2BKPA

Structure analysis of unknown function protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN PH0236
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
total genus 74
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkpA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkpA02
3L4BC 4G65A 4L74A 4J7CA 2BKPA 1T72A 4J90A 2AEJA 2BKNA 3L39A 4L73A 2I0MA 1T8BA 1VCTA 2IIUA 3RBZA 4J9UE 2AEFA 4EI2A 2OLTA 2BKOA 4GVLA 1LNQA 4L75A 4YS2A 4J9VA 1XWMA 4Q25A 3JXOA 4L76A 2FY8A 4J91A 4RO0A 2AEMA 2OGUA 4XTTA 3RBXA 3KXDA 1SUMB
chains in the Genus database with same CATH superfamily
5AT1B 1IWGA 4PAAA 1BXNA 5KTQA 2Z2LA 3UQ4A 2HSEB 1IAPA 4OV6A 4MYTA 1C4AA 3HFVA 1H7XA 3DKDA 3RQWA 2YWHA 4OX8A 1FEWA 4ZJLA 4IDKA 5B0CA 4EO8A 4RO0A 3GCXP 2GVDB 4A48A 4CZZB 5ETOA 1YVFA 1YI2S 2W01A 1XIQA 8ATCB 2OA5A 2XGPA 5DRKA 2CZ9A 1WF0A 2BYCA 3HCXA 1TL5A 3MWBA 1NK8A 3T5KA 2XO6A 1B4SA 2IJNA 3BH7B 3JC6D 4CRJA 1U6ZA 4ZVFA 3E3XA 1YQ3A 4XAKA 4OZJA 3TO8A 2MKIA 1VQSA 3JQJA 2XLJA 2W67A 2W00A 2VKRA 1YHQS 3PTRB 4B3OA 2GJFA 5DDOC 2Q43A 1MIVA 4ZVEA 5MAOA 5D77A 1TL3A 2UUWA 3RIFA 1K73T 4DX6A 1FRKA 5EN1A 3M2RB 4DL6A 4DXLA 3DRPA 2EHOD 2VWAA 4TWFA 4LT6A 4FYVB 2IFXA 5ETMA 1BR2A 2FB0A 3BB5A 1HMVA 1HFAA 4NLOA 2WBLA 2J0QD 2Q9QD 2M9KA 5FY7A 2MZJA 2ASDA 2B5JA 4C8MA 1SPBP 3X1LB 1RWNB 2Y48B 5I3UB 1DBDA 1HHSA 2KG0A 4LF9T 4N77A 4ILRA 4DBQA 3G8TA 4ADZA 2UU9T 2WVEA 3C15B 2C2EA 2HHHJ 4ZEYA 3AQOA 3BR9A 1W26A 4DQSA 2D41A 1RAAB 4MIAA 1RGVA 4QH4A 1VOMA 4ZPBA 4NLRA 4IYQA 5B0BA 2CG4A 3IXQA 4U7IA 1FTCA 1QVFR 3QGIA 1UA1A 5DQHA 5FLXU 1YITS 1U7LA 4MJKA 4HWIB 2RA1A 5JQGE 2OTJS 4QIWD 4FYWB 1Y00A 2EHOB 1UJ5A 2C3OA 1KVIA 1NH7A 1HD1A 3TI0A 3LWMA 2QL9B 4Q44A 3BS9A 1G7CB 2LDIA 2VC0A 2ZUGA 1XDOA 3R6GB 1RTIA 2WRMA 2Q9QB 1TFWA 2VQEF 2I6WA 3HHEA 3CE8A 3IR6B 4ZP8A 4U7CA 3MR6A 2VG5B 1TVRB 3DN9A 4YHJA 1KBRA 4IFVA 2GK9A 5D3GA 5J1EB 1M5KC 1LK7A 2WS3A 3POTB 5GONE 3OTBA 3ZEFB 1XDPA 5AQSB 3ABVA 1KFYA 1X60A 2WWVA 1KQSR 2HIYA 4ZVHA 4DV5T 1YLXA 4ILBA 2DB1A 2EFPA 4A98A 5AQFB 2OSQA 4DV3J 5KT4A 3GV5B 3AAIA 5LGNB 1WHVA 4TN7B 7AT1B 5LG4A 2ZFHA 4ZOLE 1Y0HA 5K14A 3WZ0A 2Y8YA 2HHPA 3CULA 2HHXA 2VONA 1P1LA 1RT2A 2FJEA 4B3MF 4YMEA 4HACA 1P1TA 3QAUA 4JI4J 3N6MA 4ILUA 2WONB 3AJ2A 1CJTA 3T8OA 2XAFB 4QWNB 4QW9A 3L7UA 3CDUA 4DL7A 2IRXA 2DR9A 1XK8A 3LP2B 3U02A 2KYXA 2HQGA 4OYBA 1N33J 5HWYA 2A2CA 2OELA 1S7IA 2LQ8A 4X4UA 4DFPA 4U8YA 5HLFB 2J7KA 1E1HB 3O1IA 4DX7A 5KT3A 3SFUA 2DNGA 4EEYA 2LLYA 3KK1A 2KXHA 2XMVA 5GMDA 4AIUA 1LW2B 2A72A 1UX5A 4RL1A 4KB7A 3KUGA 4ZJQA 1K9MT 2EBGA 3BSNA 4LSNB 1HW9A 2JHEA 3IA0A 3J80U 2WSCC 2XMTA 4ZLNA 3PG9A 4BC7A 1P9YA 5ETRA 1FMVA 4ECUA 2YKSA 4KBMB 4X64J 4URQU 4ZI3C 1SKRA 1V6HA 1V5VA 1QTMA 3M9MB 5HCMA 3OPKA 4I0WA 1FXDA 2HNYB 1MMAA 2WU5A 4ED5A 2HNDB 2GFFA 2A3JA 4MKAA 2QA7A 3JSMA 1SC4B 4KI0F 4UXNB 4DCPB 3ZZPA 1J2VA 3QFHA 3PURA 2H51B 3DI6A 3WAJA 1ZM4A 1S97A 3PKYA 1HG5A 1WC0A 4ZCKA 2OMLA 5CA5A 1KDNA 2V8VA 2HVIA 3UCGA 1D0YA 1BHNA 3ZO7A 4EWTA 1SHZC 3AD7C 1O8BA 4JV2A 2HFOA 2ASYA 1GMVA 4HFEA 3TLWA 1HBOB 4DR1J 1WI6A 1J5OA 2PG8A 4J9NA 5KFQA 2HQCA 1SQGA 2A2DA 1R8BA 4XAXB 2AZ1A 2F3JA 1RJJA 4ZP9A 3NS7B 1DU2A 2Q6BA 3ZZOA 4L5GA 1X9MA 2LQBA 1SXLA 2YNGB 3MR7A 3J7YU 5C24B 2QJ3A 1F6TA 2E5HA 3Q8UA 2IRYA 1MNDA 4YR2A 4LRCA 1C2PA 4NEZA 1DQAA 1DLOB 3MMBA 1FKPA 1VQKS 3KV6A 4DV1T 1Q1KA 3IF8B 4EZ9A 2BQ3A 4AQGA 3A3PB 1S9EB 2PEBA 3AOBA 3HKEE 4LSLB 1ZA1B 3I9ZA 2W9BB 3NS6A 4JYAT 2NS1B 1X4BA 3SXLA 2BJ9A 5KFFA 3NMAA 4ILLA 1X4CA 3PDNA 2IAJA 1D0EA 3MOZA 1Q8IA 3LWLA 4K0KT 1WOPA 4R8UB 1FE4A 4PCQA 1HNZJ 2JVRA 4DUZT 3BQIA 1ZAVA 2FBWA 2D69A 4KAIA 2W2OP 1YSJA 4QYRA 4J9SA 1JLBB 3HHLA 3D3BJ 4J5OA 3NWRA 2ZNYA 3E01A 1RAEB 2YNIB 4CXYA 2OPQA 1UGOA 4N8OA 3DOKA 1OY6A 4C3LA 1N33F 4LF5F 4OYIA 5DM6Q 3R6NA 1FK9A 4NIQA 2IC3B 1S49A 2DCFA 2HMIB 4HL9A 4OJ1A 3AA0B 2X1BA 1G1XA 5KFIA 4ED1A 2V6YB 3OHAA 2BQUA 1U0HA 3KLIB 9ATCB 1DRZA 1RT4B 3EVYA 5F8PA 3S6EA 3LUYA 2ALYB 2N3OA 4ZVGA 3AXJB 2V7KA 4AKRB 2WW4A 3DDIA 1FJEB 3AAAB 4YDXA 1FI4A 3R5DA 3NZPA 1S79A 1URNA 3R84B 2LECA 3PO4A 1IBMJ 2V6XA 4X1YE 5ABEA 2DNMA 1Q81T 1NZAA 3KG4A 4M1KA 3K5OA 2PJQA 4ZVTB 1RWUA 3TVZA 3DLEA 4EFAC 3CWZB 1R8HA 4MTPA 4H63H 5LSOA 4Q8EA 3QGPA 3LW5C 1Q53A 4JLEA 2V26A 2Z56B 1OQ3A 1RWOB 5AQMB 2HG4A 3OVSA 2DGTA 4ZI2C 2IYGA 1SV5B 3I0SB 1SA0E 3ONJA 3ITHB 2VG6A 5HEGA 3TR5A 1VQMS 1C1BA 1NHUA 5EDWA 5FDLA 2OMOA 1S6UA 4A4JA 3QB5K 4PFPA 2DHAA 1IVZA 4RUAA 1IWAA 4HKQA 2CMRA 3N01A 5HEUA 1F3VA 2CWXA 2QZ8A 2QG9B 4IRDA 1JLEB 2NW9A 5KG5A 3S1TA 1M5SA 2JEGA 3CX8B 5DJBA 1YJRA 3LTOA 5J2MA 4Q45A 3I0RB 1RT1B 2W25A 2Y1JA 2CBIA 2BDPA 1PC4A 4HVZA 3M65A 5LP6E 4Z90A 1WWHA 3FMBA 4J9QA 5KFCA 2W2UA 3SQGA 2V2KA 3GIMA 3K0JA 5JH7E 3W9HA 1H2TZ 1WKJA 3MM7A 2JMHA 2BG9A 4F3OA 5IWAJ 2HK3A 4DPOA 4XZCA 3Q2MA 3OL7A 3QT8A 2X1FA 3V6KA 1TAUA 3GIJA 4FP9A 2UVRA 4DV2F 1SJRA 1S4FA 2XQYA 2MQQA 2R2TA 2NP9A 3MJXA 5B0AA 2DHRA 3ZKRA 3QBCA 2HVDA 4CNYA 4P2XA 3D6HB 4B9UA 4QIFA 4O3NA 2MSSA 1PSDA 3Q5WA 4DV0T 4DG1B 2PIIA 5F3JA 4OYKA 4Y00A 1WKLA 5KT6A 4DV4J 4HKAA 4QWAA 3EDUA 5FXZA 2E5IA 2XSJA 1WEZA 3RH3A 2ZOGA 1UEUA 1UJ4A 1G6BA 3OJUA 2WW8A 2C3MA 4DR7F 2W4DA 3MFHA 3SSRA 1RTHA 4CT9A 4URSA 3IBCB 1S9GA 2GW8A 1HNZF 1CPZA 1X9BA 3EI0A 4PQUA 1I51B 3LG7A 5J2NB 1IBKJ 4I69A 4G6VB 3L95X 4CXXA 1HBNA 4ISSA 1ZYQA 2Z2YB 1H73A 3NNHA 1J1JA 4C98A 2MGZA 3AHPA 2RUGA 1JIHA 1YJVA 4CLKA 2JIWA 1VQ8S 5BYQA 3MM8A 3PVXA 5HJYA 5HSPA 3M8QA 1B7TA 2IIUA 3BM7A 3CCQS 4Q2MA 2GA7A 1VR6A 2R42A 1OXZA 2W9CA 3VV2B 3ILLA 3WAKA 4HEA9 1UPMB 3JC6C 1HQEB 1SKUB 3OKQA 2P6TA 3IR7B 2LEPA 1YK9A 4L6V3 4L74A 5H9FJ 4M94A 4CLPA 1IKWB 2MTQA 2DEIA 1Z8UA 1RA7A 2AEFA 4J9VA 4ATNA 1EB0A 4BHQA 2CUYA 3O4XE 5JREA 4WFBQ 2M4MA 3G86A 1XJWB 1AUDA 4U2YA 1NK5A 2BM0A 3CCES 4HFBA 4F4ZA 4ETZA 2D2SA 4OX9J 3TW0A 1IBMF 1UVJA 1HW8A 2PE8A 3V81B 2NREA 4OI1A 1RTDB 1CULB 3AEEA 3MACA 4ZIVA 4OL8A 4LREA 2XNRA 3EVMA 2RHSB 4PG7A 3PJWA 1GMWD 3Q8PB 3TX0A 4GK0E 1BWVA 1F5CA 2FQQB 4PXCA 3G71S 4U96A 2KRRA 1QLNA 3OR1A 1YGYA 5CYQA 4Z91A 1K44A 5J2UE 2IBKA 2DVIA 3ZTRA 2W4PA 3UDEA 1REVA 2B9YA 3LGNA 5KFBA 1RUSA 2XZWA 4WFYA 3JTPA 4ZS6A 3NCPA 4NLYA 2UU9F 1V9DA 4GO7X 4O4GA 3QSYB 3GJQB 2MDAA 1TKXB 2WMOA 3R6LB 2ZHBA 4ASKA 2HFUA 2C5KT 1S6PA 1UZHA 3D1QA 3EDQB 4X64T 8RUCA 2QYWA 1U1PA 3NL0A 4L0RA 3LO3A 3P96A 3A12A 1S0NA 2SXLA 5IC4B 4NRUA 2CRLA 3Q89A 4HE8A 2UXBJ 2QC3A 2E9ZA 5KG2A 1L3UA 4LQ9A 1KS2A 1S59A 3OTCA 5IXUA 5IWAF 2E66A 3R27A 2YY3A 2BANA 3IGVA 2JZ5A 3D6TB 1E7PA 2W2QP 3BKTA 2E1PA 2XYPB 4RKUC 2DNRA 3O3LA 4NZ0A 1FF2A 1JLAA 3N9NA 2C42A 3I87A 4LIRA 2BA9A 3MF5A 2DH7A 2WSSV 2L48A 2LQJA 3NG8A 1VC0A 2VQFT 2UXDT 3TJ8A 2B6AB 5KFUA 5LJMA 1ZHCA 3CW2C 2XTJP 3R1LA 3HO1A 5JVGQ 3FZMB 3SCLE 3IWLA 1AZSB 5HMYA 5EK2A 2HN2A 1LW0A 5KFYA 3AH6A 2CPDA 3UWTA 4N7TA 2E1MC 5JVHQ 2MPUA 1UVMA 4M95A 4K0UA 3OUYA 1S7HA 2XYHB 4V19J 2PEHA 1MNEA 3NVOA 1QAXA 2Z57B 1LKZA 2ACXA 2ZM2A 3OXLA 3FVYA 1C4CA 4DR2J 1U1RA 3M8YA 1IBKF 1FVSA 4EZHA 2LXFA 2E8IA 3MK7C 1EZZB 1X4AA 1SL0A 4LF2A 2APOA 3GYXB 3VWSA 4NPOA 4IL4A 4G1QA 5D4OA 4IREA 4JI1J 1M1HA 3DRRA 2QLFB 3I96A 2UV8G 1IKYB 3H42A 1HPZB 3MEKA 2A0FB 1S1VA 3W8PA 2OEKA 4AKHA 5KFSA 1HQUA 5CHCB 2DLRA 1FJGT 3HD2A 3NWIA 2DRBA 1Q82T 5ETNA 3PY8A 4O44B 4ZP6A 4HT7A 1HF8A 2LSKA 1R31A 2PMWA 2KJVA 4C8LA 1HYSB 5KOWA 2H48B 5AQJB 3BN4A 3TNVA 4NEYA 2QFIA 4RBUA 3DYAB 1K0TA 5KG3A 3PDYA 1QUUA 3D66A 4Q7AA 3T9ZA 4PJMA 3P7IA 2XQ3A 3N6NA 4KGZB 4G1IA 2MQNA 3VAFA 4O0NA 5KFJA 3BO2A 5BYSA 1XTZA 4CYUB 4OX9F 2LRKA 1QM9A 1YW0A 1XNRJ 3H40A 3FJ2A 1WF2A 4PG8A 1ZPWX 4CO5A 1HG2A 2YH0A 2MZRA 1RT3B 3HKDE 3ET6A 3RGIA 1HNIB 4CLUA 2IPOB 1V3RA 2R6GF 2RIJA 2WM9A 3EUNA 1RAIB 2BM1A 2RU9A 3CQCB 2UUAT 3M05A 3A4TA 2C0SA 4U74A 5J2PB 5ABGA 2HW3A 2KO1A 2CQCA 2XMUA 1HNVB 2VH7A 3TAMA 1RAFB 3FBLA 2GNKA 4PXDA 1SL1A 3LOUA 4UF0B 4LBHA 2AP6A 5FVLA 1Y4ZB 4ZPCA 3M2VB 3T5LA 1ZV4X 4MK8A 5LMNJ 5H9EJ 5D8HB 2MZTA 3HL6A 1P6TA 4CI3B 2DPJA 3DM2B 4UR9A 5KG7A 2ZVIA 3GSDA 2J76E 3PRBA 3QUJA 2XM3A 3G8SA 1E2AA 3I32A 4KH0B 1AROP 3PYEA 3KBTA 3D1HA 1U47A 4JP8A 2XY5A 2NPIA 5BMVE 2NXEA 1PJ5A 2UXBF 1U1OA 1CVJA 2AKWB 1VC6A 3PTWA 4B9MA 3NAHA 2HH7A 3MTKA 1HBMA 4OYAA 5G4DA 2DT9A 2YWWA 1UEKA 3RRWA 2GHVC 1C1CA 1TMMA 1GEHA 5DQIA 2HWTA 2ABYA 5DDQC 1WOSA 3A8EA 1NEKA 5IYZE 3PEHA 2NLWA 2CPJA 3DLHA 4CO3A 3AODA 2WB4A 2OPPB 1YBUA 3QT5A 1SKWA 5AQGB 4DU7A 2OSRA 3AE7A 3B54A 4OZ2A 1ITPA 2XASB 1J27A 1FDAA 1WKKA 4DV1F 1XWLA 2VJVA 4FKXA 1TAQA 3MEGB 2PA3A 4L76A 4G2AA 3IC1A 3PX0A 2WAUA 4JYAF 4F4AA 3BEGB 2YWKA 1X4DA 2RUSA 1T03A 3VR1A 2EK6A 1QSDA 1FRMA 3IG1B 3M8RA 4DV6J 4C3KA 2E5JA 1EP4B 2L9QA 4CO1A 4K0KF 4I4BA 4C8KA 1WC3A 3HSGA 4DR2F 1JLFB 5LT5A 4FI5A 2FPHX 4P7TA 2BJDA 4DQRA 3DC2A 3EUHA 3V5UA 5A8KB 5HANA 4FS2A 1RCOB 3OQ2A 5LSRA 2E5LT 5AQHB 2DCUB 1Y5LB 1NH8A 1FDNA 4BWMA 3DGPA 2FJAB 3RRKA 4YP3A 3G8QA 3PU8A 3PYFA 2RKIB 4H4KC 2D0TA 3UDVA 4ZS3A 4DV4T 3KJVB 3G2XA 1NSPA 3AAWB 3AB3B 5HVFA 4CLTA 3DLGA 3AE5A 4DR5J 4X1IE 4OYMA 2A2FX 2WVBA 1QE1A 1WELA 3W63A 4MIWA 3C51A 4NL5A 2HWHA 2QL7B 4JUYA 4DFJA 4IE0A 2W2MP 3HP6A 4ZVUB 1L0VA 2VV5A 1DTTB 2Y8WA 3OTDA 2GO8A 4IDPA 1XNRF 4HWCA 2DNZA 3PW5A 1VQ6S 4YJ3E 1OPIA 1C0UA 3MR2A 3KLFA 5I42A 3VRAA 2EVZA 3I31A 2UVUA 4ELUA 1IKXB 3NZQA 4U33A 4U7UK 3F57A 4DIDB 2H5JB 3SCJE 1R0AA 1FWPA 1U1NA 4DMVA 2WBRA 3CDBA 5FP3A 3NEKA 1PBUA 4MALA 5JJBA 3EAMA 2YNFA 2NUUG 4JI7J 2YDRA 4WE1A 2WCXA 3BBFA 4NZ6A 4PPDA 5ITHA 2W4CA 3W64A 4ENOA 5LMNF 3TUPA 2AV5A 1N32J 4IFYA 3ZZYA 4KBIA 1NZ8A 4KV8A 4CWBA 1HNWT 4EZ6A 4UOFA 4UUWA 2X1AA 2NSCA 4ZLJA 2CIMA 2N4DA 3KBUA 3DHXA 3TUIC 4DFKA 4MLKA 1LOUA 3GWHA 1TKTB 3IWXA 2OGUA 4X4TA 1YRUA 3UN2A 4IG0A 1OSDA 3VVTA 1RLDA 5D78A 3ZTQA 2C2RA 1WTFA 3I5BA 3MPDA 4O4HE 3P49B 4QWCA 4NOHA 3BGRB 3MCMA 2CPYA 5HVHA 5GVQA 2R7UA 5F8HA 3RIUA 4P2MA 1P9QC 2MLYA 4WU3A 4H54A 3PUZF 3NAIA 4I55E 2ZH1A 2QA2A 5GMEA 2U1AA 2AZ3A 4QW8A 3PCOB 1T72A 3MHYA 4AL7A 2VBYA 4B3OB 1VQLS 1RSCA 4B3TJ 1TK0A 1G3OA 5AQPB 4MK9A 3FZHB 3BDPA 1TL3B 3N0VA 3RU0A 4UQGA 2CM0A 4IOCQ 3UD5A 2AEMA 3OYXA 2PT0A 3VGVA 3DRPB 2F7VA 2AJ2A 1JJ4A 5ETWA 2V50A 2VHGA 3PUXF 2JRKA 4DS4A 4HI2A 2MPKA 3OJSA 5CQGA 1RTZA 5KFWA 2IMOA 2AGQA 1JNRA 2X3DA 4ZN1A 3H5SA 1H74A 2B5JB 4DV6F 2PFFB 4ZPDA 3ZN0B 2UXNB 5E2QA 2XY8B 1B99A 2K48A 4KFBA 3AA8A 2F5GA 5GAHI 1S1TB 2G0JA 1N5SA 1FNXH 3H5XA 3LBXB 3ZTPA 2I2YA 1KONA 3L7PA 3MM5B 4BJMA 2LCWA 2V2ZA 4FNHA 3RB4A 1JJCB 3Q8SB 4KUMB 5A2QY 4A8XA 4NLPA 4U7UD 2FYXA 5L9XA 3ISNC 1JLQB 4LFAT 2BABA 5B09A 1M1GA 5LOQA 4QHOA 1NWMX 1CEZA 2FLLA 2FDNA 1QSYA 5E3CA 4KO0A 1MROA 4J90A 4P6QA 4EBDA 1OWXA 4K4YA 2VG7B 3ZN1B 5D4LA 1FXRA 1VQ4S 1MLAA 3IFEA 4RR5A 3V6DA 5M2UA 4HTEA 1UTAA 3OTOJ 5ETQA 1L3KA 1ZZFA 1UX4A 2KU7A 2DGXA 1RTIB 2VICA 3BQLA 3I9V9 3RLFF 2X9XA 2KTQA 4O4JE 2GGPA 2FZKB 2CVIA 3DNCA 2AJ4A 5LXRA 3NBPB 2L9NA 4ED7A 2MQOA 2X68A 1KQKA 5D3GB 1MWYA 5E3RA 3MUMP 3KHRA 4YSZA 1PYTA 2FVSA 2VPYB 3KV4A 3KYLA 4FS1A 2HYIB 4LVNP 1WD6A 4NXNT 3MPVA 3CD6S 5HMWA 3C16B 2GIFA 2MY8A 5DGBA 3KHHA 4LFBT 2RQKA 4DX5A 1F1BB 2FHJA 2FGCA 3KDOA 4H9QC 3K3QC 3QJLA 1IR1A 1PCAA 1NDKA 3E8OA 4CO2A 5ADZA 3ZMUB 5K14B 1IJ5A 2XAGB 1RT2B 1N32F 2FJEB 4RBVA 5FJ4A 2M2BA 2QRXA 3BQKA 2DWKA 1B0TA 1XERA 1WG1A 3JYTA 4I7FB 2GHWA 3UCZP 1UFWA 1SQFA 4PPZA 4DUYJ 1TUWA 2EEYA 3H20A 3FFIA 2UUCJ 5CFBA 2GO9A 1U8WA 3ZLIA 2RRNA 5T14A 3G6ES 2NWBA 3BREA 3H3MA 2W8KA 3WX8A 2XUEA 5IT9Y 3D5MA 4IDQA 2YPYA 1A7GE 3OPCA 4UZCA 3NY0A 4FXDA 1F5BA 1H7CA 3ZC1A 3EX7B 3GILA 4TYAA 1YJ9S 2A6MA 4IOBA 4O3OA 4HH1A 2V4QA 4A8KA 2WDVA 4KHPT 2VPZB 5KFOA 2XHEB 4WZMA 5FKYA 1D8YA 4EEDA 1NKEA 3OXFA 1NPKA 3MXZA 1ELOA 2G0IA 2UXDF 2UXCJ 2M5YA 3N6LA 4LF8F 4X66F 4NASA 3JAMU 5HEOA 4QPTA 4EAHA 3X3UA 4FF4A 2V34A 1YJWS 4BAYB 2FJDB 2WAQD 4LRFA 3HULA 3T1HT 1SUMB 4B3ST 2M8HA 4R0EA 1Q16B 2XQ7A 5DLFA 2KXFA 2R2SA 2Y8DA 1ZA2B 3I0OA 4ED8A 5HQMA 3B4MA 2C2DA 1GTEA 2FJVA 4IR9A 4X4NA 2VDHA 4C11B 4FDFA 2XQAA 2AT1B 1QY7A 4MKYA 1VMBA 1CLFA 1HNXT 1CJUA 2IUBA 1R0CB 2B9XA 3OFHA 3O5TB 2K24A 4OYZA 3VAGA 4IOAQ 2FD2A 4I50E 2CKWA 5KFPA 4WXOA 1IBLT 5HROA 2Z58B 3MUTP 5FY0A 4QBUA 1CSJA 2BZBA 1U48A 2CZVC 2VOOA 1J5OB 1R8PA 1MW7A 2VPXB 4MBQA 5JR9B 5AQKB 1Q5YA 3HHLD 1LEOA 1NJIT 3JXOA 3TOQA 3TVYA 4ID5B 3B13A 3MURP 1KTQA 4LBPA 2N1GA 1RBLA 3C19A 1D8ZA 2W7PA 3BQ1A 1FKOA 4X20E 4UOCA 3MMBB 4JI6J 4AL6A 5JRCA 3DDNA 5FXVA 4DZ6A 1EIYB 4YFSA 1NCLA 3NOCA 2D3O1 2DGVA 2ASLA 1R0BG 2H9ZA 3WI3A 4IDNA 2E1AA 2ZH8A 4EYYR 2ZITA 3NKZA 2K2PA 2XWXA 3L3PA 4L75A 1E6YB 5LL6d 4YB5A 3I6PA 2BE9B 4GVBB 3H4DA 3VHLA 1Y5IB 1CJKA 2ROGA 2MKJA 4FF3A 5ETPA 2QLXA 5GMKa 4ZZCA 2MOZA 1VRTB 4EMDA 2ATCB 3W2VA 5T41A 3MCOA 2V4JB 1CUNA 2GAGC 3MMAB 3W9IA 2CWKA 1YG0A 3ZCJA 4F02A 2W62A 2MSTA 1D9DA 2IM3A 3KV5A 3E01B 4CP5A 2OPQB 1HD0A 2EKYA 1KSPA 3VQTA 2UUCF 4GMKA 3A13A 2C3UA 3W5YA 1FK9B 4E7SA 3DU5A 3I4PA 2YVSA 4DOZA 2ASJA 1CQNA 5HMZA 1U0HB 4Q25A 3UVJA 2COLA 3QJPA 5HP1A 4B6XA 1EQMA 3M3ZB 4X62J 2Y9HA 4A46A 1DY3A 3T1AA 3BKFA 4XO0A 3CX6B 4RNNA 2IA6A 2IBOA 3N9UC 2DNQA 1KEKA 1T8BA 2BX6A 2RSQA 1S77D 2BKOA 3QZ7A 1NUEA 2UXCF 1I94J 3ZZTA 1YJ7A 4QH5A 1BR1A 3ANWA 2X51A 2AU0A 2MJNA 3IBWA 4K59A 2CJ9A 2XS5A 3FSYA 4GKJT 1AXQA 3CMQA 4X4RA 4Z8XA 3GMGA 2NTXA 1QVGR 4QYZK 1BE4A 3MEDA 2RHQB 1NEEA 1N88A 3H37A 5J2QB 2XBPA 2ZE2A 4RWWA 3UD3P 1CJVA 1HI8A 2VG6B 4DL4A 3T6JA 1T8EA 3NGKA 3T5HA 3G4SS 2EBEA 1C1BB 2CPXA 2B4OA 3RBDA 3EICA 3SV3A 2GVZA 2YKMA 1Y10A 2IA0A 5FDLB 1SVDA 3KVAA 2OFGX 3QGHA 2JSXA 3CCWA 2E1RA 3LANA 1TL7A 2QX0A 2AYBA 4E98A 2E5LF 2O3DA 5DG8A 3ZJ2A 2L3MA 4MMOA 1UETA 4OI6A 3J7ZT 4COFA 2CJAA 3ELHA 2HS3A 4CN4A 4XK8C 3SQGB 1KFDA 2HLUA 3DTOA 5CA1E 1Q8BA 1E6VA 1T94A 4FJOA 1ZOYA 4OYWA 4EGLA 2VKHA 3OFEA 1P8GA 4BJNA 3Q5DA 3EHZA 3DOMA 4DDFA 4JI3T 1YKWA 3RYLA 5AFUL 1IJFB 5JDFA 2CNOB 3VCDA 4PWDA 5HBMB 1RBOB 2RRBA 3FK4A 3GP9A 3RIAA 3UDCA 5LBMA 1HR0T 3MOJB 1VIXA 2RRAA 2WU2A 3CWJA 2WDRA 3JSBA 2CRBA 5L3FB 3LGMA 3GG0A 2WSEC 2XSJB 3HPOA 3G6XA 2D5UA 3ZC4A 3E2EA 2BV3A 1UUSA 4JI2J 2A9UA 3KKFA 2F4FA 2JQKA 2H5IB 4R5PA 2LM9A 2OUGA 1NBEB 4LFCF 3DOLA 2A10A 2PC6A 5B0EA 3UU3A 5AE2A 3BR8A 3TWZA 1LFWA 2LA4A 3L09A 4AKLA 3H59A 2LA6A 1HBNB 2QIFA 1V3ZA 2YKAA 4HI1A 2MGZB 4DNDA 1U25A 1RDRA 1G8XA 3C46A 1HNWF 1VI7A 3M8QB 4MFRA 3ZSTA 2RT3A 4DR6T 4Y2AA 1SL2A 2PA8D 5KFKA 1FRLA 1RT7A 1VFJA 4RWXA 5E7OB 4XPEA 3HR0A 2UUBT 3R5CA 4USUA 1M62A 4A5XA 2GMLA 2CQ0A 3CKDA 1BQMA 2L9WA 2DNYA 2J47A 2VZ9A 3CPZA 4DMWA 3Q24A 3C2PA 2D7SA 4B02A 2HPLA 4UOHA 4PJNA 2VFVA 2R8GA 2K9AA 1VQ7S 1FT8A 1GX6A 1URRA 3ENAA 3ONXA 1MMLA 3C4WA 1I94F 3HVAA 4GK5E 2CQHA 4P2FA 3MA9A 1WFDA 2CQPA 1YKEB 3GLJA 1RCXB 1RHKB 3B8HA 5LMUJ 4ICLA 1HL6A 4DUYT 2DISA 2RS2A 1RT5A 1KNZA 1MWZA 3T1YT 2E5VA 4E7ZA 5CJ5A 2CPFA 3OYZA 1UCNA 5CAAA 3MM9A 1VIOA 1Y9OA 3DRXA 1U49A 4YHHT 1Q95G 4DR3J 5DLGA 1PAEX 2YBVA 3RQUA 2ZOFA 2JLFA 1JXVA 4O4GB 2AX1A 2N4CA 1PG5B 2I9SA 2JWNA 3GJRB 2HKEA 2XS2A 2VFSA 2ZJRQ 4DV7T 3G96A 3PUYF 3CCUS 5DM7Q 1FFSB 1S6PB 3SCIE 2N7CA 1N0UA 4CH1A 1H2UX 2CXDA 3HK2A 1Q79A 1OEDC 4KYZA 2ZHOA 3WDOA 1K47A 3A8KA 2JMKA 3PJ9A 2HHTA 3MAAA 4ZVPB 3GTYX 2L08A 2CQ4A 3BGLA 3GJSB 5AJ3J 2BEFA 4B3RT 3H4BA 3FCHA 2MQ8A 1HQ2A 4X65J 3QZ8A 4KP3C 1AB8A 2DIVA 4DS5A 5FY1A 3Q8QB 3NGDA 4IH7A 4RZRA 5JDMA 2XC9A 5B08A 2I1RA 4RUHA 1FRHA 2R7WA 3KLHA 4USJC 4Q0BA 2ZDPA 3M32B 1VJWA 4JI2F 1BQNA 2F8MA 3GR0A 1GNKA 4I2QA 3FEXB 2K8GA 4ES3A 4PEOA 3NBXX 5E41A 4K8RA 2HRTA 5CD4H 3E0ZA 4FKYA 3QRQA 3F44A 3WX4A 3DDKA 1Z0PA 2BKNA 3RYIE 2UUTA 4HLBA 3GE9A 5LJ3Y 3VGSA 1IJ6A 5C2GA 3ZMTB 1YIJS 2GC8A 4X1KE 2LHRA 4RUBA 3DRRB 3M30A 2HFZA 4F8RA 3QT6A 1F60B 3TA2A 4Z2XA 3RX6A 3AEFA 2GMHA 4GC7A 4TQRA 5F9NA 1NSAA 1ZETA 5ETSA 5IOLA 4IL9A 2SPCA 4YS2A 4H9NC 1Z4UA 4TV8E 4WBNE 1GFWB 1LWCA 4UELA 2GIQA 1M1KT 1WR6A 1OWAA 3UT5E 2PSZA 2ZVSA 4K4VA 4JI8J 2IM0A 1X4GA 1WHYA 4F36A 5JXSA 1J5EJ 4YB1P 2HZVA 5A6PA 2P9BA 4KHPF 1U4QA 2J9DE 1CS4B 4RW8B 3BSOA 1T02A 2GVDA 1S1UB 3PFEA 4TV9E 2DCLA 4ECTA 1S4EA 3ET6B 9RUBA 1VK3A 4DR4J 4JBCA 4USTA 2F4VJ 5LOVE 1ZP0A 3UULA 2J9CA 1S94A 4LMKA 2HFNA 3UNGC 1ULRA 3CJRA 3VGTA 4Y2KA 2IHR1 4B3SF 4QX7B 4ZHQE 1V9OA 4FN5A 1NJXA 1RQ0A 1F2HA 2KYZA 3N2OA 2Q6CA 2DPIA 2N9DA 4ZHRA 1SC6A 4UOGA 2YKOA 4QU6A 3RC3A 3LGHA 2ZH2A 1T0TV 3E22E 4CZCA 1JNZA 3NP5A 3IP0A 4RBTA 1W0BA 2HGLA 2BW2A 2B9EA 2RE1A 5GAEI 4WPAA 3D1OA 1U5PA 4KX6A 3QFWA 4HEAA 3VZIA 3C50A 1AT1B 3HHLC 5I4MA 3KV9A 4I2PB 3ZNUA 4CN1A 2IY5B 1XBWA 3BYRA 1LNQA 4F7VA 4W90B 1NB7A 2IJFA 2WTFA 3A8JA 3NNCA 3K8PC 4HWDA 2MKCA 5AQLB 3AJDA 2DITA 4A8SA 5KFGA 4NCAA 3F31A 1C1CB 3CJSA 3FZLB 1L3VA 4PW8A 2HZCA 2IYIA 5AJ3F 3IEEA 4OK0A 3C15A 4O0IA 5J1GA 4GOUA 1D3WA 2HQ3A 4IDOA 4X65F 3IBPA 2IIHA 3F41A 4PABA 4YFUA 4ZOSA 4P72A 3UUXB 4AKIA 2ZH9A 5AXLA 3P4QA 4OHFA 1XMOJ 1APSA 3EPIA 4J9UE 1ZTTA 1N34T 1XWMA 3QK6A 4U8VA 3UN3A 3FXEB 2PFDA 2ZM6T 1UWBB 4ZI2D 2RILA 3L8RA 5AQVB 2EHOA 3FSXA 2WBMA 1UW4A 2LDYA 3EM1A 2JVOA 2CJQA 4OYPA 5J1NA 3RBEA 1TKZB 1S48A 4M63A 2I6HA 3BSAA 4AQYT 5D4PA 2IVYA 3ZT6A 1O51A 4IO1A 1WG4A 1XMQJ 5IZHA 2CQGA 1NK9A 5J1EA 3DGPB 2XSAA 4N78D 1LFPA 2KN4A 3VZHA 3D28A 2QEXS 3ZCIA 3I55S 3ENWA 2CPHA 4FBTA 2DK2A 2F63A 4EYHB 4C0OC 1RZMA 1GXTA 3D0GE 2JQQA 4HN9A 1ZZNA 1KQFB 4NCBA 3NRYA 1ZAWA 1RAOA 4IE4A 1GXUA 2YK0A 2XCAA 2Y0SD 3DLGB 2VQEJ 1S6QA 3HSDA 4WK3A 1VRUA 3AVRA 2W7OA 1VLYA 4P10A 3ZPOA 1YBTA 1QE1B 2Y6XA 2E29A 1FTRA 2BJ8A 2BG9C 2C5JA 3CNQP 3ENVA 4YY3T 4F3QA 3CC7S 2VK9A 4X2BA 4FBUA 1RU1A 1VGYA 4L3NA 2BBEA 3LK3B 4UEMA 2Y0BB 3HSZA 4TY9A 1C0UB 1TTHB 2AMCB 1S0OA 3LJCA 3KLFB 2R9LA 1HHTP 4UTGA 3NCRA 4DR4F 3LP2A 2QSWA 5LSLA 3RRCA 3UQ7A 2HRYA 2J0WA 1OSCA 1R0AB 3EPGA 5HLFA 1RWMB 2MTLA 1T9YA 3B4DA 1M90T 3RG6A 2V8PA 1HLWA 4ZMMA 4MFBA 2QA4S 4WE1B 2D0UA 4B3MJ 2FJXA 3FZFB 4LSNA 4N5SA 5ETTA 4JB8B 3PX6A 2RP4A 3WC0A 3FEYB 4HT5A 1WF1A 4IFYB 4CLLA 4TU8A 4KV8B 2J9EA 4KPYA 3Q22A 3RPUA 4QX8B 2ZDOA 4WKRA 3K57A 3RB6A 5EK4A 4IG0B 5L2LA 4H4OA 2HNYA 4KKOB 4AXJA 2HNDA 2DY9A 3QOFA 4YTPA 4NRTA 3CD0A 5LMUT 2VVSA 2I0MA 1RLCL 2V7LA 4FVCA 3EGNA 3D6MB 4OZLA 4USHA 5F8LA 5AXKA 3OFFA 4ZKAA 2EK1A 5TAOA 1KVKA 4WK1A 3O6QA 4JI3F 5L38A 4LF7T 2E5GA 2VVNA 3RR7A 3OL8A 3CC4S 5A8RA 4DR3T 2WCAA 2G1HA 4TZ4C 3E08A 4N41A 3NRBA 4L72B 1VQOS 2LVWA 2CA5A 1LV5A 2XS7A 1HR0F 1XMOF 1MIYA 2BW7A 4YB7A 2M6IA 2MB0B 5LG3A 3CMES 4FF1A 4IHJE 2NOXA 5L39A 3BF4A 3OW2R 2BRKA 2V7MA 3DP7A 1UMJA 5IT0A 3TZZA 2KWHA 4CI1B 1ZPVA 3N9LA 1S6OA 5HXCA 3I9YA 1ZM9A 2OPRA 3MM6A 4KFBB 1FNOA 3TZXA 3OLBA 3ZZRA 5BR8T 5GAHU 1X5TA 4X84A 2KZ7B 2R2RA 1F0XA 5C5JA 2B3TB 2RF2A 2AYEA 3NGTA 4JI5T 1DLOA 4DMZA 4I1TA 1TELA 4RU2A 1XMQF 2QYGA 4CCHA 2D1CA 1SJ4P 1TK8A 4PRFA 4GKKJ 1H2VZ 1K1SA 2J6TA 2AF6A 1U09A 2FHJD 1S9EA 5LM7E 4ANDA 2BOAA 1NDCA 4LSLA 2W9BA 1PYSB 1FJCA 2X7IA 4LF6J 3GIRA 2JQ9A 3DLKB 3UNYA 3O44A 4KO0B 3HZGA 4DCJB 4K2JA 2CEAA 1U6FA 3RHWA 2MJUA 3AY0A 1D09B 1GX5A 2VDIA 3N28A 3N2KE 2BQRA 2D74B 3V6DB 3HM9A 5GADI 1VRQC 3VQSA 2QO3A 3PFOA 1M5HA 2V5HG 1HIYA 3QO9A 3ZZ0A 3GWCA 4G63A 2GGPB 3H2LA 1JLBA 1YD8G 2OD4A 4K4WA 3H90A 4O4IE 1SKSA 4TWHA 2Z2ZA 4ERRA 4B9LA 2ZD1A 1F2GA 2J0SD 2VKDA 5KT2A 4JV5J 4WW0A 1QUPA 4O3PA 4DCOB 4DSKA 3AA7B 2V8HA 4FYYB 2NXCA 1VQPS 5KT7A 1N36T 1RWVB 3ULHA 4K4UA 4C2MA 1RABB 2IM1A 1IM4A 1KLNA 4U31A 2IC3A 2GHPA 2XZTB 3C6UB 1WHWA 5IT4A 2HHSA 4NXMJ 3T1YF 4EO6A 1HARA 4QWEA 3BV8A 4OHYA 4LR9A 1JLGA 1NSQA 3KLIA 4WWSA 4F4YA 4I6AA 3R5GA 1OEDA 3AXMA 4USKA 3TKLB 3ZZUA 4JI8T 4YT0A 3EGVA 1BD6A 4F2SA 3AXJA 1JJHA 1C0TA 4M5JA 4IQMA 1J5ET 2B8QA 4ZXLA 2OEMA 2IM2A 1TK5A 1H7WA 4BS2A 2CQ1A 4IG3A 4LF5J 3JYTB 2W0GA 5A0YA 2KWIB 4CLZA 1UKUA 4K7QA 4PUOB 3GCWP 4A47A 5A8WB 4WIIA 3FFIB 3TUZC 4Q2LA 1KQGB 1N5VA 1SV5A 1W7WA 5D15A 4X4PA 2PN6A 2ZBQA 2CNLB 2BDEA 2X67A 1KWMA 4EYIB 4E0DA 3TAQA 3P3DA 4LMZA 3IAS9 2LSGA 1TL4A 3ZSSA 3W65A 2HAIA 3M8SA 3K59A 4F4KA 1RBAA 2F65A 5HK4A 1OIAA 4NCGA 1R7IA 3JSRA 1U26A 4DU8A 1X0FA 1LWFA 5HXHA 4TY8A 4AXIA 5CYMA 2KFZA 1A9NB 1WDDA 4CQ1A 3D6FB 5HEJA 1ZKEA 3I82A 3BPDA 5F9LA 1M5OC 1Y64B 2XPKA 1VK8A 3H8YA 2EC2A 2VURA 2ZH6A 4EEBA 3U7JA 1RTJB 1XNQJ 5HN0A 3N9MA 3I5CA 2QE5A 3IRXA 2XJ7A 2KXPB 3J7Z5 1CJUB 4GKKF 4MAKA 1S0VA 4DSEA 2YKQA 4ZCIA 2G13A 4YB6A 3R3TA 4DG1A 2Z6EA 2QA1A 4LF6F 5HROB 3VTIA 1IBCB 3K89A 1KLMA 3ONLC 1YRXA 2Z4PA 2ZKUA 3AJ1A 3Q86A 3NGUA 3CCZA 3O9XA 3M2UA 1X5OA 3RUBL 3K3OA 4DV2J 2YTCA 2YPZA 4TYBA 2B43A 4LRBA 3CQGB 5HO4A 4KJIA 2W24A 4GC6A 4C8OA 2I38A 2JOQA 3NNAA 1FKOB 3TQEA 4K4TA 4Q5VA 1S1XB 1Q8KA 3UPFA 3PUAA 1DARA 1U6BA 2DRAA 1UAWA 4ECRA 2ZEJA 5ETLA 4K50A 4M5NA 2KNDA 2IVFB 2Q1LA 4JV5F 1KK7A 4M5DB 2LXIA 2WDQA 3HFKA 3FZKB 5K20B 4PAGA 4DR7J 5LGUB 4HFCA 1F3FA 2R2UA 4NLSA 3FKBA 3PM9A 5HEHA 3M6UA 4DPWA 5KFEA 1SB6A 1ZM2A 2H65B 4NXMF 3RJMB 3CJKB 3P4RA 1YJNS 1IKWA 2OHDA 3EGWB 1CJKB 5K9FA 4LF4T 3ILIA 4ECQA 3K8VA 2NW8A 2WVCA 3PJAJ 4WP3A 2AIRB 3W2VB 1X5PA 4OIXA 1U2FA 4ZVQB 3RZAA 4EZ4A 4PR6A 1FD8A 2NZ4A 1B0VA 4P9SA 3N5FA 5H1SV 1VYAA 2HURA 1RTDA 5KOXA 1CULA 2DI4A 2JX2A 4F26A 1IM6A 3R2DJ 3JAFA 3N79A 3OL6A 3MECB 4H63V 3GG1A 1FKAF 2D3OR 2JJ9A 1Y3JA 3E51A 2J1DG 1RE1B 1DJ0A 3U1MA 1KOHA 3PW0A 2XNQA 1X5SA 4FYXB 1WR0A 1S5ZA 3GB0A 3MI7X 2CVEA 3PRVA 3SV4A 3TARA 5K5MA 3UVJB 5A2QU 5E3QA 5L3EB 4WP8A 4ED4A 4RW4B 4ITSA 4B3MT 2HPJA 3BN7A 1FRXA 2J6UA 1F9HA 4KH1B 2P5VA 1FJ7A 2ZWPA 3HSJA 3K3NA 3EDRB 2PMHA 1ZTWA 2LSYA 2BRLA 1S99A 4IR1A 4PWUA 1BUXA 3HXMA 5AQNB 2GQ2A 2CPIA 2L41A 3CJ2A 3PUSA 1XR5A 2IC9A 4TN2A 4AQFC 3BZQA 2CWOA 5KG1A 2FJBA 5L4EA 3QIPA 3RYFE 3NXZA 3LP0A 2N7YA 2P2CB 4LF9J 3DRSA 4NI2A 3J81j 2UU9J 2HHVA 2E1CA 3HVTA 4ZPWR 2YQ1A 2EW9A 3KLGA 4LJMA 3TQ1A 3KNGA 1XNQF 1GMWA 4B9SA 2BJ7A 5FIIA 1EQ0A 2C2NA 2IVMA 3VR9A 4RNOA 4K4SA 3QMQA 5EX3A 1TL7B 1WSVA 2YU2A 2VA3A 2LU2A 2VBZA 4DL2A 2FUPA 2CPTA 2AE9A 2CCQA 5SZTA 2XSFA 1KP6A 4TNOA 1AZSA 3MKDA 3ZYMA 4YEAA 1KKHA 3NKYA 3NGSA 1U0SA 2LFVA 2IMLA 4C8NA 3DRYA 4NLXA 3AA9A 3IMQJ 4PKDB 2N3LA 2CPZA 4PG6A 1JLCA 2DEJA 4LMLA 2GS8A 2YEVC 2U2FA 3JADA 2NTYA 1W9RA 5LA6E 5J2TE 4DN9A 5EHHA 3DOMB 3OTEA 4DQQA 2IDLA 3KLEA 1WG5A 3GYNA 3JQKA 3RYHE 3FUYA 2HHHT 3W7BA 4JI0F 3C98B 4D3HA 3RIUC 2YNHB 4Q43A 4PWDB 4TQSA 2RB7A 2CAJA 4NA1A 1DQ9A 2GQCA 3TA1A 4W92B 3KDNA 3CD5A 2QRRA 1R27B 4LUBA 1TU0B 1CHUA 1AJ3A 2J5AA 5DDPC 4I6YA 4O4RA 3OL9A 4OHZA 4DJBA 2EWHA 3CC2S 2VL8A 3THPA 1NK7A 5IT9U 1RWKB 2BE2B 5C25A 4DV5J 1WC4A 4W4MA 3G82A 5E0OA 5FL1A 4O44A 4EK2A 2MQPA 3UDLA 5E3AA 2RPAA 3VALA 2DBBA 4O2BE 1S57A 3HT3A 1N56A 3A8YC 4R5PB 3THVA 2YXLA 4C97A 3CK6A 4UY8T 2CJYB 1FX4A 2XTLA 4YLHA 3DYAA 3TYTA 3DOLB 2H7VC 4C6AA 3D3CJ 2I5JB 2XQ6A 4ZI7E 4ILCA 2HQFA 3KUHA 5CGMA 3R1HA 3KUEA 5KFNA 3C3LA 2PGCA 2C2OB 2EG1A 4KE5A 4CYUA 2JL9A 3KJQB 2OIHA 1KEYA 3ISND 3IR5B 4HFHA 4GIWA 2V8GA 4M5IA 1ZH5A 1OEDE 2JRSA 3U3IA 3J81Y 3DU6A 4Q8FA 2CA9A 2LEHA 1GK8A 4AISA 1RT7B 2AJQA 1XR6A 2OV9A 2H3EB 5J2PA 5DG9A 2AX0A 4B08A 2OPSB 4DV3T 4OZ3A 4XDDA 4USIA 2Y1IA 1BQMB 1WC6A 2V2VA 5L1KA 2IRUA 4I4TE 1PJ7A 5HYAA 3Q9DA 2V63A 4B9TA 2M88A 2AJ1A 2XMKA 1D1BA 5IM0A 1D9AA 1NB2A 3M2VA 1PAUB 5K8PA 4ECXA 3HZEA 5DETA 4JI4T 3EXCX 1VQYA 4LF7F 2X0HA 2B9WA 3DM2A 4H4MA 3UFGA 4WKYA 2QMWA 2DO4A 4Z37A 1MU2B 1RYSA 2E9RX 3L39A 2F8HA 4WJBA 2KT5A 1N33T 4OYOA 5KFMA 4WBOA 3FRZA 4OLOA 5K8MA 2PFVA 5AQUB 2D9OA 5A1LA 1RHQB 3FC9A 3KNAA 2DXEA 2DGUA 1RT5B 4LF9F 3MUVP 2C3YA 4DVDA 2Z0GA 3MM9B 3BPSP 5ABFB 1WUUA 2LEBA 1WC1A 3Q23A 1R3NA 1SJQA 4Y3CA 5FMNA 4KHMA 5BR8F 3P4WA 2OPPA 4TXSA 5AE3A 4YOEA 5F3ZA 2KRBA 4FVMA 3K5MA 2J0XA 2P9EA 1PKUA 4K5RA 2G2YA 2LT3A 4WXWA 5IQQA 4N8NA 3MEGA 1YXRA 3RBXA 4CXWA 4QCLA 4IIJE 4A8MP 6FD1A 1N48A 3PHTA 4GYSA 1NK4A 3RI5A 4F4WA 2CLYC 2V7IA 2HHWA 3FBEA 3IG1A 1Y7PA 2YH1A 3FMWA 5L1IA 3LDQB 1EP4A 4ZP7A 4OJ3A 3IS9A 1HBUB 2XY6A 4ECVA 3K8WA 3SDEB 3RRGA 4DV1J 1XN9A 2RDIA 1B3TA 1HTJF 3ETOA 2E9XC 2X9HA 5D4NA 3N9PA 2FJAA 4OMFG 3PJXA 2X3GA 4EBEA 2CQDA 1H6KX 1I3OB 4ES2A 4JYAJ 5GAGI 4DR1T 4USMA 4P7VA 4TX5A 4O3RA 2RKIA 1VHIA 4RW9B 4DV5F 4K0KJ 1IUJA 3KLHB 3GV7B 4RUCA 5CABA 3KJVA 3A5XA 4HTJA 5DDRC 1DHMA 2HGMA 4CI0B 2RNEA 1IKVB 4PWWA 3SBMA 4DUZJ 5B0GA 2LKZA 4I2QB 4A8WA 1NDPA 2DWGA 2B8PA 4OV1A 1M7KA 3FNNA 2MQLA 5AXMA 4HFDA 3SZ2A 1I5OB 1Y3KA 2MY7A 3LH2S 4KHZF 1RISA 2DR6A 4HHHA 3V2UC 3KXDA 5DQGA 1DTTA 5KG6A 4OZNA 3P8BB 4IRKA 1R89A 2WSFC 3FCVA 4AFFA 1U45A 1FFWB 3PX4A 5CCLA 3MDFA 3THTA 4C0HA 3M30B 2Y1RI 2DL1A 4Y2CA 1LWEB 4IE6A 2PMZD 4ZK7M 2R7VA 3JTOA 1RHUB 1RT6A 2X9WA 3BBCA 3QJJA 2H4WB 1HNZT 4IQXA 1IJEB 1LWCB 4LR8A 3KJNB 3S7RA 3SI8A 2BS2A 2B4UA 1I6JA 4QWDA 4IH6A 4ZCLA 2I8EA 4RW7A 5F41A 4LQ3A 5HL7Q 3F73A 4NA2A 3CJ8A 4ZZBA 5C42A 2FY8A 3KG1A 1SUQA 4JOUA 2YKPA 3US5A 4JEUB 3CJ5A 3QAEA 1TKTA 4J7CA 4B9NA 1AYEA 5G0RB 4V1Ak 3X1DA 3P4SA 3BGRA 3EVOA 5H6RB 1OQ6A 3AFGA 4U9RA 3H7HB 2JEIA 3AE9A 2D9PA 2HNZB 3CPWR 4O23A 1NK6A 2X1GA 2V8SV 1EX8A 4YN3B 3TZWA 2YDQA 1GQEA 1QAIA 4M5KA 3TVKA 3C6TA 2VFTA 5IV3A 4ZHRB 4H9SE 1IBMT 3PZPA 5LHHB 2CNKB 3RB0A 1RAGB 5L1LA 4ALZA 2M8DB 1UA0A 1JNZB 1N5TA 2OO4A 4WYWA 2EC0A 3PW4A 4Y34A 2HK2A 3NGRA 5GAEU 1FMWA 4UV9B 3H98A 2NXJA 3PIOQ 1RK8A 1FE0A 2KKHA 3AB2B 4CLSA 4ECYA 2ZUAA 4WZXA 1OY9A 2QMUB 4W98A 2FY1A 3GPAA 2J8SA 2OFHX 4KT0C 4ZVRB 4P0AA 1S1TA 1UURA 4JV1A 2BG9E 3LBXA 2DNHA 1T9VA 3MM5A 3MPUB 2VPWB 1LKXA 4CTAB 3EJMA 2KSRA 4WYVA 3AE6A 4DV0J 3FGVA 1JLQA 4CO4A 1ACMB 2HBRB 5FVKA 2WOMA 4ZS2A 3GN5B 1O3XA 4BBYA 2DNNA 3KOAA 5T7LB 2IDOB 3V4IA 1YRTA 4MKVA 2VG7A 3PUGA 3DLBA 5IWAT 3W15B 1LVFA 3SMZA 3ZXWA 3CO9A 3KK3A 4DUZF 1K1QA 3ETMA 4QIGA 2G0UA 4ECZA 1TMJA 2ALZA 1OS5A 5E33A 1JJ2R 1NKBA 4LF4F 2R8JA 4K5SA 5E3PA 4CM2A 3CDAA 2POKA 2OKQA 3M8ZA 2XZDB 4IGUA 4ELTA 2LQ9A 2JC0A 4PJLA 3NBPA 4X4QA 2MZQA 5HAXA 2MMYA 3Q83A 4ETXA 1QLBA 1DZ5A 2ZJPQ 2PTFA 2YN6A 4WTYA 1MSWD 4DSIA 3FDSA 2JJ4D 1Y01A 3C16A 1I6ZA 2ODUA 3ZYLA 1ZS6A 1JXEA 4B9VA 5THWA 4CH0S 1N5YB 1FA0A 1HHQA 5KT5A 4P1NA 3C14A 1S6QB 3LPEA 1VRUB 3SCKE 5LHIB 1IBKT 1EZ3A 1HWKA 3I56S 4AQFA 3AE8A 3V4MA 4NYPA 2JLGA 4CO0A 3CJTA 1RA6A 2K1RA 1J5WA 2A3DA 3ZNJ1 1FEHA 1NMEB 3CTRA 4OI4A 2B0GA 2XI3A 4I7FA 4B17A 1EETA 1Y5NB 7FDRA 4I0UA 3QIDA 2PBIA 3PKMA 4EYUA 2ZHAA 4F6RC 3AOCA 4DO0A 3JSYA 2EG2A 3JQMA 3ILOA 4QQBA 3MMCB 3P5BP 3SSSA 4ED0A 1RADB 3SSQA 4MFBB 4BWJA 1T9UA 2MYSA 4MIBA 5K8NA 1W0AA 3GU0A 2ROPA 1IQZA 4LIWA 3HKCE 1S76D 1N0VC 4IDKB 2DJWA 1UVKA 4OX9T 4WU2A 1AFJA 1G4CA 2XWYA 4ZA1A 3N5LA 1H0HB 4GRSA 1YX2A 2HBZB 4CLFA 2BXJA 3BSCA 2K06A 2LXUA 2H1YA 1B7YB 3RBZA 3AEAA 3VAHA 1X9SA 5LGTB 4H4OB 2EPIA 1N6QA 2WZHA 2FHMA 2M0GB 2PO4A 2FJDA 4P0BA 3CJ0A 4HDHA 1S0MA 1KTVA 2FVRA 1QSLA 3F2EA 2LOPA 1NU4A 2K3KA 1D1UA 2ATLA 5L47A 4C11A 3TEGA 3L9ZA 1SC1B 4IKAA 3LP1A 3IWNC 2VQFJ 2KL8A 2HHHF 2UXDJ 4JEHB 2CWYA 5A8RB 3M1VA 1OPZA 4QU7A 3SFGA 4PK5A 4LF8J 2VOPA 1FEEA 4O4LE 3H25A 4DV0F 4X66J 4RNMA 1VQ9S 4NYZA 1HMVB 1IXKA 1KNRA 1RYRA 4WIQA 3LQVA 4LMJA 3UUNA 3Q5XA 5J1PA 1Q4RA 4KSEB 2VKOA 2HZAA 4RNHA 2UXBT 2N82B 4NE9C 3OT9A 2ERRA 1H38A 3ZTSA 4C4WA 2F9JA 2DXDA 4CI2B 3AQPA 5JR9A 3EGZA 4I67A 3BGFA 2OPRB 3MM6B 2R7TA 4ID5A 2IMWP 4OX7A 4ED6A 4URGA 4ZDNA 2IW5B 4USWA 3JCFA 3TP2A 1RKJA 2BVLA 3LSVA 2W4XA 3IRWP 1B7FA 2CHNA 3P50A 2RF2B 3VF0B 3R5AA 5AQOB 3C8YA 4NUUA 1FWKA 2ZWOA 3MEEA 1NPPA 1YBAA 2RAQA 2DGSA 5L9NA 1DAXA 3AA6B 2G9OA 3N4WA 3CJQA 4HH0A 4UVCB 1WDTA 3SFEA 2ZJQQ 1RWPB 1FJGJ 2R8HA 2XQCA 4DFMA 2ZZMA 4NWBA 1U24A 5KX5E 1E6YA 2BACA 3S8SA 3DGVA 2QLWA 4GVBA 3FBZA 4M5HA 5HXEA 1EHWA 2LM2A 4DV3F 4DR2T 4RJVA 5L3DB 2WQYA 4YTNA 2YDSA 1VRTA 5GADU 4KC5A 4IFVB 4M5GA 3QO9B 1UP1A 2V4JA 3MPYA 5LCYA 3MMAA 2JEJA 3LF0A 4JI1T 1UWAA 2DNKA 4C9DA 1WCRA 4JI4F 3D9BA 1O5JA 2EFVA 4A97A 2ZD1B 3W1YC 4AYBD 3K5NA 4YXDA 5JDLA 2NPFA 2PD1A 5IS2A 2B76A 2VIHA 2W8LA 2UUAJ 4IUFA 4U95A 2ODVA 3N9QA 3AOAA 4DHVA 3CCTA 1SJ1A 4M5LA 2LHNA 4QYZJ 1SI9A 3OV7A 1R43A 3AE1A 4UT4A 2H3RA 1SIWB 3AEDA 4XDCA 1VRBA 4UZBA 1JLGB 2X0LB 1Q5VA 4HACB 2NR4A 4G65A 1OEDB 5LHGB 4P2SA 1S1WA 1CJTB 3HI2A 2L3LA 4J9MA 1C0TB 1N5QA 1XNRT 5DO2A 1YTYA 2HFSA 3ZT5A 3A1YG 1W09A 4GYRA 4CH7A 1MG7A 1Z2ZA 4CLYA 2CQ3A 3HHKA 4X64F 3TLTA 4IG3B 4ZN3A 1LXNA 1GTHA 4EU0A 5A0YB 5KFAA 3RB3A 4A8QA 4MYUA 1FNMA 1PYOB 3KK1B 4C90A 4NLUA 4EIWA 2E9XA 3I9WA 3EVWA 5J2QA 1AW0A 3D67A 1T7SA 4ZPAA 3EZOA 4KGKA 1V3SA 2JPFA 2CG8A 1UEVA 4K4XA 5F3TA 2EFQA 3Q8YA 1TL1A 3KK2A 1T7PA 3WC2A 1LRZA 5LMNT 3LK42 2AXDS 1UFLA 2VQFF 3AD8C 2FLOA 4XTTA 1LXJA 1JK9B 3CMLA 3NRXA 1FO1A 2H4YB 3GZ7A 3K17A 4NCGB 5H6QB 2QVAA 1LWFB 2E44A 2KJWA 4TY8B 3JSMB 5CYMB 2ZH3A 2V69A 1SH0A 4DR1F 3V5RA 5FL0A 4DLGA 3VAIA 3RTVA 3UD4P 2CXLA 3W2WA 1HWIA 3DI6B 5CXTA 2GX8A 3ZMVB 3CCVS 1OO0B 4LR7A 3MXHP 1W25A 4LBIA 2VJUA 1U2RA 2W66A 2FUG9 3M9NB 3GMIA 3VKHA 2BVMA 1VQ5S 2DNOA 3V6JA 5CA0E 2KB2A 2YWEA 2E5LJ 3EMTA 2LEAA 2BKPA 1QTNB 2DYAA 3GR1A 3T3FA 3IRXB 3QSIA 5HBMA 2WMNA 1W2IA 5FXWA 1KHWA 1JKHA 1XZYA 2HBYB 4N56A 2P9CA 1WC5A 1GMUA 3O1LA 2RQ4A 1RI7A 3HD1A 1FJGF 1KLMB 4C8ZA 1RB0A 4ANCA 3VAJA 4DV6T 4NLVA 4C8YA 3M2UB 2FIUA 3QLHA 2VBWA 1Q7YT 2CQ2A 1RU2A 2D3UA 3UU5A 3PV8A 3QT7A 1FKPB 3UTKA 5HAOA 5AE1A 2CJXB 2JEFA 3I0QA 2GJIA 3OR2A 3QWPA 3WQPA 3CX7B 2DXFA 1KD1T 3WBZA 4FPIA 2C1EB 1NSKL 2RH3A 3CF5Q 4I43B 2IAJB 2BS4A 2AHOB 1KOOA 1G73A 2A1BA 2B56A 3O2IA 3KHLA 1UFKA 2CNNB 2UUAF 4OLPA 3UI3A 4CLWA 1B0PA 3Q0AA 4UY85 1WYBA 3OBVE 4LFCJ 3AEBA 3W8GA 4CT8A 5FNVE 4Z7YA 2GV1A 2R8IA 4DR5T 2QMXA 2C2KB 4KPCA 1WNEA 5BXIA 2XHWA 1GT8A 3TEHB 4ZCMA 1A0OB 3FSIA 1ZOTA 3HHLB 2EHOC 3PW7A 1SCJB 5IQ6A 1HNWJ 2ZH5A 2MHEA 2MYFA 3DOKB 4UV8B 3QRPA 2QGFB 2KFYA 2Q9QC 2PI4A 2JFDA 1HI1A 5M4YA 1HS7A 1DTQA 2LSIA 5CYJA 2RS8A 5EUHA 4WYLA 5B7WA 2C28A 1Q0NA 2QV6A 2J8AA 5JDQA 4M8LA 2I0XA 2RDDA 3QQCD 2ZH4A 4GO5X 4JI7T 1NK0A 2AJ0A 2HEKA 2MKSA 3MR5A 2LP4A 4UQTA 4DF4A 1R8AA 3PV0F 3F0NA 4C91A 1VHFA 4NX9A 1REGX 3FBFA 4OJGA 1N32T 3I5AA 1F9FA 1QSSA 2KINB 1JX4A 3DLEB 4U7YA 3QC9A 3N5BA 4RX6A 1PC5A 2GZOA 3SWHA 5DZ7A 3VHQA 2ROEA 3HDSA 4Y28C 2MLZA 2QN6B 1VC5A 3OXGA 4QIVA 5MLCV 1YJTA 3DXSX 5KDMC 6AT1B 2C2MB 1NJWA 3SS1A 2KT9A 3ESLA 2FJBB 3QIPB 2HVZA 4A8OA 2O66A 2HIQA 3LP0B 5U47A 2C22A 4PG4A 1FFGB 3DRSB 4NI2B 3CUNA 1CC8A 1VLOA 2OLTA 4B3TT 2KXNB 2NUHA 2ZH7A 3HVTB 5KFZA 2W61A 3KLGB 3OSNA 1VBYA 1VBXA 2DNXA 2RVJA 1O0PA 3R5BA 1YWXA 1NAFA 4YR0A 4J37A 5J2MB 3CIZA 1HCIA 4TU9A 4C0BA 3MFIA 4LFAJ 5F8JA 2HVHA 4S0MA 4LF8T 4F0HA 1NO8A 4DUTA 4X66T 1FRIA 4ZVOB 4PJJA 1TQLA 3AAEB 1LK5A 3Q8VA 2ZC3A 3FBBA 3MM7B 2ZC4A 4DV4F 1QJHA 1RWWB 2BG9B 2DNPA 4NZ7A 4A8FA 1EKSA 1JLCB 5DQVA 3M32A 4ANEA 2ZBPA 4D3GA 5AQTB 1BQXA 2V4RA 5HJXA 2NSBA 5DQWA 4TVAB 3KLEB 1HX8A 1FHTA 5L8RC 5HQLA 2F40A 1B64A 2DD8S 2UVVA 3VKGA 1ZM3A 4DX8H 3KDSE 1PO6A 3NWGA 5F5WA 2AWZA 2F8EX 4ECSA 3EZ5A 4NXNJ 2XM1A 1DFDA 3DFEA 2W2PP 1UPPA 4ILMA 4DL5A 4LFBJ 4GVLA 5CCMA 3FQKA 3V6HA 2DHXA 3HLUA 1RTHB 2W7AA 5D0HA 4WCEQ 5LYJE 5C25B 5KFLA 2QA4G 2QTWA 1S9GB 2V67A 1WOOA 3G82B 1UZDA 4PQUB 3OTOT 2MAWA 3L4BC 2LKHA 1VBZA 4OI0A 3D0HE 1T95A 2FHOB 2LMIA 4UVBB 2MBGA 5IFMA 3BH6B 1N4LA 2X9YA 2HLTA 3PUWF 4YSYA 3T6BA 2AYGA 5A76A 2A18A 2DIUA 1U4BA 4FYDA 3MM8B 3CB4A 2BUNA 4ID8A 3D7SB 2ZOMA 1D9FA 1IR0A 2XY7A 3DLJA 2V1DB 2W9CB 1IN0A 1FD2A 3CJ3A 5KFVA 3TJAA 2VKZG 1CS4A 4RW8A 4I68A 4N76A 1S1UA 3PRDA 4OZ5A 1WEXA 4YQWA 5AQIB 2O67A 5F8GA 1NXIA 2AYMA 5FLXY 4OHXA 3WIUA 3OLAA 2LKGA 3MMJA 3BO4A 3SIPB 3LALA 4F50A 5F0WA 2KG1A 5JDHA 2FC8A 2CFXA 4KGMA 4KR0B 2DHGA 3CXCR 1H72C 5IM0B 4KHPJ 4WZQA 2ES0A 2X66A 3U27A 4OI2A 3M6VA 2GCFA 4H4MB 1D0XA 3FB2A 1YQHA 2HHQA 4OHWA 5FXXA 1TV6A 3QNWB 4RW6A 2KVQE 2V5DA 3TJ9A 4DLEA 4EGWA 5H9FK 2UUCT 2EFOA 1HA1A 3OR1B 1TP7A 2W63A 4I2PA 5CYQB 1MMGA 3MCNA 3T1HJ 1GXLA 4IRCA 2NYHA 2RJZA 4B3SJ 4IDZA 1UW9A 1REVB 5IUXA 4PYDA 4UVAB 5L4HA 4C3MA 4KTQA 1NDLA 3NLCA 3CD7A 3CDWA 4AL5A 1TR0A 5ETKA 2RDJA 1UVNA 4OFZA 3IA3A 2XQ8A 4AUKA 4OQJA 1HNXJ 1TUVA 3K5PA 1VS3A 2KDOA 3RAQA 2J4GA 2ACZA 2G2OA 3Q2TC 5C3JA 4LFAF 3R9LA 2UXCT 1ZAXA 2AGOA 1M0SA 1IBLJ 1SIZA 4NLQA 2XAQB 1K0VA 3P4UB 3AE3A 2M3DA 2VB6A 3T9NA 3IN5A 3FBCA 5F8NA 4TLQA 2XMAA 2YX7A 4ER8A 4UIGA 3M8PA 2BANB 5JMNA 3NOGA 1UWBA 3P45B 3W66A 4TKTA 3KTQA 4TU7A 5M2RA 1OMSA 2NQPA 2HQDA 3D68A 4X5TA 3IS9B 1Q86T 1JLAB 4H9RC 1IR2A 3BO3A 2K5BB 3ZTOA 3FRYA 1TKZA 4RLEA 2YKNA 2BS3A 2AEJA 1U2CA 2C3PA 4FF2A 2DH8A 3A8IA 3J80Y 1T3OA 2JDJA 1GH8A 2V68A 1LW0B 3HX9A 1M5VC 4JI1F 2KT2A 4RU9A 4NXNF 4A56A 4HHJA 1S12A 3OUYB 3T41A 1RKIA 4LFBF 5GAGU 4YJ2E 3A3OB 1KNPA 3OVAA 4Y0FA 5JTGA 4U2ZA 4YSXA 3CCMS 1XQIA 4YDDB 3TLVA 4DPUA 1UCUA 1JB0C 3H5YA 2G0CA 2DNLA 1K8AT 2OD6A 2VL1A 3M8WA 4G1QB 3N9OA 4M5MA 1WYCA 1RHJB 2OTLS 2JC1A 1WEYA 4JI6T 2MXYA 2BJ1A 3DMJA 3Q8RB 3RC8A 2F1FA 1EARA 3PE0A 1U1MA 1U8SA 3KWMA 5KMGP 1S1VB 1RXOB 1HQUB 4O2AE 3U78A 3WHIA 2YOEA 3VGUA 1N8RT 3C4XA 2DTJA 3A3NB 1X4HA 1XC9A 3RR8A 1T05A 1PGZA 1RT6B 3KMQA 2H89A 2M6BA 3RAXA 1NENA 4QR0A 4LFCT 4X4VA 4TUYE 3R7NB 1FIOA 3SYZA 1T11A 3KVBA 2J6SA 2VODA 4EI2A 1HKAA 2R7XA 4CDIA 2V9WA 3KG0A 2IJRA 3VVUA 1SJFA 2B4PA 3H2VE 4DL0C 4RW7B 1NLKL 3ADAC 4CNZA 3ETVA 2FC9A 2R7RA 3JTNA 5C42B 4DL3A 1W2BR 1SUQB 1DQ8A 4V19X 4KY3A 5M2PA 4XIUA 1S9FA 4GKJJ 2VA2A 3BGUA 1R8IA 2RD5C 3NMRA 2ZLYA 5JDGA 4WFXA 1X4FA 4KKOA 3ZMZB 3UW1A 4NLTA 3MAQA 3T1HF 2XM2A 3TAMB 2CADA 2DY1A 4A8YA 2MZ1A 4WFNQ 2J62A 3D4JA 1V5IB 1F9EB 2XHCA 3IHRA 4DBRA 2L9DA 4ZVSB 4X62T 1MIWA 3ICLA 2MKKA 2LRLA 1B70B 3M2RA 1WRDA 3HVWA 3RGLA 1HNXF 2GJ2A 3CSKA 3C6TB 1BY9A 4EV6A 2DR8A 1PILA 1N54B 3J7AN 3OFGA 1I94T 4O3SA 3RKOA 2HGNA 1IBLF 3KHGA 5KFXA 5C2TA 2UXXB 5C8YE 4PYAA 3CT9A 2NW7A 4E8UA 3CCSS 5I3UA 3MCSA 3CO0P 2Q79A 4IE5A 1HBMB 1WACA 3UR3C 3R7SB 4ZPVR 2XZEA 5HVGA 3FZBA 4KMCA 4JI3J 3CVRA 5H9EK 7FD1A 1OYEA 3FXDB 2XMMA 3HKZD 3GIKA 4XPCA 1HR0J 1T98A 2HQIA 3J81U 1S10A 1QDUB 4TNWA 2CQBA 1YQ4A 2CE7A 4I64A 2WOMB 4DWIA 4CQIA 5IV4A 1T03B 4ERDA 2XEXA 3WIVA 3CGIA 4LF1A 3PYGA 5KFRA 3EWGA 1UL3A 3PXGa 4WFZA 3DLKA 2CDRB 4FNIA 5CH7B 2VFRA 3V4IB 3FZ2A 5ABHA 4NYOA 2EKNA 3CVKA 2Q9QA 3HT0A 5BJRA 5CZXA 3KK3B 1HFEL 1WORA 2H88A 5EWGA 2NCKL 5HCJA 4DR5F 2VG5A 1TVRA 3Q5EA 3CIMA 3LAKA 3PACA 2DGQA 3G87A 5EGYA 1NNDA 3POTA 1CBKA 4KHRA 5CD4A 3MPWA 3R8YA 5RUBA 2XQ5A 3TAPA 3RYCE 4NLGA 4DR6J 4XBFB 2K3WA 4R25A 2BBJA 2KMFA 5F8IA 3H3AA 3I1AA 2UUBJ 3BBBA 2IDEA 4MHCA 1Q8LA 4OX6A 4DQPA 3P8CD 4JI2T 1FESA 2Y3YA 3HI9A 3D2WA 2JFKA 3C6UA 4FXVA 3UN5A 2OAUA 3HF5A 5DJQC 2ACYA 5DZ6A 1VJQA 3C14B 1MMDA 2FLPA 1XR7A 4HYKA 4U72A 4JI7F 4UUXA 1BLUA 5HMXA 3TANA 1RP5A 1HWJA 4L3KA 2MKYA 4U6PA 4PXBA 4WTOB 2WONA 4F8HA 2OP5A 3ISZA 2B1EA 3CIRA 1AUSL 5EX0A 5IHYA 1X9WA 5I42B 3OVUA 2VF3A 2K1RB 1ZEEA 4DQIA 4GKJF 4F67A 2ZKTA 2QGSA 1NJYA 1EETB 2K7KA 2ZZNA 5LNKA 4NLDA 4PUOA 3J7Yq 5A8WA 5L1JA 3MD3A 2YQ3A 1FDBA 5L3GB 3MZKB 4HWHA 3T1YJ 2YNFB 2OI2A 2P6SA 3IO1A 3SQOP 2V94A 3J7A1 3K5LA 1LW2A 1ZBTA 3ILJA 3FCWA 2R7OA 2KZZA 3MR3A 2DGOA 4KGXB 2CDQA 2ILYA 2DRDA 2ZBRA 4YHHJ 4B3TF 2G2ZA 4F4XA 3R97A 2CBJA 3KMSA 3C66A 3S01A 1TZ0A 3VR8A 3QYYA 4MT1A 2CXFA 4DV7J 5L46A 4ZITA 1X79A 3VRBA 3GQCA 2LJLA 1QAYA 3H5UA 2ZBCA 2DR7A 2MEWA 4L9IA 1GAOA 1N6QB 2HN1A 1G2EA 4QXCB 3PU3A 2FZGB 3QPIA 5LJ5Y 5I3PA 4BCAA 3EE3A 4JUZA 3I4HX 5CB4E 2V0NA 5JVDE 2VBXA 2A6OA 1WJ9A 4B3RJ 1RTJA 5LXYA 2EFGA 1RWXB 3LP1B 3GFHA 4CN6A 2C2ZB 3RF1A 3M1VB 3GFYA 1EJ7L 2G1DA 1HBOA 2XLKA 2CJKA 2BBHA 2MQMA 4LVOP 4QIEA 1JNRB 4M1PA 8AT1B 5LBQB 2MKHA 2AD9A 1DURA 3ZJ1A 1X4EA 4USVA 4PZVA 4MK7A 5CZVA 4JV0A 2M7SA 3RRHA 2XAHB 1BR0A 2LSJA 3J7YI 5LXTE 4BLGA 2HPUA 1JWWA 2MZSA 2YNGA 3M6XA 5C24A 2P9GA 4Y2IA 4K2XA 1YJUA 2CHOA 4ZIWA 3OTOF 2V9KA 2D9DA 4QOTA 3AE4A 1KHVA 4X65T 4BC9A 3G6VA 1UVIA 3HHDA 1S1XA 3IM8A 3MEEB 5I3QA 2W9AA 3EABA 2PI5A 4OHVA 1LQ9A 3QWUA 5D0GA 2UVWA 3GYGA 4Y6IA 4BA9A 4DR6F 3UR0A 1RACB 2R7QA 1MROB 5ETVA 2QLJB 3EDVA 2ADBA 5FYMA 3OJAA 4M5DA 4ED3A 3VAKA 2ADCA 2OH2A 3UQSA 3K7RA 3GIIA 1KRPA 2DH9A 4OZ1A 3UE2A 2UUBF 4R8UA 2BJEA 2HBQB 3LA0A 2WK4A 2XCPA 3EZUA 5D0EA 1KN6A 4K4ZA 2J7UA 3CJKA 2XLIA 3MD1A 3AE2A 2EI5A 1OJ4A 4ED2A 2JQHA 2FTRA 3SFDA 4X4OA 4QKNA 2OJ3A 1RHRB 2HS0A 5A6WA 2CQIA 4R0JA 4ZJOA 1Z1ZA 2YNIA 4FXWA 3G06A 2BJ3A 4DEZA 3B82A 4WF9Q 2DKOB 2OEJA 2E9XD 1YDLA 3CCRS 3T19A 4BDPA 2ZMAA 3HA4A 3CCJS 2KHCA 4V1Av 2HMIA 4DSJA 4F04B 2V2QA 3DLLQ 1WLXA 3KJFB 5B0FA 5E5NA 4QJVA 4DUYF 3MECA 4E2FB 2O5DA 4DI6A 4PFOA 3BYPA 2V6YA 3BJYA 3W62A 2XB2D 2C5IT 1RT4A 2M70A 3J9X1 2J9DA 5KFTA 2XMJA 4YHHF 4P71A 3ZC0A 4F2RA 1S35A 2CZ4A 1D1CA 1US7B 4RW4A 3BQ2A 2ZM8A 1S1WB 2ZBIA 2CLYB 4P73A 4DV7F 2LU1A 3CEDA 4ZLPA 1HWLA 2KVIA 3L3CA 1X8DA 3D0IE 4DR4T 3IGNA 2B51A 4DN0A 3K1SA 4ECWA 3L7OA 2HHUA 2F4VT 3I0SA 3FQLA 2W2NP 5HXSA 2PDAA 3ITHA 2M52A 1JMTA 2CXEA 3PUVF 1R6YA 1U1QA 5KFHA 3RAMA 4U3CA 2H5EA 2E9XB 2R4FA 2R8KA 3DHWC 2E7WA 5C7PA 3DCAA 2KM8B 4EUVA 1HI0P 4B3RF 4H4KA 1TL1B 3GSIA 4AXPA 3KK2B 4AI6A 1JLEA 2GAHC 3AVSA 4PK4A 3GFZA 3I0RA 1SBRA 1RT1A 3IBFB 1L5UA 2K3IA 2MHNA 1CQMA 4NLWA 4C7QA 1PIEA 5EK3A 5L3CB 1NAQA 2Z30B 3M7VA 1N34J 3HFZB 4HWFA 1CC7A 2WB5A 2ZM6J 3MAHA 2LLZA 2O01C 3ENQA 2LYVA 4J9OA 4WFAQ 5ADXL 3CCLS 1MN7A 4X4SA 3W2WB 2YWFA 2O1PA 3R5JB 4YTMA 2KH9A 1KVJA 2XG8A 2VU5A 1VCTA 4ELVA 1Y11A 3B6BA 3UU4A 4AKGA 1D1AA 2XYGB 3OBIA 4O8SA 2AGPA 2YWGA 2YNHA 4AQYJ 2GIRA 4HHUA 2VASA 5D0RA 2WZIA 5LJNA 2NXUA 4OYXA 3PR4A 4JI6F 1Q78A 2WY2A 5KG4A 1XMOT 4CM0A 1JKHB 1CG2A 3ZMSB 3R2CJ 3P5TL 2NZCA 3LK2B 5F0UA 3BK9A 2QL5B 3TRGA 2BE2A 2YX1A 1QUVA 2VUGA 2HRUA 1PBAA 5J2NA 5K8OA 4JI0J 3QLHB 1H3DA 3HKWA 4QH1A 5KXJA 4FZVA 3MGJA 3BGOP 4KQZA 3OD2A 5IC6B 4EOZB 5EWFA 2I5JA 5JRCB 4L73A 4YY3J 3OR2B 1XMQT 4I6WA 4QR2A 3PIPQ 2WVFA 2VFUA 3TLSA 1WHXA 1YZ7A 1FRJA 2QT7A 3PO5A 4ISTA 1SH3A 4ANJA 2UV8A 3CDEA 3GJTB 4PXEA 1HQEA 2QYCA 2QFJA 3O1JA 3EYZA 4G1PA 4OZ0A 1T9XA 5DABA 1H98A 5AQRB 1SE7A 3QGGA 2GQQA 1L3TA 1MMNA 3M4XA 2KLQA 2V7JA 2XMWA 2DR5A 2FVPA 2H7OA 3HJVA 2YINA 3SEOA 2Q66A 2VQET 4UF4A 2OPSA 3AD9C 1QAJA 4P75A 5B0DA 3H0PA 1EKRA 2D3ZA 3GA8A 1S72S 1NM2A 2RQCA 4HTIA 3NS5A 3B5MA 4AE5A 4X62F 1OY8A 4P74A 4HDGA 3SRZA 4J91A 3V81A 1SJ3P 2Z2MA 3LPYA 3P4PA 1F5AA 3G9CA 5HQ8A 2BZ2A 3UUBA 2YQ0A 4QZVB 4YUDA 1KFSA 1KF6A 1MU2A 3PNIA 1KR4A 2B4VA 1I1GA 1RAJA 2JNJA 1NHKL 1DTQB 4J9RA 3G6YA 3B78A 3HJFA 1N52B 2QLBB 2WZ1A 1ICEB 3EXYA 2W1BA 2VD3A 5KAKA 3F56A 3W61A 5HP1B 2KZMA 3FHNA 4ES1A 4G3IA 3K58A 3U1LA 4NUVA 1YZ6A 5LB7B 4WBFA 4LF7J 5ABFA 2BE7D 3QB5A 2DGWA 1TKXA 2E7VA 4DPXA 5F8MA 2L8KA 3LFMA 3PUQA 3TZYA 2GMJA 3ANWB 4Y2MA 1FVQA 3RKGA 3CJ4A 3MTJA 2VL0A 3KLVA 4F25A 2LOSA 3W60A 4LSZB 3HHNB 3MEDB 1N34F 3C4ZA 1LWXA 4QXHB 2ZE2B 1RHMB 2ZM6F 4IH5A 2XGQA 1CJVB 4QPXA 1BWEA 4J2CA 1WI8A 2XO7A 3OSPA 1UJ6A 4H9OC 2EFNA 1O6XA 3K2YA 1VCSA 5SUHA 2GVZB 2YKMB 1XEZA 1HBUA 3R7BB 3JB9k 2OLWA 5BR8J 3OHBA 5AXNA 2R7SA 4MKBA 2XAJB 3SDEA 4IO9Q 4DSFA 3AA1B 4AQYF 4JI5J 2B6AA 3AXKA 3UU6A 3N2GE 2FGOA 4J9LA 1FDDA 4EXTA 2I59A 2G4BA 2KFNA 2YU1A 2UZAA 3LAMA 3QRRA 2AJFE 4OI3A 2ZM0A 4DPTA 5EZYE 4ZI3D 5DS7A 1NHVA 2VC1A 3PYDA 5C2CA 1SQEA 1KC8T 1E6VB 4P52A 4RW9A 2XULA 2FZCB 2BVZA 3TUJC 2LQ5A 1R6VA 1IKVA 3PHEA 3ZT7A 3QATA 4DSLA 4HGAA 3A7MA 2V8DA 1TKDA 4UW2A 3GONA 3ONQA 4P09A 1VQNS 4YY3F 3PEJA 1WTBA 1VDHA 4GKKT 1EAYC 3TA0A 1IKYA 1HPZA 2KI2A 2WB1D 1U1LA 3S4UA 4H9PC 2UP1A 3W5XA 5HI7A 4LF6T 3BDEA 4FPRA 5KG0A 2V5CA 3AB4B 5J0ZA 4QR1A 1LWEA 1MWQA 1N36J 5BYRA 1T3NA 2N2NA 1NJZA 1HYSA 1U02A 1RAHB 4J9PA 1A6LA 4AT1B 1AFIA 3UU8A 3VU7H 3JS9A 1BGXT 2FVCA 1HX1B 2JLEA 2WP9A 1HWUA 2ILZA 5KFDA 3UFCX 4PK6A 1FX2A 2XSBA 3Q2SC 4DPYA 2F9DA 3HVRA 4QXBB 1FERA 3M6WA 3FEZA 5JR9C 3RW7A 2HAFA 2MLXA 2HFVA 1RT3A 5L3BB 1HNIA 2CPEA 4IT4A 4KRWA 4TNVA 4OJHA 3W3SA 3UUMA 4JV5T 3RW6A 3IAM9 2FHKA 1LVKA 4NPPA 1BMQB 3HMJG 5G0RA 4QWBA 2XQ4A 5LMUF 1HNVA 3AEGA 2HS4A 4NXMT 4IE7A 1QD1A 4UF0A 3GFXA 2HWIA 3KFWX 2V6AA 2HVEA 3PJAA 2FJWA 2HNZA 1IQTA 3D54A 4ILAA 5FD1A 1T9TA 3T5JA 2DO0A 2KT3A 4PG5A 3W5ZA 4DR3F 1NPRA 4KGVB 3SOLA 3B57A 1TUGB 4PQAA 1FXLA 4KIAA 3D0TA 4WNKA 4LF5T 1JQGA 1X7VA 1IZNB 2WHOA 4EBCA 2NYIA 1TV6B 2LE8A 4RW6B 2IC6A 3HKBE 3V5SA 4F0KA 4ICLB 5HATA 5D6GA 3CMAS 2BMBA 3TX8A 2CYYA 2XI2A 3OVBA 2AQ4A 1L3SA 6FDRA 2X0YA 4OYJA 2AW0A 2FVQA 3H2UB 5AQQB 1Z2LA 4NMXA 4LRAA 2Q3PA 2WVDA 2XQ9A 4JBWF 2WWUA 4JI5F 2JH3A 4HFVA 3UFEA 3DXBA 2B7CB 4NMLA 4CTAA 1NKCA 3DJBA 1PJ6A 4Z7CA 3GN5A 4F0MA 3AT1B 4J9KA 1Q7LB 3W9JA 2K7JA 4MH8A 5T7LA 1OYDA 3PR5B 1D0ZA 3MAAB 3M8PB 2M67A 1FCAA 3ZYKA 1R8CA 2RMLA 1JLFA 2KHDA 4I56A 2DHSA 3C64A 4EB6E 3IM9A 2QSFA 5DG7A 2NR0A 3CQXC 2B7BB 1MN9A 3O1HA 5A8KA 3KINB 1XNQT 2RQMA 3TLUA 2VKJA 1SC3B 1SH2A 1JXLA 3ZFVA 1P27B 2YKNB 3O8WA 3BQ0A 4LRDA 3NCQA 3ETUA 4CIOA 4HFIA 1FWLA 1VBKA 2KM8C 1X31C 2P8IA 4F3MA 5JDNA 1ROFA 3ZZZA 4TWDA 3U1NA 4ZLLA 1VISA 4Q0BB 1N36F 4U67Q 4AD6A 1X0PA 1NRKA 5EWEA 4C48A 3UCUP 1BQNB 3JAMY 5HWXA 2E9TA 2IAKA 2NXNA 4ZPTR 4DV2T 1N5YA 4LF4J 2H54B 3M9OB 1UVLA 2J7WA 2E7XA 4JI0T 4JI8F 1XMBA 2RU3A 1U1KA 2DHHA 3JAEA 1WSRA 2CJBA 2EXUA 2BOPA 5HXRA 1J5EF 5JUMA 1AA1B 4WP9A 4RPFA 3AECA 4DZDA 3DMJB 4NA3A 2YX4A 3P6YC 1BC6A 4O3QA 1M5PC 5DGAA 1T9WA 1IKXA 4N47A 3VAMA 4PNIA 1BR4A 2Y1LB 4RNFA 2ZZTA 2R3VA 3GV8B 2BR0A 4DR7T 2ACMA 2FLNA 3BKUA 3MZIA 3QNUA 4YR3A 4HR2A 2E2AA 4Y65A 2ZNZA 1TFYA 2Z8QA 4TLRA 2F4VF 3UO0A 1UK5A 1T05B 3MMCA 4DF8A 3PW2A 1YKHB
chains in the Genus database with same CATH topology
3L4BC 4G65A 4L74A 4J7CA 2BKPA 1T72A 4J90A 2AEJA 2BKNA 3L39A 4L73A 2I0MA 1T8BA 1VCTA 2IIUA 3RBZA 4J9UE 2AEFA 4EI2A 2OLTA 2BKOA 4GVLA 1LNQA 4L75A 4YS2A 4J9VA 1XWMA 4Q25A 3JXOA 4L76A 2FY8A 4J91A 4RO0A 2AEMA 2OGUA 4XTTA 3RBXA 3KXDA 1SUMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4B C;  4G65 A;  4L74 A;  4J7C A;  2BKP A;  1T72 A;  4J90 A;  2AEJ A;  2BKN A;  3L39 A;  4L73 A;  2I0M A;  1T8B A;  1VCT A;  2IIU A;  3RBZ A;  4J9U E;  2AEF A;  4EI2 A;  2OLT A;  2BKO A;  4GVL A;  1LNQ A;  4L75 A;  4YS2 A;  4J9V A;  1XWM A;  4Q25 A;  3JXO A;  4L76 A;  2FY8 A;  4J91 A;  4RO0 A;  2AEM A;  2OGU A;  4XTT A;  3RBX A;  3KXD A;  1SUM B; 
#chains in the Genus database with same CATH topology
 5AT1 B;  1IWG A;  4PAA A;