2EHOB

Crystal structure of human gins complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GINS complex subunit 4
publication title Crystal structure of the human GINS complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 41
structure length 145
sequence length 145
chains with identical sequence F, J
ec nomenclature
pdb deposition date 2007-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ehoB01
2E9XD 2EHOB 2Q9QC 2EHOA 2Q9QB 3ANWA 3JC6D 2E9XA
chains in the Genus database with same CATH superfamily
2C0SA 4X5TA 3MKDA 4LF9T 3N2GE 4QKNA 2E9XA 5HEJA 2LSGA 1XDOA 3M3ZB 2H7OA 4DIDB 1O3XA 4MBQA 1HCIA 2W62A 5CA1E 3JC6C 4LFAT 3MACA 1HTJF 3CQCB 3BQKA 3J9X1 1YQ3A 3RRWA 3AEAA 3LBXB 4DR4T 4QX8B 4E7SA 2VQFT 4HE8A 4UV8B 3TLUA 3P4RA 3KVBA 2CBIA 5JR9A 3BQIA 5LHHB 2K5BB 1E2AA 3ONJA 5FP3A 4P0AA 2NR4A 3I9WA 4GKKT 3BQLA 4CN1A 3Q5XA 2WBLA 5LMNT 3ZC0A 3QUJA 3DJBA 1WYCA 4HWIB 4AQFC 3W15B 5HWXA 4JV5T 1UUSA 4MALA 2VKHA 2FUPA 2QYWA 4H9PC 2FBWA 1YXRA 3GMIA 3PUYF 5M4YA 3Q5EA 3P7IA 3O1HA 3ZKRA 2ACXA 2BVMA 3B13A 4U2ZA 2XPKA 3IBPA 2BZBA 3CX8B 3N5LA 2JQQA 2GK9A 1X79A 4ASKA 3AAEB 3ANWA 1M7KA 2V7KA 1XMOT 5CJ5A 4U7YA 1CUNA 3RGLA 4ILBA 2K9AA 2VKDA 5L3DB 5AFUL 2V6XA 3AE2A 4TWHA 1SE7A 3RC3A 5JQGE 4CXWA 3SWHA 3TKLB 3PV0F 4IDNA 1HG2A 4Z91A 3I0OA 5LBMA 5ABGA 4B3MT 2XTLA 4PJLA 2UUAT 3CMLA 1KF6A 5FXXA 1XDPA 4ZI3C 3LK3B 4IDOA 3AB3B 2BS2A 1IAPA 1WLXA 5AQPB 4IDZA 2CE7A 4HKAA 2YU1A 3L8RA 3EUHA 3RF1A 3RLFF 3GWHA 1HNWT 3PJAJ 2YINA 2JPFA 4ILCA 4I43B 4AQFA 2BBHA 1W0BA 2IC9A 1SUMB 2RPAA 1W0AA 3UUBA 2X9HA 2KINB 4ZHQE 2KLQA 5HXSA 4KP3C 4ERRA 2E5LT 1S35A 3LK2B 4PJJA 3C51A 5BR8T 4HFEA 2CXLA 2NTYA 5AQRB 4H9SE 1LVKA 4YJ3E 4F6RC 4EYYR 3ABVA 3VRAA 4X20E 1UX4A 3K3QC 3MXZA 3F31A 2HN2A 2J47A 4NXMT 3UU6A 4N78D 2IC6A 4H9RC 5E0OA 3GN5B 1Y01A 1D0ZA 4CI3B 1BR1A 4CN6A 1LKXA 2W2UA 4UVCB 5IUXA 1U5PA 4WYVA 5LGUB 3NZPA 1N34T 3K8PC 2BG9B 2YKSA 4YY3T 4G63A 5AQLB 2V6YA 4YXDA 4ISSA 5EZYE 4X1YE 3ZN1B 4K0KT 2VURA 2ZM2A 2J1DG 4IE0A 3Q2MA 3K1SA 1ZHCA 2DLRA 2YDQA 4KBMB 2D0TA 2L9QA 3PUZF 2X0YA 4QXHB 4EYUA 4E7ZA 2BS3A 3P50A 1T8BA 1WRDA 2CLYC 2OV9A 4EEDA 2CRBA 2Q9QD 2W0GA 4P0BA 3JAFA 4XZCA 4GK0E 2Y6XA 2WMNA 3RX6A 4ZZCA 4JI1T 1HNZT 5C2TA 2EHOC 4IHJE 5JDHA 2RA1A 1ZP0A 1OEDE 1MMNA 3QOFA 3AXJA 4HFIA 5HXEA 2ZM6T 4JI0T 3PUXF 2WM9A 4LFCT 3UULA 3RQUA 4PAGA 2LJLA 4A97A 2QGSA 4EAHA 4H9NC 3EVYA 3FHNA 4O2AE 2V7JA 2Q9QB 3IF8B 2CEAA 2A2FX 5LJMA 4C91A 4UF0A 5ABFB 1OEDC 2WWUA 4AQGA 2E9XD 2UUBT 4U72A 3HA4A 4TNWA 3CX6B 4DVDA 3UTKA 2C5IT 3ZSSA 5FY0A 2KMFA 1VRBA 3UFGA 2LLYA 3ESLA 4B3ST 4JLEA 2A3DA 4YJ2E 2XQ9A 3PJAA 3AAAB 2N1GA 4PK4A 5AQIB 4EEBA 2IUBA 1D1BA 5JDGA 5C3JA 4LF4T 4DMWA 4UV9B 5IYZE 5AQKB 4AXPA 2E9XB 5JDQA 3C4ZA 1XWMA 2M67A 2MYSA 2XSBA 2NW8A 1U4QA 3UUXB 2X9WA 4WBOA 3E22E 3O1IA 2WU5A 2EHOA 4H63H 3A7MA 3E0ZA 1T98A 3CK6A 3N9PA 1HX1B 4U33A 5JR9B 4QWNB 4H9OC 5FL0A 3IEEA 4X62T 1MNEA 3OPCA 3C98B 2KWIB 2ODUA 3SS1A 3UU5A 1R8IA 4B3TT 2XQAA 4EZHA 4B3RT 1Z8UA 3P8CD 3PUGA 1D0XA 3OKQA 4IGUA 3RRCA 3FBZA 4WZXA 3UQ7A 1D1CA 1OEDA 4Z8XA 1QSDA 4NUVA 3LG7A 3LK42 3P4SA 4O4HE 2FJBA 4O8SA 4I4TE 4HEAA 4YSXA 2XSAA 1HFAA 4DV2T 3P4QA 3L09A 4PK5A 2A72A 5KDMC 3FXDB 2H89A 2JQ9A 4DV7T 3ANWB 4DR3T 5FMNA 1FIOA 1HNXT 2VK9A 5LG4A 3EDUA 3TLWA 1YQ4A 2LKGA 2D0UA 2BDEA 4HFVA 3G06A 4DUZT 2WWVA 2ZM0A 3LFMA 4O4LE 4YFSA 3L39A 2BVLA 3CKDA 3AA6B 3V5UA 4JUYA 2YDSA 2DCFA 4U31A 5JDNA 4GYRA 3HI2A 1JNRA 1WR0A 4JI3T 1JNZA 4OYKA 1J5ET 5DQWA 3FZFB 5JRCA 3UU8A 4CI2B 4GK5E 3FZHB 2CWYA 5FY1A 2XQ5A 5AQQB 4WNKA 2E5VA 2V5CA 1WYBA 2J4GA 5JVDE 1KEYA 4LMJA 4MFRA 3N9OA 2XZEA 5ADXL 3O9XA 2PG8A 2AE9A 2LE8A 4DV0T 4IIJE 4JI2T 5AQVB 1MMGA 5LGTB 4QXCB 1J1JA 2X51A 4HN9A 4KHPT 2M6BA 4WW0A 3ZMSB 4QX7B 2C5KT 2LSYA 4JEHB 3AEEA 4PJMA 4PW8A 3ONLC 5C8YE 3FBLA 5CGMA 2VB6A 4YHHT 2E2AA 2YK0A 1YD8G 2KWHA 2X68A 5F5WA 3F2EA 4TX5A 5JREA 2W00A 1LVFA 2X0HA 4TV8E 3ZMTB 5H6RB 4IE5A 3AEBA 4LFBT 3PU3A 3UQ4A 1HS7A 1OWAA 3D0TA 1XNQT 3AE6A 2LM2A 4HWCA 4UEMA 4ZI3D 2BKPA 4Z90A 4HGAA 4PJNA 3H3AA 4X65T 4NPPA 5HEOA 5L2LA 4EB6E 2V8SV 5L3GB 2LT3A 2V6YB 1T7SA 5L3CB 2NTXA 4GIWA 5LHGB 3RH3A 2IDOB 3P4WA 2HPLA 4ZS2A 3AE9A 5LGNB 5HXCA 3IA3A 2PJQA 4O2BE 1YW0A 2YOEA 3CX7B 2Y8DA 5L3BB 2PBIA 2WZHA 2VL8A 3OBVE 2LRLA 1Y64B 4ZEYA 4OHFA 3CQXC 2OA5A 4HWDA 5F3JA 3SRZA 2WU2A 4P1NA 4U2YA 5JTGA 2B76A 2H88A 5BMVE 4K0UA 3A5XA 3A8YC 4FJOA 2VVSA 3AXJB 2KNDA 4LMKA 1NEKA 3UU4A 3ZEFB 2WSSV 4DUYT 3FZMB 1BR2A 2QRXA 4JI6T 4JBWF 1VCTA 4LF7T 4BJMA 4HFBA 2UXBT 2X9XA 4CQIA 3R6NA 4UF0B 4TUYE 3T8OA 5LJNA 3QB5K 4ANJA 4LF8T 2K24A 3LDQB 2X0LB 5DJQC 3NKZA 3ZN0B 2VKJA 5AQJB 2XAGB 3AAIA 1H7CA 4F8HA 4HWHA 3K3NA 1IZNB 4UVBB 4EGWA 2LSIA 5FXZA 5CB4E 2V7IA 3T1HT 3LSVA 2ODVA 3MZKB 3HKBE 2EHOD 5ABHA 5LB7B 2AXDS 5FKYA 2X9YA 4PK6A 3RKOA 1HX8A 5FXWA 3OTOT 4I0UA 2XJ7A 4KUMB 1VCSA 3AE8A 3H3MA 4AIUA 3VKGA 3S4UA 4U3CA 4ZI7E 2Y48B 2LOPA 3NRXA 4CXYA 1FJGT 3GA8A 2CLYB 4JI7T 1HG5A 4YT0A 2V5DA 5FNVE 2H3RA 2V1DB 4DBQA 1UCUA 4AKLA 4B6XA 2XAFB 4XBFB 4TWFA 5EK3A 3RIFA 3H37A 1UK5A 2EHOB 4EZ4A 2E8IA 2I0MA 1NWMX 2VL0A 4JI5T 4TZ4C 1MIYA 3FZKB 3ZMVB 4HWFA 5AQTB 4A98A 4AQYT 4UR9A 1XNRT 3M65A 1YKEB 1VOMA 5HCMA 3ZCJA 1I6ZA 3AE5A 3EI0A 2X66A 3ZYLA 4J2CA 2I6HA 2W66A 2BG9A 3B57A 3RI5A 4C90A 3PUVF 2IW5B 2ES0A 4IT4A 2D9DA 3AE1A 4YHJA 3PDYA 1OEDB 2CXDA 2LHNA 2MAWA 3C4XA 4QXBB 5AQGB 2UUCT 2CA5A 3FZLB 3VHLA 3ZT5A 3KFWX 5EK2A 2DL1A 5LCYA 5FVLA 3KV5A 3CVRA 2LHRA 4UELA 2M6IA 4LMLA 4ZI2C 3KV4A 3ZT6A 4CXXA 2J62A 2CBJA 2UXXB 2CHOA 2HHHT 4LF5T 4A5XA 4ZOLE 4DR5T 4EV6A 4GKJT 1UX5A 3MJXA 2JMKA 3QB5A 4L9IA 3OYXA 4YLHA 5FL1A 2FJDA 3DTOA 1UGOA 5F8PA 3TLTA 4YTNA 4V1Av 5KMGP 3KV6A 4MLKA 2YU2A 1QLBA 3CPZA 2V26A 3ZT7A 2I59A 3AECA 1XMQT 2DNXA 4M1PA 1I94T 1S94A 2CCQA 5J2TE 2D5UA 4I50E 4X66T 4UXNB 3VR8A 2PFVA 2JJ9A 5IHYA 5JDLA 5JRCB 5A1LA 5CA0E 1DU2A 5LG3A 3PUQA 1QUUA 4DV6T 3UU3A 2XQ4A 2BBJA 4PFOA 3RC8A 4YTPA 2WDVA 3OYZA 2W61A 5KX5E 2NOXA 1KNRA 2LM9A 2CXFA 4CN4A 5AQUB 2WQYA 1WCRA 2LSJA 2XUEA 2W67A 2BS4A 2D2SA 4COFA 3DP7A 5JH7E 5FY7A 2XHEB 4YSZA 2ACZA 3E08A 3JC6D 3MK7C 3NRYA 3J7Yq 1FMVA 1NENA 3C4WA 3RKGA 4ILUA 4BA9A 2XAJB 3F57A 2PTFA 4YSYA 2V7LA 1SA0E 1V9DA 2C5JA 5HCJA 2N9DA 5ETWA 3QNUA 5KXJA 3ZMUB 4ZXLA 3RYCE 3C64A 3AE7A 2XM2A 3ZJ1A 5J2UE 5DABA 2LRKA 1SHZC 1XZYA 4DBRA 1E1HB 4KX6A 2VQET 2WP9A 3PU8A 3PUAA 3PURA 1W9RA 5J1GA 5LOVE 3KV9A 5HXRA 3AEDA 4KHZF 2CHNA 5TAOA 5L47A 5LXTE 2CM0A 3LJCA 5AQSB 3FB2A 1MIWA 4OX9T 3N9LA 3ZMZB 2UU9T 4QH1A 1AJ3A 5H6QB 2NW7A 1KNZA 2ZMAA 4X64T 1N36T 4IL9A 2VKOA 4MHCA 1NAFA 2SPCA 3WAKA 3V5SA 3BK9A 1IBLT 2WAUA 2WMOA 3VRBA 1D1AA 2X67A 3I0QA 3AA0B 3ZCIA 5LMUT 4JYAT 4GYSA 2NP9A 3CQGB 4IREA 4TNVA 2UXDT 1G8XA 2XM1A 4DV3T 3CIRA 4L0RA 3HKEE 3RIUC 2K3WA 3ONXA 4NXNT 2L8KA 2DWGA 1N32T 1B7TA 5LNKA 3NWIA 3RYHE 3WI3A 3ZYKA 2CWOA 5L3EB 3ZC1A 3RQWA 1IBKT 2WS3A 5ABEA 2Z6EA 1YKHB 2JMHA 3N2OA 3KINB 3ETUA 3CWZB 1FEWA 3EDVA 4OFZA 3NVOA 4KI0F 2YN6A 3OJAA 3N2KE 4HFCA 4O4IE 1D0YA 4DV5T 4QHOA 5JDFA 4AKGA 3LBXA 4BAYB 2CMRA 3EAMA 3UFEA 2WCAA 2N2NA 5FYMA 5HXHA 2LKHA 5JDMA 3NZQA 3N9MA 3AE4A 5AQFB 4JEUB 4ZS3A 4DR7T 3PTRB 3K3OA 1W09A 2HPJA 3HR0A 3ZLIA 2H7VC 1BR0A 4UVAB 1WR6A 5LHIB 5FVKA 1N33T 3JCFA 4IDPA 5EK4A 4DV1T 2IMLA 2VVNA 5HEHA 2ZLYA 4UIGA 4ILAA 1ZEEA 4ISTA 5IWAT 1GQEA 3SOLA 4AISA 3AEFA 2YEVC 4H9QC 2ZM8A 3PUSA 4HFHA 3PE0A 3PUWF 4H63V 2JQKA 2KZ7B 2XQ7A 4AI6A 2BG9E 2LOSA 3X1DA 5LYJE 1ZKEA 3HL6A 1MMAA 2BKOA 4QH5A 3JAEA 4DV4T 2DI4A 3RIUA 4X1IE 3UT5E 5L4EA 3VU7H 3AA7B 5AQMB 1T72A 4IDQA 1IJ6A 3EABA 3KVAA 1MIVA 5CFBA 4IE4A 2BG9C 5J0ZA 2MPKA 2NWBA 4P09A 4PNIA 3VKHA 1FMWA 3N9NA 4OYJA 1IBMT 1Z0PA 4EXTA 3ZPOA 3RYIE 3SFEA 3Q5WA 2XQYA 5L4HA 1LRZA 4LF6T 4BJNA 1G73A 4FI5A 2QVAA 5AQHB 4ZZBA 3SFDA 2IIUA 4L5GA 1US7B 3RPUA 1MMDA 4JI8T 2VWAA 3RYFE 4DO0A 4DMVA 2CPTA 2XQ6A 3I1AA 3B5MA 2JQHA 5HEGA 2KSRA 1M62A 2G0UA 2LEHA 2XY8B 5HWYA 4CI1B 4AKRB 3KBTA 4IE6A 3MA9A 3UUMA 1MNDA 3IHRA 3QC9A 4AKHA 2YDRA 3AEGA 4CZZB 4DR1T 2UXNB 4GOUA 4U74A 1E7PA 4DR2T 4PFPA 1CHUA 3O4XE 2Q9QC 3HKDE 1HF8A 3EHZA 3QK6A 3HKCE 3U3IA 2WZIA 2MOZA 2MTQA 2DHRA 3WAJA 2WDRA 3GN5A 4WBNE 3AVSA 2MBGA 4U7IA 2JRKA 3ZSTA 4TN7B 1WFDA 2L3LA 2FJAA 2A9UA 4QH4A 5LA6E 2UXCT 2B1EA 3R84B 1OXZA 4ZI2D 4YTMA 2WDQA 2KT9A 4TV9E 3RIAA 3ZJ2A 3TLVA 1UURA 5DQVA 2RP4A 2K48A 1BR4A 2P9BA 2V7MA 1J5WA 2OLTA 3JADA 1ZV4X 4IE7A 4OK0A 4A56A 2E9XC 4AKIA 3VR9A 3P4PA 2XAQB 1IJ5A 1X9BA 1HR0T 5FXVA 4XAXB 3C50A 3FXEB 4KMCA 3ZYMA 4EOZB 3AA1B 2XAHB 4EIWA 3TLSA 1KK7A 3Q9DA 2XQ8A 1KNPA 2FJEA 4O4JE 5JR9C 2XQ3A 2HN1A 4Q25A 3N9QA 3T1YT 4G2AA 1L0VA 5HEUA 3I9YA 2IAKA 3ETVA 1ZOYA 5HYAA 2DWKA 3NBXX 5GONE 3L3PA 1EZ3A 4DNDA 2Q9QA 3RHWA 2NW9A 2W63A 4NIQA 4TWDA 3AE3A 5AQOB 2IHR1 3OVUA 5ABFA 4HFDA 2QA7A 2VASA 2W4XA 4DR6T 5L3FB 2F4VT 4I55E 3UUNA 4HTEA 4NUUA 5LBQB 3KDSE 2WB5A 4ADZA 4JI4T 1KFYA 2JIWA 2R6GF 5HAXA 4X1KE 5LP6E 3KBUA 3Q5DA 2BKNA 2HH7A 2WY2A 2XASB 4IL4A 2LSKA 3AVRA 3U78A 5AQNB 2KXPB 3O1JA
chains in the Genus database with same CATH topology
1VRBA 2C0SA 4O4IE 3MKDA 1D0YA 3ESLA 4QHOA 5JDFA 4AKGA 3N2GE 2K24A 4QKNA 2E9XA 2X0LB 4JLEA 5DJQC 3LBXA 4BAYB 2A3DA 3ZN0B 2LSGA 4YJ2E 2VKJA 2CMRA 2XAGB 3AAAB 2H7OA 2N1GA 3AAIA 1O3XA 4MBQA 1HCIA 2W62A 3UFEA 1H7CA 5CA1E 2N2NA 4PK4A 3K3NA 1D1BA 1IZNB 3JC6C 4UVBB 5JDGA 2LSIA 3MACA 5FXZA 5CB4E 4DMWA 4UV9B 5FYMA 5IYZE 5HXHA 5JDMA 2V7IA 1HTJF 3NZQA 3CQCB 2ODVA 3BQKA 3MZKB 3HKBE 3J9X1 2EHOD 3N9MA 4AXPA 2E9XB 3RRWA 5JDQA 3LBXB 3C4ZA 4QX8B 4JEUB 4ZS3A 4E7SA 3PTRB 4HE8A 4UV8B 2X9YA 3K3OA 4PK6A 3RKOA 2HPJA 3HR0A 3KVBA 1HX8A 3ZLIA 2M67A 2H7VC 2MYSA 5JR9A 1BR0A 2NW8A 4UVAB 1U4QA 3BQIA 5FXWA 3UUXB 2X9WA 4KUMB 4WBOA 5LHHB 2K5BB 1WR6A 5LHIB 3VKGA 5FP3A 3S4UA 3E22E 4ZI7E 2Y48B 3O1IA 4P0AA 2LOPA 5EK4A 3NRXA 4CXYA 3I9WA 3BQLA 2EHOA 3GA8A 2CLYB 4H63H 3Q5XA 2ZLYA 2WBLA 4UIGA 3E0ZA 1T98A 1ZEEA 3N9PA 4ISTA 3ZC0A 1HG5A 3DJBA 3QUJA 4QWNB 3SOLA 5JR9B 5FNVE 1WYCA 4H9OC 2H3RA 2V1DB 3IEEA 4DBQA 4AQFC 1UCUA 1MNEA 4AKLA 2YEVC 4H9QC 3C98B 3W15B 5HWXA 2ZM8A 2KWIB 3PUSA 2ODUA 4B6XA 2XAFB 3SS1A 4XBFB 4MALA 3PE0A 5EK3A 2VKHA 4H63V 2KZ7B 3H37A 4AI6A 2EHOB 2LOSA 4EZ4A 2E8IA 5LYJE 4EZHA 3P8CD 1ZKEA 3HL6A 1NWMX 3PUGA 1D0XA 1MMAA 3OKQA 4H9PC 4IGUA 3RRCA 3FBZA 3GMIA 4TZ4C 1MIYA 5M4YA 2DI4A 4X1IE 3UT5E 3ZMVB 3P7IA 3VU7H 3O1HA 1D1CA 2ACXA 2BVMA 3AA7B 3M65A 3B13A 4Z8XA 3IBPA 1YKEB 2BZBA 1QSDA 3CX8B 3N5LA 2JQQA 1VOMA 4NUVA 3ZCJA 1IJ6A 2GK9A 1X79A 4ASKA 3KVAA 3AAEB 1MIVA 2X66A 3LG7A 3LK42 3ZYLA 4IE4A 4J2CA 4O4HE 3ANWA 2V7KA 3B57A 4C90A 2IW5B 2NWBA 2ES0A 4O8SA 4I4TE 4P09A 4HEAA 1HFAA 4YHJA 4PNIA 1CUNA 3PDYA 2CXDA 3VKHA 2LHNA 3C4XA 3L09A 4PK5A 4QXBB 2A72A 2CA5A 3VHLA 1FMWA 2K9AA 5KDMC 3KFWX 5EK2A 2VKDA 5LCYA 3FXDB 5L3DB 3KV5A 5AFUL 3N9NA 4OYJA 3ANWB 3CVRA 5FMNA 1FIOA 2LHRA 1Z0PA 2VK9A 3ZPOA 4EXTA 4UELA 3RC3A 5JQGE 5LG4A 3RYIE 3EDUA 4CXWA 4ZI2C 2D0UA 3KV4A 3Q5WA 2XQYA 3SWHA 2BDEA 4HFVA 1LRZA 4BJNA 1G73A 4FI5A 3TKLB 4CXXA 2ZM0A 1HG2A 3LFMA 4O4LE 2UXXB 4YFSA 2BVLA 3CKDA 3AA6B 3I0OA 4L5GA 4ZOLE 5LBMA 3V5UA 4JUYA 1UX5A 1US7B 3MJXA 2JMKA 2DCFA 4L9IA 3OYXA 5JDNA 4YLHA 4GYRA 3RPUA 1MMDA 3DTOA 5F8PA 2VWAA 3RYFE 3HI2A 4DO0A 4V1Av 4DMVA 3I1AA 5KMGP 4OYKA 3KV6A 2XTLA 5DQWA 4MLKA 2YU2A 4PJLA 3CPZA 5JRCA 3CMLA 5FXXA 4ZI3C 3LK3B 4GK5E 4CI2B 2V26A 2I59A 2DNXA 3AB3B 4M1PA 2CWYA 2G0UA 2LEHA 5FY1A 1IAPA 1S94A 2CCQA 5HWYA 2D5UA 4AKRB 4CI1B 5J2TE 1WLXA 3KBTA 4IDZA 2CE7A 4HKAA 4WNKA 4IE6A 2YU1A 3MA9A 3EUHA 4I50E 3UUMA 4UXNB 3GWHA 1WYBA 1MNDA 2PFVA 3IHRA 2JJ9A 2YINA 5JVDE 2JPFA 3QC9A 4I43B 4AQFA 4AKHA 5IHYA 4MFRA 5JDLA 3N9OA 5ADXL 2IC9A 3O9XA 5A1LA 5JRCB 2PG8A 4CZZB 5CA0E 2UXNB 2LE8A 4GOUA 4U74A 4IIJE 2X9HA 2KINB 4ZHQE 3PUQA 4PFPA 1QUUA 2KLQA 1MMGA 5LGTB 4QXCB 3O4XE 2Q9QC 3HKDE 2X51A 4PFOA 1HF8A 3RC8A 4HN9A 3QK6A 5HXSA 3OYZA 4KP3C 3HKCE 2W61A 4ERRA 1S35A 3LK2B 3U3IA 5KX5E 2NOXA 4WW0A 4PJJA 3C51A 2MOZA 3ZMSB 2MTQA 2LM9A 2CXFA 4QX7B 2CXLA 2C5KT 2LSYA 2DHRA 2LSJA 2NTYA 3WAJA 4H9SE 1LVKA 2XUEA 4JEHB 3GN5A 4YJ3E 4F6RC 2D2SA 4WBNE 4EYYR 3AVSA 3DP7A 2MBGA 4PJMA 4PW8A 4X20E 1UX4A 3K3QC 3MXZA 3F31A 5JH7E 5C8YE 5FY7A 2XHEB 2JRKA 4TN7B 3FBLA 2L3LA 3E08A 2VB6A 3JC6D 3MK7C 3NRYA 5LA6E 3J7Yq 2B1EA 3R84B 1FMVA 1OXZA 4ZI2D 3C4WA 4N78D 2IC6A 2KT9A 4H9RC 4ILUA 4TV9E 5E0OA 3ZJ2A 4BA9A 2YK0A 3GN5B 1YD8G 2XAJB 3F57A 1D0ZA 5DQVA 2KWHA 1BR1A 2RP4A 4CI3B 1LKXA 2K48A 2X68A 4UVCB 1U5PA 1BR4A 2V7LA 2P9BA 3F2EA 2V7MA 4TX5A 1SA0E 5LGUB 3NZPA 1V9DA 2C5JA 5JREA 2W00A 2N9DA 1LVFA 3K8PC 5ETWA 4TV8E 3ZMTB 5H6RB 4IE5A 4G63A 3PU3A 3ZMUB 1HS7A 1ZV4X 1OWAA 3D0TA 3RYCE 4IE7A 4OK0A 4ISSA 3C64A 3ZJ1A 5J2UE 5DABA 4A56A 2E9XC 4AKIA 5EZYE 4UEMA 4ZI3D 1SHZC 2XAQB 4X1YE 1IJ5A 3ZN1B 4HGAA 5FXVA 4PJNA 2ZM2A 2J1DG 3H3AA 4XAXB 4DBRA 1E1HB 3Q2MA 4IE0A 3C50A 5L2LA 1ZHCA 3FXEB 4EB6E 2DLRA 3PU8A 3PUAA 5L3GB 4KBMB 2LT3A 3PURA 2D0TA 4KMCA 2L9QA 3ZYMA 4EOZB 3AA1B 2XAHB 4EIWA 5J1GA 5L3CB 1KK7A 5LOVE 2NTXA 4QXHB 3KV9A 4GIWA 4EYUA 5LHGB 5HXRA 3Q9DA 3RH3A 4E7ZA 2HPLA 5TAOA 4ZS2A 5LXTE 1WRDA 2CLYC 2CM0A 3LJCA 5LGNB 2Q9QD 2W0GA 4P0BA 4O4JE 4XZCA 5JR9C 5HXCA 4GK0E 3FB2A 1MIWA 2Y6XA 3N9LA 3ZMZB 2WMNA 2PJQA 3N9QA 4O2BE 3RX6A 1AJ3A 4G2AA 5H6QB 1YW0A 2NW7A 1KNZA 2ZMAA 3CX7B 2VKOA 2EHOC 2Y8DA 3I9YA 4IHJE 2IAKA 4MHCA 5L3BB 3ETVA 1NAFA 2PBIA 2VL8A 3OBVE 5JDHA 2SPCA 5HYAA 2RA1A 2DWKA 3WAKA 3NBXX 5GONE 3L3PA 1EZ3A 3V5SA 1Y64B 4DNDA 2Q9QA 1MMNA 3BK9A 2NW9A 2W63A 4OHFA 3CQXC 2WAUA 5HXEA 2OA5A 2WMOA 5F3JA 2WM9A 1D1AA 3SRZA 3UULA 2X67A 3I0QA 3AA0B 3ZCIA 2QA7A 2VASA 4GYSA 4PAGA 2NP9A 5BMVE 3CQGB 5L3FB 4K0UA 2LJLA 1G8XA 3A5XA 4I55E 4EAHA 2QGSA 4H9NC 4L0RA 3HKEE 3EVYA 3FHNA 3ONXA 4FJOA 4O2AE 2V7JA 2Q9QB 3UUNA 4HTEA 3IF8B 2CEAA 2A2FX 4NUUA 5LJMA 4C91A 4ANJA 2KNDA 5LBQB 4UF0A 2L8KA 2DWGA 3KDSE 4ADZA 3ZEFB 1B7TA 5LNKA 4AQGA 2WWUA 2E9XD 2WSSV 3RYHE 3WI3A 3ZYKA 1BR2A 2CWOA 5L3EB 3ZC1A 5HAXA 4U72A 4X1KE 4BJMA 2Z6EA 2X9XA 4CQIA 3HA4A 5LP6E 1YKHB 2JMHA 3CX6B 4DVDA 3N2OA 3KBUA 3UTKA 2C5IT 3KINB 2HH7A 3ETUA 3R6NA 2XASB 3CWZB 4UF0B 1FEWA 2LSKA 3AVRA 3EDVA 4OFZA 4TUYE 3T8OA 5FY0A 3OJAA 2KMFA 5LJNA 3U78A 3N2KE 2KXPB 3O1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9X D;  2EHO B;  2Q9Q C;  2EHO A;  2Q9Q B;  3ANW A;  3JC6 D;  2E9X A; 
#chains in the Genus database with same CATH topology
 2C0S A;  4X5T A;  3MKD A;  4LF9 T;  3N2G E;  4QKN A;  2E9X A;  5HEJ A;  2LSG A;  1XDO A;  3M3Z B;  2H7O A;  4DID B;  1O3X A;  4MBQ A;  1HCI A;  2W62 A;  5CA1 E;  3JC6 C;  4LFA T;  3MAC A;  1HTJ F;  3CQC B;  3BQK A;  3J9X 1;  1YQ3 A;  3RRW A;  3AEA A;  3LBX B;  4DR4 T;  4QX8 B;  4E7S A;  2VQF T;  4HE8 A;  4UV8 B;  3TLU A;  3P4R A;  3KVB A;  2CBI A;  5JR9 A;  3BQI A;  5LHH B;  2K5B B;  1E2A A;  3ONJ A;  5FP3 A;  4P0A A;  2NR4 A;  3I9W A;  4GKK T;  3BQL A;  4CN1 A;  3Q5X A;  2WBL A;  5LMN T;  3ZC0 A;  3QUJ A;  3DJB A;  1WYC A;  4HWI B;  4AQF C;  3W15 B;  5HWX A;  4JV5 T;  1UUS A;  4MAL A;  2VKH A;  2FUP A;  2QYW A;  4H9P C;  2FBW A;  1YXR A;  3GMI A;  3PUY F;  5M4Y A;  3Q5E A;  3P7I A;  3O1H A;  3ZKR A;  2ACX A;  2BVM A;  3B13 A;  4U2Z A;  2XPK A;  3IBP A;  2BZB A;  3CX8 B;  3N5L A;  2JQQ A;  2GK9 A;  1X79 A;  4ASK A;  3AAE B;  3ANW A;  1M7K A;  2V7K A;  1XMO T;  5CJ5 A;  4U7Y A;  1CUN A;  3RGL A;  4ILB A;  2K9A A;  2VKD A;  5L3D B;  5AFU L;  2V6X A;  3AE2 A;  4TWH A;  1SE7 A;  3RC3 A;  5JQG E;  4CXW A;  3SWH A;  3TKL B;  3PV0 F;  4IDN A;  1HG2 A;  4Z91 A;  3I0O A;  5LBM A;  5ABG A;  4B3M T;  2XTL A;  4PJL A;  2UUA T;  3CML A;  1KF6 A;  5FXX A;  1XDP A;  4ZI3 C;  3LK3 B;  4IDO A;  3AB3 B;  2BS2 A;  1IAP A;  1WLX A;  5AQP B;  4IDZ A;  2CE7 A;  4HKA A;  2YU1 A;  3L8R A;  3EUH A;  3RF1 A;  3RLF F;  3GWH A;  1HNW T;  3PJA J;  2YIN A;  2JPF A;  4ILC A;  4I43 B;  4AQF A;  2BBH A;  1W0B A;  2IC9 A;  1SUM B;  2RPA A;  1W0A A;  3UUB A;  2X9H A;  2KIN B;  4ZHQ E;  2KLQ A;  5HXS A;  4KP3 C;  4ERR A;  2E5L T;  1S35 A;  3LK2 B;  4PJJ A;  3C51 A;  5BR8 T;  4HFE A;  2CXL A;  2NTY A;  5AQR B;  4H9S E;  1LVK A;  4YJ3 E;  4F6R C;  4EYY R;  3ABV A;  3VRA A;  4X20 E;  1UX4 A;  3K3Q C;  3MXZ A;  3F31 A;  2HN2 A;  2J47 A;  4NXM T;  3UU6 A;  4N78 D;  2IC6 A;  4H9R C;  5E0O A;  3GN5 B;  1Y01 A;  1D0Z A;  4CI3 B;  1BR1 A;  4CN6 A;  1LKX A;  2W2U A;  4UVC B;  5IUX A;  1U5P A;  4WYV A;  5LGU B;  3NZP A;  1N34 T;  3K8P C;  2BG9 B;  2YKS A;  4YY3 T;  4G63 A;  5AQL B;  2V6Y A;  4YXD A;  4ISS A;  5EZY E;  4X1Y E;  3ZN1 B;  4K0K T;  2VUR A;  2ZM2 A;  2J1D G;  4IE0 A;  3Q2M A;  3K1S A;  1ZHC A;  2DLR A;  2YDQ A;  4KBM B;  2D0T A;  2L9Q A;  3PUZ F;  2X0Y A;  4QXH B;  4EYU A;  4E7Z A;  2BS3 A;  3P50 A;  1T8B A;  1WRD A;  2CLY C;  2OV9 A;  4EED A;  2CRB A;  2Q9Q D;  2W0G A;  4P0B A;  3JAF A;  4XZC A;  4GK0 E;  2Y6X A;  2WMN A;  3RX6 A;  4ZZC A;  4JI1 T;  1HNZ T;  5C2T A;  2EHO C;  4IHJ E;  5JDH A;  2RA1 A;  1ZP0 A;  1OED E;  1MMN A;  3QOF A;  3AXJ A;  4HFI A;  5HXE A;  2ZM6 T;  4JI0 T;  3PUX F;  2WM9 A;  4LFC T;  3UUL A;  3RQU A;  4PAG A;  2LJL A;  4A97 A;  2QGS A;  4EAH A;  4H9N C;  3EVY A;  3FHN A;  4O2A E;  2V7J A;  2Q9Q B;  3IF8 B;  2CEA A;  2A2F X;  5LJM A;  4C91 A;  4UF0 A;  5ABF B;  1OED C;  2WWU A;  4AQG A;  2E9X D;  2UUB T;  4U72 A;  3HA4 A;  4TNW A;  3CX6 B;  4DVD A;  3UTK A;  2C5I T;  3ZSS A;  5FY0 A;  2KMF A;  1VRB A;  3UFG A;  2LLY A;  3ESL A;  4B3S T;  4JLE A;  2A3D A;  4YJ2 E;  2XQ9 A;  3PJA A;  3AAA B;  2N1G A;  4PK4 A;  5AQI B;  4EEB A;  2IUB A;  1D1B A;  5JDG A;  5C3J A;  4LF4 T;  4DMW A;  4UV9 B;  5IYZ E;  5AQK B;  4AXP A;  2E9X B;  5JDQ A;  3C4Z A;  1XWM A;  2M67 A;  2MYS A;  2XSB A;  2NW8 A;  1U4Q A;  3UUX B;  2X9W A;  4WBO A;  3E22 E;  3O1I A;  2WU5 A;  2EHO A;  4H63 H;  3A7M A;  3E0Z A;  1T98 A;  3CK6 A;  3N9P A;  1HX1 B;  4U33 A;  5JR9 B;  4QWN B;  4H9O C;  5FL0 A;  3IEE A;  4X62 T;  1MNE A;  3OPC A;  3C98 B;  2KWI B;  2ODU A;  3SS1 A;  3UU5 A;  1R8I A;  4B3T T;  2XQA A;  4EZH A;  4B3R T;  1Z8U A;  3P8C D;  3PUG A;  1D0X A;  3OKQ A;  4IGU A;  3RRC A;  3FBZ A;  4WZX A;  3UQ7 A;  1D1C A;  1OED A;  4Z8X A;  1QSD A;  4NUV A;  3LG7 A;  3LK4 2;  3P4S A;  4O4H E;  2FJB A;  4O8S A;  4I4T E;  4HEA A;  4YSX A;  2XSA A;  1HFA A;  4DV2 T;  3P4Q A;  3L09 A;  4PK5 A;  2A72 A;  5KDM C;  3FXD B;  2H89 A;  2JQ9 A;  4DV7 T;  3ANW B;  4DR3 T;  5FMN A;  1FIO A;  1HNX T;  2VK9 A;  5LG4 A;  3EDU A;  3TLW A;  1YQ4 A;  2LKG A;  2D0U A;  2BDE A;  4HFV A;  3G06 A;  4DUZ T;  2WWV A;  2ZM0 A;  3LFM A;  4O4L E;  4YFS A;  3L39 A;  2BVL A;  3CKD A;  3AA6 B;  3V5U A;  4JUY A;  2YDS A;  2DCF A;  4U31 A;  5JDN A;  4GYR A;  3HI2 A;  1JNR A;  1WR0 A;  4JI3 T;  1JNZ A;  4OYK A;  1J5E T;  5DQW A;  3FZF B;  5JRC A;  3UU8 A;  4CI2 B;  4GK5 E;  3FZH B;  2CWY A;  5FY1 A;  2XQ5 A;  5AQQ B;  4WNK A;  2E5V A;  2V5C A;  1WYB A;  2J4G A;  5JVD E;  1KEY A;  4LMJ A;  4MFR A;  3N9O A;  2XZE A;  5ADX L;  3O9X A;  2PG8 A;  2AE9 A;  2LE8 A;  4DV0 T;  4IIJ E;  4JI2 T;  5AQV B;  1MMG A;  5LGT B;  4QXC B;  1J1J A;  2X51 A;  4HN9 A;  4KHP T;  2M6B A;  4WW0 A;  3ZMS B;  4QX7 B;  2C5K T;  2LSY A;  4JEH B;  3AEE A;  4PJM A;  4PW8 A;  3ONL C;  5C8Y E;  3FBL A;  5CGM A;  2VB6 A;  4YHH T;  2E2A A;  2YK0 A;  1YD8 G;  2KWH A;  2X68 A;  5F5W A;  3F2E A;  4TX5 A;  5JRE A;  2W00 A;  1LVF A;  2X0H A;  4TV8 E;  3ZMT B;  5H6R B;  4IE5 A;  3AEB A;  4LFB T;  3PU3 A;  3UQ4 A;  1HS7 A;  1OWA A;  3D0T A;  1XNQ T;  3AE6 A;  2LM2 A;  4HWC A;  4UEM A;  4ZI3 D;  2BKP A;  4Z90 A;  4HGA A;  4PJN A;  3H3A A;  4X65 T;  4NPP A;  5HEO A;  5L2L A;  4EB6 E;  2V8S V;  5L3G B;  2LT3 A;  2V6Y B;  1T7S A;  5L3C B;  2NTX A;  4GIW A;  5LHG B;  3RH3 A;  2IDO B;  3P4W A;  2HPL A;  4ZS2 A;  3AE9 A;  5LGN B;  5HXC A;  3IA3 A;  2PJQ A;  4O2B E;  1YW0 A;  2YOE A;  3CX7 B;  2Y8D A;  5L3B B;  2PBI A;  2WZH A;  2VL8 A;  3OBV E;  2LRL A;  1Y64 B;  4ZEY A;  4OHF A;  3CQX C;  2OA5 A;  4HWD A;  5F3J A;  3SRZ A;  2WU2 A;  4P1N A;  4U2Y A;  5JTG A;  2B76 A;  2H88 A;  5BMV E;  4K0U A;  3A5X A;  3A8Y C;  4FJO A;  2VVS A;  3AXJ B;  2KND A;  4LMK A;  1NEK A;  3UU4 A;  3ZEF B;  2WSS V;  4DUY T;  3FZM B;  1BR2 A;  2QRX A;  4JI6 T;  4JBW F;  1VCT A;  4LF7 T;  4BJM A;  4HFB A;  2UXB T;  2X9X A;  4CQI A;  3R6N A;  4UF0 B;  4TUY E;  3T8O A;  5LJN A;  3QB5 K;  4ANJ A;  4LF8 T;  2K24 A;  3LDQ B;  2X0L B;  5DJQ C;  3NKZ A;  3ZN0 B;  2VKJ A;  5AQJ B;  2XAG B;  3AAI A;  1H7C A;  4F8H A;  4HWH A;  3K3N A;  1IZN B;  4UVB B;  4EGW A;  2LSI A;  5FXZ A;  5CB4 E;  2V7I A;  3T1H T;  3LSV A;  2ODV A;  3MZK B;  3HKB E;  2EHO D;  5ABH A;  5LB7 B;  2AXD S;  5FKY A;  2X9Y A;  4PK6 A;  3RKO A;  1HX8 A;  5FXW A;  3OTO T;  4I0U A;  2XJ7 A;  4KUM B;  1VCS A;  3AE8 A;  3H3M A;  4AIU A;  3VKG A;  3S4U A;  4U3C A;  4ZI7 E;  2Y48 B;  2LOP A;  3NRX A;  4CXY A;  1FJG T;  3GA8 A;  2CLY B;  4JI7 T;  1HG5 A;  4YT0 A;  2V5D A;  5FNV E;  2H3R A;  2V1D B;  4DBQ A;  1UCU A;  4AKL A;  4B6X A;  2XAF B;  4XBF B;  4TWF A;  5EK3 A;  3RIF A;  3H37 A;  1UK5 A;  2EHO B;  4EZ4 A;  2E8I A;  2I0M A;  1NWM X;  2VL0 A;  4JI5 T;  4TZ4 C;  1MIY A;  3FZK B;  3ZMV B;  4HWF A;  5AQT B;  4A98 A;  4AQY T;  4UR9 A;  1XNR T;  3M65 A;  1YKE B;  1VOM A;  5HCM A;  3ZCJ A;  1I6Z A;  3AE5 A;  3EI0 A;  2X66 A;  3ZYL A;  4J2C A;  2I6H A;  2W66 A;  2BG9 A;  3B57 A;  3RI5 A;  4C90 A;  3PUV F;  2IW5 B;  2ES0 A;  4IT4 A;  2D9D A;  3AE1 A;  4YHJ A;  3PDY A;  1OED B;  2CXD A;  2LHN A;  2MAW A;  3C4X A;  4QXB B;  5AQG B;  2UUC T;  2CA5 A;  3FZL B;  3VHL A;  3ZT5 A;  3KFW X;  5EK2 A;  2DL1 A;  5LCY A;  5FVL A;  3KV5 A;  3CVR A;  2LHR A;  4UEL A;  2M6I A;  4LML A;  4ZI2 C;  3KV4 A;  3ZT6 A;  4CXX A;  2J62 A;  2CBJ A;  2UXX B;  2CHO A;  2HHH T;  4LF5 T;  4A5X A;  4ZOL E;  4DR5 T;  4EV6 A;  4GKJ T;  1UX5 A;  3MJX A;  2JMK A;  3QB5 A;  4L9I A;  3OYX A;  4YLH A;  5FL1 A;  2FJD A;  3DTO A;  1UGO A;  5F8P A;  3TLT A;  4YTN A;  4V1A v;  5KMG P;  3KV6 A;  4MLK A;  2YU2 A;  1QLB A;  3CPZ A;  2V26 A;  3ZT7 A;  2I59 A;  3AEC A;  1XMQ T;  2DNX A;  4M1P A;  1I94 T;  1S94 A;  2CCQ A;  5J2T E;  2D5U A;  4I50 E;  4X66 T;  4UXN B;  3VR8 A;  2PFV A;  2JJ9 A;  5IHY A;  5JDL A;  5JRC B;  5A1L A;  5CA0 E;  1DU2 A;  5LG3 A;  3PUQ A;  1QUU A;  4DV6 T;  3UU3 A;  2XQ4 A;  2BBJ A;  4PFO A;  3RC8 A;  4YTP A;  2WDV A;  3OYZ A;  2W61 A;  5KX5 E;  2NOX A;  1KNR A;  2LM9 A;  2CXF A;  4CN4 A;  5AQU B;  2WQY A;  1WCR A;  2LSJ A;  2XUE A;  2W67 A;  2BS4 A;  2D2S A;  4COF A;  3DP7 A;  5JH7 E;  5FY7 A;  2XHE B;  4YSZ A;  2ACZ A;  3E08 A;  3JC6 D;  3MK7 C;  3NRY A;  3J7Y q;  1FMV A;  1NEN A;  3C4W A;  3RKG A;  4ILU A;  4BA9 A;  2XAJ B;  3F57 A;  2PTF A;  4YSY A;  2V7L A;  1SA0 E;  1V9D A;  2C5J A;  5HCJ A;  2N9D A;  5ETW A;  3QNU A;  5KXJ A;  3ZMU B;  4ZXL A;  3RYC E;  3C64 A;  3AE7 A;  2XM2 A;  3ZJ1 A;  5J2U E;  5DAB A;  2LRK A;  1SHZ C;  1XZY A;  4DBR A;  1E1H B;  4KX6 A;  2VQE T;  2WP9 A;  3PU8 A;  3PUA A;  3PUR A;  1W9R A;  5J1G A;  5LOV E;  3KV9 A;  5HXR A;  3AED A;  4KHZ F;  2CHN A;  5TAO A;  5L47 A;  5LXT E;  2CM0 A;  3LJC A;  5AQS B;  3FB2 A;  1MIW A;  4OX9 T;  3N9L A;  3ZMZ B;  2UU9 T;  4QH1 A;  1AJ3 A;  5H6Q B;  2NW7 A;  1KNZ A;  2ZMA A;  4X64 T;  1N36 T;  4IL9 A;  2VKO A;  4MHC A;  1NAF A;  2SPC A;  3WAK A;  3V5S A;  3BK9 A;  1IBL T;  2WAU A;  2WMO A;  3VRB A;  1D1A A;  2X67 A;  3I0Q A;  3AA0 B;  3ZCI A;  5LMU T;  4JYA T;  4GYS A;  2NP9 A;  3CQG B;  4IRE A;  4TNV A;  2UXD T;  1G8X A;  2XM1 A;  4DV3 T;  3CIR A;  4L0R A;  3HKE E;  3RIU C;  2K3W A;  3ONX A;  4NXN T;  2L8K A;  2DWG A;  1N32 T;  1B7T A;  5LNK A;  3NWI A;  3RYH E;  3WI3 A;  3ZYK A;  2CWO A;  5L3E B;  3ZC1 A;  3RQW A;  1IBK T;  2WS3 A;  5ABE A;  2Z6E A;  1YKH B;  2JMH A;  3N2O A;  3KIN B;  3ETU A;  3CWZ B;  1FEW A;  3EDV A;  4OFZ A;  3NVO A;  4KI0 F;  2YN6 A;  3OJA A;  3N2K E;  4HFC A;  4O4I E;  1D0Y A;  4DV5 T;  4QHO A;  5JDF A;  4AKG A;  3LBX A;  4BAY B;  2CMR A;  3EAM A;  3UFE A;  2WCA A;  2N2N A;  5FYM A;  5HXH A;  2LKH A;  5JDM A;  3NZQ A;  3N9M A;  3AE4 A;  5AQF B;  4JEU B;  4ZS3 A;  4DR7 T;  3PTR B;  3K3O A;  1W09 A;  2HPJ A;  3HR0 A;  3ZLI A;  2H7V C;  1BR0 A;  4UVA B;  1WR6 A;  5LHI B;  5FVK A;  1N33 T;  3JCF A;  4IDP A;  5EK4 A;  4DV1 T;  2IML A;  2VVN A;  5HEH A;  2ZLY A;  4UIG A;  4ILA A;  1ZEE A;  4IST A;  5IWA T;  1GQE A;  3SOL A;  4AIS A;  3AEF A;  2YEV C;  4H9Q C;  2ZM8 A;  3PUS A;  4HFH A;  3PE0 A;  3PUW F;  4H63 V;  2JQK A;  2KZ7 B;  2XQ7 A;  4AI6 A;  2BG9 E;  2LOS A;  3X1D A;  5LYJ E;  1ZKE A;  3HL6 A;  1MMA A;  2BKO A;  4QH5 A;  3JAE A;  4DV4 T;  2DI4 A;  3RIU A;  4X1I E;  3UT5 E;  5L4E A;  3VU7 H;  3AA7 B;  5AQM B;  1T72 A;  4IDQ A;  1IJ6 A;  3EAB A;  3KVA A;  1MIV A;  5CFB A;  4IE4 A;  2BG9 C;  5J0Z A;  2MPK A;  2NWB A;  4P09 A;  4PNI A;  3VKH A;  1FMW A;  3N9N A;  4OYJ A;  1IBM T;  1Z0P A;  4EXT A;  3ZPO A;  3RYI E;  3SFE A;  3Q5W A;  2XQY A;  5L4H A;  1LRZ A;  4LF6 T;  4BJN A;  1G73 A;  4FI5 A;  2QVA A;  5AQH B;  4ZZB A;  3SFD A;  2IIU A;  4L5G A;  1US7 B;  3RPU A;  1MMD A;  4JI8 T;  2VWA A;  3RYF E;  4DO0 A;  4DMV A;  2CPT A;  2XQ6 A;  3I1A A;  3B5M A;  2JQH A;  5HEG A;  2KSR A;  1M62 A;  2G0U A;  2LEH A;  2XY8 B;  5HWY A;  4CI1 B;  4AKR B;  3KBT A;  4IE6 A;  3MA9 A;  3UUM A;  1MND A;  3IHR A;  3QC9 A;  4AKH A;  2YDR A;  3AEG A;  4CZZ B;  4DR1 T;  2UXN B;  4GOU A;  4U74 A;  1E7P A;  4DR2 T;  4PFP A;  1CHU A;  3O4X E;  2Q9Q C;  3HKD E;  1HF8 A;  3EHZ A;  3QK6 A;  3HKC E;  3U3I A;  2WZI A;  2MOZ A;  2MTQ A;  2DHR A;  3WAJ A;  2WDR A;  3GN5 A;  4WBN E;  3AVS A;  2MBG A;  4U7I A;  2JRK A;  3ZST A;  4TN7 B;  1WFD A;  2L3L A;  2FJA A;  2A9U A;  4QH4 A;  5LA6 E;  2UXC T;  2B1E A;  3R84 B;  1OXZ A;  4ZI2 D;  4YTM A;  2WDQ A;  2KT9 A;  4TV9 E;  3RIA A;  3ZJ2 A;  3TLV A;  1UUR A;  5DQV A;  2RP4 A;  2K48 A;  1BR4 A;  2P9B A;  2V7M A;  1J5W A;  2OLT A;  3JAD A;  1ZV4 X;  4IE7 A;  4OK0 A;  4A56 A;  2E9X C;  4AKI A;  3VR9 A;  3P4P A;  2XAQ B;  1IJ5 A;  1X9B A;  1HR0 T;  5FXV A;  4XAX B;  3C50 A;  3FXE B;  4KMC A;  3ZYM A;  4EOZ B;  3AA1 B;  2XAH B;  4EIW A;  3TLS A;  1KK7 A;  3Q9D A;  2XQ8 A;  1KNP A;  2FJE A;  4O4J E;  5JR9 C;  2XQ3 A;  2HN1 A;  4Q25 A;  3N9Q A;  3T1Y T;  4G2A A;  1L0V A;  5HEU A;  3I9Y A;  2IAK A;  3ETV A;  1ZOY A;  5HYA A;  2DWK A;  3NBX X;  5GON E;  3L3P A;  1EZ3 A;  4DND A;  2Q9Q A;  3RHW A;  2NW9 A;  2W63 A;  4NIQ A;  4TWD A;  3AE3 A;  5AQO B;  2IHR 1;  3OVU A;  5ABF A;  4HFD A;  2QA7 A;  2VAS A;  2W4X A;  4DR6 T;  5L3F B;  2F4V T;  4I55 E;  3UUN A;  4HTE A;  4NUU A;  5LBQ B;  3KDS E;  2WB5 A;  4ADZ A;  4JI4 T;  1KFY A;  2JIW A;  2R6G F;  5HAX A;  4X1K E;  5LP6 E;  3KBU A;  3Q5D A;  2BKN A;  2HH7 A;  2WY2 A;  2XAS B;  4IL4 A;  2LSK A;  3AVR A;  3U78 A;  5AQN B;  2KXP B;  3O1J A; 
#chains in the Genus database with same CATH homology
 1VRB A;  2C0S A;  4O4I E;  3MKD A;  1D0Y A;  3ESL A;  4QHO A;  5JDF A;  4AKG A;  3N2G E;  2K24 A;  4QKN A;  2E9X A;  2X0L B;  4JLE A;  5DJQ C;  3LBX A;  4BAY B;  2A3D A;  3ZN0 B;  2LSG A;  4YJ2 E;  2VKJ A;  2CMR A;  2XAG B;  3AAA B;  2H7O A;  2N1G A;  3AAI A;  1O3X A;  4MBQ A;  1HCI A;  2W62 A;  3UFE A;  1H7C A;  5CA1 E;  2N2N A;  4PK4 A;  3K3N A;  1D1B A;  1IZN B;  3JC6 C;  4UVB B;  5JDG A;  2LSI A;  3MAC A;  5FXZ A;  5CB4 E;  4DMW A;  4UV9 B;  5FYM A;  5IYZ E;  5HXH A;  5JDM A;  2V7I A;  1HTJ F;  3NZQ A;  3CQC B;  2ODV A;  3BQK A;  3MZK B;  3HKB E;  3J9X 1;  2EHO D;  3N9M A;  4AXP A;  2E9X B;  3RRW A;  5JDQ A;  3LBX B;  3C4Z A;  4QX8 B;  4JEU B;  4ZS3 A;  4E7S A;  3PTR B;  4HE8 A;  4UV8 B;  2X9Y A;  3K3O A;  4PK6 A;  3RKO A;  2HPJ A;  3HR0 A;  3KVB A;  1HX8 A;  3ZLI A;  2M67 A;  2H7V C;  2MYS A;  5JR9 A;  1BR0 A;  2NW8 A;  4UVA B;  1U4Q A;  3BQI A;  5FXW A;  3UUX B;  2X9W A;  4KUM B;  4WBO A;  5LHH B;  2K5B B;  1WR6 A;  5LHI B;  3VKG A;  5FP3 A;  3S4U A;  3E22 E;  4ZI7 E;  2Y48 B;  3O1I A;  4P0A A;  2LOP A;  5EK4 A;  3NRX A;  4CXY A;  3I9W A;  3BQL A;  2EHO A;  3GA8 A;  2CLY B;  4H63 H;  3Q5X A;  2ZLY A;  2WBL A;  4UIG A;  3E0Z A;  1T98 A;  1ZEE A;  3N9P A;  4IST A;  3ZC0 A;  1HG5 A;  3DJB A;  3QUJ A;  4QWN B;  3SOL A;  5JR9 B;  5FNV E;  1WYC A;  4H9O C;  2H3R A;  2V1D B;  3IEE A;  4DBQ A;  4AQF C;  1UCU A;  1MNE A;  4AKL A;  2YEV C;  4H9Q C;  3C98 B;  3W15 B;  5HWX A;  2ZM8 A;  2KWI B;  3PUS A;  2ODU A;  4B6X A;  2XAF B;  3SS1 A;  4XBF B;  4MAL A;  3PE0 A;  5EK3 A;  2VKH A;  4H63 V;  2KZ7 B;  3H37 A;  4AI6 A;  2EHO B;  2LOS A;  4EZ4 A;  2E8I A;  5LYJ E;  4EZH A;  3P8C D;  1ZKE A;  3HL6 A;  1NWM X;  3PUG A;  1D0X A;  1MMA A;  3OKQ A;  4H9P C;  4IGU A;  3RRC A;  3FBZ A;  3GMI A;  4TZ4 C;  1MIY A;  5M4Y A;  2DI4 A;  4X1I E;  3UT5 E;  3ZMV B;  3P7I A;  3VU7 H;  3O1H A;  1D1C A;  2ACX A;  2BVM A;  3AA7 B;  3M65 A;  3B13 A;  4Z8X A;  3IBP A;  1YKE B;  2BZB A;  1QSD A;  3CX8 B;  3N5L A;  2JQQ A;  1VOM A;  4NUV A;  3ZCJ A;  1IJ6 A;  2GK9 A;  1X79 A;  4ASK A;  3KVA A;  3AAE B;  1MIV A;  2X66 A;  3LG7 A;  3LK4 2;  3ZYL A;  4IE4 A;  4J2C A;  4O4H E;  3ANW A;  2V7K A;  3B57 A;  4C90 A;  2IW5 B;  2NWB A;  2ES0 A;  4O8S A;  4I4T E;  4P09 A;  4HEA A;  1HFA A;  4YHJ A;  4PNI A;  1CUN A;  3PDY A;  2CXD A;  3VKH A;  2LHN A;  3C4X A;  3L09 A;  4PK5 A;  4QXB B;  2A72 A;  2CA5 A;  3VHL A;  1FMW A;  2K9A A;  5KDM C;  3KFW X;  5EK2 A;  2VKD A;  5LCY A;  3FXD B;  5L3D B;  3KV5 A;  5AFU L;  3N9N A;  4OYJ A;  3ANW B;  3CVR A;  5FMN A;  1FIO A;  2LHR A;  1Z0P A;  2VK9 A;  3ZPO A;  4EXT A;  4UEL A;  3RC3 A;  5JQG E;  5LG4 A;  3RYI E;  3EDU A;  4CXW A;  4ZI2 C;  2D0U A;  3KV4 A;  3Q5W A;  2XQY A;  3SWH A;  2BDE A;  4HFV A;  1LRZ A;  4BJN A;  1G73 A;  4FI5 A;  3TKL B;  4CXX A;  2ZM0 A;  1HG2 A;  3LFM A;  4O4L E;  2UXX B;  4YFS A;  2BVL A;  3CKD A;  3AA6 B;  3I0O A;  4L5G A;  4ZOL E;  5LBM A;  3V5U A;  4JUY A;  1UX5 A;  1US7 B;  3MJX A;  2JMK A;  2DCF A;  4L9I A;  3OYX A;  5JDN A;  4YLH A;  4GYR A;  3RPU A;  1MMD A;  3DTO A;  5F8P A;  2VWA A;  3RYF E;  3HI2 A;  4DO0 A;  4V1A v;  4DMV A;  3I1A A;  5KMG P;  4OYK A;  3KV6 A;  2XTL A;  5DQW A;  4MLK A;  2YU2 A;  4PJL A;  3CPZ A;  5JRC A;  3CML A;  5FXX A;  4ZI3 C;  3LK3 B;  4GK5 E;  4CI2 B;  2V26 A;  2I59 A;  2DNX A;  3AB3 B;  4M1P A;  2CWY A;  2G0U A;  2LEH A;  5FY1 A;  1IAP A;  1S94 A;  2CCQ A;  5HWY A;  2D5U A;  4AKR B;  4CI1 B;  5J2T E;  1WLX A;  3KBT A;  4IDZ A;  2CE7 A;  4HKA A;  4WNK A;  4IE6 A;  2YU1 A;  3MA9 A;  3EUH A;  4I50 E;  3UUM A;  4UXN B;  3GWH A;  1WYB A;  1MND A;  2PFV A;  3IHR A;  2JJ9 A;  2YIN A;  5JVD E;  2JPF A;  3QC9 A;  4I43 B;  4AQF A;  4AKH A;  5IHY A;  4MFR A;  5JDL A;  3N9O A;  5ADX L;  2IC9 A;  3O9X A;  5A1L A;  5JRC B;  2PG8 A;  4CZZ B;  5CA0 E;  2UXN B;  2LE8 A;  4GOU A;  4U74 A;  4IIJ E;  2X9H A;  2KIN B;  4ZHQ E;  3PUQ A;  4PFP A;  1QUU A;  2KLQ A;  1MMG A;  5LGT B;  4QXC B;  3O4X E;  2Q9Q C;  3HKD E;  2X51 A;  4PFO A;  1HF8 A;  3RC8 A;  4HN9 A;  3QK6 A;  5HXS A;  3OYZ A;  4KP3 C;  3HKC E;  2W61 A;  4ERR A;  1S35 A;  3LK2 B;  3U3I A;  5KX5 E;  2NOX A;  4WW0 A;  4PJJ A;  3C51 A;  2MOZ A;  3ZMS B;  2MTQ A;  2LM9 A;  2CXF A;  4QX7 B;  2CXL A;  2C5K T;  2LSY A;  2DHR A;  2LSJ A;  2NTY A;  3WAJ A;  4H9S E;  1LVK A;  2XUE A;  4JEH B;  3GN5 A;  4YJ3 E;  4F6R C;  2D2S A;  4WBN E;  4EYY R;  3AVS A;  3DP7 A;  2MBG A;  4PJM A;  4PW8 A;  4X20 E;  1UX4 A;  3K3Q C;  3MXZ A;  3F31 A;  5JH7 E;  5C8Y E;  5FY7 A;  2XHE B;  2JRK A;  4TN7 B;  3FBL A;  2L3L A;  3E08 A;  2VB6 A;  3JC6 D;  3MK7 C;  3NRY A;  5LA6 E;  3J7Y q;  2B1E A;  3R84 B;  1FMV A;  1OXZ A;  4ZI2 D;  3C4W A;  4N78 D;  2IC6 A;  2KT9 A;  4H9R C;  4ILU A;  4TV9 E;  5E0O A;  3ZJ2 A;  4BA9 A;  2YK0 A;  3GN5 B;  1YD8 G;  2XAJ B;  3F57 A;  1D0Z A;  5DQV A;  2KWH A;  1BR1 A;  2RP4 A;  4CI3 B;  1LKX A;  2K48 A;  2X68 A;  4UVC B;  1U5P A;  1BR4 A;  2V7L A;  2P9B A;  3F2E A;  2V7M A;  4TX5 A;  1SA0 E;  5LGU B;  3NZP A;  1V9D A;  2C5J A;  5JRE A;  2W00 A;  2N9D A;  1LVF A;  3K8P C;  5ETW A;  4TV8 E;  3ZMT B;  5H6R B;  4IE5 A;  4G63 A;  3PU3 A;  3ZMU B;  1HS7 A;  1ZV4 X;  1OWA A;  3D0T A;  3RYC E;  4IE7 A;  4OK0 A;  4ISS A;  3C64 A;  3ZJ1 A;  5J2U E;  5DAB A;  4A56 A;  2E9X C;  4AKI A;  5EZY E;  4UEM A;  4ZI3 D;  1SHZ C;  2XAQ B;  4X1Y E;  1IJ5 A;  3ZN1 B;  4HGA A;  5FXV A;  4PJN A;  2ZM2 A;  2J1D G;  3H3A A;  4XAX B;  4DBR A;  1E1H B;  3Q2M A;  4IE0 A;  3C50 A;  5L2L A;  1ZHC A;  3FXE B;  4EB6 E;  2DLR A;  3PU8 A;  3PUA A;  5L3G B;  4KBM B;  2LT3 A;  3PUR A;  2D0T A;  4KMC A;  2L9Q A;  3ZYM A;  4EOZ B;  3AA1 B;  2XAH B;  4EIW A;  5J1G A;  5L3C B;  1KK7 A;  5LOV E;  2NTX A;  4QXH B;  3KV9 A;  4GIW A;  4EYU A;  5LHG B;  5HXR A;  3Q9D A;  3RH3 A;  4E7Z A;  2HPL A;  5TAO A;  4ZS2 A;  5LXT E;  1WRD A;  2CLY C;  2CM0 A;  3LJC A;  5LGN B;  2Q9Q D;  2W0G A;  4P0B A;  4O4J E;  4XZC A;  5JR9 C;  5HXC A;  4GK0 E;  3FB2 A;  1MIW A;  2Y6X A;  3N9L A;  3ZMZ B;  2WMN A;  2PJQ A;  3N9Q A;  4O2B E;  3RX6 A;  1AJ3 A;  4G2A A;  5H6Q B;  1YW0 A;  2NW7 A;  1KNZ A;  2ZMA A;  3CX7 B;  2VKO A;  2EHO C;  2Y8D A;  3I9Y A;  4IHJ E;  2IAK A;  4MHC A;  5L3B B;  3ETV A;  1NAF A;  2PBI A;  2VL8 A;  3OBV E;  5JDH A;  2SPC A;  5HYA A;  2RA1 A;  2DWK A;  3WAK A;  3NBX X;  5GON E;  3L3P A;  1EZ3 A;  3V5S A;  1Y64 B;  4DND A;  2Q9Q A;  1MMN A;  3BK9 A;  2NW9 A;  2W63 A;  4OHF A;  3CQX C;  2WAU A;  5HXE A;  2OA5 A;  2WMO A;  5F3J A;  2WM9 A;  1D1A A;  3SRZ A;  3UUL A;  2X67 A;  3I0Q A;  3AA0 B;  3ZCI A;  2QA7 A;  2VAS A;  4GYS A;  4PAG A;  2NP9 A;  5BMV E;  3CQG B;  5L3F B;  4K0U A;  2LJL A;  1G8X A;  3A5X A;  4I55 E;  4EAH A;  2QGS A;  4H9N C;  4L0R A;  3HKE E;  3EVY A;  3FHN A;  3ONX A;  4FJO A;  4O2A E;  2V7J A;  2Q9Q B;  3UUN A;  4HTE A;  3IF8 B;  2CEA A;  2A2F X;  4NUU A;  5LJM A;  4C91 A;  4ANJ A;  2KND A;  5LBQ B;  4UF0 A;  2L8K A;  2DWG A;  3KDS E;  4ADZ A;  3ZEF B;  1B7T A;  5LNK A;  4AQG A;  2WWU A;  2E9X D;  2WSS V;  3RYH E;  3WI3 A;  3ZYK A;  1BR2 A;  2CWO A;  5L3E B;  3ZC1 A;  5HAX A;  4U72 A;  4X1K E;  4BJM A;  2Z6E A;  2X9X A;  4CQI A;  3HA4 A;  5LP6 E;  1YKH B;  2JMH A;  3CX6 B;  4DVD A;  3N2O A;  3KBU A;  3UTK A;  2C5I T;  3KIN B;  2HH7 A;  3ETU A;  3R6N A;  2XAS B;  3CWZ B;  4UF0 B;  1FEW A;  2LSK A;  3AVR A;  3EDV A;  4OFZ A;  4TUY E;  3T8O A;  5FY0 A;  3OJA A;  2KMF A;  5LJN A;  3U78 A;  3N2K E;  2KXP B;  3O1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...