2BKPA

Structure analysis of unknown function protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
b'YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN PH0236
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
total genus 74
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkpA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkpA02
4J9UE 4GVLA 4EI2A 1T8BA 3RBZA 2AEMA 2BKPA 3KXDA 1VCTA 3L4BC 4Q25A 2BKOA 4J90A 4L75A 4RO0A 2I0MA 3JXOA 4J7CA 4G65A 2AEFA 4L74A 1LNQA 2BKNA 4J9VA 1T72A 2AEJA 2FY8A 4L76A 1XWMA 4YS2A 2IIUA 4J91A 4L73A 3L39A 4XTTA 3RBXA 1SUMB 2OLTA 2OGUA
chains in the Genus database with same CATH superfamily
3UUBA 2BG9B 4R8UA 3BPDA 2H3RA 3I1AA 2W62A 2B8QA 3QAEA 4E2FB 3R27A 1S4EA 2J7KA 1VK8A 4P52A 5GONE 3NCQA 4JI5J 4WFZA 2HURA 1Y9OA 4O0NA 1FESA 3TZXA 1WG5A 1D9FA 1RWOB 2M67A 1UGOA 2W2PP 4I69A 2YU1A 2C2OB 3DRSA 3D1HA 4UV9B 2XTJP 1VC5A 4DL5A 3OVUA 1NSPA 4QH1A 4DSEA 4DBRA 5GAEU 2FC9A 4OYMA 4DLEA 2H3EB 4FNHA 5L8RC 5L3DB 4PYDA 5F0WA 4F67A 3OVSA 3CJ5A 4Z8XA 4RUHA 4DUYT 3BKFA 2EHOA 4E8UA 2UUAJ 2OPSA 1ZAVA 5E0OA 5KFEA 2E9XD 4DV2T 4C91A 1CULB 1HWKA 1IQTA 1XC9A 1HWUA 5K8OA 2VL1A 2V9WA 4NA1A 3AXJB 1SUQA 1KC8T 1I94J 3CIZA 4R5PA 3Q83A 1HNZT 4KKOA 4IG0B 3J80U 4ZS2A 1HYSB 3ZYMA 1G73A 2GNKA 4LFCT 2DXEA 4F2RA 1LW2A 4IOBA 2WSEC 3RAXA 5LYJE 3BO2A 3IBCB 1IKVB 2W9BA 4I68A 3ETMA 1NENA 5L9NA 1OS5A 1WF0A 4QJVA 1O5JA 4RJVA 3O9XA 3FMBA 4DCJB 4NYPA 4UOGA 4MFBB 2ZVSA 4DUTA 2VPYB 3V81B 3P4RA 1BQXA 3MEEA 3MPWA 3W3SA 1S0NA 3PV0F 2C3OA 3C50A 1HS7A 2QA7A 3TA2A 4M5DA 2OSRA 1Q81T 1RYRA 2QMXA 3BQKA 2XC9A 4IYQA 1EQ0A 5JVGQ 4O4GB 2RUSA 1WC3A 2HK2A 3RX6A 2V7LA 3C16B 4X5TA 3KLIB 2CQBA 5L2LA 5CYMA 2LQ9A 4B9MA 4PKDB 3CD0A 3M8SA 4HDHA 5DRKA 3VAFA 1VQLS 5HXHA 2Y8DA 4Q5VA 4DI6A 1OEDE 1SV5B 4AKRB 2L9NA 4V19X 2KT3A 1BGXT 1FRLA 4DFMA 1UVLA 4WTOB 2HKEA 2XMAA 2XGQA 1YBTA 2WBLA 3Q8UA 3D7SB 5KDMC 2BE2B 3B4MA 3I0QA 4NXMT 3T3FA 5AXLA 3DGPB 3QMQA 3F31A 5A8KA 2LYVA 1NH8A 3M32A 4CNZA 4O3PA 3CT9A 1FRKA 3M2RA 2D7SA 3CDUA 1F6TA 2W2QP 2LSYA 1NPPA 3PVXA 4OX7A 3IM8A 5L1KA 2DBBA 5AJ3F 3A8YC 2J9DA 2BXJA 5A2QU 1C0UB 1RBOB 2WVFA 4ZHQE 2MZRA 4NCAA 1FXDA 4E98A 1MIYA 2D74B 4Q2LA 4HLBA 3KDOA 1SIZA 3LGNA 2XLIA 4B3RT 1M5SA 3GE9A 1S1WA 3FCVA 2HNDB 2PC6A 1QLBA 1YRTA 2VKZG 4G63A 4ZMMA 5F8HA 1VMBA 4KGXB 4WIIA 3DLBA 1VRUB 1EKRA 3LGMA 3N28A 1NU4A 2V4QA 1S76D 1VQSA 3MUMP 1Q16B 2HWIA 3CCVS 3MPVA 5KG3A 1VYAA 1V9OA 4UIGA 5HJXA 4PJLA 2BS2A 3EYZA 1Y11A 1J2VA 2V8DA 4LF6T 5LSLA 5LMUF 4PAGA 2I2YA 3GMIA 4LBHA 2HQ3A 1UFKA 2RAQA 2HVEA 4HT5A 2GW8A 3W61A 4J5OA 3PYDA 5KTQA 2KO1A 3LWLA 2VJUA 4DR2T 3TI0A 2L48A 4EEBA 1K9MT 3L8RA 4WZMA 2Q6BA 2GHWA 3OBIA 3NNAA 3KBTA 3QSYB 1WACA 4M5MA 4KHPT 3TAMB 4JV5T 1TZ0A 3K59A 2BRLA 2XULA 3NVOA 5L3BB 4OYXA 5BYRA 1WR0A 1ZM4A 5CD4A 1Q8LA 4EU0A 3G8TA 3S01A 4DV0J 5BMVE 5FP3A 5LXYA 3FBEA 3UI3A 1HQEB 1Y10A 1WYBA 2OPPB 4CO4A 2V9KA 4UY85 2YNHA 1U1PA 1YJ7A 5LGUB 2A18A 3NWRA 1HNWT 5A6WA 1UMJA 2V4JA 7FDRA 4YQWA 3EAMA 5JDHA 2VHGA 5B0BA 3J81Y 1HHSA 3TVKA 2UU9F 1S99A 5DM7Q 4DR3F 4BLGA 4E7SA 2E8IA 2V6YB 2DLRA 3H5XA 1FTCA 3CJSA 4PWDB 2HRUA 5HP1B 2ZUGA 1P9YA 3AE5A 3QB5K 3DOLA 1FMVA 2LECA 3AAAB 3H98A 4QU7A 4DQRA 5LGTB 2JQQA 1JLCB 2VG7B 3PO5A 5DLGA 3P4UB 1S59A 1RTDA 2HBRB 3BBCA 1OQ6A 3BBBA 2NW7A 2GGPA 4X2BA 1J5OA 3CJ0A 4KBMB 2BS3A 3GFYA 2PN6A 2WVCA 2E9XB 3RIFA 2UVWA 1YQ3A 2EPIA 5KG0A 5J2NA 3DLKB 3HT0A 1O6XA 3F44A 2Z4PA 2MHNA 3CCZA 2DH9A 2UXCF 1TAQA 4PK4A 4ID5B 3MEGA 5T41A 4WXOA 2WSCC 4AT1B 3HI9A 2JMHA 4XDDA 2HVIA 4HH1A 3VZIA 3IBPA 4O44A 2UXDJ 3SXLA 5ABFB 1KRPA 1FVQA 4IGUA 5F8IA 2QYGA 5KFNA 4RNMA 2ZH9A 3MD3A 2ZITA 1Q5YA 2PJQA 4UELA 5KFYA 4IDKA 5LM7E 4HEA9 2MZSA 1Y3JA 2HLUA 2ZKTA 1RKIA 1NKCA 1VGYA 4NIQA 1IN0A 4PK6A 3NWIA 4N8NA 2BANB 2CNNB 1JNZA 3T1AA 1VJWA 5A1LA 2RVJA 4C2MA 1WI6A 2W25A 3MCMA 1UEVA 1L5UA 4IE0A 3NNHA 4RWWA 4MMOA 2W00A 2BR0A 1U5PA 1FKOB 3S7RA 1NKEA 2XSJA 4ECQA 3U3IA 2ZLYA 3ZT5A 1HW8A 3SQGB 4C6AA 4YHHF 1XK8A 4F02A 3RIAA 3H25A 3W7BA 2CQ0A 2K9AA 1EQMA 2UVVA 2Z57B 3M2UA 3DXBA 4TQRA 3EDQB 5C24B 2HFNA 4F7VA 4DL0C 2YY3A 2JJ9A 2KHCA 4NLYA 1FDBA 2BG9E 3US5A 2DPIA 4CQIA 4WIQA 2HAIA 3RAMA 2MQOA 2CJAA 3QB5A 3DLEB 4CI0B 1D9AA 4CP5A 1N5YB 2V8HA 2CA5A 1WSVA 2CQGA 2RS8A 4C48A 4QR2A 5EWFA 1FK9B 1JLAA 2DNZA 1FEHA 3BQ2A 4CCHA 3AE4A 2XQ9A 2FVCA 3TZWA 2MY8A 2EXUA 4DR6J 2DRBA 3RQUA 1RTHB 3QAUA 2DVIA 2V6XA 2AIRB 2HHPA 3G6XA 1VQNS 1GXTA 3C4WA 2Y0BB 5BR8J 4DQIA 3AOAA 3GYGA 2EK1A 3RLFF 5LHHB 2ZH3A 3QPIA 4G3IA 2FJDB 3U78A 4DIDB 1WKLA 3BPSP 1NK8A 5JR9B 4KFBA 1T9WA 1V3SA 5ETKA 1WR6A 2JC1A 2D3ZA 4ZZCA 2CKWA 3Q8SB 1MN9A 1U0HB 2HWHA 2VKRA 3RJMB 5CAAA 4Z37A 4ZHRA 4TYAA 3BDEA 2J9EA 4TZ4C 4CO3A 1GXLA 2AW0A 1Q78A 1FNXH 2XZTB 3FSIA 2QLWA 2ADCA 3N9UC 2YPYA 3SDEB 2GCFA 4C0BA 1YJWS 4P2XA 2E1CA 2HQCA 5A6PA 2ZWPA 2VG5B 3BSOA 3D28A 3ZN0B 3AXMA 4B3SF 3MMCA 3C8YA 4TNWA 4MT1A 1HL6A 2LP4A 2MQQA 1YVFA 1J5EJ 1I3OB 1LVFA 2WCAA 2MTLA 4B3TJ 3A3OB 2E66A 3MFIA 4DR7F 3ETVA 2OPSB 3RBXA 2V68A 1C1CB 4IUFA 5HLFA 2W67A 3R8YA 4L0RA 3WX8A 2ILYA 2M88A 1FE4A 4ZI2C 4EWTA 4MK7A 2W9CB 4H9SE 5EK2A 3BZQA 3UN3A 2XAJB 1XNRT 3P6YC 2DGXA 1EB0A 3HJFA 2X0LB 1KVJA 1SKRA 4IT4A 3MECA 5A0YA 3D1QA 2JLGA 4PFOA 1UCUA 4DR3T 2V2KA 4U7UD 4DR1J 3SV3A 1SKUB 3NS7B 1FJ7A 4ZN3A 2W9BB 4YB1P 2X9WA 3MM6B 1DY3A 2IM3A 4TN2A 5D0EA 3R84B 2UVRA 7AT1B 4YXDA 1S9FA 4M8LA 4F4ZA 3JQMA 3CD6S 3RRCA 1C0TA 3EZUA 4KHRA 1HKAA 3BGFA 2IJFA 4NYOA 2E5JA 3ILLA 2KMFA 2XMUA 3OLBA 3MUVP 4Y2AA 3EDRB 1NKBA 2NZ4A 3EGZA 5KG1A 4AL6A 2ZD1B 5IT4A 1S48A 1DRZA 2ZBIA 4X4SA 2ZJQQ 3I4HX 4DV1F 3MCSA 4C97A 5TAOA 2UXCT 2MDAA 1VQMS 1FF2A 3AA1B 2B4OA 1PIEA 1GK8A 4FYWB 2Q1LA 1NCLA 3MWBA 2HSEB 1QY7A 3PW2A 3CUNA 3EMTA 2UVUA 2RB7A 5KFSA 4O4LE 3VU7H 1JJ2R 5A8KB 3TVYA 1RT7B 2XHWA 4OHYA 3M32B 2XAFB 3GWCA 3AH6A 2IMLA 4WU3A 2QLXA 4L76A 1CPZA 3OL9A 3NY0A 1X8DA 4ED2A 5HANA 2CPEA 1LOUA 2GIFA 3AD7C 3RW6A 4DPXA 4AI6A 2HRYA 3LBXB 3HX9A 1IBLJ 2G0JA 2HLTA 1S1WB 3KNAA 1LWCA 2KLQA 4RW4B 4JI2T 1EIYB 4KO0A 1XMQF 5CGMA 2I0XA 2F4FA 4YHHT 3PTRB 1P9QC 3VRBA 3ADAC 3PRDA 2X9XA 3CPWR 3I32A 2CNOB 2H54B 3Q8YA 3MM8B 1ZPWX 3FC9A 1P27B 4XIUA 2Z2ZA 1U8WA 1SC3B 4DN9A 2BVLA 3HVTA 2ZE2B 4OK0A 2OJ3A 4F25A 2PD1A 1Z2ZA 4ECWA 4CYUB 2C28A 2DGWA 3ONQA 2WCXA 4ZP9A 4KGKA 1URNA 1B7FA 1MROA 4X62J 4RUBA 3KLEA 1TK0A 4U9RA 4F8HA 4OZ3A 3GJSB 3BQIA 1TL1B 4A8KA 1RWWB 2W4CA 3Q0AA 2CRBA 3I9YA 2DY1A 5KXJA 4QWDA 4NXMJ 4HGAA 3GN5A 1DAXA 5KT5A 3BGRA 4DV5F 2QA1A 3K17A 4UUXA 3NNCA 2IHR1 2M4MA 4BA9A 1HR0F 1UKUA 3IS9A 2UUWA 3M30B 2Y8WA 3JS9A 3W2VB 5I3UA 4C8NA 1KLNA 5T7LB 3BO3A 1FD8A 3VAKA 2VPXB 5L47A 1FD2A 2DR5A 4JI3F 1MNDA 2MKJA 5F3JA 2YNHB 4IFVA 3O4XE 1KDNA 2WU2A 2KG1A 4LFAF 4QX8B 4EYIB 2RS2A 3LH2S 2V4JB 1KS2A 1VC6A 3UN2A 3IR6B 5D77A 3CCUS 1WG4A 4YFSA 1E6YB 3N0VA 3I6PA 3TUPA 2ZDPA 4P10A 3DYAB 1OSCA 5K5MA 1MWZA 5GAGI 4WCEQ 1NJXA 5F0UA 3DI6A 2JEJA 2Y48B 3K3QC 1FHTA 3C51A 2WZ1A 2M52A 3F57A 2AYBA 1N34T 3R97A 4KX6A 2CWKA 5KX5E 2VL8A 5DQWA 4PUOA 2ACXA 4LF6J 4ILUA 3CX7B 1URRA 4P73A 3DHWC 5I3QA 3DOKA 4AXJA 4DR7T 4DV6J 2ZDOA 4LVNP 3HKBE 3C15A 3CWJA 4OHZA 3GU0A 3I0OA 4OZLA 4IKAA 1N0VC 1H7WA 3CVKA 1X4AA 2XHCA 1K0VA 3V4IA 3T1HJ 2LXUA 2P9GA 4WW0A 3E01B 4YP3A 3ZC0A 1UFWA 3IAS9 3W62A 3MEGB 1MWQA 4JV5J 3OW2R 1NHVA 3JSBA 3C14A 5AFUL 3D0TA 4MK9A 4JYAJ 1N6QA 2BJ3A 2E5LF 1S77D 2QTWA 3QT7A 3S1TA 3MR5A 3DMJB 4CTAA 3KDNA 2HW3A 5C25B 3MAHA 3H40A 4DV7T 2BMBA 3MAQA 3HPOA 2RF2B 1YJTA 1X9MA 5GMKa 1MU2B 4IDKB 3K8PC 3H3AA 4DG1A 4DR5F 3GIMA 3H20A 1NSQA 4WFAQ 2VPWB 3LW5C 1TFYA 3BSAA 5DG9A 3ANWA 4ZCLA 2CIMA 3LWMA 2RMLA 4UQGA 2B56A 4PK5A 2AJ2A 3ZZTA 1RT3B 4H9QC 3A5XA 2HHWA 3MMAA 3AE6A 3G82B 2QIFA 4A8XA 3ZZYA 5A8WA 1WC4A 2FUPA 3E51A 2YDQA 4PFPA 2KH9A 1N8RT 2P9CA 3OR1A 9RUBA 4KE5A 4L73A 5JREA 4USKA 1FE0A 5KFHA 5DM6Q 1S4FA 2HHUA 5HVFA 1RUSA 3CMLA 3CXCR 1VLYA 4WPAA 3I55S 4CZZB 1MIVA 1RBAA 1N56A 2WK4A 3M2UB 4DX6A 2FVRA 5HAXA 3UFGA 2V7MA 2A10A 5GMEA 2ZWOA 5KFWA 4XPEA 1S9GB 2YKMB 1XNQT 4JUZA 3ZTPA 3KK1A 3VR1A 1ZM2A 1CC7A 5C7PA 3POTA 1HBNA 3LANA 2B7CB 3LPYA 4RX6A 4HACB 3DLJA 2OV9A 2VKDA 1FX2A 2NOXA 1GXUA 1FDDA 3B82A 5H9FJ 3EGNA 3R5AA 2I5JB 1T02A 1Q86T 3E0ZA 4EV6A 2BW7A 4PXCA 3I0SB 2XQ7A 3FB2A 2AEFA 3T6JA 3PKMA 1JX4A 4USJC 1QTNB 3M8WA 2XEXA 3MKDA 1HPZB 4K2XA 1YLXA 2JFDA 2XM3A 5HK4A 3MR7A 2YX1A 1GQEA 2DHHA 3ONLC 3L4BC 3FBLA 2JSXA 1RB0A 2EFPA 1XMQT 4TLRA 1B64A 1KQFB 5IV4A 2LOSA 3UU8A 4OI1A 2N2NA 1TV6A 1VIXA 3OHBA 1Y4ZB 3M9OB 1UW4A 5A8RA 5FXVA 4H9RC 2DNQA 2IDEA 2ASLA 3CJ2A 3MM5A 3JTPA 1VBXA 2EEYA 1LFPA 2JIWA 4KRWA 3DHXA 5HROB 1RAGB 1XWLA 3OV7A 2WM9A 4LMKA 4PCQA 2ZVIA 1SKWA 2DWGA 1PSDA 1HA1A 2F4VF 4AKLA 2MZJA 3RRGA 4LF9F 3A8KA 2WW4A 4V1Ak 4ZKAA 4ILMA 3MOZA 4QPTA 2LQJA 1LXJA 3UU6A 9ATCB 4DV5T 5LNKA 5JQGE 2J47A 3MR2A 3QLHA 1HR0T 3Q8PB 1Q82T 1AZSB 2FHOB 4Y6IA 3KK2B 4C8ZA 1BWEA 2BJDA 4EIWA 5AJ3J 2XI3A 1Z4UA 2C2MB 1ZETA 3FVYA 3D2WA 3RBDA 4DXLA 4YS2A 2YNFA 1UW9A 2C1EB 3R5JB 4TLQA 3OFEA 2M2BA 1FWKA 1DTQB 1FMWA 2KM8C 3PO4A 3AE9A 1U7LA 4K2JA 4B02A 2QZ8A 5LHIB 2DNHA 5HXRA 2QSWA 4ZIVA 1QLNA 3MECB 3VWSA 5E3RA 3PY8A 4A8WA 4EI2A 4X84A 3QZ7A 1S94A 3UO0A 3H5UA 2YQ1A 1WKKA 2MQPA 2R8HA 3QGPA 2GV1A 2XMMA 2D0TA 2NQPA 5L4EA 3CMAS 2IC6A 4IO9Q 4G6VB 2DHSA 3K8WA 4TU8A 4BCAA 3B78A 5LMUJ 4J9UE 3PE0A 2QX0A 4HDGA 1WEXA 1OPIA 2IUBA 1PAEX 3BM7A 2HFZA 2K7KA 2ZFHA 2IJRA 3TLWA 5KG5A 1GAOA 4IO1A 5A2QY 2RD5C 2YH1A 3TVZA 4Z7YA 1X4FA 1SH3A 3C6UA 5LOVE 1S1TB 4J9KA 3LJCA 5L3GB 3EUHA 4AKIA 3ZMTB 4PAAA 3TO8A 4G1QA 3PRVA 3PIPQ 4LBIA 1QVFR 4Y0FA 2GVDB 4HFBA 4NLRA 2PIIA 1HMVB 3NKZA 4ISTA 3RGLA 5L1JA 2HHVA 4I6WA 2KXPB 2HVHA 2ALZA 2XM1A 3QC9A 5JRCA 2Y1LB 5HEGA 4EAHA 3OL7A 1Q53A 2MY7A 4IREA 2VK9A 4TV9E 4NZ7A 2FY8A 4XO0A 2E9RX 5SZTA 3L09A 5JDNA 4USIA 4WK1A 2ROGA 4DR5T 3JAMY 2B0GA 1NRKA 4C3LA 2D9OA 3U1NA 3PDYA 4DF4A 2OTJS 1NZAA 3RF1A 4FBUA 2WB1D 4IE6A 2I1RA 2UU9J 2W01A 2VBXA 2HHHJ 1TL3B 1SQGA 1WEYA 2VFVA 3UD5A 3PU3A 4UF0A 4I6AA 1JJHA 4B9NA 2BABA 1DBDA 1TVRB 4DV4F 1TP7A 2YKNB 2M6IA 1M5OC 3T5JA 4LF8J 5BXIA 1JNRA 3BS9A 5BYQA 2GIQA 1IJ5A 2MZ1A 3PJAJ 4ANCA 4JI1J 4DV3F 1TL7A 2YQ0A 4IR9A 5ETVA 1X7VA 2ASYA 1E2AA 3FSYA 3W2WB 2IRUA 3TR5A 4BWMA 4UOFA 3HFVA 5ABHA 4ZPDA 4P2MA 4EK2A 5JUMA 4C0HA 2QYCA 3T5HA 3A8EA 1IKYB 2W7AA 1AJ3A 2K5BB 4Y65A 1RWXB 1U1NA 2J9CA 1UAWA 3R2DJ 1HARA 2PO4A 3GV7B 2Q9QA 1LNQA 3P45B 1OEDA 2J0WA 3N01A 4KV8B 2VUGA 5C42A 2F9JA 3ABVA 3IA3A 1JLFA 3PR5B 5HYAA 5F8PA 3KLEB 2CPHA 3V5RA 2Q3PA 5J2TE 2LDYA 5AE1A 2FZGB 2FTRA 3TJ8A 2E9TA 2CLYB 3QATA 1D09B 3RZAA 1L3TA 2VDHA 2MKCA 2M9KA 3OL6A 3RB6A 1X4BA 1WYCA 2EKYA 1S1UA 3ZNUA 4I4TE 5M4YA 1S5ZA 2YNIA 1S0OA 3UU4A 1RT1B 4DEZA 3L39A 3VALA 1JLQB 2OPQA 1UUSA 2LDIA 3AJ1A 2XAGB 4RW7A 1IM6A 1XQIA 2A2FX 5L4HA 2KT5A 4YDDB 1NHUA 2CQ3A 5MLCV 3UQ4A 1U2RA 2AEJA 1N52B 5H9EJ 4OIXA 4ZVOB 3SCIE 3Q22A 3L7OA 3R1LA 2V8GA 1U2CA 4IIJE 4K5RA 3MOJB 3EVOA 4EFAC 5AQUB 1UZDA 2OLWA 4QU6A 3LP0A 1QM9A 2DIVA 2HYIB 2IDLA 2K1RB 3HHLC 4WF9Q 1SBRA 4LF9T 3P5BP 3RRHA 1L3SA 4CLYA 1WC5A 4FXWA 4M5JA 5F3ZA 3QO9A 3K0JA 1K0TA 1RAAB 4I2PB 1KF6A 3KNGA 2B5JB 4LJMA 2LXIA 3KJFB 3W5XA 3TZZA 2LVWA 1HF8A 3HULA 4AKHA 3L7UA 2MGZB 2FHJD 2G13A 2PTFA 4NL5A 3GA8A 3HZEA 2MXYA 3EVYA 4CLUA 2W0GA 2LSKA 2VBWA 3AEDA 1PC5A 4F04B 5DGBA 2NW8A 1X5PA 4ED5A 4YR3A 2VQFJ 4FBTA 4COFA 3KFWX 1UEUA 5HEOA 1SJQA 2QL9B 1CLFA 3K3NA 2BDEA 2YKAA 2NLWA 2DY9A 4L9IA 1AROP 3RBZA 3FZMB 5FIIA 1S12A 3L3PA 4ZVSB 2F63A 3TANA 1HG2A 2WZIA 1NSKL 4C3KA 3D4JA 1U25A 1RI7A 4QWEA 2YWHA 2O01C 2RUGA 2ZM8A 4F4XA 1B4SA 4CTAB 2F7VA 2R7OA 4Y2IA 5EK4A 4NRTA 1BD6A 3ELHA 1TR0A 2QGFB 3AE1A 2FDNA 2WB4A 1IKXA 4DPOA 3VGSA 3C3LA 4P6QA 5JDFA 2LEBA 4BJMA 4F6RC 3T1YJ 4MAKA 1SKSA 1N88A 3J7Z5 2OEJA 4UVBB 1N32F 1Y01A 1S1XA 2XQAA 1SVDA 3BGOP 1T8BA 1TUWA 2BJ1A 3KXDA 1VCTA 2FVQA 2NZCA 4NLVA 4NASA 3CQCB 2LXFA 3KKFA 1LK5A 4XAKA 1D1BA 2XMJA 4EXTA 4USTA 3OVAA 1NBEB 4J37A 5H1SV 4DUZF 2JLFA 2MSTA 4HHJA 1YG0A 4X4OA 3PURA 2CPFA 5ETMA 3QOFA 2OEKA 3FFIA 1C1BB 5DDRC 5F9LA 3DRPA 1T95A 3NLCA 4KHMA 3ZTRA 4B3SJ 1R0BG 1QAYA 2AHOB 1Z2LA 2ATLA 4WFYA 4IH5A 4CLLA 2G2OA 2ZC4A 4CH7A 2X1AA 2Z2YB 1GTEA 2BYCA 4JV1A 1WOSA 3M8YA 1T05B 2MPUA 2D5UA 4DR7J 3TJAA 5JDQA 2KN4A 4W4MA 3IXQA 1LWFB 2HZAA 3IAM9 3VAGA 4DVDA 2XI2A 3TLVA 5CJ5A 2VWAA 1ROFA 2BJ9A 2LU2A 2GX8A 3POTB 1FFGB 4I2QA 5AXNA 2G1HA 1HG5A 3D3CJ 1XMBA 2AX1A 2LKGA 4DX7A 3CC2S 1G8XA 2DH7A 1V3RA 2HBQB 4HFEA 1X0FA 4DS4A 2VICA 1NJZA 1AA1B 4RNHA 1F1BB 3PU8A 2KTQA 4EEDA 4RWXA 3H8YA 3CMQA 3NKYA 2SXLA 4RBUA 3I5BA 4GKJJ 2KT2A 4QXCB 4DV4T 3L95X 3W9HA 3ZJ1A 1T7SA 3CF5Q 3NG8A 4ZVEA 2IA0A 2RPAA 1CS4A 1FJGF 5CA1E 3A4TA 4YJ2E 4W92B 2I6WA 3P7IA 1PILA 2HGNA 4DV3T 3RAQA 1SL0A 5BYSA 5F5WA 4JI7F 4CN1A 3W5YA 2Z58B 4G1PA 2PFVA 2IA6A 3QYYA 1Q8KA 2IC3B 4FN5A 3M4XA 2CQ4A 4Y00A 2DXDA 1D0YA 4IG3A 1P8GA 4DMWA 1QE1B 4HFHA 2KL8A 3MM5B 4CM2A 1XEZA 2B6AB 2FQQB 2X3GA 2D1CA 5F9NA 3HSDA 2M3DA 3HHDA 4DV1J 4Q0BB 3K5PA 2QA4S 3NGDA 3JC6D 3CDAA 3KINB 3DDNA 1IZNB 1OY8A 4Y28C 3AHPA 1PAUB 4ZJQA 2WMNA 2G4BA 3Q9DA 1LK7A 1N36F 2LRKA 3ULHA 2BG9A 3C19A 2N4CA 2COLA 1TAUA 4N7TA 2DNOA 2BUNA 4UXNB 2YWEA 2CCQA 4X1IE 1N5TA 4KJIA 1Q7LB 2WDQA 2FLLA 4JI6F 3SIPB 4P7TA 4XK8C 1G2EA 3TX0A 5C2TA 2HWTA 2HK3A 2OA5A 3VVUA 3GP9A 3RYLA 4DSFA 2B1EA 1FCAA 3HKCE 2J62A 2C5IT 2XSBA 2CVIA 2GHPA 2W8LA 1VQPS 3ZSTA 2CXEA 2R8IA 4AQGA 1HNXJ 7FD1A 5KFDA 1FXLA 4WZQA 2MOZA 2K06A 4KSEB 2W63A 3NL0A 5IT9U 3RTVA 1CULA 4NXNF 2FHKA 2JEFA 1HBOB 4LSLB 2V6AA 2W1BA 1ZV4X 3K5NA 1R43A 2EI5A 3AXJA 1ZZNA 1HI0P 4NI2B 3IC1A 2VG6B 4F26A 3RB0A 2MSSA 4XTTA 3J81j 2CQHA 3SMZA 3DLHA 3I87A 2IIHA 2OELA 4KY3A 1PBAA 4ZLNA 1CJTB 3RHWA 4F4KA 4JI4J 5IQ6A 4IG0A 4A48A 4PXBA 3G96A 2APOA 2V50A 4ECVA 1HYSA 3OTBA 4QW9A 2R3VA 3NOCA 2GMLA 2HAFA 3K7RA 3LPEA 2PE8A 4O4RA 5IUXA 3ZJ2A 2W9AA 3AA7B 1IKVA 3UW1A 4ELVA 4WK3A 2OEMA 4U8YA 4K4UA 2BOPA 2C2ZB 3UE2A 2WDRA 1RAFB 3W64A 2KFNA 1B0VA 4J7CA 4ECYA 3SYZA 5AQVB 1RCOB 4MFBA 3TQ1A 2MZQA 5KMGP 3RKGA 2E7XA 3OLAA 2HFUA 3V81A 3FEXB 4WNKA 3FRYA 1NJWA 2HHTA 3TA1A 1WJ9A 4OI3A 1JMTA 3NS5A 3NGSA 1HR0J 2MJUA 4UR9A 1BE4A 1S6UA 4O4GA 3Q5DA 3MM7B 4J9QA 4QWBA 4F3OA 4N76A 3C64A 4AIUA 2XYPB 3C16A 4ZITA 1U09A 2L08A 3MMJA 2IW5B 3NCRA 3NBXX 1UVKA 4AQFC 1T03B 5DABA 2W2OP 5EWEA 4QIVA 4E7ZA 4YR2A 4DCPB 4JI3J 4EGWA 3GG0A 2WAQD 1PJ6A 2AU0A 2DHRA 3OFHA 3W9IA 1SV5A 1N32T 2J6SA 4LFAJ 2Z2MA 3VTIA 3J9X1 2R8JA 5B7WA 3IHRA 2BE2A 1Z1ZA 3AVRA 3TOQA 1T11A 3OYZA 1DQ9A 4YB6A 4FDFA 3DGPA 4RO0A 3N9LA 3MK7C 4DUZT 4F4AA 4I4BA 2CPIA 2DR9A 3MZKB 1RXOB 4LSZB 2VDIA 4YFUA 2ASDA 2MLYA 5KFGA 3F56A 3MPDA 3TP2A 2FHMA 2PA3A 3PUXF 3LF0A 1XR5A 4CLFA 1C0UA 2ZHAA 3MCNA 4F4WA 4LF4T 2R4FA 2BACA 1IUJA 4CLPA 1T3NA 2VFSA 2BRKA 2XY8B 4CLSA 1F5BA 5KFKA 2AKWB 3IWLA 2HNDA 1Y5IB 1CUNA 5U47A 1IKWA 4EUVA 3W60A 4U7IA 3O44A 3I9ZA 3ZZZA 2AJ0A 1G1XA 3GYNA 5IZHA 4EZ9A 4ZI2D 1HFEL 3M3ZB 4H54A 1CEZA 3W63A 2W2MP 2W4XA 2AGPA 1CSJA 1DTTB 3KLVA 1WDTA 1NO8A 2E5GA 1C4CA 1OWAA 4ED4A 2Q9QB 2OIHA 2A2CA 3D66A 4IFYB 1W26A 3WZ0A 1RAHB 4B3MF 5C42B 5CH7B 1IBKF 2E5LJ 4NLOA 2GK9A 1QAJA 4OX8A 2F8HA 3AJ2A 1WD6A 2AF6A 2FJAB 4ZP8A 5D4OA 1RAJA 4P09A 3CIMA 4CQ1A 3HHNB 4RPFA 3ENAA 3CMES 1U1MA 1FJGT 4R0JA 3CC7S 1S1UB 3OR2B 1S97A 2ES0A 2O66A 4W98A 4ZPTR 3AE7A 4GVLA 4HWDA 2RJZA 2QL7B 4OLPA 5IM0B 4JI7T 2ADBA 2DHXA 1MMDA 1CJUB 3QNUA 5B0DA 4LR7A 4TYBA 1HWLA 4FVCA 2YNGB 1JKHB 1JLEA 4RW7B 1HCIA 2KU7A 3X1DA 1UETA 3NRBA 3IWNC 2X0YA 2HHSA 2XQ8A 5H9EK 1HQEA 3JYTB 1S1VB 5ABGA 4DFPA 3OYXA 4GKKF 2ZZNA 2LM2A 4V19J 1F9HA 3NGTA 3KLHB 2DCFA 3CTRA 4RKUC 2NR0A 1JXVA 2VA2A 1N36T 1BWVA 4U67Q 2AJFE 3TLSA 3MMBB 3QO9B 1SJFA 2IDOB 4CT8A 4G1IA 5K8PA 3WBZA 3EM1A 3HVRA 4FF4A 4H9NC 2AV5A 3PCOB 4DOZA 5CXTA 2XZEA 3H7HB 2V6YA 4J2CA 2KRBA 4B9VA 2XGPA 4I43B 1DHMA 3TWZA 4PWDA 5E41A 5HP1A 4JLEA 4Q43A 3OTDA 4Z90A 3UVJB 4UVCB 4DU7A 2QSFA 3BN4A 2XS5A 4CN4A 3AVSA 1JLCA 3V6KA 2RA1A 2VG7A 3W15B 1BY9A 5FY0A 1RAOA 1SC6A 2UUCT 2OSQA 1Q1KA 1UJ5A 4LRBA 3OJSA 1YJ9S 3GYXB 1YZ7A 4DL7A 2JMKA 5DQIA 2J6UA 1KHWA 1KP6A 4UF4A 8RUCA 1F0XA 2E9XA 5ETWA 1KHVA 5F8NA 2XWXA 1FKPB 3ZZOA 3DLKA 3W66A 3Q5EA 1FO1A 1Q5VA 3I9V9 2YKSA 2CQIA 1P6TA 5DETA 1IR2A 4F3QA 2QV6A 4ID5A 1YRUA 1QAXA 3G6VA 2JQ9A 3PHTA 2HHQA 3M6VA 3EZ5A 4J9SA 4C90A 4HFCA 4C9DA 2MQNA 1S1XB 3CULA 4KPYA 5ABFA 1LWXA 4KAIA 1VCSA 4HEAA 2LCWA 2HZCA 2IIUA 2V7JA 2Y0SD 2F4VJ 4I67A 3CW2C 3NZPA 4JB8B 3ZZUA 4LF9J 2XMWA 1YWXA 3DRPB 5IC4B 4XZCA 1XJWB 1PJ5A 3WQPA 2P6SA 2BANA 4A56A 3S6EA 4PG8A 4IDPA 4EEYA 2B9YA 3RYFE 1T9VA 1RWNB 4LR8A 3JB9k 1EZ3A 2EHOC 2XY7A 1U1KA 4B3RF 4ZI3C 2HNYB 3HXMA 4WE1A 3EJMA 4B17A 3PACA 3N6MA 2A9UA 4OI4A 4ZPAA 2VVSA 3ZO7A 3H5YA 3SQGA 1N5SA 1X0PA 5CABA 4Z91A 3QIDA 3I4PA 4Y2MA 4GC7A 3OKQA 1X5OA 4ZJLA 1RU2A 2XHEB 5HEHA 5K8NA 3PYEA 3M8QB 1IR1A 4MKYA 2G0IA 2GQ2A 3ESLA 5GAHI 2H48B 3BGLA 4JI5F 3NGUA 2GZOA 4H63V 5LJNA 3PRBA 4O3QA 1QUUA 3PG9A 3LA0A 2VKHA 3DLEA 1N5YA 4B9LA 2K3KA 4Y34A 2CAJA 2WB5A 2VFUA 2IAJA 3HKZD 1RYSA 3UTKA 2L9DA 4YJ3E 4AQYF 4TV8E 3THVA 2CJBA 2W24A 1RTZA 4NLUA 5LXRA 4O23A 2JWNA 2N82B 4HI2A 1F3FA 1RTHA 1HX8A 3PZPA 2UUAF 4M1KA 1RACB 1TK5A 2UUBF 4KHPF 2D9PA 3H2UB 3HD2A 3W9JA 1YITS 1LEOA 4UOCA 4ZPCA 3P4QA 3KG1A 2FJDA 4ECZA 1M1KT 2OLTA 2CZ9A 4ELTA 5JR9A 1Q95G 4PWWA 4U95A 3CNQP 1BUXA 1LWEB 4MKVA 1U0HA 4B3MT 2E1RA 4O4IE 3QWPA 3NGRA 1IBKT 2EWHA 5LGNB 4CI2B 2R7TA 1R31A 3NEKA 1CBKA 2DNYA 2XYHB 2KWIB 3NXZA 4AISA 4RW6B 2Y1JA 3DM2B 3B13A 1QTMA 2CPJA 3H4DA 2JHEA 1G7CB 3GILA 5KFXA 1Q0NA 3PX4A 1UWAA 2FD2A 3NMAA 4X66F 4ZI7E 2CDQA 2ZM6F 4A98A 2QVAA 3SDEA 1FI4A 2PG8A 2IC9A 1U26A 2MAWA 3PFEA 4N8OA 3PW0A 4DX8H 1UZHA 3G87A 3ISNC 3UU5A 2I59A 4DCOB 3RU0A 1S9EA 1SJ1A 2IVMA 3OJAA 2VG5A 4C4WA 5G0RB 3MEDB 5ADXL 2HN2A 2J7UA 3KJVA 5C8YE 3CJTA 3TAPA 1J27A 1O51A 5IWAF 4IE5A 3PUVF 4EB6E 1VJQA 2J8AA 2RT3A 1ACMB 2OTLS 1WOPA 3RG6A 4IHJE 5HVHA 1D0EA 2CHNA 2BQRA 2YPZA 1X9WA 3FKBA 4OJ1A 3UNGC 1C1CA 1NZ8A 2Y1IA 5HXSA 4C8MA 4DL6A 4GKKT 2W9CA 4DV3J 2FLNA 3FNNA 1KBRA 4YMEA 1RT2A 3BK9A 5JDLA 2BBJA 3ZXWA 3OSPA 2UXNB 1G6BA 3C6TB 4LUBA 4C8YA 5DS7A 1RABB 3H2VE 2XASB 2BM0A 4TVAB 1KFDA 4QXBB 2HH7A 5FLXU 4FPRA 4DF8A 2R7XA 1HWIA 4M5GA 1U4BA 4GYRA 2HPJA 3G71S 4CXWA 3UQ7A 3EI0A 4QYZJ 3MM6A 5HQMA 5LB7B 4CLZA 1MW7A 2VC0A 2KXNB 3QNWB 1FJCA 4P7VA 3KYLA 1VBZA 4RW9B 3M1VB 3G2XA 5CZXA 4KH1B 3H90A 2NPIA 5KFVA 1TKZB 2VA3A 3RR7A 1H7CA 4LFBT 1I6JA 2CG8A 2XY6A 3IFEA 1U1RA 3FRZA 2CPTA 3VR8A 1K1SA 4C8KA 2B9EA 1MMAA 1ZBTA 3TEHB 5J2MB 1AB8A 1T9XA 2ZD1A 1UX5A 4LF5T 2V69A 3T5KA 4AXPA 1IAPA 4X1KE 2H7VC 3HCXA 4U96A 1SH2A 3BBFA 1RWKB 2VQEF 2VKJA 1HBMB 3SSQA 1JB0C 2J7WA 3WAKA 3R6LB 1U49A 2F3JA 4YY3J 3Q2SC 3J81U 3M65A 2HPUA 3TYTA 1HTJF 2JX2A 3GZ7A 2RE1A 2N7YA 5K9FA 5LBMA 3QGIA 1RT7A 5AQNB 3G6YA 4DSJA 4L6V3 1SQEA 1S72S 2C2EA 1UJ6A 1M5KC 2UXBJ 5J1GA 1EAYC 2Z2LA 3MTKA 4DL3A 2AZ1A 5KG4A 2X66A 1SIWB 2MKIA 2AGQA 1CHUA 4HTEA 1OY9A 1AFJA 3GR0A 4K7QA 2M7SA 2XMVA 3BYRA 3LBXA 2K48A 2CADA 4DV0F 4ER8A 2AJ4A 4LSNB 4A8MP 3PNIA 4ECRA 1WLXA 4RW4A 1XMOT 1IKWB 3LSVA 2LLYA 2DR8A 1VRTA 3FUYA 5M2RA 3ZYKA 1R8BA 5KFZA 3ETOA 4C11B 2CM0A 1KNRA 4DZDA 2KDOA 1SB6A 2RRNA 2ZKUA 4CM0A 3BN7A 3N6NA 3THTA 1D1AA 1QUVA 3MM8A 2CXLA 4H9OC 4I6YA 3QRQA 2CMRA 1SXLA 3ZFVA 1S7IA 1S6PB 5HN0A 4FZVA 4JI5T 1EP4A 2A1BA 2CPZA 1X5TA 2LEHA 1BR4A 1U1LA 2ZE2A 4Q45A 3DOMA 3ZTQA 3IO1A 2MEWA 1HIYA 1QSSA 4CYUA 2V2QA 4DZ6A 1H2UX 4X20E 3ET6B 2RKIA 5KFUA 4O4JE 4J9NA 2X9HA 5HWYA 4U7UK 5ETPA 4AQYT 4EMDA 2Y3YA 2ZBCA 4ZP7A 2W66A 1TL1A 2DWKA 3LAMA 1GFWB 2WOMB 3UDVA 2UUAT 2YN6A 3PKYA 5LCYA 2RQMA 2PFDA 1R8CA 4UY8T 2C2DA 1O8BA 3DP7A 3UR0A 4NUUA 2P8IA 4DUZJ 2UUBT 1JLEB 5HCMA 5DG7A 3M30A 3KMQA 3CCSS 3PIOQ 3W2VA 4AL5A 1SA0E 3KMSA 2XCPA 5T7LA 1T72A 3QJJA 3SCLE 4ED3A 2DITA 1S7HA 4CNYA 2I8EA 2IM2A 2ZEJA 4MH8A 3LP2A 5DZ7A 5FKYA 3MR6A 4HWHA 3B4DA 5KOWA 2ZH6A 3L7PA 3ZC1A 2UXDF 5J2PB 3SEOA 4X64J 3OVBA 2FJVA 1XNRF 2V5CA 3CCQS 3QIPB 2F5GA 4HFDA 2NXEA 1ITPA 4ERRA 3PXGa 3JQJA 4P71A 4A8OA 3ZC4A 1XIQA 2DHAA 4ANJA 4X66T 1OSDA 1YIJS 4UUWA 2ZM6T 1E6YA 1UCNA 3G06A 1HNVB 3DYAA 4A5XA 1R0AB 1CG2A 1E1HB 2XAHB 2X1GA 2MKKA 1DLOB 1HBUB 3FBFA 3PW7A 2UV8G 2FVSA 2X7IA 3RB4A 2L9QA 1DQ8A 3KLGB 4J90A 2BA9A 2QLBB 3J7A1 1RT6A 5IWAT 5EK3A 3EXCX 2R42A 3GCXP 3SZ2A 2MQ8A 3CO9A 3R7SB 4K4TA 4TWHA 4TY8B 2D2SA 5G4DA 2CVEA 3QWUA 1L0VA 1KQSR 6FD1A 1FJGJ 5EX3A 3VGTA 3BR8A 1F5CA 3MACA 2W4PA 2UP1A 5B0FA 3VQSA 4NLSA 4ZJOA 2HQFA 2R7SA 1H2VZ 4JI7J 5AT1B 3NRXA 3E01A 5AQGB 3M8PB 3JC6C 2KNDA 4ZOLE 4KIAA 1BQNB 3MJXA 3KOAA 3N2OA 3CQGB 3K5MA 3DMJA 4F3MA 1CC8A 1UVMA 2QE5A 2OHDA 5C25A 4BAYB 4U74A 3N9NA 2IVYA 3CPZA 3T5LA 3ZYLA 3FBZA 2RF2A 5IQQA 1A0OB 1MU2A 3DRXA 3T19A 1MMNA 4ATNA 4DR6F 4NPPA 1KQGB 1A9NB 2G0UA 2NREA 2ZH7A 2CJQA 2X9YA 3BYPA 5HMXA 2Q6CA 4EBEA 2QA4G 4C3MA 4DPUA 2MHEA 3MI7X 1RT3A 5BR8F 2EFOA 2HNZB 3G82A 1L3KA 4WU2A 4ZPWR 3RUBL 4JI6J 4WE1B 2WMOA 4F36A 2HIQA 2BQ3A 3D54A 4JI2F 1KK7A 3CWZB 5E3CA 2VQET 5IFMA 3HO1A 3A8IA 4CZCA 1RTIA 4UEMA 2JQHA 2QFJA 1IQZA 1G4CA 3C4XA 2GIRA 1KD1T 3ITHA 3FK4A 4F0KA 4KGZB 3MURP 3LGHA 1S9GA 2R7QA 2YKMA 1FNOA 5IYZE 2VB6A 4F2SA 3KTQA 4NXNJ 1UEKA 3AQOA 3R5BA 4RBTA 4ED0A 5J1NA 1TUGB 4XDCA 2YK0A 4YB7A 1FIOA 4CIOA 3HHLD 4CLWA 3HFKA 5HMZA 4FXVA 4HACA 3WC2A 2CDRB 3LP1B 2JRKA 1RKJA 2IAJB 3KLFB 4DWIA 2WVDA 2I5JA 2ZNYA 4B3OB 3HD1A 5H6RB 3TJ9A 2FVPA 1WSRA 3I0SA 4NZ0A 3RGIA 4WFXA 2IFXA 4ZLLA 4FKXA 4O2AE 1FRXA 4YTPA 2BKOA 2ILZA 5CYQB 1HPZA 2YWFA 4DV0T 3GIJA 4BDPA 1IJEB 5ABEA 1TMMA 4N77A 1NK0A 1TFWA 1B3TA 3LO3A 5J2QA 3FCHA 3DTOA 2UXXB 1R8AA 2MPKA 4AE5A 5C5JA 1VBKA 3RR8A 2NCKL 3DKDA 2QO3A 3RH3A 3GJRB 3KV6A 1ZS6A 5AQQB 2UV8A 5EZYE 3EWGA 1VFJA 2KM8B 1GEHA 4UT4A 3CIRA 3UU3A 3HDSA 3KJQB 4IR1A 3I0RB 1LKXA 3KV9A 3EUNA 1Y3KA 2Q43A 2HHXA 3ZMVB 1RJJA 4NE9C 4K4VA 5HROA 2MYSA 2KXFA 4NA3A 4KUMB 3CJ4A 4UZCA 2VZ9A 1KEYA 2DGSA 1B0PA 2XPKA 1BHNA 1X4DA 3A3NB 2HRTA 3CJQA 2MKSA 1S9EB 3NBPB 1CJKB 1N34F 4QHOA 3FSXA 4OLOA 3KJVB 1IWGA 1QJHA 3RKOA 4YSYA 5JH7E 3L9ZA 2ASJA 5E3QA 1UURA 2YOEA 1Y5LB 4TQSA 1AZSA 5HBMB 3KK2A 2FGCA 1FEWA 2LQBA 3SSSA 2IYGA 5KFIA 3F2EA 3DLGB 2DHGA 4IRKA 4HTIA 3GPAA 1RWMB 1WHWA 5KG7A 4DU8A 4LIWA 2UXDT 2J0SD 1RT2B 4MFRA 4CRJA 1EARA 3HKDE 2YU2A 1DTQA 1AYEA 1N0UA 2W2NP 2FPHX 2EFGA 4GO5X 4ICLB 5CQGA 1FDNA 5LMNJ 3OHAA 3OPKA 2K3IA 3WDOA 2LEPA 2LSIA 1F9FA 2MMYA 3GFXA 1MSWD 3O1HA 1UL3A 4KGMA 1N33J 4ZOSA 4IH6A 4QX7B 2AQ4A 3IRWP 4Y2CA 4X4VA 2XB2D 2PMHA 5L3FB 2NR4A 1X5SA 2RNEA 4EBDA 3IRXB 4DV7F 3IGVA 2ZJRQ 5LT5A 3UNYA 4PRFA 2YWKA 1IBKJ 3GQCA 3W5ZA 3P5TL 4NOHA 1REVB 1YJRA 3UCUP 3IMQJ 1YJVA 2BOAA 3K1SA 1K44A 1IBLF 2KHDA 3EZOA 1U47A 1MMLA 4O8SA 4MKAA 5LHGB 4IQMA 2IBOA 2J4GA 1JQGA 2DNMA 5ETTA 2K24A 1UVJA 3RIUA 1X4HA 1A7GE 4F8RA 1S1TA 2AE9A 5J1PA 4C8LA 4OI6A 4YB5A 2DB1A 2FC8A 3AE2A 3OUYA 4EZHA 2GHVC 2OUGA 2GVDA 1HHTP 1HMVA 1WUUA 2JFKA 2OO4A 2PEHA 3THPA 3TX8A 4GK5E 4CXYA 2R7VA 2KT9A 4DUYJ 3AAWB 2XO7A 1ZPVA 4DSIA 1KNZA 1YZ6A 4PJJA 4PJNA 2RRAA 1J1JA 3NMRA 1XNQF 4DV2J 4X62F 3CX6B 2NYHA 3PW4A 1TKXB 2MQLA 2DEJA 3UDLA 2ZHBA 1YSJA 3PEHA 1C4AA 4DR6T 2V34A 4BHQA 5AQIB 2CXDA 4NA2A 1HI1A 4HWFA 5LSRA 1MMGA 2OPRB 4ILBA 1VOMA 4FI5A 1C2PA 1H6KX 4H4OB 1HNZJ 3HFZB 2ZOGA 2D41A 5LJ3Y 5GAHU 3JSYA 4EBCA 5BR8T 1N54B 4Q8FA 1UA1A 4LFCJ 1TL3A 2ZUAA 3IR5B 2H4YB 3RYCE 5ETSA 1TVRA 2YKNA 1VQ5S 4KGVB 4F0MA 4JBCA 3G9CA 3UCGA 1VRTB 4HVZA 2W7OA 3J7YU 3TUJC 1IM4A 1E6VB 3SCJE 1OMSA 1T94A 3NS6A 2CQPA 3AD8C 2VOPA 2ZH2A 3ILIA 1VRBA 3N9OA 1UVIA 3W2WA 4OJHA 4LRDA 1RU1A 3E8OA 1EP4B 2QYWA 4RUCA 3CJRA 2XQ6A 1VDHA 2LA4A 1VQYA 5HEJA 3DOMB 3ETUA 1IKYA 1MIWA 3ICLA 1Z8UA 2E2AA 4CDIA 4WJBA 2OP5A 1NJYA 3HHLB 2Q79A 2LEAA 4ZLJA 4USWA 4W90B 2RKIB 4KV8A 5D3GB 1TKDA 4TNVA 2V0NA 2DR7A 3P4WA 1BXNA 3PJ9A 4YDXA 3HVWA 4Q7AA 1MWYA 2V94A 4YTNA 4IH7A 3A1YG 1WTFA 5DJQC 4M63A 2KINB 4QBUA 1HW9A 2DNNA 4UQTA 1CJVB 3GG1A 3CGIA 2O67A 5HMYA 2DXFA 5B0GA 2MJNA 3AD9C 1VHIA 2GFFA 1G3OA 5I42B 4OHXA 3OBVE 3GCWP 4J9OA 3QRRA 2K2PA 5J1EB 2JVRA 1RT1A 4PW8A 3P4PA 1X9BA 2XQ5A 1JLQA 5DDOC 3LP2B 4JYAF 1XWMA 1UJ4A 4URGA 2EK6A 2MYFA 3DXSX 1VQ9S 2WBRA 3UPFA 1RSCA 1RAEB 4B3RJ 5HWXA 3EXYA 2XQ3A 2FJEB 2BE7D 1IBMF 1FRHA 3H4BA 1NEKA 2B43A 3F41A 4KC5A 3MAAB 4ANEA 5FNVE 5IC6B 2ATCB 3B6BA 2KJWA 5HQLA 2O3DA 4PQUA 4CXXA 2HQDA 1VQ6S 1YTYA 4USVA 2K1RA 3JTNA 4DPWA 5CA0E 4WFNQ 3FZFB 4OI2A 2BVMA 2ACYA 1D9DA 2DCLA 2V7IA 2ZJPQ 1JJ4A 4TY9A 3K89A 2QFIA 3O1IA 2X1BA 1RT6B 4I2PA 3FEYB 1U48A 1UWBB 2B5JA 3R9LA 2OFGX 3LTOA 1PYSB 4IOAQ 1RT4B 5FY1A 2WWVA 2DNKA 4FF2A 2MGZA 3R5DA 5L1IA 1F2GA 4M1PA 2WAUA 4DO0A 1ZA2B 3VZHA 2H5IB 4CLKA 2D69A 4ERDA 4AQYJ 4B9TA 4FF3A 4P2SA 1PGZA 5AQJB 4DR2J 3HKWA 2MB0B 1M62A 3BQ1A 4PJMA 2DRAA 1SJRA 4JP8A 1ZH5A 2AYGA 4TU9A 3JQKA 4K50A 1WDDA 2FY1A 2UUBJ 1FFWB 4KHPJ 5HL7Q 4DQPA 4EYHB 2CQ1A 3EPGA 2BJ7A 1FKAF 2ROEA 4GOUA 2CFXA 3QGGA 2R7RA 2WP9A 3NAIA 4YSXA 3JADA 2KYXA 3Q24A 2GJIA 4U2YA 4QWNB 4DFJA 4U7YA 5J2UE 2DJWA 3N6LA 4K4WA 1FDAA 1HNWJ 2G0CA 1IBLT 4JI0F 3M7VA 5KT7A 2ODVA 3HVAA 3VAHA 2KVIA 4ZXLA 3W65A 1QSLA 4K0KF 4X66J 2HQIA 4DSLA 2ZM6J 2L3LA 2AYEA 2JRSA 1M5VC 2C22A 1O0PA 4OX9F 8ATCB 3QJLA 1C1BA 4PXEA 4H4KC 3DGVA 2E9ZA 3TUZC 2M5YA 1LFWA 5D8HB 1RTIB 3VAMA 4ZCKA 5FY7A 5IWAJ 2N1GA 3D6MB 4IE7A 4I1TA 2JQKA 2WONA 5F8JA 1KFSA 2ABYA 3GIRA 1T05A 3ITHB 3HT3A 4FYVB 3OXLA 4OYOA 1I1GA 3SSRA 1LWFA 5HAOA 4USUA 3BJYA 2HZVA 4X62T 2DL1A 5KT6A 3LOUA 2M8DB 3CK6A 2FIUA 4DPYA 2RDDA 1EETB 2H7OA 2FZCB 3M8RA 2PMWA 1FXRA 4HT7A 3AFGA 1DZ5A 4N47A 4HKAA 2A3DA 1S10A 1KQKA 4HH0A 1PYTA 1M1GA 3AODA 2RILA 3BREA 4Y2KA 1EZZB 1KTQA 3PUAA 5LJ5Y 2MLXA 3CJ8A 4ITSA 2JH3A 3P4SA 1LXNA 3N9MA 2DGTA 5J2QB 1VQKS 1RZMA 4ECUA 1YQ4A 1XBWA 2RHSB 3CD7A 5CB4E 3N9PA 4DS5A 1YKHB 1YW0A 1S49A 1D0ZA 5AQLB 4K59A 3WHIA 1LQ9A 3ZEFB 3VAIA 1ZM9A 5IOLA 4S0MA 1ZZFA 2DISA 4QCLA 4L3NA 4YUDA 1TUVA 4QPXA 2IC3A 5LL6d 2KFYA 4QW8A 3Q2TC 1W0BA 1NNDA 4ZP6A 1QE1A 3UN5A 1FRMA 2IRXA 4QR1A 3IM9A 4P75A 1ELOA 2B6AA 3IG1B 5AQFB 2H88A 1R8HA 3KVBA 1WFDA 5C2CA 5LG3A 3ZZPA 5LG4A 1FRIA 2GMJA 2XG8A 4IDOA 4Q0BA 2HQGA 1HNIB 2DGOA 2VQEJ 3W8PA 1XDPA 3FXEB 3JAMU 4USMA 1F5AA 3Q5WA 2E7VA 4OJGA 3J80Y 1OQ3A 5FLXY 4ED6A 5B0AA 3E2EA 2IMWP 4DV6T 1GH8A 5IHYA 4BS2A 4I56A 3G8QA 1ZTWA 3O5TB 1SPBP 2G1DA 1KFYA 2P9BA 4CO0A 4RBVA 3N5FA 1LKZA 3T1HT 5AE3A 4I64A 2JC0A 3HP6A 4B9SA 2W61A 1VQ7S 1GMWA 3EDUA 4BC7A 4IOCQ 4OZNA 1BC6A 5KT4A 2XY5A 4JYAT 2DNGA 3DNCA 2VV5A 2A2DA 1MLAA 2EHOD 3ONXA 4A46A 5ETRA 3TA0A 4DQSA 2YWWA 5KFAA 5E3PA 4ZI3D 1JIHA 4TN7B 3MDFA 1E7PA 1X31C 4K5SA 3WX4A 3AEGA 2XNQA 1IBMT 4A8QA 3CEDA 4XBFB 2DCUB 3Q2MA 3PYFA 3M6WA 2Q9QC 1AXQA 3CKDA 5JMNA 3TLTA 1HBOA 4LSLA 4MIWA 2ZHOA 2NXNA 1OEDC 1HQ2A 2BX6A 4Z7CA 4NI2A 2VG6A 5KFJA 1S6OA 3O6QA 3CCJS 2RQKA 3J7Yq 5MAOA 4F4YA 4AL7A 4NCGB 1CJTA 2PFFB 4MIAA 4J9VA 4KR0B 2HHHF 3JCFA 3EGWB 3R3TA 4CO2A 1TL5A 1I6ZA 1P1TA 3VGUA 1AFIA 4WTYA 1CQNA 4LVOP 3X3UA 3V6DB 1SL2A 3BR9A 2FHJA 2U2FA 4LF8F 4FJOA 2N3OA 2J6TA 2H9ZA 3G8SA 1SI9A 1OYDA 3CDEA 4OMFG 1WNEA 2D0UA 2WU5A 3N5BA 4JI1F 2HG4A 1FNMA 1FWLA 1YBAA 3CB4A 3C4ZA 2HGLA 4H4MB 4USHA 1S6QA 2IMOA 1YK9A 1RT5B 1F3VA 1WC6A 3OUYB 1P1LA 3BH6B 1FEEA 1UK5A 4FS1A 4MJKA 3MM7A 2DI4A 4GRSA 3FQKA 2XQCA 4MBQA 2BV3A 1T03A 3DU6A 5FDLB 2GJFA 4NRUA 3MR3A 4TNOA 1M7KA 1MNEA 3BKTA 3I82A 1Y00A 2PGCA 3GMGA 3M2VB 1VQ8S 2EC0A 4D3GA 4NLTA 1K47A 2BVZA 1XNRJ 2XSAA 5FXXA 3EHZA 4OZ1A 4JI0T 4OZ5A 2E1MC 1M1HA 4OJ3A 4LQ9A 4K0KT 3MF5A 3GLJA 2EC2A 2ACMA 2EFNA 1BQMB 5KFCA 4DR3J 1R6YA 4PR6A 3U1MA 4FP9A 1TU0B 5JXSA 3KUGA 3FGVA 4OX9T 1WC1A 2VKOA 3ISND 1OYEA 2LKZA 4KI0F 2XTLA 3JSMB 1TKTB 2R7UA 3P8CD 2H65B 4HN9A 2W4DA 3LALA 2CQCA 3E22E 3DLLQ 1RK8A 3FEZA 2C5JA 2YX4A 1UPMB 3QT5A 3MEKA 3KWMA 3C2PA 1X60A 4RU9A 2XS2A 2DTJA 1GX5A 5AE2A 2ZNZA 4FNIA 2IVFB 2FJBA 2KI2A 2QLFB 5F8GA 2LE8A 1BR2A 2V7KA 1DTTA 2CBJA 4LR9A 1VR6A 4ELUA 3IBWA 3AY0A 2UXCJ 3BSNA 4IFYA 2QGSA 3TNVA 3SFDA 2Z30B 1QSDA 3A8JA 3DJBA 3T9NA 4ILAA 4K4XA 2VASA 2J0XA 4FPIA 1XR7A 5HXEA 1ZAXA 2DNRA 5AXKA 3PEJA 5KT3A 1T8EA 2B4PA 2FJAA 3KHRA 2WHOA 1TTHB 3V4MA 2VQFF 3CJ3A 3OR2A 5KT2A 3VQTA 3IF8B 1GMWD 5D78A 1WF2A 4X4QA 5IM0A 1TELA 1ZP0A 1NDLA 2V8VA 4OYIA 1GX6A 4ANDA 1W09A 1CJUA 2WWUA 2MQMA 4WFBQ 2HFOA 2DR6A 2MKYA 2YNGA 1JKHA 1SC1B 2I9SA 3T41A 1JK9B 3LDQB 2NXCA 4M5NA 2JEIA 2R9LA 3HM9A 3OD2A 5D4NA 3U02A 1W25A 4P1NA 4CLTA 2DNXA 2N4DA 4JI2J 2A0FB 3PM9A 3GV8B 2VJVA 1PBUA 4PYAA 3C46A 3QGHA 3T1YF 2NW9A 1RBLA 2ACZA 3JYTA 1S1VA 4YHHJ 3AT1B 2RQ4A 4NZ6A 5KG2A 3CCES 4OHVA 1JWWA 5AQHB 5DO2A 4FS2A 5LMUT 4PQUB 4AXIA 1NLKL 4R8UB 5M2UA 3KLHA 1NDPA 4J9RA 3B8HA 1WKJA 2P6TA 1JXLA 3MMBA 1VBYA 2YKQA 1Y7PA 3VCDA 3LG7A 4OZJA 3DRSB 5FMNA 1H7XA 4O3NA 4H9PC 2YX7A 4K4ZA 4EO6A 2NYIA 1BR0A 3A7MA 2IM0A 4TXSA 4QXHB 1HD0A 2NPFA 3OL8A 3KUEA 3OTCA 4C0OC 3AJDA 3UVJA 1BLUA 5CHCB 5CA5A 4G65A 2MTQA 5LXTE 1ZM3A 4RNOA 2WBMA 2EHOB 2HS0A 2ZM2A 5I3PA 1GMUA 3J7ZT 2X68A 3PW5A 1U8SA 1ULRA 1VS3A 1R7IA 2KG0A 1NK5A 1M0SA 4HKQA 5L38A 5RUBA 1SUQB 1FKPA 1RHUB 2CYYA 5FVLA 1IXKA 4G2AA 1SJ4P 4R5PB 2B3TB 2KVQE 4KKOB 5GADI 1KWMA 2UU9T 1QDUB 1T98A 3PJXA 2KB2A 2HHHT 3IN5A 4OZ2A 2BG9C 1UP1A 2AD9A 1LW2B 4GKJF 3Q89A 4WWSA 4DBQA 2NWBA 3BQLA 2BKPA 4LF8T 4ASKA 4A4JA 1DARA 4Z2XA 2GQCA 4J9PA 2B9WA 2R2RA 2RP4A 4JI1T 4CO1A 3MEEB 3QSIA 2GVZA 2VURA 2FLPA 2ZBRA 1N34J 3N4WA 4FKYA 4M5DB 4U2ZA 1CVJA 4MKBA 1N4LA 1U24A 1WORA 4KBIA 2NUHA 1RTJA 4LF4F 1OJ4A 1NAQA 3S8SA 4ZPBA 5CYMB 2WONB 2K8GA 2V8SV 3T8OA 1H74A 2D3OR 2WY2A 1RGVA 2DO0A 5CYJA 2HNYA 3CDWA 2V4RA 5HMWA 3OXGA 4AKGA 4HHHA 4HHUA 1KNPA 3KHGA 1KN6A 4U7CA 4IL9A 4NMLA 2BE9B 4KB7A 2XJ7A 4N78D 3N79A 4KH0B 4OYKA 3M8QA 4UZBA 2WW8A 2QN6B 1R8IA 2DO4A 4X4TA 3VGVA 4RNNA 1DFDA 5HQ8A 3G86A 5EHHA 3A13A 3I31A 1VC0A 3M2RB 3QRPA 5H9FK 4RUAA 2LOPA 5JTGA 3N9QA 5EWGA 3E08A 5LJMA 2DGVA 5K14A 4DV7J 2NTXA 5IS2A 2VBZA 5FYMA 3FBBA 4TU7A 2C3MA 2BQUA 5KG6A 2DEIA 5CCLA 3VAJA 3R6GB 1HNXF 1D0XA 2ODUA 3TAQA 3K58A 4HWCA 5FD1A 2C0SA 2XWYA 1NJIT 1T0TV 3CJKA 2CZ4A 3K5LA 3D0IE 2GO8A 3NP5A 1SCJB 3UR3C 5D4LA 1R0CB 4U33A 4UW2A 1R27B 5KFRA 2XS7A 5HVGA 2XBPA 1V9DA 4L72B 5LP6E 3GWHA 2KWHA 5C3JA 3SOLA 1LWEA 2GAGC 4RL1A 2BEFA 4M5HA 2HS3A 4JI4F 1KVIA 3I5AA 1XZYA 3RC8A 4ALZA 4LF7F 5JDMA 1FFSB 2HBZB 1RE1B 2G2YA 2RIJA 4RW6A 3WC0A 3DM2A 1XNQJ 2L8KA 2UUTA 3OTOF 3G6ES 1VK3A 4N56A 2VQFT 2NXUA 2F1FA 3QUJA 2C42A 1SQFA 2YH0A 3ZMSB 5EX0A 1VIOA 5GAGU 5G0RA 3MEDA 3MXHP 3H0PA 5F3TA 2WRMA 1JXEA 3RPUA 4URSA 2V2VA 3KV4A 4U8VA 5EN1A 2CNKB 2UZAA 4BBYA 2RH3A 3H3MA 2UUCF 3PYGA 3KV5A 3IEEA 3UD4P 1NB2A 3D1OA 3DC2A 4OYWA 1NPKA 4PG6A 4O3RA 1XMQJ 3T1YT 2OMLA 5ADZA 2V5HG 1N5VA 1PKUA 3HR0A 4L75A 2H1YA 6AT1B 3KG4A 5DQHA 4TWFA 2IY5B 2QC3A 4MK8A 2XQYA 2XAQB 3C6TA 3A3PB 3UFCX 3ZMZB 5KFQA 3DFEA 4QYRA 2AEMA 2EFVA 2B4VA 1MN7A 1KR4A 3V5UA 5IXUA 3O3LA 2BW2A 4B3ST 4QZVB 3DOLB 3ILOA 3M9NB 4EOZB 3ZTOA 2KSRA 4IL4A 2FYXA 3GFZA 5E2QA 3PX0A 4ECXA 3IWXA 2P9EA 3LFMA 4JV0A 2YEVC 1D3WA 1RTDB 4DL4A 4UVAB 1KEKA 4RW9A 3M1VA 2QRXA 2GGPB 1EHWA 4PWUA 1HQUA 1J5OB 1TKZA 1S6QB 2F8MA 3OSNA 2B7BB 3HF5A 3VKGA 4I50E 2GAHC 4DV5J 1U1OA 4CH1A 2V8PA 1OWXA 3FQLA 2ZZTA 1GT8A 3O1LA 2CWXA 3LK3B 5LOQA 5J2NB 2N7CA 5THWA 3BGUA 4TWDA 5J2MA 2QT7A 2IYIA 4LRAA 3CCMS 2Q66A 4WXWA 2LQ8A 4UV8B 2H89A 5EGYA 1B0TA 2ROPA 4O44B 1W9RA 1HBMA 1WC0A 2FBWA 3BH7B 5HSPA 1WI8A 1ZEEA 3JSRA 2NS1B 4ES1A 1IR0A 4GKJT 5DQVA 1KONA 1H98A 2J5AA 1IBMJ 1HI8A 2OAUA 3MXZA 1EX8A 4ZK7M 3UCZP 2ERRA 4N5SA 3TLUA 3OJUA 3G4SS 2YKPA 2JZ5A 2XMKA 4UOHA 3DRYA 3JTOA 3O8WA 2OGUA 4JI8F 1JNZB 4FXDA 3DRRA 3LAKA 3AOCA 2XLKA 1IWAA 2F65A 2X0HA 4NMXA 2C3PA 1RLCL 4N41A 2JVOA 1UA0A 3AEFA 5FVKA 1H72C 3QK6A 4FVMA 3DN9A 4WKRA 5L3CB 4DV1T 1AUDA 2XSJB 4LSNA 4OYJA 5AQSB 1DQAA 2LMIA 4LBPA 2E9XC 2M6BA 1V5VA 3CO0P 1RHRB 5KFPA 1Q79A 4C11A 4U3CA 5KFFA 3DU5A 2FJBB 1U6BA 2BKNA 4P2FA 2ZZMA 4LRCA 2CPDA 2V1DB 2JLEA 2DPJA 1YKEB 1EJ7L 3PR4A 4QR0A 1S6PA 4WZXA 3BSCA 1KTVA 4EYUA 2YDRA 4LF1A 3AEEA 1NDCA 1T9YA 2RSQA 2AXDS 3GIIA 1UPPA 3FZBA 5HATA 1JLAB 2BJ8A 2XQ4A 4DHVA 4I0WA 3ET6A 3GB0A 1Z0PA 4EYYR 4DR5J 4JEHB 2ZMAA 2HBYB 4JI0J 1Q7YT 3FZLB 2CRLA 2C3UA 4U6PA 4WBNE 3OPCA 2LSGA 2C5KT 3MPYA 3RW7A 1HNXT 3KHHA 4K0KJ 2WOMA 1S35A 1FRJA 1RAIB 1NXIA 1YI2S 4R0EA 2OFHX 8AT1B 2DNLA 4RNFA 3IGNA 3OFGA 4FYYB 2M0GB 3R1HA 4OX9J 4LMZA 4PNIA 3R2CJ 4KFBB 4ZA1A 1OIAA 3SFEA 1IJFB 1Y0HA 5L3EB 1F60B 1RHMB 3D67A 3T9ZA 4ZCIA 2OKQA 2NXJA 3P50A 1X79A 1B99A 4ZHRB 4JI4T 4WBFA 1UFLA 2IPOB 4MALA 4NUVA 3BDPA 4LF7T 1U02A 5J2PA 1YQHA 1M90T 3PX6A 4IRDA 4D3HA 2VL0A 3QIPA 3MTJA 3RRKA 4Q8EA 4ID8A 5B0EA 4X65F 2VFRA 2I0MA 2HPLA 3I56S 2WSSV 3HSZA 3OTOT 5JJBA 4RU2A 3SI8A 2XNRA 1V3ZA 4CN6A 3NGKA 5F41A 4PEOA 1HNVA 2EBGA 1R0AA 2KJVA 1DLOA 1F2HA 2A72A 1HBUA 2EG1A 3PUYF 3MMCB 1RA7A 2VIHA 1N48A 2BM1A 2E7WA 1FERA 4BJNA 2GA7A 4IQXA 1R89A 3KLGA 4DPTA 2C2NA 1B7YB 3CVRA 3PJAA 1YXRA 3TEGA 2LQ5A 3SRZA 3MA9A 4TY8A 2HMIA 1JLBA 3AXKA 2WTFA 3P8BB 4H4KA 5HLFB 4LFBF 4JI3T 3Q8VA 4DN0A 3GJQB 5L1LA 5JVHQ 4K8RA 2O5DA 3FZHB 4M94A 5JR9C 3N2GE 4LFAT 5KFLA 3KG0A 3D5MA 4LF5F 4DR4F 3N5LA 4KQZA 2WQYA 3D6FB 2QMWA 2WSFC 4JEUB 1U4QA 2AJ1A 2B8PA 2RU3A 1HD1A 4OZ0A 4JV2A 4PQAA 3M8PA 4PG4A 5A0YB 2FGOA 3PUZF 4KTQA 3MUTP 2DYAA 4HFVA 2EKNA 3ZSSA 3LUYA 4PG7A 1BQNA 2MZTA 1YJNS 3AB3B 5DQGA 2VONA 3EABA 3VKHA 4WYLA 1S79A 3I9WA 4ZS3A 3CCTA 4X4PA 4QWAA 3HJVA 1HHQA 4DX5A 1WG1A 3IP0A 5D4PA 3UQSA 2J9DE 3ZCJA 2OMOA 1C0TB 2I38A 1R8PA 2GVZB 2L3MA 2U1AA 4ETZA 2M70A 2EFQA 1KVKA 2B4UA 4QIFA 5HCJA 2G9OA 1XN9A 4CO5A 1RTJB 2AJQA 1WHXA 2JOQA 2PDAA 2EG2A 2HNZA 4CI1B 1XERA 1YGYA 1NH7A 1ZOTA 1YKWA 3ZZ0A 3L3CA 2R7WA 1VQ4S 3D9BA 2YWGA 4YN3B 2NSCA 1NMEB 4YEAA 3GJTB 1XMOF 1K73T 3AA0B 3Q8RB 2E5LT 4ZVTB 2RQCA 2PBIA 3PUSA 2CJKA 4JOUA 4OYAA 3IA0A 1QUPA 2YVSA 3MM9A 5DLFA 3J7AN 2CZVC 3GV5B 2BJEA 3ZTSA 2X51A 1D1UA 3V6JA 2CQDA 1WWHA 2AYMA 3SCKE 4PPZA 1VLOA 4MHCA 5K14B 4JI8T 5D15A 4O0IA 5DDQC 2CG4A 3LP1A 2FJWA 2DGQA 2LHRA 3KLFA 4XAXB 3KK3A 3K2YA 3R6NA 4B3OA 3V5SA 4PG5A 4NEZA 1MG7A 3EGVA 1KSPA 3QZ8A 3B54A 2GO9A 3QT6A 4L74A 1LWCB 1UX4A 2CXFA 1JLGA 4RZRA 5CYQA 1NB7A 5GVQA 3BEGB 3M6XA 2E1PA 2VH7A 4GMKA 4KO0B 1KOOA 3CSKA 4OV1A 2H4WB 2BS4A 5KFBA 1HLWA 2N3LA 4MYUA 2PMZD 3NWGA 4HWIB 3CJKB 4CWBA 1IVZA 1CQMA 3VRAA 2YXLA 4NWBA 1QVGR 5D0HA 3RRWA 3DDKA 4FYDA 1I94F 1H73A 1LV5A 4KMCA 4NCBA 3HVTB 3ZMUB 1AW0A 2VOOA 3PDNA 4LQ3A 3I0RA 4ZN1A 1YRXA 2OD4A 3PUWF 4OL8A 2CA9A 4FF1A 1PG5B 5M2PA 4ZIWA 1MROB 2R2SA 2CHOA 3KBUA 4NEYA 4DMZA 3HKEE 1U2FA 2E5IA 2D3O1 5FXZA 2LU1A 2CEAA 4Y3CA 5I4MA 2VODA 2R8KA 1AT1B 4ZVUB 3SFGA 3GN5B 2AX0A 3NBPA 3BGRB 1CJKA 1GMVA 3QT8A 2Y9HA 3SS1A 4DFKA 3UDEA 3IS9B 2YQ3A 4WP8A 3AAEB 5A76A 3KJNB 2QJ3A 5I3UB 3FBCA 4HE8A 5HBMA 4RR5A 4J91A 4ZVHA 2Y8YA 1PCAA 4DV4J 3FZKB 4TX5A 1SE7A 1HFAA 2AMCB 3OXFA 2FJXA 3HSGA 3DLGA 2XYGB 4IFVB 4MYTA 1EKSA 4CT9A 3F73A 2E1AA 4TUYE 2V5DA 4YY3F 4ES2A 2CWOA 4ZS6A 4X65T 5HI7A 3D0GE 4ICLA 4NLDA 4KYZA 3IR7B 2VBYA 5CCMA 5ETNA 1QAIA 2F4VT 3DI6B 4B6XA 2A3JA 2UXBF 4K4SA 4YOEA 5LSOA 2NP9A 2E5VA 1LW0A 3OFFA 4P0BA 2CJYB 5GAEI 3IRXA 4PUOB 3Q8QB 1QD1A 2E29A 2AZ3A 2PSZA 3UFEA 1REVA 2L41A 4QH5A 2HEKA 5GADU 1GNKA 2V63A 1WELA 3BO4A 1HQUB 3DOKB 4A8YA 2VD3A 1RADB 1TMJA 5B0CA 3NRYA 4XPCA 3C15B 3TARA 1NAFA 1U0SA 4H63H 2Z0GA 2V67A 1Y64B 1KLMA 3D6TB 4ES3A 3DDIA 3WIVA 3D0HE 3V4IB 1RQ0A 1D1CA 2RRBA 4KHZF 1DJ0A 5DJBA 4DR4T 3WI3A 1D8YA 2LM9A 1RLDA 2WDVA 4Q44A 2IAKA 1IJ6A 3AB2B 2POKA 3KDSE 3C14B 1N6QB 2LLZA 2HVDA 1Q8BA 5K8MA 3P49B 4K4YA 4CI3B 4ILLA 2JL9A 4QH4A 4QQBA 4NLPA 4URQU 3TRGA 4I0UA 2LA6A 6FDRA 3TUIC 4NLXA 3TW0A 2DRDA 3HHKA 2AGOA 2ZH4A 1VQOS 5IT0A 4DG1B 3FCWA 2KYZA 1TKXA 2P2CB 4KT0C 3IBFB 2XUEA 2VF3A 1W2BR 3ANWB 1VRQC 3VVTA 2GJ2A 2ZH5A 4ZDNA 1IBCB 5L9XA 2FZKB 3TQEA 2WS3A 5EUHA 5HXCA 5B09A 3PJWA 2OPRA 3DRRB 1ZAWA 3QFWA 3MMAB 4H4OA 3CC4S 1A6LA 5ETLA 1RISA 2XSFA 5A8WB 3AA8A 4YTMA 1X4CA 3CDBA 5FJ4A 1AUSL 2CPYA 4EZ4A 3OR1B 4HTJA 3R5CA 2IM1A 1WOOA 3D68A 2C3YA 4GC6A 2IBKA 1WEZA 1L3VA 1RHQB 4HL9A 5C2GA 2DH8A 1J5WA 4YT0A 5AXMA 1E6VA 3NOGA 2A6OA 4X64F 3I5CA 3H37A 1R3NA 4B9UA 4ZVPB 3B57A 2E44A 1QSYA 4OYPA 1U6ZA 3KK1B 3Q5XA 2V26A 2KRRA 3PV8A 1Y5NB 1XDOA 1HBNB 1U6FA 4QIGA 2Q9QD 1VHFA 1RHKB 4IDNA 4DQQA 1YJUA 3EDVA 4NLGA 3GSDA 2QG9B 2VU5A 3HHLA 1Q4RA 2DD8S 2ZH1A 4I7FA 5D3GA 3HMJG 3SV4A 5ETOA 1N32J 1FWPA 1OO0B 2ZH8A 3RYHE 4RW8A 2E5HA 4IDZA 4WP9A 4MIBA 4OYBA 3GTYX 4DLGA 3U1LA 1CJVA 1NEEA 3E3XA 1TV6B 3QFHA 3LK42 2HS4A 5I42A 3ZT6A 5SUHA 5A8RB 3BQ0A 1T9UA 1YDLA 5J1EA 4ED1A 5B08A 3EVMA 3EVWA 1I94T 1K1QA 2AT1B 2HN1A 4JBWF 1YHQS 2KZMA 4DL2A 4LF4J 5GMDA 1TL4A 4B08A 3CCWA 1S0VA 4GVBA 4ZVFA 4DJBA 1WHVA 5JVDE 4HI1A 3SFUA 2P5VA 5AQTB 4YLHA 3PUQA 2GC8A 2FJEA 3AB4B 3AAIA 2WZHA 3I96A 1W2IA 3K57A 4Q25A 3MAAA 2J1DG 3OQ2A 1RHJB 2NUUG 2FLOA 4NX9A 1OXZA 1NM2A 1VISA 1VI7A 4I55E 2WVEA 5D0GA 2Z56B 3ZPOA 1APSA 3QLHB 2EW9A 3TZYA 4X4RA 3HK2A 2LFVA 1X9SA 2GMHA 3NCPA 1UWBA 2GS8A 4Q2MA 1RT4A 2HMIB 1JLBB 4M95A 4X1YE 2ZM0A 4E0DA 5AQPB 1O3XA 2Z8QA 5K20B 3P3DA 2W2UA 4WKYA 3RQWA 2M8HA 3PUGA 2LSJA 3CE8A 1NK6A 1W0AA 2CQ2A 2R6GF 1PJ7A 3D6HB 2VVNA 3AA6B 2YNFB 1SC4B 3MFHA 4ETXA 3QBCA 5HO4A 1FX4A 4AD6A 3PFOA 3H42A 4PXDA 2AP6A 4YY3T 1L3UA 3EPIA 2A6MA 2L9WA 2K7JA 2JNJA 3V2UC 3D3BJ 3X1LB 2JPFA 4HYKA 2XMTA 4KPCA 2CE7A 3HA4A 4LT6A 2RDJA 2UXBT 3N2KE 1D8ZA 4X4NA 4EGLA 4TKTA 4GK0E 2HIYA 1RP5A 4NYZA 2MKHA 4NPOA 1H2TZ 3VF0B 2YBVA 1M5HA 1RWPB 1H3DA 3BKUA 2IRYA 2WVBA 4IDQA 4QIEA 4LF7J 1X4EA 2F8EX 1XTZA 3JAEA 1WTBA 4C98A 1N36J 2EBEA 5E5NA 1I5OB 2PA8D 3EICA 3CD5A 3OTOJ 3M9MB 2J76E 3VHQA 3FHNA 3ENVA 4ENOA 2K3WA 3JXOA 4P9SA 1PC4A 4OHWA 3QJPA 2YTCA 4P72A 3C6UB 4L3KA 3F0NA 3MD1A 5D0RA 3Q86A 1SUMB 4PPDA 4R25A 4G1QB 3WIUA 4ILCA 3VR9A 4F50A 4PABA 4AYBD 2H5EA 2KXHA 2O1PA 1PYOB 4QWCA 5J0ZA 2LT3A 2YINA 1UTAA 4DSKA 3TKLB 4M5KA 2C2KB 3ZCIA 4ZPVR 5AQKB 3CX8B 5JRCB 3KLIA 2UUCJ 5CD4H 2CWYA 1WF1A 3MM9B 1F9EB 3SWHA 1V6HA 5FXWA 2KFZA 4K0UA 4ED8A 4A97A 4BWJA 3UWTA 1OPZA 1SHZC 1S0MA 5DDPC 2CJ9A 4DMVA 3EX7B 4ECTA 4YHJA 1EETA 3UUXB 4EZ6A 2DKOB 5ETQA 4M5IA 1SH0A 1X4GA 5HJYA 4WYWA 1ZYQA 1ZOYA 3RBEA 3KK3B 3BV8A 5F8MA 2CUYA 4UF0B 2B9XA 3GSIA 1ZTTA 5ITHA 1T7PA 3UULA 1J5EF 2D9DA 3M05A 3AQPA 1NDKA 1JLGB 3C66A 4B3TF 1K8AT 2HFVA 2BDPA 1JNRB 2HVZA 2G2ZA 3RIUC 3VHLA 2VC1A 3BF4A 2CJXB 3VV2B 5CFBA 3H59A 2MLZA 4IE4A 2OD6A 2DGUA 5T14A 4NLWA 1TL7B 2CNLB 4X64T 3OTEA 5KFTA 4LREA 3GIKA 5DGAA 1FT8A 4X4UA 3FZ2A 2PI5A 2Y6XA 3H2LA 3NAHA 1ZHCA 1JJCB 5E3AA 2RU9A 5LMNF 2X67A 1TQLA 4OX6A 1VRUA 2YDSA 2W7PA 1N33F 1Q8IA 5KFOA 3R7NB 5IT9Y 3A12A 4UTGA 2XM2A 4ZCMA 1WRDA 4DR1F 4GIWA 1YBUA 3IG1A 3SQOP 3UT5E 3RC3A 3UDCA 3GFHA 2QL5B 4LIRA 1OEDB 2ZOMA 1V5IB 1NK7A 4U31A 1HNIA 5AQRB 2DNPA 2LJLA 5F8LA 5HEUA 1ICEB 1JLFB 3M6UA 1U1QA 4ZVQB 5IV3A 1TK8A 5FL1A 2ZOFA 3ZLIA 3DCAA 4RLEA 4YSZA 3FXDB 2D3UA 3UUMA 3ONJA 1S57A 3CQXC 4U72A 3QQCD 4OV6A 4BC9A 4WBOA 1I51B 4KP3C 2XCAA 3K8VA 1REGX 2R8GA 3WAJA 4J9LA 3H5SA 1NSAA 1HWJA 4OYZA 3M8ZA 2YNIB 2XLJA 3P96A 1DU2A 2DIUA 4EO8A 2OPQB 4JI8J 2OH2A 1H0HB 5LBQB 4HFIA 1NUEA 3UUNA 1RDRA 3TAMA 2FUG9 2QLJB 5LA6E 3U27A 4A47A 3MCOA 4ZVRB 3FJ2A 1BMQB 2R2TA 4ADZA 4DUYF 2MBGA 1FJEB 4OHFA 3B5MA 3AEBA 3HLUA 3EE3A 4DV2F 2OPPA 4IRCA 4AQFA 3FDSA 3W1YC 3LP0B 3GONA 2C2RA 2ALYB 1LRZA 2DK2A 4O2BE 2NSBA 2R2UA 5AQOB 2I6HA 1LW0B 2X1FA 5DG8A 3AECA 1HNZF 1WCRA 4WP3A 1ZA1B 4B3MJ 2JEGA 3R7BB 4OFZA 1B70B 4NCGA 3AE8A 1NK9A 1NHKL 4LFCF 3KHLA 2BZBA 4QYZK 4ZVGA 2CLYC 4P74A 2BBEA 4A8FA 4JI6T 1RWUA 3V6DA 2CBIA 1W7WA 3LQVA 1XR6A 1B7TA 2GQQA 1RWVB 3T6BA 4PZVA 1KLMB 2HFSA 4M5LA 1R6VA 2JDJA 3O2IA 1HX1B 4ZLPA 3ZKRA 2QMUB 1LVKA 2LRLA 3Q23A 4WYVA 2NTYA 3PTWA 4C7QA 4H4MA 1KKHA 3C98B 3ILJA 4O3OA 3K3OA 3V6HA 1RT5A 2J0QD 2VPZB 3RI5A 4NXNT 2KZZA 1ZKEA 2OI2A 3GR1A 3AEAA 2QRRA 5AQMB 3HI2A 4DDFA 2Z6EA 1IKXB 5CZVA 5BJRA 2VFTA 2B51A 1NPRA 4QIWD 2B76A 4DNDA 2W8KA 4O3SA 5FDLA 3RYIE 4QOTA 5KAKA 3AA9A 4GKKJ 3HSJA 4ZEYA 2XZDB 2BZ2A 3M2VA 4HR2A 4AUKA 4X65J 4NXMF 4ISSA 4ECSA 3CCLS 1T9TA 2H51B 2XZWA 3MPUB 2PI4A 4F0HA 1DURA 3RB3A 2YKOA 1BQMA 1RCXB 4P0AA 2EVZA 3FFIB 3R5GA 4A8SA 3HZGA 2ZBPA 1KOHA 5KFMA 1OY6A 1SL1A 5DZ6A 2ZBQA 2SPCA 4NLQA 2CPXA 2RDIA 1T3OA 2X3DA 3MGJA 3JSMA 1TKTA 1US7B 4LMJA 3ISZA 1N5QA 3ZNJ1 2IJNA 1YX2A 4O4HE 4OQJA 3FMWA 2J8SA 3K5OA 5L39A 4MLKA 2F40A 3CCRS 1FKOA 1SJ3P 2QEXS 4LFBJ 3W8GA 2DT9A 1RA6A 4LRFA 2HGMA 4OI0A 4ED7A 4L5GA 4I2QB 4ZZBA 4LF5J 4DR4J 3OT9A 1FA0A 5C24A 4J9MA 3MZIA 3PHEA 1NWMX 2KKHA 4JUYA 3O1JA 3KUHA 4ILRA 4I7FB 2H5JB 5E33A 2LKHA 1M5PC 3LK2B 1WHYA 2V2ZA 4AFFA 2KZ7B 3ZT7A 3ENWA 4LF6F 5D6GA 1H38A 2PEBA 4RW8B 1U45A 2AWZA 1J5ET 3J7YI 4B3TT 3JAFA 1FK9A 5EDWA 4DV6F 1CS4B 3U7JA 5JDGA 3HHEA 2JJ4D 2F9DA 1GTHA 3MHYA 3AE3A 5H6QB 1FTRA 4DR2F 3ENQA 5FL0A 4LF2A 4YR0A 4QKNA 3T1HF 3AOBA 4GO7X 4CH0S 1BR1A 2Y1RI 3KVAA 2ZC3A 3NZQA 2LHNA 2BBHA 5LMNT 1NK4A 4MTPA 4IG3B 4JV5F 1PO6A 2FB0A 3BB5A 5L46A 1N33T 2XO6A 3SBMA 4DR1T 4GVBB 1UVNA 2RHQB 4FYXB 3HL6A 1XMOJ 2QA2A 4V1Av 2PT0A 5KOXA 4LMLA 3ZZRA 3UD3P 1YD8G 1FVSA 4C8OA 3ZN1B 5E7OB 4GYSA 1HNWF 2N9DA 3S4UA
chains in the Genus database with same CATH topology
4J9UE 4GVLA 4EI2A 1T8BA 3RBZA 2AEMA 2BKPA 3KXDA 1VCTA 3L4BC 4Q25A 2BKOA 4J90A 4L75A 4RO0A 2I0MA 3JXOA 4J7CA 4G65A 2AEFA 4L74A 1LNQA 2BKNA 4J9VA 1T72A 2AEJA 2FY8A 4L76A 1XWMA 4YS2A 2IIUA 4J91A 4L73A 3L39A 4XTTA 3RBXA 1SUMB 2OLTA 2OGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9U E;  4GVL A;  4EI2 A;  1T8B A;  3RBZ A;  2AEM A;  2BKP A;  3KXD A;  1VCT A;  3L4B C;  4Q25 A;  2BKO A;  4J90 A;  4L75 A;  4RO0 A;  2I0M A;  3JXO A;  4J7C A;  4G65 A;  2AEF A;  4L74 A;  1LNQ A;  2BKN A;  4J9V A;  1T72 A;  2AEJ A;  2FY8 A;  4L76 A;  1XWM A;  4YS2 A;  2IIU A;  4J91 A;  4L73 A;  3L39 A;  4XTT A;  3RBX A;  1SUM B;  2OLT A;  2OGU A; 
#chains in the Genus database with same CATH topology
 3UUB A;  2BG9