2EHOB

Crystal structure of human gins complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords GINS complex subunit 4
publication title Crystal structure of the human GINS complex
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 145
sequence length 145
chains with identical sequence F, J
ec nomenclature
pdb deposition date 2007-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ehoB01
2Q9QC 2E9XA 2EHOA 2Q9QB 2EHOB 3JC6D 3ANWA 2E9XD
chains in the Genus database with same CATH superfamily
4GYRA 1HFAA 4UVCB 3ZSSA 2E2AA 5JRCB 3NRYA 5L3DB 4DR1T 2HHHT 4NXMT 3MZKB 4AQFA 2VVNA 3F57A 4DVDA 2IMLA 4OYKA 4O4JE 3QUJA 3AA7B 4MHCA 4QHOA 2MAWA 1XMOT 2IAKA 1HG2A 4ISTA 2BVLA 3D0TA 3NZPA 5LJMA 1UURA 2YKSA 5AFUL 2J62A 3RX6A 3CQGB 5JH7E 1YXRA 4WBNE 3RRWA 4PK4A 3RIUC 3SFDA 1LKXA 3PJAJ 5FMNA 3AEDA 1WFDA 3RI5A 3QOFA 2V26A 4TNVA 3ZPOA 4LF6T 4OYJA 4P1NA 5JREA 3EDVA 3UQ4A 2K9AA 2DLRA 1HNWT 2M6BA 5LNKA 3O1HA 4LF8T 3VKHA 2LEHA 5C3JA 2XQ7A 3IBPA 4DUYT 2LKGA 2CWYA 3L3PA 5LP6E 2XQ5A 5J2TE 2XAJB 1J1JA 2X0HA 3V5UA 4DV1T 3H37A 2XQ4A 4UV9B 3B13A 2LKHA 1YW0A 2N1GA 4EB6E 4X5TA 4B3ST 4ZI3C 3P50A 3TLTA 3KV6A 2L9QA 2WWVA 4A97A 3C98B 4JI3T 3LFMA 5KDMC 2VKOA 3RKGA 4X1KE 3HKBE 2XM2A 3FZFB 4MLKA 3VR9A 1XNRT 3JC6C 4DV0T 2BG9C 4PFPA 3VKGA 5FKYA 5EK4A 1AJ3A 2HN1A 4A56A 2IIUA 4YXDA 2XY8B 3E0ZA 2HH7A 3GN5A 5KXJA 4PNIA 5FXVA 1LVKA 4UVBB 3UUXB 5LGNB 4YTNA 2G0UA 4TWDA 3O1JA 2Y6XA 4PJJA 4CI2B 3C4XA 3PUAA 3UUMA 1OEDC 4NPPA 2WDRA 2Q9QD 2ZMAA 3IEEA 2LSJA 2UXNB 4O2BE 5FXZA 3RYFE 5AQNB 3LG7A 3KV4A 2BS3A 5ETWA 2XQYA 3QNUA 3V5SA 4ZS3A 1W09A 2YEVC 3KV9A 5ABHA 1UX5A 2DWGA 1MNDA 4CN1A 2WDQA 3AE5A 2B76A 3ZJ2A 2A72A 5J2UE 1MNEA 3DTOA 3ZKRA 4DNDA 5LMNT 2C5JA 5AQOB 3UU8A 3ZMSB 1SHZC 5LHGB 4UF0A 3E22E 4U31A 2XM1A 2C0SA 3L09A 1XDOA 3TLUA 3Q2MA 4JI4T 4ZS2A 3H3AA 2WMNA 5C8YE 3ZLIA 3VU7H 2F4VT 3CKDA 2LT3A 4PJNA 3AXJA 4XZCA 3AA0B 4OX9T 3VRAA 4HFIA 2E9XB 1B7TA 3RF1A 2EHOC 3OYZA 4DMVA 2V8SV 3AECA 3CX7B 5JDQA 2IC9A 5L3BB 1W0AA 2AE9A 3K1SA 1KK7A 2M67A 4KP3C 3UU3A 3ABVA 1U5PA 2LE8A 1D1AA 2BBHA 2C5KT 3HKDE 3R84B 2XAGB 3EAMA 1OEDE 3PURA 2NW9A 2E5VA 5EK3A 2V7IA 2XQ9A 3ZYLA 2D0UA 2IW5B 3ANWA 3N2KE 1E7PA 4BA9A 4EYUA 5LHHB 2X9YA 5L4HA 5AQPB 4YSYA 3W15B 2FJDA 4MFRA 3RPUA 2OV9A 2WCAA 1JNZA 2JQ9A 4ISSA 2PG8A 3BK9A 2V5DA 3UU6A 2PTFA 1HF8A 4JI7T 4ILAA 1HX1B 3MACA 3C50A 4IGUA 2X0YA 3DJBA 3ZYKA 5LGUB 1HX8A 5H6QB 4GK0E 5IHYA 2D0TA 3P4WA 5LHIB 4C91A 4DIDB 2NP9A 2WWUA 3M3ZB 1HNXT 3LBXA 3ZJ1A 5CJ5A 3MK7C 4CN6A 4JI0T 2MYSA 4X1YE 4KMCA 3C64A 4HFVA 3C51A 1QLBA 1G8XA 2VB6A 4PFOA 2LM9A 2LSYA 4N78D 4TZ4C 4HFBA 1VOMA 1S94A 3MA9A 3NBXX 2ZM2A 4MBQA 2W63A 3FXDB 3LSVA 4L5GA 2IHR1 1HTJF 2CXLA 3AAAB 1E1HB 3QK6A 5HCJA 1X9BA 5L4EA 3WAKA 1ZP0A 2DL1A 4CQIA 2GK9A 1KEYA 4H63H 2VL0A 4ANJA 5FL0A 3CIRA 1UK5A 2LHRA 1N36T 3TLWA 1CUNA 4YTMA 1HR0T 3ETVA 4J2CA 4WNKA 5FY0A 2D2SA 3PV0F 3ONLC 1IJ6A 5DJQC 3P4PA 3K3OA 2ACXA 4O4LE 2WQYA 3FXEB 3RC8A 3PUVF 5JDMA 2FJEA 4DV4T 2X9WA 5LYJE 2I0MA 2Q9QC 3BQIA 3ZN1B 2KWHA 4H9QC 2XQ3A 4DV6T 2E5LT 1QUUA 1XZYA 2BG9B 2KINB 3NKZA 4ZOLE 3P8CD 5CFBA 3U78A 2BDEA 4L0RA 2NWBA 3O4XE 5FVKA 4HEAA 1H7CA 2RPAA 3LJCA 1W0BA 2QVAA 5LG3A 2C5IT 4DMWA 2H7OA 5HXRA 1Z0PA 1S35A 4DV2T 4U74A 5HWYA 1BR2A 3SS1A 3ZMVB 4NUVA 4LMKA 4JUYA 1MMNA 1N32T 2V1DB 2WMOA 2XTLA 4JYAT 4B3RT 4H9OC 2K48A 3A7MA 2ACZA 3G06A 4DR6T 2ZM0A 1US7B 3N9OA 4GIWA 5JR9C 3OPCA 4ZEYA 3CPZA 2XAFB 5JRCA 4EEDA 4IIJE 4EIWA 5HEJA 2NW7A 1T98A 2UU9T 4GKKT 5CA0E 2RP4A 2V6YB 4I50E 3KINB 2VKDA 5L3FB 2QA7A 1O3XA 2W66A 4PK5A 2UXXB 3QB5K 2J1DG 1UGOA 2WS3A 2IUBA 4NIQA 4AQGA 4I0UA 1YD8G 5L3GB 2MBGA 4ASKA 2W4XA 2LJLA 2V7LA 4EYYR 2VQET 1WLXA 1UUSA 4U7YA 3CWZB 5JDNA 4U33A 4EZ4A 2IDOB 2LSKA 3F31A 4QXHB 2XHEB 1MIVA 5FNVE 4EOZB 2CLYB 4QX7B 1I6ZA 2CHOA 5FY1A 4LFCT 3UQ7A 4H9PC 2EHOB 3ZYMA 5L3EB 4HWCA 1WYCA 3FZHB 4XBFB 2LHNA 4UIGA 4X65T 5AQJB 4HWHA 2E9XD 4OHFA 1MIWA 4AQFC 3GWHA 2YK0A 3HKEE 4K0UA 5FVLA 3ZCJA 4I43B 2YU2A 4U3CA 3DP7A 4EZHA 4CZZB 3P4RA 5AQUB 4ZI2C 3U3IA 4AKRB 3KDSE 3AEAA 4UVAB 2CBIA 3AA6B 3FZLB 3L8RA 2D5UA 2LOPA 4IDNA 3ZSTA 2CXDA 4X64T 1ZV4X 5J0ZA 2ODUA 3CMLA 4U72A 1FJGT 1WYBA 2YDSA 4Z8XA 4FJOA 3SRZA 2OLTA 2R6GF 4JBWF 1VCSA 2VASA 4X62T 3ZMUB 1U4QA 3PUQA 2KXPB 5KMGP 2H89A 5LBMA 3PTRB 4H63V 4IDPA 2QRXA 3S4UA 4AKGA 2V6XA 4CI3B 1NEKA 3M65A 1T72A 2XQ6A 4YSZA 3Q5XA 1MIYA 3N2GE 3X1DA 4IHJE 3RC3A 2E8IA 1MMAA 3VR8A 4X20E 3ZEFB 4AKHA 5J1GA 4JI1T 4YJ2E 1IBKT 4JI6T 4QH4A 3I0QA 3O1IA 4OFZA 2VKHA 2WBLA 3EABA 2DNXA 4EGWA 2UXDT 2WU2A 2WU5A 4QXCB 4AXPA 5JTGA 3RQUA 4TNWA 2K24A 1BR1A 1FMWA 3Q9DA 1Y01A 4HFCA 1KNRA 3AE7A 3CX8B 2ZM8A 1J5WA 3QB5A 1E2AA 4UR9A 3UUBA 1SE7A 1D0YA 3P4QA 2MOZA 3R6NA 3KBUA 3KVAA 1N34T 4TUYE 5HAXA 2DCFA 4WYVA 2XAHB 4BAYB 4OK0A 1D1CA 2P9BA 5LMUT 1KF6A 3UTKA 1L0VA 2PFVA 1YQ3A 5LCYA 2CWOA 2X9HA 4DV7T 4TWFA 3HA4A 2HPJA 1I94T 3OTOT 3AE4A 3EDUA 4HE8A 3ETUA 4YHJA 4H9RC 2A3DA 5IWAT 2YDQA 2NW8A 4HFHA 2E9XA 4B6XA 2VURA 2XZEA 3FZKB 3CVRA 3ZCIA 5F8PA 1T7SA 3CQCB 3TLSA 2RA1A 2LM2A 2Q9QB 4Z91A 4ZI3D 2H88A 1HG5A 3N9QA 5HEOA 5AQVB 3EUHA 3UUNA 1YQ4A 3J7Yq 1XMQT 4YSXA 4AKIA 3CQXC 5HCMA 1IBMT 5M4YA 4QX8B 3HI2A 3FBZA 1UCUA 2K5BB 1HCIA 2KT9A 2FJAA 2SPCA 1OWAA 3ZMTB 4ILUA 1XWMA 5FXXA 3AEGA 4HFDA 3KV5A 4I55E 4LFBT 2XSBA 4DBRA 2N2NA 4E7ZA 3H3MA 4A5XA 4IDOA 4YHHT 1HNZT 1KNZA 3A5XA 3L39A 3RRCA 4ZXLA 5LBQB 3UFEA 3OVUA 5JR9B 5IYZE 3N9MA 2UXBT 2NOXA 5F5WA 2BKPA 2KZ7B 4TX5A 4MALA 2WZHA 3KBTA 2KWIB 3MKDA 1BR0A 2VVSA 5FXWA 3T1YT 2FUPA 4IE0A 1CHUA 2OA5A 4DV3T 4IDZA 2YU1A 5HEGA 4ERRA 4TWHA 3EI0A 3RYCE 5GONE 2WB5A 5ABFB 2N9DA 4C90A 1WR0A 2LRLA 4G63A 2JQHA 3PUWF 2IC6A 3AEFA 1OXZA 5FYMA 3RIUA 2JQQA 5AQIB 4E7SA 2E9XC 3N5LA 2X68A 3AE6A 3T8OA 5FP3A 3ONXA 3ZMZB 3MJXA 4ILBA 4CN4A 3VRBA 2I6HA 1BR4A 2NTXA 4QWNB 5JQGE 1FMVA 4YY3T 3N9NA 1LVFA 4HGAA 4F8HA 2XUEA 3J9X1 1M62A 5CGMA 4HWFA 2J4GA 1WCRA 3P7IA 2QGSA 4H9NC 3ONJA 2J47A 2Z6EA 4JI2T 5HXSA 2X66A 2V7MA 1VCTA 2LOSA 5LJNA 2D9DA 5LXTE 1FEWA 2MTQA 4ILCA 2DWKA 4DR2T 4LMJA 3OBVE 3AE9A 4HTEA 4G2AA 4YJ3E 3NZQA 5TAOA 1OEDB 2AXDS 3LDQB 4ZZCA 5A1LA 1ZEEA 4UXNB 3RIAA 4A98A 5FL1A 3P4SA 2JQKA 2BG9A 3OJAA 4L9IA 3FZMB 4M1PA 3K3QC 3EVYA 2CA5A 1W9RA 4AI6A 2WY2A 4JI5T 2KLQA 4UEMA 2WAUA 5AQQB 2WSSV 2ZLYA 4GOUA 3IF8B 1OEDA 1VRBA 5L47A 1UX4A 2KNDA 3AE2A 2Y8DA 1JNRA 4AISA 5JDLA 3QC9A 4U2YA 3ZT5A 3PU8A 1GQEA 3IHRA 4ZHQE 3NRXA 1T8BA 2ES0A 2DHRA 5HXEA 2NR4A 3RLFF 2VQFT 2HPLA 2X51A 4IE4A 2JIWA 1KFYA 3RH3A 3PDYA 3RYHE 3Q5EA 3MXZA 2XQAA 4O4IE 2V6YA 3IA3A 5EZYE 1R8IA 2K3WA 2YDRA 3GA8A 4PW8A 4EEBA 1HS7A 4YLHA 2ZM6T 4KHZF 5DQWA 1LRZA 4TN7B 4X66T 4DV5T 2CPTA 3GN5B 2KSRA 3N9LA 3ZN0B 3JCFA 3PE0A 4AQYT 3HKCE 2BS2A 4CXWA 1ZHCA 4PJMA 5H6RB 4U2ZA 2B1EA 4TV8E 4HWIB 3B5MA 4HFEA 3PJAA 3FBLA 2LLYA 4K0KT 3AA1B 3F2EA 2EHOA 3RGLA 4QH5A 4CXYA 4UV8B 3WAJA 2CRBA 5LOVE 4CI1B 3PUGA 5IUXA 3AE8A 1SUMB 2CEAA 3E08A 2M6IA 2UUAT 1ZKEA 3AB3B 5F3JA 4DR5T 2JJ9A 4GKJT 3AVRA 3RHWA 3UU5A 5BR8T 3JAFA 2A9UA 3AEBA 2PBIA 4IE5A 1MMGA 1ZOYA 3BQLA 3HL6A 5L3CB 5DQVA 2PJQA 2BVMA 2CM0A 2X0LB 2VKJA 3B57A 5C2TA 4YFSA 4UF0B 4IE7A 5HEHA 4O2AE 3K8PC 3BQKA 1NAFA 2BBJA 4DO0A 4KUMB 2W2UA 2H7VC 2WM9A 2CCQA 4DBQA 4Z90A 5L2LA 2I59A 3PUXF 4LMLA 1Z8UA 2XPKA 3Q5WA 2WDVA 1WR6A 3AAIA 3TLVA 4HKAA 3AXJB 1IZNB 1M7KA 5LB7B 1XDPA 5AQGB 3ZC0A 2H3RA 4V1Av 2NTYA 2V5CA 4NUUA 1N33T 4CXXA 3RKOA 3VHLA 2CMRA 2VL8A 2LRKA 2JPFA 2X9XA 4IDQA 4KHPT 3Q5DA 4PAGA 4U7IA 5ABGA 4UELA 1Y64B 3ZC1A 5ABEA 2UUCT 3AE3A 3OKQA 3K3NA 1D0ZA 2UXCT 3WI3A 4WZXA 2Y48B 3ZT7A 3LK42 4DR3T 2CLYC 3EHZA 1YKHB 3AAEB 3PUSA 4GYSA 3C4ZA 3OYXA 2LSGA 5AQMB 2BZBA 3SWHA 3PUZF 3ANWB 3RQWA 4Q25A 5KX5E 3AEEA 2BG9E 1NWMX 4ZI7E 1D1BA 5AQFB 4B3TT 3RIFA 2CBJA 4LF4T 4ZZBA 4P0AA 2QYWA 1D0XA 5LG4A 4EAHA 3CX6B 5BMVE 2W62A 4F6RC 4QXBB 4JV5T 2XSAA 1V9DA 2YINA 5AQKB 5AQLB 3C4WA 4JEUB 4WBOA 2L3LA 4ADZA 1G73A 4KI0F 4JI8T 4NXNT 5CB4E 4JEHB 4KBMB 4IE6A 3PU3A 2YOEA 5JDGA 2FJBA 1MMDA 4IL9A 2JMHA 3LBXB 2BKNA 3NWIA 3UFGA 3I9WA 3JC6D 3AVSA 3T1HT 2Q9QA 2DI4A 2JMKA 2VK9A 5ADXL 4DUZT 3TKLB 3ZT6A 3FHNA 3O9XA 3I1AA 4LFAT 3CK6A 2XASB 4ZI2D 3A8YC 4XAXB 5HXCA 4LF7T 1YKEB 3I9YA 4PK6A 1X79A 1WRDA 4P0BA 1EZ3A 4PJLA 4YT0A 1QSDA 2ODVA 3ESLA 2YN6A 2KMFA 5HXHA 2CHNA 3SOLA 1XNQT 4X1IE 2VWAA 4YTPA 4EXTA 5JDHA 2LSIA 5LA6E 2HN2A 1KNPA 3SFEA 1J5ET 5HYAA 5JR9A 3I0OA 2FBWA 4COFA 5CA1E 3RYIE 5JVDE 2BS4A 2JRKA 1DU2A 4HWDA 5AQRB 3LK2B 3UT5E 2XJ7A 3HR0A 4AKLA 5LGTB 4LF5T 2V7JA 5AQHB 5JDFA 2BKOA 2XAQB 4I4TE 1IBLT 2WP9A 2X67A 3LK3B 4KX6A 5EK2A 5ABFA 4EV6A 2MPKA 3N9PA 3AE1A 5AQTB 4JLEA 3FB2A 2UUBT 3NVOA 2WZIA 3UULA 4H9SE 3GMIA 4BJNA 4GK5E 1FIOA 4FI5A 2V7KA 2L8KA 4DR4T 4AIUA 3KFWX 4IREA 4HN9A 5AQSB 3KVBA 3JADA 5DABA 3N2OA 4QKNA 3UU4A 4TV9E 4BJMA 5HWXA 2W00A 2EHOD 2CXFA 2XQ8A 2CE7A 5HEUA 4IL4A 4B3MT 4O8SA 1IJ5A 4QH1A 3PUYF 4DR7T 1IAPA 1SA0E 5E0OA 2A2FX 2W61A 2W0GA 3JAEA 4LF9T 1NENA 2W67A 4IT4A 4WW0A 5FY7A 4O4HE 4P09A
chains in the Genus database with same CATH topology
2B1EA 4TV8E 4GYRA 1HFAA 4UVCB 4KMCA 3C64A 4HFVA 3C51A 1D0YA 3FBLA 5JRCB 3NRYA 2MOZA 3R6NA 3KBUA 5L3DB 1G8XA 3KVAA 2VB6A 4PFOA 3MZKB 4AQFA 2LM9A 4TUYE 2LSYA 4N78D 5HAXA 2DCFA 3F57A 4TZ4C 4DVDA 3AA1B 1VOMA 1S94A 2XAHB 3F2EA 3MA9A 4OYKA 3NBXX 2ZM2A 4OK0A 4BAYB 4MBQA 2EHOA 2W63A 1D1CA 3FXDB 4O4JE 4CXYA 2P9BA 4L5GA 3QUJA 3AA7B 4UV8B 3UTKA 3WAJA 4MHCA 1HTJF 4QHOA 2CXLA 5LOVE 2PFVA 4CI1B 2IAKA 3PUGA 1HG2A 5LCYA 2CWOA 3AAAB 4ISTA 2X9HA 2BVLA 1E1HB 3D0TA 2CEAA 3HA4A 2HPJA 3NZPA 3QK6A 5AFUL 5LJMA 3E08A 3RX6A 3WAKA 3EDUA 1ZKEA 3AB3B 4HE8A 5F3JA 2JJ9A 3ETUA 4CQIA 3AVRA 3CQGB 4YHJA 2GK9A 5JH7E 4H9RC 4WBNE 2A3DA 4H63H 3RRWA 2NW8A 2E9XA 4B6XA 4ANJA 4PK4A 3CVRA 3ZCIA 5F8PA 1LKXA 3CQCB 5FMNA 2PBIA 4IE5A 2RA1A 1MMGA 2Q9QB 4ZI3D 3BQLA 3HL6A 2V26A 5L3CB 2LHRA 5DQVA 3ZPOA 1CUNA 2PJQA 4OYJA 3ETVA 1HG5A 2BVMA 3N9QA 4J2CA 2CM0A 4WNKA 5JREA 2X0LB 3EDVA 5FY0A 2K9AA 2D2SA 1IJ6A 2DLRA 2VKJA 5LNKA 5DJQC 3EUHA 3O1HA 3B57A 3K3OA 3UUNA 2ACXA 3J7Yq 3VKHA 2LEHA 4YFSA 4UF0B 4O4LE 4IE7A 3IBPA 4O2AE 3K8PC 3FXEB 3RC8A 4AKIA 2CWYA 3CQXC 3L3PA 5JDMA 3BQKA 1NAFA 5LP6E 4DO0A 5J2TE 4KUMB 5M4YA 2X9WA 2XAJB 4QX8B 2H7VC 3HI2A 2WM9A 3FBZA 2CCQA 4DBQA 5LYJE 3V5UA 1UCUA 2K5BB 2Q9QC 3BQIA 3H37A 1HCIA 2KT9A 2SPCA 1OWAA 4UV9B 3B13A 3ZN1B 3ZMTB 5L2LA 2I59A 2KWHA 1YW0A 2N1GA 4EB6E 4H9QC 4ILUA 3Q5WA 4ZI3C 5FXXA 1WR6A 1QUUA 3AAIA 3KV5A 2KINB 4HKAA 4ZOLE 3P8CD 1IZNB 4I55E 3KV6A 3ZC0A 2H3RA 4V1Av 3U78A 2NTYA 2BDEA 4DBRA 2N2NA 4E7ZA 2L9QA 4L0RA 2NWBA 4NUUA 3O4XE 4HEAA 4CXXA 3RKOA 3C98B 3VHLA 1KNZA 3A5XA 3RRCA 1H7CA 3LJCA 5LBQB 3LFMA 3UFEA 2CMRA 2VL8A 2C5IT 2JPFA 4DMWA 5JR9B 2H7OA 2X9XA 5IYZE 5KDMC 3N9MA 2VKOA 5HXRA 1Z0PA 1S35A 4PAGA 2NOXA 4U74A 2KZ7B 4X1KE 4TX5A 1Y64B 4UELA 3ZC1A 4MALA 5HWYA 3HKBE 1BR2A 3SS1A 3ZMVB 4NUVA 3KBTA 4MLKA 3OKQA 4JUYA 3K3NA 1D0ZA 1MMNA 2KWIB 3JC6C 3MKDA 4PFPA 1BR0A 3VKGA 3WI3A 2V1DB 2WMOA 5EK4A 1AJ3A 2XTLA 2Y48B 3LK42 5FXWA 4A56A 2CLYC 4H9OC 2K48A 1YKHB 3AAEB 3PUSA 4GYSA 3C4ZA 3E0ZA 2HH7A 2LSGA 3OYXA 4IE0A 2OA5A 2BZBA 3SWHA 3GN5A 4PNIA 3ANWB 5FXVA 4IDZA 2ZM0A 5KX5E 1US7B 3N9OA 1NWMX 4ZI7E 2YU1A 4GIWA 5JR9C 1D1BA 1LVKA 4UVBB 3UUXB 4ERRA 3RYCE 5LGNB 3CPZA 5GONE 2G0UA 3O1JA 2Y6XA 2XAFB 4PJJA 4CI2B 3C4XA 3PUAA 3UUMA 4P0AA 2N9DA 1D0XA 4C90A 5LG4A 5JRCA 4EAHA 4IIJE 4G63A 2Q9QD 4EIWA 3CX6B 2NW7A 5BMVE 2W62A 2ZMAA 1T98A 3IEEA 2LSJA 2UXNB 4O2BE 5CA0E 5FXZA 3RYFE 2IC6A 4F6RC 1OXZA 2RP4A 4QXBB 5FYMA 2JQQA 3LG7A 4I50E 3KV4A 1V9DA 2YINA 4E7SA 2E9XC 3KINB 3N5LA 2VKDA 2X68A 5L3FB 2QA7A 5ETWA 1O3XA 2XQYA 3C4WA 4JEUB 4WBOA 3T8OA 5FP3A 3V5SA 2L3LA 4ADZA 4PK5A 2UXXB 1G73A 3ONXA 4ZS3A 3ZMZB 3MJXA 2YEVC 5CB4E 4JEHB 3KV9A 2J1DG 4KBMB 4IE6A 3PU3A 1BR4A 2NTXA 5JDGA 1MMDA 1UX5A 4QWNB 2DWGA 5JQGE 4AQGA 1MNDA 1FMVA 2JMHA 3LBXB 3N9NA 3CX8B 1YD8G 1LVFA 4HGAA 3ZJ2A 2A72A 5L3GB 2MBGA 2XUEA 3I9WA 3JC6D 4ASKA 5J2UE 2LJLA 3AVSA 1MNEA 2V7LA 3J9X1 2Q9QA 2DI4A 3DTOA 4DNDA 4EYYR 2JMKA 1WLXA 3CWZB 5JDNA 2C5JA 2VK9A 4EZ4A 3F31A 2LSKA 4QXHB 3P7IA 2XHEB 1MIVA 5FNVE 4EOZB 2CLYB 5ADXL 2QGSA 4QX7B 4H9NC 3TKLB 3FHNA 3O9XA 3I1AA 2Z6EA 5FY1A 3ZMSB 1SHZC 5LHGB 4UF0A 5HXSA 2X66A 2XASB 2V7MA 3E22E 4ZI2D 2LOSA 5LJNA 5LXTE 1FEWA 4H9PC 2EHOB 4XAXB 5HXCA 3ZYMA 2MTQA 5L3EB 2DWKA 2C0SA 3L09A 1YKEB 3OBVE 3I9YA 4PK6A 3Q2MA 4HTEA 4ZS2A 4G2AA 1X79A 4YJ3E 3NZQA 5TAOA 1WRDA 3H3AA 2WMNA 1WYCA 5C8YE 5A1LA 1ZEEA 4UXNB 4XBFB 4P0BA 2LHNA 3ZLIA 4UIGA 1EZ3A 3VU7H 4PJLA 3CKDA 1QSDA 2ODVA 3ESLA 2KMFA 5HXHA 2LT3A 2E9XD 3OJAA 4L9IA 4OHFA 4PJNA 3SOLA 1MIWA 4X1IE 2VWAA 4AQFC 4XZCA 4EXTA 5JDHA 3GWHA 3AA0B 4M1PA 2YK0A 3K3QC 2LSIA 3EVYA 2E9XB 2CA5A 4AI6A 3HKEE 1B7TA 4K0UA 5LA6E 3ZCJA 4I43B 5HYAA 2EHOC 2KLQA 3OYZA 4UEMA 4DMVA 2YU2A 4EZHA 3DP7A 3CX7B 5JR9A 5JDQA 2IC9A 2WAUA 3I0OA 4CZZB 5CA1E 4ZI2C 2WSSV 3U3IA 3RYIE 5JVDE 5L3BB 4AKRB 3KDSE 2ZLYA 4UVAB 4GOUA 2JRKA 3AA6B 3IF8B 1VRBA 1KK7A 2D5UA 2M67A 4KP3C 1UX4A 2KNDA 2Y8DA 3LK2B 2LOPA 3UT5E 1U5PA 2LE8A 1D1AA 2CXDA 2C5KT 5JDLA 3HKDE 1ZV4X 3R84B 2XAGB 3QC9A 3HR0A 3PURA 2ODUA 2NW9A 4AKLA 3CMLA 4U72A 5EK3A 5LGTB 2V7IA 3PU8A 2V7JA 3IHRA 1WYBA 3ZYLA 4Z8XA 2D0UA 4ZHQE 5JDFA 2IW5B 3ANWA 3NRXA 3N2KE 4FJOA 2XAQB 4BA9A 4EYUA 2ES0A 3SRZA 4I4TE 5LHHB 2DHRA 2X9YA 5HXEA 2X67A 2VASA 3LK3B 3ZMUB 5EK2A 2HPLA 3W15B 2X51A 1U4QA 4IE4A 3N9PA 3PUQA 4MFRA 2KXPB 3RPUA 5KMGP 4JLEA 5LBMA 3PTRB 3FB2A 4H63V 3S4UA 3RH3A 4AKGA 4ISSA 2PG8A 3UULA 4H9SE 3GMIA 4CI3B 3BK9A 3PDYA 4BJNA 1HF8A 4GK5E 3RYHE 3M65A 1FIOA 4FI5A 3MXZA 4O4IE 2V7KA 2L8KA 3KFWX 3MACA 3C50A 3Q5XA 1MIYA 4IGUA 5EZYE 3DJBA 3N2GE 4HN9A 3ZYKA 4IHJE 3RC3A 5LGUB 2E8IA 1MMAA 3KVBA 5DABA 3N2OA 4QKNA 4TV9E 4BJMA 1HX8A 5H6QB 5HWXA 4X20E 2W00A 4GK0E 3ZEFB 5IHYA 4AKHA 2D0TA 5J1GA 2EHOD 3GA8A 4YJ2E 2CXFA 4PW8A 3I0QA 3O1IA 4OFZA 1HS7A 2VKHA 4YLHA 2CE7A 5LHIB 2WBLA 4C91A 2NP9A 2DNXA 2WWUA 4O8SA 1IJ5A 5DQWA 1IAPA 1LRZA 1SA0E 3LBXA 4TN7B 5E0OA 3ZJ1A 4AXPA 4QXCB 3GN5B 2A2FX 3N9LA 2W61A 3ZN0B 3MK7C 3PE0A 2W0GA 3HKCE 2K24A 1BR1A 1FMWA 3Q9DA 4CXWA 1ZHCA 4WW0A 5FY7A 4O4HE 4PJMA 2MYSA 4P09A 2ZM8A 4X1YE 5H6RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Q C;  2E9X A;  2EHO A;  2Q9Q B;  2EHO B;  3JC6 D;  3ANW A;  2E9X D; 
#chains in the Genus database with same CATH topology
 4GYR A;  1HFA A;  4UVC B;  3ZSS A;  2E2A A;  5JRC B;  3NRY A;  5L3D B;  4DR1 T;  2HHH T;  4NXM T;  3MZK B;  4AQF A;  2VVN A;  3F57 A;  4DVD A;  2IML A;  4OYK A;  4O4J E;  3QUJ A;  3AA7 B;  4MHC A;  4QHO A;  2MAW A;  1XMO T;  2IAK A;  1HG2 A;  4IST A;  2BVL A;  3D0T A;  3NZP A;  5LJM A;  1UUR A;  2YKS A;  5AFU L;  2J62 A;  3RX6 A;  3CQG B;  5JH7 E;  1YXR A;  4WBN E;  3RRW A;  4PK4 A;  3RIU C;  3SFD A;  1LKX A;  3PJA J;  5FMN A;  3AED A;  1WFD A;  3RI5 A;  3QOF A;  2V26 A;  4TNV A;  3ZPO A;  4LF6 T;  4OYJ A;  4P1N A;  5JRE A;  3EDV A;  3UQ4 A;  2K9A A;  2DLR A;  1HNW T;  2M6B A;  5LNK A;  3O1H A;  4LF8 T;  3VKH A;  2LEH A;  5C3J A;  2XQ7 A;  3IBP A;  4DUY T;  2LKG A;  2CWY A;  3L3P A;  5LP6 E;  2XQ5 A;  5J2T E;  2XAJ B;  1J1J A;  2X0H A;  3V5U A;  4DV1 T;  3H37 A;  2XQ4 A;  4UV9 B;  3B13 A;  2LKH A;  1YW0 A;  2N1G A;  4EB6 E;  4X5T A;  4B3S T;  4ZI3 C;  3P50 A;  3TLT A;  3KV6 A;  2L9Q A;  2WWV A;  4A97 A;  3C98 B;  4JI3 T;  3LFM A;  5KDM C;  2VKO A;  3RKG A;  4X1K E;  3HKB E;  2XM2 A;  3FZF B;  4MLK A;  3VR9 A;  1XNR T;  3JC6 C;  4DV0 T;  2BG9 C;  4PFP A;  3VKG A;  5FKY A;  5EK4 A;  1AJ3 A;  2HN1 A;  4A56 A;  2IIU A;  4YXD A;  2XY8 B;  3E0Z A;  2HH7 A;  3GN5 A;  5KXJ A;  4PNI A;  5FXV A;  1LVK A;  4UVB B;  3UUX B;  5LGN B;  4YTN A;  2G0U A;  4TWD A;  3O1J A;  2Y6X A;  4PJJ A;  4CI2 B;  3C4X A;  3PUA A;  3UUM A;  1OED C;  4NPP A;  2WDR A;  2Q9Q D;  2ZMA A;  3IEE A;  2LSJ A;  2UXN B;  4O2B E;  5FXZ A;  3RYF E;  5AQN B;  3LG7 A;  3KV4 A;  2BS3 A;  5ETW A;  2XQY A;  3QNU A;  3V5S A;  4ZS3 A;  1W09 A;  2YEV C;  3KV9 A;  5ABH A;  1UX5 A;  2DWG A;  1MND A;  4CN1 A;  2WDQ A;  3AE5 A;  2B76 A;  3ZJ2 A;  2A72 A;  5J2U E;  1MNE A;  3DTO A;  3ZKR A;  4DND A;  5LMN T;  2C5J A;  5AQO B;  3UU8 A;  3ZMS B;  1SHZ C;  5LHG B;  4UF0 A;  3E22 E;  4U31 A;  2XM1 A;  2C0S A;  3L09 A;  1XDO A;  3TLU A;  3Q2M A;  4JI4 T;  4ZS2 A;  3H3A A;  2WMN A;  5C8Y E;  3ZLI A;  3VU7 H;  2F4V T;  3CKD A;  2LT3 A;  4PJN A;  3AXJ A;  4XZC A;  3AA0 B;  4OX9 T;  3VRA A;  4HFI A;  2E9X B;  1B7T A;  3RF1 A;  2EHO C;  3OYZ A;  4DMV A;  2V8S V;  3AEC A;  3CX7 B;  5JDQ A;  2IC9 A;  5L3B B;  1W0A A;  2AE9 A;  3K1S A;  1KK7 A;  2M67 A;  4KP3 C;  3UU3 A;  3ABV A;  1U5P A;  2LE8 A;  1D1A A;  2BBH A;  2C5K T;  3HKD E;  3R84 B;  2XAG B;  3EAM A;  1OED E;  3PUR A;  2NW9 A;  2E5V A;  5EK3 A;  2V7I A;  2XQ9 A;  3ZYL A;  2D0U A;  2IW5 B;  3ANW A;  3N2K E;  1E7P A;  4BA9 A;  4EYU A;  5LHH B;  2X9Y A;  5L4H A;  5AQP B;  4YSY A;  3W15 B;  2FJD A;  4MFR A;  3RPU A;  2OV9 A;  2WCA A;  1JNZ A;  2JQ9 A;  4ISS A;  2PG8 A;  3BK9 A;  2V5D A;  3UU6 A;  2PTF A;  1HF8 A;  4JI7 T;  4ILA A;  1HX1 B;  3MAC A;  3C50 A;  4IGU A;  2X0Y A;  3DJB A;  3ZYK A;  5LGU B;  1HX8 A;  5H6Q B;  4GK0 E;  5IHY A;  2D0T A;  3P4W A;  5LHI B;  4C91 A;  4DID B;  2NP9 A;  2WWU A;  3M3Z B;  1HNX T;  3LBX A;  3ZJ1 A;  5CJ5 A;  3MK7 C;  4CN6 A;  4JI0 T;  2MYS A;  4X1Y E;  4KMC A;  3C64 A;  4HFV A;  3C51 A;  1QLB A;  1G8X A;  2VB6 A;  4PFO A;  2LM9 A;  2LSY A;  4N78 D;  4TZ4 C;  4HFB A;  1VOM A;  1S94 A;  3MA9 A;  3NBX X;  2ZM2 A;  4MBQ A;  2W63 A;  3FXD B;  3LSV A;  4L5G A;  2IHR 1;  1HTJ F;  2CXL A;  3AAA B;  1E1H B;  3QK6 A;  5HCJ A;  1X9B A;  5L4E A;  3WAK A;  1ZP0 A;  2DL1 A;  4CQI A;  2GK9 A;  1KEY A;  4H63 H;  2VL0 A;  4ANJ A;  5FL0 A;  3CIR A;  1UK5 A;  2LHR A;  1N36 T;  3TLW A;  1CUN A;  4YTM A;  1HR0 T;  3ETV A;  4J2C A;  4WNK A;  5FY0 A;  2D2S A;  3PV0 F;  3ONL C;  1IJ6 A;  5DJQ C;  3P4P A;  3K3O A;  2ACX A;  4O4L E;  2WQY A;  3FXE B;  3RC8 A;  3PUV F;  5JDM A;  2FJE A;  4DV4 T;  2X9W A;  5LYJ E;  2I0M A;  2Q9Q C;  3BQI A;  3ZN1 B;  2KWH A;  4H9Q C;  2XQ3 A;  4DV6 T;  2E5L T;  1QUU A;  1XZY A;  2BG9 B;  2KIN B;  3NKZ A;  4ZOL E;  3P8C D;  5CFB A;  3U78 A;  2BDE A;  4L0R A;  2NWB A;  3O4X E;  5FVK A;  4HEA A;  1H7C A;  2RPA A;  3LJC A;  1W0B A;  2QVA A;  5LG3 A;  2C5I T;  4DMW A;  2H7O A;  5HXR A;  1Z0P A;  1S35 A;  4DV2 T;  4U74 A;  5HWY A;  1BR2 A;  3SS1 A;  3ZMV B;  4NUV A;  4LMK A;  4JUY A;  1MMN A;  1N32 T;  2V1D B;  2WMO A;  2XTL A;  4JYA T;  4B3R T;  4H9O C;  2K48 A;  3A7M A;  2ACZ A;  3G06 A;  4DR6 T;  2ZM0 A;  1US7 B;  3N9O A;  4GIW A;  5JR9 C;  3OPC A;  4ZEY A;  3CPZ A;  2XAF B;  5JRC A;  4EED A;  4IIJ E;  4EIW A;  5HEJ A;  2NW7 A;  1T98 A;  2UU9 T;  4GKK T;  5CA0 E;  2RP4 A;  2V6Y B;  4I50 E;  3KIN B;  2VKD A;  5L3F B;  2QA7 A;  1O3X A;  2W66 A;  4PK5 A;  2UXX B;  3QB5 K;  2J1D G;  1UGO A;  2WS3 A;  2IUB A;  4NIQ A;  4AQG A;  4I0U A;  1YD8 G;  5L3G B;  2MBG A;  4ASK A;  2W4X A;  2LJL A;  2V7L A;  4EYY R;  2VQE T;  1WLX A;  1UUS A;  4U7Y A;  3CWZ B;  5JDN A;  4U33 A;  4EZ4 A;  2IDO B;  2LSK A;  3F31 A;  4QXH B;  2XHE B;  1MIV A;  5FNV E;  4EOZ B;  2CLY B;  4QX7 B;  1I6Z A;  2CHO A;  5FY1 A;  4LFC T;  3UQ7 A;  4H9P C;  2EHO B;  3ZYM A;  5L3E B;  4HWC A;  1WYC A;  3FZH B;  4XBF B;  2LHN A;  4UIG A;  4X65 T;  5AQJ B;  4HWH A;  2E9X D;  4OHF A;  1MIW A;  4AQF C;  3GWH A;  2YK0 A;  3HKE E;  4K0U A;  5FVL A;  3ZCJ A;  4I43 B;  2YU2 A;  4U3C A;  3DP7 A;  4EZH A;  4CZZ B;  3P4R A;  5AQU B;  4ZI2 C;  3U3I A;  4AKR B;  3KDS E;  3AEA A;  4UVA B;  2CBI A;  3AA6 B;  3FZL B;  3L8R A;  2D5U A;  2LOP A;  4IDN A;  3ZST A;  2CXD A;  4X64 T;  1ZV4 X;  5J0Z A;  2ODU A;  3CML A;  4U72 A;  1FJG T;  1WYB A;  2YDS A;  4Z8X A;  4FJO A;  3SRZ A;  2OLT A;  2R6G F;  4JBW F;  1VCS A;  2VAS A;  4X62 T;  3ZMU B;  1U4Q A;  3PUQ A;  2KXP B;  5KMG P;  2H89 A;  5LBM A;  3PTR B;  4H63 V;  4IDP A;  2QRX A;  3S4U A;  4AKG A;  2V6X A;  4CI3 B;  1NEK A;  3M65 A;  1T72 A;  2XQ6 A;  4YSZ A;  3Q5X A;  1MIY A;  3N2G E;  3X1D A;  4IHJ E;  3RC3 A;  2E8I A;  1MMA A;  3VR8 A;  4X20 E;  3ZEF B;  4AKH A;  5J1G A;  4JI1 T;  4YJ2 E;  1IBK T;  4JI6 T;  4QH4 A;  3I0Q A;  3O1I A;  4OFZ A;  2VKH A;  2WBL A;  3EAB A;  2DNX A;  4EGW A;  2UXD T;  2WU2 A;  2WU5 A;  4QXC B;  4AXP A;  5JTG A;  3RQU A;  4TNW A;  2K24 A;  1BR1 A;  1FMW A;  3Q9D A;  1Y01 A;  4HFC A;  1KNR A;  3AE7 A;  3CX8 B;  2ZM8 A;  1J5W A;  3QB5 A;  1E2A A;  4UR9 A;  3UUB A;  1SE7 A;  1D0Y A;  3P4Q A;  2MOZ A;  3R6N A;  3KBU A;  3KVA A;  1N34 T;  4TUY E;  5HAX A;  2DCF A;  4WYV A;  2XAH B;  4BAY B;  4OK0 A;  1D1C A;  2P9B A;  5LMU T;  1KF6 A;  3UTK A;  1L0V A;  2PFV A;  1YQ3 A;  5LCY A;  2CWO A;  2X9H A;  4DV7 T;  4TWF A;  3HA4 A;  2HPJ A;  1I94 T;  3OTO T;  3AE4 A;  3EDU A;  4HE8 A;  3ETU A;  4YHJ A;  4H9R C;  2A3D A;  5IWA T;  2YDQ A;  2NW8 A;  4HFH A;  2E9X A;  4B6X A;  2VUR A;  2XZE A;  3FZK B;  3CVR A;  3ZCI A;  5F8P A;  1T7S A;  3CQC B;  3TLS A;  2RA1 A;  2LM2 A;  2Q9Q B;  4Z91 A;  4ZI3 D;  2H88 A;  1HG5 A;  3N9Q A;  5HEO A;  5AQV B;  3EUH A;  3UUN A;  1YQ4 A;  3J7Y q;  1XMQ T;  4YSX A;  4AKI A;  3CQX C;  5HCM A;  1IBM T;  5M4Y A;  4QX8 B;  3HI2 A;  3FBZ A;  1UCU A;  2K5B B;  1HCI A;  2KT9 A;  2FJA A;  2SPC A;  1OWA A;  3ZMT B;  4ILU A;  1XWM A;  5FXX A;  3AEG A;  4HFD A;  3KV5 A;  4I55 E;  4LFB T;  2XSB A;  4DBR A;  2N2N A;  4E7Z A;  3H3M A;  4A5X A;  4IDO A;  4YHH T;  1HNZ T;  1KNZ A;  3A5X A;  3L39 A;  3RRC A;  4ZXL A;  5LBQ B;  3UFE A;  3OVU A;  5JR9 B;  5IYZ E;  3N9M A;  2UXB T;  2NOX A;  5F5W A;  2BKP A;  2KZ7 B;  4TX5 A;  4MAL A;  2WZH A;  3KBT A;  2KWI B;  3MKD A;  1BR0 A;  2VVS A;  5FXW A;  3T1Y T;  2FUP A;  4IE0 A;  1CHU A;  2OA5 A;  4DV3 T;  4IDZ A;  2YU1 A;  5HEG A;  4ERR A;  4TWH A;  3EI0 A;  3RYC E;  5GON E;  2WB5 A;  5ABF B;  2N9D A;  4C90 A;  1WR0 A;  2LRL A;  4G63 A;  2JQH A;  3PUW F;  2IC6 A;  3AEF A;  1OXZ A;  5FYM A;  3RIU A;  2JQQ A;  5AQI B;  4E7S A;  2E9X C;  3N5L A;  2X68 A;  3AE6 A;  3T8O A;  5FP3 A;  3ONX A;  3ZMZ B;  3MJX A;  4ILB A;  4CN4 A;  3VRB A;  2I6H A;  1BR4 A;  2NTX A;  4QWN B;  5JQG E;  1FMV A;  4YY3 T;  3N9N A;  1LVF A;  4HGA A;  4F8H A;  2XUE A;  3J9X 1;  1M62 A;  5CGM A;  4HWF A;  2J4G A;  1WCR A;  3P7I A;  2QGS A;  4H9N C;  3ONJ A;  2J47 A;  2Z6E A;  4JI2 T;  5HXS A;  2X66 A;  2V7M A;  1VCT A;  2LOS A;  5LJN A;  2D9D A;  5LXT E;  1FEW A;  2MTQ A;  4ILC A;  2DWK A;  4DR2 T;  4LMJ A;  3OBV E;  3AE9 A;  4HTE A;  4G2A A;  4YJ3 E;  3NZQ A;  5TAO A;  1OED B;  2AXD S;  3LDQ B;  4ZZC A;  5A1L A;  1ZEE A;  4UXN B;  3RIA A;  4A98 A;  5FL1 A;  3P4S A;  2JQK A;  2BG9 A;  3OJA A;  4L9I A;  3FZM B;  4M1P A;  3K3Q C;  3EVY A;  2CA5 A;  1W9R A;  4AI6 A;  2WY2 A;  4JI5 T;  2KLQ A;  4UEM A;  2WAU A;  5AQQ B;  2WSS V;  2ZLY A;  4GOU A;  3IF8 B;  1OED A;  1VRB A;  5L47 A;  1UX4 A;  2KND A;  3AE2 A;  2Y8D A;  1JNR A;  4AIS A;  5JDL A;  3QC9 A;  4U2Y A;  3ZT5 A;  3PU8 A;  1GQE A;  3IHR A;  4ZHQ E;  3NRX A;  1T8B A;  2ES0 A;  2DHR A;  5HXE A;  2NR4 A;  3RLF F;  2VQF T;  2HPL A;  2X51 A;  4IE4 A;  2JIW A;  1KFY A;  3RH3 A;  3PDY A;  3RYH E;  3Q5E A;  3MXZ A;  2XQA A;  4O4I E;  2V6Y A;  3IA3 A;  5EZY E;  1R8I A;  2K3W A;  2YDR A;  3GA8 A;  4PW8 A;  4EEB A;  1HS7 A;  4YLH A;  2ZM6 T;  4KHZ F;  5DQW A;  1LRZ A;  4TN7 B;  4X66 T;  4DV5 T;  2CPT A;  3GN5 B;  2KSR A;  3N9L A;  3ZN0 B;  3JCF A;  3PE0 A;  4AQY T;  3HKC E;  2BS2 A;  4CXW A;  1ZHC A;  4PJM A;  5H6R B;  4U2Z A;  2B1E A;  4TV8 E;  4HWI B;  3B5M A;  4HFE A;  3PJA A;  3FBL A;  2LLY A;  4K0K T;  3AA1 B;  3F2E A;  2EHO A;  3RGL A;  4QH5 A;  4CXY A;  4UV8 B;  3WAJ A;  2CRB A;  5LOV E;  4CI1 B;  3PUG A;  5IUX A;  3AE8 A;  1SUM B;  2CEA A;  3E08 A;  2M6I A;  2UUA T;  1ZKE A;  3AB3 B;  5F3J A;  4DR5 T;  2JJ9 A;  4GKJ T;  3AVR A;  3RHW A;  3UU5 A;  5BR8 T;  3JAF A;  2A9U A;  3AEB A;  2PBI A;  4IE5 A;  1MMG A;  1ZOY A;  3BQL A;  3HL6 A;  5L3C B;  5DQV A;  2PJQ A;  2BVM A;  2CM0 A;  2X0L B;  2VKJ A;  3B57 A;  5C2T A;  4YFS A;  4UF0 B;  4IE7 A;  5HEH A;  4O2A E;  3K8P C;  3BQK A;  1NAF A;  2BBJ A;  4DO0 A;  4KUM B;  2W2U A;  2H7V C;  2WM9 A;  2CCQ A;  4DBQ A;  4Z90 A;  5L2L A;  2I59 A;  3PUX F;  4LML A;  1Z8U A;  2XPK A;  3Q5W A;  2WDV A;  1WR6 A;  3AAI A;  3TLV A;  4HKA A;  3AXJ B;  1IZN B;  1M7K A;  5LB7 B;  1XDP A;  5AQG B;  3ZC0 A;  2H3R A;  4V1A v;  2NTY A;  2V5C A;  4NUU A;  1N33 T;  4CXX A;  3RKO A;  3VHL A;  2CMR A;  2VL8 A;  2LRK A;  2JPF A;  2X9X A;  4IDQ A;  4KHP T;  3Q5D A;  4PAG A;  4U7I A;  5ABG A;  4UEL A;  1Y64 B;  3ZC1 A;  5ABE A;  2UUC T;  3AE3 A;  3OKQ A;  3K3N A;  1D0Z A;  2UXC T;  3WI3 A;  4WZX A;  2Y48 B;  3ZT7 A;  3LK4 2;  4DR3 T;  2CLY C;  3EHZ A;  1YKH B;  3AAE B;  3PUS A;  4GYS A;  3C4Z A;  3OYX A;  2LSG A;  5AQM B;  2BZB A;  3SWH A;  3PUZ F;  3ANW B;  3RQW A;  4Q25 A;  5KX5 E;  3AEE A;  2BG9 E;  1NWM X;  4ZI7 E;  1D1B A;  5AQF B;  4B3T T;  3RIF A;  2CBJ A;  4LF4 T;  4ZZB A;  4P0A A;  2QYW A;  1D0X A;  5LG4 A;  4EAH A;  3CX6 B;  5BMV E;  2W62 A;  4F6R C;  4QXB B;  4JV5 T;  2XSA A;  1V9D A;  2YIN A;  5AQK B;  5AQL B;  3C4W A;  4JEU B;  4WBO A;  2L3L A;  4ADZ A;  1G73 A;  4KI0 F;  4JI8 T;  4NXN T;  5CB4 E;  4JEH B;  4KBM B;  4IE6 A;  3PU3 A;  2YOE A;  5JDG A;  2FJB A;  1MMD A;  4IL9 A;  2JMH A;  3LBX B;  2BKN A;  3NWI A;  3UFG A;  3I9W A;  3JC6 D;  3AVS A;  3T1H T;  2Q9Q A;  2DI4 A;  2JMK A;  2VK9 A;  5ADX L;  4DUZ T;  3TKL B;  3ZT6 A;  3FHN A;  3O9X A;  3I1A A;  4LFA T;  3CK6 A;  2XAS B;  4ZI2 D;  3A8Y C;  4XAX B;  5HXC A;  4LF7 T;  1YKE B;  3I9Y A;  4PK6 A;  1X79 A;  1WRD A;  4P0B A;  1EZ3 A;  4PJL A;  4YT0 A;  1QSD A;  2ODV A;  3ESL A;  2YN6 A;  2KMF A;  5HXH A;  2CHN A;  3SOL A;  1XNQ T;  4X1I E;  2VWA A;  4YTP A;  4EXT A;  5JDH A;  2LSI A;  5LA6 E;  2HN2 A;  1KNP A;  3SFE A;  1J5E T;  5HYA A;  5JR9 A;  3I0O A;  2FBW A;  4COF A;  5CA1 E;  3RYI E;  5JVD E;  2BS4 A;  2JRK A;  1DU2 A;  4HWD A;  5AQR B;  3LK2 B;  3UT5 E;  2XJ7 A;  3HR0 A;  4AKL A;  5LGT B;  4LF5 T;  2V7J A;  5AQH B;  5JDF A;  2BKO A;  2XAQ B;  4I4T E;  1IBL T;  2WP9 A;  2X67 A;  3LK3 B;  4KX6 A;  5EK2 A;  5ABF A;  4EV6 A;  2MPK A;  3N9P A;  3AE1 A;  5AQT B;  4JLE A;  3FB2 A;  2UUB T;  3NVO A;  2WZI A;  3UUL A;  4H9S E;  3GMI A;  4BJN A;  4GK5 E;  1FIO A;  4FI5 A;  2V7K A;  2L8K A;  4DR4 T;  4AIU A;  3KFW X;  4IRE A;  4HN9 A;  5AQS B;  3KVB A;  3JAD A;  5DAB A;  3N2O A;  4QKN A;  3UU4 A;  4TV9 E;  4BJM A;  5HWX A;  2W00 A;  2EHO D;  2CXF A;  2XQ8 A;  2CE7 A;  5HEU A;  4IL4 A;  4B3M T;  4O8S A;  1IJ5 A;  4QH1 A;  3PUY F;  4DR7 T;  1IAP A;  1SA0 E;  5E0O A;  2A2F X;  2W61 A;  2W0G A;  3JAE A;  4LF9 T;  1NEN A;  2W67 A;  4IT4 A;  4WW0 A;  5FY7 A;  4O4H E;  4P09 A; 
#chains in the Genus database with same CATH homology
 2B1E A;  4TV8 E;  4GYR A;  1HFA A;  4UVC B;  4KMC A;  3C64 A;  4HFV A;  3C51 A;  1D0Y A;  3FBL A;  5JRC B;  3NRY A;  2MOZ A;  3R6N A;  3KBU A;  5L3D B;  1G8X A;  3KVA A;  2VB6 A;  4PFO A;  3MZK B;  4AQF A;  2LM9 A;  4TUY E;  2LSY A;  4N78 D;  5HAX A;  2DCF A;  3F57 A;  4TZ4 C;  4DVD A;  3AA1 B;  1VOM A;  1S94 A;  2XAH B;  3F2E A;  3MA9 A;  4OYK A;  3NBX X;  2ZM2 A;  4OK0 A;  4BAY B;  4MBQ A;  2EHO A;  2W63 A;  1D1C A;  3FXD B;  4O4J E;  4CXY A;  2P9B A;  4L5G A;  3QUJ A;  3AA7 B;  4UV8 B;  3UTK A;  3WAJ A;  4MHC A;  1HTJ F;  4QHO A;  2CXL A;  5LOV E;  2PFV A;  4CI1 B;  2IAK A;  3PUG A;  1HG2 A;  5LCY A;  2CWO A;  3AAA B;  4IST A;  2X9H A;  2BVL A;  1E1H B;  3D0T A;  2CEA A;  3HA4 A;  2HPJ A;  3NZP A;  3QK6 A;  5AFU L;  5LJM A;  3E08 A;  3RX6 A;  3WAK A;  3EDU A;  1ZKE A;  3AB3 B;  4HE8 A;  5F3J A;  2JJ9 A;  3ETU A;  4CQI A;  3AVR A;  3CQG B;  4YHJ A;  2GK9 A;  5JH7 E;  4H9R C;  4WBN E;  2A3D A;  4H63 H;  3RRW A;  2NW8 A;  2E9X A;  4B6X A;  4ANJ A;  4PK4 A;  3CVR A;  3ZCI A;  5F8P A;  1LKX A;  3CQC B;  5FMN A;  2PBI A;  4IE5 A;  2RA1 A;  1MMG A;  2Q9Q B;  4ZI3 D;  3BQL A;  3HL6 A;  2V26 A;  5L3C B;  2LHR A;  5DQV A;  3ZPO A;  1CUN A;  2PJQ A;  4OYJ A;  3ETV A;  1HG5 A;  2BVM A;  3N9Q A;  4J2C A;  2CM0 A;  4WNK A;  5JRE A;  2X0L B;  3EDV A;  5FY0 A;  2K9A A;  2D2S A;  1IJ6 A;  2DLR A;  2VKJ A;  5LNK A;  5DJQ C;  3EUH A;  3O1H A;  3B57 A;  3K3O A;  3UUN A;  2ACX A;  3J7Y q;  3VKH A;  2LEH A;  4YFS A;  4UF0 B;  4O4L E;  4IE7 A;  3IBP A;  4O2A E;  3K8P C;  3FXE B;  3RC8 A;  4AKI A;  2CWY A;  3CQX C;  3L3P A;  5JDM A;  3BQK A;  1NAF A;  5LP6 E;  4DO0 A;  5J2T E;  4KUM B;  5M4Y A;  2X9W A;  2XAJ B;  4QX8 B;  2H7V C;  3HI2 A;  2WM9 A;  3FBZ A;  2CCQ A;  4DBQ A;  5LYJ E;  3V5U A;  1UCU A;  2K5B B;  2Q9Q C;  3BQI A;  3H37 A;  1HCI A;  2KT9 A;  2SPC A;  1OWA A;  4UV9 B;  3B13 A;  3ZN1 B;  3ZMT B;  5L2L A;  2I59 A;  2KWH A;  1YW0 A;  2N1G A;  4EB6 E;  4H9Q C;  4ILU A;  3Q5W A;  4ZI3 C;  5FXX A;  1WR6 A;  1QUU A;  3AAI A;  3KV5 A;  2KIN B;  4HKA A;  4ZOL E;  3P8C D;  1IZN B;  4I55 E;  3KV6 A;  3ZC0 A;  2H3R A;  4V1A v;  3U78 A;  2NTY A;  2BDE A;  4DBR A;  2N2N A;  4E7Z A;  2L9Q A;  4L0R A;  2NWB A;  4NUU A;  3O4X E;  4HEA A;  4CXX A;  3RKO A;  3C98 B;  3VHL A;  1KNZ A;  3A5X A;  3RRC A;  1H7C A;  3LJC A;  5LBQ B;  3LFM A;  3UFE A;  2CMR A;  2VL8 A;  2C5I T;  2JPF A;  4DMW A;  5JR9 B;  2H7O A;  2X9X A;  5IYZ E;  5KDM C;  3N9M A;  2VKO A;  5HXR A;  1Z0P A;  1S35 A;  4PAG A;  2NOX A;  4U74 A;  2KZ7 B;  4X1K E;  4TX5 A;  1Y64 B;  4UEL A;  3ZC1 A;  4MAL A;  5HWY A;  3HKB E;  1BR2 A;  3SS1 A;  3ZMV B;  4NUV A;  3KBT A;  4MLK A;  3OKQ A;  4JUY A;  3K3N A;  1D0Z A;  1MMN A;  2KWI B;  3JC6 C;  3MKD A;  4PFP A;  1BR0 A;  3VKG A;  3WI3 A;  2V1D B;  2WMO A;  5EK4 A;  1AJ3 A;  2XTL A;  2Y48 B;  3LK4 2;  5FXW A;  4A56 A;  2CLY C;  4H9O C;  2K48 A;  1YKH B;  3AAE B;  3PUS A;  4GYS A;  3C4Z A;  3E0Z A;  2HH7 A;  2LSG A;  3OYX A;  4IE0 A;  2OA5 A;  2BZB A;  3SWH A;  3GN5 A;  4PNI A;  3ANW B;  5FXV A;  4IDZ A;  2ZM0 A;  5KX5 E;  1US7 B;  3N9O A;  1NWM X;  4ZI7 E;  2YU1 A;  4GIW A;  5JR9 C;  1D1B A;  1LVK A;  4UVB B;  3UUX B;  4ERR A;  3RYC E;  5LGN B;  3CPZ A;  5GON E;  2G0U A;  3O1J A;  2Y6X A;  2XAF B;  4PJJ A;  4CI2 B;  3C4X A;  3PUA A;  3UUM A;  4P0A A;  2N9D A;  1D0X A;  4C90 A;  5LG4 A;  5JRC A;  4EAH A;  4IIJ E;  4G63 A;  2Q9Q D;  4EIW A;  3CX6 B;  2NW7 A;  5BMV E;  2W62 A;  2ZMA A;  1T98 A;  3IEE A;  2LSJ A;  2UXN B;  4O2B E;  5CA0 E;  5FXZ A;  3RYF E;  2IC6 A;  4F6R C;  1OXZ A;  2RP4 A;  4QXB B;  5FYM A;  2JQQ A;  3LG7 A;  4I50 E;  3KV4 A;  1V9D A;  2YIN A;  4E7S A;  2E9X C;  3KIN B;  3N5L A;  2VKD A;  2X68 A;  5L3F B;  2QA7 A;  5ETW A;  1O3X A;  2XQY A;  3C4W A;  4JEU B;  4WBO A;  3T8O A;  5FP3 A;  3V5S A;  2L3L A;  4ADZ A;  4PK5 A;  2UXX B;  1G73 A;  3ONX A;  4ZS3 A;  3ZMZ B;  3MJX A;  2YEV C;  5CB4 E;  4JEH B;  3KV9 A;  2J1D G;  4KBM B;  4IE6 A;  3PU3 A;  1BR4 A;  2NTX A;  5JDG A;  1MMD A;  1UX5 A;  4QWN B;  2DWG A;  5JQG E;  4AQG A;  1MND A;  1FMV A;  2JMH A;  3LBX B;  3N9N A;  3CX8 B;  1YD8 G;  1LVF A;  4HGA A;  3ZJ2 A;  2A72 A;  5L3G B;  2MBG A;  2XUE A;  3I9W A;  3JC6 D;  4ASK A;  5J2U E;  2LJL A;  3AVS A;  1MNE A;  2V7L A;  3J9X 1;  2Q9Q A;  2DI4 A;  3DTO A;  4DND A;  4EYY R;  2JMK A;  1WLX A;  3CWZ B;  5JDN A;  2C5J A;  2VK9 A;  4EZ4 A;  3F31 A;  2LSK A;  4QXH B;  3P7I A;  2XHE B;  1MIV A;  5FNV E;  4EOZ B;  2CLY B;  5ADX L;  2QGS A;  4QX7 B;  4H9N C;  3TKL B;  3FHN A;  3O9X A;  3I1A A;  2Z6E A;  5FY1 A;  3ZMS B;  1SHZ C;  5LHG B;  4UF0 A;  5HXS A;  2X66 A;  2XAS B;  2V7M A;  3E22 E;  4ZI2 D;  2LOS A;  5LJN A;  5LXT E;  1FEW A;  4H9P C;  2EHO B;  4XAX B;  5HXC A;  3ZYM A;  2MTQ A;  5L3E B;  2DWK A;  2C0S A;  3L09 A;  1YKE B;  3OBV E;  3I9Y A;  4PK6 A;  3Q2M A;  4HTE A;  4ZS2 A;  4G2A A;  1X79 A;  4YJ3 E;  3NZQ A;  5TAO A;  1WRD A;  3H3A A;  2WMN A;  1WYC A;  5C8Y E;  5A1L A;  1ZEE A;  4UXN B;  4XBF B;  4P0B A;  2LHN A;  3ZLI A;  4UIG A;  1EZ3 A;  3VU7 H;  4PJL A;  3CKD A;  1QSD A;  2ODV A;  3ESL A;  2KMF A;  5HXH A;  2LT3 A;  2E9X D;  3OJA A;  4L9I A;  4OHF A;  4PJN A;  3SOL A;  1MIW A;  4X1I E;  2VWA A;  4AQF C;  4XZC A;  4EXT A;  5JDH A;  3GWH A;  3AA0 B;  4M1P A;  2YK0 A;  3K3Q C;  2LSI A;  3EVY A;  2E9X B;  2CA5 A;  4AI6 A;  3HKE E;  1B7T A;  4K0U A;  5LA6 E;  3ZCJ A;  4I43 B;  5HYA A;  2EHO C;  2KLQ A;  3OYZ A;  4UEM A;  4DMV A;  2YU2 A;  4EZH A;  3DP7 A;  3CX7 B;  5JR9 A;  5JDQ A;  2IC9 A;  2WAU A;  3I0O A;  4CZZ B;  5CA1 E;  4ZI2 C;  2WSS V;  3U3I A;  3RYI E;  5JVD E;  5L3B B;  4AKR B;  3KDS E;  2ZLY A;  4UVA B;  4GOU A;  2JRK A;  3AA6 B;  3IF8 B;  1VRB A;  1KK7 A;  2D5U A;  2M67 A;  4KP3 C;  1UX4 A;  2KND A;  2Y8D A;  3LK2 B;  2LOP A;  3UT5 E;  1U5P A;  2LE8 A;  1D1A A;  2CXD A;  2C5K T;  5JDL A;  3HKD E;  1ZV4 X;  3R84 B;  2XAG B;  3QC9 A;  3HR0 A;  3PUR A;  2ODU A;  2NW9 A;  4AKL A;  3CML A;  4U72 A;  5EK3 A;  5LGT B;  2V7I A;  3PU8 A;  2V7J A;  3IHR A;  1WYB A;  3ZYL A;  4Z8X A;  2D0U A;  4ZHQ E;  5JDF A;  2IW5 B;  3ANW A;  3NRX A;  3N2K E;  4FJO A;  2XAQ B;  4BA9 A;  4EYU A;  2ES0 A;  3SRZ A;  4I4T E;  5LHH B;  2DHR A;  2X9Y A;  5HXE A;  2X67 A;  2VAS A;  3LK3 B;  3ZMU B;  5EK2 A;  2HPL A;  3W15 B;  2X51 A;  1U4Q A;  4IE4 A;  3N9P A;  3PUQ A;  4MFR A;  2KXP B;  3RPU A;  5KMG P;  4JLE A;  5LBM A;  3PTR B;  3FB2 A;  4H63 V;  3S4U A;  3RH3 A;  4AKG A;  4ISS A;  2PG8 A;  3UUL A;  4H9S E;  3GMI A;  4CI3 B;  3BK9 A;  3PDY A;  4BJN A;  1HF8 A;  4GK5 E;  3RYH E;  3M65 A;  1FIO A;  4FI5 A;  3MXZ A;  4O4I E;  2V7K A;  2L8K A;  3KFW X;  3MAC A;  3C50 A;  3Q5X A;  1MIY A;  4IGU A;  5EZY E;  3DJB A;  3N2G E;  4HN9 A;  3ZYK A;  4IHJ E;  3RC3 A;  5LGU B;  2E8I A;  1MMA A;  3KVB A;  5DAB A;  3N2O A;  4QKN A;  4TV9 E;  4BJM A;  1HX8 A;  5H6Q B;  5HWX A;  4X20 E;  2W00 A;  4GK0 E;  3ZEF B;  5IHY A;  4AKH A;  2D0T A;  5J1G A;  2EHO D;  3GA8 A;  4YJ2 E;  2CXF A;  4PW8 A;  3I0Q A;  3O1I A;  4OFZ A;  1HS7 A;  2VKH A;  4YLH A;  2CE7 A;  5LHI B;  2WBL A;  4C91 A;  2NP9 A;  2DNX A;  2WWU A;  4O8S A;  1IJ5 A;  5DQW A;  1IAP A;  1LRZ A;  1SA0 E;  3LBX A;  4TN7 B;  5E0O A;  3ZJ1 A;  4AXP A;  4QXC B;  3GN5 B;  2A2F X;  3N9L A;  2W61 A;  3ZN0 B;  3MK7 C;  3PE0 A;  2W0G A;  3HKC E;  2K24 A;  1BR1 A;  1FMW A;  3Q9D A;  4CXW A;  1ZHC A;  4WW0 A;  5FY7 A;  4O4H E;  4PJM A;  2MYS A;  4P09 A;  2ZM8 A;  4X1Y E;  5H6R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...