A47A 4YDXA 1YKWA 4I7FA 4DFMA 5H6QB 3VGVA 4F4WA 4O4GB 2I38A 3W2VA 3EZ5A 2C5IT 3QO9B 4CH0S 3QNWB 1PYSB 4ZLNA 5CZXA 5F8PA 4ILUA 4DQPA 3PFOA 3NBXX 3CJ0A 3QZ7A 4K5SA 4A5XA 3CC4S 1OJ4A 3BR9A 1YX2A 5L8RC 3CCQS 5HXHA 3UQ4A 5CH7B 1R0AB 2VG5B 3K8WA 2AZ1A 5LJ5Y 3PUXF 3ZPOA 1HNXF 1T7PA 1WACA 5IYZE 2JFKA 1AT1B 4HKQA 4DIDB 3LAMA 1S1TA 3A8EA 2F4VF 5ITHA 4X4SA 2WHOA 5J1PA 4USIA 5TAOA 3DOLA 4ZP8A 2HPUA 2DRAA 1BQMA 3DRSB 2H9ZA 2CPXA 1RT5A 3QGGA 3I56S 4BHQA 4YHHJ 1TL1B 4DZDA 4M8LA 4PAAA 2FJDB 1URRA 3MECA 4Y34A 1CS4A 1Y10A 2BVZA 3VAGA 2FZCB 1K1SA 2OGUA 2ZOMA 5KMGP 4X62F 4ANCA 1ACMB 1FJGJ 3N79A 5LMUT 2COLA 2FY1A 1FEWA 3BGRB 1T02A 4A8FA 3CO0P 5H9FK 2JMHA 2PDAA 2HVZA 3SSSA 5BR8F 3P96A 1NK9A 1HYSA 4L73A 1HKAA 4JYAF 4B3RJ 3HP6A 3TEGA 2PMHA 3LGNA 4NEZA 5L9NA 1NPPA 4LFCJ 2UUAJ 3ZT5A 3DLEB 2J6SA 2WS3A 4ZJOA 2HVDA 5FXXA 2NZCA 3RYFE 3EX7B 2FJDA 4XAXB 3BGOP 3LK2B 4JBCA 2IMOA 2BABA 2KSRA 2L9QA 3IR6B 4Q0BA 4QIGA 2C5JA 4EBCA 5KG0A 1K8AT 3KBTA 4EYIB 1TMMA 5A0YB 4DEZA 1HMVB 1JLCB 1NXIA 3IFEA 1FDDA 4AQYJ 2XYHB 4LVNP 3ZTSA 3GG1A 3GA8A 4DNDA 1PAUB 1VOMA 2EC2A 1SV5A 1QE1A 3M8PA 2VFRA 1T8BA 2NSBA 1MMDA 2XY5A 2HIQA 2E9XD 2HHQA 3LK3B 2RRAA 2YY3A 4JI4J 1TUGB 4IO9Q 3JADA 4OJ3A 3F2EA 2JZ5A 4LR7A 1VQKS 5DDOC 4LF7F 5LCYA 3C6TB 4Y6IA 4JI3J 1N4LA 1YSJA 2ES0A 1UCUA 3JAMU 1V3ZA 2VL1A 3PJXA 4CN6A 1LWCB 3CIZA 2KM8B 4DR6F 4U8YA 5HAXA 3MOJB 4E2FB 1VRQC 2XMJA 3BSNA 2DNZA 4DV7J 1X4AA 1EKRA 5GVQA 3GSIA 4TQSA 1NK4A 3TZWA 1CVJA 3FBLA 3H59A 3EDVA 3DU6A 3U1NA 3KV9A 1QLBA 4GVLA 1SC4B 1S6QB 4DV3F 2WZIA 4E8UA 4K4XA 1A9NB 2X9HA 2BJ3A 2LXIA 3OR1A 1X5SA 4A8XA 2FZKB 4RW6B 4MH8A 2CG4A 3IWLA 1V6HA 3MZIA 2D3OR 4WP9A 1DY3A 4DV5J 4IRDA 1FDNA 3JSYA 2L9WA 4DV6T 4H9RC 3QSIA 2AQ4A 3CULA 1DFDA 4QR1A 1VFJA 1MMAA 1HNVA 4DR2T 4QH5A 4KHPJ 2HBQB 2N4CA 4QXBB 2PE8A 2HFNA 1OPZA 1FWLA 3C14A 4QJVA 1O6XA 4KHRA 2Q6CA 1TU0B 1EKSA 4IE4A 3TR5A 2P9EA 1ZM3A 2CDQA 1RTJA 2XNRA 2RU9A 1P1LA 4LF5F 2VOOA 1FI4A 3FSYA 1JLBB 2R3VA 2CQHA 3SOLA 3AFGA 4DR7F 5CYMA 1WJ9A 2FZGB 4NLGA 4HR2A 2HHUA 1S1XA 2ZD1B 4ZP6A 1TV6B 1L3TA 5DQWA 2FUPA 1SKUB 4GVBB 2HWHA 3SQGB 5KG5A 5KT5A 4OL8A 4CP5A 4ZZCA 5IQQA 3UR0A 1QTMA 1X4BA 4IOAQ 4LQ9A 5C42A 2KRBA 3M6XA 1SJRA 4ECTA 1YJ9S 3W3SA 1JLQA 2ZBIA 1RHQB 3ADAC 3C14B 2HURA 3G6YA 3T1HF 3ZC4A 4LMJA 3AE4A 1K9MT 1ZTWA 3MEEA 4HDGA 1M0SA 2VPXB 5KFBA 2X0HA 2HNZA 2ZM6J 2B4PA 3QLHB 5KFOA 3NRBA 1F1BB 2ADCA 1HFAA 3RRWA 2RH3A 4YR0A 1M62A 3TUIC 4I7FB 4UXNB 3M4XA 1DQAA 4NLQA 3MA9A 2MBGA 5EWFA 2CQGA 3HT3A 4BJNA 3HHKA 2QEXS 1R3NA 3QMQA 3EI0A 2YTCA 3CTRA 3O9XA 2YBVA 4TWDA 2POKA 2IDLA 1IM6A 2DR7A 3FSXA 4J9LA 3HT0A 5LA6E 2BACA 4ATNA 3HHLA 1K44A 3D68A 4WZMA 2HQDA 1JNRA 1DU2A 2CQIA 3Q5WA 2KL8A 1VMBA 1S0VA 4M5DB 3JS9A 3NGDA 4MBQA 3RB3A 5C25B 5BR8T 2RQKA 2BRKA 3OBIA 3BF4A 1FDBA 5KG6A 5FXWA 4LF4T 4CO4A 4YLHA 1GX6A 3V6KA 1HR0F 3MEDB 5ABFA 1OY6A 1FESA 1I6ZA 1FJ7A 4DSFA 2W25A 4JYAJ 1VC6A 3N9MA 4NZ7A 1PJ6A 2GMJA 3DGPA 3DDIA 5AQUB 1YHQS 4DV5F 2DY9A 3HHLC 5KFMA 1URNA 3K3NA 1NCLA 4B3ST 3UPFA 1E6YB 1FRMA 1SJ3P 3A1YG 5B0BA 2OSQA 4K2XA 3C64A 4LSLA 3SEOA 4X1IE 1TL7B 4UF0A 3OXLA 1WSVA 2X9WA 2QFIA 3O6QA 4X1YE 3RB0A 3HHDA 2D0UA 1VJQA 5EUHA 1DAXA 4UT4A 2YX4A 5IXUA 1U1NA 5C25A 1M5KC 1H73A 3D1HA 5D0RA 5BYQA 2IJRA 2DPJA 1D9FA 3JAMY 4K0KJ 3CW2C 4UV8B 1G1XA 4FXDA 3DHXA 1FXRA 1WDTA 3UCGA 1D1CA 2KNDA 2FJVA 1XMQJ 3D9BA 1EETB 3UNYA 3K2YA 3KKFA 1HQEB 1OEDA 1BR0A 2E5GA 1WEYA 4ZCIA 4MMOA 4DPYA 2FIUA 4DPXA 5HLFA 1WI8A 2V2KA 5D15A 1TKTA 2ZZNA 4X4UA 4HWIB 4I68A 2WOMB 2J0XA 2BYCA 4V1Av 1RUSA 2RE1A 2CVEA 3ZFVA 4WIIA 3EPIA 3CJQA 5ADZA 2C2MB 2JVRA 1ZM2A 4HEA9 4DV7F 4J9MA 1X4FA 4ED7A 2AMCB 4PG5A 4QHOA 3CK6A 2YNIB 3KDSE 4ITSA 5AXKA 1PAEX 2XHWA 4GIWA 4EYUA 1GTEA 4F3QA 3MUVP 2EPIA 4RW7A 2GQQA 2A0FB 2QT7A 2YQ0A 2DPIA 4TY9A 1FJCA 1JNRB 1U1RA 4QIEA 5E2QA 4DV4J 3AE8A 2C2EA 3OR1B 1U25A 2W2UA 1Y4ZB 2IPOB 5LM7E 2J6UA 2X66A 3TLVA 3O5TB 3J81U 3HKDE 2YNIA 4CWBA 3TJ9A 4MKVA 1JLGA 2MJUA 1V9OA 4QWCA 4IRCA 2J0SD 2V7MA 4EBEA 1WOOA 2XSAA 5KT7A 2YKMB 2WCXA 2YWEA 4TLRA 1XR6A 4ZVHA 3AA8A 4F36A 4UVAB 3HKBE 1UFLA 3CMAS 2OEKA 3VGTA 2LU2A 3CCES 3N9UC 2PN6A 5AQTB 1Q0NA 4M5NA 1NJZA 1NWMX 1HWJA 4JI2T 2VJUA 1M5PC 1IJEB 1Y5NB 1EQ0A 2CNOB 4H9NC 2GMHA 3VR9A 3J7A1 5FVLA 4PG4A 3RI5A 4KHPF 4DR4F 1HPZB 2LQBA 2W1BA 2LU1A 3L7PA 2UUWA 5A0YA 3Q2TC 3KNGA 4AKRB 1S77D 5LMNJ 4UUWA 1N5QA 6AT1B 2AGPA 3I0QA 3TANA 3UN3A 3K5LA 5AJ3J 3Q2MA 1LWXA 4USMA 5LT5A 2OTLS 2I6HA 3GJSB 2LCWA 4DX7A 4OYBA 3NS5A 3QT5A 3NNCA 1HNWT 2B51A 1M1GA 1F9EB 1S0OA 4FF3A 4AKGA 4DOZA 2EG1A 1RT7A 2B56A 1XEZA 2FVQA 2HHWA 4M5DA 1NEKA 3C6TA 2DH9A 2XMAA 2FJXA 4DR4J 3M3ZB 5CFBA 5HMZA 2XASB 2E44A 5AT1B 2V6YB 3UI3A 2EK1A 3OHAA 3MPUB 2V94A 2R8GA 3CO9A 3M2RB 2YKPA 1YJTA 4KYZA 5DQIA 2FHOB 1QAYA 1YKHB 3DN9A 3KLHA 3V4IB 1Z0PA 4LFBJ 2GGPA 5I42B 3BEGB 4X84A 3F73A 2UXNB 1AUSL 2UXCJ 3CJTA 4FN5A 3N6LA 5EWEA 2CLYB 2J62A 3Q8RB 4HGAA 2JL9A 5C7PA 3SQOP 4QOTA 2YNFA 2ZVIA 3VAFA 4MJKA 4JI3T 1HBNB 4NYOA 2EXUA 2W62A 1WOPA 3NCRA 1FF2A 2VBWA 1SKSA 1UFWA 3G6VA 4ZVRB 3LOUA 4OX9T 5K14A 5IV3A 4OJGA 1ZYQA 1MN7A 1CBKA 1WR6A 2Y0SD 3K0JA 5DO2A 1N36F 5J2TE 3PV0F 3QAUA 3PV8A 4DN9A 3WX4A 2JC1A 1W0AA 1BGXT 4CLZA 4CT9A 1BQNB 1UW9A 3US5A 3JTNA 2UUBJ 4L75A 2XQ9A 4XO0A 2OA5A 1HNIA 2HWTA 1PJ5A 4Q8EA 5FP3A 2KFNA 1AJ3A 1ZV4X 2QLBB 4I50E 4JI1J 3KLGB 4OX7A 3RR7A 4NMLA 1S9FA 3HM9A 4KSEB 3BYPA 3PW0A 2J0WA 1WHYA 2O1PA 2YNFB 4X4NA 1CUNA 1OPIA 3KWMA 1MIYA 2H5EA 4NLYA 1S6QA 3SCIE 4CO0A 3G87A 1S94A 4DR6J 1NAQA 4JI4F 1QY7A 3PVXA 2ATCB 2Y8WA 7AT1B 1WRDA 1GQEA 1Y11A 4LF6J 4K4SA 1NHUA 4FI5A 2LJLA 4DV3T 2RNEA 1WC4A 1UWBA 4EYYR 2VPWB 2VKZG 2LECA 1YTYA 2UXDJ 3DYAA 3GCXP 3SFGA 3R6LB 1XNRT 5HQMA 1OQ6A 3KUGA 3J81j 4CLWA 1HNZF 1RT3A 3ETUA 2FYXA 1WF2A 1IM4A 3QPIA 4NXNF 2CHOA 3ZSSA 4F25A 4IL4A 2VODA 1U8SA 3DLEA 4CXYA 2WB1D 3PG9A 3PR4A 3FCVA 4F02A 3W2VB 4MK9A 3CIRA 3ET6B 1V9DA 5DDQC 5LG4A 1I1GA 3C51A 4J9VA 4O4HE 1RBAA 3ISZA 2XI2A 2B9XA 4DL5A 2Q3PA 3JCFA 1F5AA 3KJVA 1R8AA 3PRDA 5HANA 4NUUA 3JAFA 2IW5B 3FJ2A 2DNQA 5GAHI 1HNZJ 3GIMA 2WU2A 2OPQB 2HN1A 2V2ZA 3H20A 4O0NA 1RP5A 3GYXB 3T1HT 1KHVA 2WY2A 3H90A 1IR1A 3ZNJ1 4RNOA 2X9YA 4YB7A 1E6VB 2BOPA 3HSGA 1VBYA 5A8KA 5KT3A 3IG1A 3EZOA 3JXOA 3TQ1A 2LLYA 1H2TZ 1ZAXA 3AODA 1VQ9S 3HCXA 3MFIA 3EE3A 1T7SA 3KLFA 4FYYB 1CHUA 2XS5A 4PG6A 3G8TA 2LFVA 2CXFA 5LMUF 3I5CA 4RUAA 2OPPA 3PUYF 1FEEA 2ODVA 2CJAA 2VKHA 2VA3A 4XDCA 1SI9A 5EX3A 4DR5T 4WJBA 2IVYA 3UQSA 2XLJA 2HHHF 1Z2LA 4DFKA 2B5JA 1FE0A 1CULB 1RLCL 4RW9B 1UWBB 2H3RA 3RBDA 4RWWA 4WFBQ 1MU2B 2ASYA 5GAEI 5JREA 3UCUP 4AXIA 5B0DA 3K3OA 4I67A 3QK6A 2G0UA 1JXEA 4B3TT 2W8LA 1XN9A 3AY0A 4ZIWA 2DITA 1LW2B 3NBPA 3KLEB 2VHGA 2KMFA 4G3IA 5E3CA 3MM8A 3R5CA 2N9DA 3N5BA 2W9BA 2OEMA 2B43A 1D9AA 1J1JA 1S97A 1XNQF 1P8GA 2ZC3A 3OV7A 4LF4F 2PO4A 3DRSA 2ILZA 1Q82T 2J8SA 4CI2B 2A2DA 4OYPA 5F3JA 4B3RT 3NCQA 5JVHQ 4FKYA 1IQTA 3KHRA 2F8MA 2WVEA 3C16A 2CMRA 1FNXH 2R7VA 2HVIA 2DI4A 1T11A 3FRYA 1N0VC 1BUXA 2F1FA 3M9OB 2AYGA 4F4KA 4Q43A 2AEJA 2VOPA 3UVJA 3I9WA 3FBEA 1S59A 2IIUA 3RC8A 1EZZB 2QV6A 4PQUA 2Z58B 1OYEA 1FJGT 3KLIB 4UZBA 5J1GA 1KDNA 2ALZA 4NI2B 1SIZA 5J1EB 2PBIA 3QWUA 3KJVB 4G1PA 5M2RA 2DNXA 1TK8A 1TMJA 1N6QA 5K8NA 3GWHA 2W2OP 4DSEA 1WTBA 4HH0A 4X64T 2QMUB 1RAEB 2BJ8A 3BBFA 2JEJA 4ADZA 3ZZYA 3AEAA 3ZMTB 4DUZJ 2L8KA 4CQ1A 2OLTA 3DXBA 3NAIA 2VASA 5C24B 3EUNA 2IMWP 4IE6A 4FVMA 2W01A 1T9UA 2J7WA 2A6MA 1X5TA 3KG1A 4Y2AA 2VKOA 2UU9F 3T1AA 3ZYMA 5HCMA 4DFJA 2N2NA 3B5MA 2X1GA 4PQUB 5D78A 2PA8D 2CJBA 2I0XA 2JLEA 5J2UE 2HZAA 4F50A 4BWJA 4CO1A 3GONA 1XZYA 3AE6A 2IVFB 1U1KA 2XZDB 1H7CA 3V81B 3HKCE 2K7JA 3M8PB 2Q9QD 4WK1A 5I3UB 2CQ1A 1N6QB 1MNEA 2BX6A 1KLMA 1KONA 4JI2J 2MZQA 3DC2A 4ZK7M 1TVRB 5L39A 1QUPA 1RT2B 2IM3A 3AXKA 4M5LA 3RU0A 1Y9OA 1ZA1B 3K58A 3X3UA 1HBMB 2A3DA 1N54B 3GJTB 2LXUA 2HQGA 2ILYA 4DCJB 2BEFA 4RO0A 4V1Ak 3DRYA 4DVDA 2IDEA 2B4UA 3I9ZA 1U47A 3G96A 3VZIA 2F4FA 4J2CA 1IKYB 3E08A 3GFYA 3PIOQ 5DG7A 1WLXA 2QG9B 5AQHB 2HNDA 1HR0J 4N76A 2OELA 4MKAA 1FWPA 5HMXA 3RB4A 3R7NB 4ES2A 5DDRC 1RBLA 3LAKA 1OS5A 1JB0C 1BR2A 1WSRA 2O01C 4EZ9A 2RT3A 2G0IA 4GC7A 2MKJA 3KTQA 2DXEA 5C42B 4OYMA 4HFCA 5A8WB 1XDOA 3RB6A 2WP9A 2WWUA 5LB7B 4A46A 3OVSA 1EHWA 4URGA 3GCWP 2VICA 2NSCA 2DGVA 3RC3A 2K5BB 1QAXA 4ED4A 5FLXU 5KFZA 4YJ2E 3K8VA 2LLZA 4AD6A 1U1PA 4NX9A 4QYZK 4F67A 1UA0A 2XQ3A 4IRKA 2HMIA 2LRLA 1R0CB 4AE5A 2XAFB 4YY3F 3DP7A 1C1CA 3DU5A 2D5UA 4B02A 3OFHA 1IBKF 3ET6A 3S7RA 5EZYE 4GK0E 3D0HE 2ZOFA 4DN0A 2BS4A 2AXDS 2CQCA 1NJYA 2EFQA 2C3MA 2V6YA 2HN2A 3VTIA 3RYHE 1P6TA 2LP4A 4YTPA 3SCKE 5DABA 3ANWB 1SL2A 4MAKA 3UO0A 2CWKA 1RWPB 3ILOA 3ETOA 2EFPA 3DHWC 1OY9A 1CJTA 5ETKA 1O8BA 3E51A 4FF1A 1WFDA 2PIIA 1NDKA 2YDSA 3CCSS 2RAQA 2ZE2B 4FVCA 4R5PB 2ZH5A 2W0GA 2PSZA 4AXJA 3QT8A 4ICLB 2D9PA 3MM6A 3FBBA 2XQ4A 5KFAA 1OWAA 2K48A 5L3BB 3E01B 5L38A 1N33F 2KXNB 5GMKa 3J7YI 3RX6A 2BUNA 4J9NA 3OHBA 3LK42 3LH2S 4NLWA 1HR0T 5KFQA 1LV5A 1Q78A 5T41A 4DR1T 2DNRA 4MALA 3JC6D 4ER8A 3OTBA 3EVOA 1FMVA 4ZPDA 3I6PA 3FSIA 2L9NA 4LF2A 3SIPB 3VVUA 4UUXA 5F3TA 3ZCIA 3AXJB 4IDKB 5K8OA 4I43B 2XTJP 4PFOA 4DG1B 4RW8B 3D1QA 3GTYX 5KFPA 1YBTA 3AQOA 4ZVSB 2RQMA 2UU9J 3HVTB 3OFFA 5HP1B 2KZZA 4KX6A 2AF6A 4TYAA 1MMNA 2EBEA 5CD4A 4H63H 3HLUA 4M94A 3RZAA 2PTFA 2MLYA 2VONA 3W2WB 2E5JA 5AE1A 1I6JA 5CA1E 1RWXB 2XQYA 4CTAB 2VIHA 4ED8A 4ZHRA 5EX0A 1N48A 6FDRA 5MAOA 1H6KX 3PM9A 1JXLA 4ZI3C 1G2EA 5HMYA 5T14A 2DR8A 4CXXA 2E5HA 3I55S 4PW8A 1NDCA 2E5LT 2KKHA 1K1QA 1DBDA 2ZKTA 2DH7A 2XPKA 5A8RB 1IKXA 3OTCA 3CKDA 4N78D 5LSOA 4KC5A 2KWIB 1FT8A 3PO4A 5LXRA 1MMLA 3WZ0A 1N8RT 3ZC0A 3W15B 1Y7PA 3UDVA 2KI2A 2NLWA 1EB0A 4DR2F 3RRGA 1QVGR 3UDEA 3M2VB 3RUBL 2MQLA 2K3WA 3V6JA 4ECSA 3V2UC 2Z2MA 5CA0E 3NG8A 2GHVC 2O5DA 4KI0F 4U72A 1FNOA 2CWXA 3D4JA 1S6PB 1U09A 2D3O1 3BSCA 2ZM6F 1PO6A 4B9TA 4CI3B 2DGWA 3M6UA 4ZHQE 2Y8YA 2BZ2A 4FXWA 2ZUAA 4ZVEA 5L1JA 3NMRA 4EOZB 3G6ES 5FMNA 4NMXA 1F60B 3I4HX 2H51B 3F56A 2F3JA 2X1AA 1X4GA 4HACA 4MIBA 2CHNA 3CD7A 1TKDA 4A8KA 5ETNA 3CEDA 2W9CB 4FPRA 2E1RA 1HNZT 1OYDA 1CSJA 3ZNUA 4NPPA 2LHNA 5K14B 5K8PA 1TL7A 4RL1A 5EK2A 2HBYB 4I1TA 3TUPA 5KFEA 4GKKT 2YNHA 4PXEA 1RADB 4DUZF 2JJ9A 3BQ1A 1JJ4A 4QH4A 1D9DA 3PACA 4GMKA 5H9EK 1KFSA 3UE2A 1KRPA 2JMKA 1WC3A 4K0KT 3ZT6A 3HI2A 4QZVB 3Q8PB 3GIIA 2YN6A 4B9SA 2CPHA 4DV0F 4QIWD 5C3JA 5HXRA 1N34J 3M32B 3C6UA 3BO4A 4F2SA 2CPTA 1Z2ZA 5IT0A 3C15B 1H72C 3U02A 4Y3CA 3MCSA 3KV5A 3CPZA 3ONQA 4EIWA 4L74A 1UJ4A 2C42A 1BMQB 1RAGB 2EHOA 4UV9B 2WW8A 1A7GE 2IJFA 3CUNA 1SH3A 4U7YA 4N5SA 4NLVA 2RDJA 2BZBA 2UP1A 2AWZA 1XTZA 5LP6E 1HQUB 3IRXA 3IRWP 3AAAB 3H3MA 3KHGA 2FBWA 3IAM9 4K4WA 4OQJA 3UN2A 5LNKA 2B9WA 2CBIA 2UZAA 4RZRA 3GYNA 2WSCC 2WBRA 4PWWA 1YQ4A 1KQGB 1XQIA 4O8SA 1XC9A 3EMTA 3CQGB 4B3TJ 1T3OA 3JC6C 3OLAA 2I1RA 1Q7LB 3QJPA 2QVAA 2CBJA 5B09A 2AE9A 2VQEF 4OHYA 3PJAJ 5F8GA 3B78A 3TUZC 4X65J 4DS5A 3LJCA 4I64A 3OPKA 3AE3A 2VKDA 3Q8QB 1X5OA 2KHCA 2GO8A 3LGHA 1IZNB 1FIOA 5E41A 4HFIA 3AEEA 1Y3KA 2ASDA 2UUBF 2YWFA 1T94A 3MAAA 2B0GA 4KKOA 2HW3A 4NIQA 2QX0A 4JUYA 1IN0A 3T9NA 1KQSR 2ZH9A 2LSYA 1LVKA 4JI7T 1UKUA 4ZI2D 1VQ7S 5AQNB 2H4WB 2JPFA 4RKUC 1SQEA 1JLBA 4YSXA 4WFNQ 5I3QA 2VBZA 5B0EA 3NLCA 3RRCA 2H65B 2G0CA 4H4KA 1RT4B 2X67A 2CYYA 1AB8A 4B3SF 4UIGA 3ZMSB 1SH2A 4IG3B 2G2ZA 2C3UA 1Q79A 1DLOB 5L1IA 2ZH4A 3I82A 4IH7A 1SJ1A 4RNMA 1WG5A 4DQRA 5CJ5A 2CQ4A 4RUCA 3OR2B 1JLEB 3MGJA 1XR7A 1H38A 4ED6A 1ITPA 2MDAA 3C6UB 1S4FA 1TP7A 2KN4A 1RAIB 5U47A 2B5JB 4DI6A 2CXDA 5IV4A 4YQWA 2JJ4D 3R7BB 3A7MA 3IR7B 1N56A 4DSJA 4CLUA 4KBIA 4HFVA 2Y1IA 4IH5A 5HROB 2ZHBA 5BMVE 5D4NA 2XB2D 4U96A 3OVAA 3FB2A 2DGUA 2FVCA 1BQMB 1PG5B 2RS2A 1TUWA 2LSKA 4V19X 1RT5B 4CXWA 1S4EA 4DV0J 2V8HA 2CPIA 2EW9A 3G82B 1Q8LA 2LA4A 1RK8A 5HEUA 2MKHA 2D69A 3DOLB 4B9VA 5HYAA 1RAJA 1F5BA 4A4JA 1SUMB 1V3SA 5CYMB 2WSSV 4P74A 5M4YA 3ICLA 5GAGI 1ZAVA 5EN1A 3L9ZA 3PW4A 4MHCA 1NSKL 1R8CA 5DQHA 2V7LA 3T6BA 1J5EJ 2Q79A 5IOLA 1DQ9A 4RW8A 5JXSA 5SUHA 4EWTA 1TAQA 2X51A 2E8IA 3KLFB 2H54B 4GRSA 3ITHA 1FK9B 4EZ4A 1KNRA 4PXCA 4CO2A 2WRMA 3ZC1A 3BBCA 2DNLA 4O44B 3CC7S 3P49B 3A8IA 2R7WA 4XPEA 1C4AA 2H5JB 1ZZNA 1MG7A 3CE8A 4LF9J 3OFEA 3ZKRA 4ILCA 3GFZA 2XQ5A 4LT6A 4C8KA 3CCVS 1DZ5A 5C5JA 4AL7A 2VQEJ 3H7HB 3DI6B 3D28A 1MROB 3RW6A 4ILAA 3OT9A 4WP8A 1U1OA 2A9UA 1S6UA 5A76A 8RUCA 1MMGA 3NGTA 2J0QD 2OIHA 1Q81T 2XSJA 4ZLPA 1RKJA 3G9CA 2QA2A 4HT5A 2HGMA 5BXIA 4CO5A 1E6YA 4KV8A 2DTJA 2ZITA 4EEYA 1GX5A 1PC5A 3MZKB 3RGLA 1W25A 2MGZB 3BQLA 5H9EJ 3TLWA 3TAQA 1UVNA 1U1LA 2D0TA 1GFWB 2YKNB 3CMLA 3Q8YA 1D0XA 3FKBA 3BH6B 2V34A 3RHWA 4HT7A 4S0MA 2DO4A 3RQUA 4Y0FA 1UPPA 2C28A 1OWXA 4HACB 1WG4A 1JLAA 4XPCA 3I0SA 3T1YT 1TTHB 1KEKA 1KOHA 1R8HA 2K3IA 3GFHA 1Q95G 3J7Yq 4O4IE 4CLFA 1UJ5A 5FLXY 4HYKA 2I9SA 1U0SA 2X0LB 3TJAA 4EGWA 4HTIA 1YLXA 2QLFB 3IMQJ 4I4TE 2GX8A 1LK5A 5HROA 2DWKA 3FFIB 2BJEA 4OYOA 4OLPA 4O3QA 1FJEB 4O3PA 1MLAA 3UT5E 2VUGA 2VB6A 2NR4A 1TKTB 2YNHB 3PTWA 4DR5F 1UP1A 2CJ9A 3DOMA 4I6WA 3MPYA 2HPLA 2B1EA 3TEHB 4MT1A 4ZVOB 2OPRA 4AKLA 3M6WA 5IT9Y 2HGLA 2DH8A 5KFNA 5ETTA 5JJBA 2IIHA 3OBVE 1SH0A 3OTOJ 2JLGA 3N5LA 2GVDA 2BBJA 2VQET 3CJ3A 2ZH7A 2RS8A 2P9CA 3THTA 2SPCA 2RU3A 1HL6A 3H5UA 5KTQA 1TL1A 1RT1B 2RB7A 4FPIA 4KH0B 3M8QB 2BE2B 1QSLA 2GHPA 2WQYA 4URQU 3MCNA 4KPYA 3J7AN 2EHOB 3DRPA 4C0OC 4D3GA 4B6XA 4G1QB 1N36T 5JR9C 5HMWA 3VF0B 4NLTA 1E1HB 1PSDA 4PNIA 1RABB 2NYIA 3PDYA 4DBQA 4CI1B 2GJFA 4QX8B 3SZ2A 2VL0A 3CWZB 4LF5J 4KFBA 1IKWA 2ZHOA 1XR5A 1ZS6A 5AQJB 3D6TB 3T9ZA 4KE5A 2IBKA 3MR6A 3DKDA 1J5OB 5KT6A 1TV6A 3HA4A 3QRPA 2UXBF 2R8IA 3T8OA 4J9PA 3ZTRA 2WBLA 2IJNA 3SFUA 1KNPA 1PBUA 2ZNYA 1YWXA 2A2CA 3UDCA 1S99A 1LEOA 2ERRA 4Y2MA 1NMEB 2NXCA 9RUBA 3LQVA 1BWVA 1WF0A 2LEAA 4PPDA 3ZCJA 2LKZA 2V26A 4J9SA 4KQZA 4H9QC 3RQWA 2V6XA 4ICLA 5KFDA 3OJUA 2RDIA 2XTLA 5L4HA 2RUGA 2VBXA 3WBZA 1KQKA 2IAJA 4C2MA 2W7OA 2I6WA 4JV2A 5CGMA 5JDMA 2DL1A 4PAGA 3PIPQ 4MIAA 3VAJA 1PILA 3RKGA 2B9EA 3PEHA 3J9X1 2J6TA 2CPFA 3KK1B 3SV3A 2G2YA 2W4DA 1RT6A 2X7IA 4EZHA 1IBMJ 1I94T 2WW4A 2UXBJ 1APSA 3BQ2A 3HZEA 1S48A 3CCRS 2BE9B 3W1YC 2K8GA 4IQXA 3H5XA 3HULA 3ETVA 1PBAA 3TUJC 1CEZA 2QFJA 1XWMA 5EK3A 3AEGA 1X9SA 2W7PA 5CZVA 2V8SV 3K8PC 4P2MA 3AVRA 1RHMB 1FFGB 5D4OA 4TNOA 4WZXA 1F0XA 1NDPA 4COFA 4OHVA 3HFKA 2A6OA 4KGXB 2KTQA 3BGLA 2VF3A 2WVCA 4FYDA 1UZHA 4C48A 2YPZA 3U7JA 1KD1T 1NZ8A 2VFVA 5LHHB 2HVEA 1S10A 2A3JA 1X7VA 3MEKA 3MUTP 5KAKA 1HWKA 1SJQA 3Q89A 3W8GA 4PJJA 3MAHA 5F8LA 5IQ6A 3DM2A 3CJKB 4R8UB 2ATLA 2HQCA 2DNYA 3HR0A 3BKUA 5HEGA 3M32A 4K0KF 1U2RA 4EU0A 1JNZA 4U95A 2NREA 1DRZA 2KWHA 4OV6A 1KS2A 2GJ2A 4R8UA 4DJBA 4PG8A 1HIYA 4LF9F 2GQCA 4K8RA 1I51B 3P5TL 3QOFA 2BQ3A 3QB5K 2LEHA 4DUYT 5LL6d 3SSQA 2RPAA 2CG8A 3W9JA 2LYVA 2Q9QB 5LG3A 3C4ZA 1PYTA 2I59A 2Z6EA 2RHQB 3O4XE 7FD1A 2IRYA 3MR2A 1SJFA 4IIJE 2KYZA 3DRRA 3Q23A 1YVFA 1NK6A 1U8WA 3DM2B 2E7VA 1HBNA 3VAIA 4Q2LA 3QBCA 4OHXA 2YX7A 3GR1A 1VQOS 1IBLJ 2MXYA 4HKAA 2A18A 4EBDA 1TL4A 3ZTPA 3BH7B 2L08A 3X1LB 1IQZA 1W2BR 1YJWS 3MDFA 5BR8J 5GADU 3CT9A 3I32A 3FBCA 4CCHA 2LSGA 2E9TA 2JRSA 2R9LA 4RU2A 3V5UA 3FFIA 2JQQA 2QYGA 4LQ3A 2VK9A 1UGOA 1G7CB 3S01A 1DTQA 4NLUA 4JYAT 2HVHA 4CM0A 4AQYT 4CYUB 4F7VA 4DV1J 1M5OC 4C97A 4IDNA 2VC1A 3PUAA 3E01A 9ATCB 5LJ3Y 1CJTB 1F9HA 1TQLA 1VHIA 3A8YC 4LF1A 3QT7A 1HI1A 3EVWA 3WHIA 4TV9E 1GEHA 2DBBA 4OZ2A 3CDAA 5LBMA 1RYRA 4ELTA 1X4DA 3HVWA 2ALYB 2EFVA 3W60A 5E5NA 1S6OA 1UTAA 4DL2A 3DLKA 3L7OA 5KG2A 1RB0A 3UU6A 3BS9A 4C8YA 1T9YA 1MWZA 5IHYA 1O51A 2E1PA 4QH1A 4DPOA 3VR1A 2W61A 2C5KT 2E2AA 4IFYB 4QX7B 1NPKA 1P9QC 4IDKA 1HBMA 1I3OB 4NPOA 4LSZB 4TN2A 3GV7B 4KP3C 4WYWA 4HFBA 3MJXA 1TVRA 3TO8A 3PUZF 1JK9B 5IM0A 1X0FA 2W2NP 3HPOA 4B9NA 4G1QA 1V5IB 1B0VA 3TX0A 1SE7A 1PKUA 2RQ4A 2JHEA 1IUJA 2NP9A 4HHUA 2PT0A 4OYIA 3V5SA 1RTHB 4JB8B 3DMJA 1FD2A 4Q8FA 1X31C 4MYUA 2HQFA 3BGRA 4RUHA 1CULA 1TKZA 3ENAA 4QYRA 4ISTA 3CCMS 3IS9B 2FD2A 2P9BA 3AVSA 3VQSA 4I69A 1Y01A 1BE4A 4K7QA 2HWIA 1S76D 1RHKB 1BY9A 1H2VZ 1XJWB 2L3LA 1YJNS 2HHPA 4OYXA 2W7AA 2XO7A 2DIUA 2AYEA 2NXJA 3MTKA 3PE0A 3K57A 1RA6A 2LVWA 4FYVB 3NBPB 3PR5B 1HBUA 1ZBTA 2XHEB 4DV2T 3QFHA 1KOOA 4LBPA 3ILLA 2QMWA 4HVZA 1U5PA 5EK4A 3J81Y 4JI0T 2JWNA 2VFSA 3Q5EA 2ZVSA 4P7VA 5JR9B 2KH9A 4M5IA 4WFZA 1S1XB 2A10A 3J7YU 3V6HA 4GVBA 1C1CB 4YN3B 3KV4A 1ZPVA 2OPRB 4UZCA 1IJ5A 4ZCLA 3RKOA 3OSPA 4X4QA 3QAEA 1FXDA 4IQMA 4P72A 4LSNA 2XYPB 1HI8A 2GAHC 3QIPB 4Z8XA 3CB4A 2CJXB 2OMLA 2OO4A 3VU7H 4P1NA 3CPWR 2NW9A 1UVMA 1RQ0A 4LSNB 1JMTA 4PG7A 1W2IA 3QATA 3PY8A 4F26A 1N32J 1LK7A 3VWSA 4GKKJ 3ZO7A 5AQLB 1BHNA 1IBKT 1JQGA 5HN0A 1ULRA 3SDEB 3VQTA 3A3NB 4DPTA 4GOUA 5GONE 5HATA 3KOAA 4JV5J 5FL0A 2IC3B 1EP4A 1BR1A 4ZOLE 2G13A 2MKCA 1B7FA 2DR6A 2AJ4A 3FNNA 4LRFA 3MR5A 1HG5A 4E0DA 2J9CA 3DLHA 3A8KA 3AA9A 3M05A 5HEJA 1MW7A 4IG0B 2FJEB 3KUHA 4BBYA 2F65A 2B4OA 4U31A 3DDKA 1RWKB 1RAOA 2IMLA 2ZBCA 1C0UA 1VC0A 2WDVA 4Q2MA 4LFBF 4IDOA 3ZJ2A 2HK3A 4QR0A 2YKOA 5HXCA 2MGZA 4DS4A 2U1AA 4F0KA 1N36J 4UOHA 2IFXA 2ZHAA 3ISND 1RTIA 4M1PA 2BE7D 4MTPA 4C91A 1RT7B 3D0IE 4FXVA 2CQBA 4DDFA 3SS1A 2KRRA 1NJXA 2XQ8A 1WG1A 2AJ1A 3CQXC 2IBOA 1OMSA 1NK7A 1H3DA 2P8IA 2BS3A 1Q8BA 2IC6A 1X8DA 2HRUA 5L4EA 2HAFA 4TU9A 1EARA 3F31A 2DWGA 2BV3A 1SC1B 1OIAA 4WBNE 1UVKA 6FD1A 2J47A 3D3BJ 2CCQA 2FLLA 1Q4RA 3K1SA 4I0WA 1IR2A 2ZBPA 4IR9A 2N3OA 3HSDA 2OAUA 3VALA 2GVZB 1L0VA 5DM7Q 2WDQA 8AT1B 4YOEA 3U3IA 2DYAA 4KHMA 4AKIA 2BANA 1MWYA 5HK4A 1X9BA 1Q1KA 4F4XA 1LKXA 1WHXA 2E9RX 2ZD1A 2V8DA 3AH6A 3AB3B 3TWZA 3KG0A 4IDPA 1QTNB 2OI2A 1I94J 4UQTA 1OSDA 4ES3A 4IE0A 5LMUJ 2KB2A 2GVDB 3THVA 4DR6T 1HD0A 1KTQA 2YKMA 2MY8A 4B3MT 2Y6XA 3UW1A 2M4MA 5AJ3F 2LHRA 2LE8A 4LF6T 3GB0A 2RILA 2CQ2A 2YQ3A 5B7WA 4DZ6A 5HAOA 4WKYA 4YFSA 2DNGA 1P27B 1BXNA 3IM9A 3MACA 2ASJA 5DG9A 4OZ1A 4ILRA 4LRDA 2DHAA 3TZZA 2R8KA 4L0RA 2NPIA 3EGVA 2YH1A 1RTDA 5JR9A 2W24A 5HLFB 3LBXB 3CCZA 3SI8A 4JI5T 4M5JA 1ZOTA 4G6VB 5ETMA 3GSDA 2XWYA 1SJ4P 4WTOB 1VBKA 5K5MA 2OH2A 1FA0A 2GZOA 2GV1A 1WC5A 1U45A 3Q2SC 2DHHA 4A56A 2CIMA 3M65A 4HWCA 3M8QA 4ZI2C 1QSSA 3GN5B 4FJOA 1EAYC 4QCLA 1KFYA 5IUXA 4NLSA 1R0AA 3UWTA 5CXTA 4X66F 2KO1A 3TLUA 4U6PA 1RCOB 3OSNA 2ZWOA 2YDQA 4CLKA 2F9JA 3U1LA 3RYIE 1WNEA 1ZPWX 3DMJB 4DR7T 2CM0A 4NRTA 3OJAA 4JI6F 2ZMAA 1WORA 1R8BA 2ZM2A 3ILIA 1QSDA 4M63A 3OL7A 2FDNA 2RHSB 4OHZA 5LYJE 3FCHA 2DGXA 2CJKA 4UY85 5KFFA 1XNRF 5KFGA 1QLNA 3GQCA 1RTHA 3S1TA 4I2PB 4TWHA 2OMOA 1NEEA 2CFXA 1IWAA 2D7SA 3R5BA 2MQNA 3V4IA 3Q0AA 2Z4PA 3O1JA 3DLGB 4X66J 3RRHA 1WKLA 1Q8IA 1X0PA 3X1DA 2RF2B 1NZAA 4ED3A 5FL1A 5KG7A 1NUEA 5F8JA 1HX8A 3ZXWA 4U74A 3KV6A 4DHVA 1Y5IB 2BRLA 3R97A 3GV8B 4RLEA 2VZ9A 1SL1A 1UMJA 4RW7B 1SKRA 4PUOB 2HBZB 2MB0B 1EX8A 4ZVTB 4IL9A 1VQMS 1RHUB 2MKYA 2YINA 1X9MA 1UEUA 3IF8B 4AKHA 3A12A 4CZCA 4NE9C 1R89A 2OPSA 3MWBA 2VURA 1B7YB 1FVSA 3AA7B 2ABYA 2R7XA 2OFGX 1O5JA 3CQCB 2Y3YA 3DNCA 2XQAA 1QM9A 3BGUA 3PEJA 1W09A 4CQIA 1QJHA 1YJRA 5GMDA 3QC9A 3PX0A 1LQ9A 1VJWA 1JXVA 3WAJA 4Q5VA 4C8ZA 1UVIA 4OI4A 4A8OA 3N28A 3SDEA 4HL9A 2DCFA 3EAMA 1B4SA 2C2KB 3F0NA 4ISSA 3GJRB 2ZDPA 4Z91A 4CZZB 1UL3A 5D0GA 5HBMB 4O23A 2ZDOA 3HXMA 2I0MA 4ZS2A 3JQMA 1U26A 2ACXA 1W0BA 3HK2A 5DJQC 3RR8A 2VVNA 2DNKA 3WX8A 3NVOA 2QIFA 4YR3A 3R1HA 1HW8A 4USTA 4WZQA 5LHIB 1YIJS 3ITHB 2QN6B 2PMWA 3TAMA 5D6GA 1IXKA 3MM5B 2B8PA 2ZLYA 4BLGA 2YXLA 2NQPA 2JEIA 1XMBA 4L6V3 1NB2A 4ZCMA 3ZSTA 1RJJA 2FUG9 1SUQA 4CNYA 4HFHA 3KYLA 3QLHA 1LWEA 2CZVC 4IH6A 2XCPA 2XMKA 3NY0A 3ZN1B 1UPMB 4OHFA 2YPYA 2EG2A 4OMFG 2QSFA 4DQSA 4ZS3A 5D3GB 4NASA 2XM1A 3EPGA 3SCJE 2MTLA 4DG1A 1S6PA 3DI6A 3FRZA 3MMBB 2G1DA 3M2RA 4CO3A 4UF0B 4DR3J 1RA7A 1VQSA 5ABHA 1G6BA 1RHRB 2KU7A 4RW6A 4NLRA 3ZZRA 4P75A 1D0YA 3SRZA 4E7SA 3OTOT 2EVZA 3KNAA 4U9RA 1FRLA 2ZC4A 5JQGE 4B9MA 3QRRA 2HGNA 2MYFA 4U7UK 4ED1A 3FEXB 2HZVA 1R8IA 1VQ4S 5DZ7A 4MFRA 3AE5A 4FBTA 3N9NA 3HVRA 3DTOA 3W5YA 4ZLJA 4KTQA 5KFTA 4ZVPB 5JDFA 3KBUA 2V50A 3C98B 1SL0A 2GA7A 3GU0A 4KB7A 3ETMA 3HHNB 4DV7T 4J9RA 4W90B 2FY8A 5T7LB 1VGYA 1AUDA 4H4OB 4LF5T 3QZ8A 5H1SV 1S9EB 2G4BA 2XI3A 5HVHA 2AJ2A 2AJ0A 2F8HA 5CD4H 5LXYA 3BO3A 4URSA 4LF7J 5GAEU 1H0HB 3FZ2A 4PWDB 3MM6B 3H37A 4PJNA 2VL8A 1IJFB 2N7CA 2CPEA 1UK5A 4JI8J 4K2JA 4ZIVA 2HLTA 2BBHA 5HCJA 5AQGB 2KG0A 3HSJA 3H2LA 3N2KE 3O8WA 3V4MA 3MPDA 3AXMA 2WZHA 1JX4A 2FVPA 4BJMA 4N41A 1RYSA 1JLGB 1RZMA 2XQ6A 2H48B 1N32T 5LOVE 4NOHA 3MUMP 2E5IA 2J76E 1GTHA 3AA0B 3K5OA 4Y65A 3ZTQA 4IYQA 1PGZA 5BYSA 5DDPC 2F63A 2CJYB 3HVTA 5HQLA 4NXMJ 3PX6A 2M2BA 1U1QA 3EDRB 1NKBA 3PO5A 3WIUA 3JSMA 3H5SA 2XMWA 3NXZA 3DLJA 2XNQA 3PCOB 4I2PA 5CA5A 3MOZA 4TU7A 2Y8DA 4PKDB 3HHLB 2J5AA 3NGUA 3ENWA 2DNPA 3CVRA 4OI6A 4Y28C 4TXSA 2R6GF 2XBPA 3CJ5A 2DR5A 2WU5A 4QWBA 2XC9A 1LWFA 2MZRA 2BJ9A 3DCAA 1C4CA 3CDUA 1AW0A 1FK9A 4J91A 3DGPB 2AX1A 3FK4A 1TFYA 1LW0B 2E1AA 4YY3J 3EVYA 3O44A 1FO1A 3Q86A 1PJ7A 4CNZA 3KMSA 4XK8C 2EHOC 2OV9A 4DLGA 4L3KA 1B99A 2V5CA 2M8HA 4XTTA 2YNGA 4ZMMA 2LT3A 3TJ8A 4DR1J 5IWAF 2M5YA 3DOKA 1S1UA 1H74A 1BLUA 1KVIA 2CUYA 4KHZF 2LEBA 5LGUB 3W64A 2CRBA 1L3KA 3R3TA 1T8EA 4ERDA 2YU1A 5K9FA 2IHR1 2EHOD 4DX6A 1NKEA 1UX5A 3DXSX 4TY8A 5D77A 5EHHA 3K5NA 3PUGA 4XAKA 2DB1A 3MECB 2MKIA 3M8SA 1UURA 2ACYA 3Q8VA 5L3CB 4DV5T 4M5MA 3OKQA 3SSRA 2CNKB 2B9YA 3MMJA 2JC0A 4EGLA 3HJVA 3LP1A 1KTVA 2XAJB 2N4DA 2AGQA 3P4WA 2PFDA 1DQ8A 4CLPA 4I4BA 2JH3A 4F0HA 2NTYA 2M7SA 1LOUA 3DLKB 2AHOB 3NOCA 5CQGA 1HBUB 4F2RA 4B3RF 4R0EA 2FJEA 4A8MP 1B70B 2E5LJ 3MD1A 4DV1T 2PEBA 1BD6A 4DL3A 1LWCA 4JEUB 2H7VC 1OXZA 2YH0A 3CXCR 3PUSA 3HJFA 2W2QP 4DPWA 8ATCB 3JQKA 4PCQA 4TQRA 2G9OA 3HD2A 4O2BE 4ENOA 1UJ6A 2H1YA 3O2IA 3EM1A 4TUYE 1MWQA 2YEVC 4ECRA 1ZM4A 5KFKA 1T3NA 5JRCB 3ZYKA 1RWOB 2GIFA 1V3RA 2B6AA 1NBEB 3SCLE 1DTTB 1I94F 4J37A 1HD1A 1UCNA 1FX2A 3T41A 1R6VA 2MLZA 2G1HA 3WI3A 4ETXA 4X5TA 2B76A 1DTQB 2OKQA 1X9WA 1REVB 2F4VJ 5ABEA 3JSRA 3G86A 4ED5A 3GLJA 4EI2A 4RBVA 2HS0A 3GPAA 1EP4B 2YWKA 3H4DA 3SFDA 4USWA 3R2DJ 5JTGA 5FXZA 3MCMA 2AJFE 4ANDA 1UVLA 4PPZA 5THWA 2L9DA 3A3OB 3S4UA 3JYTB 3WQPA 5E3QA 4X4RA 2M6IA 2P6TA 2XEXA 5CCMA 4PK5A 4U2ZA 3RAMA 4QW8A 5KFUA 3VRBA 4OI2A 2NS1B 2FC9A 4ECQA 3W66A 3PYFA 3VHQA 5D8HB 4DMZA 2GIQA 2PG8A 1QD1A 3S6EA 4QYZJ 5HO4A 1S0NA 1L5UA 4NLPA 1KF6A 1F5CA 2ZH8A 2FVRA 2LKHA 3GFXA 3P4PA 3N2OA 5LOQA 3M2VA 2ZJRQ 4L76A 2E9XC 4ZEYA 3CGIA 2PJQA 3VHLA 4YFUA 3GZ7A 3M8YA 1XK8A 1M5HA 3M8WA 4X2BA 5J2NB 2IYIA 2V4RA 2R2SA 2K2PA 2V7KA 1FEHA 1LFWA 3O3LA 2HNYA 4DUZT 4ZA1A 2P5VA 4U7UD 4O4GA 3KUEA 5B0GA 2X1FA 2RDDA 3P4QA 1FTCA 5K20B 2J9DA 3MM5A 3ENQA 1JLEA 1Y3JA 1HNWJ 4UVBB 4XIUA 1OEDE 4ECUA 4H9OC 2JDJA 2D9OA 1UEKA 1FNMA 5D4LA 2IYGA 1CJUB 4YDDB 2MQOA 2VV5A 4WBFA 3QYYA 4C98A 1WF1A 1RCXB 3QB5A 2V8VA 5J1EA 1CLFA 4CM2A 4NCGA 4MKYA 2V7JA 3AAIA 3LWMA 5AQSB 3PURA 2DHSA 1VIXA 2WB5A 1E6VA 2YKQA 4EUVA 1HCIA 2JQKA 2QSWA 1HWUA 2IAKA 3M30A 1Q7YT 3FEYB 4M1KA 4JI7J 2GW8A 2KXPB 1H7WA 2D3UA 1D0ZA 2JLFA 4CH7A 4DX5A 4EO6A 4LFBT 1EIYB 3T19A 4N47A 3ZYLA 4RWXA 4BC7A 3FZHB 2DNOA 1R8PA 3TX8A 3G06A 2GJIA 3AQPA 3BREA 4TX5A 4JEHB 2JVOA 4J90A 2X9XA 3CC2S 2WCAA 1OEDC 2R7UA 2DNHA 2FQQB 2XZEA 1NLKL 3IC1A 1GT8A 2LKGA 3B8HA 4EK2A 5KFCA 3Q5XA 1G8XA 2CWOA 1K0VA 3AA6B 1WI6A 4PABA 3MPWA 3RTVA 3IEEA 1VCSA 1HARA 4RBUA 4ZOSA 2DT9A 4IT4A 1U6ZA 1H7XA 2YKSA 1YITS 2K24A 2M8DB 1N5TA 3IWXA 3OD2A 2OP5A 3WAKA 1RAFB 4A98A 3MAQA 3SFEA 3CNQP 3QSYB 3SMZA 3NRXA 2UV8A 1WOSA 3B4MA 1UWAA 3TQEA 2J9DE 4CIOA 4LIWA 3PU3A 3W8PA 2UUCT 4ZITA 2QTWA 2CVIA 2XJ7A 2NR0A 3AEBA 4EV6A 5F8HA 1IKWB 2IUBA 2ZM8A 3N9QA 3QGHA 4WFXA 4RU9A 2NWBA 2UVRA 2C2RA 2Y1LB 4ZDNA 2ZH3A 1HYSB 4HH1A 4W92B 2HQIA 2QL5B 4NA2A 3IR5B 3IXQA 3EJMA 3AECA 1GNKA 4JI4T 4WK3A 2Q9QA 3J7Z5 3EDQB 2K3KA 2AGOA 2MZTA 4WFAQ 2MJNA 3MKDA 4YMEA 3CJSA 5AE3A 4KRWA 2HPJA 5L46A 1RT3B 2E5LF 2EEYA 3PXGa 4F4ZA 1NK0A 2R7QA 3CMQA 2M0GB 1X4EA 2MZSA 1D1UA 2V9KA 2CDRB 3QIPA 1RAAB 1F2HA 2WMNA 4DV2F 2V5HG 1IKYA 5FVKA 5JH7E 4RNFA 4FYXB 1BR4A 5KFWA 2HMIB 4L3NA 5JDNA 1LVFA 5KFIA 2DGOA 1S79A 1IJ6A 4G65A 3TVZA 4A8WA 2MAWA 5HWYA 4YHHF 2X3GA 2UVVA 2WB4A 3NKYA 2N82B 3P8BB 2BM1A 4C8LA 2ROGA 1X4CA 3PKYA 3K59A 3IG1B 4LRBA 4UY8T 1S1VA 3PTRB 3CSKA 2V2VA 4QIVA 1B0TA 4Y2KA 3CD5A 1TR0A 3BPDA 2NUHA 4UEMA 1KQFB 1SC3B 4C9DA 1AFJA 3GR0A 1VS3A 3BN4A 5A1LA 3AE7A 3NNAA 5HVFA 3JTPA 1LW0A 3OPCA 3CX8B 4HFEA 2BDEA 4DV6F 3L3CA 2Z56B 5JVGQ 4ASKA 4WKRA 3WIVA 2KT2A 1NM2A 1R43A 2Y1JA 2YKNA 5A8RA 2W9AA 2KLQA 2YWHA 1RT2A 3BR8A 1EJ7L 2IA0A 2YDRA 3NZQA 5L3DB 3F41A 1KLMB 4CI0B 1XDPA 2R8JA 4AQFC 4LREA 3F44A 5HL7Q 2I2YA 4NLOA 2XLKA 3FHNA 2OD6A 5HXSA 4H9PC 4DX8H 1BQNA 1Y64B 4TVAB 1N32F 2HZCA 4Y00A 1TAUA 1R31A 2E66A 3LFMA 4ZN1A 4HEAA 3KJQB 1VRUB 2X3DA 3Q83A 1Y0HA 4OV1A 3M1VB 5J2PA 1J5OA 3CX7B 5F3ZA 3R6GB 1AYEA 4JV5T 1YZ6A 3N9OA 3AE1A 3AA1B 1IR0A 4J9OA 1TKXB 1IBMT 2CQ3A 1KFDA 1IBCB 2W67A 4WFYA 1S72S 3HF5A 1J2VA 3BKFA 4P9SA 3UU4A 4UF4A 1NK5A 4ZI7E 3UFGA 4OK0A 2UXDF 4ED2A 3KFWX 1TL5A 5J2MB 1G3OA 1U6BA 2GQ2A 4NXNJ 4PK4A 1MIWA 1GXUA 1S9GA 1VDHA 4JV0A 2JIWA 2QJ3A 2WONA 1T05B 4OFZA 1XNQJ 2XULA 4L5GA 4ZLLA 1REGX 4O3OA 1Z8UA 4FNIA 3BJYA 4LIRA 4NI2A 3AAEB 2IAJB 4P71A 4NA3A 4IDQA 3GMGA 1VRUA 4GKJF 2UV8G 3ZTOA 2LQ5A 5GMEA 1T72A 4ANJA 5J2QB 1WYBA 1G73A 3Q22A 2F7VA 3R5GA 1Z4UA 4PJLA 3IBWA 3IGNA 1RWNB 2VVSA 2O3DA 2WAUA 2Z2ZA 2DXFA 3PRBA 4BS2A 4GYRA 1M5SA 4JV1A 1HNIB 3MK7C 2DKOB 3MMCA 5HJYA 5HXEA 4HWDA 3IWNC 4DR1F 2MPKA 2FHJD 4H9SE 4JI7F 4ECWA 1LFPA 4AL5A 2HFSA 3HI9A 4B3SJ 2K1RB 5E3AA 1JWWA 4IHJE 3ISNC 3RW7A 4UOGA 3TW0A 4GKJJ 4CH1A 4BWMA 2L41A 2IC9A 4CLYA 3Q5DA 3AAWB 2OEJA 4O44A 4WIQA 5DM6Q 1GMUA 2X1BA 4LUBA 2DRBA 3LDQB 1CJVA 3AOCA 3EGWB 4LMZA 1N88A 2XUEA 4BAYB 5A8KB 4XDDA 4ELVA 3TA2A 3P4SA 3M9NB 1C0TA 4OI0A 3HX9A 3NGRA 2W4PA 3POTB 5H6RB 1KEYA 4DR3F 2CZ9A 1YK9A 2C2NA 3U27A 1NJIT 3OTOF 1YGYA 2VDHA 4LF8F 1ELOA 2UUCF 2MQPA 3OL9A 2C3PA 4NXMF 2UXBT 1NB7A 4J9KA 3EZUA 4JI5F 4DCOB 2V68A 3I31A 3HD1A 2L48A 1NENA 4LFAJ 2OD4A 5H9FJ 3D0TA 1Q86T 4RNNA 5C2GA 4IDZA 5HEHA 1HX1B 3PUQA 3MI7X 2J1DG 1BC6A 3S8SA 5I3UA 1UX4A 4BA9A 4WP3A 3GIRA 2PI5A 2ZFHA 3KXDA 3BSOA 1RLDA 5CCLA 3CVKA 5A2QY 3M2UA 1RTIB 1Z1ZA 2F9DA 3ZZUA 3VAMA 2OTJS 1HI0P 4DF8A 4USHA 5AXNA 2RIJA 5DZ6A 4FYWB 4YSYA 2N3LA 2FPHX 3TA1A 1PC4A 5KG1A 4KPCA 3GE9A 2AV5A 5JDGA 3KVBA 3MM7B 4JP8A 1KN6A 3CCTA 4NYPA 3PUVF 5M2PA 3IRXB 1VRBA 3ZZOA 2C0SA 1HHTP 1O3XA 2XMVA 3KLHB 4H63V 3PKMA 4HN9A 1FKOB 3RPUA 4C3KA 2D74B 2FJAB 4NL5A 3MMBA 3DDNA 4DSLA 3I96A 3TZXA 4USJC 4YT0A 4YTMA 4Q44A 1RWVB 2YQ1A 4RNHA 2XS7A 3MTJA 1NSAA 1Q53A 2E9XB 1R7IA 1CQMA 3K7RA 2AEFA 3ONLC 1T0TV 2G0JA 3UVJB 1FFWB 4MK8A 1VK8A 3P3DA 3CDEA 3OW2R 3DRRB 2GNKA 3NMAA 5KFLA 4ZPAA 3QJJA 1N5SA 3LO3A 3IO1A 3UN5A 4C0HA 2XYGB 3C66A 2IM0A 2D9DA 1DARA 3G8QA 2DLRA 1S12A 2H89A 4G1IA 4ZJQA 4ID8A 4DR2J 4X4TA 2VBYA 2FJBA 3AJ1A 2ZZTA 4KHPT 2PMZD 1ZM9A 3ESLA 2ZZMA 3N6MA 4ZS6A 4B3OA 2QO3A 3BK9A 3LBXA 3ZJ1A 1T03A 5CABA 5AQFB 3MEGB 3BSAA 3QWPA 5LXTE 2XG8A 5BJRA 3KHHA 2EC0A 2F40A 2Y0BB 3R5AA 2IY5B 2ZH2A 3FMBA 5KG3A 2KG1A 3OYXA 2H3EB 3PHTA 5LBQB 2DIVA 1CS4B 5E3PA 1REVA 2V5DA 3CCUS 1TFWA 2LM9A 4C4WA 3OXGA 1SHZC 3GJQB 1RT1A 1U0HA 2DNMA 1KBRA 3OYZA 1XMQT 3TVKA 2LQ9A 4ID5B 3V6DB 4HWHA 3KDOA 4LFCF 5AE2A 4OX9J 5LGTB 2N1GA 4ZP9A 4P0BA 1GK8A 3C50A 1VR6A 2JX2A 3MAAB 4H4MB 4N8OA 1TL3A 2OLWA 2DGSA 2KZMA 3RH3A 1YW0A 5I3PA 3MCOA 2R42A 4HWFA 3NGKA 4YHJA 4DV6J 2EI5A 5F8IA 3NGSA 3UU5A 3OL6A 4BDPA 2RA1A 1HA1A 4JI1T 1Y5LB 4QU7A 2AX0A 1M90T 2E9XA 3DJBA 3R1LA 4XZCA 3UUMA 3KMQA 1RDRA 2RD5C 1T9XA 2C2DA 2BJDA 1FKPA 1LWFB 3N0VA 2MKSA 5F9LA 1JKHB 1DLOA 4NCAA 3GG0A 2NTXA 2IM2A 4QWAA 5ETOA 1SC6A 1S9EA 4HE8A 2YVSA 2XMUA 5JVDE 4M5GA 5E7OB 1FKPB 4NLXA 3I87A 2R2UA 3BQ0A 1FX4A 1HTJF 1NPRA 1DTTA 3M6VA 2XQCA 1QSYA 3Q24A 4QKNA 4N77A 3OVBA 5KT2A 3ZN0B 4KUMB 3EWGA 3C15A 4X62J 4DPUA 5J2PB 4M5HA 4K4VA 2MQMA 1NSQA 3M8ZA 2I8EA 1RWMB 2QGFB 4CYUA 2EBGA 3AJDA 5DJBA 4N7TA 1F9FA 1Q5VA 1R6YA 3MD3A 1ZZFA 3UNGC 4LF4J 2R2TA 3PRVA 2HSEB 2A72A 3D3CJ 3C3LA 1U49A 4EB6E 2P2CB 1HMVA 2OHDA 2CPJA 2F8EX 2K9AA 3NS6A 3OUYA 2VKJA 3MEEB 1U24A 4R5PA 2FLNA 5GAHU 2I5JB 2HH7A 3LPYA 3TAPA 4DU8A 2RP4A 4K59A 2HNZB 4LMKA 2HYIB 3AOBA 3E22E 5AQPB 1YKEB 4ZVGA 3P8CD 1N52B 3BQIA 2ZBRA 4ID5A 2WAQD 3RBXA 4KT0C 3DGVA 3W65A 5MLCV 4O0IA 4IE5A 4TYBA 3HHEA 3IAS9 4QXHB 1R0BG 1U0HB 3THPA 2WK4A 3RRKA 3KJFB 4W4MA 1XNRJ 2W9BB 4JI0F 3BDEA 4DO0A 2UVWA 1LWEB 4ZVUB 3JAEA 5L2LA 1GXLA 3FEZA 2D1CA 3D54A 3KHLA 3L7UA 1FE4A 1LW2A 2HHSA 4WF9Q 2NW7A 5G0RA 1VISA 3N9PA 1NK8A 1M7KA 4XBFB 2BS2A 2E9ZA 2EFOA 1D8ZA 2B3TB 2CWYA 2AKWB 3ZMVB 4P73A 4NXNT 2CPYA 3W2WA 2LDIA 2HHHJ 1CPZA 4CN1A 1XERA 2R2RA 2UXCT 1K0TA 4DU7A 1L3SA 1WD6A 4JI2F 5ADXL 4Z37A 2R4FA 1WEXA 1NHKL 3CJ4A 2Q1LA 4X62T 3NWIA 1WC1A 2EKYA 1JLAB 5EWGA 5ETLA 1X79A 5ETWA 2M6BA 1RISA 2BJ7A 4DR5J 5E0OA 1SVDA 3AD9C 1HNVB 3FC9A 1SKWA 4ZN3A 3CWJA 2NZ4A 1TK5A 5F8NA 3GYGA 2Q43A 4IGUA 2CQPA 1O0PA 2BG9A 4ED0A 1VBXA 3EDUA 2H5IB 2UUBT 4O4RA 1U4QA 3VGUA 5L3FB 4NRUA 2NYHA 2V69A 3CJKA 2GC8A 3PNIA 4F4AA 5BYRA 2VPYB 2MQ8A 4ELUA 4YS2A 4IKAA 4RW4B 4GKJT 2QL7B 3EVMA 1S5ZA 2IA6A 3SWHA 3MHYA 4JOUA 3UQ7A 4U3CA 4OLOA 4WE1A 2RSQA 3UR3C 4ECXA 5ETQA 2WDRA 4QR2A 1T03B 1FTRA 1UUSA 2Z2LA 3KDNA 2CRLA 1RTZA 4AIUA 2FJBB 1GAOA 3QIDA 1XIQA 1VQ6S 4EXTA 2AYMA 2CNNB 3O1IA 3G71S 2HAIA 3I4PA 2OUGA 3R5DA 7FDRA 5DG8A 5FJ4A 2BOAA 4Z7YA 4PYDA 3FBZA 2CKWA 3PJWA 3T1YJ 3RBEA 4ZPVR 4IG0A 1ZHCA 3MFHA 1HG2A 4LFCT 2JNJA 3VAKA 4DBRA 1NJWA 1C0TB 4Z90A 1FKAF 1FMWA 2DK2A 2X68A 5IWAJ 4ZHRB 2BXJA 5A6PA 2KFYA 3WC2A 3NP5A 3ILJA 4K4ZA 4C8MA 2BDPA 4TNWA 1YQ3A 4WE1B 2QA1A 2HS4A 5FY7A 3Q8UA 4YUDA 4I2QA 1WELA 2KYXA 3AJ2A 2B7CB 4WBOA 3I5BA 1Q8KA 4HLBA 1S7IA 1KC8T 1QAJA 1RTJB 1RSCA 3LGMA 1W26A 3HO1A 5D3GA 1FXLA 4L72B 3GN5A 4UW2A 1SXLA 1PIEA 1HNXJ 4NXMT 3A4TA 1VBZA 2RRNA 5J1NA 1E2AA 2HG4A 4O3RA 3OVUA 2R7RA 1SUQB 1GH8A 4IO1A 4DV2J 3TARA 4J9UE 1YQHA 4F3OA 3SQGA 4B3MF 2MTQA 3QFWA 4WU3A 4U2YA 1CC7A 2HKEA 2LA6A 2DRDA 5KT4A 1ZKEA 2C3YA 3MM8B 1JJHA 3DOKB 4W98A 3W5ZA 2FLPA 2VJVA 2GVZA 1CQNA 2WOMA 4F3MA 5AQIB 3KK3B 2G2OA 2PEHA 2DHGA 4IR1A 3GIKA 3ULHA 1WUUA 2UU9T 1N0UA 4X4VA 3ONXA 4MLKA 1UAWA 4QU6A 2QZ8A 3PW5A 2QA4G 4H4KC 2JQ9A 2VU5A 3AE2A 2E7XA 1CC8A 4X66T 1WDDA 4NZ0A 4ES1A 4IE7A 2KDOA 4OI3A 1RHJB 4ZKAA 5AQMB 4CLLA 4IFYA 3CF5Q 3FXDB 2FGCA 2CPDA 4QBUA 2WWVA 2AD9A 4DV4T 4JI6T 1BWEA 3I5AA 3LG7A 5GADI 1HS7A 3DRXA 4ILMA 3K3QC 1J5EF 3RLFF 3OLBA 2HRTA 1F2GA 2HQ3A 3D0GE 1MN9A 3PYEA 3R8YA 4ETZA 1J5WA 1ICEB 4ZPBA 3R6NA 2ZNZA 4LRCA 1IBMF 3LP2A 2DEJA 4JUZA 3JQJA 5AQVB 2CA9A 2KVIA 2W2PP 4I2QB 2JFDA 2MKKA 2B6AB 2GMLA 1WC6A 4ZPTR 2MHEA 2GO9A 3EGNA 2JEGA 2LQ8A 1T98A 2APOA 4X20E 5LJMA 4B9LA 2UXXB 2BMBA 4EAHA 4LMLA 4IOCQ 4J7CA 2XAQB 1XBWA 3N4WA 1US7B 3IGVA 2DD8S 5B0FA 2GAGC 2BKNA 2QRRA 1HLWA 5E33A 5LMNF 3D5MA 4U33A 2LQJA 3BB5A 4YR2A 4OYKA 3GV5B 4K4UA 1VQNS 3E0ZA 3EGZA 2DO0A 5L1LA 1FRXA 5C8YE 2LSJA 1TZ0A 3UULA 2MQQA 1FRIA 1KSPA 4FP9A 3W9IA 2C2ZB 2BG9C 4OZNA 2A2FX 3I1AA 3H0PA 3B13A 3BDPA 1N5YA 2ZKUA 3LPEA 1W7WA 1M5VC 4K4YA 3JB9k 2BQRA 3NEKA 3ZMUB 3MM9A 4JI6J 2VQFT 3NZPA 4E98A 2Z0GA 4WNKA 1K73T 1WR0A 3HFVA 1X4HA 5C2CA 3CJRA 4GO5X 1IBKJ 4DFPA 1VLOA 1FRKA 2XSFA 4OX9F 3HKZD 2FHMA 5A2QU 1FWKA 3ZMZB 2UUTA 2IRUA 4ZPCA 1NAFA 5F9NA 5FDLA 2XSBA 4KMCA 3UD4P 2KXHA 3IM8A 3UCZP 2MSSA 2M9KA 4ZI3D 3AT1B 2GFFA 4C8OA 2RKIB 4X65F 3EHZA 2BKPA 3PYGA 2FC8A 1HF8A 1EQMA 1OEDB 4FBUA 2BG9E 5CHCB 3I0OA 2XY8B 2XM2A 4YB5A 5B0AA 1FJGF 4QIFA 3PFEA 4I6AA 5GAGU 4NA1A 1RXOB 2BA9A 2V4JB 5IM0B 3W62A 4RBTA 3EICA 4AFFA 4IFVA 3MURP 4PWUA 4FF4A 2GIRA 4QQBA 2AYBA 2PFFB 4CT8A 5FD1A 2QL9B 4LBIA 2J7UA 5HBMA 4L9IA 1FD8A 3RIAA 5HP1A 4P6QA 3IS9A 2XGPA 1UVJA 3VRAA 1T9TA 1TKZB 4JBWF 2HK2A 2V6AA 4KAIA 5AQOB 3SYZA 1NSPA 1NNDA 2UUAT 1VC5A 2H88A 1ZAWA 2K06A 3TI0A 4A48A 2E5VA 2QYCA 4HI1A 4OI1A 5AXMA 2CZ4A 3UFEA 1NH7A 1D8YA 2CLYC 5HQ8A 4C7QA 4JI8T 3D7SB 1WKJA 2M3DA 4E7ZA 1OSCA 2MHNA 2BANB 1ZH5A 3VKHA 1AA1B 4KY3A 1TK0A 1YXRA 3D6HB 4H54A 2NXEA 2V4JA 2VWAA 2C3OA 3FZLB 4I6YA 2LEPA 4M5KA 4AQFA 2KVQE 1VIOA 2JEFA 3NL0A 1UETA 4AT1B 5JUMA 4TU8A 2JRKA 2CE7A 1AROP 3HSZA 2DXDA 2ZJPQ 2KZ7B 1N5YB 3AEDA 2FJWA 4H4OA 2DGTA 3EXYA 4P0AA 3OTEA 2YWGA 3LP0A 4JV5F 2ASLA 3ZZ0A 4TZ4C 3MXZA 4MK7A 4A8YA 5IFMA 5KFHA 5DQVA 3LA0A 2WMOA 5AQQB 4QXCB 4DUYF 1MROA 4GKKF 2V8PA 4CRJA 3LP0B 3TVYA 2XMTA 2NXUA 4A8QA 4USVA 2W66A 4RR5A 1UEVA 2W4XA 5DLFA 1ZTTA 1HNWF 3PJ9A 3H2VE 1N34T 2FVSA 4KGVB 2HLUA 3OQ2A 4K50A 1J5ET 1LNQA 3TA0A 2UUCJ 1NU4A 4KH1B 4QWNB 2W00A 1YRTA 2B8QA 2QA4S 1XMOF 4D3HA 3D6MB 5A6WA 2CQDA 3P50A 1WTFA 2XZWA 1LXNA 5F0WA 1KWMA 1WKKA 2FLOA 2SXLA 3M30B 4I56A 2XCAA 1FCAA 3JSBA 1KR4A 2V9WA 1RGVA 3NWGA 4UOCA 3T1HJ 1D1AA 1YJUA 3LUYA 1HPZA 5J2NA 3B57A 2DNNA 3ZZPA 1IWGA 4KGKA 1VCTA 1HBOA 4UQGA 2HEKA 4O2AE 4OYWA 3RYLA 1SBRA 2D2SA 4WYLA 4AQYF 4RW4A 5IC6B 3IBFB 4DL0C 2BE2A 4K0UA 2V7IA 1RU2A 3AHPA 4OYZA 2H4YB 4G2AA 1YZ7A 3DOMB 3NS7B 4DQQA 1FRJA 1U48A 3QUJA 4RPFA 2PGCA 4KJIA 4U7IA 4A8SA 4DL7A 2B4VA 3JSMB 1RBOB 3JTOA 3VGSA 3OL8A 3QT6A 1GXTA 1UA1A 2BW7A 2XY6A 5IWAT 2V1DB 3O1HA 2QRXA 4RX6A 4Y2CA 3W7BA 5DGAA 2OPQA 5LSLA 3IBPA 3L8RA 4LR9A 2GCFA 3RIUA 2BBEA 1VQ8S 3CMES 5AXLA 4QW9A 3CCWA 4A97A 1S1UB 4AXPA 3GIJA 4C6AA 3PYDA 4EEBA 1YBAA 1T9WA 5D4PA 4ZXLA 2BKOA 4Q25A 3UDLA 4DR3T 4AI6A 1KKHA 1SQGA 1IBLF 3NNHA 4RJVA 5ABGA 4AISA 3UUNA 3LANA 1AFIA 4KV8B 4FZVA 3MM9B 2I5JA 2LM2A 1AZSA 2U2FA 4MYTA 4UTGA 3V81A 3H5YA 2LOSA 2VG7A 2ZJQQ 4EO8A 3ZT7A 4LFAF 4UOFA 1QAIA 2FTRA 2MPUA 3BZQA 1NDLA 2AT1B 2ROPA 3DYAB 1VLYA 3ABVA 5F8MA 2XAHB 3P6YC 1DHMA 4NYZA 5ETPA 2GHWA 4AYBD 5FY0A 4X64F 2VG6A 5ABFB 1U6FA 4JLEA 2WONB 2DR9A 3MM7A 5J2QA 4GYSA 3VAHA 1KP6A 1N5VA 4TV8E 4F04B 3PDNA 2VH7A 2CXLA 5DETA 2MOZA 2BVMA 1R27B 2CADA 2CNLB 2CQ0A 2ZE2A 2FHJA 4O3NA 3E8OA 3KG4A 4LRAA 4NCGB 2FJAA 1HHQA 4EMDA 4ECZA 2YOEA 1PCAA 4P2FA 3BO2A 4KIAA 3GMIA 3FQLA 5C24A 3V5RA 4P10A 3R27A 4P7TA 5B0CA 3UFCX 5IS2A 5ETRA 2W63A 3NAHA 2RUSA 4F4YA 2UUAF 3FBFA 2J7KA 3MMAA 5CYQB 2VD3A 5HWXA 1W9RA 1Y00A 2V67A 2W9CA 4KO0A 2HS3A 3TNVA 3OFGA 2LSIA 2UVUA 4QWDA 1J27A 3DRPB 3I0RA 2GS8A 4PXDA 2CAJA 4O4LE 3NRYA 1WYCA 4EEDA 1IVZA 4RW9A 4MFBB 2XO6A 2RJZA 2KT9A 3PHEA 1N33J 1MSWD 2O66A 4U67Q 3UD5A 2DJWA 2BW2A 1UFKA 3LP2B 3G8SA 2E1CA 3H42A 3T5HA 2ODUA 1ZETA 4DUTA 3KK2A 2UXCF 4OJHA 4DV4F 4YB6A 4WXOA 4TY8B 4TKTA 2DEIA 2XGQA 4NUVA 2WBMA 1KHWA 2C22A 1NRKA 3KLGA 2L3MA 1HW9A 5EGYA 1RT4A 1X5PA 1MNDA 2HNDB 3VR8A 1MU2A 2M88A 2XM3A 2WSEC 2IRXA 4LR8A 2NPFA 1VQ5S 3A8JA 4KR0B 4YY3T 1P1TA 4NCBA 4FNHA 1DJ0A 4UVCB 3MMCB 5HVGA 2KT3A 4LSLB 2AW0A 2WZ1A 4DQIA 2LMIA 2HHHT 1YJ7A 3N5FA 4P09A 3R2CJ 3CDBA 4HI2A 4DSIA 2XS2A 1HQEA 2E29A 1C1BB 1LKZA 4P2SA 3V6DA 3P7IA 1HWIA 2EWHA 1EETA 2AZ3A 2OSRA 4YSZA 2DGQA 3TZYA 1XMOT 1XMQF 4KKOB 1Q16B 1U02A 3FZBA 2KINB 4YXDA 2VQFJ 3FXEB 3IHRA 4IREA 1FVQA 5DLGA 1KLNA 2XSJB 4B3TF 2GGPB 3K17A 5I42A 1WWHA 1X60A 2HHVA 2BR0A 3PX4A 4PK6A 5FY1A 2MYSA 3Q9DA 4OZLA 2DISA 2R8HA 2R7OA 4F8RA 3LW5C 4NWBA 3I0SB 4ECYA 5F5WA 4I55E 3HKEE 4HTEA 1KVKA 2HHTA 1S1WB 5JDHA 1N33T 3H25A 3KINB 4HTJA 3ZZTA 2LXFA 5CAAA 3J80U 3FVYA 1U4BA 3IBCB 5T7LA 2XY7A 2YKAA 5ETSA 5HI7A 3W63A 4AUKA 2VA2A 1U7LA 2JOQA 2VPZB 1WHVA 3D67A 5LHGB 1SB6A 5L9XA 5KFXA 1JKHA 4IG3A 1VQPS 2LDYA 3B4DA 3RBZA 2VQFF 2ZUGA 4OYJA 3EUHA 1TELA 1WHWA 5C2TA 1SPBP 3A13A 5DS7A 5KG4A 3WDOA 3EXCX 2Z8QA 2D3ZA 1UW4A 3C46A 3HKWA 3B82A 4K4TA 5K8MA 2RRBA 4LJMA 5L47A 5KOXA 2VG6B 2V4QA 4O4JE 1U1MA 3EYZA 3TKLB 3ONJA 5FKYA 2W8KA 4FF2A 2ADBA 3PW2A 3LALA 1TL3B 4X65T 2M70A 4B08A 3H40A 1RT6B 4OJ1A 5F0UA 3FDSA 2DHXA 3M9MB 2QLXA 2M52A 1B3TA 1IBLT 3KJNB 4YTNA 2CXEA 3T5KA 3W9HA 2QC3A 3T5JA 1RU1A 4OZJA 1AXQA 3B6BA 3CCLS 4Z7CA 1YI2S 3FGVA 1B0PA 4AQGA 3M1VA 3FZMB 3H8YA 3NOGA 3POTA 4Q7AA 3VCDA 3DFEA 2K7KA 3C2PA 2Y48B 2YNGB 4AL6A 2RF2A 4ZVQB 2ZBQA 1D3WA 1JLCA 2EK6A 5KFYA 1VRTA 5LJNA 4B9UA 5FIIA 1C1BA 1U2CA 5L3EB 2AEMA 5JDQA 1A0OB 3MPVA 4DLEA 4F0MA 2JQHA 4C8NA 3CD0A 5KDMC 2ZM6T 5FXVA 3OR2A 1RACB 2RQCA 3DLLQ 3UU3A 5CYJA 3CIMA 3OTDA 2HFZA 3AB2B 1CJKB 1YDLA 5KFVA 2P6SA 3P4RA 3MR3A 3KK3A 2PA3A 3N9LA 1ZEEA 4KFBB 4USUA 1ZA2B 1B7TA 3SV4A 3RAQA 3L09A 1D0EA 1YRUA 1SCJB 3KLEA 4C11A 5RUBA 5KFSA 2WVDA 4U8VA 3BKTA 3IA3A 5KFJA 4P2XA 4YEAA 3RG6A 2ZM0A 5AQRB 1GMVA 5A8WA 5KX5E 4PUOA 3GP9A 2JSXA 1SQFA 4DWIA 4MKBA 1RAHB 3QQCD 2IM1A 3ZZZA 1JJ2R 3QJLA 4DSKA 5HSPA 2FB0A 4X4PA 4WYVA 4O3SA 4DMWA 1S57A 1DURA 2KJWA 3F57A 4I0UA 3K5PA 3E3XA 2K1RA 1JLFB 2QMXA 3P4UB 3U1MA 4DV0T 3H4BA 5L3GB 1ROFA 2V8GA 2KXFA 3BV8A 5JMNA 1M1KT 2LRKA 1IKXB 1HNXT 4KGZB 5DQGA 2V0NA 1T9VA 4PZVA 5DRKA 5LGNB 2F4VT 1V5VA 1YRXA 4KO0B 2CJQA 1YD8G 3FQKA 1VI7A 1T05A 1JLFA 1NH8A 4LVOP 4ZJLA 2YX1A 1T95A 5IT9U 3O1LA 1S35A 5CYQA 1K47A 4WCEQ 5KXJA 5IC4B 1RTDB 4OZ5A 3LSVA 1FKOA 2OFHX 4PR6A 4C90A 1N34F 3T1YF 4QWEA 2QYWA 2VC0A 1CG2A 5IZHA 2BJ1A 2C2OB 3CX6B 4OIXA 3H3AA 3OJSA 3R9LA 3M8RA 1G4CA 1HQUA 5LMNT 2ZWPA 3HL6A 2FGOA 4CLTA 4LF9T 2KM8C 1MIVA 2QLJB 3I0RB 3IP0A 4GO7X 3C4XA 4DUYJ 1YBUA 4ZVFA 1LXJA 5JRCA 1FHTA 4UR9A 4FKXA 2EKNA 4NLDA 3KK2B 4ZPWR 3RIFA 2UXDT 2QLWA 5KFRA 1KVJA 2MMYA 3BPSP 2AU0A 3CJ2A 3OUYB 3FUYA 4PEOA 1VRTB 4FS2A 1F3VA 2QA7A 1FERA 3BYRA 3RF1A 1SIWB 2X0YA 4Y2IA 1A6LA 3UUXB 4FS1A 4X64J 3HMJG 1FDAA 5IT4A 1KK7A 4X1KE 4MIWA 3DLBA 1Q5YA 4KGMA 2V2QA
chains in the Genus database with same CATH topology
3KXDA 2BKPA 4L73A 1VCTA 2I0MA 1SUMB 2BKOA 4Q25A 4L74A 3L39A 4J90A 4YS2A 1XWMA 3RBZA 1T72A 3L4BC 4J9UE 4J9VA 4GVLA 4EI2A 2AEFA 1LNQA 2BKNA 2FY8A 4L76A 4L75A 2AEMA 4G65A 2AEJA 4RO0A 1T8BA 4XTTA 2OGUA 3JXOA 2OLTA 2IIUA 4J91A 3RBXA 4J7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXD A;  2BKP A;  4L73 A;  1VCT A;  2I0M A;  1SUM B;  2BKO A;  4Q25 A;  4L74 A;  3L39 A;  4J90 A;  4YS2 A;  1XWM A;  3RBZ A;  1T72 A;  3L4B C;  4J9U E;  4J9V A;  4GVL A;  4EI2 A;  2AEF A;  1LNQ A;  2BKN A;  2FY8 A;  4L76 A;  4L75 A;  2AEM A;  4G65 A;  2AEJ A;  4RO0 A;  1T8B A;  4XTT A;  2OGU A;  3JXO A;  2OLT A;  2IIU A;  4J91 A;  3RBX A;  4J7C A; 
#chains in the Genus database with same CATH topology
 3E2E A;  1WCR A;  2W4C A;  5SZT A;  4ZP7 A;  1QUU A;  1