2BKPA

Structure analysis of unknown function protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN PH0236
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
total genus 74
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkpA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkpA02
2BKOA 2IIUA 4EI2A 1T8BA 3RBXA 3KXDA 4J7CA 2BKPA 1XWMA 2BKNA 1LNQA 4XTTA 4J91A 3RBZA 2AEFA 4G65A 4L73A 1SUMB 4L75A 4YS2A 4RO0A 2OLTA 4J90A 4L76A 4Q25A 4GVLA 3L4BC 3L39A 1VCTA 2OGUA 4J9VA 2AEMA 3JXOA 4L74A 4J9UE 2FY8A 2AEJA 1T72A 2I0MA
chains in the Genus database with same CATH superfamily
3NS5A 3NKYA 1S6QB 1IZNB 2OPRA 3RF1A 2IIHA 2EW9A 2KT2A 2XMAA 5K5MA 2H5IB 4UVBB 3FEZA 1W2IA 3VR9A 3KK3B 2UP1A 2R7QA 4R0EA 4CQIA 4DMVA 1XJWB 2V34A 4GK0E 4AQYT 1EB0A 1TU0B 3UUXB 3K5MA 4O2BE 2MLYA 4WCEQ 4JI0F 5AQPB 4DV6T 2ZE2A 2RNEA 4A47A 2CBIA 4LFAT 3I9V9 1ZTWA 4X4RA 4B3TJ 4C7QA 1EP4B 5IT9Y 5HMWA 1GXLA 4KHPT 5ETMA 4JV5J 1FEWA 2PI4A 1FT8A 4M5KA 2KU7A 4ZHRB 2HIYA 4ZOLE 1W25A 1S1XB 8AT1B 3DOMB 4ZOSA 1SBRA 3GJTB 3OD2A 3C8YA 2E9ZA 1T0TV 2CXDA 1LK7A 2Z2LA 5HSPA 2K3WA 3I5CA 4LR9A 4KMCA 1RAFB 4JI6J 2MSTA 2QE5A 5LHHB 4YOEA 2ZVIA 1WLXA 4MBQA 1H72C 3FK4A 3BGRA 1VLOA 1NLKL 2OGUA 4OLOA 3RRWA 4CI0B 3SWHA 4IDNA 3QGGA 1F6TA 4DL4A 1LQ9A 2BS3A 5E7OB 4DSFA 3K8WA 2VBWA 4P2XA 2LQ9A 4ZLNA 3R6GB 4K4TA 4DR6F 4JEHB 5FXXA 5JTGA 4LF5J 1Y5LB 4MFBB 4P9SA 2UVUA 1UWBA 4KO0A 5AQRB 3I4PA 3ZSTA 1NK6A 3AEAA 4KHRA 4L3NA 2MGZA 2NXUA 3KLEB 3R97A 3CE8A 4G2AA 1BY9A 2J9DE 2CNLB 4QH5A 2IDLA 1HTJF 2B7CB 3SXLA 2AEMA 3KTQA 2FDNA 5KMGP 1ACMB 4UUXA 2ZHOA 1CC8A 3JC6C 4UZBA 1NUEA 1RZMA 3MGJA 4U7IA 5K8MA 3G8QA 2OD6A 4O44A 2A1BA 1JLQB 4V1Av 2FLLA 3NOCA 2B3TB 4B02A 2MY7A 3D2WA 1T03A 3H2VE 5D15A 3HA4A 2D0UA 5B0EA 2Q9QD 2KB2A 3CJQA 1UVMA 3RAXA 3LUYA 1WRDA 2CQHA 1S97A 1T72A 5K9FA 2ZITA 1IBKJ 3GPAA 1XN9A 3MJXA 4PJNA 2KO1A 4TQSA 2RKIB 5CA0E 3WQPA 1HG5A 1WKLA 2QFIA 4NXNT 3UDLA 3SQGA 2E9XB 2FGOA 2MQNA 2E44A 1HPZA 1R8CA 1IXKA 3PFEA 4ECRA 1U2CA 4RZRA 1E6YB 2UVWA 4LVOP 4RJVA 4L9IA 1M5VC 1HBUA 4DV1F 3N2GE 2RH3A 1HNXT 4ANEA 1SH0A 5FXZA 3KV4A 1DLOB 4RWWA 1FJEB 4X62T 4CI1B 2W9CA 1FVQA 5A8RA 2NYHA 3DOLA 4K4ZA 5F8NA 4ETXA 3OL7A 2K1RA 2YN6A 3D68A 4ICLB 2FJVA 4DQSA 3GSIA 3NS7B 4U95A 2V4QA 3QIPB 1DQAA 3A3PB 3M8ZA 1U45A 4W92B 2BBJA 2DRAA 3M2VB 4HR2A 3DFEA 4CXWA 4CT8A 2XSJB 5LL6d 2PA3A 2VDHA 4UELA 4HGAA 2JJ4D 4HHJA 1MNDA 3WX4A 1BQXA 2CQGA 3RBZA 3CD0A 2NXEA 5KFPA 2Q6BA 2BZBA 4IFVA 1U25A 4B3OA 1MWZA 4PG6A 1FKPA 5L1LA 2ODVA 2QEXS 3QOFA 5KT5A 2BV3A 4EGLA 1RA6A 5CGMA 3MXHP 3D5MA 1OQ3A 3PR4A 2M8DB 2R3VA 3QB5A 3MAHA 2AGOA 4COFA 4P71A 2DWGA 4G1PA 4Y2KA 3MM5A 3BSAA 5AJ3J 1LWXA 4OJ1A 2IHR1 4NEZA 2BUNA 4DQRA 2A2CA 1G73A 1N0UA 1HNZF 3CIMA 1XTZA 3NAHA 2QG9B 2QL7B 4F3OA 5ABEA 4G1QB 4N41A 5I42B 4Q43A 1JKHB 1BQNA 2CVEA 4O2AE 4LF7J 2OSRA 3CC7S 4NCAA 1WSVA 3X1LB 1RWXB 4ZA1A 3HVTA 3OBIA 3EM1A 1N36T 4KB7A 5L1JA 2HWIA 5HEUA 3I31A 1QE1A 3U7JA 3H2LA 1I3OB 2NUUG 3W2WB 2A2FX 2RAQA 4PG8A 4JI2T 1YRTA 3FBZA 4DL7A 3KNAA 5LGNB 1OEDB 1TR0A 4TY8B 4E8UA 4FBUA 4YDDB 1C1BB 1MG7A 5LXRA 4IQMA 4ZDNA 1OY6A 3UVJB 4P7VA 5GAGI 1VRUB 2M4MA 1TZ0A 2H5EA 2D9OA 1TK8A 1XNQT 2P6SA 2GVZB 4M5DB 4DU8A 2FVQA 4I2QA 3I9WA 4OYOA 3IMQJ 1P6TA 4DUZF 3B4MA 2ZHBA 2MKYA 3P6YC 4RW4B 1KFSA 3D1OA 1Y64B 2YQ3A 1G3OA 1Y7PA 1CJTB 3MPYA 3MR5A 1U5PA 2NUHA 4D3HA 1RTJA 4ZCMA 1B7TA 1WORA 3IG1A 1Y01A 2W2MP 1IBMF 4F4XA 5HWXA 5HVHA 1YTYA 1VHFA 2GVDA 2ZM0A 3AE8A 2XQ9A 2VA3A 4ELTA 2XMTA 1HR0F 3Q8QB 3Q8YA 2B5JB 2MY8A 3EAMA 1HBOA 5HN0A 2VJVA 2QGSA 4DWIA 4AYBD 3T6BA 4LRFA 5ITHA 1PKUA 1S1VA 3OBVE 5KFXA 4AKHA 2V68A 2XNQA 1IJEB 4FPRA 1RA7A 3P7IA 4HTJA 5H1SV 4Z2XA 3VAKA 3KWMA 4HFIA 2CBJA 2VC0A 2G13A 2BANB 1L5UA 1IM6A 1KOHA 1IJ6A 4C6AA 4TX5A 5KX5E 3T1YT 4JI3J 2VVNA 2DISA 2P6TA 3SFDA 2HBRB 3TVKA 3M05A 4NPPA 3ZTQA 2W62A 1GK8A 3AEBA 4M5MA 3DLEB 4H54A 1HMVB 3CTRA 3TLSA 4YB5A 3T1HF 3Q8UA 4DV2T 4I7FB 1ZBTA 3QMQA 2R8JA 5A8KB 1SL2A 2MZQA 2UU9F 4DV5T 2E7WA 2QC3A 2MKHA 1V9OA 1EJ7L 5DGBA 1HCIA 1RT2B 2J7UA 4DV6J 4X4PA 2K2PA 1UL3A 1VR6A 3VVTA 3QRQA 4NYZA 5CCMA 2A3DA 4NRTA 4B3MT 4X20E 3KYLA 3JS9A 2FJBA 2I6WA 5FDLB 4RW7B 2B8PA 4LSNA 2B4OA 2HW3A 3LP2A 1YD8G 4MTPA 5IC4B 3SSRA 3ZSSA 1LWCA 2XLIA 1KHWA 1S49A 4DV4J 1RISA 5KFMA 3TLUA 4PUOA 1Q82T 2G0UA 2Z6EA 3TP2A 2KWIB 4JB8B 3RGIA 3QRRA 4LF9F 2ZM8A 2Z57B 3A13A 4WTOB 5C2GA 5JRCB 4H9NC 4P09A 1E2AA 3KVAA 1LOUA 4DFMA 1CUNA 1N0VC 1X5OA 4QIEA 2P9GA 4NLWA 2E8IA 4CLLA 2ADBA 1ULRA 3AJ1A 2EXUA 2B4UA 2DNNA 3S6EA 4HTEA 1KR4A 4LRDA 1RABB 2DD8S 2LU2A 2A9UA 4WZXA 3MCSA 4IYQA 1S6UA 3G86A 2VG6B 4KKOA 2BE9B 2ABYA 1JWWA 1IM4A 4Q8FA 4USJC 3BH6B 2RQCA 2E2AA 3K5NA 1HNVB 3UU3A 4DV7J 4K4XA 3EE3A 4K4YA 3AA6B 4LT6A 1UVNA 4MK9A 3DJBA 1D09B 5L3CB 2MKKA 4UF4A 5JR9A 2J0XA 1WR0A 1QSYA 2OMLA 2PFFB 3UQ7A 3UUBA 3RHWA 3ZNUA 4FZVA 4YUDA 2W9BA 4CTAA 1T9VA 1TL5A 4QXHB 4LMJA 2CJXB 1KLNA 4ISTA 3W8GA 5IXUA 2XLJA 1KFYA 3BR9A 4QCLA 1XIQA 2UXXB 4NYOA 1AW0A 1CSJA 5KFYA 3UPFA 4Z91A 4ZXLA 5KFUA 2XY5A 4AKIA 1NHVA 2DBBA 1GXUA 1TKZA 5HEOA 2AV5A 4EAHA 2LVWA 1KN6A 2E1AA 4Y2AA 1T02A 1V3SA 4ZVOB 1DTTA 4OFZA 2B7BB 2ROEA 4IG3B 3NP5A 2M7SA 2JL9A 1YX2A 1NSQA 2KM8C 4N7TA 1DFDA 2OIHA 4WYWA 3H90A 3I0RA 4E7ZA 3GA8A 2JC1A 4B3TF 1RJJA 1DAXA 2JLFA 1PG5B 4ZVTB 4C8MA 4DVDA 1IKVA 2CPFA 4JV5F 1VJQA 2GAGC 3HHKA 3RGLA 5LMUT 3OR2B 3FRYA 1TL1A 4XK8C 2XNRA 1FIOA 3ZT6A 5D6GA 4EYHB 1RYRA 2AJ0A 2BJ8A 4W98A 4OJHA 4ADZA 2JWNA 3CJKA 2YKNB 1HNXJ 3CCUS 2D9DA 2C2EA 2Y1IA 3ENVA 5IM0A 2JLGA 3DDNA 2F8EX 3IRXA 3DRPB 2DHXA 3HHDA 4ZVUB 1VFJA 5KT3A 1SQGA 1KOOA 1Y11A 2NW8A 4RBVA 3KBTA 5B0FA 4AKRB 1TKXA 3NVOA 4U74A 4O4RA 4A46A 1TELA 4ZVRB 2IBOA 4CRJA 2PEHA 3EDVA 2ADCA 5A8WA 3V6DB 4K4SA 4LF5F 4YHJA 3KK2A 1MN9A 4LF2A 4M1PA 2IBKA 5E3QA 4CLYA 1YK9A 2XQ4A 3D28A 3QT7A 5H9FK 4CN1A 4IDOA 2CQIA 5FL0A 4J37A 4U96A 2MB0B 4BDPA 2XWXA 2OHDA 3BGLA 4ZPBA 1SJFA 3X3UA 4E7SA 2I38A 4V19J 4FJOA 3UR3C 1MNEA 3VAGA 4G3IA 3I82A 2HLTA 4OZJA 3P4UB 3Q24A 3OSPA 2J8AA 2VFRA 3HHLB 2GGPA 2BVMA 3C4XA 5BYQA 2KYXA 1O0PA 3R6LB 2O1PA 4QIGA 3NRXA 4WFXA 4F0HA 4Y6IA 3W63A 4F3QA 2FY1A 5JJBA 2W2PP 3W5YA 1FMWA 3GJQB 3RH3A 2M0GB 1N36J 1C4CA 3ZZ0A 5K8NA 2FZGB 4DOZA 3M8QA 3HCXA 2XYGB 1T8EA 4KAIA 4Y65A 4QIWD 1TKTB 4JI2J 3NG8A 5D3GB 3AOBA 2Q43A 2CM0A 3NGRA 3CD6S 1SV5A 4J9LA 4TWHA 1KS2A 2KRRA 1VCSA 4J9SA 5LOVE 3G96A 2ZD1B 4NA3A 6AT1B 1M7KA 2IM0A 4OYWA 3P4PA 3FEYB 2QFJA 3PIOQ 3KUEA 1UA1A 4JV0A 4NI2A 3H5YA 4CLZA 4OV1A 3C19A 2XSAA 3FFIA 2JRSA 2PFVA 3MMAB 1S57A 1SJQA 4IOAQ 2DGUA 2J0WA 1TL4A 3MD3A 2PSZA 2IAKA 2H7VC 1S99A 2HFZA 3HDSA 1FRMA 2OPQB 4A5XA 1UA0A 1HNWT 3VV2B 5DO2A 2K9AA 1QVGR 3MPVA 3PUXF 2VU5A 1OJ4A 4TU8A 5A2QU 5CJ5A 1S0OA 4K0KT 4V1Ak 3HJVA 4OYMA 3Q8RB 3GV8B 2MZ1A 5LCYA 3IGVA 3FCHA 1WYBA 4K0UA 4U9RA 4DFKA 2NXNA 4DMWA 2I5JA 3GCXP 3VQTA 3DRRB 2IIUA 3T1YJ 5H9EK 2CPZA 1T9YA 3HF5A 1FKOB 1NM2A 5J2PB 4B3RF 3IBCB 5G4DA 3VHLA 3F31A 1NAFA 3VGUA 2KFZA 2VICA 3ETMA 3BQ1A 5LMNF 3L39A 3S01A 5AJ3F 4DL2A 3T5LA 2VJUA 1VQOS 3NCPA 4DV2J 4BHQA 2A2DA 2Z2ZA 4GKKJ 3GLJA 3LANA 4ZK7M 2LSYA 5L4EA 3M2UA 1H6KX 3K8VA 4QWBA 3IA0A 4LF7F 1B7FA 3EX7B 1BXNA 3GMIA 4PG4A 4DR7T 2BBEA 5KG6A 3CX6B 5LBMA 3T5JA 5CH7B 1N33F 2BJ3A 2V0NA 3US5A 2C22A 4I1TA 4DZ6A 4NYPA 4KX6A 1RWPB 1DURA 3KG0A 1UVKA 1QLBA 4B3MJ 2DPJA 3CB4A 2VKJA 2FB0A 2H3EB 1Z8UA 2NZ4A 2QJ3A 3MEKA 4QHOA 3ETVA 3RRCA 1NK9A 2PA8D 2XAFB 4TYAA 2N7YA 3O3LA 2ACZA 3CC2S 1OYEA 4KIAA 4CO4A 4HEA9 2MPKA 4DUYF 2DGSA 3Q8VA 1NAQA 4DBRA 1VIOA 4DN9A 2CDRB 2QIFA 2FUG9 1U8WA 1ZEEA 3BQKA 2DIUA 3QAEA 3JYTB 3AEEA 3AE1A 1HX1B 2CFXA 4RL1A 2HRYA 1XR7A 2CG4A 4DR3J 1FTCA 4LF6F 1TV6A 4CN4A 4QR1A 3PUSA 4CXYA 3SYZA 3LO3A 2V94A 1IKXB 4ERDA 3EI0A 1NK8A 3A8EA 2ZUGA 3CQXC 2PMZD 3OTDA 2BOAA 5HXSA 3AECA 4DU7A 1GTEA 2ACYA 2BS4A 2H88A 3OR1A 4CM0A 3R1LA 2OJ3A 1U26A 4W4MA 2R7TA 3EGVA 5EHHA 2GV1A 3SEOA 2C0SA 2W2QP 1XMOT 4JI3F 2YH0A 4MKYA 4Y3CA 3EPGA 5IV4A 4IDKA 1U48A 3HKZD 2H51B 3K0JA 2BM0A 1FVSA 3EGWB 3GSDA 1FDBA 3EZOA 3TOQA 5JDFA 3PJXA 1B0TA 4OYPA 2JEFA 3EXYA 2XGQA 5F3TA 1ZZFA 2V5DA 5KG2A 2B8QA 2VG5B 1RXOB 3JAFA 2HH7A 1S6QA 3R7NB 3B4DA 3U27A 3MMJA 3TARA 1QSLA 3W3SA 1QSSA 3PKYA 3CULA 5KDMC 1FCAA 5AQVB 2LQ8A 2K48A 5L9XA 3KK3A 4MALA 1HBNB 2H3RA 3CCTA 1S0MA 2A10A 1T9UA 4I6YA 3E8OA 3KLVA 4LFCJ 2J6SA 2BMBA 2VB6A 4YHHT 3RW7A 4DV4F 2K3KA 5LJMA 3SZ2A 2BM1A 5LMUJ 2KHCA 3I0SB 4OIXA 1ZOTA 4KY3A 3PU8A 2RDJA 2R7XA 3B13A 3R2DJ 3ZJ1A 3X1DA 2LKGA 1W9RA 1XZYA 3CWJA 3HK2A 4YTMA 3CCRS 1EP4A 3BSCA 4ZZCA 2CQ1A 2GO9A 2UUAT 2QLWA 2W4CA 5KOXA 3OXGA 1K47A 1C1CB 1F60B 2BA9A 2DGQA 1J5OB 2HQFA 4ZHRA 1U6FA 3LFMA 3FQLA 2AX1A 1WOSA 1IN0A 2RS8A 2DCUB 4C8ZA 1S1XA 2WWVA 1CS4B 1NDPA 1H2UX 1B4SA 2ZJPQ 1X4CA 3DOMA 3NRYA 1JX4A 2ZM2A 5DDPC 3JAMU 4DV7F 4PK5A 4EV6A 4KI0F 5H9FJ 4KH0B 3N6LA 3Q2TC 1A6LA 4C3MA 2JLEA 2E1RA 2KZMA 3ETUA 2VC1A 3AA0B 4DSEA 2KN4A 3CVRA 4X64T 2NREA 3PZPA 4WE1B 4FKYA 2JOQA 2YNIB 3TI0A 4ECQA 5JDMA 2BW7A 1X5PA 2WOMB 2ZOGA 4OZLA 2DY9A 1RAJA 2ZFHA 3HFZB 1HX8A 4L6V3 1BLUA 4DFPA 5EUHA 2EFPA 4MFBA 4WXWA 3MURP 3EVWA 2R8HA 4DCOB 2E9XC 3FGVA 4PK4A 3ZC1A 3KLEA 5HATA 1OY8A 2HNDB 2WRMA 2VPYB 1OY9A 2QRRA 1FWKA 2CNOB 8ATCB 3J7ZT 2HZVA 2D74B 1KF6A 1LW0B 4JI7T 4I64A 4UY85 1YJNS 3M8SA 2ES0A 1RHUB 1CJUB 2OUGA 1SKSA 1JLQA 4QJVA 5GMDA 2VUGA 2Z2YB 5KFAA 2ZJRQ 2LYVA 4KJIA 3G6YA 1ZM2A 2K5BB 4H63H 3NBXX 4U8VA 2CEAA 2ILZA 2HN1A 3Q8PB 3W2VB 1FD2A 2HFUA 1MIYA 3P45B 1J5ET 1U1NA 5F9NA 2VOPA 2RKIA 2PE8A 3U78A 2XM2A 1IJFB 1Q8KA 4OI4A 2E9XA 4OYAA 1I6JA 4PW8A 2H4YB 3PW0A 2AZ1A 4O3NA 2FBWA 1U1QA 1S76D 1E6YA 1T7SA 2UUTA 3TAMA 5C8YE 1E1HB 3R84B 1HNWJ 1GXTA 4F02A 2KH9A 1ZZNA 2RJZA 4IOCQ 2YWWA 4ZHQE 4NASA 4K0KJ 1DLOA 3MOJB 4GKJF 1BUXA 3IS9B 2KYZA 3CDAA 2M2BA 4KGKA 4F4AA 4NWBA 5H9EJ 2WZ1A 4QH4A 2LRLA 1BWVA 3K57A 1QM9A 2CPHA 2HQDA 5KFSA 2CWXA 3AB2B 3C6TB 4AQGA 2WW8A 1RWWB 2WB1D 3BJYA 2UUBT 3OPCA 3QIPA 3M2VA 4AKGA 3BPDA 3KV9A 2XSJA 2WY2A 4A98A 4OYKA 2DK2A 3BYRA 4UR9A 1UZHA 1XWMA 3RZAA 2XCPA 1OEDC 5KFQA 1I6ZA 1VDHA 3A3OB 1UETA 2QL9B 1S10A 3SCLE 2QLBB 4J9MA 2C1EB 2OA5A 4ZN1A 3DCAA 4B08A 1ZM3A 5L1KA 2ZOFA 2YKSA 1JLAB 2KFNA 4ED2A 1Q8LA 1ZAVA 2BG9B 3MHYA 4DR7J 4DS5A 1SJRA 2KXHA 4BC9A 4KYZA 4P73A 1M5KC 1LKXA 1SCJB 3T1AA 4WBFA 4LFBF 2BEFA 3G6ES 2RF2A 3MOZA 4FS1A 5FP3A 6FDRA 4J9OA 4DV0T 4KHZF 3OHBA 2HGNA 1KEYA 2VPWB 4YJ3E 1QAXA 5AQMB 1XEZA 4G1QA 5I42A 1YHQS 1JKHA 4O0IA 2XI2A 1T3OA 1VJWA 1UFKA 2VQFT 2LJLA 2RA1A 2J9EA 2DNZA 3SSQA 2RUSA 3M6XA 4C98A 4CLPA 3M6VA 4CIOA 1FRIA 4JYAJ 4OYIA 1RGVA 3K89A 3PUAA 3AE7A 3GYNA 4ZP7A 3W2WA 3O4XE 3AVSA 4ZS6A 2GQ2A 2ASLA 1S4EA 4RU2A 2CPYA 1OEDA 2X0LB 4TY8A 4NL5A 2O67A 2JEJA 1C1BA 4ZKAA 4KQZA 4ECZA 5ETPA 4CH7A 4KGMA 1NDKA 2R42A 3UVJA 1VRUA 3A8JA 4YP3A 2X7IA 5BXIA 4FPIA 4P52A 4OYXA 2GMHA 3P8CD 4WKRA 4QQBA 3G6XA 1M5HA 2MZSA 2GVZA 2V9KA 4JI0T 3L3PA 4M5DA 2GC8A 4EFAC 2JMKA 2LEBA 4NEYA 1AFJA 4TU7A 2EG2A 1IVZA 4RW4A 4EYUA 2XUEA 1CJTA 3AE4A 3UU4A 4F4WA 3PEHA 3ENQA 4EYIB 2OTLS 1YKEB 4ECVA 5DJQC 4IH5A 1SH3A 2RT3A 2HVHA 5AQTB 3VZIA 5EWEA 2X9YA 2VASA 3MF5A 2MOZA 3PJAJ 5DS7A 4O23A 2B5JA 2QL5B 5ABGA 3OJUA 3QZ7A 1L3UA 1N5SA 2GZOA 2CZ9A 3E3XA 2AF6A 2GHVC 2L8KA 2I6HA 4WYVA 4X5TA 5M2RA 1TMJA 2HBZB 1GMUA 4X4OA 1ZPWX 4K4VA 4U33A 1HQEB 2BANA 2A3JA 2Y1RI 3CCVS 5ETSA 4ZS2A 2HNZB 2EC2A 4IFYB 2Z2MA 2X66A 2VH7A 2PMHA 2RE1A 2QA1A 3E08A 5JXSA 2EFGA 3ZFVA 3DLBA 3LDQB 4XAKA 1HMVA 1ZAXA 2CQ4A 4RPFA 4NLSA 4I7FA 4DR6T 2W8LA 5A8KA 3KMQA 4AI6A 1DY3A 1T05B 4WBNE 3WIUA 2YQ0A 4YHHJ 2YVSA 1TL3B 1O5JA 3PUVF 4EI2A 3RBXA 2BQUA 2VFUA 4R5PB 1OPIA 5DG7A 1D0ZA 4N47A 1Q0NA 3KMSA 2HK3A 4H9PC 5BR8F 3UD5A 4XAXB 4O3OA 2XY7A 3RIUC 5FDLA 4RW7A 3VZHA 3OSNA 3HKCE 2MHNA 1RSCA 3GU0A 4KC5A 2UUAJ 5J2QB 1Q79A 3THTA 4IREA 2HGLA 4C4WA 1N4LA 2XHWA 5FVKA 1B3TA 3RW6A 4DR3F 4JI1F 1CJKB 4U7UD 4FF2A 2QO3A 5D4PA 1T9WA 3UULA 1HARA 4QYZK 4C0OC 3OJAA 3BO4A 2JQKA 2C2ZB 1Q8IA 1OO0B 1PBUA 5BYRA 2RQ4A 3G9CA 2IMWP 2DR7A 3VRAA 1QUVA 4RLEA 3W65A 1N6QB 1WEZA 5D0GA 2FC9A 2VG6A 1HWJA 4M95A 5C2TA 1OWAA 5D8HB 1WOOA 3NEKA 5FXVA 4DLGA 4Q5VA 4B3SJ 2YNFB 5AQLB 2ILYA 5JUMA 5IWAF 4U8YA 2DNQA 3HULA 5CZVA 3C98B 3A8YC 1RWVB 2CPJA 1S1WB 2CJQA 1IWAA 2V8GA 3TANA 2DXDA 4KGZB 4DV1T 1RHRB 3RIUA 4X1KE 2CRLA 4UOCA 3VHQA 4ID5A 4FP9A 3IEEA 3ZZUA 3RR7A 4WZQA 4I2PB 2AJFE 4ECTA 1RYSA 3F56A 4ZVHA 5LJ5Y 2F4FA 3ZTRA 1U1OA 2O5DA 1FRLA 2WDVA 4RO0A 2DWKA 3BGOP 3J80U 3N0VA 5A2QY 4RUHA 4ERRA 3QB5K 4KTQA 3ZTSA 3FZKB 1RHQB 1OWXA 2GIRA 3V4IA 5MAOA 4LFCF 3Q83A 1RLDA 2WWUA 2ZDPA 2IC6A 3VR1A 3H5XA 1N5TA 4EIWA 5J1PA 2BJ9A 1D8ZA 1U0SA 4IG3A 4YR0A 1F5AA 2CQPA 3MM9B 3N9QA 4DX7A 5AQUB 2FVPA 1VIXA 4J91A 3ONXA 4CNZA 1UUSA 4YFSA 4WZMA 4ED3A 3GB0A 4UUWA 4M94A 1ELOA 1MIWA 3LK3B 1N8RT 1JLGB 4F4KA 2GIFA 2R2TA 5FY7A 1MWQA 1HNZT 3IA3A 1N54B 3OR2A 4OYBA 2IUBA 3PKMA 2UUCF 3W15B 3HT0A 3CCZA 4NCBA 3ZO7A 2EFVA 5EX0A 2YKNA 1KC8T 1OQ6A 4OX7A 5KFFA 2W9AA 3QUJA 4RBUA 2RUGA 1JLEB 5KT4A 2J9CA 1Q8BA 3DRPA 4PXBA 1RT6B 1ZS6A 4HT7A 1GH8A 3MPUB 2ZZMA 1FFGB 5LYJE 2MEWA 1VQSA 1X31C 1TKDA 2VQEF 2JSXA 5D0EA 2UUBJ 3BB5A 2R2RA 3TRGA 4MIBA 1SKUB 1X4AA 3IN5A 5KFGA 3DLLQ 2WZHA 3V6DA 4J90A 2LQJA 3MZIA 3RYHE 2L9QA 3BM7A 3IRWP 4DUZT 1QAYA 2ASYA 1PILA 1BHNA 4WW0A 2AIRB 2W66A 3OLAA 3ET6B 1XMQJ 3PIPQ 1VQNS 3M32B 2WMNA 2Y8DA 1EARA 2X3GA 2V1DB 3R5CA 1NBEB 4YMEA 4AFFA 4FNIA 3ISND 3AD7C 1YQHA 5DG8A 1ZH5A 2RU9A 3LH2S 2IC9A 1IBMT 1VISA 2XTJP 1B0VA 1Y3JA 4EBCA 2XSBA 4YTPA 3QT5A 1W7WA 3JQJA 3E2EA 4Y00A 2GQCA 2AJ1A 3VALA 4IE5A 1HHTP 3UD4P 4A8SA 3HHLA 5JVGQ 1QDUB 4IE0A 3TQEA 2J4GA 5KFRA 2KJWA 2VQFJ 3O9XA 3NBPB 3PFOA 3ILOA 2BDPA 1AJ3A 4ZJQA 2JH3A 3QGHA 5T41A 4ZI2C 1AFIA 3C15B 3TQ1A 2E5GA 3HT3A 1N5QA 2D3UA 3LAMA 1TKTA 3UQSA 2QYCA 4NLRA 4MIAA 5D3GA 1RAHB 2DGWA 1ZKEA 3PACA 3T1HT 4X1IE 2AEFA 3T19A 3D1HA 2E66A 4DPYA 4L76A 5AXKA 2ZD1A 2UU9T 1UKUA 3HSGA 2ZH4A 2M8HA 2E7XA 5E33A 4JI0J 4OZ5A 3MEEB 4XBFB 1WG5A 4A8QA 3MM8B 1IR0A 4NPOA 5KFEA 1IKYB 3P3DA 2DPIA 1HI1A 2V9WA 4WXOA 4IL9A 5FY1A 3MMAA 1QY7A 4N78D 3SDEB 1SIZA 1Y5NB 4I67A 1KDNA 2GMJA 1S59A 2ZEJA 4MHCA 3WIVA 3BSOA 3PX0A 4B9NA 4LF1A 2F63A 2Z4PA 2XJ7A 1HS7A 2OPQA 5A0YB 2DNKA 3W9HA 4NRUA 2H9ZA 5HEJA 3TAQA 4EO8A 2CRBA 1O51A 2NZCA 2XHEB 2WONA 4Q45A 3MUVP 3AAEB 4LF9T 2CPEA 4QWNB 3K3QC 1TAUA 4DLEA 1RCXB 3D6HB 4IDPA 2DNRA 1M5SA 1KNZA 3AQOA 2K7KA 2EHOB 3ZNJ1 3IAS9 2QLXA 4I68A 3GV5B 4WTYA 1MLAA 2V26A 3DRRA 3UTKA 2C5IT 3RC8A 1RWNB 1NJWA 4HH1A 5L8RC 1H2TZ 2PEBA 1FKOA 3ADAC 5J2PA 2HHSA 4X66F 3AFGA 2QYGA 4DMZA 1XDPA 2LSKA 2GJIA 5LP6E 2BRLA 3SCJE 3OVAA 2X1FA 4HFBA 2YXLA 3JAMY 3F41A 4WU3A 4U2ZA 3W64A 5AQHB 4DR6J 1JXEA 4MIWA 4QIFA 2O01C 3H98A 1PGZA 3N9PA 3NWGA 2COLA 3C4WA 3B6BA 3TA2A 1U0HB 2N2NA 1D1UA 3PYDA 5A6WA 2XULA 3Q86A 4OJ3A 2DNYA 4WWSA 4JYAF 4H4MB 3MR2A 4ZIVA 1K0TA 4FYYB 1KVIA 1TUWA 3KNGA 2NTXA 4PXEA 3TEGA 2Q6CA 4TLRA 3G2XA 3AJ2A 4AQYF 2MYSA 2LSIA 4K2XA 2JZ5A 3M2RB 2RPAA 2GO8A 2HHUA 5F8IA 3H3MA 2HRUA 1EIYB 3PO4A 4E2FB 3EABA 2FYXA 3JYTA 3ICLA 2ZMAA 4FYWB 1RT3B 2OD4A 3W9IA 1YQ4A 4FI5A 1BE4A 2IM3A 1GMWA 4B3TT 3MCMA 2BQRA 4FF1A 2VVSA 4QXBB 1KBRA 4NXMF 1CQMA 4C8LA 3A3NB 5JVDE 4JV5T 3M8YA 1IKXA 3MTJA 3I4HX 3H59A 3R2CJ 3SCIE 1Q7YT 2NCKL 3ISZA 3WC2A 1WI8A 3A8KA 3VWSA 3UO0A 5AQOB 3BGFA 2Z0GA 3T8OA 2MJUA 4JI4F 4A8WA 3ILIA 3KINB 2DTJA 2IW5B 3IAM9 5I3PA 3A8IA 3H25A 2XWYA 1JXLA 5EN1A 4RW9B 2KL8A 1H73A 5JH7E 5DQIA 5D0RA 4GVBB 5TAOA 2FJAB 2IYGA 1ZV4X 1YW0A 5LT5A 4AL7A 3OL9A 5HXHA 3FJ2A 3QBCA 2W2NP 1J5WA 4RW8B 1UWAA 3I6PA 2E5LF 3ZZYA 1FNXH 1SUMB 2LKHA 2AYMA 2VG5A 4PZVA 5HXRA 4LF5T 1R43A 3DDKA 3BQLA 4H63V 2NYIA 4UOFA 3G71S 1X4FA 4WYLA 5M2PA 4FS2A 1S77D 4HFCA 3UU5A 3CDBA 4KGVB 2GCFA 4CO2A 4K2JA 2AD9A 3DU5A 3UN5A 2LOPA 2KJVA 1MIVA 1G4CA 3CF5Q 1SXLA 1HBNA 1WELA 2PMWA 4H9SE 5ETTA 2FHJA 2KT9A 4O3SA 1CJVB 2XS2A 4OJGA 3CWZB 4HVZA 3VAFA 4FXWA 4USHA 4O3PA 5THWA 2QLJB 1NB2A 3FZBA 4F8HA 2YH1A 4U31A 3I0SA 5EGYA 4F04B 5HP1B 4PNIA 2NQPA 2YWEA 2X1BA 1QSDA 5A76A 4ETZA 3PU3A 5FYMA 2ZJQQ 4HE8A 1S1TB 4AXJA 2WVFA 5FJ4A 4H4OB 3ZCJA 5C24B 5ADXL 2A0FB 5CYMB 1LWEB 4USTA 1QJHA 1C1CA 1N88A 3AA8A 1IBKT 4NXNF 4UT4A 3MCNA 4TWDA 3HKWA 1J5OA 1EKSA 3EGZA 1KP6A 2AHOB 4O3RA 1N5VA 1CS4A 1V5IB 3ELHA 3OVBA 2HFSA 5GMKa 4RNFA 4B3SF 1WD6A 1U24A 3OFGA 2CXLA 3CGIA 4MK8A 5KFKA 1DZ5A 4RKUC 1NEEA 2G2ZA 2AU0A 3LGMA 2W01A 4DBQA 2DRDA 3M4XA 3OTOJ 4ZITA 2PTFA 1U6BA 5AE2A 4OZ0A 4WE1A 2YNGB 3T6JA 2YNIA 1TVRB 3C46A 3HD2A 1WTBA 4O8SA 4LSLB 1FJGF 1QLNA 2WOMA 1IBMJ 2XLKA 2IJFA 1FJCA 4Q2MA 4CLKA 1S48A 3OT9A 3LPEA 1HR0J 1ITPA 5F41A 4Q7AA 1F2HA 2HURA 3MECB 5GVQA 3RIFA 1HL6A 2DH8A 3R3TA 4YQWA 3CCLS 2Q66A 2HNDA 5CAAA 3BQ2A 3CJ5A 4Z90A 4DR4F 1D0YA 1YXRA 1QTMA 4LBPA 5IS2A 5K14B 5JQGE 1LRZA 2HVDA 2MTQA 4WFBQ 5GONE 2BOPA 1LW0A 2JNJA 1IR2A 1WEYA 2NW9A 4L72B 5FIIA 9RUBA 1Z2ZA 3RKOA 5AQFB 4B3RT 2E5HA 3R5AA 3OJSA 1CJUA 1I94F 3HO1A 5LMNT 1NKEA 1UFLA 2IA6A 4B9TA 3S4UA 2KZ7B 2YINA 1DTQB 4CI2B 3T1HJ 2RMLA 2Z8QA 3NWRA 1H7WA 3KLGA 4X2BA 5F9LA 3HHLD 2VBYA 2UU9J 2X1AA 3VAIA 3Q0AA 3W2VA 1SL0A 5HVFA 4LF7T 1N33T 3EZ5A 3DHXA 4LR8A 1I51B 3CJ2A 1NHKL 1MROB 2EI5A 1R89A 4L0RA 2OPPA 2J0SD 3FXEB 4DNDA 4QU7A 1WKJA 4HHUA 1AZSB 5EWGA 3NGSA 3OUYB 3GFYA 4IRDA 1Q4RA 2CXEA 1LEOA 3TUJC 3EZUA 1PSDA 2DR9A 1EETB 3CXCR 4U2YA 4LF9J 4K4WA 3SOLA 1Y9OA 3IS9A 2MQQA 2PO4A 1RADB 4DUYT 2PFDA 2UXBF 1Q16B 3J7Z5 3NNAA 4CM2A 1XMQF 3MMBB 1KVJA 3C6TA 3O1HA 5BJRA 2V2KA 1IR1A 1BR1A 2JPFA 3OW2R 3RB0A 3IWXA 4ILRA 1L3VA 3I0QA 2WBMA 3RJMB 3WC0A 1Y4ZB 1ZTTA 1UZDA 3M8WA 2IM2A 2EK1A 2ZBQA 4CXXA 2MZTA 3WZ0A 4AXPA 3ITHB 1KD1T 3V6HA 3E0ZA 2W4XA 2CG8A 4BLGA 4ZI2D 1R8IA 2HVIA 4NIQA 5KG3A 3GWCA 4ER8A 3WHIA 4JI8J 2XYHB 4QKNA 4WKYA 2HHPA 3AA9A 2KXPB 2V4JB 4WP9A 4FKXA 2O3DA 1SVDA 3D6MB 1EKRA 1JLAA 3KKFA 2HHQA 1NSAA 4J9UE 2YQ1A 1WF1A 2BG9A 2VBZA 3EXCX 4J9RA 1K1SA 4YTNA 2NPIA 4JI3T 4ILAA 2DR5A 2V8DA 3L7UA 1HBMB 1XR5A 4F67A 2EPIA 3IO1A 1YLXA 1HYSB 3TJAA 4LIRA 1WG1A 3FBLA 1YZ7A 3ZZOA 1XQIA 2BXJA 4PR6A 3UUMA 2XSFA 2R7OA 2JRKA 4U7UK 1FDAA 4TNWA 4QOTA 5L4HA 2MGZB 3FBFA 2AT1B 2OI2A 4ZVQB 5KFOA 4JLEA 4Y34A 3V4MA 2UXCJ 4TLQA 3KXDA 1GQEA 3TAPA 3CCQS 1UVIA 3Q5EA 2JDJA 3HPOA 4MAKA 3E51A 4AL6A 2IMOA 3CCMS 2DH9A 3J80Y 4M1KA 1RKJA 3D3CJ 3UD3P 1R8AA 2XAJB 1UCUA 5GAEI 1RT1B 3QAUA 1WF2A 2CWKA 4DV4T 1T9XA 3BREA 2J7KA 1O3XA 3CPWR 2ZOMA 4KH1B 1E7PA 5JDNA 3O1IA 2XZWA 2LOSA 5L3FB 2RDIA 1WYCA 5JREA 2APOA 4XO0A 2SXLA 2YWKA 2EBEA 2X67A 3SIPB 3S8SA 1UTAA 5FKYA 3TLTA 2DO4A 3FMBA 3AE6A 2JVRA 3AAAB 3H4DA 3AQPA 3RR8A 3M7VA 4LF4J 5CCLA 4O4IE 1J2VA 2XPKA 4PEOA 3MACA 1TUGB 3D0GE 2HZAA 1N32F 1MMDA 1HPZB 2P8IA 1UP1A 3RBEA 4EZHA 2V67A 2GIQA 4DV7T 3MAAB 4RNNA 1TL7B 3ZC4A 1VMBA 3ONQA 2LXIA 5JDGA 1R0AB 4HKAA 4LUBA 1HQEA 3H5SA 1IWGA 5KT6A 2C3MA 1VRBA 4TXSA 1Z1ZA 3DLGB 4OX9J 2HNZA 2HLUA 4IFYA 2LM2A 4X4TA 2X1GA 1QUUA 4ILCA 5HAOA 2LT3A 2OV9A 4WNKA 3NMAA 4GC6A 2ZKTA 4C8NA 2NLWA 3QT8A 4YR3A 3P4RA 1P8GA 5B0BA 4DPOA 2HGMA 1S72S 3EVYA 1VBZA 5E2QA 1T05A 1G2EA 2QSFA 4JEUB 4DCPB 2CPXA 2WHOA 3ANWB 1TL3A 3T9ZA 4UXNB 4ZP9A 3OL8A 1X8DA 4L74A 4R5PA 2CJBA 4DX8H 4IRCA 5LBQB 3QO9B 2K8GA 4USIA 1C0TB 2CNNB 3BO2A 1HFAA 1DRZA 4NLYA 4K4UA 2XAHB 4FF3A 5J2QA 3U3IA 2UV8G 4J9NA 1VHIA 4HACB 3RG6A 2WP9A 2H1YA 1CJKA 4OZ1A 2F8MA 1YZ6A 4X84A 3BSNA 2V7JA 4ZLPA 1YITS 1TP7A 3WAKA 3D54A 5T7LA 1W26A 4GRSA 3RX6A 1WR6A 3AE2A 4ZP6A 2DIVA 2FJEB 4Y2IA 5B0GA 5L38A 1BR4A 2AJ2A 4OLPA 3MM7B 1RP5A 1K44A 1VRTB 3EDUA 3T41A 5IHYA 3ULHA 2K3IA 2LA6A 1N6QA 2YOEA 4PXDA 4MMOA 1X60A 3JXOA 3L8RA 1V5VA 1URRA 1LFWA 2EC0A 2F1FA 3BN4A 2BE7D 2BRKA 1UGOA 2YNFA 5HLFB 2W63A 2A6MA 2HHXA 3LQVA 2C2RA 3B57A 4AL5A 1JQGA 1S1WA 3Q2SC 3QJJA 5LNKA 1Q7LB 2HPJA 1NH8A 1SC1B 4GKJT 1Z2LA 2XASB 3FHNA 4YJ2E 2V6AA 3H5UA 4QIVA 4ZVSB 3VCDA 3PUZF 2FZCB 3GWHA 2YU1A 4KE5A 2MAWA 2W8KA 3DLHA 4CWBA 2IA0A 2RQKA 2F7VA 4I2PA 2D3ZA 3IG1B 3BBBA 2ZZNA 2G0IA 3SFGA 2UVRA 1R8HA 4B3RJ 1FF2A 5IZHA 4KPCA 1JJHA 4DR5J 5LMNJ 4PWDB 3QZ8A 3DTOA 2I2YA 2DKOB 2L48A 4K8RA 5ABHA 4FF4A 2XM1A 3SS1A 2E5IA 2VWAA 3HLUA 1D9FA 3H20A 2JFDA 4KP3C 5D0HA 3LBXB 2RS2A 3MM9A 2C3YA 2EKNA 2HAIA 3M8RA 3ETOA 5F8JA 1N33J 4PK6A 1RK8A 5FLXU 3ENAA 2YU2A 2J47A 1JLGA 3IWLA 4LFBT 4C8OA 4YLHA 2D3O1 1REVB 3PTWA 3FKBA 3GFXA 2XO6A 2JFKA 2VKHA 3M8PB 2ACXA 2BX6A 3LJCA 2AE9A 4DG1B 4M5JA 4N77A 2W4PA 2ZH8A 4DUYJ 1JLEA 5HMYA 2DNLA 3J7YI 5J1EB 4O4GA 3OTOF 1RT6A 1LXNA 2W67A 1VBXA 1KRPA 3U02A 3P5BP 4LF6J 4LRAA 2C42A 3HZGA 4A8KA 1JJ2R 3FZFB 3HI2A 5F3JA 3Q89A 3F2EA 2X51A 4OV6A 1RHJB 3EDRB 1AUDA 3A12A 3S1TA 5HQMA 3C51A 3N01A 3FEXB 1OMSA 1RWMB 3J81U 3M3ZB 1KQFB 3FMWA 4ZCKA 3ET6A 4PQUB 3M32A 4WFAQ 5LB7B 1KQSR 1QTNB 5F0UA 2FIUA 3JAEA 2LM9A 1L3SA 3IGNA 4IE7A 4HH0A 4EGWA 3N9UC 3IHRA 4P7TA 2V5CA 2XS5A 4PXCA 2MXYA 1H7CA 3KJQB 4DPUA 4B9MA 1CLFA 3RYFE 3RAMA 4HWHA 3QYYA 2FHOB 4OI6A 3W61A 2HIQA 2RILA 3U1NA 3N5FA 4PG5A 1RAEB 3MUTP 3V81B 2IDEA 1E6VB 4DHVA 3NBPA 2CQCA 2AWZA 4GC7A 4GKKT 1IKWB 1DHMA 1HNIB 3HM9A 4LBHA 3J81j 2W9BB 3C15A 1FFWB 2LU1A 1MMLA 3EICA 3C64A 2ZNZA 4Q0BB 2FHMA 1RAAB 4OHFA 4X65J 4C48A 3T5KA 2EHOC 1LV5A 3RIAA 1F5CA 2VIHA 5M2UA 3C16B 3PYEA 4KFBB 3GR1A 5KFBA 3QLHB 1UK5A 4P0BA 1LW2B 5M4YA 4QXCB 3B8HA 4O4JE 1N5YB 4ZPWR 1NNDA 4LREA 1VI7A 1TKZB 5KG4A 2OAUA 1FMVA 3C6UB 3MEEA 1R0BG 4CH1A 3VF0B 1X5SA 2SPCA 3MM8A 1WTFA 1IKYA 3SMZA 3UUNA 5BR8T 1SC4B 3SDEA 2D2SA 3NWIA 1EQMA 1HI0P 4HFDA 3CIZA 3VAHA 2W2UA 5DM7Q 3BDEA 2MKSA 3ZN1B 2KRBA 1S0NA 3KK1B 5A0YA 3KG4A 5LJ3Y 2MDAA 4DR3T 1BMQB 5KOWA 4JI1T 2YDQA 4ILBA 4ZJOA 3KJFB 2OP5A 2E1PA 4ED4A 4J9QA 3DGVA 3UNGC 4QH1A 3LF0A 5CYQB 3GIMA 4QR0A 1ZOYA 1TTHB 3NGDA 3UCGA 4PFOA 2LSGA 2BKOA 2LXFA 2EHOA 4K7QA 3S7RA 5F8HA 3NZQA 2FGCA 1SJ1A 4JI8F 5CB4E 4YY3F 3TZYA 5EX3A 4HTIA 3GTYX 1DQ8A 3N28A 4Y2MA 2VK9A 1KNPA 4TZ4C 1CPZA 4OZ2A 4ILLA 5IWAT 4X4QA 4KBMB 3RRHA 3ILLA 3DNCA 2BR0A 2D69A 2P5VA 1K9MT 2VOOA 2CAJA 4ZJLA 1U0HA 2L9NA 2DLRA 5FY0A 2IJNA 4CDIA 2DGVA 3W60A 2UZAA 3N9MA 1FDDA 1UEVA 1U02A 2RB7A 3AB4B 4P72A 1MU2B 2CYYA 4N8OA 1VQ8S 2YPZA 5F0WA 4H4MA 4L5GA 3HHEA 3KVBA 5AT1B 1UX5A 9ATCB 3RB6A 2UXCF 3KV5A 1BR2A 2CVIA 1RE1B 1F2GA 3GIKA 5J2UE 3J9X1 1VQ5S 2J5AA 4YT0A 4WIIA 4ZMMA 3CJ4A 2LP4A 4LFCT 2WS3A 5I3UB 3LK2B 5SZTA 1WC0A 3VKGA 2UXDF 1X4EA 4M8LA 2ROPA 4M5NA 1FESA 5GAGU 1RT3A 1ZA1B 2H65B 1CBKA 2GW8A 2HN2A 2RSQA 3QSIA 1N34F 4QWCA 1RTIB 3K17A 1KTQA 4DUTA 1X79A 2VPXB 2F5GA 4HI1A 2DXFA 4LF4F 1YBUA 2B9EA 3JCFA 2HG4A 3BKTA 3UDCA 1FEEA 3VQSA 1X4BA 4M5IA 2UUCT 4KT0C 3O8WA 5LXTE 2E1MC 4ELVA 1R6YA 5CXTA 3MFIA 3DN9A 2QZ8A 4S0MA 3HVWA 4GKJJ 1REGX 2L08A 4PYDA 3PHEA 2VKDA 3JC6D 2XMKA 3PG9A 4RW9A 2OSQA 4GVBA 4OX9F 1M5OC 3TUIC 2FJAA 3L3CA 4RNOA 2VQET 4RBTA 1RLCL 4ZPAA 3EMTA 4N76A 5DJBA 2XAQB 3PE0A 1M0SA 3K3OA 2KWHA 4CZZB 4RW8A 5JVHQ 1Y0HA 3N2OA 4ILUA 2D7SA 4UQGA 2BE2B 3VTIA 3IR5B 2ZC4A 1NJXA 1FRJA 3MEGB 5E3CA 2VG7B 1FXLA 2R7WA 1R31A 5HJXA 2AP6A 3ZXWA 1PC4A 2I5JB 3IXQA 5L1IA 1WDTA 3QJPA 3DMJB 1ICEB 2FJWA 2RQMA 1CJVA 1NDCA 4C8KA 1UVLA 3IWNC 5HXEA 3FUYA 3CCJS 5EK4A 4LFBJ 3POTB 1JXVA 3GILA 2D9PA 1H38A 1N52B 3CX8B 5G0RB 2ZH3A 5HP1A 3CDEA 4ZCIA 5HVGA 3OFEA 2ODUA 1S1TA 2AW0A 4ES2A 1H0HB 1RTDB 4UF0B 1TMMA 2FZKB 2PDAA 4CLUA 1J5EF 2CJAA 4ASKA 5C24A 5CYMA 1LWEA 5CD4A 3M30B 4YSXA 4RUBA 5L3BB 4W90B 3BPSP 2N4DA 1YJVA 4HLBA 2KXFA 2R2SA 1KSPA 3MR3A 1UPMB 2KHDA 3Q5WA 1WDDA 3TX8A 1SKRA 3L95X 1JLCB 3ZKRA 3VR8A 3NMRA 2C3UA 4UQTA 5J0ZA 3ZCIA 3RQWA 3CVKA 3H37A 3CDWA 4G63A 4ISSA 2V8PA 4L3KA 1FX4A 4OI1A 3AB3B 3CJTA 1FHTA 4DPWA 4NCGB 3R5BA 3BS9A 3GN5B 5JDLA 3ONLC 3TKLB 1R0CB 3MEDB 1TVRA 1TAQA 4LSLA 4DS4A 5LG4A 4OHXA 4NMXA 3AEDA 2OEJA 5LG3A 3MECA 5DDOC 2GJFA 1FXRA 5IFMA 4LMKA 4QZVB 4DR5F 4R8UB 1K0VA 4IT4A 1P9YA 4ES1A 2DHSA 1RUSA 1CULB 1S7HA 5K14A 5AXNA 1JB0C 3WBZA 2E1CA 1BGXT 2LEAA 3RB3A 3W66A 4DR1F 3PRVA 1HA1A 3OFHA 4X66T 3R1HA 4M63A 4WBOA 2RIJA 2ZH1A 1YJWS 4IR1A 4EU0A 1DTQA 4IG0B 4J9PA 4U67Q 1JMTA 2KFYA 1W09A 3A4TA 4EB6E 3TO8A 3HXMA 5HI7A 3I96A 3K2YA 3KBUA 3QIDA 4BWJA 4ANCA 3JTNA 4OI3A 2RDDA 1VQ6S 2V2ZA 3Q5DA 1XNRF 4HHHA 2BS2A 2WVBA 1RT7A 3U1MA 3BR8A 4MH8A 4JYAT 1MROA 2ROGA 3B82A 3SRZA 5BR8J 5DDRC 3ZEFB 3I56S 2DT9A 3KLIB 1AZSA 4FNHA 3BF4A 3OUYA 4TUYE 3QNUA 4BAYB 3MI7X 2M70A 2POKA 3AXJB 4JI1J 1EETA 4UV8B 2H7OA 5EWFA 2PD1A 1QAIA 5U47A 5KG7A 1D3WA 3EGNA 3C4ZA 1RTZA 1GX5A 2F65A 2YNHB 3HFKA 4LQ3A 2E5JA 2MKIA 1PJ7A 3MMBA 2XQ3A 4DL3A 4J9VA 4UY8T 4WF9Q 1URNA 2HMIB 2HVEA 2MLXA 4PAAA 4JI5J 2WM9A 4NXMT 4N5SA 1NKBA 1RT4B 2J6TA 2ATLA 4CI3B 5FVLA 3ITHA 1ZP0A 4C3LA 4A4JA 4EZ4A 2GK9A 1R8BA 5KG0A 2CQ0A 4PPZA 5IWAJ 5IYZE 2WQYA 4ATNA 3DOKB 2UVVA 1AYEA 1FXDA 3HI9A 2KI2A 4FVCA 2V4JA 5B0DA 1XBWA 1IBLF 2EHOD 4JI4T 4TVAB 1FEHA 2VL8A 4LVNP 2J8SA 5HCJA 2EFQA 3O6QA 4J2CA 1JNRB 4QR2A 1HWKA 2B51A 1KKHA 3UE2A 1WNEA 4Z37A 2QMXA 3D6TB 3IBWA 5CD4H 4O0NA 1K73T 4XDDA 4WPAA 1HBMA 2YDRA 4YN3B 5L3DB 4LF8J 2ZUAA 4X65F 1HYSA 4XIUA 3N9NA 5IC6B 2KVQE 1EX8A 3BV8A 1R7IA 2E5LT 4LR7A 3O5TB 3HKBE 4F4YA 4C91A 4UOHA 3IR7B 4USUA 2CHOA 4HFHA 3VKHA 1OEDE 2BVLA 4LMLA 4LJMA 3ZMUB 1FI4A 2BDEA 1VQ4S 2MQPA 4F0MA 1XERA 2DH7A 2NTYA 3CD5A 1HHQA 4TN2A 3AEFA 4XPEA 2X9WA 2H4WB 2YX4A 3H8YA 2ASJA 3DLJA 4FVMA 1RBAA 3ZT7A 3JTOA 3RKGA 1RT1A 4U7CA 4Q44A 3C14B 1NPRA 3NLCA 4YDXA 5B0AA 2X0YA 2F8HA 2XCAA 4O4HE 4DQQA 3AVRA 2EKYA 1NSPA 3IP0A 2UUCJ 1RQ0A 3ZZZA 2V7LA 2V50A 4ED7A 2YKQA 4DPXA 4NUUA 3KUGA 4C0BA 5J2TE 2Y6XA 3TW0A 4MLKA 2AYBA 1F1BB 5FLXY 1S6PB 1PJ5A 2LSJA 1RAGB 2MKCA 4DEZA 4DSKA 2OLTA 2YX1A 1UJ6A 3TA1A 2VQEJ 2QA4S 3GJSB 2WB5A 2PIIA 4Z7CA 4B3ST 3QWPA 4I56A 4PYAA 3MAAA 2BBHA 3TAMB 1TL7A 4K50A 3CT9A 5HXCA 1IQTA 3UN3A 1Q86T 4Q2LA 4DV3F 1R0AA 5F8GA 4ECYA 3DLGA 3D0IE 1F0XA 3P96A 3FNNA 3FVYA 3NAIA 2GNKA 2VURA 2VV5A 2NWBA 2CWYA 4DR2J 3O1JA 2D41A 5GADI 1YBAA 3UNYA 2MYFA 3ABVA 2HQ3A 3BBFA 1FJGT 2JX2A 2HS4A 1PJ6A 1RU2A 2RU3A 2E29A 1H98A 2BJ1A 2E5VA 2HQGA 3R9LA 4OK0A 4TYBA 3ZC0A 3ANWA 4L73A 1XC9A 2WVCA 3J81Y 3DXBA 3LWMA 1HKAA 3PX4A 1EQ0A 3L4BC 4DR4T 2FPHX 5F8LA 3G4SS 3PX6A 6FD1A 2FLOA 3IR6B 3KJNB 3QO9A 3ZYKA 2QRXA 3G82B 3ZJ2A 2D0TA 1C0TA 2FVRA 4ZVPB 2EFOA 2M6IA 3PURA 2IC3B 5KFZA 2BACA 3FXDB 2BQ3A 2WVEA 3AEGA 3TA0A 1X9WA 1I94T 4HACA 2V7KA 5K8PA 3CEDA 3PW4A 4WU2A 1HFEL 1FK9B 1WACA 1G6BA 1HW8A 2RF2B 5LJNA 1D9DA 4KV8B 1U1KA 4O4LE 2V5HG 3CDUA 3TYTA 4WFYA 1GFWB 4ZPTR 1GTHA 3NCRA 4I50E 1WC3A 2FJEA 1M90T 4NLXA 5CZXA 3GCWP 5DQHA 3MM7A 2FJDB 1VRTA 1S79A 3AHPA 5J2MB 2IDOB 1NZAA 2JIWA 2A18A 3HVRA 5EK2A 3OPKA 3RU0A 1AB8A 3MFHA 3KJVB 5KFCA 4K5SA 3ZYMA 4GYSA 2AX0A 5HLFA 4EEBA 3PXGa 2WZIA 3A7MA 4ICLA 3J7AN 4ZI3C 4KHMA 3UCUP 4UV9B 1VQKS 5ETWA 1T9TA 2ACMA 5ETNA 2OPSB 2MQOA 1KHVA 1DJ0A 2IVFB 2C2OB 4KGXB 2QMUB 3ZTPA 5ETRA 1S9GB 3N5LA 1D0XA 5C42B 2UXBT 4UEMA 1VQLS 5FD1A 5SUHA 3KHLA 1FDNA 1VQPS 4DSLA 1EAYC 3SI8A 3FC9A 2IPOB 1J1JA 2V8SV 1TFYA 2VFVA 1XMQT 5F8MA 2N1GA 4LRCA 4ZI7E 2MZRA 2HHVA 2N82B 4X66J 1VQMS 3PW2A 2VFSA 2KVIA 2Q1LA 2IRYA 4PWDA 3G6VA 4OZ3A 4Z7YA 3CMES 1T3NA 3UFCX 4B6XA 2VL1A 3LOUA 1YJ7A 3MKDA 1NWMX 2DNMA 2C28A 3FCVA 3KFWX 4Q8EA 1X4HA 3LBXA 1WCRA 4PABA 2K7JA 1RTHB 2QYWA 5HANA 1RCOB 1X0PA 4AQFC 1S4FA 3HSDA 3NY0A 4GYRA 3SV4A 4G1IA 3TZXA 3HKDE 2M52A 5ABFB 1A0OB 2W24A 2NR4A 2ALYB 3A5XA 3ZPOA 4F2RA 2DY1A 2LLZA 4QWEA 4IQXA 2LXUA 3DLKB 3DC2A 4CYUB 1REVA 3QQCD 5L3GB 2AZ3A 3MD1A 2CMRA 3C2PA 4U72A 2J9DA 1UVJA 3F44A 3GFHA 4AQYJ 3M8PA 4ENOA 3CJ0A 1GT8A 2P9CA 4Y0FA 2V63A 4DG1A 4KSEB 2F4VF 3CD7A 3MMCB 3P50A 1FX2A 2OKQA 2HHHF 4LFAJ 3HFVA 4CLFA 5J1EA 4OYZA 2NSCA 3GQCA 2R7RA 2B0GA 5JR9C 2CDQA 5IQQA 2QA7A 4X4VA 3E01B 4KHPJ 5LOQA 2ZM6F 3PJ9A 3CKDA 4YS2A 3RI5A 5CHCB 4NXMJ 3K1SA 4ES3A 1B64A 2H89A 2RVJA 3OTCA 2EFNA 1KQKA 4FN5A 2GA7A 4XDCA 2VL0A 2W7PA 3PVXA 3T5HA 4AQFA 2MQLA 2BKPA 1P27B 4I69A 4PQUA 3BEGB 2DNXA 4AISA 1B7YB 5C25B 1YJTA 3Q23A 1YWXA 4CCHA 2IFXA 2QTWA 4ED8A 4RNHA 2DI4A 4F36A 5HEHA 4BC7A 2B6AB 5AQQB 4JI4J 5LXYA 3K5LA 3VAMA 2OFHX 2CQ2A 2HNYB 5AE3A 1LXJA 2LLYA 4ANJA 4OX6A 2ZZTA 1NU4A 2UV8A 1N32T 1KEKA 3GJRB 1VRQC 1Z0PA 4TKTA 3J7A1 2M3DA 2R2UA 1R3NA 3GIJA 5GADU 1P1LA 5B08A 3DLEA 2VFTA 2HHWA 5DETA 4NX9A 2YBVA 3V81A 2DXEA 2E5LJ 1E6VA 3DRYA 2LDIA 1MSWD 4F6RC 1IKWA 1HNIA 4ID5B 1RT2A 1RKIA 1NSKL 2B4VA 2IRUA 3PW7A 1V6HA 4C3KA 3PRDA 3HP6A 2EG1A 2B9XA 4J7CA 4Q0BA 3JTPA 2AGPA 2QX0A 3QNWB 1HW9A 1NK0A 4IGUA 3FRZA 3C16A 4DF4A 4KFBA 3GV7B 1VBKA 3M6WA 3QLHA 1LW2A 3PNIA 4I0UA 1N5YA 2E9TA 7AT1B 2MSSA 4DX5A 4DPTA 1F5BA 4QWAA 2GHWA 4HDGA 2G0JA 4C2MA 3DGPB 2CPDA 4R25A 3V4IB 1IQZA 3C6UA 3M9NB 4YB6A 3RQUA 2C2DA 2V4RA 1EZ3A 5FNVE 2EBGA 3QSYB 3RRGA 3MR6A 2Z30B 4MFRA 5JRCA 3HSZA 2DL1A 3MK7C 2M88A 1HG2A 4NLQA 1O8BA 2LFVA 2NPFA 1BC6A 5T14A 3JSMB 2F9DA 4ZS3A 3TUZC 1NENA 3CCWA 3KK1A 3GIRA 5IQ6A 4NXNJ 2P9BA 1JJCB 4JI5F 5ADZA 4P75A 5HROB 5CYQA 3VGTA 2LEHA 1P1TA 3G87A 3UU8A 2K24A 1HNVA 4MKAA 4C9DA 3PDNA 3DYAB 2MTLA 4HT5A 2G1HA 1VOMA 2XQ8A 3K58A 1U4QA 4NOHA 4C8YA 4P10A 2ASDA 4P6QA 3F57A 4X62J 3IC1A 3GG1A 3M1VB 4NLOA 4JI6F 3MM6B 4D3GA 4LIWA 3QFHA 4C11B 3H0PA 3KUHA 3CQGB 2XO7A 3MTKA 1LWFB 5HBMB 3VAJA 4TV8E 3I1AA 1VQ9S 1OPZA 2Z58B 5F8PA 1FJGJ 3D66A 4ZCLA 2RD5C 4RX6A 2VZ9A 3V5UA 1YJRA 3HVAA 1R6VA 4LF8F 2BABA 3R5GA 3ESLA 2YK0A 3L9ZA 4OQJA 4BJNA 1FFSB 5KFIA 2YX7A 1F3FA 4DR4J 3QGIA 2YKPA 4GIWA 3CSKA 1MU2A 5DLGA 1OSCA 3DM2B 2CZVC 1SJ4P 2CA9A 4PJMA 4WFNQ 2JVOA 2F40A 4QW9A 2C5KT 4LRBA 4ECUA 5ETVA 2HAFA 3KHGA 1DARA 3GZ7A 3LW5C 3UT5E 3V6JA 4MK7A 2XZDB 1I94J 1Q78A 5IUXA 5KTQA 2VD3A 2W0GA 1NH7A 1WF0A 4EWTA 3OTBA 1S94A 4EK2A 3HJFA 1WWHA 4CH0S 4DXLA 2CQ3A 2C3PA 1FA0A 3FZHB 3QPIA 3U1LA 4DCJB 5I3UA 4X1YE 4QYRA 4H9RC 4CLTA 4IRKA 1ZHCA 3Q8SB 1CEZA 3KHHA 3HMJG 4H9QC 1GEHA 2OTJS 4DQPA 4P74A 4JUZA 1JK9B 3MPDA 2DRBA 3DDIA 1RTIA 1IBKF 3G8TA 4MYTA 3RYIE 1XMBA 5CQGA 3IBPA 2Y8WA 4DQIA 4DSJA 3PYGA 1ZM9A 2XQCA 1SL1A 2E9XD 4PFPA 1YRXA 3JSBA 2XI3A 2XM3A 4BWMA 2QSWA 4UIGA 1VC0A 5HAXA 2RRBA 2WB4A 1XNQJ 3ZZPA 5I4MA 2UUWA 2YWHA 2JEIA 1MW7A 3VVUA 4A97A 5D4LA 1HQUB 2ZWOA 2UXBJ 2BVZA 3OTOT 2Y0BB 3LGHA 2DHGA 2VF3A 5JDQA 3V2UC 2XY8B 2J0QD 3LAKA 1LVKA 4DZDA 3CJ3A 4DR2F 2R7UA 1T7PA 1BQMB 4TQRA 1S1UB 2WBRA 2O66A 1H3DA 3CIRA 2BE2A 3ZMZB 1HR0T 1Q5YA 3BBCA 2WONB 5HCMA 1RT5B 3IM8A 3MEGA 2VG7A 2WCXA 4CO0A 3TZZA 5AQKB 2W1BA 4KBIA 1WUUA 3KG1A 4ILMA 1NZ8A 1YI2S 4F0KA 4RUCA 4QW8A 3BQ0A 2BW2A 3D0TA 4UVCB 4MJKA 4ZN3A 2VPZB 3DMJA 2NXCA 1TK0A 1EZZB 1A9NB 4URGA 3AD8C 2WSFC 1U7LA 5L47A 3KLHB 5HQ8A 1YSJA 3POTA 1IAPA 3QWUA 2IM1A 1MMNA 5LM7E 1YBTA 5G0RA 4M5GA 1U47A 5LSRA 2BKNA 3F73A 3WI3A 3BKUA 3H40A 4DV5J 1G7CB 3HL6A 1WHVA 5J2NB 1RTDA 2OH2A 2A6OA 4UF0A 2W7OA 1Q81T 4ANDA 3N9LA 1VQ7S 4ZI3D 1NK7A 4F2SA 3M30A 1XWLA 3FZ2A 5I3QA 1SIWB 3ONJA 3KLFB 4OX8A 4GO5X 4ZVEA 3IBFB 4ELUA 3D3BJ 2ZH2A 2E9RX 3R5DA 3RRKA 3PRBA 4CT9A 1I1GA 1DU2A 4ALZA 1JLCA 2XG8A 3DKDA 2XQ7A 4CO5A 5B7WA 3BYPA 1UPPA 2WCAA 2ZH7A 1YQ3A 1UJ4A 1B0PA 5LGTB 1NXIA 2IVMA 4NCGA 3TVYA 5DQGA 4QBUA 2J62A 3CMQA 3GN5A 3M9MB 3ZMSB 3CJSA 1KQGB 1SC6A 3MEDA 4EOZB 1JNZB 4PCQA 3RPUA 3AJDA 1Q53A 4F50A 1Y00A 5DQVA 2N4CA 3TNVA 1ZYQA 5IOLA 2HHTA 4DSIA 2IAJB 1KLMB 4IE6A 5KT2A 1N32J 2UXNB 1K8AT 4B9SA 4IR9A 1EHWA 3P4QA 1T98A 2KG1A 4R8UA 2KDOA 1WC6A 1DBDA 1JLBB 2MKJA 5EDWA 4F25A 4EMDA 1CULA 3PY8A 4P1NA 3FDSA 3D67A 4JI8T 4DO0A 4UVAB 4OZNA 5KFJA 4YY3T 2QT7A 3DRSB 3QRPA 2DB1A 1PYSB 1JLFB 3D4JA 1YGYA 2CLYB 4M5LA 3PEJA 1C0UB 4JP8A 4USWA 2YKMB 3M65A 2BZ2A 4IG0A 4I4TE 1HD0A 4A56A 1WFDA 1RB0A 3CMAS 4B17A 4QYZJ 2L3LA 3AE3A 4UW2A 5AXMA 3RUBL 2CUYA 3P5TL 1MMAA 2WU2A 4F26A 1WHWA 4YB1P 5F5WA 3NL0A 3SFEA 1WOPA 2PT0A 2Q9QB 4QX7B 3PHTA 4DV6F 4P2MA 2JEGA 2J6UA 4JV1A 4LFAF 4WK1A 3ZZRA 2ZH5A 2UXCT 2B1EA 3KLIA 4BBYA 2FY8A 2FUPA 3B5MA 3AXJA 1SJ3P 4KHPF 5E3PA 3B54A 1SHZC 1R8PA 3THPA 3PV8A 4O3QA 2X0HA 2I8EA 2R7VA 1R27B 1YDLA 2X3DA 2YWGA 3K7RA 2DR6A 2UXDT 3OQ2A 2YNHA 1KWMA 1US7B 1MWYA 4EZ6A 1FNOA 4PAGA 1NO8A 2LCWA 2MBGA 2MHEA 2HMIA 2YPYA 1D1BA 1AA1B 1VC6A 1YJUA 1WI6A 2J1DG 2JMHA 3N9OA 1N34T 3ZTOA 1YIJS 5B0CA 2HPUA 1RT4A 2LEPA 3UU6A 1HQ2A 4LF4T 3MR7A 2VDIA 5HO4A 3V5SA 1V9DA 5E3RA 5DLFA 4HWCA 2XGPA 4OHVA 3O1LA 3C66A 4NLTA 1VS3A 1ZPVA 3LP0B 2BG9E 3DOKA 2HEKA 2NS1B 2HS0A 1NJIT 5AQJB 4CO1A 2V6YB 1JNRA 4PWUA 1S0VA 3TWZA 3DI6B 1ZA2B 7FD1A 4OX9T 3H2UB 1X5TA 2CJKA 2N9DA 1QUPA 4KUMB 2H48B 3FSXA 3PYFA 1XDOA 3FSYA 5HQLA 3I9ZA 4JBWF 2EEYA 4ZLLA 2IJRA 3W8PA 4PKDB 2GJ2A 1S35A 1RAOA 3PR5B 4PG7A 4A8YA 4R0JA 4HDHA 2KTQA 1RBLA 4GO7X 1LVFA 3UI3A 3FBCA 3I9YA 3ZN0B 2XAGB 2AJ4A 2I0MA 1XR6A 4CZCA 1OS5A 4PWWA 3OL6A 4GMKA 2VKZG 1UAWA 4IL4A 2XMUA 1OIAA 1UX4A 2HRTA 2IMLA 5A1LA 3C14A 4OL8A 2Q3PA 1H7XA 3QT6A 1KNRA 1SUQB 3ISNC 1WG4A 4QPXA 1NCLA 1WEXA 4ECSA 1APSA 4LQ9A 3TVZA 5DM6Q 3KLGB 1NPPA 2HWTA 4HFEA 1RU1A 2XQYA 1O6XA 1WHYA 3J7Yq 2HKEA 1T94A 4IH6A 1HNXF 1S6PA 1VYAA 1N56A 4CLSA 3UQ4A 1TK5A 2D5UA 3DP7A 2CQDA 4X62F 3R5JB 4BA9A 2XTLA 1S9EB 2LQ5A 4ZP8A 5D77A 1VBYA 3GONA 2OPPB 1NJYA 2R8IA 1C2PA 3HR0A 3L7OA 4OHWA 1FD8A 1HWIA 1D9AA 2XY6A 3UCZP 5KFVA 5KFDA 4ID8A 4NUVA 4QX8B 3N6NA 3PV0F 3K8PC 1DQ9A 2LA4A 4I0WA 2YWFA 2JHEA 5AE1A 3K59A 1KTVA 2I1RA 2AJQA 3R7SB 2ZNYA 2AYEA 3TJ8A 2DNPA 1WHXA 2OO4A 2F3JA 3CW2C 1PO6A 2AGQA 1QVFR 4HN9A 1SE7A 1U4BA 5LSLA 1RWOB 3Q2MA 4RW6B 3W62A 1Q95G 2CKWA 3I0OA 1LFPA 2Z56B 4FYDA 5KFLA 3O44A 3UFGA 2CA5A 2V7IA 3T9NA 3WX8A 2QVAA 4XPCA 4DR5T 1WC5A 3GMGA 5HMXA 5CFBA 3AE9A 3TUPA 3JADA 3G82A 5IT4A 3LWLA 4Y28C 3LP1B 2IC3A 1M1GA 1PYTA 4DR1T 4P2FA 1OXZA 2CXFA 3DRXA 2XBPA 5BMVE 2C2NA 1N36F 4NLVA 2OPRB 4EEDA 3B78A 3I55S 3QK6A 2YEVC 4CNYA 4DFJA 1FK9A 1JJ4A 3RC3A 3CCSS 3LG7A 2PC6A 2V8VA 4KV8A 4JI2F 3BKFA 4TWFA 3QATA 5C2CA 2VA2A 4Z8XA 4U3CA 5KFNA 1M5PC 1NEKA 2HBQB 4AT1B 3QC9A 2FJDA 3AOAA 2WK4A 2KT3A 4YR2A 2VBXA 1VGYA 1HLWA 3I5AA 5J2MA 1XNRT 5HJYA 2M67A 2OEKA 1XNQF 4LMZA 4JOUA 1S7IA 1SQFA 2ZE2B 3OTEA 3KJVA 4GOUA 1L3KA 4JBCA 2WVDA 5BYSA 1UEKA 5K20B 2WDRA 1N48A 3GYGA 3NRBA 1WSRA 4LF6T 2Y9HA 2OPSA 3JSRA 2HZCA 3ZLIA 1FE4A 2AKWB 4DIDB 3OXLA 2QN6B 1U1MA 3PJWA 3DXSX 3BQIA 2ALZA 1S9GA 5C42A 1D0EA 3OV7A 4OYJA 4MYUA 1H74A 2W25A 4J5OA 5CA5A 5DABA 5D4NA 2NXJA 4UZCA 4TNVA 1RHMB 5L46A 4F7VA 5HMZA 2HWHA 2W7AA 1QD1A 4YY3J 3ZMVB 2R4FA 2WDQA 2HS3A 3JB9k 4JUYA 2LE8A 4YB7A 3BGRB 4KRWA 5KFWA 2KG0A 1Y5IB 3T1YF 4YFUA 1XMOJ 1PC5A 2WBLA 2VKRA 4NLPA 1FE0A 3PW5A 1UW4A 3RYCE 4FYXB 2XQ6A 3NKZA 2WAUA 2U2FA 3PUQA 4DV2F 1IBLT 5AQIB 1UEUA 1LNQA 1RTHA 3LALA 4GKKF 3SV3A 1UWBB 4KO0B 4DV5F 1NJZA 1RBOB 5AXLA 1U2FA 1KFDA 4OI2A 3GE9A 4ED6A 1B99A 2PG8A 4ED5A 5ABFA 1GX6A 2ZBRA 2PJQA 4B9UA 5GMEA 4UTGA 2HPLA 2W61A 4TV9E 4OHYA 3DLKA 1L3TA 4CYUA 1ZM4A 3FBBA 4X65T 4FXVA 4B3MF 2CJ9A 2DITA 1FO1A 3HKEE 2B76A 4IIJE 4LBIA 5L3EB 3VRBA 1BR0A 4O44B 1UJ5A 3MDFA 2JQ9A 3WAJA 1PAUB 1FRHA 5HYAA 2NW7A 1TQLA 2CJYB 4P2SA 3OLBA 1U1PA 3MMCA 3MXZA 4NLGA 3D7SB 2L41A 1T03B 1P9QC 2UXDJ 2H5JB 5H6RB 5LSOA 2D1CA 3D6FB 3FQKA 4E0DA 3H3AA 3R6NA 5ETLA 3MZKB 3NXZA 1S6OA 3E01A 4ZVFA 3JQMA 3HZEA 1HI8A 1N34J 2XYPB 1GMWD 2V2QA 4OMFG 4V19X 3L09A 4CO3A 4NLUA 4RWXA 3SQGB 2DO0A 4CLWA 1BWEA 3W7BA 2FVCA 5T7LB 5C25A 2JQHA 2AXDS 4EUVA 2V2VA 2Y48B 2A72A 2WAQD 2CADA 2B6AA 1HBUB 2EK6A 2DEIA 4DF8A 3M6UA 5HWYA 3BZQA 2HNYA 5KAKA 3EJMA 4X64J 3P8BB 4GVLA 3CCES 2FD2A 3T3FA 1AUSL 1GMVA 2W9CB 1CHUA 4HWDA 5A8RB 3DOLB 3MAQA 2ZVSA 5C7PA 2W4DA 2K1RB 3LSVA 5HEGA 4M5HA 3FBEA 3CO9A 2NOXA 3BGUA 5DG9A 2EVZA 2BJEA 2WW4A 2G4BA 4DV3T 2Q79A 2D3OR 2OEMA 1SKWA 2C2MB 4IFVB 3FCWA 4DI6A 5IT0A 4B3OB 1ZETA 1SH2A 4FYVB 1FKPB 2IVYA 5JMNA 4ZEYA 4ECWA 4EO6A 5ETOA 3EYZA 3PM9A 4JI7J 4WP8A 4XTTA 1S9FA 7FDRA 3RYLA 3NGKA 5LA6E 4F8RA 3AAWB 2CPTA 2LDYA 3A1YG 4PPDA 1SC3B 3AOCA 3I87A 1T95A 3PTRB 1HHSA 5IT9U 3NGTA 3FSIA 3MM5B 2FHJD 1UCNA 4NLDA 3H42A 3DGPA 1FWPA 4Y2CA 1D1AA 1FKAF 1VC5A 4CQ1A 2LKZA 2B9WA 2M5YA 1UURA 4EBEA 3W1YC 2DR8A 5LMUF 1U09A 2ZH6A 2XB2D 2JQQA 5F3ZA 3PUYF 2HSEB 1BQNB 3CMLA 1G8XA 1J5EJ 5EK3A 5LHIB 1Y10A 4C90A 3KDOA 3JSMA 3HVTB 2U1AA 3TR5A 2ZDOA 2CPIA 2KT5A 1QE1B 1VCTA 3K3NA 2L9DA 3WDOA 3AODA 1F9FA 2R6GF 5HROA 4DX6A 2AEJA 3N79A 3L7PA 3ILJA 5KG5A 3V6KA 4EZ9A 1RWKB 2WSCC 2Y1JA 3KHRA 5ETQA 3NZPA 2FTRA 3DYAA 1Q1KA 2KZZA 1VQYA 4QU6A 1WJ9A 2EWHA 3UDVA 5DQWA 3M1VA 1CC7A 2LHRA 2XMMA 2X68A 3FZMB 2G0CA 1JIHA 4I2QB 3MM6A 3HHLC 4C11A 1SPBP 4I4BA 4O4GB 2QLFB 1LWFA 1YKHB 5HBMA 1NHUA 1RWUA 2N7CA 1U8SA 1RTJB 3SBMA 3GP9A 1KK7A 3KV6A 4I6AA 1HWUA 5L9NA 5KT7A 2GVDB 3DU6A 1NKCA 3JSYA 3P4WA 1HBOB 4ZPCA 3TX0A 4HWFA 3DM2A 5AFUL 3EUNA 1S1VB 4NA2A 3UWTA 3ZYLA 1TFWA 1WC1A 1M62A 1FJ7A 4AKLA 2M9KA 3IF8B 4DR1J 2C3OA 4AXIA 3MUMP 5A6PA 2QMWA 2MPUA 3ZZTA 5AQGB 1WC4A 4WP3A 3ZMTB 3W9JA 2DCLA 4HFVA 5D4OA 4DN0A 4NZ6A 3I5BA 5CA1E 5E5NA 4DV0J 2LMIA 1X4DA 2FC8A 4RUAA 3RBDA 2IY5B 5E0OA 3SCKE 4HKQA 3NOGA 1SI9A 5MLCV 5GAEU 2QV6A 1UW9A 2YDSA 2R7SA 1XNRJ 1GNKA 3C3LA 3BDPA 2VHGA 3CUNA 2R8KA 1FRXA 1GAOA 2JC0A 4FDFA 1FNMA 1KVKA 2C5JA 4PJLA 2DNOA 1S12A 2XZTB 1NPKA 4N56A 3EWGA 3K5PA 2JJ9A 2ZWPA 3AA7B 4EEYA 2FJXA 4K59A 2OFGX 2FJBB 3LTOA 4DL5A 2M6BA 3JQKA 4LSNB 4PQAA 4U6PA 2PI5A 3V5RA 2ZBCA 2RRNA 3CJ8A 3LP2B 1NB7A 5DZ6A 1Y3KA 4IDQA 1LWCB 3SSSA 4I55E 1HNWF 4PUOB 2F4VT 3H4BA 2OMOA 4EBDA 4BJMA 2HHHT 1IUJA 1HQUA 4URQU 3KDNA 5H6QB 4K0KF 2GX8A 4EXTA 1HF8A 1OYDA 4X4NA 2B4PA 5DRKA 5J1GA 2DJWA 2HYIB 2Y0SD 1VK8A 3O2IA 3EHZA 2DNGA 2KKHA 2ZM6T 3NCQA 2LHNA 3BO3A 2CNKB 1BQMA 1LKZA 3AD9C 1S1UA 1ZAWA 5B09A 4IOBA 2PGCA 2MQ8A 4BCAA 1YRUA 2PN6A 2L9WA 5IV3A 4KKOB 3CJRA 4HI2A 4LSZB 1RT5A 3PCOB 4YXDA 5E41A 3N2KE 1LK5A 1W0BA 4IH7A 4DL0C 2B43A 1J27A 2V7MA 1IBLJ 5JR9B 1SA0E 1PYOB 5LGUB 4A48A 2KMFA 4WK3A 2L3MA 4PRFA 1L0VA 2ERRA 4CTAB 3NNHA 3Q9DA 4DR7F 3LPYA 3G06A 3KLHA 2P9EA 3OHAA 1X9MA 1HIYA 4NA1A 4B9LA 4C97A 4DDFA 4E98A 3HSJA 2G2OA 2Y8YA 4ZPVR 1CG2A 4IE4A 3SFUA 4ECXA 2R8GA 4KPYA 3PUGA 2XEXA 3CNQP 1NDLA 2V6XA 2CHNA 1F9EB 3RLFF 3BH7B 2ZBIA 2DHHA 4ZPDA 3KOAA 4ITSA 5J2NA 1AT1B 3W5XA 3Q5XA 4A8FA 5LHGB 2MJNA 1X9SA 2DEJA 2XQAA 3LGNA 2KNDA 4HWIB 3CO0P 3GR0A 5DGAA 2CZ4A 3CC4S 1I5OB 3GG0A 3Q22A 2G2YA 5HL7Q 3KLFA 1DTTB 1F3VA 3N6MA 2HFNA 5L39A 4P0AA 3I0RB 4RR5A 1PBAA 2DVIA 2VODA 1H2VZ 2QGFB 4AIUA 2WTFA 2CLYC 1PIEA 2DGXA 1A7GE 2YKAA 1SB6A 5E3AA 1IKVB 2X9XA 4NMLA 3P49B 4IHJE 3EDQB 2B9YA 1TL1B 1RACB 4H4KC 2G1DA 4CN6A 1JNZA 2XZEA 3IFEA 3G8SA 3CJKB 1PAEX 3AAIA 1T11A 2IRXA 2CE7A 5AQNB 4ZVGA 1VK3A 5IM0B 3ZT5A 2GAHC 2IAJA 2RP4A 2Q9QC 5DZ7A 3CK6A 4JI5T 1KLMA 2HK2A 2K06A 3LA0A 2QA4G 2HVZA 3RTVA 2VKOA 1NRKA 3IRXB 2I9SA 3SQOP 5J1NA 1V3RA 1XMOF 4MT1A 3E22E 3KDSE 1ROFA 5C3JA 3VU7H 2RRAA 1JLBA 4U7YA 2OLWA 1Z4UA 3BK9A 1TKXB 2AYGA 3PDYA 2ZLYA 2GHPA 4DV1J 2I59A 4DV3J 3N5BA 4I6WA 2KM8B 2XMWA 3N4WA 5GAHI 3AE5A 3DRSA 2XHCA 2NSBA 4EYYR 5A8WB 1JLFA 4GK5E 1S5ZA 4JI6T 5KXJA 3P4SA 3KK2B 1C0UA 4YSZA 4K5RA 4G65A 2YKMA 4HL9A 3GFZA 1UMJA 2ZH9A 2RHQB 1RI7A 2HQIA 3HX9A 1HWLA 4IUFA 2BYCA 2XMJA 1M1HA 3IM9A 4USVA 4C0HA 5FMNA 5L2LA 3PJAA 2FHKA 2XMVA 4J9KA 4LF8T 2W00A 4H4KA 4ZLJA 4L75A 1YG0A 1C4AA 2DNHA 2KSRA 3M2RA 2DYAA 4RU9A 4YHHF 4MKBA 3AXKA 1UFWA 2Q9QA 5KFHA 1F9HA 1B70B 2GGPB 2NP9A 4YEAA 2X9HA 3OKQA 5HK4A 2HFVA 3FB2A 5CABA 2KLQA 1MMGA 1WKKA 2C2KB 1AROP 3K5OA 5EZYE 3M8QB 2UUAF 3EVOA 4DJBA 2NR0A 3TEHB 4USKA 3J7YU 2XS7A 3VGVA 3BN7A 1HNZJ 1AXQA 3QGPA 1OSDA 2Y1LB 4PJJA 2XQ5A 4IKAA 1U1RA 1VLYA 4F3MA 1SV5B 2WU5A 2FQQB 5RUBA 4MKVA 4AD6A 1YKWA 4AUKA 1RAIB 4IO9Q 1NMEB 2GQQA 3NS6A 4N8NA 3AT1B 3RB4A 1NK4A 5FL1A 3AXMA 4NI2B 3UFEA 4H9OC 4X64F 3M9OB 2H54B 3FFIB 4IDZA 3THVA 4AE5A 3TJ9A 4ZZBA 3OVSA 1X7VA 2ZC3A 3LP0A 1U1LA 5FXWA 2YY3A 3EPIA 2FLNA 3NGUA 4FBTA 3NNCA 1XK8A 2MLZA 2DGTA 2V6YA 2BJ7A 2E7VA 4DUZJ 5AQSB 2KINB 4OI0A 5ETKA 2YKOA 3DI6A 2YTCA 3QJLA 2P2CB 3HD1A 4BS2A 2CWOA 3MPWA 2Y3YA 2N3LA 4DR2T 3F0NA 3OYZA 2N3OA 3EVMA 4JI7F 2GS8A 4HEAA 4IO1A 2KXNB 5D78A 2J76E 4Q25A 2R9LA 2DHRA 3GIIA 2MZJA 3UN2A 4DL6A 1KONA 4ED1A 3ENWA 2AMCB 4NZ0A 3TLVA 1K1QA 1SQEA 4A8XA 2VONA 3D1QA 3R7BB 2QA2A 2DCFA 1QAJA 3AA1B 2PBIA 4ED0A 2ZHAA 1X4GA 1Q5VA 1TUVA 3M2UB 4F4ZA 2LQBA 4YSYA 3RAQA 3TLWA 4H4OA 1YVFA 2GMLA 2ZBPA 2F9JA 3MA9A 1CQNA 4XZCA 2W2OP 4QWDA 3I32A 1BD6A 4TNOA 4TN7B 1SUQA 1FTRA 3MCOA 3D0HE 2IYIA 3LK42 4NZ7A 1W0AA 2MQMA 3EUHA 3W5ZA 2LRKA 1D1CA 2OELA 1FRKA 3HHNB 4WIQA 2WMOA 2F4VJ 4NE9C 1YJ9S 2WSEC 4UOGA 2V69A 2HHHJ 3OVUA 2XC9A 4USMA 1D8YA 1V3ZA 1RT7B 3R27A 1U6ZA 2FLPA 1S9EA 4OHZA 3UW1A 2RHSB 2ZKUA 2YNGA 1W2BR 4FXDA 1G1XA 4RNMA 2ZM6J 2CCQA 3C50A 2BG9C 1U2RA 2UUBF 1TV6B 3AH6A 3QFWA 3D9BA 2G9OA 3CQCB 3MWBA 2ATCB 5CYJA 1T8BA 1CVJA 4JV2A 4KR0B 1X9BA 3OYXA 4TU9A 4G6VB 8RUCA 5KFTA 1IBCB 1HD1A 4A8OA 3FZLB 3UDEA 2LECA 1FWLA 4A8MP 4TY9A 1U49A 2AQ4A 5DDQC 1RDRA 1PCAA 3OXFA 4X4UA 2I0XA 3TZWA 3H7HB 2FVSA 3OR1B 2HQCA 4RW6A 5C5JA 3DHWC 4I43B 2CIMA 4CP5A 5GAHU 2CQBA 4ZIWA 4B9VA 1NK5A 2DGOA 5K8OA 2GFFA 3OFFA 2B56A 3GYXB 3CPZA 4X4SA 3UR0A 3CX7B 1RHKB 1X0FA 4WJBA 4IDKB 2J7WA 2HFOA 2DHAA 4DV0F 2BJDA 4HYKA 3PO5A 3R8YA 3VGSA 2WSSV 1M1KT 3LP1A 2HBYB 4WFZA 5KG1A 4URSA 2MMYA 1FERA 1MN7A 1IJ5A 3PUWF 2VQFF 5JDHA 3AY0A 2V8HA 4QPTA
chains in the Genus database with same CATH topology
2BKOA 2IIUA 4EI2A 1T8BA 3RBXA 3KXDA 4J7CA 2BKPA 1XWMA 2BKNA 1LNQA 4XTTA 4J91A 3RBZA 2AEFA 4G65A 4L73A 1SUMB 4L75A 4YS2A 4RO0A 2OLTA 4J90A 4L76A 4Q25A 4GVLA 3L4BC 3L39A 1VCTA 2OGUA 4J9VA 2AEMA 3JXOA 4L74A 4J9UE 2FY8A 2AEJA 1T72A 2I0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKO A;  2IIU A;  4EI2 A;  1T8B A;  3RBX A;  3KXD A;  4J7C A;  2BKP A;  1XWM A;  2BKN A;  1LNQ A;  4XTT A;  4J91 A;  3RBZ A;  2AEF A;  4G65 A;  4L73 A;  1SUM B;  4L75 A;  4YS2 A;  4RO0 A;  2OLT A;  4J90 A;  4L76 A;  4Q25 A;  4GVL A;  3L4B C;  3L39 A;  1VCT A;  2OGU A;  4J9V A;  2AEM A;  3JXO A;  4L74 A;  4J9U E;  2FY8 A;  2AEJ A;  1T72 A;  2I0M A; 
#chains in the Genus database with same CATH topology
 3NS5 A;  3NKY A;  1S6Q B;