2CXLA

Run domain of rap2 interacting protein x, crystallized in i422 space group
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
165
structure length
158
Chain Sequence
b'MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rap2 interacting protein x
molecule tags Protein binding
source organism Mus musculus
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
total genus 39
structure length 158
sequence length 165
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxlA00
3CWZB 2DWKA 2CXLA 2CXFA 2DWGA 4GIWA
chains in the Genus database with same CATH superfamily
4HTEA 4YHJA 3RF1A 5JREA 2I0MA 1W0AA 4PNIA 4DV4T 5LBQB 1HG5A 4K0UA 2JMKA 3KVAA 4JI8T 1XNQT 4U31A 3M65A 3PDYA 5H6QB 2NR4A 3AECA 3LK42 1MIWA 5BMVE 2MOZA 4PK6A 4JI0T 3UUMA 4FJOA 4DMWA 5AQGB 2JQQA 1D0XA 2D5UA 2WSSV 3DTOA 3RC8A 4BJMA 2WY2A 1QLBA 4H63H 2JQ9A 2PTFA 2CE7A 3K3OA 3SWHA 3UUXB 3ZN1B 4JI7T 2IDOB 1ZEEA 2E5LT 5BR8T 3TLSA 3LDQB 4LMLA 1MNDA 2IW5B 3FZKB 5L4EA 4QWNB 2HH7A 1M62A 1D1BA 2QVAA 5L3DB 4QKNA 4KX6A 2VQET 1EZ3A 3WAJA 2LHNA 4WW0A 3ZCJA 5ABHA 1IBMT 3EDUA 2CEAA 4HFBA 3LJCA 4UF0B 2FUPA 3K1SA 3ANWB 2OA5A 4OFZA 4JEUB 3T8OA 4CI2B 4LF7T 3I9YA 4YTMA 4BA9A 4JI5T 3ZPOA 2H7VC 2WMNA 3ONXA 5JTGA 2BS2A 3A7MA 5L3CB 2NP9A 4G63A 4GYRA 3OKQA 2CBIA 2E9XB 3CPZA 2LOPA 3OYZA 1ZKEA 2CXDA 2LRKA 3PJAJ 3PV0F 3FZMB 2E9XA 3RYFE 4AKGA 1XMOT 1BR4A 1KNZA 2UXCT 1UUSA 4I43B 5AQFB 2AXDS 3H37A 3OVUA 4CN6A 5HXSA 2C5JA 1CUNA 1HCIA 2XJ7A 3Q9DA 2WDQA 4NIQA 4WBOA 4AKIA 3J9X1 3C4XA 2ODUA 2LM9A 2LT3A 1W9RA 2NTYA 4XAXB 3S4UA 3UTKA 3ZMVB 5J2UE 4ZS2A 2VKDA 4DR5T 1BR0A 2WDRA 4IT4A 4M1PA 3AA1B 4YJ2E 4OHFA 4ZI3D 2DWGA 2VVSA 5EK4A 2L3LA 1HX1B 2WMOA 5AQRB 4AIUA 5DQWA 4UEMA 1D1CA 2LKGA 2XQ5A 2X9YA 3LBXB 5FVLA 3C4ZA 5AQVB 4P0AA 2CXLA 3QNUA 2CWOA 3ANWA 1NEKA 2DCFA 4AQFC 2QA7A 1BR2A 4I4TE 4PAGA 4IDQA 3AEEA 3ZCIA 2H3RA 3Q5WA 4UVAB 4O4IE 3ZMTB 5AQSB 4AKRB 1FJGT 2L8KA 2R6GF 3MJXA 3RPUA 5FL1A 1WYBA 3GA8A 1ZP0A 2FJAA 4TNVA 5FNVE 4DR1T 2NTXA 3HKDE 4IDNA 1M7KA 2Q9QB 4CXYA 3GN5A 3CQCB 3RLFF 1CHUA 5JDHA 2E2AA 3KFWX 1I6ZA 1WR0A 4YY3T 4U74A 5ABEA 3CMLA 2LSIA 2X9WA 3ETVA 4PJJA 5LNKA 2XASB 1XNRT 2XQ7A 5IYZE 5ABFA 1N34T 2DHRA 3PUQA 3N2GE 4L0RA 3KINB 4LF4T 2LSKA 2JIWA 4IDZA 2QRXA 4H9SE 5AQTB 3ZMSB 3CVRA 4AQGA 4DR6T 4JLEA 1W0BA 4N78D 2Q9QC 5AQOB 5L3FB 3TLUA 3N9PA 2VL0A 3PU8A 1MMGA 3R6NA 3LSVA 1MMDA 4FI5A 1XZYA 3EAMA 3KBUA 3KV4A 4A56A 2V5DA 4IE0A 4H63V 2BS3A 5LMUT 2ZMAA 5CJ5A 3AXJB 5FYMA 2D0UA 5HEUA 3NWIA 2DLRA 4A97A 4TUYE 1ZHCA 1JNZA 2KWIB 4COFA 3GN5B 3ZJ2A 2KXPB 2DWKA 2ZM2A 4JI3T 2XTLA 3B5MA 3R84B 3RIUA 3OPCA 4DUYT 5L4HA 4YTNA 4OK0A 1T72A 3RGLA 2IC9A 3E0ZA 2W4XA 3EVYA 3RIUC 3RQUA 3VR8A 3AAAB 1DU2A 3TLWA 4UELA 3MK7C 4H9RC 4Z90A 4O4JE 3P50A 2XAQB 3F57A 1J1JA 3N9QA 4LMKA 3MKDA 3HKBE 4TV9E 2X9XA 3N9LA 4JEHB 3SOLA 2J62A 4GKJT 4DUZT 4TWFA 5GONE 4EB6E 4TNWA 2M6BA 3AE3A 1SUMB 2UUAT 4B3MT 2YINA 5JR9B 3F2EA 4X20E 2W2UA 1LVFA 5KMGP 3L39A 3FBLA 1HR0T 3AA0B 4I0UA 1US7B 2J4GA 3C50A 3LFMA 4HE8A 4J2CA 4YSXA 4LF6T 5LGUB 3VKGA 2WWUA 4WYVA 5LHHB 3H3MA 4YT0A 5TAOA 5IUXA 3KV9A 4UIGA 1T98A 1IJ5A 2I6HA 2E9XD 3L09A 3QB5A 4X62T 1IBLT 2M67A 4WZXA 4X1YE 2HHHT 3H3AA 1Y01A 5FY1A 3VU7H 2C5IT 2J1DG 3C64A 4V1Av 3JAFA 3P7IA 4CXXA 4LFCT 3J7Yq 1XMQT 2WU2A 4HFDA 4ZEYA 3RH3A 3FZLB 2W63A 5LCYA 3X1DA 2RPAA 4ASKA 4DR4T 4KHZF 4U7YA 3AVSA 3I0OA 4TZ4C 3RKGA 3EDVA 3A8YC 3HI2A 5FKYA 3JADA 3RKOA 3ZSTA 3JAEA 4CXWA 5LMNT 2XQ6A 5AQIB 3ZT6A 1J5WA 2ZM6T 4GOUA 1OEDC 3N2KE 2VURA 3ZSSA 3HA4A 4XZCA 1UK5A 2BG9B 3EHZA 4P09A 5HWYA 3SFEA 2LOSA 4NPPA 5JRCA 4DV7T 1NAFA 1WYCA 4U2YA 5FXZA 1KF6A 2UXBT 4I55E 3ZLIA 2KNDA 2HPLA 4LMJA 5AQHB 1HF8A 5FP3A 2BBJA 3ZEFB 2X68A 3DP7A 2IMLA 2NOXA 3SS1A 3ZMUB 2YKSA 2EHOD 3FXEB 1QSDA 4G2AA 5HXRA 3ZYMA 5HEGA 2YU1A 2CPTA 2KT9A 3AEBA 3IHRA 3IBPA 4YJ3E 3ZYLA 4UVCB 3C98B 5HEJA 1U4QA 3LK3B 3W15B 3AE7A 1YKEB 4UV8B 3ZC0A 4UF0A 2XSAA 4MFRA 1S35A 2V6XA 5CFBA 3I0QA 4MLKA 5AQLB 2BKNA 1IJ6A 5JQGE 2BKOA 2OV9A 3CKDA 4E7ZA 2MBGA 2BBHA 3RQWA 4IHJE 4DBRA 2VASA 2WZHA 4CN1A 2XUEA 3FHNA 2L9QA 3OYXA 3UUNA 4UR9A 4KI0F 2W67A 3K3QC 3BQLA 5DQVA 2OLTA 4Q25A 4AISA 4AQFA 3DJBA 4JBWF 4EYUA 2K3WA 2MPKA 4PJNA 3AE5A 3ESLA 1OEDA 4ZI7E 4JI2T 2NW7A 2QYWA 1UURA 3FZFB 3N9OA 4DV2T 5AQKB 3HL6A 1N36T 3KBTA 5LBMA 2UUCT 3VRBA 5HCJA 2ES0A 4O4LE 1BR1A 3PUYF 4E7SA 2W61A 5JDLA 5JDQA 4DR2T 1MIVA 4O2BE 5C8YE 4IE6A 1N33T 4LF8T 2D2SA 4P0BA 3KDSE 3P4QA 4ZZBA 2YEVC 3FB2A 3FXDB 3GMIA 3MXZA 4HFCA 4OX9T 2CHOA 2N1GA 4HWHA 4ILCA 3HR0A 2K5BB 3IEEA 3V5SA 2W62A 4WBNE 2LSGA 2CHNA 2VL8A 2WM9A 3PUAA 1Z0PA 4YTPA 3ONLC 2UU9T 4ZI2C 4JV5T 1WLXA 5AQNB 3NKZA 5FL0A 2F4VT 3JC6C 3T1YT 4OYJA 3HKEE 3FBZA 1G8XA 2V7IA 4IDOA 5LB7B 2IC6A 3VKHA 2LE8A 5F3JA 3KVBA 1T7SA 3C51A 1LRZA 2J47A 1W09A 3I1AA 1SHZC 4H9QC 3VHLA 4EZ4A 1HNXT 2ACXA 3NRYA 2XZEA 4HFHA 2E5VA 3IA3A 5LOVE 2WS3A 4HEAA 4DNDA 2V7JA 2CLYC 3M3ZB 4EZHA 2WQYA 2XAJB 3GWHA 3PUZF 4F6RC 3N5LA 4HFIA 5L47A 5HAXA 3UFGA 1MMNA 4NXNT 4EGWA 4X1KE 4MALA 4HWFA 3CX7B 2X0YA 4LFAT 5AQUB 1KK7A 3HKCE 2FBWA 4HWCA 4YHHT 3OTOT 2XSBA 3Q5EA 2XQAA 2DI4A 4QH5A 2XM2A 1V9DA 2VKHA 4PFOA 1WRDA 5DJQC 2WAUA 2QGSA 4AKLA 2JMHA 3MA9A 4QHOA 1H7CA 1OEDE 3O4XE 3P4SA 4DVDA 4DV0T 1I94T 2XHEB 4DR7T 5FVKA 2JQHA 4ILAA 4U7IA 1NENA 3RYHE 4EAHA 2WB5A 1LKXA 2LKHA 3AEAA 3AE4A 3P4WA 4HWDA 4PK5A 3QK6A 2ZM0A 3O1IA 5EK3A 1HS7A 2N9DA 2X66A 3AEDA 4TX5A 3N9NA 5HWXA 4GYSA 3ZN0B 1UX5A 2XAGB 2XAFB 3CWZB 2DNXA 3CX6B 3PUVF 4IL9A 4MBQA 3UU3A 4CN4A 2ODVA 5CGMA 3ZMZB 2H89A 3CQXC 4A98A 2HN1A 5KX5E 3UQ4A 4U3CA 4YXDA 4OYKA 3UT5E 1ZV4X 3JCFA 2ZM8A 4X65T 2LLYA 4AXPA 3I9WA 3K8PC 4H9NC 2H7OA 3TKLB 3AA6B 4EYYR 5F5WA 2VK9A 1E1HB 2VVNA 2XQYA 4IGUA 2IUBA 5LGNB 1G73A 3MZKB 4KUMB 4QX7B 4CI1B 2WBLA 3B13A 2WU5A 3BQKA 2JPFA 4ILBA 4IREA 4QH4A 3EUHA 2W00A 5HXCA 1FMWA 3JC6D 3WI3A 3UU4A 2VWAA 1MMAA 5F8PA 1HTJF 5JR9C 5J2TE 3AXJA 3C4WA 2NW8A 5E0OA 5IWAT 2RA1A 1KFYA 2KLQA 1LVKA 2UXXB 2V6YB 2XQ8A 2Y6XA 4L5GA 4ANJA 5EK2A 1VCTA 3RRWA 4HGAA 4CI3B 3V5UA 1GQEA 2CBJA 2KZ7B 4PK4A 4Z91A 4X1IE 3SFDA 2K9AA 4HWIB 4CQIA 2X0LB 3LK2B 2MYSA 3PJAA 3ZKRA 1IBKT 2BS4A 2DL1A 1L0VA 2CXFA 2YOEA 5LYJE 4ZXLA 1YKHB 4AKHA 5LG3A 2V26A 2CRBA 3PE0A 2B1EA 1D0ZA 4BJNA 4O2AE 3G06A 1HNWT 4QXBB 1FEWA 4KHPT 4NUUA 2VQFT 3KV5A 2Q9QD 4IE7A 4L9IA 5JRCB 2CWYA 4O8SA 5AFUL 3AAIA 3L8RA 2FJEA 4IE5A 5FY0A 2A2FX 4IIJE 2XQ3A 4ISSA 4PJMA 3ZT7A 4ADZA 2AE9A 2EHOA 4A5XA 1OEDB 2B76A 2V6YA 3AE9A 3QOFA 2EHOB 5ABGA 2WDVA 3KV6A 4DBQA 1HG2A 3Q2MA 2FJBA 2X51A 3ZJ1A 1XWMA 2CM0A 5JDFA 3LBXA 4I50E 4TWDA 5KXJA 4EEDA 2UXDT 5CB4E 1XDPA 2XAHB 1YW0A 4C91A 4B3RT 5CA0E 1UX4A 2JJ9A 3N9MA 4Z8XA 5J1GA 2VKOA 5LG4A 4X64T 3RYIE 2E8IA 1XDOA 3O9XA 4LF5T 3AVRA 2X9HA 5AQQB 1YD8G 3AEFA 2YDRA 4YSZA 5HXEA 2LRLA 2FJDA 1E7PA 2C0SA 3NZQA 3AEGA 2Q9QA 3AA7B 2K48A 1MNEA 1WFDA 1Z8UA 2P9BA 2NWBA 1YQ3A 2WCAA 3QB5K 1KNRA 2A9UA 4UVBB 1Y64B 3P8CD 2K24A 5AQPB 4GKKT 3UULA 4X66T 3ZT5A 4QH1A 5CA1E 4EIWA 3BK9A 3EABA 4JYAT 4LF9T 5JR9A 3Q5XA 1D1AA 4DV1T 2W66A 5FXXA 3UU8A 1E2AA 5L3BB 3T1HT 2KWHA 5L3EB 2W0GA 1X9BA 3PUSA 5M4YA 2BG9C 4TN7B 1WR6A 2BKPA 2LSYA 1T8BA 4DIDB 2CA5A 2MAWA 2JRKA 2MTQA 5H6RB 2YN6A 3PTRB 4ZI2D 5LJMA 1FIOA 2XPKA 3PUGA 4CZZB 2YU2A 3ABVA 3UU5A 5A1LA 5JDGA 1B7TA 4YSYA 5C3JA 4HKAA 4LFBT 2VB6A 4HFEA 4JUYA 4KMCA 4O4HE 2X67A 3RI5A 3QUJA 1QUUA 4H9PC 4TV8E 2G0UA 4JI6T 4TWHA 4EV6A 4ZOLE 3RX6A 2BVMA 3E08A 4QX8B 5FMNA 5KDMC 5LP6E 5JVDE 2UUBT 4UXNB 3NBXX 3VRAA 3MACA 5FY7A 3RYCE 5JDMA 1JNRA 2M6IA 1D0YA 3UUBA 1WCRA 2HN2A 4ILUA 2V8SV 3N2OA 1R8IA 3TLTA 4B3TT 2Y48B 3ETUA 2LHRA 2CMRA 2ZLYA 3D0TA 3WAKA 2YK0A 4P1NA 4K0KT 3O1HA 5LXTE 3UU6A 4JI1T 3SRZA 2LJLA 2IAKA 3RC3A 1VRBA 4U72A 1YXRA 2WWVA 3PURA 4IE4A 5LGTB 4HFVA 1VCSA 4HN9A 5AQJB 2KMFA 4IL4A 3ZYKA 2X0HA 3AAEB 5EZYE 4EXTA 4DV3T 1MIYA 1OWAA 1N32T 3CIRA 4U2ZA 1UCUA 2BG9A 2JQKA 3CQGB 4ERRA 3CX8B 3LG7A 2V7LA 1YQ4A 2HPJA 5ETWA 2YDQA 2XQ4A 2CCQA 5HYAA 3FZHB 5C2TA 2BG9E 2E9XC 2IHR1 2NW9A 4B3ST 2RP4A 1NWMX 4XBFB 2UXNB 2D0TA 5HXHA 3UQ7A 1O3XA 3PUXF 4PW8A 2N2NA 1HFAA 2H88A 2XY8B 3AE6A 3RIFA 4EOZB 4PFPA 2BZBA 4ISTA 3CK6A 5LA6E 4C90A 5ABFB 3U3IA 5L2LA 5AQMB 2EHOC 2BDEA 2YDSA 4YFSA 1SA0E 2PFVA 1KNPA 2I59A 2KSRA 2PJQA 4NUVA 4UV9B 5DABA 3TLVA 4DR3T 5IHYA 3ZC1A 3B57A 3UFEA 3AE2A 5JH7E 4PJLA 3NVOA 4KBMB 5FXWA 4MHCA 5FXVA 3QC9A 3ONJA 1VOMA 3PUWF 4ZI3C 3E22E 2PG8A 1HX8A 1KEYA 2LSJA 2XQ9A 3NZPA 3P4PA 4X5TA 3RIAA 3BQIA 1FMVA 2CLYB 5LJNA 1U5PA 2BVLA 4GK0E 3P4RA 4YLHA 3A5XA 4IDPA 4ZZCA 1IZNB 2GK9A 3EI0A 4JI4T 4DV5T 3AE8A 4QXHB 4WNKA 2V7KA 4EEBA 1UGOA 1AJ3A 3U78A 3F31A 3Q5DA 4ZS3A 4B6XA 2C5KT 4U33A 2PBIA 2SPCA 4KP3C 4DV6T 2V5CA 3RRCA 2ACZA 2LEHA 2Y8DA 3O1JA 4GIWA 3VR9A 1IAPA 2A72A 3L3PA 3NRXA 2V7MA 4QXCB 4ZHQE 5J0ZA 2KINB 4DMVA 4AQYT 5HEOA 5L3GB 3RHWA 2Z6EA 5LHGB 2V1DB 5HEHA 2VKJA 1HNZT 1S94A 2A3DA 2D9DA 2LM2A 2XM1A 4H9OC 3K3NA 1SE7A 4GK5E 4BAYB 3IF8B 4DO0A 4F8HA 5ADXL 5LHIB 4AI6A 5JDNA 1OXZA 3AE1A 3AB3B 5HCMA 4NXMT 1J5ET 2WZIA 1X79A 2IIUA 1ZOYA 3PU3A 3OBVE 2WP9A 3OJAA
chains in the Genus database with same CATH topology
4HTEA 4YHJA 5JREA 4PNIA 5LBQB 1HG5A 4K0UA 2JMKA 3KVAA 3M65A 3PDYA 5H6QB 3LK42 1MIWA 5BMVE 2MOZA 4PK6A 3UUMA 4FJOA 4DMWA 2JQQA 1D0XA 2D5UA 2WSSV 3DTOA 3RC8A 4BJMA 4H63H 2CE7A 3K3OA 3SWHA 3UUXB 3ZN1B 1ZEEA 1MNDA 2IW5B 4QWNB 2HH7A 5L3DB 1D1BA 4QKNA 1EZ3A 3WAJA 2LHNA 4WW0A 3ZCJA 3EDUA 2CEAA 3LJCA 4UF0B 4OFZA 3ANWB 2OA5A 4JEUB 3T8OA 4CI2B 3I9YA 4BA9A 3ZPOA 2H7VC 2WMNA 3ONXA 5L3CB 2NP9A 4G63A 4GYRA 3OKQA 2E9XB 3CPZA 2LOPA 3OYZA 1ZKEA 2CXDA 3RYFE 4AKGA 2E9XA 1BR4A 1KNZA 4I43B 3H37A 5HXSA 2C5JA 1CUNA 1HCIA 3Q9DA 4WBOA 4AKIA 3J9X1 3C4XA 2LM9A 2LT3A 2NTYA 2ODUA 4XAXB 3S4UA 3UTKA 3ZMVB 5J2UE 1BR0A 4ZS2A 2VKDA 4M1PA 3AA1B 4YJ2E 4OHFA 4ZI3D 2DWGA 5EK4A 2L3LA 2WMOA 5DQWA 4UEMA 1D1CA 2X9YA 3LBXB 3C4ZA 4P0AA 2CXLA 2CWOA 3ANWA 2DCFA 4AQFC 2QA7A 1BR2A 4I4TE 4PAGA 3ZMTB 3ZCIA 2H3RA 3Q5WA 4UVAB 4O4IE 4AKRB 2L8KA 3MJXA 3RPUA 1WYBA 3GA8A 5FNVE 2NTXA 3HKDE 4CXYA 2Q9QB 3GN5A 3CQCB 5JDHA 3KFWX 4U74A 3CMLA 2LSIA 2X9WA 3ETVA 4PJJA 5LNKA 2XASB 5IYZE 2DHRA 3PUQA 3N2GE 4L0RA 3KINB 2LSKA 4IDZA 4AQGA 3ZMSB 3CVRA 4JLEA 5L3FB 4N78D 2Q9QC 3N9PA 1MMGA 3R6NA 1MMDA 4FI5A 3KBUA 3KV4A 4A56A 4IE0A 4H63V 2ZMAA 5FYMA 2D0UA 2DLRA 4TUYE 1ZHCA 2KWIB 3GN5B 3ZJ2A 2KXPB 2DWKA 2ZM2A 2XTLA 3R84B 4OK0A 2IC9A 3E0ZA 3EVYA 3AAAB 4UELA 3MK7C 4H9RC 4O4JE 2XAQB 3F57A 3N9QA 3MKDA 3HKBE 4TV9E 2X9XA 3N9LA 4JEHB 3SOLA 5GONE 4EB6E 2YINA 5JR9B 3F2EA 4X20E 1LVFA 5KMGP 3FBLA 3AA0B 1US7B 3C50A 4J2CA 3LFMA 4HE8A 3VKGA 5LGUB 2WWUA 5LHHB 5TAOA 3KV9A 4UIGA 1T98A 1IJ5A 2E9XD 3L09A 2M67A 4X1YE 3H3AA 5FY1A 3VU7H 2C5IT 2J1DG 3C64A 4V1Av 3P7IA 4CXXA 3J7Yq 3RH3A 5LCYA 2W63A 4ASKA 3AVSA 3I0OA 4TZ4C 3EDVA 3HI2A 3ZC0A 3RKOA 4CXWA 4GOUA 3N2KE 3HA4A 4XZCA 4P09A 5HWYA 2LOSA 5JRCA 1NAFA 1WYCA 5FXZA 4I55E 3ZLIA 2KNDA 2HPLA 5FP3A 1HF8A 3ZEFB 2X68A 3DP7A 2NOXA 3SS1A 3ZMUB 4G2AA 2EHOD 3FXEB 1QSDA 3ZYMA 5HXRA 2YU1A 2KT9A 3IHRA 3IBPA 4YJ3E 3ZYLA 4UVCB 3C98B 1U4QA 3LK3B 3W15B 1YKEB 4UV8B 4UF0A 4MFRA 1S35A 3I0QA 4MLKA 5JQGE 1IJ6A 3CKDA 4E7ZA 4IHJE 4DBRA 2VASA 2XUEA 3FHNA 2L9QA 3OYXA 3UUNA 3K3QC 3BQLA 5DQVA 4AQFA 4EYUA 3DJBA 4ZI7E 4PJNA 3ESLA 2NW7A 3N9OA 3HL6A 3KBTA 5LBMA 2ES0A 4O4LE 1BR1A 4E7SA 2W61A 5JDLA 5JDQA 1MIVA 4O2BE 5C8YE 4IE6A 2D2SA 4P0BA 3KDSE 2YEVC 3GMIA 3FB2A 3FXDB 3MXZA 2N1GA 3HR0A 2K5BB 3IEEA 3V5SA 2W62A 4WBNE 2LSGA 2VL8A 2WM9A 3PUAA 1Z0PA 4ZI2C 1WLXA 3JC6C 4OYJA 3HKEE 3FBZA 1G8XA 2V7IA 3VKHA 2IC6A 2LE8A 5F3JA 3KVBA 4H9QC 3C51A 1LRZA 3I1AA 3VHLA 4EZ4A 1SHZC 2ACXA 3NRYA 5LOVE 4DNDA 4HEAA 2V7JA 2CLYC 4EZHA 2XAJB 3GWHA 3N5LA 5HAXA 1MMNA 4X1KE 4MALA 3CX7B 1KK7A 3HKCE 4PFOA 2DI4A 5DJQC 1V9DA 2VKHA 1WRDA 2WAUA 2QGSA 4AKLA 2JMHA 3MA9A 4QHOA 1H7CA 3O4XE 2XHEB 3RYHE 4EAHA 1LKXA 3V5UA 4PK5A 1HS7A 3QK6A 2ZM0A 3O1IA 5EK3A 2N9DA 2X66A 4TX5A 3N9NA 5HWXA 4GYSA 3ZN0B 1UX5A 2XAGB 2XAFB 3CWZB 2DNXA 3CX6B 4MBQA 2ODVA 3ZMZB 3CQXC 5KX5E 4OYKA 3UT5E 1ZV4X 2ZM8A 4AXPA 3I9WA 3K8PC 4H9NC 2H7OA 3TKLB 3AA6B 4EYYR 2VK9A 1E1HB 4IGUA 2XQYA 5LGNB 1G73A 3MZKB 4KUMB 4QX7B 4CI1B 2WBLA 3B13A 3BQKA 2JPFA 3EUHA 2W00A 5HXCA 1FMWA 3JC6D 3WI3A 2VWAA 1MMAA 5F8PA 1HTJF 5JR9C 5J2TE 3C4WA 2NW8A 5E0OA 2RA1A 2KLQA 2Y6XA 1LVKA 2UXXB 4L5GA 4ANJA 5EK2A 3RRWA 4HGAA 4CI3B 2KZ7B 4PK4A 4X1IE 2K9AA 4CQIA 2X0LB 3LK2B 2MYSA 4AKHA 2CXFA 5LYJE 1YKHB 2V26A 3PE0A 2B1EA 1D0ZA 4BJNA 4O2AE 4QXBB 1FEWA 4NUUA 3KV5A 2Q9QD 4IE7A 4L9IA 5JRCB 2CWYA 4O8SA 5AFUL 3AAIA 4IE5A 5FY0A 2A2FX 4IIJE 4ISSA 4PJMA 4ADZA 2EHOA 4DBQA 2EHOB 3KV6A 1HG2A 3Q2MA 2X51A 3ZJ1A 2CM0A 5JDFA 3LBXA 4I50E 5CB4E 2XAHB 1YW0A 4C91A 5CA0E 1UX4A 2JJ9A 3N9MA 4Z8XA 5J1GA 2VKOA 5LG4A 3RYIE 2E8IA 3O9XA 3AVRA 2X9HA 1YD8G 5HXEA 4H9SE 2C0SA 3NZQA 4DVDA 2Q9QA 3AA7B 2K48A 1MNEA 3PU8A 2MBGA 2P9BA 2NWBA 4UVBB 5LXTE 1Y64B 3P8CD 2K24A 3UULA 5CA1E 4EIWA 3BK9A 5JR9A 3Q5XA 1D1AA 5FXXA 5L3BB 2KWHA 5L3EB 2W0GA 3PUSA 5M4YA 4TN7B 1WR6A 2LSYA 2CA5A 2JRKA 2MTQA 5H6RB 3PTRB 4ZI2D 5LJMA 1FIOA 3PUGA 4CZZB 2YU2A 5A1LA 5JDGA 1B7TA 4HKAA 2VB6A 4KMCA 4O4HE 2X67A 3QUJA 1QUUA 4H9PC 4TV8E 2G0UA 4ZOLE 3RX6A 2BVMA 3E08A 4QX8B 5FMNA 5KDMC 5LP6E 5JVDE 4UXNB 3NBXX 3MACA 5FY7A 3RYCE 5JDMA 1D0YA 4ILUA 3N2OA 2Y48B 3ETUA 2LHRA 2CMRA 2ZLYA 3D0TA 3WAKA 2YK0A 3O1HA 3SRZA 2LJLA 2IAKA 3RC3A 1VRBA 4U72A 3PURA 4IE4A 5LGTB 4HFVA 4HN9A 2KMFA 3ZYKA 3AAEB 5EZYE 4EXTA 1MIYA 1OWAA 1UCUA 3CQGB 4ERRA 3CX8B 3LG7A 2V7LA 2HPJA 5ETWA 2CCQA 5HYAA 2NW9A 2E9XC 1NWMX 2RP4A 4XBFB 2UXNB 2D0TA 5HXHA 1O3XA 4PW8A 2N2NA 1HFAA 4EOZB 4PFPA 2BZBA 4ISTA 5LA6E 5L2LA 4C90A 3U3IA 2EHOC 2BDEA 4YFSA 1SA0E 2I59A 2PFVA 4NUVA 2PJQA 4UV9B 5DABA 5IHYA 3ZC1A 3B57A 3UFEA 5JH7E 4PJLA 5FXWA 4KBMB 4MHCA 5FXVA 3QC9A 1VOMA 4ZI3C 3E22E 2PG8A 1HX8A 2LSJA 4F6RC 3NZPA 3BQIA 1FMVA 2CLYB 5LJNA 1U5PA 2BVLA 4GK0E 4YLHA 3A5XA 1IZNB 2GK9A 4QXHB 4WNKA 2V7KA 1AJ3A 3U78A 3F31A 4ZS3A 4B6XA 2C5KT 2PBIA 2SPCA 4KP3C 3RRCA 2LEHA 2Y8DA 3O1JA 4GIWA 2A72A 1IAPA 3L3PA 3NRXA 2V7MA 4QXCB 4ZHQE 2KINB 4DMVA 5L3GB 2Z6EA 5LHGB 2V1DB 2VKJA 1S94A 2A3DA 4BAYB 4H9OC 3K3NA 4GK5E 3IF8B 4DO0A 5LHIB 5ADXL 4AI6A 5JDNA 1OXZA 3AB3B 1X79A 3PU3A 3OBVE 4JUYA 3OJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWZ B;  2DWK A;  2CXL A;  2CXF A;  2DWG A;  4GIW A; 
#chains in the Genus database with same CATH topology
 4HTE A;  4YHJ A;  3RF1 A;  5JRE A;  2I0M A;  1W0A A;  4PNI A;  4DV4 T;  5LBQ B;  1HG5 A;  4K0U A;  2JMK A;  3KVA A;  4JI8 T;  1XNQ T;  4U31 A;  3M65 A;  3PDY A;  5H6Q B;  2NR4 A;  3AEC A;  3LK4 2;  1MIW A;  5BMV E;  2MOZ A;  4PK6 A;  4JI0 T;  3UUM A;  4FJO A;  4DMW A;  5AQG B;  2JQQ A;  1D0X A;  2D5U A;  2WSS V;  3DTO A;  3RC8 A;  4BJM A;  2WY2 A;  1QLB A;  4H63 H;  2JQ9 A;  2PTF A;  2CE7 A;  3K3O A;  3SWH A;  3UUX B;  3ZN1 B;  4JI7 T;  2IDO B;  1ZEE A;  2E5L T;  5BR8 T;  3TLS A;  3LDQ B;  4LML A;  1MND A;  2IW5 B;  3FZK B;  5L4E A;  4QWN B;  2HH7 A;  1M62 A;  1D1B A;  2QVA A;  5L3D B;  4QKN A;  4KX6 A;  2VQE T;  1EZ3 A;  3WAJ A;  2LHN A;  4WW0 A;  3ZCJ A;  5ABH A;  1IBM T;  3EDU A;  2CEA A;  4HFB A;  3LJC A;  4UF0 B;  2FUP A;  3K1S A;  3ANW B;  2OA5 A;  4OFZ A;  4JEU B;  3T8O A;  4CI2 B;  4LF7 T;  3I9Y A;  4YTM A;  4BA9 A;  4JI5 T;  3ZPO A;  2H7V C;  2WMN A;  3ONX A;  5JTG A;  2BS2 A;  3A7M A;  5L3C B;  2NP9 A;  4G63 A;  4GYR A;  3OKQ A;  2CBI A;  2E9X B;  3CPZ A;  2LOP A;  3OYZ A;  1ZKE A;  2CXD A;  2LRK A;  3PJA J;  3PV0 F;  3FZM B;  2E9X A;  3RYF E;  4AKG A;  1XMO T;  1BR4 A;  1KNZ A;  2UXC T;  1UUS A;  4I43 B;  5AQF B;  2AXD S;  3H37 A;  3OVU A;  4CN6 A;  5HXS A;  2C5J A;  1CUN A;  1HCI A;  2XJ7 A;  3Q9D A;  2WDQ A;  4NIQ A;  4WBO A;  4AKI A;  3J9X 1;  3C4X A;  2ODU A;  2LM9 A;  2LT3 A;  1W9R A;  2NTY A;  4XAX B;  3S4U A;  3UTK A;  3ZMV B;  5J2U E;  4ZS2 A;  2VKD A;  4DR5 T;  1BR0 A;  2WDR A;  4IT4 A;  4M1P A;  3AA1 B;  4YJ2 E;  4OHF A;  4ZI3 D;  2DWG A;  2VVS A;  5EK4 A;  2L3L A;  1HX1 B;  2WMO A;  5AQR B;  4AIU A;  5DQW A;  4UEM A;  1D1C A;  2LKG A;  2XQ5 A;  2X9Y A;  3LBX B;  5FVL A;  3C4Z A;  5AQV B;  4P0A A;  2CXL A;  3QNU A;  2CWO A;  3ANW A;  1NEK A;  2DCF A;  4AQF C;  2QA7 A;  1BR2 A;  4I4T E;  4PAG A;  4IDQ A;  3AEE A;  3ZCI A;  2H3R A;  3Q5W A;  4UVA B;  4O4I E;  3ZMT B;  5AQS B;  4AKR B;  1FJG T;  2L8K A;  2R6G F;  3MJX A;  3RPU A;  5FL1 A;  1WYB A;  3GA8 A;  1ZP0 A;  2FJA A;  4TNV A;  5FNV E;  4DR1 T;  2NTX A;  3HKD E;  4IDN A;  1M7K A;  2Q9Q B;  4CXY A;  3GN5 A;  3CQC B;  3RLF F;  1CHU A;  5JDH A;  2E2A A;  3KFW X;  1I6Z A;  1WR0 A;  4YY3 T;  4U74 A;  5ABE A;  3CML A;  2LSI A;  2X9W A;  3ETV A;  4PJJ A;  5LNK A;  2XAS B;  1XNR T;  2XQ7 A;  5IYZ E;  5ABF A;  1N34 T;  2DHR A;  3PUQ A;  3N2G E;  4L0R A;  3KIN B;  4LF4 T;  2LSK A;  2JIW A;  4IDZ A;  2QRX A;  4H9S E;  5AQT B;  3ZMS B;  3CVR A;  4AQG A;  4DR6 T;  4JLE A;  1W0B A;  4N78 D;  2Q9Q C;  5AQO B;  5L3F B;  3TLU A;  3N9P A;  2VL0 A;  3PU8 A;  1MMG A;  3R6N A;  3LSV A;  1MMD A;  4FI5 A;  1XZY A;  3EAM A;  3KBU A;  3KV4 A;  4A56 A;  2V5D A;  4IE0 A;  4H63 V;  2BS3 A;  5LMU T;  2ZMA A;  5CJ5 A;  3AXJ B;  5FYM A;  2D0U A;  5HEU A;  3NWI A;  2DLR A;  4A97 A;  4TUY E;  1ZHC A;  1JNZ A;  2KWI B;  4COF A;  3GN5 B;  3ZJ2 A;  2KXP B;  2DWK A;  2ZM2 A;  4JI3 T;  2XTL A;  3B5M A;  3R84 B;  3RIU A;  3OPC A;  4DUY T;  5L4H A;  4YTN A;  4OK0 A;  1T72 A;  3RGL A;  2IC9 A;  3E0Z A;  2W4X A;  3EVY A;  3RIU C;  3RQU A;  3VR8 A;  3AAA B;  1DU2 A;  3TLW A;  4UEL A;  3MK7 C;  4H9R C;  4Z90 A;  4O4J E;  3P50 A;  2XAQ B;  3F57 A;  1J1J A;  3N9Q A;  4LMK A;  3MKD A;  3HKB E;  4TV9 E;  2X9X A;  3N9L A;  4JEH B;  3SOL A;  2J62 A;  4GKJ T;  4DUZ T;  4TWF A;  5GON E;  4EB6 E;  4TNW A;  2M6B A;  3AE3 A;  1SUM B;  2UUA T;  4B3M T;  2YIN A;  5JR9 B;  3F2E A;  4X20 E;  2W2U A;  1LVF A;  5KMG P;  3L39 A;  3FBL A;  1HR0 T;  3AA0 B;  4I0U A;  1US7 B;  2J4G A;  3C50 A;  3LFM A;  4HE8 A;  4J2C A;  4YSX A;  4LF6 T;  5LGU B;  3VKG A;  2WWU A;  4WYV A;  5LHH B;  3H3M A;  4YT0 A;  5TAO A;  5IUX A;  3KV9 A;  4UIG A;  1T98 A;  1IJ5 A;  2I6H A;  2E9X D;  3L09 A;  3QB5 A;  4X62 T;  1IBL T;  2M67 A;  4WZX A;  4X1Y E;  2HHH T;  3H3A A;  1Y01 A;  5FY1 A;  3VU7 H;  2C5I T;  2J1D G;  3C64 A;  4V1A v;  3JAF A;  3P7I A;  4CXX A;  4LFC T;  3J7Y q;  1XMQ T;  2WU2 A;  4HFD A;  4ZEY A;  3RH3 A;  3FZL B;  2W63 A;  5LCY A;  3X1D A;  2RPA A;  4ASK A;  4DR4 T;  4KHZ F;  4U7Y A;  3AVS A;  3I0O A;  4TZ4 C;  3RKG A;  3EDV A;  3A8Y C;  3HI2 A;  5FKY A;  3JAD A;  3RKO A;  3ZST A;  3JAE A;  4CXW A;  5LMN T;  2XQ6 A;  5AQI B;  3ZT6 A;  1J5W A;  2ZM6 T;  4GOU A;  1OED C;  3N2K E;  2VUR A;  3ZSS A;  3HA4 A;  4XZC A;  1UK5 A;  2BG9 B;  3EHZ A;  4P09 A;  5HWY A;  3SFE A;  2LOS A;  4NPP A;  5JRC A;  4DV7 T;  1NAF A;  1WYC A;  4U2Y A;  5FXZ A;  1KF6 A;  2UXB T;  4I55 E;  3ZLI A;  2KND A;  2HPL A;  4LMJ A;  5AQH B;  1HF8 A;  5FP3 A;  2BBJ A;  3ZEF B;  2X68 A;  3DP7 A;  2IML A;  2NOX A;  3SS1 A;  3ZMU B;  2YKS A;  2EHO D;  3FXE B;  1QSD A;  4G2A A;  5HXR A;  3ZYM A;  5HEG A;  2YU1 A;  2CPT A;  2KT9 A;  3AEB A;  3IHR A;  3IBP A;  4YJ3 E;  3ZYL A;  4UVC B;  3C98 B;  5HEJ A;  1U4Q A;  3LK3 B;  3W15 B;  3AE7 A;  1YKE B;  4UV8 B;  3ZC0 A;  4UF0 A;  2XSA A;  4MFR A;  1S35 A;  2V6X A;  5CFB A;  3I0Q A;  4MLK A;  5AQL B;  2BKN A;  1IJ6 A;  5JQG E;  2BKO A;  2OV9 A;  3CKD A;  4E7Z A;  2MBG A;  2BBH A;  3RQW A;  4IHJ E;  4DBR A;  2VAS A;  2WZH A;  4CN1 A;  2XUE A;  3FHN A;  2L9Q A;  3OYX A;  3UUN A;  4UR9 A;  4KI0 F;  2W67 A;  3K3Q C;  3BQL A;  5DQV A;  2OLT A;  4Q25 A;  4AIS A;  4AQF A;  3DJB A;  4JBW F;  4EYU A;  2K3W A;  2MPK A;  4PJN A;  3AE5 A;  3ESL A;  1OED A;  4ZI7 E;  4JI2 T;  2NW7 A;  2QYW A;  1UUR A;  3FZF B;  3N9O A;  4DV2 T;  5AQK B;  3HL6 A;  1N36 T;  3KBT A;  5LBM A;  2UUC T;  3VRB A;  5HCJ A;  2ES0 A;  4O4L E;  1BR1 A;  3PUY F;  4E7S A;  2W61 A;  5JDL A;  5JDQ A;  4DR2 T;  1MIV A;  4O2B E;  5C8Y E;  4IE6 A;  1N33 T;  4LF8 T;  2D2S A;  4P0B A;  3KDS E;  3P4Q A;  4ZZB A;  2YEV C;  3FB2 A;  3FXD B;  3GMI A;  3MXZ A;  4HFC A;  4OX9 T;  2CHO A;  2N1G A;  4HWH A;  4ILC A;  3HR0 A;  2K5B B;  3IEE A;  3V5S A;  2W62 A;  4WBN E;  2LSG A;  2CHN A;  2VL8 A;  2WM9 A;  3PUA A;  1Z0P A;  4YTP A;  3ONL C;  2UU9 T;  4ZI2 C;  4JV5 T;  1WLX A;  5AQN B;  3NKZ A;  5FL0 A;  2F4V T;  3JC6 C;  3T1Y T;  4OYJ A;  3HKE E;  3FBZ A;  1G8X A;  2V7I A;  4IDO A;  5LB7 B;  2IC6 A;  3VKH A;  2LE8 A;  5F3J A;  3KVB A;  1T7S A;  3C51 A;  1LRZ A;  2J47 A;  1W09 A;  3I1A A;  1SHZ C;  4H9Q C;  3VHL A;  4EZ4 A;  1HNX T;  2ACX A;  3NRY A;  2XZE A;  4HFH A;  2E5V A;  3IA3 A;  5LOV E;  2WS3 A;  4HEA A;  4DND A;  2V7J A;  2CLY C;  3M3Z B;  4EZH A;  2WQY A;  2XAJ B;  3GWH A;  3PUZ F;  4F6R C;  3N5L A;  4HFI A;  5L47 A;  5HAX A;  3UFG A;  1MMN A;  4NXN T;  4EGW A;  4X1K E;  4MAL A;  4HWF A;  3CX7 B;  2X0Y A;  4LFA T;  5AQU B;  1KK7 A;  3HKC E;  2FBW A;  4HWC A;  4YHH T;  3OTO T;  2XSB A;  3Q5E A;  2XQA A;  2DI4 A;  4QH5 A;  2XM2 A;  1V9D A;  2VKH A;  4PFO A;  1WRD A;  5DJQ C;  2WAU A;  2QGS A;  4AKL A;  2JMH A;  3MA9 A;  4QHO A;  1H7C A;  1OED E;  3O4X E;  3P4S A;  4DVD A;  4DV0 T;  1I94 T;  2XHE B;  4DR7 T;  5FVK A;  2JQH A;  4ILA A;  4U7I A;  1NEN A;  3RYH E;  4EAH A;  2WB5 A;  1LKX A;  2LKH A;  3AEA A;  3AE4 A;  3P4W A;  4HWD A;  4PK5 A;  3QK6 A;  2ZM0 A;  3O1I A;  5EK3 A;  1HS7 A;  2N9D A;  2X66 A;  3AED A;  4TX5 A;  3N9N A;  5HWX A;  4GYS A;  3ZN0 B;  1UX5 A;  2XAG B;  2XAF B;  3CWZ B;  2DNX A;  3CX6 B;  3PUV F;  4IL9 A;  4MBQ A;  3UU3 A;  4CN4 A;  2ODV A;  5CGM A;  3ZMZ B;  2H89 A;  3CQX C;  4A98 A;  2HN1 A;  5KX5 E;  3UQ4 A;  4U3C A;  4YXD A;  4OYK A;  3UT5 E;  1ZV4 X;  3JCF A;  2ZM8 A;  4X65 T;  2LLY A;  4AXP A;  3I9W A;  3K8P C;  4H9N C;  2H7O A;  3TKL B;  3AA6 B;  4EYY R;  5F5W A;  2VK9 A;  1E1H B;  2VVN A;  2XQY A;  4IGU A;  2IUB A;  5LGN B;  1G73 A;  3MZK B;  4KUM B;  4QX7 B;  4CI1 B;  2WBL A;  3B13 A;  2WU5 A;  3BQK A;  2JPF A;  4ILB A;  4IRE A;  4QH4 A;  3EUH A;  2W00 A;  5HXC A;  1FMW A;  3JC6 D;  3WI3 A;  3UU4 A;  2VWA A;  1MMA A;  5F8P A;  1HTJ F;  5JR9 C;  5J2T E;  3AXJ A;  3C4W A;  2NW8 A;  5E0O A;  5IWA T;  2RA1 A;  1KFY A;  2KLQ A;  1LVK A;  2UXX B;  2V6Y B;  2XQ8 A;  2Y6X A;  4L5G A;  4ANJ A;  5EK2 A;  1VCT A;  3RRW A;  4HGA A;  4CI3 B;  3V5U A;  1GQE A;  2CBJ A;  2KZ7 B;  4PK4 A;  4Z91 A;  4X1I E;  3SFD A;  2K9A A;  4HWI B;  4CQI A;  2X0L B;  3LK2 B;  2MYS A;  3PJA A;  3ZKR A;  1IBK T;  2BS4 A;  2DL1 A;  1L0V A;  2CXF A;  2YOE A;  5LYJ E;  4ZXL A;  1YKH B;  4AKH A;  5LG3 A;  2V26 A;  2CRB A;  3PE0 A;  2B1E A;  1D0Z A;  4BJN A;  4O2A E;  3G06 A;  1HNW T;  4QXB B;  1FEW A;  4KHP T;  4NUU A;  2VQF T;  3KV5 A;  2Q9Q D;  4IE7 A;  4L9I A;  5JRC B;  2CWY A;  4O8S A;  5AFU L;  3AAI A;  3L8R A;  2FJE A;  4IE5 A;  5FY0 A;  2A2F X;  4IIJ E;  2XQ3 A;  4ISS A;  4PJM A;  3ZT7 A;  4ADZ A;  2AE9 A;  2EHO A;  4A5X A;  1OED B;  2B76 A;  2V6Y A;  3AE9 A;  3QOF A;  2EHO B;  5ABG A;  2WDV A;  3KV6 A;  4DBQ A;  1HG2 A;  3Q2M A;  2FJB A;  2X51 A;  3ZJ1 A;  1XWM A;  2CM0 A;  5JDF A;  3LBX A;  4I50 E;  4TWD A;  5KXJ A;  4EED A;  2UXD T;  5CB4 E;  1XDP A;  2XAH B;  1YW0 A;  4C91 A;  4B3R T;  5CA0 E;  1UX4 A;  2JJ9 A;  3N9M A;  4Z8X A;  5J1G A;  2VKO A;  5LG4 A;  4X64 T;  3RYI E;  2E8I A;  1XDO A;  3O9X A;  4LF5 T;  3AVR A;  2X9H A;  5AQQ B;  1YD8 G;  3AEF A;  2YDR A;  4YSZ A;  5HXE A;  2LRL A;  2FJD A;  1E7P A;  2C0S A;  3NZQ A;  3AEG A;  2Q9Q A;  3AA7 B;  2K48 A;  1MNE A;  1WFD A;  1Z8U A;  2P9B A;  2NWB A;  1YQ3 A;  2WCA A;  3QB5 K;  1KNR A;  2A9U A;  4UVB B;  1Y64 B;  3P8C D;  2K24 A;  5AQP B;  4GKK T;  3UUL A;  4X66 T;  3ZT5 A;  4QH1 A;  5CA1 E;  4EIW A;  3BK9 A;  3EAB A;  4JYA T;  4LF9 T;  5JR9 A;  3Q5X A;  1D1A A;  4DV1 T;  2W66 A;  5FXX A;  3UU8 A;  1E2A A;  5L3B B;  3T1H T;  2KWH A;  5L3E B;  2W0G A;  1X9B A;  3PUS A;  5M4Y A;  2BG9 C;  4TN7 B;  1WR6 A;  2BKP A;  2LSY A;  1T8B A;  4DID B;  2CA5 A;  2MAW A;  2JRK A;  2MTQ A;  5H6R B;  2YN6 A;  3PTR B;  4ZI2 D;  5LJM A;  1FIO A;  2XPK A;  3PUG A;  4CZZ B;  2YU2 A;  3ABV A;  3UU5 A;  5A1L A;  5JDG A;  1B7T A;  4YSY A;  5C3J A;  4HKA A;  4LFB T;  2VB6 A;  4HFE A;  4JUY A;  4KMC A;  4O4H E;  2X67 A;  3RI5 A;  3QUJ A;  1QUU A;  4H9P C;  4TV8 E;  2G0U A;  4JI6 T;  4TWH A;  4EV6 A;  4ZOL E;  3RX6 A;  2BVM A;  3E08 A;  4QX8 B;  5FMN A;  5KDM C;  5LP6 E;  5JVD E;  2UUB T;  4UXN B;  3NBX X;  3VRA A;  3MAC A;  5FY7 A;  3RYC E;  5JDM A;  1JNR A;  2M6I A;  1D0Y A;  3UUB A;  1WCR A;  2HN2 A;  4ILU A;  2V8S V;  3N2O A;  1R8I A;  3TLT A;  4B3T T;  2Y48 B;  3ETU A;  2LHR A;  2CMR A;  2ZLY A;  3D0T A;  3WAK A;  2YK0 A;  4P1N A;  4K0K T;  3O1H A;  5LXT E;  3UU6 A;  4JI1 T;  3SRZ A;  2LJL A;  2IAK A;  3RC3 A;  1VRB A;  4U72 A;  1YXR A;  2WWV A;  3PUR A;  4IE4 A;  5LGT B;  4HFV A;  1VCS A;  4HN9 A;  5AQJ B;  2KMF A;  4IL4 A;  3ZYK A;  2X0H A;  3AAE B;  5EZY E;  4EXT A;  4DV3 T;  1MIY A;  1OWA A;  1N32 T;  3CIR A;  4U2Z A;  1UCU A;  2BG9 A;  2JQK A;  3CQG B;  4ERR A;  3CX8 B;  3LG7 A;  2V7L A;  1YQ4 A;  2HPJ A;  5ETW A;  2YDQ A;  2XQ4 A;  2CCQ A;  5HYA A;  3FZH B;  5C2T A;  2BG9 E;  2E9X C;  2IHR 1;  2NW9 A;  4B3S T;  2RP4 A;  1NWM X;  4XBF B;  2UXN B;  2D0T A;  5HXH A;  3UQ7 A;  1O3X A;  3PUX F;  4PW8 A;  2N2N A;  1HFA A;  2H88 A;  2XY8 B;  3AE6 A;  3RIF A;  4EOZ B;  4PFP A;  2BZB A;  4IST A;  3CK6 A;  5LA6 E;  4C90 A;  5ABF B;  3U3I A;  5L2L A;  5AQM B;  2EHO C;  2BDE A;  2YDS A;  4YFS A;  1SA0 E;  2PFV A;  1KNP A;  2I59 A;  2KSR A;  2PJQ A;  4NUV A;  4UV9 B;  5DAB A;  3TLV A;  4DR3 T;  5IHY A;  3ZC1 A;  3B57 A;  3UFE A;  3AE2 A;  5JH7 E;  4PJL A;  3NVO A;  4KBM B;  5FXW A;  4MHC A;  5FXV A;  3QC9 A;  3ONJ A;  1VOM A;  3PUW F;  4ZI3 C;  3E22 E;  2PG8 A;  1HX8 A;  1KEY A;  2LSJ A;  2XQ9 A;  3NZP A;  3P4P A;  4X5T A;  3RIA A;  3BQI A;  1FMV A;  2CLY B;  5LJN A;  1U5P A;  2BVL A;  4GK0 E;  3P4R A;  4YLH A;  3A5X A;  4IDP A;  4ZZC A;  1IZN B;  2GK9 A;  3EI0 A;  4JI4 T;  4DV5 T;  3AE8 A;  4QXH B;  4WNK A;  2V7K A;  4EEB A;  1UGO A;  1AJ3 A;  3U78 A;  3F31 A;  3Q5D A;  4ZS3 A;  4B6X A;  2C5K T;  4U33 A;  2PBI A;  2SPC A;  4KP3 C;  4DV6 T;  2V5C A;  3RRC A;  2ACZ A;  2LEH A;  2Y8D A;  3O1J A;  4GIW A;  3VR9 A;  1IAP A;  2A72 A;  3L3P A;  3NRX A;  2V7M A;  4QXC B;  4ZHQ E;  5J0Z A;  2KIN B;  4DMV A;  4AQY T;  5HEO A;  5L3G B;  3RHW A;  2Z6E A;  5LHG B;  2V1D B;  5HEH A;  2VKJ A;  1HNZ T;  1S94 A;  2A3D A;  2D9D A;  2LM2 A;  2XM1 A;  4H9O C;  3K3N A;  1SE7 A;  4GK5 E;  4BAY B;  3IF8 B;  4DO0 A;  4F8H A;  5ADX L;  5LHI B;  4AI6 A;  5JDN A;  1OXZ A;  3AE1 A;  3AB3 B;  5HCM A;  4NXM T;  1J5E T;  2WZI A;  1X79 A;  2IIU A;  1ZOY A;  3PU3 A;  3OBV E;  2WP9 A;  3OJA A; 
#chains in the Genus database with same CATH homology
 4HTE A;  4YHJ A;  5JRE A;  4PNI A;  5LBQ B;  1HG5 A;  4K0U A;  2JMK A;  3KVA A;  3M65 A;  3PDY A;  5H6Q B;  3LK4 2;  1MIW A;  5BMV E;  2MOZ A;  4PK6 A;  3UUM A;  4FJO A;  4DMW A;  2JQQ A;  1D0X A;  2D5U A;  2WSS V;  3DTO A;  3RC8 A;  4BJM A;  4H63 H;  2CE7 A;  3K3O A;  3SWH A;  3UUX B;  3ZN1 B;  1ZEE A;  1MND A;  2IW5 B;  4QWN B;  2HH7 A;  5L3D B;  1D1B A;  4QKN A;  1EZ3 A;  3WAJ A;  2LHN A;  4WW0 A;  3ZCJ A;  3EDU A;  2CEA A;  3LJC A;  4UF0 B;  4OFZ A;  3ANW B;  2OA5 A;  4JEU B;  3T8O A;  4CI2 B;  3I9Y A;  4BA9 A;  3ZPO A;  2H7V C;  2WMN A;  3ONX A;  5L3C B;  2NP9 A;  4G63 A;  4GYR A;  3OKQ A;  2E9X B;  3CPZ A;  2LOP A;  3OYZ A;  1ZKE A;  2CXD A;  3RYF E;  4AKG A;  2E9X A;  1BR4 A;  1KNZ A;  4I43 B;  3H37 A;  5HXS A;  2C5J A;  1CUN A;  1HCI A;  3Q9D A;  4WBO A;  4AKI A;  3J9X 1;  3C4X A;  2LM9 A;  2LT3 A;  2NTY A;  2ODU A;  4XAX B;  3S4U A;  3UTK A;  3ZMV B;  5J2U E;  1BR0 A;  4ZS2 A;  2VKD A;  4M1P A;  3AA1 B;  4YJ2 E;  4OHF A;  4ZI3 D;  2DWG A;  5EK4 A;  2L3L A;  2WMO A;  5DQW A;  4UEM A;  1D1C A;  2X9Y A;  3LBX B;  3C4Z A;  4P0A A;  2CXL A;  2CWO A;  3ANW A;  2DCF A;  4AQF C;  2QA7 A;  1BR2 A;  4I4T E;  4PAG A;  3ZMT B;  3ZCI A;  2H3R A;  3Q5W A;  4UVA B;  4O4I E;  4AKR B;  2L8K A;  3MJX A;  3RPU A;  1WYB A;  3GA8 A;  5FNV E;  2NTX A;  3HKD E;  4CXY A;  2Q9Q B;  3GN5 A;  3CQC B;  5JDH A;  3KFW X;  4U74 A;  3CML A;  2LSI A;  2X9W A;  3ETV A;  4PJJ A;  5LNK A;  2XAS B;  5IYZ E;  2DHR A;  3PUQ A;  3N2G E;  4L0R A;  3KIN B;  2LSK A;  4IDZ A;  4AQG A;  3ZMS B;  3CVR A;  4JLE A;  5L3F B;  4N78 D;  2Q9Q C;  3N9P A;  1MMG A;  3R6N A;  1MMD A;  4FI5 A;  3KBU A;  3KV4 A;  4A56 A;  4IE0 A;  4H63 V;  2ZMA A;  5FYM A;  2D0U A;  2DLR A;  4TUY E;  1ZHC A;  2KWI B;  3GN5 B;  3ZJ2 A;  2KXP B;  2DWK A;  2ZM2 A;  2XTL A;  3R84 B;  4OK0 A;  2IC9 A;  3E0Z A;  3EVY A;  3AAA B;  4UEL A;  3MK7 C;  4H9R C;  4O4J E;  2XAQ B;  3F57 A;  3N9Q A;  3MKD A;  3HKB E;  4TV9 E;  2X9X A;  3N9L A;  4JEH B;  3SOL A;  5GON E;  4EB6 E;  2YIN A;  5JR9 B;  3F2E A;  4X20 E;  1LVF A;  5KMG P;  3FBL A;  3AA0 B;  1US7 B;  3C50 A;  4J2C A;  3LFM A;  4HE8 A;  3VKG A;  5LGU B;  2WWU A;  5LHH B;  5TAO A;  3KV9 A;  4UIG A;  1T98 A;  1IJ5 A;  2E9X D;  3L09 A;  2M67 A;  4X1Y E;  3H3A A;  5FY1 A;  3VU7 H;  2C5I T;  2J1D G;  3C64 A;  4V1A v;  3P7I A;  4CXX A;  3J7Y q;  3RH3 A;  5LCY A;  2W63 A;  4ASK A;  3AVS A;  3I0O A;  4TZ4 C;  3EDV A;  3HI2 A;  3ZC0 A;  3RKO A;  4CXW A;  4GOU A;  3N2K E;  3HA4 A;  4XZC A;  4P09 A;  5HWY A;  2LOS A;  5JRC A;  1NAF A;  1WYC A;  5FXZ A;  4I55 E;  3ZLI A;  2KND A;  2HPL A;  5FP3 A;  1HF8 A;  3ZEF B;  2X68 A;  3DP7 A;  2NOX A;  3SS1 A;  3ZMU B;  4G2A A;  2EHO D;  3FXE B;  1QSD A;  3ZYM A;  5HXR A;  2YU1 A;  2KT9 A;  3IHR A;  3IBP A;  4YJ3 E;  3ZYL A;  4UVC B;  3C98 B;  1U4Q A;  3LK3 B;  3W15 B;  1YKE B;  4UV8 B;  4UF0 A;  4MFR A;  1S35 A;  3I0Q A;  4MLK A;  5JQG E;  1IJ6 A;  3CKD A;  4E7Z A;  4IHJ E;  4DBR A;  2VAS A;  2XUE A;  3FHN A;  2L9Q A;  3OYX A;  3UUN A;  3K3Q C;  3BQL A;  5DQV A;  4AQF A;  4EYU A;  3DJB A;  4ZI7 E;  4PJN A;  3ESL A;  2NW7 A;  3N9O A;  3HL6 A;  3KBT A;  5LBM A;  2ES0 A;  4O4L E;  1BR1 A;  4E7S A;  2W61 A;  5JDL A;  5JDQ A;  1MIV A;  4O2B E;  5C8Y E;  4IE6 A;  2D2S A;  4P0B A;  3KDS E;  2YEV C;  3GMI A;  3FB2 A;  3FXD B;  3MXZ A;  2N1G A;  3HR0 A;  2K5B B;  3IEE A;  3V5S A;  2W62 A;  4WBN E;  2LSG A;  2VL8 A;  2WM9 A;  3PUA A;  1Z0P A;  4ZI2 C;  1WLX A;  3JC6 C;  4OYJ A;  3HKE E;  3FBZ A;  1G8X A;  2V7I A;  3VKH A;  2IC6 A;  2LE8 A;  5F3J A;  3KVB A;  4H9Q C;  3C51 A;  1LRZ A;  3I1A A;  3VHL A;  4EZ4 A;  1SHZ C;  2ACX A;  3NRY A;  5LOV E;  4DND A;  4HEA A;  2V7J A;  2CLY C;  4EZH A;  2XAJ B;  3GWH A;  3N5L A;  5HAX A;  1MMN A;  4X1K E;  4MAL A;  3CX7 B;  1KK7 A;  3HKC E;  4PFO A;  2DI4 A;  5DJQ C;  1V9D A;  2VKH A;  1WRD A;  2WAU A;  2QGS A;  4AKL A;  2JMH A;  3MA9 A;  4QHO A;  1H7C A;  3O4X E;  2XHE B;  3RYH E;  4EAH A;  1LKX A;  3V5U A;  4PK5 A;  1HS7 A;  3QK6 A;  2ZM0 A;  3O1I A;  5EK3 A;  2N9D A;  2X66 A;  4TX5 A;  3N9N A;  5HWX A;  4GYS A;  3ZN0 B;  1UX5 A;  2XAG B;  2XAF B;  3CWZ B;  2DNX A;  3CX6 B;  4MBQ A;  2ODV A;  3ZMZ B;  3CQX C;  5KX5 E;  4OYK A;  3UT5 E;  1ZV4 X;  2ZM8 A;  4AXP A;  3I9W A;  3K8P C;  4H9N C;  2H7O A;  3TKL B;  3AA6 B;  4EYY R;  2VK9 A;  1E1H B;  4IGU A;  2XQY A;  5LGN B;  1G73 A;  3MZK B;  4KUM B;  4QX7 B;  4CI1 B;  2WBL A;  3B13 A;  3BQK A;  2JPF A;  3EUH A;  2W00 A;  5HXC A;  1FMW A;  3JC6 D;  3WI3 A;  2VWA A;  1MMA A;  5F8P A;  1HTJ F;  5JR9 C;  5J2T E;  3C4W A;  2NW8 A;  5E0O A;  2RA1 A;  2KLQ A;  2Y6X A;  1LVK A;  2UXX B;  4L5G A;  4ANJ A;  5EK2 A;  3RRW A;  4HGA A;  4CI3 B;  2KZ7 B;  4PK4 A;  4X1I E;  2K9A A;  4CQI A;  2X0L B;  3LK2 B;  2MYS A;  4AKH A;  2CXF A;  5LYJ E;  1YKH B;  2V26 A;  3PE0 A;  2B1E A;  1D0Z A;  4BJN A;  4O2A E;  4QXB B;  1FEW A;  4NUU A;  3KV5 A;  2Q9Q D;  4IE7 A;  4L9I A;  5JRC B;  2CWY A;  4O8S A;  5AFU L;  3AAI A;  4IE5 A;  5FY0 A;  2A2F X;  4IIJ E;  4ISS A;  4PJM A;  4ADZ A;  2EHO A;  4DBQ A;  2EHO B;  3KV6 A;  1HG2 A;  3Q2M A;  2X51 A;  3ZJ1 A;  2CM0 A;  5JDF A;  3LBX A;  4I50 E;  5CB4 E;  2XAH B;  1YW0 A;  4C91 A;  5CA0 E;  1UX4 A;  2JJ9 A;  3N9M A;  4Z8X A;  5J1G A;  2VKO A;  5LG4 A;  3RYI E;  2E8I A;  3O9X A;  3AVR A;  2X9H A;  1YD8 G;  5HXE A;  4H9S E;  2C0S A;  3NZQ A;  4DVD A;  2Q9Q A;  3AA7 B;  2K48 A;  1MNE A;  3PU8 A;  2MBG A;  2P9B A;  2NWB A;  4UVB B;  5LXT E;  1Y64 B;  3P8C D;  2K24 A;  3UUL A;  5CA1 E;  4EIW A;  3BK9 A;  5JR9 A;  3Q5X A;  1D1A A;  5FXX A;  5L3B B;  2KWH A;  5L3E B;  2W0G A;  3PUS A;  5M4Y A;  4TN7 B;  1WR6 A;  2LSY A;  2CA5 A;  2JRK A;  2MTQ A;  5H6R B;  3PTR B;  4ZI2 D;  5LJM A;  1FIO A;  3PUG A;  4CZZ B;  2YU2 A;  5A1L A;  5JDG A;  1B7T A;  4HKA A;  2VB6 A;  4KMC A;  4O4H E;  2X67 A;  3QUJ A;  1QUU A;  4H9P C;  4TV8 E;  2G0U A;  4ZOL E;  3RX6 A;  2BVM A;  3E08 A;  4QX8 B;  5FMN A;  5KDM C;  5LP6 E;  5JVD E;  4UXN B;  3NBX X;  3MAC A;  5FY7 A;  3RYC E;  5JDM A;  1D0Y A;  4ILU A;  3N2O A;  2Y48 B;  3ETU A;  2LHR A;  2CMR A;  2ZLY A;  3D0T A;  3WAK A;  2YK0 A;  3O1H A;  3SRZ A;  2LJL A;  2IAK A;  3RC3 A;  1VRB A;  4U72 A;  3PUR A;  4IE4 A;  5LGT B;  4HFV A;  4HN9 A;  2KMF A;  3ZYK A;  3AAE B;  5EZY E;  4EXT A;  1MIY A;  1OWA A;  1UCU A;  3CQG B;  4ERR A;  3CX8 B;  3LG7 A;  2V7L A;  2HPJ A;  5ETW A;  2CCQ A;  5HYA A;  2NW9 A;  2E9X C;  1NWM X;  2RP4 A;  4XBF B;  2UXN B;  2D0T A;  5HXH A;  1O3X A;  4PW8 A;  2N2N A;  1HFA A;  4EOZ B;  4PFP A;  2BZB A;  4IST A;  5LA6 E;  5L2L A;  4C90 A;  3U3I A;  2EHO C;  2BDE A;  4YFS A;  1SA0 E;  2I59 A;  2PFV A;  4NUV A;  2PJQ A;  4UV9 B;  5DAB A;  5IHY A;  3ZC1 A;  3B57 A;  3UFE A;  5JH7 E;  4PJL A;  5FXW A;  4KBM B;  4MHC A;  5FXV A;  3QC9 A;  1VOM A;  4ZI3 C;  3E22 E;  2PG8 A;  1HX8 A;  2LSJ A;  4F6R C;  3NZP A;  3BQI A;  1FMV A;  2CLY B;  5LJN A;  1U5P A;  2BVL A;  4GK0 E;  4YLH A;  3A5X A;  1IZN B;  2GK9 A;  4QXH B;  4WNK A;  2V7K A;  1AJ3 A;  3U78 A;  3F31 A;  4ZS3 A;  4B6X A;  2C5K T;  2PBI A;  2SPC A;  4KP3 C;  3RRC A;  2LEH A;  2Y8D A;  3O1J A;  4GIW A;  2A72 A;  1IAP A;  3L3P A;  3NRX A;  2V7M A;  4QXC B;  4ZHQ E;  2KIN B;  4DMV A;  5L3G B;  2Z6E A;  5LHG B;  2V1D B;  2VKJ A;  1S94 A;  2A3D A;  4BAY B;  4H9O C;  3K3N A;  4GK5 E;  3IF8 B;  4DO0 A;  5LHI B;  5ADX L;  4AI6 A;  5JDN A;  1OXZ A;  3AB3 B;  1X79 A;  3PU3 A;  3OBV E;  4JUY A;  3OJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...