2CXLA

Run domain of rap2 interacting protein x, crystallized in i422 space group
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
165
structure length
158
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords rap2 interacting protein x
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 158
sequence length 165
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxlA00
4GIWA 2CXFA 2DWGA 2CXLA 2DWKA 3CWZB
chains in the Genus database with same CATH superfamily
1JNRA 2ZMAA 3P4SA 2CWOA 1VRBA 3P7IA 3SFEA 4B3MT 2BS2A 3VKGA 2LHRA 1FIOA 2WZIA 4WNKA 2CRBA 3RI5A 1KNZA 4H63H 3F57A 3BQKA 4IREA 4EZHA 3P8CD 2FJBA 1Z0PA 4ZI2C 3U3IA 1SHZC 3KVAA 4X1KE 3TLUA 3RF1A 5AQHB 1EZ3A 3F31A 2EHOA 4HFIA 3ANWA 3RQWA 5ABEA 4TWFA 3QNUA 3AA1B 4HKAA 3ZCIA 3FBLA 4GKJT 2CXLA 2ZM0A 3PV0F 2NTXA 2XAGB 2X9WA 3R6NA 4AQYT 1KNRA 3ZMTB 5JR9C 3V5SA 5DQVA 3ZMZB 2XM2A 2Q9QA 2XJ7A 4EYUA 4QH4A 3O1HA 2VWAA 4HGAA 3CMLA 2WCAA 3A7MA 4YTNA 5CJ5A 2UXBT 3EDVA 4ILBA 3KV6A 4ZEYA 2CM0A 4O4IE 3HKCE 3C50A 4ILUA 3ZCJA 2XQ4A 4LFAT 1AJ3A 2IMLA 4FI5A 1W0BA 4JI2T 5FVKA 3FHNA 1G73A 3X1DA 4DV5T 2IAKA 2XHEB 1WR0A 2XAQB 1BR1A 2JQHA 4EOZB 4CXWA 3CQGB 4AKLA 2W62A 4EIWA 2IHR1 2V6YB 2JIWA 5CA1E 4Q25A 3JAFA 3NZQA 1CUNA 1LVKA 4U7IA 2LHNA 4I43B 3T8OA 2XUEA 3I0OA 2LOPA 2BG9E 5FL1A 4XBFB 4AKIA 4NXMT 2VURA 3ZYKA 1D0YA 2CHNA 5JVDE 3RLFF 2EHOC 3C4ZA 3LSVA 5AQIB 5HXSA 2J47A 3AE6A 4IIJE 1LRZA 3FZFB 5HCMA 4WYVA 3OPCA 4JEUB 1GQEA 3EI0A 5L3GB 5HEOA 2AXDS 5EK4A 3TLTA 2RA1A 2MYSA 2BG9B 3PUAA 4IT4A 2CA5A 3OKQA 4UF0B 2Q9QC 4L9IA 3AEFA 2W2UA 2NWBA 4MFRA 1ZEEA 3P4RA 2XQ6A 4CN4A 1N36T 2WY2A 2WU2A 4JI7T 4DR1T 5JREA 4PW8A 1FMWA 3FXDB 4PK4A 4ZI3D 3WAJA 3RC3A 2BDEA 2XQ5A 3FZLB 1LKXA 2V5CA 3ZJ2A 4IDPA 4P1NA 2R6GF 2X0HA 3ZPOA 2IC6A 3FZKB 5LG3A 1J5ET 3C98B 3MZKB 4XAXB 2X9YA 5FY0A 3UFEA 2GK9A 3J9X1 4TX5A 2YN6A 5BR8T 5HAXA 2LKHA 3ABVA 4GYSA 4GOUA 1D1BA 3L3PA 3C4XA 2X0YA 3FB2A 3SWHA 4PAGA 2YK0A 3G06A 4ANJA 4YHHT 4UV9B 2J4GA 4KMCA 4AISA 4YTPA 1B7TA 3NKZA 1HTJF 2XAHB 1G8XA 3K3OA 3S4UA 2CCQA 2QGSA 3Q5WA 3RIUA 2NW8A 4ZZBA 2WB5A 5H6RB 5DABA 2W61A 2W63A 3QB5A 4HFVA 2V7KA 3I9WA 2XQYA 2X9XA 3JADA 4UR9A 4CQIA 4DMVA 1XDOA 1IBKT 3PUXF 4QKNA 1WCRA 3UU5A 1WR6A 4BJNA 3RIFA 3ZJ1A 2KXPB 4WBNE 4UVCB 3LJCA 1ZKEA 2E8IA 3PU3A 3ZN0B 2HN2A 5HCJA 4P09A 2UXDT 3FZMB 4Z91A 3HKBE 3GN5B 2V7IA 1HNXT 2X68A 2VKOA 2MTQA 5AQGB 3P4QA 2K48A 4MHCA 5AQUB 4DV1T 1O3XA 4IGUA 2DLRA 2J1DG 1M62A 4HEAA 4ADZA 1U4QA 5AQOB 3ZMVB 1KNPA 4JEHB 2W00A 4DR4T 2D2SA 4DV3T 4EAHA 2HPLA 4ZOLE 3TLSA 2JRKA 4H9NC 3AE7A 4GK5E 5HXCA 2Y6XA 4IE7A 3UU6A 3RIUC 4B3RT 4ZI2D 3EABA 3N9NA 2WBLA 4L0RA 1FEWA 4Z8XA 3GMIA 4A56A 4LF8T 3RYHE 2WQYA 2E9XA 2WAUA 2OA5A 5L3BB 5FXZA 3VHLA 1IAPA 3UTKA 5FXXA 4ZXLA 2WMOA 1HR0T 5HEJA 3TLWA 2IIUA 3K3QC 2DWGA 3VR8A 3T1YT 1XZYA 1T72A 4EV6A 5IYZE 3QB5K 1OEDB 3RGLA 2W0GA 2V6XA 4AKHA 2XQ3A 4G2AA 2Y48B 5GONE 4F6RC 4O8SA 3RYCE 5HXEA 2BVMA 2VVSA 1ZOYA 4C91A 2VQFT 4ISTA 2DL1A 4TNVA 5FVLA 3AE5A 1XWMA 3AECA 4DV0T 5ETWA 4DR7T 4ILCA 2MAWA 2P9BA 4GKKT 4O2BE 5J0ZA 3N9MA 4AKRB 4DVDA 4LMJA 1ZHCA 4DBRA 3PURA 4YLHA 2V6YA 4DV4T 1I6ZA 4V1Av 2WU5A 3HA4A 4NPPA 3QC9A 2K3WA 2BKOA 3DTOA 3AE9A 3IF8B 1SUMB 4TV9E 2KWHA 2I59A 2KWIB 1SA0E 1QUUA 4QX7B 3AA0B 2EHOD 2E9XC 1WYCA 5ABFB 5JDMA 1IZNB 2BBJA 4LF9T 1L0VA 5A1LA 5M4YA 4HFCA 4DUZT 4OK0A 2XASB 4DR3T 2Y8DA 3GWHA 5C3JA 5JTGA 5LMUT 2BBHA 2H7OA 2Q9QD 5LHGB 4QWNB 1KFYA 5F5WA 4KUMB 5H6QB 3BQLA 3OBVE 1T7SA 4H9RC 5LMNT 2A72A 2N9DA 2XAFB 4A5XA 4YSXA 4JUYA 4AQFA 2H7VC 5AQQB 4YSYA 1HNZT 3PDYA 2IUBA 1WYBA 3PE0A 2FJAA 3K3NA 4NUUA 4X62T 4I50E 3ZN1B 4UV8B 1D0ZA 2OLTA 5LGUB 1T98A 3ZT5A 2M6IA 2CLYC 2YU2A 2M6BA 1MNDA 2VKHA 3TKLB 3H3AA 2WZHA 3N9OA 4LFBT 3RYFE 5JH7E 4YJ3E 5L4HA 4PJJA 2C5JA 2BVLA 4I55E 4P0BA 2PBIA 5CFBA 4A97A 1HX1B 4AQGA 4TN7B 5JR9B 1SE7A 2VL8A 1J1JA 2V1DB 1XNQT 2CPTA 4QH1A 5LB7B 2E5LT 4IDNA 4DV2T 4IDZA 2CLYB 3EAMA 4P0AA 1KK7A 4CI1B 2ES0A 3ZSTA 3SS1A 3E22E 2YINA 1D1AA 3PUGA 5FNVE 5JRCB 2V7JA 1MIYA 4E7SA 3VU7H 3LBXA 4JI6T 1BR2A 2D5UA 5AQPB 3KVBA 4AQFC 4G63A 5KX5E 3N2KE 4WW0A 3IBPA 2K9AA 1NAFA 4DR5T 3CK6A 3MJXA 2XQAA 1R8IA 2X51A 3LDQB 4K0UA 5LBMA 1NEKA 2VB6A 3NZPA 4H9SE 1M7KA 2DHRA 2UUAT 4ASKA 4ZS3A 4YJ2E 1YQ3A 1E2AA 2XTLA 1QLBA 1Y64B 3SFDA 3ZLIA 5JDNA 2EHOB 2CWYA 3ANWB 1HG2A 3FBZA 2F4VT 3FZHB 3KV9A 5L2LA 2QA7A 2XQ8A 2XM1A 3J7Yq 3UUBA 4I0UA 1W0AA 1BR4A 2LLYA 4CI3B 3AVSA 3AE1A 1US7B 3BQIA 3RHWA 2W66A 2Q9QB 3N9PA 3RX6A 2WS3A 3EHZA 4KI0F 2LE8A 2B1EA 2I0MA 2IW5B 3EUHA 4QXBB 3ESLA 4O4LE 3OYZA 4K0KT 3AEEA 4YXDA 2NP9A 4OFZA 4CN1A 4PK6A 2VVNA 2YU1A 3UUXB 3T1HT 1XNRT 2CBJA 3JC6D 3VRAA 4JV5T 3CKDA 3CQCB 5JQGE 3AE3A 4DO0A 3F2EA 3CX7B 3P4PA 2CE7A 3MACA 3Q5DA 3LK42 2CHOA 2JQKA 3ZMSB 4JI8T 5DQWA 1IBLT 1Y01A 5IWAT 3RKGA 1UURA 2N2NA 2ZM8A 5FMNA 5L3EB 3JAEA 3P4WA 2WMNA 3KINB 1D0XA 2BS3A 4JI4T 3C4WA 2LOSA 3BK9A 1WRDA 5AQJB 5EK3A 5LOVE 5KMGP 4GK0E 1OEDA 4TV8E 4CZZB 1MMNA 2QVAA 3AXJA 3OTOT 3O1IA 2CXDA 3ONJA 1S35A 2CBIA 2XSBA 3QUJA 4IL9A 3PUVF 2LRLA 2VK9A 4TUYE 2AE9A 2N1GA 4XZCA 3AA6B 5LCYA 5AQNB 4AI6A 2UUBT 3NRYA 4PNIA 1IJ6A 4F8HA 2YEVC 4YSZA 2WM9A 1MMAA 4U31A 5AQMB 4LMLA 3AA7B 1VOMA 5HWXA 1XDPA 3PUWF 1I94T 5C8YE 4IDOA 5LP6E 2MOZA 3AE4A 4B3TT 4PJLA 5LJNA 1UK5A 1UUSA 4HWHA 2V7LA 4B3ST 4U74A 5L3DB 2BKNA 2VKDA 5BMVE 4PK5A 1NWMX 4KBMB 4BAYB 4IE0A 3TLVA 2YOEA 1HF8A 5E0OA 2K24A 4OYJA 5HEGA 2ZLYA 3HR0A 2HH7A 2V7MA 1S94A 2NTYA 3VKHA 5AFUL 4DV6T 3KBTA 4JI1T 2UU9T 3GA8A 5TAOA 4NXNT 4H9OC 3WI3A 4DR6T 3K1SA 3OYXA 2W67A 4KHPT 3LG7A 3HKEE 1YKEB 5AQKB 4DUYT 3LFMA 2W4XA 4FJOA 1E1HB 1MMGA 2XZEA 3EDUA 4H9PC 3SRZA 2H89A 3ZC0A 2LT3A 2C0SA 4C90A 5LYJE 4EEBA 1HS7A 3JCFA 5HYAA 2JQ9A 4HFEA 3AEBA 5LG4A 3ETUA 1YD8G 1HG5A 5HXHA 2X0LB 4CXYA 1OXZA 4OYKA 4DBQA 3N9LA 4YT0A 2Z6EA 5HEHA 3UQ7A 4NUVA 4JYAT 1UX4A 1N32T 2DI4A 2KMFA 4PJMA 1KF6A 3WAKA 3ONLC 1YXRA 1D1CA 4ZZCA 2VASA 3SOLA 5FXVA 3RPUA 4N78D 2V5DA 4UIGA 4HWFA 4HFHA 2BZBA 1VCTA 4U7YA 5LHHB 4O4JE 1WFDA 2NW9A 1CHUA 3FXEB 3A8YC 1UGOA 1U5PA 3CWZB 3AAEB 4YFSA 4M1PA 4ZHQE 5LJMA 2LSYA 4U33A 3RC8A 3CQXC 4COFA 5JRCA 5J1GA 3MK7C 4DMWA 4HWIB 2YDSA 1YQ4A 1N33T 3HI2A 5ADXL 4OHFA 1LVFA 5LHIB 2D0UA 4U72A 4B6XA 1X79A 2D9DA 3UFGA 2KNDA 3HKDE 5JDFA 1IJ5A 1E7PA 4DR2T 5LGTB 1W9RA 5C2TA 2H3RA 5EZYE 5F8PA 3AAIA 1FMVA 2BG9A 5KDMC 3Q2MA 3PTRB 4DV7T 3UT5E 4QHOA 4UF0A 4ZS2A 2WWVA 2BKPA 3Q5EA 2E9XB 3OVUA 5F3JA 3KBUA 4QH5A 2WDQA 4HWDA 1Z8UA 3PU8A 3N2GE 4UELA 2VQET 3RQUA 2C5IT 1QSDA 3UU4A 4IDQA 4HTEA 2IDOB 2PTFA 4ZI7E 2LSKA 5JDGA 1W09A 4DNDA 4TWDA 1MIVA 2JJ9A 2E2AA 3AEDA 2NR4A 2FJEA 1XMOT 3PJAJ 3M65A 5JDHA 4EYYR 4LFCT 4KP3C 2ZM2A 2NOXA 3ZKRA 3NWIA 3RYIE 3LK2B 3CVRA 3AE8A 1MNEA 4PFOA 5FKYA 3RKOA 1ZV4X 2HHHT 2OV9A 2A9UA 3K8PC 3AAAB 4CI2B 4MALA 3LK3B 3ZSSA 4IL4A 4L5GA 4HFBA 3O4XE 5LA6E 2WP9A 4TWHA 3H37A 4AKGA 2V8SV 2BG9C 4TNWA 2BS4A 2VKJA 2ZM6T 3CPZA 2DCFA 3D0TA 2LKGA 2IC9A 4X5TA 4AXPA 5CB4E 3ONXA 4U2ZA 5AQRB 1OWAA 2CXFA 3ZYLA 3MXZA 3UU8A 2J62A 3KFWX 2KT9A 2KSRA 4GYRA 5JDLA 1HNWT 4EGWA 2HN1A 1HFAA 4J2CA 1XMQT 4BA9A 3GN5A 4EXTA 3N5LA 3MKDA 4GIWA 4X20E 5L4EA 4X1YE 2XSAA 1VCSA 2LM2A 5J2TE 4LF6T 4NIQA 1UCUA 3ZT6A 3QOFA 5AQLB 2ODVA 4O4HE 4U3CA 2PG8A 2C5KT 4WZXA 3UUNA 4UVBB 3O9XA 4JI3T 1NENA 2E5VA 4X65T 4KHZF 2X9HA 3N2OA 4I4TE 4Z90A 4EEDA 3DP7A 3M3ZB 4MLKA 5IUXA 4IHJE 3C64A 2A3DA 3A5XA 3R84B 3E0ZA 2LRKA 3KV4A 1V9DA 2L3LA 1YW0A 3PUYF 4HFDA 4UVAB 1N34T 2MPKA 5L47A 3NBXX 2DWKA 2LSGA 4JI0T 3QK6A 2DNXA 3IA3A 1ZP0A 4X1IE 5JDQA 4MBQA 4O2AE 2FJDA 2WSSV 3B5MA 4ERRA 3AB3B 2XQ9A 3ZC1A 4WBOA 3U78A 4AIUA 1WLXA 2UXXB 1FJGT 5DJQC 5LXTE 3L8RA 5LBQB 3O1JA 2QYWA 4QXCB 3UUMA 4LMKA 3UQ4A 1YKHB 2LM9A 3RRWA 3ZMUB 5L3FB 1HCIA 2ACXA 3ETVA 3I1AA 3LBXB 2M67A 2H88A 5AQVB 3PUZF 1MMDA 4HWCA 4E7ZA 3OJAA 4KX6A 3Q5XA 3B57A 2A2FX 5HEUA 3L39A 5FP3A 5L3CB 1IBMT 3C51A 2XPKA 2UXCT 4UXNB 2B76A 3DJBA 4DIDB 5KXJA 3Q9DA 3W15B 4LF5T 2K5BB 1UX5A 3PJAA 2FBWA 2UXNB 2JPFA 4X66T 2I6HA 3UU3A 3RRCA 3N9QA 3CX8B 5LNKA 1DU2A 2XY8B 2YKSA 2PJQA 2ACZA 4QXHB 2WDVA 2E9XD 2UUCT 2XQ7A 4YHJA 4HE8A 3I9YA 2PFVA 4IE5A 5CGMA 3VRBA 4ZI3C 4UEMA 2X67A 4A98A 4YTMA 1KEYA 3H3MA 4CXXA 5ABFA 2WWUA 2MBGA 2LSIA 3L09A 2D0TA 4QX8B 5FL0A 4LF7T 3RIAA 2XAJB 5ABHA 3KV5A 3AEGA 2L8KA 3UULA 4EB6E 4PFPA 3B13A 4U2YA 3NRXA 3E08A 5IHYA 1HX8A 2JMHA 2JMKA 1OEDC 3MA9A 3AVRA 2KLQA 3AE2A 1BR0A 3V5UA 1OEDE 2WDRA 4BJMA 2YDRA 3P50A 4CN6A 3ZT7A 4OX9T 3VR9A 4IE4A 5AQTB 5FY7A 5CA0E 4H9QC 2LEHA 3JC6C 4X64T 5LGNB 2RP4A 3HL6A 2CEAA 2VL0A 4JI5T 1H7CA 5ABGA 2LJLA 3CIRA 4JBWF 2X66A 2YDQA 2HPJA 3I0QA 4TZ4C 2CMRA 5J2UE 2KZ7B 4LF4T 1T8BA 2LSJA 2ODUA 2QRXA 2SPCA 3AXJB 4EZ4A 2KINB 2FUPA 1MIWA 3CX6B 4PJNA 1X9BA 3IEEA 5FYMA 3AEAA 5AQFB 4ILAA 4HN9A 2JQQA 5JR9A 2V26A 3ZEFB 3PUSA 2L9QA 3EVYA 4H63V 4JLEA 3KDSE 3IHRA 5FY1A 3NVOA 5AQSB 4ISSA 2NW7A 5HWYA 1J5WA 1JNZA 3PUQA 4IE6A 3ZYMA 3RH3A 2G0UA 5EK2A 5FXWA 2RPAA 4YY3T 5HXRA
chains in the Genus database with same CATH topology
4O4LE 4MALA 4H9NC 3LK3B 3OYZA 2NP9A 4OFZA 4L5GA 3O4XE 4PK6A 2ZMAA 4GK5E 2YU1A 5LA6E 2CWOA 3UUXB 1VRBA 5HXCA 3JC6D 3P7IA 3CKDA 3CQCB 5JQGE 3H37A 4DO0A 2Y6XA 4IE7A 3F2EA 4AKGA 3CX7B 4ZI2D 2CE7A 3MACA 3VKGA 2LHRA 1FIOA 3N9NA 3LK42 2WBLA 4L0RA 1FEWA 2VKJA 4WNKA 3CPZA 4Z8XA 2DCFA 3D0TA 3GMIA 3ZMSB 4A56A 1KNZA 4H63H 2IC9A 3F57A 3RYHE 5DQWA 3BQKA 2E9XA 2WAUA 2OA5A 4AXPA 5L3BB 2N2NA 2ZM8A 5FMNA 5FXZA 5CB4E 3ONXA 3VHLA 4EZHA 5L3EB 1IAPA 3UTKA 5FXXA 3P8CD 2WMNA 3KINB 1D0XA 1OWAA 2CXFA 2WMOA 3ZYLA 3C4WA 2LOSA 3BK9A 3MXZA 1WRDA 5EK3A 5LOVE 1Z0PA 3KFWX 3U3IA 1SHZC 4ZI2C 2KT9A 3KVAA 4X1KE 4GK0E 4TV8E 5KMGP 4CZZB 1MMNA 4GYRA 5JDLA 3K3QC 1EZ3A 2DWGA 3F31A 3O1IA 1HFAA 4J2CA 2EHOA 2CXDA 3ANWA 4BA9A 3GN5A 1S35A 4EXTA 3QUJA 3AA1B 3N5LA 4HKAA 5IYZE 3MKDA 4GIWA 3ZCIA 4X20E 3FBLA 2VK9A 2CXLA 2N1GA 4TUYE 4X1YE 4XZCA 2ZM0A 3AA6B 2W0GA 2NTXA 2XAGB 5LCYA 5J2TE 4AKHA 4G2AA 2Y48B 5GONE 1UCUA 4AI6A 4F6RC 4O8SA 2X9WA 3R6NA 3NRYA 2ODVA 4O4HE 3RYCE 3ZMTB 5HXEA 2BVMA 2PG8A 1IJ6A 4PNIA 5JR9C 2YEVC 3V5SA 4C91A 5DQVA 2C5KT 3ZMZB 2Q9QA 2WM9A 3UUNA 1MMAA 4ISTA 4UVBB 4EYUA 3AA7B 1VOMA 5HWXA 3O9XA 5C8YE 3O1HA 2VWAA 4HGAA 5ETWA 5LP6E 2MOZA 2X9HA 3CMLA 2P9BA 4O2BE 4PJLA 3N2OA 5LJNA 4I4TE 3N9MA 3EDVA 3DP7A 3KV6A 2CM0A 4O4IE 4AKRB 4DVDA 4MLKA 2V7LA 3HKCE 3C50A 4ILUA 3ZCJA 4IHJE 1ZHCA 1AJ3A 4U74A 5L3DB 3C64A 4FI5A 4DBRA 2VKDA 2A3DA 3A5XA 3FHNA 3R84B 5BMVE 1G73A 3E0ZA 3PURA 4YLHA 4PK5A 1NWMX 3KV4A 1V9DA 2IAKA 4KBMB 2L3LA 4BAYB 1YW0A 2XHEB 4IE0A 4V1Av 3HA4A 2XAQB 1BR1A 1HF8A 3QC9A 4UVAB 5E0OA 4EOZB 4CXWA 2K24A 3DTOA 3IF8B 4OYJA 3CQGB 4TV9E 3NBXX 2DWKA 4AKLA 2W62A 4EIWA 2KWHA 2I59A 2LSGA 2ZLYA 2KWIB 3HR0A 2HH7A 3QK6A 1SA0E 2DNXA 1QUUA 4QX7B 5CA1E 2V7MA 4X1IE 3NZQA 1CUNA 1LVKA 3AA0B 5JDQA 4MBQA 1S94A 2NTYA 3VKHA 5AFUL 2LHNA 4O2AE 4I43B 2EHOD 3KBTA 3T8OA 2WSSV 2XUEA 4ERRA 2E9XC 3GA8A 5TAOA 1WYCA 3AB3B 3I0OA 5JDMA 1IZNB 2LOPA 3ZC1A 4WBOA 3U78A 4H9OC 3WI3A 4XBFB 5A1LA 5M4YA 4OK0A 2XASB 1WLXA 4AKIA 2UXXB 2Y8DA 3OYXA 3GWHA 5DJQC 3LG7A 3HKEE 1YKEB 5LXTE 5LBQB 3O1JA 3ZYKA 1D0YA 5JVDE 3LFMA 4QXCB 2EHOC 2H7OA 3C4ZA 4FJOA 3UUMA 1E1HB 1MMGA 2Q9QD 3EDUA 4H9PC 3SRZA 5LHGB 5HXSA 4IIJE 3ZC0A 1LRZA 2C0SA 2LT3A 4QWNB 4C90A 1YKHB 2LM9A 3RRWA 5LYJE 4JEUB 3ZMUB 5L3FB 1HCIA 2ACXA 3ETVA 3I1AA 4KUMB 5H6QB 3BQLA 5L3GB 3OBVE 3LBXB 2M67A 4H9RC 2A72A 2N9DA 2XAFB 5EK4A 1HS7A 1MMDA 5HYAA 2RA1A 4JUYA 4AQFA 2H7VC 4E7ZA 3OJAA 2MYSA 3PUAA 5LG4A 3ETUA 1YD8G 2CA5A 3PDYA 1HG5A 3OKQA 3Q5XA 4UF0B 2Q9QC 3B57A 2A2FX 4L9IA 1WYBA 2X0LB 3PE0A 1OXZA 5HXHA 4CXYA 5FP3A 5L3CB 4OYKA 2NWBA 3C51A 4MFRA 4DBQA 3K3NA 4NUUA 3N9LA 4I50E 3ZN1B 1ZEEA 2Z6EA 4UV8B 1D0ZA 4UXNB 3DJBA 4NUVA 1UX4A 5LGUB 1T98A 5JREA 4PW8A 2DI4A 2KMFA 4PJMA 3Q9DA 2CLYC 3W15B 2YU2A 3WAKA 1MNDA 1FMWA 2K5BB 1UX5A 3FXDB 4PK4A 2UXNB 1D1CA 2JPFA 2VKHA 4ZI3D 3TKLB 3WAJA 2VASA 3RC3A 3H3AA 3RRCA 2BDEA 3N9QA 3SOLA 3CX8B 5LNKA 5FXVA 3RPUA 3N9OA 2PJQA 4N78D 3RYFE 1LKXA 5JH7E 3ZJ2A 4YJ3E 4QXHB 4UIGA 4PJJA 2C5JA 2BVLA 3ZPOA 4I55E 4P0BA 2E9XD 2IC6A 2PBIA 2BZBA 4YHJA 4HE8A 3I9YA 2PFVA 4IE5A 3C98B 3MZKB 5LHHB 4XAXB 4O4JE 2X9YA 5FY0A 3UFEA 2GK9A 2NW9A 3FXEB 4UEMA 2X67A 4ZI3C 4AQGA 3J9X1 4TX5A 4TN7B 5JR9B 1U5PA 4CXXA 2WWUA 2VL8A 5HAXA 2LSIA 2V1DB 2MBGA 3CWZB 4GYSA 4GOUA 3AAEB 4YFSA 1D1BA 3L09A 4M1PA 4ZHQE 5LJMA 2D0TA 2LSYA 3RC8A 3L3PA 3C4XA 4QX8B 4IDZA 2CLYB 3FB2A 3CQXC 3SWHA 5JRCA 4PAGA 5J1GA 2YK0A 4P0AA 2XAJB 3MK7C 1KK7A 4CI1B 3KV5A 4DMWA 2ES0A 2L8KA 4ANJA 3UULA 4EB6E 4PFPA 3B13A 3SS1A 3E22E 4UV9B 2YINA 1D1AA 3PUGA 5FNVE 3NRXA 3E08A 5IHYA 3HI2A 1HX8A 4KMCA 5ADXL 4OHFA 2JMHA 1LVFA 5JRCB 2V7JA 5LHIB 1B7TA 1MIYA 2D0UA 2JMKA 3MA9A 4U72A 4B6XA 4E7SA 1X79A 3AVRA 2KLQA 1HTJF 1BR0A 2KNDA 3HKDE 3V5UA 2XAHB 1G8XA 3VU7H 5JDFA 1IJ5A 5LGTB 3LBXA 3K3OA 3S4UA 4BJMA 2H3RA 2CCQA 2QGSA 3Q5WA 5EZYE 2NW8A 5F8PA 3AAIA 4IE4A 1BR2A 2D5UA 1FMVA 3KVBA 5KDMC 4AQFC 3Q2MA 4G63A 5FY7A 5H6RB 5KX5E 3PTRB 5DABA 3UT5E 5CA0E 3N2KE 4QHOA 2W61A 4UF0A 4H9QC 2W63A 2LEHA 3IBPA 3JC6C 4WW0A 2K9AA 1NAFA 4ZS2A 4HFVA 2V7KA 5LGNB 3I9WA 2RP4A 3HL6A 2XQYA 2CEAA 2X9XA 4CQIA 1H7CA 3MJXA 2E9XB 4DMVA 5F3JA 3KBUA 4QKNA 2LJLA 3PU8A 2X51A 3N2GE 1WR6A 4K0UA 5LBMA 4UELA 2X66A 2HPJA 2VB6A 4BJNA 3NZPA 3I0QA 4H9SE 2DHRA 4TZ4C 3ZJ1A 2C5IT 4ZS3A 1QSDA 2CMRA 4ASKA 5J2UE 2KXPB 2KZ7B 4WBNE 4HTEA 4YJ2E 4UVCB 3LJCA 4ZI7E 2XTLA 2LSKA 1ZKEA 1Y64B 2LSJA 2E8IA 2ODUA 2SPCA 3PU3A 3ZN0B 5JDGA 4DNDA 3ZLIA 4EZ4A 5JDNA 4P09A 1MIVA 2EHOB 2CWYA 2KINB 3ANWB 2JJ9A 3HKBE 1HG2A 3GN5B 2V7IA 3FBZA 1MIWA 3KV9A 5L2LA 3CX6B 4PJNA 2QA7A 2X68A 3IEEA 5FYMA 2VKOA 2MTQA 3J7Yq 2K48A 4MHCA 1O3XA 4IGUA 4HN9A 2DLRA 1BR4A 2J1DG 2JQQA 5JR9A 2V26A 4CI3B 3AVSA 3ZEFB 3PUSA 2L9QA 3EVYA 3M65A 4HEAA 1US7B 3BQIA 4H63V 5JDHA 4JLEA 4EYYR 3KDSE 2Q9QB 4KP3C 2ZM2A 4ADZA 3IHRA 2NOXA 3N9PA 1U4QA 5FY1A 4ISSA 3RX6A 3RYIE 3LK2B 2NW7A 3CVRA 3ZMVB 5HWYA 4JEHB 1MNEA 2W00A 4PFOA 2LE8A 3RKOA 2D2SA 2B1EA 2IW5B 4EAHA 1ZV4X 3PUQA 3EUHA 4IE6A 3ZYMA 3RH3A 2G0UA 4QXBB 5EK2A 5FXWA 2HPLA 3K8PC 4ZOLE 2JRKA 3AAAB 3ESLA 4CI2B 5HXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIW A;  2CXF A;  2DWG A;  2CXL A;  2DWK A;  3CWZ B; 
#chains in the Genus database with same CATH topology
 1JNR A;  2ZMA A;  3P4S A;  2CWO A;  1VRB A;  3P7I A;  3SFE A;  4B3M T;  2BS2 A;  3VKG A;  2LHR A;  1FIO A;  2WZI A;  4WNK A;  2CRB A;  3RI5 A;  1KNZ A;  4H63 H;  3F57 A;  3BQK A;  4IRE A;  4EZH A;  3P8C D;  2FJB A;  1Z0P A;  4ZI2 C;  3U3I A;  1SHZ C;  3KVA A;  4X1K E;  3TLU A;  3RF1 A;  5AQH B;  1EZ3 A;  3F31 A;  2EHO A;  4HFI A;  3ANW A;  3RQW A;  5ABE A;  4TWF A;  3QNU A;  3AA1 B;  4HKA A;  3ZCI A;  3FBL A;  4GKJ T;  2CXL A;  2ZM0 A;  3PV0 F;  2NTX A;  2XAG B;  2X9W A;  3R6N A;  4AQY T;  1KNR A;  3ZMT B;  5JR9 C;  3V5S A;  5DQV A;  3ZMZ B;  2XM2 A;  2Q9Q A;  2XJ7 A;  4EYU A;  4QH4 A;  3O1H A;  2VWA A;  4HGA A;  3CML A;  2WCA A;  3A7M A;  4YTN A;  5CJ5 A;  2UXB T;  3EDV A;  4ILB A;  3KV6 A;  4ZEY A;  2CM0 A;  4O4I E;  3HKC E;  3C50 A;  4ILU A;  3ZCJ A;  2XQ4 A;  4LFA T;  1AJ3 A;  2IML A;  4FI5 A;  1W0B A;  4JI2 T;  5FVK A;  3FHN A;  1G73 A;  3X1D A;  4DV5 T;  2IAK A;  2XHE B;  1WR0 A;  2XAQ B;  1BR1 A;  2JQH A;  4EOZ B;  4CXW A;  3CQG B;  4AKL A;  2W62 A;  4EIW A;  2IHR 1;  2V6Y B;  2JIW A;  5CA1 E;  4Q25 A;  3JAF A;  3NZQ A;  1CUN A;  1LVK A;  4U7I A;  2LHN A;  4I43 B;  3T8O A;  2XUE A;  3I0O A;  2LOP A;  2BG9 E;  5FL1 A;  4XBF B;  4AKI A;  4NXM T;  2VUR A;  3ZYK A;  1D0Y A;  2CHN A;  5JVD E;  3RLF F;  2EHO C;  3C4Z A;  3LSV A;  5AQI B;  5HXS A;  2J47 A;  3AE6 A;  4IIJ E;  1LRZ A;  3FZF B;  5HCM A;  4WYV A;  3OPC A;  4JEU B;  1GQE A;  3EI0 A;  5L3G B;  5HEO A;  2AXD S;  5EK4 A;  3TLT A;  2RA1 A;  2MYS A;  2BG9 B;  3PUA A;  4IT4 A;  2CA5 A;  3OKQ A;  4UF0 B;  2Q9Q C;  4L9I A;  3AEF A;  2W2U A;  2NWB A;  4MFR A;  1ZEE A;  3P4R A;  2XQ6 A;  4CN4 A;  1N36 T;  2WY2 A;  2WU2 A;  4JI7 T;  4DR1 T;  5JRE A;  4PW8 A;  1FMW A;  3FXD B;  4PK4 A;  4ZI3 D;  3WAJ A;  3RC3 A;  2BDE A;  2XQ5 A;  3FZL B;  1LKX A;  2V5C A;  3ZJ2 A;  4IDP A;  4P1N A;  2R6G F;  2X0H A;  3ZPO A;  2IC6 A;  3FZK B;  5LG3 A;  1J5E T;  3C98 B;  3MZK B;  4XAX B;  2X9Y A;  5FY0 A;  3UFE A;  2GK9 A;  3J9X 1;  4TX5 A;  2YN6 A;  5BR8 T;  5HAX A;  2LKH A;  3ABV A;  4GYS A;  4GOU A;  1D1B A;  3L3P A;  3C4X A;  2X0Y A;  3FB2 A;  3SWH A;  4PAG A;  2YK0 A;  3G06 A;  4ANJ A;  4YHH T;  4UV9 B;  2J4G A;  4KMC A;  4AIS A;  4YTP A;  1B7T A;  3NKZ A;  1HTJ F;  2XAH B;  1G8X A;  3K3O A;  3S4U A;  2CCQ A;  2QGS A;  3Q5W A;  3RIU A;  2NW8 A;  4ZZB A;  2WB5 A;  5H6R B;  5DAB A;  2W61 A;  2W63 A;  3QB5 A;  4HFV A;  2V7K A;  3I9W A;  2XQY A;  2X9X A;  3JAD A;  4UR9 A;  4CQI A;  4DMV A;  1XDO A;  1IBK T;  3PUX F;  4QKN A;  1WCR A;  3UU5 A;  1WR6 A;  4BJN A;  3RIF A;  3ZJ1 A;  2KXP B;  4WBN E;  4UVC B;  3LJC A;  1ZKE A;  2E8I A;  3PU3 A;  3ZN0 B;  2HN2 A;  5HCJ A;  4P09 A;  2UXD T;  3FZM B;  4Z91 A;  3HKB E;  3GN5 B;  2V7I A;  1HNX T;  2X68 A;  2VKO A;  2MTQ A;  5AQG B;  3P4Q A;  2K48 A;  4MHC A;  5AQU B;  4DV1 T;  1O3X A;  4IGU A;  2DLR A;  2J1D G;  1M62 A;  4HEA A;  4ADZ A;  1U4Q A;  5AQO B;  3ZMV B;  1KNP A;  4JEH B;  2W00 A;  4DR4 T;  2D2S A;  4DV3 T;  4EAH A;  2HPL A;  4ZOL E;  3TLS A;  2JRK A;  4H9N C;  3AE7 A;  4GK5 E;  5HXC A;  2Y6X A;  4IE7 A;  3UU6 A;  3RIU C;  4B3R T;  4ZI2 D;  3EAB A;  3N9N A;  2WBL A;  4L0R A;  1FEW A;  4Z8X A;  3GMI A;  4A56 A;  4LF8 T;  3RYH E;  2WQY A;  2E9X A;  2WAU A;  2OA5 A;  5L3B B;  5FXZ A;  3VHL A;  1IAP A;  3UTK A;  5FXX A;  4ZXL A;  2WMO A;  1HR0 T;  5HEJ A;  3TLW A;  2IIU A;  3K3Q C;  2DWG A;  3VR8 A;  3T1Y T;  1XZY A;  1T72 A;  4EV6 A;  5IYZ E;  3QB5 K;  1OED B;  3RGL A;  2W0G A;  2V6X A;  4AKH A;  2XQ3 A;  4G2A A;  2Y48 B;  5GON E;  4F6R C;  4O8S A;  3RYC E;  5HXE A;  2BVM A;  2VVS A;  1ZOY A;  4C91 A;  2VQF T;  4IST A;  2DL1 A;  4TNV A;  5FVL A;  3AE5 A;  1XWM A;  3AEC A;  4DV0 T;  5ETW A;  4DR7 T;  4ILC A;  2MAW A;  2P9B A;  4GKK T;  4O2B E;  5J0Z A;  3N9M A;  4AKR B;  4DVD A;  4LMJ A;  1ZHC A;  4DBR A;  3PUR A;  4YLH A;  2V6Y A;  4DV4 T;  1I6Z A;  4V1A v;  2WU5 A;  3HA4 A;  4NPP A;  3QC9 A;  2K3W A;  2BKO A;  3DTO A;  3AE9 A;  3IF8 B;  1SUM B;  4TV9 E;  2KWH A;  2I59 A;  2KWI B;  1SA0 E;  1QUU A;  4QX7 B;  3AA0 B;  2EHO D;  2E9X C;  1WYC A;  5ABF B;  5JDM A;  1IZN B;  2BBJ A;  4LF9 T;  1L0V A;  5A1L A;  5M4Y A;  4HFC A;  4DUZ T;  4OK0 A;  2XAS B;  4DR3 T;  2Y8D A;  3GWH A;  5C3J A;  5JTG A;  5LMU T;  2BBH A;  2H7O A;  2Q9Q D;  5LHG B;  4QWN B;  1KFY A;  5F5W A;  4KUM B;  5H6Q B;  3BQL A;  3OBV E;  1T7S A;  4H9R C;  5LMN T;  2A72 A;  2N9D A;  2XAF B;  4A5X A;  4YSX A;  4JUY A;  4AQF A;  2H7V C;  5AQQ B;  4YSY A;  1HNZ T;  3PDY A;  2IUB A;  1WYB A;  3PE0 A;  2FJA A;  3K3N A;  4NUU A;  4X62 T;  4I50 E;  3ZN1 B;  4UV8 B;  1D0Z A;  2OLT A;  5LGU B;  1T98 A;  3ZT5 A;  2M6I A;  2CLY C;  2YU2 A;  2M6B A;  1MND A;  2VKH A;  3TKL B;  3H3A A;  2WZH A;  3N9O A;  4LFB T;  3RYF E;  5JH7 E;  4YJ3 E;  5L4H A;  4PJJ A;  2C5J A;  2BVL A;  4I55 E;  4P0B A;  2PBI A;  5CFB A;  4A97 A;  1HX1 B;  4AQG A;  4TN7 B;  5JR9 B;  1SE7 A;  2VL8 A;  1J1J A;  2V1D B;  1XNQ T;  2CPT A;  4QH1 A;  5LB7 B;  2E5L T;  4IDN A;  4DV2 T;  4IDZ A;  2CLY B;  3EAM A;  4P0A A;  1KK7 A;  4CI1 B;  2ES0 A;  3ZST A;  3SS1 A;  3E22 E;  2YIN A;  1D1A A;  3PUG A;  5FNV E;  5JRC B;  2V7J A;  1MIY A;  4E7S A;  3VU7 H;  3LBX A;  4JI6 T;  1BR2 A;  2D5U A;  5AQP B;  3KVB A;  4AQF C;  4G63 A;  5KX5 E;  3N2K E;  4WW0 A;  3IBP A;  2K9A A;  1NAF A;  4DR5 T;  3CK6 A;  3MJX A;  2XQA A;  1R8I A;  2X51 A;  3LDQ B;  4K0U A;  5LBM A;  1NEK A;  2VB6 A;  3NZP A;  4H9S E;  1M7K A;  2DHR A;  2UUA T;  4ASK A;  4ZS3 A;  4YJ2 E;  1YQ3 A;  1E2A A;  2XTL A;  1QLB A;  1Y64 B;  3SFD A;  3ZLI A;  5JDN A;  2EHO B;  2CWY A;  3ANW B;  1HG2 A;  3FBZ A;  2F4V T;  3FZH B;  3KV9 A;  5L2L A;  2QA7 A;  2XQ8 A;  2XM1 A;  3J7Y q;  3UUB A;  4I0U A;  1W0A A;  1BR4 A;  2LLY A;  4CI3 B;  3AVS A;  3AE1 A;  1US7 B;  3BQI A;  3RHW A;  2W66 A;  2Q9Q B;  3N9P A;  3RX6 A;  2WS3 A;  3EHZ A;  4KI0 F;  2LE8 A;  2B1E A;  2I0M A;  2IW5 B;  3EUH A;  4QXB B;  3ESL A;  4O4L E;  3OYZ A;  4K0K T;  3AEE A;  4YXD A;  2NP9 A;  4OFZ A;  4CN1 A;  4PK6 A;  2VVN A;  2YU1 A;  3UUX B;  3T1H T;  1XNR T;  2CBJ A;  3JC6 D;  3VRA A;  4JV5 T;  3CKD A;  3CQC B;  5JQG E;  3AE3 A;  4DO0 A;  3F2E A;  3CX7 B;  3P4P A;  2CE7 A;  3MAC A;  3Q5D A;  3LK4 2;  2CHO A;  2JQK A;  3ZMS B;  4JI8 T;  5DQW A;  1IBL T;  1Y01 A;  5IWA T;  3RKG A;  1UUR A;  2N2N A;  2ZM8 A;  5FMN A;  5L3E B;  3JAE A;  3P4W A;  2WMN A;  3KIN B;  1D0X A;  2BS3 A;  4JI4 T;  3C4W A;  2LOS A;  3BK9 A;  1WRD A;  5AQJ B;  5EK3 A;  5LOV E;  5KMG P;  4GK0 E;  1OED A;  4TV8 E;  4CZZ B;  1MMN A;  2QVA A;  3AXJ A;  3OTO T;  3O1I A;  2CXD A;  3ONJ A;  1S35 A;  2CBI A;  2XSB A;  3QUJ A;  4IL9 A;  3PUV F;  2LRL A;  2VK9 A;  4TUY E;  2AE9 A;  2N1G A;  4XZC A;  3AA6 B;  5LCY A;  5AQN B;  4AI6 A;  2UUB T;  3NRY A;  4PNI A;  1IJ6 A;  4F8H A;  2YEV C;  4YSZ A;  2WM9 A;  1MMA A;  4U31 A;  5AQM B;  4LML A;  3AA7 B;  1VOM A;  5HWX A;  1XDP A;  3PUW F;  1I94 T;  5C8Y E;  4IDO A;  5LP6 E;  2MOZ A;  3AE4 A;  4B3T T;  4PJL A;  5LJN A;  1UK5 A;  1UUS A;  4HWH A;  2V7L A;  4B3S T;  4U74 A;  5L3D B;  2BKN A;  2VKD A;  5BMV E;  4PK5 A;  1NWM X;  4KBM B;  4BAY B;  4IE0 A;  3TLV A;  2YOE A;  1HF8 A;  5E0O A;  2K24 A;  4OYJ A;  5HEG A;  2ZLY A;  3HR0 A;  2HH7 A;  2V7M A;  1S94 A;  2NTY A;  3VKH A;  5AFU L;  4DV6 T;  3KBT A;  4JI1 T;  2UU9 T;  3GA8 A;  5TAO A;  4NXN T;  4H9O C;  3WI3 A;  4DR6 T;  3K1S A;  3OYX A;  2W67 A;  4KHP T;  3LG7 A;  3HKE E;  1YKE B;  5AQK B;  4DUY T;  3LFM A;  2W4X A;  4FJO A;  1E1H B;  1MMG A;  2XZE A;  3EDU A;  4H9P C;  3SRZ A;  2H89 A;  3ZC0 A;  2LT3 A;  2C0S A;  4C90 A;  5LYJ E;  4EEB A;  1HS7 A;  3JCF A;  5HYA A;  2JQ9 A;  4HFE A;  3AEB A;  5LG4 A;  3ETU A;  1YD8 G;  1HG5 A;  5HXH A;  2X0L B;  4CXY A;  1OXZ A;  4OYK A;  4DBQ A;  3N9L A;  4YT0 A;  2Z6E A;  5HEH A;  3UQ7 A;  4NUV A;  4JYA T;  1UX4 A;  1N32 T;  2DI4 A;  2KMF A;  4PJM A;  1KF6 A;  3WAK A;  3ONL C;  1YXR A;  1D1C A;  4ZZC A;  2VAS A;  3SOL A;  5FXV A;  3RPU A;  4N78 D;  2V5D A;  4UIG A;  4HWF A;  4HFH A;  2BZB A;  1VCT A;  4U7Y A;  5LHH B;  4O4J E;  1WFD A;  2NW9 A;  1CHU A;  3FXE B;  3A8Y C;  1UGO A;  1U5P A;  3CWZ B;  3AAE B;  4YFS A;  4M1P A;  4ZHQ E;  5LJM A;  2LSY A;  4U33 A;  3RC8 A;  3CQX C;  4COF A;  5JRC A;  5J1G A;  3MK7 C;  4DMW A;  4HWI B;  2YDS A;  1YQ4 A;  1N33 T;  3HI2 A;  5ADX L;  4OHF A;  1LVF A;  5LHI B;  2D0U A;  4U72 A;  4B6X A;  1X79 A;  2D9D A;  3UFG A;  2KND A;  3HKD E;  5JDF A;  1IJ5 A;  1E7P A;  4DR2 T;  5LGT B;  1W9R A;  5C2T A;  2H3R A;  5EZY E;  5F8P A;  3AAI A;  1FMV A;  2BG9 A;  5KDM C;  3Q2M A;  3PTR B;  4DV7 T;  3UT5 E;  4QHO A;  4UF0 A;  4ZS2 A;  2WWV A;  2BKP A;  3Q5E A;  2E9X B;  3OVU A;  5F3J A;  3KBU A;  4QH5 A;  2WDQ A;  4HWD A;  1Z8U A;  3PU8 A;  3N2G E;  4UEL A;  2VQE T;  3RQU A;  2C5I T;  1QSD A;  3UU4 A;  4IDQ A;  4HTE A;  2IDO B;  2PTF A;  4ZI7 E;  2LSK A;  5JDG A;  1W09 A;  4DND A;  4TWD A;  1MIV A;  2JJ9 A;  2E2A A;  3AED A;  2NR4 A;  2FJE A;  1XMO T;  3PJA J;  3M65 A;  5JDH A;  4EYY R;  4LFC T;  4KP3 C;  2ZM2 A;  2NOX A;  3ZKR A;  3NWI A;  3RYI E;  3LK2 B;  3CVR A;  3AE8 A;  1MNE A;  4PFO A;  5FKY A;  3RKO A;  1ZV4 X;  2HHH T;  2OV9 A;  2A9U A;  3K8P C;  3AAA B;  4CI2 B;  4MAL A;  3LK3 B;  3ZSS A;  4IL4 A;  4L5G A;  4HFB A;  3O4X E;  5LA6 E;  2WP9 A;  4TWH A;  3H37 A;  4AKG A;  2V8S V;  2BG9 C;  4TNW A;  2BS4 A;  2VKJ A;  2ZM6 T;  3CPZ A;  2DCF A;  3D0T A;  2LKG A;  2IC9 A;  4X5T A;  4AXP A;  5CB4 E;  3ONX A;  4U2Z A;  5AQR B;  1OWA A;  2CXF A;  3ZYL A;  3MXZ A;  3UU8 A;  2J62 A;  3KFW X;  2KT9 A;  2KSR A;  4GYR A;  5JDL A;  1HNW T;  4EGW A;  2HN1 A;  1HFA A;  4J2C A;  1XMQ T;  4BA9 A;  3GN5 A;  4EXT A;  3N5L A;  3MKD A;  4GIW A;  4X20 E;  5L4E A;  4X1Y E;  2XSA A;  1VCS A;  2LM2 A;  5J2T E;  4LF6 T;  4NIQ A;  1UCU A;  3ZT6 A;  3QOF A;  5AQL B;  2ODV A;  4O4H E;  4U3C A;  2PG8 A;  2C5K T;  4WZX A;  3UUN A;  4UVB B;  3O9X A;  4JI3 T;  1NEN A;  2E5V A;  4X65 T;  4KHZ F;  2X9H A;  3N2O A;  4I4T E;  4Z90 A;  4EED A;  3DP7 A;  3M3Z B;  4MLK A;  5IUX A;  4IHJ E;  3C64 A;  2A3D A;  3A5X A;  3R84 B;  3E0Z A;  2LRK A;  3KV4 A;  1V9D A;  2L3L A;  1YW0 A;  3PUY F;  4HFD A;  4UVA B;  1N34 T;  2MPK A;  5L47 A;  3NBX X;  2DWK A;  2LSG A;  4JI0 T;  3QK6 A;  2DNX A;  3IA3 A;  1ZP0 A;  4X1I E;  5JDQ A;  4MBQ A;  4O2A E;  2FJD A;  2WSS V;  3B5M A;  4ERR A;  3AB3 B;  2XQ9 A;  3ZC1 A;  4WBO A;  3U78 A;  4AIU A;  1WLX A;  2UXX B;  1FJG T;  5DJQ C;  5LXT E;  3L8R A;  5LBQ B;  3O1J A;  2QYW A;  4QXC B;  3UUM A;  4LMK A;  3UQ4 A;  1YKH B;  2LM9 A;  3RRW A;  3ZMU B;  5L3F B;  1HCI A;  2ACX A;  3ETV A;  3I1A A;  3LBX B;  2M67 A;  2H88 A;  5AQV B;  3PUZ F;  1MMD A;  4HWC A;  4E7Z A;  3OJA A;  4KX6 A;  3Q5X A;  3B57 A;  2A2F X;  5HEU A;  3L39 A;  5FP3 A;  5L3C B;  1IBM T;  3C51 A;  2XPK A;  2UXC T;  4UXN B;  2B76 A;  3DJB A;  4DID B;  5KXJ A;  3Q9D A;  3W15 B;  4LF5 T;  2K5B B;  1UX5 A;  3PJA A;  2FBW A;  2UXN B;  2JPF A;  4X66 T;  2I6H A;  3UU3 A;  3RRC A;  3N9Q A;  3CX8 B;  5LNK A;  1DU2 A;  2XY8 B;  2YKS A;  2PJQ A;  2ACZ A;  4QXH B;  2WDV A;  2E9X D;  2UUC T;  2XQ7 A;  4YHJ A;  4HE8 A;  3I9Y A;  2PFV A;  4IE5 A;  5CGM A;  3VRB A;  4ZI3 C;  4UEM A;  2X67 A;  4A98 A;  4YTM A;  1KEY A;  3H3M A;  4CXX A;  5ABF A;  2WWU A;  2MBG A;  2LSI A;  3L09 A;  2D0T A;  4QX8 B;  5FL0 A;  4LF7 T;  3RIA A;  2XAJ B;  5ABH A;  3KV5 A;  3AEG A;  2L8K A;  3UUL A;  4EB6 E;  4PFP A;  3B13 A;  4U2Y A;  3NRX A;  3E08 A;  5IHY A;  1HX8 A;  2JMH A;  2JMK A;  1OED C;  3MA9 A;  3AVR A;  2KLQ A;  3AE2 A;  1BR0 A;  3V5U A;  1OED E;  2WDR A;  4BJM A;  2YDR A;  3P50 A;  4CN6 A;  3ZT7 A;  4OX9 T;  3VR9 A;  4IE4 A;  5AQT B;  5FY7 A;  5CA0 E;  4H9Q C;  2LEH A;  3JC6 C;  4X64 T;  5LGN B;  2RP4 A;  3HL6 A;  2CEA A;  2VL0 A;  4JI5 T;  1H7C A;  5ABG A;  2LJL A;  3CIR A;  4JBW F;  2X66 A;  2YDQ A;  2HPJ A;  3I0Q A;  4TZ4 C;  2CMR A;  5J2U E;  2KZ7 B;  4LF4 T;  1T8B A;  2LSJ A;  2ODU A;  2QRX A;  2SPC A;  3AXJ B;  4EZ4 A;  2KIN B;  2FUP A;  1MIW A;  3CX6 B;  4PJN A;  1X9B A;  3IEE A;  5FYM A;  3AEA A;  5AQF B;  4ILA A;  4HN9 A;  2JQQ A;  5JR9 A;  2V26 A;  3ZEF B;  3PUS A;  2L9Q A;  3EVY A;  4H63 V;  4JLE A;  3KDS E;  3IHR A;  5FY1 A;  3NVO A;  5AQS B;  4ISS A;  2NW7 A;  5HWY A;  1J5W A;  1JNZ A;  3PUQ A;  4IE6 A;  3ZYM A;  3RH3 A;  2G0U A;  5EK2 A;  5FXW A;  2RPA A;  4YY3 T;  5HXR A; 
#chains in the Genus database with same CATH homology
 4O4L E;  4MAL A;  4H9N C;  3LK3 B;  3OYZ A;  2NP9 A;  4OFZ A;  4L5G A;  3O4X E;  4PK6 A;  2ZMA A;  4GK5 E;  2YU1 A;  5LA6 E;  2CWO A;  3UUX B;  1VRB A;  5HXC A;  3JC6 D;  3P7I A;  3CKD A;  3CQC B;  5JQG E;  3H37 A;  4DO0 A;  2Y6X A;  4IE7 A;  3F2E A;  4AKG A;  3CX7 B;  4ZI2 D;  2CE7 A;  3MAC A;  3VKG A;  2LHR A;  1FIO A;  3N9N A;  3LK4 2;  2WBL A;  4L0R A;  1FEW A;  2VKJ A;  4WNK A;  3CPZ A;  4Z8X A;  2DCF A;  3D0T A;  3GMI A;  3ZMS B;  4A56 A;  1KNZ A;  4H63 H;  2IC9 A;  3F57 A;  3RYH E;  5DQW A;  3BQK A;  2E9X A;  2WAU A;  2OA5 A;  4AXP A;  5L3B B;  2N2N A;  2ZM8 A;  5FMN A;  5FXZ A;  5CB4 E;  3ONX A;  3VHL A;  4EZH A;  5L3E B;  1IAP A;  3UTK A;  5FXX A;  3P8C D;  2WMN A;  3KIN B;  1D0X A;  1OWA A;  2CXF A;  2WMO A;  3ZYL A;  3C4W A;  2LOS A;  3BK9 A;  3MXZ A;  1WRD A;  5EK3 A;  5LOV E;  1Z0P A;  3KFW X;  3U3I A;  1SHZ C;  4ZI2 C;  2KT9 A;  3KVA A;  4X1K E;  4GK0 E;  4TV8 E;  5KMG P;  4CZZ B;  1MMN A;  4GYR A;  5JDL A;  3K3Q C;  1EZ3 A;  2DWG A;  3F31 A;  3O1I A;  1HFA A;  4J2C A;  2EHO A;  2CXD A;  3ANW A;  4BA9 A;  3GN5 A;  1S35 A;  4EXT A;  3QUJ A;  3AA1 B;  3N5L A;  4HKA A;  5IYZ E;  3MKD A;  4GIW A;  3ZCI A;  4X20 E;  3FBL A;  2VK9 A;  2CXL A;  2N1G A;  4TUY E;  4X1Y E;  4XZC A;  2ZM0 A;  3AA6 B;  2W0G A;  2NTX A;  2XAG B;  5LCY A;  5J2T E;  4AKH A;  4G2A A;  2Y48 B;  5GON E;  1UCU A;  4AI6 A;  4F6R C;  4O8S A;  2X9W A;  3R6N A;  3NRY A;  2ODV A;  4O4H E;  3RYC E;  3ZMT B;  5HXE A;  2BVM A;  2PG8 A;  1IJ6 A;  4PNI A;  5JR9 C;  2YEV C;  3V5S A;  4C91 A;  5DQV A;  2C5K T;  3ZMZ B;  2Q9Q A;  2WM9 A;  3UUN A;  1MMA A;  4IST A;  4UVB B;  4EYU A;  3AA7 B;  1VOM A;  5HWX A;  3O9X A;  5C8Y E;  3O1H A;  2VWA A;  4HGA A;  5ETW A;  5LP6 E;  2MOZ A;  2X9H A;  3CML A;  2P9B A;  4O2B E;  4PJL A;  3N2O A;  5LJN A;  4I4T E;  3N9M A;  3EDV A;  3DP7 A;  3KV6 A;  2CM0 A;  4O4I E;  4AKR B;  4DVD A;  4MLK A;  2V7L A;  3HKC E;  3C50 A;  4ILU A;  3ZCJ A;  4IHJ E;  1ZHC A;  1AJ3 A;  4U74 A;  5L3D B;  3C64 A;  4FI5 A;  4DBR A;  2VKD A;  2A3D A;  3A5X A;  3FHN A;  3R84 B;  5BMV E;  1G73 A;  3E0Z A;  3PUR A;  4YLH A;  4PK5 A;  1NWM X;  3KV4 A;  1V9D A;  2IAK A;  4KBM B;  2L3L A;  4BAY B;  1YW0 A;  2XHE B;  4IE0 A;  4V1A v;  3HA4 A;  2XAQ B;  1BR1 A;  1HF8 A;  3QC9 A;  4UVA B;  5E0O A;  4EOZ B;  4CXW A;  2K24 A;  3DTO A;  3IF8 B;  4OYJ A;  3CQG B;  4TV9 E;  3NBX X;  2DWK A;  4AKL A;  2W62 A;  4EIW A;  2KWH A;  2I59 A;  2LSG A;  2ZLY A;  2KWI B;  3HR0 A;  2HH7 A;  3QK6 A;  1SA0 E;  2DNX A;  1QUU A;  4QX7 B;  5CA1 E;  2V7M A;  4X1I E;  3NZQ A;  1CUN A;  1LVK A;  3AA0 B;  5JDQ A;  4MBQ A;  1S94 A;  2NTY A;  3VKH A;  5AFU L;  2LHN A;  4O2A E;  4I43 B;  2EHO D;  3KBT A;  3T8O A;  2WSS V;  2XUE A;  4ERR A;  2E9X C;  3GA8 A;  5TAO A;  1WYC A;  3AB3 B;  3I0O A;  5JDM A;  1IZN B;  2LOP A;  3ZC1 A;  4WBO A;  3U78 A;  4H9O C;  3WI3 A;  4XBF B;  5A1L A;  5M4Y A;  4OK0 A;  2XAS B;  1WLX A;  4AKI A;  2UXX B;  2Y8D A;  3OYX A;  3GWH A;  5DJQ C;  3LG7 A;  3HKE E;  1YKE B;  5LXT E;  5LBQ B;  3O1J A;  3ZYK A;  1D0Y A;  5JVD E;  3LFM A;  4QXC B;  2EHO C;  2H7O A;  3C4Z A;  4FJO A;  3UUM A;  1E1H B;  1MMG A;  2Q9Q D;  3EDU A;  4H9P C;  3SRZ A;  5LHG B;  5HXS A;  4IIJ E;  3ZC0 A;  1LRZ A;  2C0S A;  2LT3 A;  4QWN B;  4C90 A;  1YKH B;  2LM9 A;  3RRW A;  5LYJ E;  4JEU B;  3ZMU B;  5L3F B;  1HCI A;  2ACX A;  3ETV A;  3I1A A;  4KUM B;  5H6Q B;  3BQL A;  5L3G B;  3OBV E;  3LBX B;  2M67 A;  4H9R C;  2A72 A;  2N9D A;  2XAF B;  5EK4 A;  1HS7 A;  1MMD A;  5HYA A;  2RA1 A;  4JUY A;  4AQF A;  2H7V C;  4E7Z A;  3OJA A;  2MYS A;  3PUA A;  5LG4 A;  3ETU A;  1YD8 G;  2CA5 A;  3PDY A;  1HG5 A;  3OKQ A;  3Q5X A;  4UF0 B;  2Q9Q C;  3B57 A;  2A2F X;  4L9I A;  1WYB A;  2X0L B;  3PE0 A;  1OXZ A;  5HXH A;  4CXY A;  5FP3 A;  5L3C B;  4OYK A;  2NWB A;  3C51 A;  4MFR A;  4DBQ A;  3K3N A;  4NUU A;  3N9L A;  4I50 E;  3ZN1 B;  1ZEE A;  2Z6E A;  4UV8 B;  1D0Z A;  4UXN B;  3DJB A;  4NUV A;  1UX4 A;  5LGU B;  1T98 A;  5JRE A;  4PW8 A;  2DI4 A;  2KMF A;  4PJM A;  3Q9D A;  2CLY C;  3W15 B;  2YU2 A;  3WAK A;  1MND A;  1FMW A;  2K5B B;  1UX5 A;  3FXD B;  4PK4 A;  2UXN B;  1D1C A;  2JPF A;  2VKH A;  4ZI3 D;  3TKL B;  3WAJ A;  2VAS A;  3RC3 A;  3H3A A;  3RRC A;  2BDE A;  3N9Q A;  3SOL A;  3CX8 B;  5LNK A;  5FXV A;  3RPU A;  3N9O A;  2PJQ A;  4N78 D;  3RYF E;  1LKX A;  5JH7 E;  3ZJ2 A;  4YJ3 E;  4QXH B;  4UIG A;  4PJJ A;  2C5J A;  2BVL A;  3ZPO A;  4I55 E;  4P0B A;  2E9X D;  2IC6 A;  2PBI A;  2BZB A;  4YHJ A;  4HE8 A;  3I9Y A;  2PFV A;  4IE5 A;  3C98 B;  3MZK B;  5LHH B;  4XAX B;  4O4J E;  2X9Y A;  5FY0 A;  3UFE A;  2GK9 A;  2NW9 A;  3FXE B;  4UEM A;  2X67 A;  4ZI3 C;  4AQG A;  3J9X 1;  4TX5 A;  4TN7 B;  5JR9 B;  1U5P A;  4CXX A;  2WWU A;  2VL8 A;  5HAX A;  2LSI A;  2V1D B;  2MBG A;  3CWZ B;  4GYS A;  4GOU A;  3AAE B;  4YFS A;  1D1B A;  3L09 A;  4M1P A;  4ZHQ E;  5LJM A;  2D0T A;  2LSY A;  3RC8 A;  3L3P A;  3C4X A;  4QX8 B;  4IDZ A;  2CLY B;  3FB2 A;  3CQX C;  3SWH A;  5JRC A;  4PAG A;  5J1G A;  2YK0 A;  4P0A A;  2XAJ B;  3MK7 C;  1KK7 A;  4CI1 B;  3KV5 A;  4DMW A;  2ES0 A;  2L8K A;  4ANJ A;  3UUL A;  4EB6 E;  4PFP A;  3B13 A;  3SS1 A;  3E22 E;  4UV9 B;  2YIN A;  1D1A A;  3PUG A;  5FNV E;  3NRX A;  3E08 A;  5IHY A;  3HI2 A;  1HX8 A;  4KMC A;  5ADX L;  4OHF A;  2JMH A;  1LVF A;  5JRC B;  2V7J A;  5LHI B;  1B7T A;  1MIY A;  2D0U A;  2JMK A;  3MA9 A;  4U72 A;  4B6X A;  4E7S A;  1X79 A;  3AVR A;  2KLQ A;  1HTJ F;  1BR0 A;  2KND A;  3HKD E;  3V5U A;  2XAH B;  1G8X A;  3VU7 H;  5JDF A;  1IJ5 A;  5LGT B;  3LBX A;  3K3O A;  3S4U A;  4BJM A;  2H3R A;  2CCQ A;  2QGS A;  3Q5W A;  5EZY E;  2NW8 A;  5F8P A;  3AAI A;  4IE4 A;  1BR2 A;  2D5U A;  1FMV A;  3KVB A;  5KDM C;  4AQF C;  3Q2M A;  4G63 A;  5FY7 A;  5H6R B;  5KX5 E;  3PTR B;  5DAB A;  3UT5 E;  5CA0 E;  3N2K E;  4QHO A;  2W61 A;  4UF0 A;  4H9Q C;  2W63 A;  2LEH A;  3IBP A;  3JC6 C;  4WW0 A;  2K9A A;  1NAF A;  4ZS2 A;  4HFV A;  2V7K A;  5LGN B;  3I9W A;  2RP4 A;  3HL6 A;  2XQY A;  2CEA A;  2X9X A;  4CQI A;  1H7C A;  3MJX A;  2E9X B;  4DMV A;  5F3J A;  3KBU A;  4QKN A;  2LJL A;  3PU8 A;  2X51 A;  3N2G E;  1WR6 A;  4K0U A;  5LBM A;  4UEL A;  2X66 A;  2HPJ A;  2VB6 A;  4BJN A;  3NZP A;  3I0Q A;  4H9S E;  2DHR A;  4TZ4 C;  3ZJ1 A;  2C5I T;  4ZS3 A;  1QSD A;  2CMR A;  4ASK A;  5J2U E;  2KXP B;  2KZ7 B;  4WBN E;  4HTE A;  4YJ2 E;  4UVC B;  3LJC A;  4ZI7 E;  2XTL A;  2LSK A;  1ZKE A;  1Y64 B;  2LSJ A;  2E8I A;  2ODU A;  2SPC A;  3PU3 A;  3ZN0 B;  5JDG A;  4DND A;  3ZLI A;  4EZ4 A;  5JDN A;  4P09 A;  1MIV A;  2EHO B;  2CWY A;  2KIN B;  3ANW B;  2JJ9 A;  3HKB E;  1HG2 A;  3GN5 B;  2V7I A;  3FBZ A;  1MIW A;  3KV9 A;  5L2L A;  3CX6 B;  4PJN A;  2QA7 A;  2X68 A;  3IEE A;  5FYM A;  2VKO A;  2MTQ A;  3J7Y q;  2K48 A;  4MHC A;  1O3X A;  4IGU A;  4HN9 A;  2DLR A;  1BR4 A;  2J1D G;  2JQQ A;  5JR9 A;  2V26 A;  4CI3 B;  3AVS A;  3ZEF B;  3PUS A;  2L9Q A;  3EVY A;  3M65 A;  4HEA A;  1US7 B;  3BQI A;  4H63 V;  5JDH A;  4JLE A;  4EYY R;  3KDS E;  2Q9Q B;  4KP3 C;  2ZM2 A;  4ADZ A;  3IHR A;  2NOX A;  3N9P A;  1U4Q A;  5FY1 A;  4ISS A;  3RX6 A;  3RYI E;  3LK2 B;  2NW7 A;  3CVR A;  3ZMV B;  5HWY A;  4JEH B;  1MNE A;  2W00 A;  4PFO A;  2LE8 A;  3RKO A;  2D2S A;  2B1E A;  2IW5 B;  4EAH A;  1ZV4 X;  3PUQ A;  3EUH A;  4IE6 A;  3ZYM A;  3RH3 A;  2G0U A;  4QXB B;  5EK2 A;  5FXW A;  2HPL A;  3K8P C;  4ZOL E;  2JRK A;  3AAA B;  3ESL A;  4CI2 B;  5HXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...