2CXLA

Run domain of rap2 interacting protein x, crystallized in i422 space group
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
165
structure length
158
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rap2 interacting protein x
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 39
structure length 158
sequence length 165
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxlA00
2DWKA 4GIWA 2CXFA 2CXLA 3CWZB 2DWGA
chains in the Genus database with same CATH superfamily
4YJ2E 4HE8A 5A1LA 5LP6E 1X9BA 3RI5A 4HFHA 4JYAT 3UQ7A 1M7KA 5ABFB 2H7VC 2FUPA 4ZI2D 4NUVA 3QC9A 4COFA 2E9XB 4LMLA 3RQUA 3O9XA 2WZIA 2J62A 4QX7B 2IC9A 4PFOA 3E22E 3KV5A 2H88A 3EABA 2LHNA 4QHOA 2Z6EA 3AEGA 3UTKA 5HCMA 5HXRA 1BR4A 4IE6A 2BG9A 2YOEA 3CQGB 4M1PA 4GYRA 5BR8T 1VCSA 4L0RA 3A7MA 1Z8UA 2IMLA 3EAMA 2W63A 3CK6A 1YQ4A 4HFCA 3IA3A 3GN5A 5LB7B 5L3CB 2WMOA 4DIDB 4DR7T 2YEVC 4EYUA 5AQOB 5FY0A 4EOZB 3P4SA 3OYXA 3RLFF 3T8OA 3AXJA 3FZMB 4A56A 5JTGA 2BBHA 3ZMUB 2LJLA 5TAOA 5EK4A 2XQAA 2UUAT 5JDGA 2J47A 2DCFA 5L3BB 5E0OA 5BMVE 2DLRA 5HWYA 3RF1A 4TN7B 3E0ZA 5CJ5A 3OTOT 2KINB 4EZ4A 5L3EB 2ZM0A 4DO0A 4H9RC 3OYZA 4ZI7E 3DJBA 4V1Av 3EI0A 3S4UA 3J9X1 5LXTE 4DUZT 4JEHB 3UQ4A 2VWAA 1G73A 2XAHB 4LFBT 5LGNB 3IBPA 2EHOB 4TWFA 3Q2MA 1KK7A 5F5WA 2MPKA 2OA5A 4DR5T 4B3TT 5AQHB 1I94T 3N9OA 3WAKA 3ETVA 5AFUL 3N2OA 3IHRA 1N36T 2L8KA 1HF8A 4O4JE 3KV6A 2NP9A 4OK0A 5AQVB 2QVAA 4BAYB 2WY2A 3ONJA 4LF9T 4CI3B 2MBGA 4AQYT 3SOLA 4X65T 3PJAJ 3PUWF 3FBZA 3RIFA 3FB2A 3KVBA 5AQLB 4Q25A 4O4HE 3RIUA 1SE7A 5L2LA 4H9OC 4YJ3E 2X0YA 3SS1A 4IDZA 4ZI2C 2N9DA 5JDNA 1LVKA 1UK5A 4K0UA 3R6NA 2KLQA 2ODVA 3NKZA 2XQ9A 1BR2A 3PUGA 3FBLA 3C4XA 2K5BB 4BA9A 2X9HA 3DP7A 4DV4T 4YY3T 3RYCE 2MAWA 2BG9B 1MIYA 3MZKB 1OEDC 3C4ZA 4KP3C 4G2AA 4DNDA 2X9WA 4KMCA 2EHOD 3GN5B 3RX6A 4IE4A 2W4XA 2WS3A 1W09A 2XUEA 4UIGA 4FI5A 2LSGA 2YINA 5L3FB 1G8XA 4IDNA 4X62T 2WWUA 3AXJB 2CE7A 1UUSA 4ASKA 5C8YE 2JRKA 2CRBA 2JJ9A 4ISTA 3ZMVB 2ES0A 3A5XA 5LJMA 4B3MT 5EK3A 4AKHA 1HNWT 4BJMA 3AE8A 4EEBA 2BKOA 4GIWA 5FL1A 5FY1A 3LDQB 3U78A 2OV9A 4TWHA 3HR0A 2X0LB 4YHHT 2MYSA 5LGUB 4YHJA 4YT0A 1E2AA 1AJ3A 4WNKA 2VKHA 5HEGA 4HFDA 1LVFA 1V9DA 4CZZB 2DWGA 3CQCB 3TLVA 2NW8A 3UUMA 3ZPOA 5FYMA 3N2GE 1KNRA 3OBVE 3Q5WA 4CQIA 2CPTA 2XAFB 3AE5A 5JVDE 4KBMB 3AVSA 2V7MA 2WDVA 4ZI3D 5LJNA 4HWCA 1FEWA 5CA1E 1LRZA 4L9IA 2L9QA 4DV3T 2Q9QA 3P4PA 2VVNA 4AKGA 3P8CD 3RRWA 3ZC1A 4TNVA 4CI2B 3WAJA 2A2FX 2A3DA 4P0BA 4EIWA 2HPLA 4LMKA 2HHHT 2X9YA 3VKHA 4L5GA 2W00A 3UFGA 4DV6T 3ZLIA 3B13A 2C5IT 3OKQA 4EZHA 3RIAA 4P09A 1I6ZA 4DV5T 4C90A 3RGLA 5KX5E 4KUMB 4P0AA 4YXDA 1XNRT 5ABEA 4EB6E 3PUQA 4KHPT 2XHEB 1HCIA 4PFPA 2V6YA 4AIUA 2D0TA 1W9RA 3JC6D 1E1HB 2EHOC 3BK9A 4EXTA 4JI8T 4O8SA 1ZKEA 5JDHA 2ZMAA 2ZM6T 4G63A 2D9DA 2ACXA 4DR2T 5JDQA 2ZM8A 4X1KE 2QGSA 1J5WA 3L3PA 4C91A 5J2UE 3AE4A 5DJQC 5HEUA 4LMJA 2BDEA 2NW7A 2QRXA 4OHFA 4J2CA 1IJ6A 4MFRA 3N9NA 4XAXB 3E08A 3KV9A 1UX4A 3AAIA 4E7ZA 4DV1T 2C0SA 4DR3T 3PUYF 3PV0F 2WDQA 3K3OA 5AQMB 4F8HA 2VK9A 3AECA 4AQFA 1WRDA 5J2TE 1XMQT 3M3ZB 3N9LA 3ZMZB 2M6BA 5LHHB 4HWIB 1FJGT 3VRAA 1M62A 3IEEA 2XAQB 2XTLA 3ZT5A 5JH7E 3FXEB 5KMGP 1MNDA 1QLBA 3CX6B 3HL6A 3H3MA 3RHWA 4ZHQE 3AB3B 1D1AA 2BG9C 2AE9A 1WR6A 3SRZA 4WW0A 4TZ4C 4ZI3C 4TNWA 1WR0A 4QH4A 5AQFB 3FZFB 1UCUA 2BS4A 4CXYA 2UUCT 1YW0A 1KEYA 4HTEA 3CIRA 3NRXA 3ZT6A 2IUBA 4PAGA 5JDMA 4ZXLA 3Q5EA 4TX5A 2XSBA 3Q5DA 2V5DA 2CBJA 3B5MA 4HFBA 4QH1A 5J1GA 4X5TA 3UFEA 4U2YA 3MK7C 4DV0T 4IL4A 3UT5E 4E7SA 4O2AE 5HXCA 4TWDA 5ETWA 4IREA 2IIUA 2M6IA 4OX9T 1ZHCA 5HXSA 5KXJA 5HWXA 3P4WA 3ZYLA 2X66A 4DBQA 2CCQA 2PFVA 1NEKA 3SFDA 1HG2A 4YTPA 4OYJA 2V8SV 3ETUA 3VHLA 5AQRB 2X51A 1Z0PA 3SWHA 3C4WA 4B3RT 3JC6C 2V6YB 3PURA 1WFDA 2WMNA 1MMNA 2WWVA 2YDSA 4XBFB 4YLHA 2R6GF 4JI3T 4H63V 5DQWA 3AE7A 3VR9A 1CUNA 1T7SA 5AQUB 4JI2T 1IZNB 3F57A 3Q5XA 1D1BA 3O1JA 1FMWA 1YQ3A 4PNIA 4EAHA 2D5UA 3RRCA 4UV8B 4PJJA 2X0HA 3ZCJA 3ZN1B 4K0KT 3FZLB 2V5CA 2W66A 2E9XD 4HWFA 5FXZA 2VKDA 3LSVA 3VR8A 4AKIA 4A5XA 4AISA 2BS2A 3N5LA 4MBQA 5FXWA 3KBUA 2LKHA 3ZYMA 2K24A 4UF0A 5AQTB 3EDUA 1BR1A 4IDPA 1HNXT 3LBXA 3NWIA 4JEUB 2LSKA 2I6HA 2YDRA 3ANWA 2CLYB 5LHIB 2HN2A 3AEEA 2YN6A 3UU5A 2HPJA 3RC8A 3C98B 4GK0E 3L8RA 3P7IA 1J1JA 2IHR1 3NZPA 4IDOA 3O4XE 5HEJA 3ONLC 4I4TE 2RA1A 4N78D 2XM2A 5CB4E 4U3CA 2WDRA 2BKPA 4PW8A 4IT4A 2LSYA 1S94A 5LGTB 4ZEYA 2I0MA 2VQFT 1OWAA 2FJEA 5JDFA 3RKGA 1HFAA 2H89A 1YD8G 4WZXA 2VURA 4ADZA 4CN4A 5HAXA 3PDYA 1D0YA 1JNRA 3UUXB 4JI1T 2XQ7A 2FJAA 3AA0B 3H37A 4UV9B 2WU5A 5C3JA 1UX5A 2BG9E 1B7TA 4F6RC 1IAPA 3NRYA 4PJLA 1HX8A 3ZN0B 3KDSE 3ESLA 3AE9A 2OLTA 2KWHA 2DI4A 3N9MA 2HH7A 2CXDA 1FMVA 5HEHA 3KFWX 4U72A 3UU4A 3ZEFB 3SFEA 4HWDA 3V5UA 3TLSA 4ZZCA 1KNPA 2XPKA 5CA0E 2F4VT 2YDQA 4NXNT 2WM9A 2YU1A 4H9QC 4PJMA 3L39A 4NPPA 3T1YT 2L3LA 2WB5A 3D0TA 3UULA 2VB6A 2W0GA 3AE6A 2E8IA 3NZQA 5L47A 2VQET 5JR9A 3W15B 3QNUA 3F31A 2E5VA 1OEDA 2ACZA 3PUSA 3RYFE 3F2EA 4LF7T 3LK3B 5FVLA 2E9XC 3CQXC 3HI2A 3K3QC 3P4QA 1R8IA 4I0UA 1KF6A 4QH5A 2XAGB 2JIWA 2ODUA 1SHZC 2ZLYA 2JMKA 2WP9A 3AEFA 3EVYA 3FHNA 4UF0B 4U33A 3HKCE 3LBXB 2BVMA 4ZOLE 3ANWB 1WLXA 2XJ7A 1HNZT 4GKJT 4AI6A 3K8PC 2CA5A 4ZS2A 3HKBE 1QUUA 2CXFA 2V7JA 3CX7B 2JQ9A 2WU2A 2PJQA 5AQPB 4PK5A 3QOFA 2DL1A 4DMVA 4YSZA 3RH3A 2AXDS 2KWIB 4GYSA 3JAEA 3AVRA 3Q9DA 4QKNA 4WBOA 2XSAA 1WCRA 2NR4A 1VCTA 5IWAT 2LSJA 2X68A 2IC6A 5AQNB 4CI1B 4DR6T 4Z91A 3JAFA 2JQKA 2XQYA 3G06A 5L3GB 5DQVA 2G0UA 1YKEB 1HX1B 5L4HA 2A9UA 1FIOA 1UGOA 5IYZE 1IJ5A 2BVLA 4A97A 3RC3A 3OPCA 2B76A 5FP3A 4Z8XA 5HXEA 4I55E 3DTOA 2DHRA 3ZKRA 2J1DG 2XZEA 3I9YA 4PK4A 4IHJE 3MJXA 3I0QA 3WI3A 4AQFC 3BQLA 2LSIA 3ZC0A 5AQJB 5L4EA 3TLWA 2UXNB 4EV6A 3CVRA 4HGAA 2CLYC 4PJNA 2QYWA 4IGUA 5J0ZA 1JNZA 1E7PA 1UURA 1HG5A 4QXBB 1NWMX 3PTRB 4GK5E 3B57A 2UXXB 4JV5T 3AEBA 3N2KE 5LG4A 4IIJE 3M65A 5ABHA 4LF6T 3MA9A 5JR9B 3GWHA 4WBNE 3C50A 4NXMT 5LBMA 3O1HA 2V26A 3PU3A 2XAJB 1XMOT 2N2NA 2NOXA 3CX8B 4ANJA 4LF8T 2XQ4A 4UR9A 5AQSB 5JRCA 3TKLB 2PBIA 4DBRA 4TV8E 2FBWA 4KI0F 4MALA 2NTYA 3QB5A 2BKNA 2CEAA 3HKEE 3LG7A 2Y48B 3EUHA 2V6XA 3JADA 5LYJE 4QXCB 4ZS3A 4PK6A 2LLYA 3EDVA 4I43B 2Q9QB 3FZHB 5FNVE 5FMNA 1IBKT 1DU2A 2QA7A 3V5SA 2D0UA 2RPAA 1ZOYA 4X1YE 5AQKB 4DR1T 2W2UA 3C64A 4HFVA 3N9PA 1X79A 2KMFA 5C2TA 4JI5T 2BZBA 4UVBB 4B3ST 2YU2A 2YK0A 4O2BE 4U7YA 2M67A 4X64T 1ZP0A 3RPUA 2WCAA 3KBTA 4HKAA 3OVUA 1LKXA 1VOMA 1SUMB 4IDQA 3TLTA 3MACA 1MNEA 3LFMA 3NBXX 4NIQA 3CPZA 3BQKA 4JUYA 3QUJA 2CMRA 4LF4T 2H7OA 1W0AA 3AEDA 1Y64B 3JCFA 4HFEA 4UELA 2VKJA 3HKDE 4UVCB 3UU3A 1XDOA 2CWOA 2C5KT 4AKLA 2C5JA 4TV9E 3AA7B 5LOVE 5LA6E 4GKKT 1XZYA 3VU7H 2RP4A 4TUYE 4LFAT 1O3XA 4ILUA 3ABVA 1MIWA 1HTJF 2Q9QD 4MHCA 3LK42 4HEAA 4YTNA 1HR0T 5HCJA 4U74A 2UXCT 3J7Yq 5LCYA 3RQWA 3T1HT 2WSSV 3RIUC 2XQ8A 1GQEA 4CXWA 5LHGB 2CBIA 4AXPA 1WYCA 4IE5A 4UEMA 5FKYA 3PUVF 5LMUT 2K3WA 4DV7T 5JREA 5GONE 1S35A 5LMNT 3BQIA 4DMWA 5FXVA 1MMGA 5JRCB 2J4GA 1YXRA 4DUYT 2B1EA 3PUXF 2XQ3A 2LM2A 3U3IA 3P50A 5LNKA 4JBWF 1QSDA 3MXZA 3KVAA 2VL8A 2W61A 2K9AA 2MTQA 5IUXA 3KINB 4EGWA 1HS7A 1NENA 3AEAA 3MKDA 5F8PA 1IBLT 2ZM2A 4ERRA 3L09A 5ABGA 3AAEB 3VKGA 3GA8A 5EZYE 2CHNA 4GOUA 3CWZB 4DVDA 4JI7T 3LK2B 3AE1A 4H9SE 1IBMT 4IL9A 3ZCIA 3ZMTB 2Y6XA 4DV2T 2FJBA 1SA0E 4OFZA 2VVSA 1ZV4X 5AQIB 1D1CA 2MOZA 4CN1A 1U4QA 4H9PC 5KDMC 1T72A 3ZJ2A 4Z90A 3R84B 2UXBT 2DWKA 3RYIE 4AQGA 2LE8A 3X1DA 2PTFA 1VRBA 2XQ6A 5LG3A 2V1DB 5JDLA 2CWYA 2A72A 4HFIA 5FY7A 4U31A 4X20E 2KXPB 5HYAA 5JR9C 5FXXA 3VRBA 2UUBT 3ONXA 3PE0A 2XQ5A 2LKGA 2LHRA 4FJOA 2Y8DA 2W67A 4X66T 4EYYR 4P1NA 2VASA 2HN1A 3TLUA 2XY8B 2IDOB 3QB5K 1H7CA 2E2AA 2CM0A 3KV4A 4ZZBA 1T8BA 3ZYKA 3PUZF 3AAAB 3GMIA 2UXDT 1ZEEA 1XNQT 3IF8B 2I59A 4IE0A 2LRLA 2JQHA 5CFBA 3N9QA 2PG8A 2Q9QC 2VL0A 2BS3A 3EHZA 2E5LT 2KZ7B 2YKSA 4XZCA 4BJNA 5AQQB 1MIVA 4KX6A 2WAUA 2X67A 3H3AA 4YSXA 4ISSA 4YSYA 1XWMA 2V7LA 3PUAA 5FVKA 3PJAA 4O4LE 1OXZA 5IHYA 2VKOA 3A8YC 2KSRA 3CMLA 1J5ET 4YTMA 4A98A 4ILCA 3LJCA 1L0VA 3ZMSB 2XASB 1NAFA 3HA4A 2XM1A 5ABFA 5ADXL 2JPFA 3UUNA 3OJAA 4AKRB 4CXXA 5HXHA 2E9XA 2JQQA 5DABA 5EK2A 4DR4T 3C51A 4HN9A 4KHZF 5CGMA 2NTXA 3P4RA 4O4IE 2LOPA 5JQGE 2W62A 2LRKA 4JI0T 3FXDB 4I50E 2IAKA 3ZJ1A 2NWBA 3ZSSA 5LBQB 2NW9A 3O1IA 3RKOA 4QX8B 2DNXA 4H9NC 4YFSA 4U2ZA 3K1SA 3PU8A 5H6RB 2D2SA 5HEOA 4UXNB 1WYBA 3NVOA 3AA6B 2H3RA 2CHOA 2LT3A 2LM9A 3K3NA 1BR0A 3QK6A 4JI6T 1YKHB 1KNZA 5M4YA 4QWNB 3AE3A 1T98A 2KT9A 3ZSTA 4LFCT 4X1IE 2KNDA 2K48A 3UUBA 3FZKB 1N32T 1U5PA 3ZT7A 3I1AA 1D0XA 5L3DB 4WYVA 5AQGB 5FL0A 3AE2A 1Y01A 2P9BA 2BBJA 1XDPA 2GK9A 4OYKA 2LOSA 1EZ3A 2LEHA 1US7B 2SPCA 2WQYA 2V7IA 2WZHA 2WBLA 4MLKA 4H63H 3I0OA 3I9WA 2IW5B 4IE7A 1OEDB 2FJDA 4CN6A 4NUUA 3UU6A 3UU8A 2EHOA 4ILAA 4ILBA 1OEDE 4JLEA 2UU9T 4UVAB 2JMHA 1W0BA 2N1GA 2V7KA 4EEDA 3CKDA 3AA1B 5H6QB 1KFYA 1N33T 1N34T 4HWHA 1CHUA 1MMAA 1MMDA 4JI4T 4QXHB 2X9XA 4LF5T 3RYHE 5F3JA 4B6XA 2CXLA 4U7IA 1D0ZA
chains in the Genus database with same CATH topology
3ZLIA 3B13A 2C5IT 4CXWA 5LHGB 4AXPA 4YJ2E 3OKQA 4HE8A 1WYCA 4IE5A 4EZHA 5A1LA 5CA0E 5LP6E 4UEMA 4P09A 2WM9A 2YU1A 4H9QC 4PJMA 2L3LA 4C90A 5KX5E 5JREA 4KUMB 5GONE 4P0AA 2H7VC 1S35A 3D0TA 4EB6E 3PUQA 3UULA 2XHEB 1HCIA 4ZI2D 4NUVA 2VB6A 2W0GA 3QC9A 2E9XB 3BQIA 4PFPA 4DMWA 5FXVA 3O9XA 2E8IA 3NZQA 1MMGA 2D0TA 5JRCB 3JC6D 4QX7B 1E1HB 5JR9A 2B1EA 3W15B 2IC9A 2EHOC 3BK9A 3F31A 4EXTA 3U3IA 3PUSA 4O8SA 4PFOA 3RYFE 3F2EA 5LNKA 1ZKEA 1QSDA 3MXZA 3E22E 3KV5A 3LK3B 3KVAA 2VL8A 2W61A 2K9AA 2LHNA 2E9XC 2MTQA 2Z6EA 4QHOA 3UTKA 5JDHA 3CQXC 3HI2A 3K3QC 3KINB 1HS7A 5HXRA 1BR4A 4IE6A 3MKDA 3CQGB 4M1PA 4GYRA 5F8PA 2ZMAA 2ZM2A 4ERRA 3L09A 4G63A 2ACXA 4L0RA 2XAGB 2W63A 5JDQA 3AAEB 2ZM8A 2ODUA 3VKGA 3GA8A 1SHZC 3GN5A 4X1KE 2QGSA 5EZYE 2ZLYA 5L3CB 3L3PA 4C91A 5J2UE 2WMOA 4GOUA 5DJQC 3CWZB 4DVDA 2JMKA 2BDEA 2NW7A 3LK2B 3EVYA 4OHFA 3FHNA 4J2CA 4UF0B 1IJ6A 3HKCE 4H9SE 2YEVC 4EYUA 4MFRA 3N9NA 4XAXB 3LBXB 3E08A 2BVMA 5FY0A 3KV9A 4EOZB 3ZCIA 1UX4A 4ZOLE 3ZMTB 2Y6XA 3AAIA 3OYXA 3ANWB 4E7ZA 3T8OA 1SA0E 1WLXA 2C0SA 1ZV4X 4OFZA 1D1CA 2MOZA 1U4QA 4H9PC 5KDMC 4AI6A 3K8PC 3ZJ2A 4A56A 3K3OA 3R84B 2CA5A 3ZMUB 4ZS2A 2DWKA 3HKBE 2LJLA 1QUUA 3RYIE 4AQGA 5TAOA 2LE8A 2VK9A 2CXFA 1VRBA 5EK4A 4AQFA 2V1DB 1WRDA 5J2TE 2V7JA 3N9LA 5JDGA 3ZMZB 5JDLA 2CWYA 2A72A 5LHHB 3CX7B 2DCFA 5FY7A 5L3BB 2PJQA 5E0OA 5BMVE 3IEEA 2KXPB 2DLRA 4X20E 5HYAA 5JR9C 5HWYA 2XAQB 5FXXA 2XTLA 4PK5A 5JH7E 4TN7B 3E0ZA 3ONXA 4DMVA 3PE0A 2KINB 3FXEB 4EZ4A 5L3EB 5KMGP 3RH3A 1MNDA 2KWIB 4GYSA 3CX6B 2ZM0A 3HL6A 4DO0A 4H9RC 4ZHQE 3AB3B 3AVRA 3OYZA 4ZI7E 3DJBA 1D1AA 3Q9DA 4QKNA 4V1Av 2LHRA 4FJOA 4WBOA 1WR6A 4WW0A 2Y8DA 3S4UA 3SRZA 3J9X1 5LXTE 4EYYR 4JEHB 2VASA 4TZ4C 2LSJA 2VWAA 2X68A 1G73A 2IC6A 2XAHB 4CI1B 4ZI3C 5LGNB 2XQYA 3IBPA 2EHOB 1H7CA 5L3GB 3Q2MA 1KK7A 2OA5A 2CM0A 3KV4A 1UCUA 5DQVA 4CXYA 1YW0A 2G0UA 1YKEB 3ZYKA 4HTEA 3NRXA 3N9OA 3WAKA 3ETVA 4PAGA 3AAAB 3GMIA 5AFUL 5JDMA 3N2OA 3IHRA 1FIOA 1ZEEA 5IYZE 2L8KA 3IF8B 1HF8A 4TX5A 1IJ5A 2I59A 4O4JE 4IE0A 3KV6A 2NP9A 4OK0A 4BAYB 2BVLA 3RC3A 4CI3B 3N9QA 5FP3A 5J1GA 2PG8A 4Z8XA 3UFEA 2Q9QC 2MBGA 5HXEA 4I55E 3DTOA 2DHRA 2J1DG 3SOLA 2KZ7B 3I9YA 4PK4A 4XZCA 4IHJE 4BJNA 3MK7C 3MJXA 1MIVA 3FBZA 3I0QA 3WI3A 4AQFC 3BQLA 2LSIA 3UT5E 3FB2A 4E7SA 4O2AE 3ZC0A 2WAUA 2X67A 3H3AA 3KVBA 5HXCA 5ETWA 4ISSA 1ZHCA 2UXNB 5HXSA 4O4HE 2V7LA 3CVRA 4HGAA 2CLYC 4PJNA 5HWXA 3ZYLA 4DBQA 2X66A 3PUAA 2CCQA 2PFVA 5L2LA 4O4LE 4H9OC 1OXZA 4IGUA 1HG2A 4YJ3E 5IHYA 3SS1A 4IDZA 2VKOA 4OYJA 4ZI2C 3ETUA 2N9DA 3VHLA 5JDNA 1LVKA 1HG5A 2X51A 4K0UA 1Z0PA 4QXBB 1NWMX 3PTRB 4GK5E 3R6NA 3SWHA 2KLQA 3C4WA 2ODVA 3CMLA 3B57A 3JC6C 2UXXB 1BR2A 3PUGA 3N2KE 3FBLA 5LG4A 3LJCA 3C4XA 3PURA 4IIJE 2K5BB 3M65A 2WMNA 3ZMSB 4BA9A 1MMNA 2XASB 3MA9A 2X9HA 3GWHA 5JR9B 1NAFA 4WBNE 3C50A 4XBFB 3HA4A 4YLHA 5LBMA 3DP7A 3O1HA 4H63V 5ADXL 2JPFA 3UUNA 2V26A 3PU3A 2XAJB 3OJAA 4AKRB 5DQWA 2N2NA 3RYCE 4CXXA 5HXHA 2NOXA 3CX8B 4ANJA 2E9XA 2JQQA 5DABA 1CUNA 5EK2A 1MIYA 5JRCA 3C51A 3MZKB 3TKLB 2PBIA 3C4ZA 1IZNB 3F57A 4HN9A 4KP3C 3Q5XA 4DBRA 4TV8E 1D1BA 4G2AA 4DNDA 3O1JA 2NTXA 1FMWA 2X9WA 4O4IE 4KMCA 4PNIA 2LOPA 2EHOD 5JQGE 4MALA 3GN5B 4EAHA 2NTYA 3RX6A 2D5UA 2W62A 3RRCA 4IE4A 4UV8B 4PJJA 3ZCJA 3ZN1B 2CEAA 3FXDB 3HKEE 4I50E 2IAKA 2E9XD 3ZJ1A 2XUEA 2NWBA 4UIGA 3LG7A 4FI5A 5LBQB 2NW9A 2Y48B 5FXZA 3EUHA 5LYJE 2LSGA 2YINA 3O1IA 2VKDA 4QXCB 3RKOA 4QX8B 5L3FB 4ZS3A 1G8XA 2WWUA 4PK6A 2CE7A 2DNXA 4H9NC 4YFSA 3EDVA 4AKIA 4I43B 2Q9QB 3N5LA 5FNVE 4MBQA 3PU8A 5FMNA 5H6RB 2D2SA 5FXWA 3KBUA 4ASKA 3ZYMA 2QA7A 2K24A 4UF0A 3EDUA 4UXNB 2D0UA 1BR1A 3V5SA 4X1YE 5C8YE 3LBXA 1WYBA 2JRKA 3C64A 4HFVA 4JEUB 2JJ9A 4ISTA 3ZMVB 3AA6B 2H3RA 2LT3A 3N9PA 2LSKA 2LM9A 1X79A 2ES0A 2KMFA 3A5XA 3ANWA 3K3NA 5LJMA 1BR0A 3QK6A 2BZBA 5EK3A 4AKHA 4UVBB 4BJMA 2YU2A 2YK0A 4O2BE 1YKHB 1KNZA 5M4YA 4GIWA 2CLYB 2M67A 5FY1A 5LHIB 4QWNB 3RPUA 1T98A 2KT9A 3U78A 3HR0A 4X1IE 2X0LB 2MYSA 2HPJA 3KBTA 4HKAA 5LGUB 3RC8A 3C98B 2KNDA 4YHJA 2K48A 4GK0E 1LKXA 1AJ3A 1VOMA 3P7IA 4WNKA 3NZPA 2VKHA 1U5PA 3O4XE 3MACA 1MNEA 3I1AA 1LVFA 1D0XA 1V9DA 3LFMA 4I4TE 5L3DB 3NBXX 2RA1A 4N78D 5CB4E 4CZZB 3CPZA 3BQKA 2DWGA 3CQCB 4JUYA 3QUJA 2CMRA 2P9BA 2H7OA 2NW8A 4PW8A 2GK9A 3UUMA 3ZPOA 5FYMA 2LSYA 1S94A 3N2GE 4OYKA 5LGTB 2LOSA 1EZ3A 2LEHA 3OBVE 3Q5WA 1US7B 2SPCA 2V7IA 2WBLA 1Y64B 4MLKA 4CQIA 1OWAA 4H63H 3I0OA 3I9WA 2IW5B 4IE7A 5JDFA 2XAFB 1HFAA 1YD8G 4NUUA 5JVDE 4UELA 4KBMB 2EHOA 2VKJA 3AVSA 2V7MA 4ZI3D 5LJNA 1FEWA 4JLEA 4ADZA 3HKDE 5CA1E 4UVCB 4UVAB 5HAXA 1LRZA 2CWOA 2C5KT 4L9IA 2JMHA 2L9QA 3PDYA 4AKLA 1D0YA 2Q9QA 2N1GA 2V7KA 2C5JA 3CKDA 3UUXB 3AA1B 4TV9E 3AA7B 5H6QB 3AA0B 5LOVE 3H37A 4UV9B 1UX5A 1B7TA 4F6RC 4AKGA 5LA6E 1IAPA 3P8CD 3NRYA 3VU7H 4PJLA 3RRWA 1HX8A 3ZN0B 3ZC1A 2RP4A 1MMAA 3KDSE 3ESLA 4CI2B 3WAJA 2A2FX 1MMDA 2A3DA 4P0BA 4TUYE 1O3XA 4ILUA 4EIWA 2KWHA 2HPLA 1MIWA 2DI4A 1HTJF 2Q9QD 3N9MA 2HH7A 2CXDA 1FMVA 4MHCA 4QXHB 3KFWX 3LK42 4U72A 4HEAA 2X9XA 3ZEFB 2X9YA 3VKHA 4L5GA 2W00A 4U74A 3RYHE 3V5UA 3J7Yq 5F3JA 4B6XA 2CXLA 1D0ZA 5LCYA 2WSSV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWK A;  4GIW A;  2CXF A;  2CXL A;  3CWZ B;  2DWG A; 
#chains in the Genus database with same CATH topology
 4YJ2 E;  4HE8 A;  5A1L A;  5LP6 E;  1X9B A;  3RI5 A;  4HFH A;  4JYA T;  3UQ7 A;  1M7K A;  5ABF B;  2H7V C;  2FUP A;  4ZI2 D;  4NUV A;  3QC9 A;  4COF A;  2E9X B;  4LML A;  3RQU A;  3O9X A;  2WZI A;  2J62 A;  4QX7 B;  2IC9 A;  4PFO A;  3E22 E;  3KV5 A;  2H88 A;  3EAB A;  2LHN A;  4QHO A;  2Z6E A;  3AEG A;  3UTK A;  5HCM A;  5HXR A;  1BR4 A;  4IE6 A;  2BG9 A;  2YOE A;  3CQG B;  4M1P A;  4GYR A;  5BR8 T;  1VCS A;  4L0R A;  3A7M A;  1Z8U A;  2IML A;  3EAM A;  2W63 A;  3CK6 A;  1YQ4 A;  4HFC A;  3IA3 A;  3GN5 A;  5LB7 B;  5L3C B;  2WMO A;  4DID B;  4DR7 T;  2YEV C;  4EYU A;  5AQO B;  5FY0 A;  4EOZ B;  3P4S A;  3OYX A;  3RLF F;  3T8O A;  3AXJ A;  3FZM B;  4A56 A;  5JTG A;  2BBH A;  3ZMU B;  2LJL A;  5TAO A;  5EK4 A;  2XQA A;  2UUA T;  5JDG A;  2J47 A;  2DCF A;  5L3B B;  5E0O A;  5BMV E;  2DLR A;  5HWY A;  3RF1 A;  4TN7 B;  3E0Z A;  5CJ5 A;  3OTO T;  2KIN B;  4EZ4 A;  5L3E B;  2ZM0 A;  4DO0 A;  4H9R C;  3OYZ A;  4ZI7 E;  3DJB A;  4V1A v;  3EI0 A;  3S4U A;  3J9X 1;  5LXT E;  4DUZ T;  4JEH B;  3UQ4 A;  2VWA A;  1G73 A;  2XAH B;  4LFB T;  5LGN B;  3IBP A;  2EHO B;  4TWF A;  3Q2M A;  1KK7 A;  5F5W A;  2MPK A;  2OA5 A;  4DR5 T;  4B3T T;  5AQH B;  1I94 T;  3N9O A;  3WAK A;  3ETV A;  5AFU L;  3N2O A;  3IHR A;  1N36 T;  2L8K A;  1HF8 A;  4O4J E;  3KV6 A;  2NP9 A;  4OK0 A;  5AQV B;  2QVA A;  4BAY B;  2WY2 A;  3ONJ A;  4LF9 T;  4CI3 B;  2MBG A;  4AQY T;  3SOL A;  4X65 T;  3PJA J;  3PUW F;  3FBZ A;  3RIF A;  3FB2 A;  3KVB A;  5AQL B;  4Q25 A;  4O4H E;  3RIU A;  1SE7 A;  5L2L A;  4H9O C;  4YJ3 E;  2X0Y A;  3SS1 A;  4IDZ A;  4ZI2 C;  2N9D A;  5JDN A;  1LVK A;  1UK5 A;  4K0U A;  3R6N A;  2KLQ A;  2ODV A;  3NKZ A;  2XQ9 A;  1BR2 A;  3PUG A;  3FBL A;  3C4X A;  2K5B B;  4BA9 A;  2X9H A;  3DP7 A;  4DV4 T;  4YY3 T;  3RYC E;  2MAW A;  2BG9 B;  1MIY A;  3MZK B;  1OED C;  3C4Z A;  4KP3 C;  4G2A A;  4DND A;  2X9W A;  4KMC A;  2EHO D;  3GN5 B;  3RX6 A;  4IE4 A;  2W4X A;  2WS3 A;  1W09 A;  2XUE A;  4UIG A;  4FI5 A;  2LSG A;  2YIN A;  5L3F B;  1G8X A;  4IDN A;  4X62 T;  2WWU A;  3AXJ B;  2CE7 A;  1UUS A;  4ASK A;  5C8Y E;  2JRK A;  2CRB A;  2JJ9 A;  4IST A;  3ZMV B;  2ES0 A;  3A5X A;  5LJM A;  4B3M T;  5EK3 A;  4AKH A;  1HNW T;  4BJM A;  3AE8 A;  4EEB A;  2BKO A;  4GIW A;  5FL1 A;  5FY1 A;  3LDQ B;  3U78 A;  2OV9 A;  4TWH A;  3HR0 A;  2X0L B;  4YHH T;  2MYS A;  5LGU B;  4YHJ A;  4YT0 A;  1E2A A;  1AJ3 A;  4WNK A;  2VKH A;  5HEG A;  4HFD A;  1LVF A;  1V9D A;  4CZZ B;  2DWG A;  3CQC B;  3TLV A;  2NW8 A;  3UUM A;  3ZPO A;  5FYM A;  3N2G E;  1KNR A;  3OBV E;  3Q5W A;  4CQI A;  2CPT A;  2XAF B;  3AE5 A;  5JVD E;  4KBM B;  3AVS A;  2V7M A;  2WDV A;  4ZI3 D;  5LJN A;  4HWC A;  1FEW A;  5CA1 E;  1LRZ A;  4L9I A;  2L9Q A;  4DV3 T;  2Q9Q A;  3P4P A;  2VVN A;  4AKG A;  3P8C D;  3RRW A;  3ZC1 A;  4TNV A;  4CI2 B;  3WAJ A;  2A2F X;  2A3D A;  4P0B A;  4EIW A;  2HPL A;  4LMK A;  2HHH T;  2X9Y A;  3VKH A;  4L5G A;  2W00 A;  3UFG A;  4DV6 T;  3ZLI A;  3B13 A;  2C5I T;  3OKQ A;  4EZH A;  3RIA A;  4P09 A;  1I6Z A;  4DV5 T;  4C90 A;  3RGL A;  5KX5 E;  4KUM B;  4P0A A;  4YXD A;  1XNR T;  5ABE A;  4EB6 E;  3PUQ A;  4KHP T;  2XHE B;  1HCI A;  4PFP A;  2V6Y A;  4AIU A;  2D0T A;  1W9R A;  3JC6 D;  1E1H B;  2EHO C;  3BK9 A;  4EXT A;  4JI8 T;  4O8S A;  1ZKE A;  5JDH A;  2ZMA A;  2ZM6 T;  4G63 A;  2D9D A;  2ACX A;  4DR2 T;  5JDQ A;  2ZM8 A;  4X1K E;  2QGS A;  1J5W A;  3L3P A;  4C91 A;  5J2U E;  3AE4 A;  5DJQ C;  5HEU A;  4LMJ A;  2BDE A;  2NW7 A;  2QRX A;  4OHF A;  4J2C A;  1IJ6 A;  4MFR A;  3N9N A;  4XAX B;  3E08 A;  3KV9 A;  1UX4 A;  3AAI A;  4E7Z A;  4DV1 T;  2C0S A;  4DR3 T;  3PUY F;  3PV0 F;  2WDQ A;  3K3O A;  5AQM B;  4F8H A;  2VK9 A;  3AEC A;  4AQF A;  1WRD A;  5J2T E;  1XMQ T;  3M3Z B;  3N9L A;  3ZMZ B;  2M6B A;  5LHH B;  4HWI B;  1FJG T;  3VRA A;  1M62 A;  3IEE A;  2XAQ B;  2XTL A;  3ZT5 A;  5JH7 E;  3FXE B;  5KMG P;  1MND A;  1QLB A;  3CX6 B;  3HL6 A;  3H3M A;  3RHW A;  4ZHQ E;  3AB3 B;  1D1A A;  2BG9 C;  2AE9 A;  1WR6 A;  3SRZ A;  4WW0 A;  4TZ4 C;  4ZI3 C;  4TNW A;  1WR0 A;  4QH4 A;  5AQF B;  3FZF B;  1UCU A;  2BS4 A;  4CXY A;  2UUC T;  1YW0 A;  1KEY A;  4HTE A;  3CIR A;  3NRX A;  3ZT6 A;  2IUB A;  4PAG A;  5JDM A;  4ZXL A;  3Q5E A;  4TX5 A;  2XSB A;  3Q5D A;  2V5D A;  2CBJ A;  3B5M A;  4HFB A;  4QH1 A;  5J1G A;  4X5T A;  3UFE A;  4U2Y A;  3MK7 C;  4DV0 T;  4IL4 A;  3UT5 E;  4E7S A;  4O2A E;  5HXC A;  4TWD A;  5ETW A;  4IRE A;  2IIU A;  2M6I A;  4OX9 T;  1ZHC A;  5HXS A;  5KXJ A;  5HWX A;  3P4W A;  3ZYL A;  2X66 A;  4DBQ A;  2CCQ A;  2PFV A;  1NEK A;  3SFD A;  1HG2 A;  4YTP A;  4OYJ A;  2V8S V;  3ETU A;  3VHL A;  5AQR B;  2X51 A;  1Z0P A;  3SWH A;  3C4W A;  4B3R T;  3JC6 C;  2V6Y B;  3PUR A;  1WFD A;  2WMN A;  1MMN A;  2WWV A;  2YDS A;  4XBF B;  4YLH A;  2R6G F;  4JI3 T;  4H63 V;  5DQW A;  3AE7 A;  3VR9 A;  1CUN A;  1T7S A;  5AQU B;  4JI2 T;  1IZN B;  3F57 A;  3Q5X A;  1D1B A;  3O1J A;  1FMW A;  1YQ3 A;  4PNI A;  4EAH A;  2D5U A;  3RRC A;  4UV8 B;  4PJJ A;  2X0H A;  3ZCJ A;  3ZN1 B;  4K0K T;  3FZL B;  2V5C A;  2W66 A;  2E9X D;  4HWF A;  5FXZ A;  2VKD A;  3LSV A;  3VR8 A;  4AKI A;  4A5X A;  4AIS A;  2BS2 A;  3N5L A;  4MBQ A;  5FXW A;  3KBU A;  2LKH A;  3ZYM A;  2K24 A;  4UF0 A;  5AQT B;  3EDU A;  1BR1 A;  4IDP A;  1HNX T;  3LBX A;  3NWI A;  4JEU B;  2LSK A;  2I6H A;  2YDR A;  3ANW A;  2CLY B;  5LHI B;  2HN2 A;  3AEE A;  2YN6 A;  3UU5 A;  2HPJ A;  3RC8 A;  3C98 B;  4GK0 E;  3L8R A;  3P7I A;  1J1J A;  2IHR 1;  3NZP A;  4IDO A;  3O4X E;  5HEJ A;  3ONL C;  4I4T E;  2RA1 A;  4N78 D;  2XM2 A;  5CB4 E;  4U3C A;  2WDR A;  2BKP A;  4PW8 A;  4IT4 A;  2LSY A;  1S94 A;  5LGT B;  4ZEY A;  2I0M A;  2VQF T;  1OWA A;  2FJE A;  5JDF A;  3RKG A;  1HFA A;  2H89 A;  1YD8 G;  4WZX A;  2VUR A;  4ADZ A;  4CN4 A;  5HAX A;  3PDY A;  1D0Y A;  1JNR A;  3UUX B;  4JI1 T;  2XQ7 A;  2FJA A;  3AA0 B;  3H37 A;  4UV9 B;  2WU5 A;  5C3J A;  1UX5 A;  2BG9 E;  1B7T A;  4F6R C;  1IAP A;  3NRY A;  4PJL A;  1HX8 A;  3ZN0 B;  3KDS E;  3ESL A;  3AE9 A;  2OLT A;  2KWH A;  2DI4 A;  3N9M A;  2HH7 A;  2CXD A;  1FMV A;  5HEH A;  3KFW X;  4U72 A;  3UU4 A;  3ZEF B;  3SFE A;  4HWD A;  3V5U A;  3TLS A;  4ZZC A;  1KNP A;  2XPK A;  5CA0 E;  2F4V T;  2YDQ A;  4NXN T;  2WM9 A;  2YU1 A;  4H9Q C;  4PJM A;  3L39 A;  4NPP A;  3T1Y T;  2L3L A;  2WB5 A;  3D0T A;  3UUL A;  2VB6 A;  2W0G A;  3AE6 A;  2E8I A;  3NZQ A;  5L47 A;  2VQE T;  5JR9 A;  3W15 B;  3QNU A;  3F31 A;  2E5V A;  1OED A;  2ACZ A;  3PUS A;  3RYF E;  3F2E A;  4LF7 T;  3LK3 B;  5FVL A;  2E9X C;  3CQX C;  3HI2 A;  3K3Q C;  3P4Q A;  1R8I A;  4I0U A;  1KF6 A;  4QH5 A;  2XAG B;  2JIW A;  2ODU A;  1SHZ C;  2ZLY A;  2JMK A;  2WP9 A;  3AEF A;  3EVY A;  3FHN A;  4UF0 B;  4U33 A;  3HKC E;  3LBX B;  2BVM A;  4ZOL E;  3ANW B;  1WLX A;  2XJ7 A;  1HNZ T;  4GKJ T;  4AI6 A;  3K8P C;  2CA5 A;  4ZS2 A;  3HKB E;  1QUU A;  2CXF A;  2V7J A;  3CX7 B;  2JQ9 A;  2WU2 A;  2PJQ A;  5AQP B;  4PK5 A;  3QOF A;  2DL1 A;  4DMV A;  4YSZ A;  3RH3 A;  2AXD S;  2KWI B;  4GYS A;  3JAE A;  3AVR A;  3Q9D A;  4QKN A;  4WBO A;  2XSA A;  1WCR A;  2NR4 A;  1VCT A;  5IWA T;  2LSJ A;  2X68 A;  2IC6 A;  5AQN B;  4CI1 B;  4DR6 T;  4Z91 A;  3JAF A;  2JQK A;  2XQY A;  3G06 A;  5L3G B;  5DQV A;  2G0U A;  1YKE B;  1HX1 B;  5L4H A;  2A9U A;  1FIO A;  1UGO A;  5IYZ E;  1IJ5 A;  2BVL A;  4A97 A;  3RC3 A;  3OPC A;  2B76 A;  5FP3 A;  4Z8X A;  5HXE A;  4I55 E;  3DTO A;  2DHR A;  3ZKR A;  2J1D G;  2XZE A;  3I9Y A;  4PK4 A;  4IHJ E;  3MJX A;  3I0Q A;  3WI3 A;  4AQF C;  3BQL A;  2LSI A;  3ZC0 A;  5AQJ B;  5L4E A;  3TLW A;  2UXN B;  4EV6 A;  3CVR A;  4HGA A;  2CLY C;  4PJN A;  2QYW A;  4IGU A;  5J0Z A;  1JNZ A;  1E7P A;  1UUR A;  1HG5 A;  4QXB B;  1NWM X;  3PTR B;  4GK5 E;  3B57 A;  2UXX B;  4JV5 T;  3AEB A;  3N2K E;  5LG4 A;  4IIJ E;  3M65 A;  5ABH A;  4LF6 T;  3MA9 A;  5JR9 B;  3GWH A;  4WBN E;  3C50 A;  4NXM T;  5LBM A;  3O1H A;  2V26 A;  3PU3 A;  2XAJ B;  1XMO T;  2N2N A;  2NOX A;  3CX8 B;  4ANJ A;  4LF8 T;  2XQ4 A;  4UR9 A;  5AQS B;  5JRC A;  3TKL B;  2PBI A;  4DBR A;  4TV8 E;  2FBW A;  4KI0 F;  4MAL A;  2NTY A;  3QB5 A;  2BKN A;  2CEA A;  3HKE E;  3LG7 A;  2Y48 B;  3EUH A;  2V6X A;  3JAD A;  5LYJ E;  4QXC B;  4ZS3 A;  4PK6 A;  2LLY A;  3EDV A;  4I43 B;  2Q9Q B;  3FZH B;  5FNV E;  5FMN A;  1IBK T;  1DU2 A;  2QA7 A;  3V5S A;  2D0U A;  2RPA A;  1ZOY A;  4X1Y E;  5AQK B;  4DR1 T;  2W2U A;  3C64 A;  4HFV A;  3N9P A;  1X79 A;  2KMF A;  5C2T A;  4JI5 T;  2BZB A;  4UVB B;  4B3S T;  2YU2 A;  2YK0 A;  4O2B E;  4U7Y A;  2M67 A;  4X64 T;  1ZP0 A;  3RPU A;  2WCA A;  3KBT A;  4HKA A;  3OVU A;  1LKX A;  1VOM A;  1SUM B;  4IDQ A;  3TLT A;  3MAC A;  1MNE A;  3LFM A;  3NBX X;  4NIQ A;  3CPZ A;  3BQK A;  4JUY A;  3QUJ A;  2CMR A;  4LF4 T;  2H7O A;  1W0A A;  3AED A;  1Y64 B;  3JCF A;  4HFE A;  4UEL A;  2VKJ A;  3HKD E;  4UVC B;  3UU3 A;  1XDO A;  2CWO A;  2C5K T;  4AKL A;  2C5J A;  4TV9 E;  3AA7 B;  5LOV E;  5LA6 E;  4GKK T;  1XZY A;  3VU7 H;  2RP4 A;  4TUY E;  4LFA T;  1O3X A;  4ILU A;  3ABV A;  1MIW A;  1HTJ F;  2Q9Q D;  4MHC A;  3LK4 2;  4HEA A;  4YTN A;  1HR0 T;  5HCJ A;  4U74 A;  2UXC T;  3J7Y q;  5LCY A;  3RQW A;  3T1H T;  2WSS V;  3RIU C;  2XQ8 A;  1GQE A;  4CXW A;  5LHG B;  2CBI A;  4AXP A;  1WYC A;  4IE5 A;  4UEM A;  5FKY A;  3PUV F;  5LMU T;  2K3W A;  4DV7 T;  5JRE A;  5GON E;  1S35 A;  5LMN T;  3BQI A;  4DMW A;  5FXV A;  1MMG A;  5JRC B;  2J4G A;  1YXR A;  4DUY T;  2B1E A;  3PUX F;  2XQ3 A;  2LM2 A;  3U3I A;  3P50 A;  5LNK A;  4JBW F;  1QSD A;  3MXZ A;  3KVA A;  2VL8 A;  2W61 A;  2K9A A;  2MTQ A;  5IUX A;  3KIN B;  4EGW A;  1HS7 A;  1NEN A;  3AEA A;  3MKD A;  5F8P A;  1IBL T;  2ZM2 A;  4ERR A;  3L09 A;  5ABG A;  3AAE B;  3VKG A;  3GA8 A;  5EZY E;  2CHN A;  4GOU A;  3CWZ B;  4DVD A;  4JI7 T;  3LK2 B;  3AE1 A;  4H9S E;  1IBM T;  4IL9 A;  3ZCI A;  3ZMT B;  2Y6X A;  4DV2 T;  2FJB A;  1SA0 E;  4OFZ A;  2VVS A;  1ZV4 X;  5AQI B;  1D1C A;  2MOZ A;  4CN1 A;  1U4Q A;  4H9P C;  5KDM C;  1T72 A;  3ZJ2 A;  4Z90 A;  3R84 B;  2UXB T;  2DWK A;  3RYI E;  4AQG A;  2LE8 A;  3X1D A;  2PTF A;  1VRB A;  2XQ6 A;  5LG3 A;  2V1D B;  5JDL A;  2CWY A;  2A72 A;  4HFI A;  5FY7 A;  4U31 A;  4X20 E;  2KXP B;  5HYA A;  5JR9 C;  5FXX A;  3VRB A;  2UUB T;  3ONX A;  3PE0 A;  2XQ5 A;  2LKG A;  2LHR A;  4FJO A;  2Y8D A;  2W67 A;  4X66 T;  4EYY R;  4P1N A;  2VAS A;  2HN1 A;  3TLU A;  2XY8 B;  2IDO B;  3QB5 K;  1H7C A;  2E2A A;  2CM0 A;  3KV4 A;  4ZZB A;  1T8B A;  3ZYK A;  3PUZ F;  3AAA B;  3GMI A;  2UXD T;  1ZEE A;  1XNQ T;  3IF8 B;  2I59 A;  4IE0 A;  2LRL A;  2JQH A;  5CFB A;  3N9Q A;  2PG8 A;  2Q9Q C;  2VL0 A;  2BS3 A;  3EHZ A;  2E5L T;  2KZ7 B;  2YKS A;  4XZC A;  4BJN A;  5AQQ B;  1MIV A;  4KX6 A;  2WAU A;  2X67 A;  3H3A A;  4YSX A;  4ISS A;  4YSY A;  1XWM A;  2V7L A;  3PUA A;  5FVK A;  3PJA A;  4O4L E;  1OXZ A;  5IHY A;  2VKO A;  3A8Y C;  2KSR A;  3CML A;  1J5E T;  4YTM A;  4A98 A;  4ILC A;  3LJC A;  1L0V A;  3ZMS B;  2XAS B;  1NAF A;  3HA4 A;  2XM1 A;  5ABF A;  5ADX L;  2JPF A;  3UUN A;  3OJA A;  4AKR B;  4CXX A;  5HXH A;  2E9X A;  2JQQ A;  5DAB A;  5EK2 A;  4DR4 T;  3C51 A;  4HN9 A;  4KHZ F;  5CGM A;  2NTX A;  3P4R A;  4O4I E;  2LOP A;  5JQG E;  2W62 A;  2LRK A;  4JI0 T;  3FXD B;  4I50 E;  2IAK A;  3ZJ1 A;  2NWB A;  3ZSS A;  5LBQ B;  2NW9 A;  3O1I A;  3RKO A;  4QX8 B;  2DNX A;  4H9N C;  4YFS A;  4U2Z A;  3K1S A;  3PU8 A;  5H6R B;  2D2S A;  5HEO A;  4UXN B;  1WYB A;  3NVO A;  3AA6 B;  2H3R A;  2CHO A;  2LT3 A;  2LM9 A;  3K3N A;  1BR0 A;  3QK6 A;  4JI6 T;  1YKH B;  1KNZ A;  5M4Y A;  4QWN B;  3AE3 A;  1T98 A;  2KT9 A;  3ZST A;  4LFC T;  4X1I E;  2KND A;  2K48 A;  3UUB A;  3FZK B;  1N32 T;  1U5P A;  3ZT7 A;  3I1A A;  1D0X A;  5L3D B;  4WYV A;  5AQG B;  5FL0 A;  3AE2 A;  1Y01 A;  2P9B A;  2BBJ A;  1XDP A;  2GK9 A;  4OYK A;  2LOS A;  1EZ3 A;  2LEH A;  1US7 B;  2SPC A;  2WQY A;  2V7I A;  2WZH A;  2WBL A;  4MLK A;  4H63 H;  3I0O A;  3I9W A;  2IW5 B;  4IE7 A;  1OED B;  2FJD A;  4CN6 A;  4NUU A;  3UU6 A;  3UU8 A;  2EHO A;  4ILA A;  4ILB A;  1OED E;  4JLE A;  2UU9 T;  4UVA B;  2JMH A;  1W0B A;  2N1G A;  2V7K A;  4EED A;  3CKD A;  3AA1 B;  5H6Q B;  1KFY A;  1N33 T;  1N34 T;  4HWH A;  1CHU A;  1MMA A;  1MMD A;  4JI4 T;  4QXH B;  2X9X A;  4LF5 T;  3RYH E;  5F3J A;  4B6X A;  2CXL A;  4U7I A;  1D0Z A; 
#chains in the Genus database with same CATH homology
 3ZLI A;  3B13 A;  2C5I T;  4CXW A;  5LHG B;  4AXP A;  4YJ2 E;  3OKQ A;  4HE8 A;  1WYC A;  4IE5 A;  4EZH A;  5A1L A;  5CA0 E;  5LP6 E;  4UEM A;  4P09 A;  2WM9 A;  2YU1 A;  4H9Q C;  4PJM A;  2L3L A;  4C90 A;  5KX5 E;  5JRE A;  4KUM B;  5GON E;  4P0A A;  2H7V C;  1S35 A;  3D0T A;  4EB6 E;  3PUQ A;  3UUL A;  2XHE B;  1HCI A;  4ZI2 D;  4NUV A;  2VB6 A;  2W0G A;  3QC9 A;  2E9X B;  3BQI A;  4PFP A;  4DMW A;  5FXV A;  3O9X A;  2E8I A;  3NZQ A;  1MMG A;  2D0T A;  5JRC B;  3JC6 D;  4QX7 B;  1E1H B;  5JR9 A;  2B1E A;  3W15 B;  2IC9 A;  2EHO C;  3BK9 A;  3F31 A;  4EXT A;  3U3I A;  3PUS A;  4O8S A;  4PFO A;  3RYF E;  3F2E A;  5LNK A;  1ZKE A;  1QSD A;  3MXZ A;  3E22 E;  3KV5 A;  3LK3 B;  3KVA A;  2VL8 A;  2W61 A;  2K9A A;  2LHN A;  2E9X C;  2MTQ A;  2Z6E A;  4QHO A;  3UTK A;  5JDH A;  3CQX C;  3HI2 A;  3K3Q C;  3KIN B;  1HS7 A;  5HXR A;  1BR4 A;  4IE6 A;  3MKD A;  3CQG B;  4M1P A;  4GYR A;  5F8P A;  2ZMA A;  2ZM2 A;  4ERR A;  3L09 A;  4G63 A;  2ACX A;  4L0R A;  2XAG B;  2W63 A;  5JDQ A;  3AAE B;  2ZM8 A;  2ODU A;  3VKG A;  3GA8 A;  1SHZ C;  3GN5 A;  4X1K E;  2QGS A;  5EZY E;  2ZLY A;  5L3C B;  3L3P A;  4C91 A;  5J2U E;  2WMO A;  4GOU A;  5DJQ C;  3CWZ B;  4DVD A;  2JMK A;  2BDE A;  2NW7 A;  3LK2 B;  3EVY A;  4OHF A;  3FHN A;  4J2C A;  4UF0 B;  1IJ6 A;  3HKC E;  4H9S E;  2YEV C;  4EYU A;  4MFR A;  3N9N A;  4XAX B;  3LBX B;  3E08 A;  2BVM A;  5FY0 A;  3KV9 A;  4EOZ B;  3ZCI A;  1UX4 A;  4ZOL E;  3ZMT B;  2Y6X A;  3AAI A;  3OYX A;  3ANW B;  4E7Z A;  3T8O A;  1SA0 E;  1WLX A;  2C0S A;  1ZV4 X;  4OFZ A;  1D1C A;  2MOZ A;  1U4Q A;  4H9P C;  5KDM C;  4AI6 A;  3K8P C;  3ZJ2 A;  4A56 A;  3K3O A;  3R84 B;  2CA5 A;  3ZMU B;  4ZS2 A;  2DWK A;  3HKB E;  2LJL A;  1QUU A;  3RYI E;  4AQG A;  5TAO A;  2LE8 A;  2VK9 A;  2CXF A;  1VRB A;  5EK4 A;  4AQF A;  2V1D B;  1WRD A;  5J2T E;  2V7J A;  3N9L A;  5JDG A;  3ZMZ B;  5JDL A;  2CWY A;  2A72 A;  5LHH B;  3CX7 B;  2DCF A;  5FY7 A;  5L3B B;  2PJQ A;  5E0O A;  5BMV E;  3IEE A;  2KXP B;  2DLR A;  4X20 E;  5HYA A;  5JR9 C;  5HWY A;  2XAQ B;  5FXX A;  2XTL A;  4PK5 A;  5JH7 E;  4TN7 B;  3E0Z A;  3ONX A;  4DMV A;  3PE0 A;  2KIN B;  3FXE B;  4EZ4 A;  5L3E B;  5KMG P;  3RH3 A;  1MND A;  2KWI B;  4GYS A;  3CX6 B;  2ZM0 A;  3HL6 A;  4DO0 A;  4H9R C;  4ZHQ E;  3AB3 B;  3AVR A;  3OYZ A;  4ZI7 E;  3DJB A;  1D1A A;  3Q9D A;  4QKN A;  4V1A v;  2LHR A;  4FJO A;  4WBO A;  1WR6 A;  4WW0 A;  2Y8D A;  3S4U A;  3SRZ A;  3J9X 1;  5LXT E;  4EYY R;  4JEH B;  2VAS A;  4TZ4 C;  2LSJ A;  2VWA A;  2X68 A;  1G73 A;  2IC6 A;  2XAH B;  4CI1 B;  4ZI3 C;  5LGN B;  2XQY A;  3IBP A;  2EHO B;  1H7C A;  5L3G B;  3Q2M A;  1KK7 A;  2OA5 A;  2CM0 A;  3KV4 A;  1UCU A;  5DQV A;  4CXY A;  1YW0 A;  2G0U A;  1YKE B;  3ZYK A;  4HTE A;  3NRX A;  3N9O A;  3WAK A;  3ETV A;  4PAG A;  3AAA B;  3GMI A;  5AFU L;  5JDM A;  3N2O A;  3IHR A;  1FIO A;  1ZEE A;  5IYZ E;  2L8K A;  3IF8 B;  1HF8 A;  4TX5 A;  1IJ5 A;  2I59 A;  4O4J E;  4IE0 A;  3KV6 A;  2NP9 A;  4OK0 A;  4BAY B;  2BVL A;  3RC3 A;  4CI3 B;  3N9Q A;  5FP3 A;  5J1G A;  2PG8 A;  4Z8X A;  3UFE A;  2Q9Q C;  2MBG A;  5HXE A;  4I55 E;  3DTO A;  2DHR A;  2J1D G;  3SOL A;  2KZ7 B;  3I9Y A;  4PK4 A;  4XZC A;  4IHJ E;  4BJN A;  3MK7 C;  3MJX A;  1MIV A;  3FBZ A;  3I0Q A;  3WI3 A;  4AQF C;  3BQL A;  2LSI A;  3UT5 E;  3FB2 A;  4E7S A;  4O2A E;  3ZC0 A;  2WAU A;  2X67 A;  3H3A A;  3KVB A;  5HXC A;  5ETW A;  4ISS A;  1ZHC A;  2UXN B;  5HXS A;  4O4H E;  2V7L A;  3CVR A;  4HGA A;  2CLY C;  4PJN A;  5HWX A;  3ZYL A;  4DBQ A;  2X66 A;  3PUA A;  2CCQ A;  2PFV A;  5L2L A;  4O4L E;  4H9O C;  1OXZ A;  4IGU A;  1HG2 A;  4YJ3 E;  5IHY A;  3SS1 A;  4IDZ A;  2VKO A;  4OYJ A;  4ZI2 C;  3ETU A;  2N9D A;  3VHL A;  5JDN A;  1LVK A;  1HG5 A;  2X51 A;  4K0U A;  1Z0P A;  4QXB B;  1NWM X;  3PTR B;  4GK5 E;  3R6N A;  3SWH A;  2KLQ A;  3C4W A;  2ODV A;  3CML A;  3B57 A;  3JC6 C;  2UXX B;  1BR2 A;  3PUG A;  3N2K E;  3FBL A;  5LG4 A;  3LJC A;  3C4X A;  3PUR A;  4IIJ E;  2K5B B;  3M65 A;  2WMN A;  3ZMS B;  4BA9 A;  1MMN A;  2XAS B;  3MA9 A;  2X9H A;  3GWH A;  5JR9 B;  1NAF A;  4WBN E;  3C50 A;  4XBF B;  3HA4 A;  4YLH A;  5LBM A;  3DP7 A;  3O1H A;  4H63 V;  5ADX L;  2JPF A;  3UUN A;  2V26 A;  3PU3 A;  2XAJ B;  3OJA A;  4AKR B;  5DQW A;  2N2N A;  3RYC E;  4CXX A;  5HXH A;  2NOX A;  3CX8 B;  4ANJ A;  2E9X A;  2JQQ A;  5DAB A;  1CUN A;  5EK2 A;  1MIY A;  5JRC A;  3C51 A;  3MZK B;  3TKL B;  2PBI A;  3C4Z A;  1IZN B;  3F57 A;  4HN9 A;  4KP3 C;  3Q5X A;  4DBR A;  4TV8 E;  1D1B A;  4G2A A;  4DND A;  3O1J A;  2NTX A;  1FMW A;  2X9W A;  4O4I E;  4KMC A;  4PNI A;  2LOP A;  2EHO D;  5JQG E;  4MAL A;  3GN5 B;  4EAH A;  2NTY A;  3RX6 A;  2D5U A;  2W62 A;  3RRC A;  4IE4 A;  4UV8 B;  4PJJ A;  3ZCJ A;  3ZN1 B;  2CEA A;  3FXD B;  3HKE E;  4I50 E;  2IAK A;  2E9X D;  3ZJ1 A;  2XUE A;  2NWB A;  4UIG A;  3LG7 A;  4FI5 A;  5LBQ B;  2NW9 A;  2Y48 B;  5FXZ A;  3EUH A;  5LYJ E;  2LSG A;  2YIN A;  3O1I A;  2VKD A;  4QXC B;  3RKO A;  4QX8 B;  5L3F B;  4ZS3 A;  1G8X A;  2WWU A;  4PK6 A;  2CE7 A;  2DNX A;  4H9N C;  4YFS A;  3EDV A;  4AKI A;  4I43 B;  2Q9Q B;  3N5L A;  5FNV E;  4MBQ A;  3PU8 A;  5FMN A;  5H6R B;  2D2S A;  5FXW A;  3KBU A;  4ASK A;  3ZYM A;  2QA7 A;  2K24 A;  4UF0 A;  3EDU A;  4UXN B;  2D0U A;  1BR1 A;  3V5S A;  4X1Y E;  5C8Y E;  3LBX A;  1WYB A;  2JRK A;  3C64 A;  4HFV A;  4JEU B;  2JJ9 A;  4IST A;  3ZMV B;  3AA6 B;  2H3R A;  2LT3 A;  3N9P A;  2LSK A;  2LM9 A;  1X79 A;  2ES0 A;  2KMF A;  3A5X A;  3ANW A;  3K3N A;  5LJM A;  1BR0 A;  3QK6 A;  2BZB A;  5EK3 A;  4AKH A;  4UVB B;  4BJM A;  2YU2 A;  2YK0 A;  4O2B E;  1YKH B;  1KNZ A;  5M4Y A;  4GIW A;  2CLY B;  2M67 A;  5FY1 A;  5LHI B;  4QWN B;  3RPU A;  1T98 A;  2KT9 A;  3U78 A;  3HR0 A;  4X1I E;  2X0L B;  2MYS A;  2HPJ A;  3KBT A;  4HKA A;  5LGU B;  3RC8 A;  3C98 B;  2KND A;  4YHJ A;  2K48 A;  4GK0 E;  1LKX A;  1AJ3 A;  1VOM A;  3P7I A;  4WNK A;  3NZP A;  2VKH A;  1U5P A;  3O4X E;  3MAC A;  1MNE A;  3I1A A;  1LVF A;  1D0X A;  1V9D A;  3LFM A;  4I4T E;  5L3D B;  3NBX X;  2RA1 A;  4N78 D;  5CB4 E;  4CZZ B;  3CPZ A;  3BQK A;  2DWG A;  3CQC B;  4JUY A;  3QUJ A;  2CMR A;  2P9B A;  2H7O A;  2NW8 A;  4PW8 A;  2GK9 A;  3UUM A;  3ZPO A;  5FYM A;  2LSY A;  1S94 A;  3N2G E;  4OYK A;  5LGT B;  2LOS A;  1EZ3 A;  2LEH A;  3OBV E;  3Q5W A;  1US7 B;  2SPC A;  2V7I A;  2WBL A;  1Y64 B;  4MLK A;  4CQI A;  1OWA A;  4H63 H;  3I0O A;  3I9W A;  2IW5 B;  4IE7 A;  5JDF A;  2XAF B;  1HFA A;  1YD8 G;  4NUU A;  5JVD E;  4UEL A;  4KBM B;  2EHO A;  2VKJ A;  3AVS A;  2V7M A;  4ZI3 D;  5LJN A;  1FEW A;  4JLE A;  4ADZ A;  3HKD E;  5CA1 E;  4UVC B;  4UVA B;  5HAX A;  1LRZ A;  2CWO A;  2C5K T;  4L9I A;  2JMH A;  2L9Q A;  3PDY A;  4AKL A;  1D0Y A;  2Q9Q A;  2N1G A;  2V7K A;  2C5J A;  3CKD A;  3UUX B;  3AA1 B;  4TV9 E;  3AA7 B;  5H6Q B;  3AA0 B;  5LOV E;  3H37 A;  4UV9 B;  1UX5 A;  1B7T A;  4F6R C;  4AKG A;  5LA6 E;  1IAP A;  3P8C D;  3NRY A;  3VU7 H;  4PJL A;  3RRW A;  1HX8 A;  3ZN0 B;  3ZC1 A;  2RP4 A;  1MMA A;  3KDS E;  3ESL A;  4CI2 B;  3WAJ A;  2A2F X;  1MMD A;  2A3D A;  4P0B A;  4TUY E;  1O3X A;  4ILU A;  4EIW A;  2KWH A;  2HPL A;  1MIW A;  2DI4 A;  1HTJ F;  2Q9Q D;  3N9M A;  2HH7 A;  2CXD A;  1FMV A;  4MHC A;  4QXH B;  3KFW X;  3LK4 2;  4U72 A;  4HEA A;  2X9X A;  3ZEF B;  2X9Y A;  3VKH A;  4L5G A;  2W00 A;  4U74 A;  3RYH E;  3V5U A;  3J7Y q;  5F3J A;  4B6X A;  2CXL A;  1D0Z A;  5LCY A;  2WSS V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...