2EHOB

Crystal structure of human gins complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
b'MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GINS complex subunit 4
publication title Crystal structure of the human GINS complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 41
structure length 145
sequence length 145
chains with identical sequence F, J
ec nomenclature
pdb deposition date 2007-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ehoB01
2E9XD 2EHOB 2E9XA 3ANWA 2Q9QB 2Q9QC 2EHOA 3JC6D
chains in the Genus database with same CATH superfamily
2M67A 4LFAT 3ANWA 3I1AA 4PK5A 5KXJA 3UUNA 3RI5A 1UUSA 3QNUA 1WRDA 3ZC1A 4ZZCA 3VKHA 2ACZA 3AAAB 4AQYT 4C91A 3P8CD 3RYFE 4DR4T 4AKRB 4F6RC 4ZI2C 4JI2T 4U2YA 3O1JA 4U72A 3RF1A 2NW7A 2ACXA 2BZBA 4YTPA 5JDNA 5JQGE 4U7YA 3ZMZB 4O4HE 4CXXA 3C64A 3ZN0B 3RGLA 1DU2A 4IE4A 4TWFA 5AQHB 1S35A 4CXWA 4LF9T 1B7TA 3I0QA 3JAFA 5FVLA 1MIYA 4DV1T 2CRBA 3ZLIA 1HFAA 2DWKA 3TLVA 4BA9A 3AVRA 4YSXA 3MKDA 3OKQA 2AE9A 2XTLA 4ZI3C 2D5UA 4X64T 2LHRA 2Y6XA 3BQLA 3O9XA 4H9NC 2XQ8A 4JUYA 1JNZA 4HFHA 4GYSA 5HXRA 5L3GB 3N9MA 5F5WA 1CHUA 5LGUB 4AKHA 2VKDA 4U31A 3AA6B 1XDOA 3N2GE 4DV5T 5HWYA 4LF8T 3UUBA 3UU3A 4X1YE 5AQRB 1W9RA 2JRKA 4UV8B 1IBMT 3UU8A 2UXNB 5KMGP 4HWDA 2CPTA 2E9XA 4X1KE 3CIRA 3CMLA 5JR9A 2LKHA 2DLRA 3B57A 3O1HA 2RPAA 2CWYA 3UUXB 2J62A 1T98A 3OYZA 5IYZE 3RPUA 3RC8A 4UVBB 3NVOA 2WY2A 2H3RA 3PUWF 1W0AA 2KWHA 4DR5T 1WFDA 2G0UA 3UU5A 2QGSA 4JI5T 2M6BA 2WM9A 4IDNA 1KFYA 5HWXA 4CI1B 4U74A 2C5KT 2J47A 3RIUC 3KVBA 1FJGT 2JMHA 2E9XD 3TLTA 5C8YE 1CUNA 3RHWA 2AXDS 4TUYE 3K3NA 2YDRA 4AI6A 3VRAA 3QB5K 2FJBA 2E9XB 2EHOA 5AQGB 5JRCA 2A2FX 4BAYB 4WBNE 3B5MA 3EUHA 3ETUA 3AE6A 3UULA 1N32T 3P4QA 3LJCA 2A72A 4OX9T 3CQCB 1LKXA 4HTEA 5J2TE 4K0KT 3OPCA 5FP3A 2NOXA 4X20E 2Q9QB 2Y8DA 5CA0E 5LA6E 3FZKB 2J1DG 3Q9DA 4HFBA 2P9BA 4YXDA 3P4PA 4DV2T 4QXCB 4EB6E 4ZHQE 4QH5A 1XMQT 4WYVA 3ZT5A 3EABA 4KP3C 3PJAJ 3Q5EA 4QHOA 3HKEE 3N2OA 4PNIA 2LSYA 2RA1A 4K0UA 3C98B 2Z6EA 4ZI2D 2W2UA 3T8OA 5HEHA 2EHOD 1HG2A 4TN7B 2W67A 5IHYA 2X51A 3VKGA 2XQAA 2E5LT 4MLKA 2ZMAA 1R8IA 3HKBE 3ETVA 2HPJA 2D2SA 2VASA 3FZFB 2EHOB 5JRCB 3R6NA 2BBHA 4HEAA 3RIAA 3UU6A 2V1DB 4HFIA 2CM0A 4DV4T 4IREA 4HFDA 2XQ3A 3KFWX 2WMNA 3ZJ2A 4CXYA 2XAGB 2VKOA 4L5GA 4NXNT 5C2TA 5EZYE 3I9YA 3L3PA 3B13A 5ABHA 4CZZB 1WCRA 3C4WA 1OXZA 3FB2A 5LMNT 4PJLA 3PE0A 1N36T 5JDMA 4JBWF 2DHRA 2JQKA 2IHR1 5JDLA 2XASB 2V7IA 1IBKT 3AE7A 4G63A 2RP4A 2NW9A 1UCUA 2OA5A 3PUVF 3SOLA 3U78A 1HNXT 5HEOA 3Q5XA 2W0GA 4KX6A 3AEDA 1EZ3A 3V5UA 2VK9A 1IJ6A 3EVYA 4LF7T 5AQOB 1MMAA 1VCSA 2N1GA 3C50A 1T72A 1J5ET 2ES0A 2K5BB 3ZMVB 5FL1A 4UF0A 2HHHT 4LMKA 1IZNB 2MPKA 4TV8E 3FZLB 3KINB 2ZM2A 4X66T 3JC6D 4JI7T 3WAJA 2YKSA 2XUEA 2XAFB 2X9WA 1SUMB 2NR4A 3T1YT 2LT3A 4ZOLE 4DR3T 2XHEB 1YD8G 1ZEEA 2KZ7B 1W0BA 2VWAA 2IUBA 5JDQA 1MNEA 3MZKB 2WMOA 2MBGA 3CX8B 3QB5A 3AECA 5C3JA 3R84B 1J5WA 1HTJF 1Z8UA 5HXHA 3KV5A 3RX6A 4DR6T 2LRLA 4WNKA 4TV9E 5ABGA 3RLFF 3AXJA 2V8SV 4UVCB 4NUUA 5AQSB 4H63V 1KNRA 3ZKRA 2H7VC 3E08A 5AQUB 2L3LA 2IMLA 5HXEA 4U33A 4PJNA 3D0TA 1GQEA 4DV0T 5HYAA 3LG7A 3ZSTA 1KK7A 3PUAA 3AE8A 3AE2A 3AE9A 4ISTA 3C51A 1WYBA 5L3EB 3A5XA 4B3ST 4KI0F 3K1SA 3S4UA 2XQ5A 4EXTA 3RKGA 3OJAA 2D0TA 3EHZA 2XQ9A 3AE1A 4NXMT 2LM2A 4ZXLA 2X9XA 3MA9A 1ZHCA 2JPFA 1VOMA 5FNVE 2MYSA 1AJ3A 2YU1A 4JI1T 2BS4A 1BR1A 3RYIE 2H7OA 2HN2A 5JDFA 5AQLB 5LBQB 2OLTA 3CQXC 4IE5A 5CB4E 3SWHA 3LFMA 4OYKA 2CLYC 5LBMA 3UU4A 2QRXA 1Y64B 3AXJB 4B6XA 5LYJE 1UK5A 3AA7B 3HA4A 4H9PC 3VR8A 2A3DA 2K48A 2CWOA 2ZM6T 4IE0A 3N2KE 3W15B 4AKLA 4I55E 4PW8A 1XNQT 2LE8A 5JREA 1WR0A 2YK0A 5L3DB 3H3MA 3OBVE 5EK4A 3AVSA 1YW0A 2CBJA 4CI3B 4HN9A 4YHJA 2KINB 2XY8B 4X1IE 1H7CA 5AQIB 4GYRA 5DQVA 5LJMA 2VL0A 3QC9A 4LMLA 4MBQA 5LMUT 5HAXA 3ONLC 3GN5A 5J0ZA 5LHHB 5H6QB 3BQKA 4P1NA 4AIUA 4U7IA 2VB6A 3RC3A 4XZCA 3PUSA 3HKDE 4DMVA 2X9HA 5FXWA 2CXDA 4CN4A 2V7KA 4PK6A 5F3JA 4GKKT 1D1AA 4Z8XA 4UIGA 3IEEA 3ZJ1A 2H89A 3T1HT 2F4VT 4P0BA 3ZC0A 3HKCE 2Q9QA 3WI3A 4MFRA 4YLHA 4IE7A 4QXBB 2UXBT 5BR8T 3VHLA 4OK0A 4AQFA 2WWVA 1FIOA 3EDVA 5LHIB 1IJ5A 3TLWA 1XDPA 4IL9A 1NEKA 2KNDA 3NBXX 5ABFB 3CWZB 1WR6A 2XZEA 1G8XA 4PK4A 5L3BB 3ABVA 2FUPA 3GN5B 3PU3A 2H88A 4KHZF 3SFEA 1MIVA 3FBZA 4YSYA 1T7SA 1HNZT 4DV3T 1MIWA 3O4XE 4DIDB 5JVDE 1WYCA 5HEGA 3ZYMA 3IF8B 1V9DA 2XSAA 2DL1A 4ASKA 3C4ZA 3PUXF 1ZV4X 3FBLA 2IIUA 2MAWA 3UQ4A 3FZMB 5LHGB 4O4JE 3ZMTB 3ZSSA 4MHCA 4A5XA 2X66A 3N9NA 2Q9QD 3ESLA 4QH4A 3FXDB 2VQFT 3GWHA 3LDQB 5FYMA 3ZT7A 2BG9C 5EK2A 4GK5E 5LJNA 3V5SA 1ZP0A 2CEAA 2ODVA 2XQ7A 5FXXA 4EZ4A 1NENA 1MMNA 3KV6A 4BJNA 3GMIA 1G73A 3KBUA 5A1LA 3NZQA 2ZLYA 1IAPA 4HWIB 4J2CA 3MXZA 3CKDA 2PFVA 2XJ7A 2WDQA 5FXVA 2LHNA 4GK0E 1D1BA 2YINA 3SS1A 3UQ7A 2Y48B 5ETWA 2X68A 4L9IA 5AQPB 2GK9A 2XAHB 3K3OA 4OHFA 2PBIA 1SE7A 4KMCA 1NAFA 2HN1A 3A8YC 1HF8A 2D0UA 4GOUA 5JDGA 3N9PA 3N9OA 2YU2A 4O4IE 1W09A 2QA7A 1OEDC 3E22E 3LK2B 2V5CA 4P0AA 4FJOA 2CLYB 4HWHA 5E0OA 3QOFA 5LGTB 2QYWA 3KDSE 4CI2B 2XPKA 1HNWT 2XQ4A 5FY7A 1LVFA 1XZYA 4ZI3D 3ZPOA 2YDQA 2JQ9A 3AEGA 5HCMA 4UV9B 2I6HA 3RRWA 4A56A 4I0UA 4EYUA 1QLBA 1UGOA 2CXLA 4H63H 3DJBA 4GKJT 2V7JA 2BG9E 1J1JA 1X79A 3P50A 3CK6A 3IBPA 4DBRA 4X5TA 2FJAA 4HFEA 1ZOYA 4DO0A 1M62A 4ILBA 3J7Yq 3DP7A 3OVUA 2LM9A 4Z91A 2JIWA 5LP6E 1E2AA 2XM1A 3P7IA 2LOPA 3M65A 2LSGA 5EK3A 3RIUA 4LF5T 4PJMA 5JH7E 3TKLB 1US7B 3MACA 4IE6A 4L0RA 4TNVA 3F57A 3L8RA 1D0ZA 2L9QA 3PUYF 3Q5WA 2WWUA 3ONJA 4DVDA 2KT9A 4HKAA 5DABA 2I0MA 5F8PA 2WAUA 3Q2MA 2V6YB 5AQQB 3ZCIA 2LLYA 4IL4A 5GONE 4LFBT 3WAKA 4B3MT 2BDEA 4EZHA 3L09A 1OEDE 4AKGA 2L8KA 2VKHA 3OTOT 2WBLA 3P4SA 3VRBA 3OYXA 1SA0E 3PU8A 3QUJA 4YY3T 1IBLT 4O2BE 2NTXA 2W4XA 1MMGA 4YJ2E 2VL8A 3HI2A 5DQWA 5HEUA 4WZXA 5LOVE 5L3CB 4UXNB 4ILUA 3NKZA 3JAEA 2UUBT 2PJQA 2E9XC 4GIWA 4DNDA 3K3QC 5JR9C 4JI0T 3LBXB 1YKHB 5AFUL 4ZZBA 4IDQA 4O4LE 5FMNA 3N9LA 2M6IA 3RQUA 3UFEA 2IW5B 5FVKA 1MNDA 3C4XA 1HX8A 4QKNA 2XAQB 4ANJA 2BBJA 1D0YA 5LB7B 3BQIA 4HWFA 4UR9A 3LK3B 3TLSA 2V26A 1U4QA 2NP9A 2NWBA 1D0XA 1MMDA 4PFOA 4TWDA 2CHOA 4OYJA 3N5LA 2W63A 2C0SA 3SFDA 2N2NA 3AEAA 2BG9B 4IT4A 1FMVA 2KMFA 1N34T 2YEVC 4OFZA 2BS2A 4BJMA 2R6GF 5KDMC 2YOEA 5LXTE 3TLUA 3LSVA 1ZKEA 5TAOA 4X65T 3A7MA 4HWCA 4IDZA 4DR2T 4WW0A 2DNXA 2IDOB 1UX4A 5M4YA 3PUQA 2LEHA 3VU7H 5LG3A 2EHOC 1QUUA 2IC9A 3P4WA 4DUZT 4DV7T 1E1HB 1U5PA 2UXDT 3RQWA 2K3WA 4MALA 4YT0A 1UX5A 5ADXL 1O3XA 3RIFA 2XSBA 2WCAA 2JQHA 4UELA 3JADA 3DTOA 5DJQC 4IHJE 4HFCA 3ZYKA 3ZEFB 5LG4A 4H9QC 2JMKA 1I6ZA 3L39A 4P09A 2VURA 5BMVE 4LMJA 5ABFA 2KWIB 3F31A 4HE8A 1OEDB 5L2LA 4XBFB 3ONXA 5FY0A 1HCIA 4WBOA 4NPPA 3AAEB 4JEHB 4YFSA 1YKEB 3P4RA 2KXPB 3CVRA 3ZT6A 4I4TE 4KBMB 2WZIA 5IWAT 4AKIA 4LFCT 3RH3A 3PV0F 3ANWB 1VCTA 2C5JA 3E0ZA 2PG8A 4JV5T 3IA3A 3BK9A 3PTRB 4ILAA 2W00A 1N33T 2X67A 2WP9A 4KHPT 4H9OC 1I94T 2DCFA 2WSSV 2WB5A 2XM2A 2V7LA 3EDUA 4H9RC 3F2EA 3M3ZB 4A97A 4Z90A 4TNWA 1KNPA 2MTQA 5FY1A 4O8SA 5CA1E 2K24A 3AAIA 4NIQA 3PUZF 2D9DA 5LGNB 3NRYA 4LF4T 4DR1T 4X62T 4DBQA 1HS7A 2E5VA 5AQVB 5HCJA 2LRKA 4V1Av 2I59A 3JC6C 2W66A 2IC6A 5CFBA 2X0LB 2UUAT 4O2AE 2XQYA 5AQJB 2X0HA 1HR0T 2FBWA 5FKYA 4C90A 4Q25A 4CN1A 2W62A 2V7MA 4TZ4C 4KUMB 5JDHA 4TWHA 2JJ9A 2XAJB 1BR2A 4JI4T 5AQMB 1UURA 1FEWA 4AQGA 2VVSA 5AQNB 2OV9A 4ZS3A 4YJ3E 3RYCE 2CCQA 2DI4A 2VQET 5L47A 2FJEA 1YQ4A 2IAKA 4NUVA 2UXXB 2CBIA 3PJAA 5JR9B 3FZHB 4PAGA 2WQYA 3EAMA 5J2UE 2B76A 3CX6B 2LOSA 3EI0A 2KLQA 3AE4A 5H6RB 4JI3T 3RRCA 5L4HA 4UVAB 3I0OA 2DWGA 2W61A 2C5IT 5FL0A 3O1IA 1L0VA 5CGMA 2PTFA 3AE3A 3LK42 5KX5E 3KBTA 5J1GA 1XNRT 4QX8B 5HXSA 3VR9A 4EGWA 5CJ5A 1VRBA 3ZMUB 2J4GA 3UT5E 3H3AA 3ZYLA 2V5DA 3AA0B 3G06A 4PJJA 2BVLA 4ERRA 2CHNA 4JI6T 4QX7B 4QXHB 4E7SA 4IDOA 4F8HA 4UEMA 3QK6A 4I43B 4G2AA 4ISSA 3U3IA 4DV6T 4M1PA 3I9WA 5FXZA 4DUYT 4JLEA 3PUGA 2X0YA 4E7ZA 2K9AA 1JNRA 2V6YA 2HPLA 4ZS2A 4EIWA 3MJXA 2WU5A 4ZI7E 3RYHE 2YN6A 1KNZA 2VVNA 3GA8A 1Y01A 1NWMX 4LF6T 2WU2A 3NRXA 2LKGA 1XMOT 4EAHA 3PURA 2NTYA 2UU9T 3AB3B 4YSZA 2BVMA 4HGAA 3KV4A 4TX5A 5AQTB 3HL6A 2CMRA 2UXCT 4EEDA 2CA5A 1T8BA 1YQ3A 3LBXA 3SRZA 1HG5A 4JYAT 4IDPA 2LSJA 2YDSA 3NZPA 3AEFA 1BR4A 4YHHT 1WLXA 1D1CA 2WS3A 4CN6A 3UUMA 1SHZC 3X1DA 5JTGA 3CQGB 5L4EA 4I50E 3RKOA 5LNKA 2XQ6A 4DMWA 4COFA 1S94A 2CXFA 2LSIA 1E7PA 4A98A 2KSRA 4DR7T 4U3CA 4ZEYA 3AEBA 4B3TT 4N78D 3KVAA 4JEUB 3J9X1 1QSDA 3NWIA 4AXPA 1KF6A 5AQKB 2X9YA 2WZHA 4IGUA 2BKPA 5HXCA 4ADZA 2VKJA 1Z0PA 5IUXA 1KEYA 2ZM0A 2MOZA 2E8IA 2BG9A 4ILCA 2NW8A 3FXEB 5LCYA 2QVAA 2V6XA 3K8PC 2B1EA 4AISA 1BR0A 2ZM8A 3KV9A 2CE7A 4QH1A 1OWAA 3ZN1B 1M7KA 3JCFA 4XAXB 2E2AA 1HX1B 5ABEA 3FHNA 2LSKA 4PFPA 4CQIA 3AEEA 1LVKA 2FJDA 2HH7A 3N9QA 2ODUA 1XWMA 4U2ZA 1X9BA 4YTNA 3ZMSB 1LRZA 2SPCA 2BKOA 4JI8T 4EEBA 4B3RT 2N9DA 2A9UA 3CX7B 4HFVA 5HEJA 3MK7C 3H37A 4EOZB 2UUCT 4IIJE 3AA1B 3IHRA 4YTMA 2Q9QC 3Q5DA 1FMWA 3ZCJA 4QWNB 4EV6A 3HR0A 2JQQA 1OEDA 2BS3A 4AQFC 5L3FB 5AQFB 3AE5A 3UFGA 4EYYR 3CPZA 4FI5A 2WDRA 4UF0B 3UTKA 1YXRA 2WDVA 4H9SE 2BKNA 2LJLA 3PDYA
chains in the Genus database with same CATH topology
3Q5XA 2M67A 2V7LA 1MMNA 3ANWA 3KV6A 3I1AA 4PK5A 4BJNA 3EDUA 4H9RC 3UUNA 2W0GA 3F2EA 1EZ3A 3GMIA 3V5UA 1WRDA 2VK9A 1IJ6A 1G73A 3KBUA 2MTQA 3ZC1A 3EVYA 5A1LA 5FY1A 3NZQA 1MMAA 2ZLYA 1IAPA 4O8SA 4J2CA 2K24A 2N1GA 3AAIA 3C50A 3CKDA 3MXZA 2PFVA 3VKHA 2ES0A 2K5BB 3ZMVB 5FXVA 3AAAB 4C91A 2LHNA 4GK0E 4UF0A 5LGNB 3P8CD 1D1BA 2YINA 3RYFE 3NRYA 3SS1A 2Y48B 4AKRB 4F6RC 1IZNB 4DBQA 4TV8E 1HS7A 5ETWA 4ZI2C 2X68A 4L9IA 3KINB 3O1JA 4U72A 2ZM2A 2GK9A 2XAHB 3K3OA 2NW7A 4V1Av 3JC6D 2I59A 2ACXA 2BZBA 2PBIA 4OHFA 5JDNA 4KMCA 3WAJA 3JC6C 5JQGE 2IC6A 1NAFA 2XUEA 2XAFB 3ZMZB 4O4HE 2X9WA 4CXXA 2X0LB 3C64A 1HF8A 2D0UA 4GOUA 3ZN0B 2LT3A 5JDGA 4O2AE 2XQYA 4IE4A 3N9PA 4ZOLE 1S35A 2XHEB 3N9OA 2YU2A 4CXWA 1YD8G 4O4IE 2QA7A 1ZEEA 2KZ7B 2VWAA 3E22E 3LK2B 1B7TA 4P0AA 4FJOA 3I0QA 2CLYB 1MNEA 5E0OA 3MZKB 4C90A 5JDQA 2WMOA 2MBGA 1MIYA 2W62A 3CX8B 2V7MA 3R84B 5LGTB 4TZ4C 4KUMB 3ZLIA 1HTJF 3RX6A 5JDHA 1HFAA 3KV5A 5HXHA 2DWKA 3KDSE 4BA9A 4CI2B 4WNKA 2JJ9A 4TV9E 2XAJB 1BR2A 3AVRA 5FY7A 1LVFA 3MKDA 1FEWA 4UVCB 3OKQA 2XTLA 4AQGA 4ZI3D 3ZPOA 4NUUA 4ZI3C 4H63V 4ZS3A 2H7VC 4UV9B 3E08A 2L3LA 3RRWA 4A56A 2D5UA 2LHRA 4EYUA 5HXEA 2Y6XA 3BQLA 2CXLA 4YJ3E 4PJNA 3RYCE 3O9XA 4H9NC 4H63H 4JUYA 3D0TA 2CCQA 2DI4A 4GYSA 3DJBA 5HXRA 2V7JA 5L3GB 1X79A 3N9MA 5HYAA 2IAKA 4NUVA 3IBPA 3LG7A 2UXXB 4DBRA 1KK7A 5LGUB 3PUAA 4AKHA 2VKDA 4DO0A 5JR9B 3AA6B 3N2GE 4PAGA 3DP7A 3C51A 4ISTA 3J7Yq 5J2UE 2LM9A 1WYBA 5L3EB 3A5XA 5HWYA 3CX6B 5CA1E 5LP6E 3S4UA 3P7IA 2LOSA 2LOPA 3M65A 4X1YE 2KLQA 2LSGA 4EXTA 5EK3A 2JRKA 4UV8B 5H6RB 3OJAA 3RRCA 4UVAB 3I0OA 2DWGA 2UXNB 4PJMA 2D0TA 5KMGP 2W61A 2C5IT 3O1IA 2E9XA 5JH7E 4X1KE 3TKLB 1US7B 2X9XA 3CMLA 3MACA 5JR9A 3MA9A 1ZHCA 2JPFA 4IE6A 2DLRA 3LK42 5KX5E 1VOMA 3B57A 3O1HA 4L0RA 3KBTA 5FNVE 3F57A 2MYSA 1AJ3A 2CWYA 2YU1A 1D0ZA 3UUXB 2L9QA 5J1GA 4QX8B 5HXSA 1BR1A 3Q5WA 3RYIE 3OYZA 1T98A 2WWUA 5IYZE 2H7OA 5JDFA 4DVDA 2KT9A 4HKAA 1VRBA 5DABA 5LBQB 3ZMUB 5F8PA 3RPUA 3H3AA 3UT5E 3RC8A 2WAUA 4UVBB 3ZYLA 2H3RA 3AA0B 3CQXC 4IE5A 4PJJA 5CB4E 3SWHA 3LFMA 4OYKA 3Q2MA 2CLYC 5LBMA 2BVLA 4ERRA 3ZCIA 2KWHA 1Y64B 4QX7B 5GONE 3WAKA 4B6XA 4QXHB 2BDEA 4E7SA 5LYJE 2G0UA 4EZHA 3L09A 3AA7B 4AKGA 2L8KA 3HA4A 4H9PC 2QGSA 2A3DA 2K48A 4UEMA 2VKHA 2WBLA 3QK6A 2CWOA 4I43B 4G2AA 2WM9A 4IE0A 3OYXA 3N2KE 4ISSA 3U3IA 3W15B 1SA0E 3PU8A 4AKLA 4I55E 3QUJA 4M1PA 4PW8A 4CI1B 5HWXA 3I9WA 5FXZA 2LE8A 4U74A 5JREA 4JLEA 3PUGA 4O2BE 2NTXA 1MMGA 2YK0A 4E7ZA 4YJ2E 2K9AA 2VL8A 3HI2A 2C5KT 2HPLA 4ZS2A 5L3DB 4EIWA 5DQWA 3MJXA 3OBVE 5EK4A 5LOVE 4ZI7E 3AVSA 3KVBA 3RYHE 5L3CB 1YW0A 4UXNB 4ILUA 2JMHA 2E9XD 4CI3B 1KNZA 4HN9A 4YHJA 2PJQA 2E9XC 2KINB 4GIWA 4DNDA 3GA8A 3K3QC 5C8YE 4X1IE 1CUNA 5JR9C 3LBXB 1NWMX 1H7CA 3NRXA 4GYRA 4TUYE 5DQVA 5LJMA 3K3NA 1YKHB 4EAHA 5AFUL 3PURA 3QC9A 4AI6A 2NTYA 4MBQA 4O4LE 5FMNA 3N9LA 5HAXA 2E9XB 2EHOA 3GN5A 5JRCA 2A2FX 3AB3B 3UFEA 4BAYB 4WBNE 2IW5B 5LHHB 3EUHA 5H6QB 1MNDA 3C4XA 2BVMA 4HGAA 3KV4A 4TX5A 1HX8A 3ETUA 3BQKA 3HL6A 4QKNA 2CMRA 3UULA 2CA5A 2XAQB 3LJCA 4ANJA 2VB6A 1D0YA 3RC3A 3LBXA 3SRZA 1HG5A 3BQIA 2A72A 4XZCA 3CQCB 2LSJA 3NZPA 3PUSA 1LKXA 4HTEA 3HKDE 4DMVA 3LK3B 5J2TE 1BR4A 2X9HA 2V26A 1U4QA 5FXWA 1WLXA 1D1CA 2NP9A 5FP3A 3UUMA 2CXDA 2NOXA 4X20E 2Q9QB 1SHZC 2NWBA 2V7KA 2Y8DA 4PK6A 1D0XA 1MMDA 5CA0E 5LA6E 2J1DG 4PFOA 3CQGB 5F3JA 3Q9DA 4OYJA 3N5LA 2W63A 2P9BA 4I50E 3RKOA 2C0SA 1D1AA 2N2NA 5LNKA 4Z8XA 4DMWA 4UIGA 1FMVA 2KMFA 4QXCB 1S94A 2YEVC 2CXFA 4EB6E 4OFZA 2LSIA 4ZHQE 3IEEA 3ZJ1A 4BJMA 5KDMC 4KP3C 4N78D 3KVAA 4JEUB 3J9X1 1QSDA 4P0BA 4QHOA 4AXPA 2X9YA 3HKEE 5LXTE 4IGUA 3ZC0A 3N2OA 1ZKEA 3HKCE 2Q9QA 5HXCA 5TAOA 4PNIA 2LSYA 2RA1A 4ADZA 4K0UA 2VKJA 4IDZA 1Z0PA 3C98B 4WW0A 3WI3A 2DNXA 2Z6EA 2ZM0A 4MFRA 2MOZA 4YLHA 4IE7A 4QXBB 2E8IA 4ZI2D 2NW8A 3FXEB 1UX4A 3VHLA 5M4YA 3T8OA 3PUQA 2LEHA 4OK0A 2EHOD 5LCYA 4AQFA 3VU7H 1HG2A 3K8PC 4TN7B 2EHOC 2B1EA 1FIOA 3EDVA 1QUUA 5IHYA 5LHIB 2IC9A 1BR0A 2ZM8A 1IJ5A 2X51A 1E1HB 3KV9A 1U5PA 2CE7A 3VKGA 4MLKA 2ZMAA 2KNDA 3NBXX 3HKBE 3CWZB 1OWAA 3ETVA 1WR6A 2HPJA 2D2SA 2VASA 4MALA 1G8XA 3ZN1B 1UX5A 5ADXL 1O3XA 4PK4A 5L3BB 4XAXB 2EHOB 3GN5B 3PU3A 5JRCB 3R6NA 4HEAA 3FHNA 4UELA 2LSKA 3DTOA 1MIVA 4PFPA 5DJQC 2V1DB 3FBZA 4CQIA 1LVKA 4IHJE 2HH7A 2CM0A 3ZYKA 3N9QA 3ZEFB 2ODUA 5LG4A 4H9QC 2JMKA 1MIWA 3O4XE 5JVDE 4P09A 3ZMSB 1LRZA 1WYCA 2SPCA 5BMVE 3ZYMA 2KWIB 3IF8B 1V9DA 3F31A 4HE8A 4ASKA 5L2LA 2N9DA 4XBFB 3C4ZA 3ONXA 5FY0A 1ZV4X 1HCIA 3FBLA 3KFWX 2WMNA 3CX7B 4HFVA 3ZJ2A 3MK7C 3H37A 4WBOA 4EOZB 5LHGB 4IIJE 4O4JE 3ZMTB 3AA1B 4CXYA 4MHCA 3AAEB 2XAGB 2VKOA 4L5GA 2X66A 3IHRA 5EZYE 3N9NA 3I9YA 4JEHB 4YFSA 3L3PA 2Q9QD 1YKEB 2KXPB 2Q9QC 3B13A 3CVRA 4I4TE 4CZZB 4KBMB 1FMWA 3C4WA 3ESLA 4AKIA 1OXZA 3RH3A 3FXDB 3ANWB 3FB2A 3GWHA 5FYMA 3ZCJA 2C5JA 4PJLA 3E0ZA 5EK2A 3PE0A 2PG8A 4GK5E 5LJNA 4QWNB 3V5SA 3HR0A 2JQQA 5JDMA 3BK9A 3PTRB 2W00A 4AQFC 2CEAA 2DHRA 2X67A 5L3FB 4H9OC 5JDLA 4EYYR 2XASB 2ODVA 2V7IA 3CPZA 4FI5A 4G63A 2DCFA 2RP4A 4UF0B 2NW9A 2WSSV 3UTKA 4H9SE 5FXXA 4EZ4A 1UCUA 2OA5A 3SOLA 3U78A 2LJLA 3PDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9X D;  2EHO B;  2E9X A;  3ANW A;  2Q9Q B;  2Q9Q C;  2EHO A;  3JC6 D; 
#chains in the Genus database with same CATH topology
 2M67 A;  4LFA T;  3ANW A;  3I1A A;  4PK5 A;  5KXJ A;  3UUN A;  3RI5 A;  1UUS A;  3QNU A;  1WRD A;  3ZC1 A;  4ZZC A;  3VKH A;  2ACZ A;  3AAA B;  4AQY T;  4C91 A;  3P8C D;  3RYF E;  4DR4 T;  4AKR B;  4F6R C;  4ZI2 C;  4JI2 T;  4U2Y A;  3O1J A;  4U72 A;  3RF1 A;  2NW7 A;  2ACX A;  2BZB A;  4YTP A;  5JDN A;  5JQG E;  4U7Y A;  3ZMZ B;  4O4H E;  4CXX A;  3C64 A;  3ZN0 B;  3RGL A;  1DU2 A;  4IE4 A;  4TWF A;  5AQH B;  1S35 A;  4CXW A;  4LF9 T;  1B7T A;  3I0Q A;  3JAF A;  5FVL A;  1MIY A;  4DV1 T;  2CRB A;  3ZLI A;  1HFA A;  2DWK A;  3TLV A;  4BA9 A;  3AVR A;  4YSX A;  3MKD A;  3OKQ A;  2AE9 A;  2XTL A;  4ZI3 C;  2D5U A;  4X64 T;  2LHR A;  2Y6X A;  3BQL A;  3O9X A;  4H9N C;  2XQ8 A;  4JUY A;  1JNZ A;  4HFH A;  4GYS A;  5HXR A;  5L3G B;  3N9M A;  5F5W A;  1CHU A;  5LGU B;  4AKH A;  2VKD A;  4U31 A;  3AA6 B;  1XDO A;  3N2G E;  4DV5 T;  5HWY A;  4LF8 T;  3UUB A;  3UU3 A;  4X1Y E;  5AQR B;  1W9R A;  2JRK A;  4UV8 B;  1IBM T;  3UU8 A;  2UXN B;  5KMG P;  4HWD A;  2CPT A;  2E9X A;  4X1K E;  3CIR A;  3CML A;  5JR9 A;  2LKH A;  2DLR A;  3B57 A;  3O1H A;  2RPA A;  2CWY A;  3UUX B;  2J62 A;  1T98 A;  3OYZ A;  5IYZ E;  3RPU A;  3RC8 A;  4UVB B;  3NVO A;  2WY2 A;  2H3R A;  3PUW F;  1W0A A;  2KWH A;  4DR5 T;  1WFD A;  2G0U A;  3UU5 A;  2QGS A;  4JI5 T;  2M6B A;  2WM9 A;  4IDN A;  1KFY A;  5HWX A;  4CI1 B;  4U74 A;  2C5K T;  2J47 A;  3RIU C;  3KVB A;  1FJG T;  2JMH A;  2E9X D;  3TLT A;  5C8Y E;  1CUN A;  3RHW A;  2AXD S;  4TUY E;  3K3N A;  2YDR A;  4AI6 A;  3VRA A;  3QB5 K;  2FJB A;  2E9X B;  2EHO A;  5AQG B;  5JRC A;  2A2F X;  4BAY B;  4WBN E;  3B5M A;  3EUH A;  3ETU A;  3AE6 A;  3UUL A;  1N32 T;  3P4Q A;  3LJC A;  2A72 A;  4OX9 T;  3CQC B;  1LKX A;  4HTE A;  5J2T E;  4K0K T;  3OPC A;  5FP3 A;  2NOX A;  4X20 E;  2Q9Q B;  2Y8D A;  5CA0 E;  5LA6 E;  3FZK B;  2J1D G;  3Q9D A;  4HFB A;  2P9B A;  4YXD A;  3P4P A;  4DV2 T;  4QXC B;  4EB6 E;  4ZHQ E;  4QH5 A;  1XMQ T;  4WYV A;  3ZT5 A;  3EAB A;  4KP3 C;  3PJA J;  3Q5E A;  4QHO A;  3HKE E;  3N2O A;  4PNI A;  2LSY A;  2RA1 A;  4K0U A;  3C98 B;  2Z6E A;  4ZI2 D;  2W2U A;  3T8O A;  5HEH A;  2EHO D;  1HG2 A;  4TN7 B;  2W67 A;  5IHY A;  2X51 A;  3VKG A;  2XQA A;  2E5L T;  4MLK A;  2ZMA A;  1R8I A;  3HKB E;  3ETV A;  2HPJ A;  2D2S A;  2VAS A;  3FZF B;  2EHO B;  5JRC B;  3R6N A;  2BBH A;  4HEA A;  3RIA A;  3UU6 A;  2V1D B;  4HFI A;  2CM0 A;  4DV4 T;  4IRE A;  4HFD A;  2XQ3 A;  3KFW X;  2WMN A;  3ZJ2 A;  4CXY A;  2XAG B;  2VKO A;  4L5G A;  4NXN T;  5C2T A;  5EZY E;  3I9Y A;  3L3P A;  3B13 A;  5ABH A;  4CZZ B;  1WCR A;  3C4W A;  1OXZ A;  3FB2 A;  5LMN T;  4PJL A;  3PE0 A;  1N36 T;  5JDM A;  4JBW F;  2DHR A;  2JQK A;  2IHR 1;  5JDL A;  2XAS B;  2V7I A;  1IBK T;  3AE7 A;  4G63 A;  2RP4 A;  2NW9 A;  1UCU A;  2OA5 A;  3PUV F;  3SOL A;  3U78 A;  1HNX T;  5HEO A;  3Q5X A;  2W0G A;  4KX6 A;  3AED A;  1EZ3 A;  3V5U A;  2VK9 A;  1IJ6 A;  3EVY A;  4LF7 T;  5AQO B;  1MMA A;  1VCS A;  2N1G A;  3C50 A;  1T72 A;  1J5E T;  2ES0 A;  2K5B B;  3ZMV B;  5FL1 A;  4UF0 A;  2HHH T;  4LMK A;  1IZN B;  2MPK A;  4TV8 E;  3FZL B;  3KIN B;  2ZM2 A;  4X66 T;  3JC6 D;  4JI7 T;  3WAJ A;  2YKS A;  2XUE A;  2XAF B;  2X9W A;  1SUM B;  2NR4 A;  3T1Y T;  2LT3 A;  4ZOL E;  4DR3 T;  2XHE B;  1YD8 G;  1ZEE A;  2KZ7 B;  1W0B A;  2VWA A;  2IUB A;  5JDQ A;  1MNE A;  3MZK B;  2WMO A;  2MBG A;  3CX8 B;  3QB5 A;  3AEC A;  5C3J A;  3R84 B;  1J5W A;  1HTJ F;  1Z8U A;  5HXH A;  3KV5 A;  3RX6 A;  4DR6 T;  2LRL A;  4WNK A;  4TV9 E;  5ABG A;  3RLF F;  3AXJ A;  2V8S V;  4UVC B;  4NUU A;  5AQS B;  4H63 V;  1KNR A;  3ZKR A;  2H7V C;  3E08 A;  5AQU B;  2L3L A;  2IML A;  5HXE A;  4U33 A;  4PJN A;  3D0T A;  1GQE A;  4DV0 T;  5HYA A;  3LG7 A;  3ZST A;  1KK7 A;  3PUA A;  3AE8 A;  3AE2 A;  3AE9 A;  4IST A;  3C51 A;  1WYB A;  5L3E B;  3A5X A;  4B3S T;  4KI0 F;  3K1S A;  3S4U A;  2XQ5 A;  4EXT A;  3RKG A;  3OJA A;  2D0T A;  3EHZ A;  2XQ9 A;  3AE1 A;  4NXM T;  2LM2 A;  4ZXL A;  2X9X A;  3MA9 A;  1ZHC A;  2JPF A;  1VOM A;  5FNV E;  2MYS A;  1AJ3 A;  2YU1 A;  4JI1 T;  2BS4 A;  1BR1 A;  3RYI E;  2H7O A;  2HN2 A;  5JDF A;  5AQL B;  5LBQ B;  2OLT A;  3CQX C;  4IE5 A;  5CB4 E;  3SWH A;  3LFM A;  4OYK A;  2CLY C;  5LBM A;  3UU4 A;  2QRX A;  1Y64 B;  3AXJ B;  4B6X A;  5LYJ E;  1UK5 A;  3AA7 B;  3HA4 A;  4H9P C;  3VR8 A;  2A3D A;  2K48 A;  2CWO A;  2ZM6 T;  4IE0 A;  3N2K E;  3W15 B;  4AKL A;  4I55 E;  4PW8 A;  1XNQ T;  2LE8 A;  5JRE A;  1WR0 A;  2YK0 A;  5L3D B;  3H3M A;  3OBV E;  5EK4 A;  3AVS A;  1YW0 A;  2CBJ A;  4CI3 B;  4HN9 A;  4YHJ A;  2KIN B;  2XY8 B;  4X1I E;  1H7C A;  5AQI B;  4GYR A;  5DQV A;  5LJM A;  2VL0 A;  3QC9 A;  4LML A;  4MBQ A;  5LMU T;  5HAX A;  3ONL C;  3GN5 A;  5J0Z A;  5LHH B;  5H6Q B;  3BQK A;  4P1N A;  4AIU A;  4U7I A;  2VB6 A;  3RC3 A;  4XZC A;  3PUS A;  3HKD E;  4DMV A;  2X9H A;  5FXW A;  2CXD A;  4CN4 A;  2V7K A;  4PK6 A;  5F3J A;  4GKK T;  1D1A A;  4Z8X A;  4UIG A;  3IEE A;  3ZJ1 A;  2H89 A;  3T1H T;  2F4V T;  4P0B A;  3ZC0 A;  3HKC E;  2Q9Q A;  3WI3 A;  4MFR A;  4YLH A;  4IE7 A;  4QXB B;  2UXB T;  5BR8 T;  3VHL A;  4OK0 A;  4AQF A;  2WWV A;  1FIO A;  3EDV A;  5LHI B;  1IJ5 A;  3TLW A;  1XDP A;  4IL9 A;  1NEK A;  2KND A;  3NBX X;  5ABF B;  3CWZ B;  1WR6 A;  2XZE A;  1G8X A;  4PK4 A;  5L3B B;  3ABV A;  2FUP A;  3GN5 B;  3PU3 A;  2H88 A;  4KHZ F;  3SFE A;  1MIV A;  3FBZ A;  4YSY A;  1T7S A;  1HNZ T;  4DV3 T;  1MIW A;  3O4X E;  4DID B;  5JVD E;  1WYC A;  5HEG A;  3ZYM A;  3IF8 B;  1V9D A;  2XSA A;  2DL1 A;  4ASK A;  3C4Z A;  3PUX F;  1ZV4 X;  3FBL A;  2IIU A;  2MAW A;  3UQ4 A;  3FZM B;  5LHG B;  4O4J E;  3ZMT B;  3ZSS A;  4MHC A;  4A5X A;  2X66 A;  3N9N A;  2Q9Q D;  3ESL A;  4QH4 A;  3FXD B;  2VQF T;  3GWH A;  3LDQ B;  5FYM A;  3ZT7 A;  2BG9 C;  5EK2 A;  4GK5 E;  5LJN A;  3V5S A;  1ZP0 A;  2CEA A;  2ODV A;  2XQ7 A;  5FXX A;  4EZ4 A;  1NEN A;  1MMN A;  3KV6 A;  4BJN A;  3GMI A;  1G73 A;  3KBU A;  5A1L A;  3NZQ A;  2ZLY A;  1IAP A;  4HWI B;  4J2C A;  3MXZ A;  3CKD A;  2PFV A;  2XJ7 A;  2WDQ A;  5FXV A;  2LHN A;  4GK0 E;  1D1B A;  2YIN A;  3SS1 A;  3UQ7 A;  2Y48 B;  5ETW A;  2X68 A;  4L9I A;  5AQP B;  2GK9 A;  2XAH B;  3K3O A;  4OHF A;  2PBI A;  1SE7 A;  4KMC A;  1NAF A;  2HN1 A;  3A8Y C;  1HF8 A;  2D0U A;  4GOU A;  5JDG A;  3N9P A;  3N9O A;  2YU2 A;  4O4I E;  1W09 A;  2QA7 A;  1OED C;  3E22 E;  3LK2 B;  2V5C A;  4P0A A;  4FJO A;  2CLY B;  4HWH A;  5E0O A;  3QOF A;  5LGT B;  2QYW A;  3KDS E;  4CI2 B;  2XPK A;  1HNW T;  2XQ4 A;  5FY7 A;  1LVF A;  1XZY A;  4ZI3 D;  3ZPO A;  2YDQ A;  2JQ9 A;  3AEG A;  5HCM A;  4UV9 B;  2I6H A;  3RRW A;  4A56 A;  4I0U A;  4EYU A;  1QLB A;  1UGO A;  2CXL A;  4H63 H;  3DJB A;  4GKJ T;  2V7J A;  2BG9 E;  1J1J A;  1X79 A;  3P50 A;  3CK6 A;  3IBP A;  4DBR A;  4X5T A;  2FJA A;  4HFE A;  1ZOY A;  4DO0 A;  1M62 A;  4ILB A;  3J7Y q;  3DP7 A;  3OVU A;  2LM9 A;  4Z91 A;  2JIW A;  5LP6 E;  1E2A A;  2XM1 A;  3P7I A;  2LOP A;  3M65 A;  2LSG A;  5EK3 A;  3RIU A;  4LF5 T;  4PJM A;  5JH7 E;  3TKL B;  1US7 B;  3MAC A;  4IE6 A;  4L0R A;  4TNV A;  3F57 A;  3L8R A;  1D0Z A;  2L9Q A;  3PUY F;  3Q5W A;  2WWU A;  3ONJ A;  4DVD A;  2KT9 A;  4HKA A;  5DAB A;  2I0M A;  5F8P A;  2WAU A;  3Q2M A;  2V6Y B;  5AQQ B;  3ZCI A;  2LLY A;  4IL4 A;  5GON E;  4LFB T;  3WAK A;  4B3M T;  2BDE A;  4EZH A;  3L09 A;  1OED E;  4AKG A;  2L8K A;  2VKH A;  3OTO T;  2WBL A;  3P4S A;  3VRB A;  3OYX A;  1SA0 E;  3PU8 A;  3QUJ A;  4YY3 T;  1IBL T;  4O2B E;  2NTX A;  2W4X A;  1MMG A;  4YJ2 E;  2VL8 A;  3HI2 A;  5DQW A;  5HEU A;  4WZX A;  5LOV E;  5L3C B;  4UXN B;  4ILU A;  3NKZ A;  3JAE A;  2UUB T;  2PJQ A;  2E9X C;  4GIW A;  4DND A;  3K3Q C;  5JR9 C;  4JI0 T;  3LBX B;  1YKH B;  5AFU L;  4ZZB A;  4IDQ A;  4O4L E;  5FMN A;  3N9L A;  2M6I A;  3RQU A;  3UFE A;  2IW5 B;  5FVK A;  1MND A;  3C4X A;  1HX8 A;  4QKN A;  2XAQ B;  4ANJ A;  2BBJ A;  1D0Y A;  5LB7 B;  3BQI A;  4HWF A;  4UR9 A;  3LK3 B;  3TLS A;  2V26 A;  1U4Q A;  2NP9 A;  2NWB A;  1D0X A;  1MMD A;  4PFO A;  4TWD A;  2CHO A;  4OYJ A;  3N5L A;  2W63 A;  2C0S A;  3SFD A;  2N2N A;  3AEA A;  2BG9 B;  4IT4 A;  1FMV A;  2KMF A;  1N34 T;  2YEV C;  4OFZ A;  2BS2 A;  4BJM A;  2R6G F;  5KDM C;  2YOE A;  5LXT E;  3TLU A;  3LSV A;  1ZKE A;  5TAO A;  4X65 T;  3A7M A;  4HWC A;  4IDZ A;  4DR2 T;  4WW0 A;  2DNX A;  2IDO B;  1UX4 A;  5M4Y A;  3PUQ A;  2LEH A;  3VU7 H;  5LG3 A;  2EHO C;  1QUU A;  2IC9 A;  3P4W A;  4DUZ T;  4DV7 T;  1E1H B;  1U5P A;  2UXD T;  3RQW A;  2K3W A;  4MAL A;  4YT0 A;  1UX5 A;  5ADX L;  1O3X A;  3RIF A;  2XSB A;  2WCA A;  2JQH A;  4UEL A;  3JAD A;  3DTO A;  5DJQ C;  4IHJ E;  4HFC A;  3ZYK A;  3ZEF B;  5LG4 A;  4H9Q C;  2JMK A;  1I6Z A;  3L39 A;  4P09 A;  2VUR A;  5BMV E;  4LMJ A;  5ABF A;  2KWI B;  3F31 A;  4HE8 A;  1OED B;  5L2L A;  4XBF B;  3ONX A;  5FY0 A;  1HCI A;  4WBO A;  4NPP A;  3AAE B;  4JEH B;  4YFS A;  1YKE B;  3P4R A;  2KXP B;  3CVR A;  3ZT6 A;  4I4T E;  4KBM B;  2WZI A;  5IWA T;  4AKI A;  4LFC T;  3RH3 A;  3PV0 F;  3ANW B;  1VCT A;  2C5J A;  3E0Z A;  2PG8 A;  4JV5 T;  3IA3 A;  3BK9 A;  3PTR B;  4ILA A;  2W00 A;  1N33 T;  2X67 A;  2WP9 A;  4KHP T;  4H9O C;  1I94 T;  2DCF A;  2WSS V;  2WB5 A;  2XM2 A;  2V7L A;  3EDU A;  4H9R C;  3F2E A;  3M3Z B;  4A97 A;  4Z90 A;  4TNW A;  1KNP A;  2MTQ A;  5FY1 A;  4O8S A;  5CA1 E;  2K24 A;  3AAI A;  4NIQ A;  3PUZ F;  2D9D A;  5LGN B;  3NRY A;  4LF4 T;  4DR1 T;  4X62 T;  4DBQ A;  1HS7 A;  2E5V A;  5AQV B;  5HCJ A;  2LRK A;  4V1A v;  2I59 A;  3JC6 C;  2W66 A;  2IC6 A;  5CFB A;  2X0L B;  2UUA T;  4O2A E;  2XQY A;  5AQJ B;  2X0H A;  1HR0 T;  2FBW A;  5FKY A;  4C90 A;  4Q25 A;  4CN1 A;  2W62 A;  2V7M A;  4TZ4 C;  4KUM B;  5JDH A;  4TWH A;  2JJ9 A;  2XAJ B;  1BR2 A;  4JI4 T;  5AQM B;  1UUR A;  1FEW A;  4AQG A;  2VVS A;  5AQN B;  2OV9 A;  4ZS3 A;  4YJ3 E;  3RYC E;  2CCQ A;  2DI4 A;  2VQE T;  5L47 A;  2FJE A;  1YQ4 A;  2IAK A;  4NUV A;  2UXX B;  2CBI A;  3PJA A;  5JR9 B;  3FZH B;  4PAG A;  2WQY A;  3EAM A;  5J2U E;  2B76 A;  3CX6 B;  2LOS A;  3EI0 A;  2KLQ A;  3AE4 A;  5H6R B;  4JI3 T;  3RRC A;  5L4H A;  4UVA B;  3I0O A;  2DWG A;  2W61 A;  2C5I T;  5FL0 A;  3O1I A;  1L0V A;  5CGM A;  2PTF A;  3AE3 A;  3LK4 2;  5KX5 E;  3KBT A;  5J1G A;  1XNR T;  4QX8 B;  5HXS A;  3VR9 A;  4EGW A;  5CJ5 A;  1VRB A;  3ZMU B;  2J4G A;  3UT5 E;  3H3A A;  3ZYL A;  2V5D A;  3AA0 B;  3G06 A;  4PJJ A;  2BVL A;  4ERR A;  2CHN A;  4JI6 T;  4QX7 B;  4QXH B;  4E7S A;  4IDO A;  4F8H A;  4UEM A;  3QK6 A;  4I43 B;  4G2A A;  4ISS A;  3U3I A;  4DV6 T;  4M1P A;  3I9W A;  5FXZ A;  4DUY T;  4JLE A;  3PUG A;  2X0Y A;  4E7Z A;  2K9A A;  1JNR A;  2V6Y A;  2HPL A;  4ZS2 A;  4EIW A;  3MJX A;  2WU5 A;  4ZI7 E;  3RYH E;  2YN6 A;  1KNZ A;  2VVN A;  3GA8 A;  1Y01 A;  1NWM X;  4LF6 T;  2WU2 A;  3NRX A;  2LKG A;  1XMO T;  4EAH A;  3PUR A;  2NTY A;  2UU9 T;  3AB3 B;  4YSZ A;  2BVM A;  4HGA A;  3KV4 A;  4TX5 A;  5AQT B;  3HL6 A;  2CMR A;  2UXC T;  4EED A;  2CA5 A;  1T8B A;  1YQ3 A;  3LBX A;  3SRZ A;  1HG5 A;  4JYA T;  4IDP A;  2LSJ A;  2YDS A;  3NZP A;  3AEF A;  1BR4 A;  4YHH T;  1WLX A;  1D1C A;  2WS3 A;  4CN6 A;  3UUM A;  1SHZ C;  3X1D A;  5JTG A;  3CQG B;  5L4E A;  4I50 E;  3RKO A;  5LNK A;  2XQ6 A;  4DMW A;  4COF A;  1S94 A;  2CXF A;  2LSI A;  1E7P A;  4A98 A;  2KSR A;  4DR7 T;  4U3C A;  4ZEY A;  3AEB A;  4B3T T;  4N78 D;  3KVA A;  4JEU B;  3J9X 1;  1QSD A;  3NWI A;  4AXP A;  1KF6 A;  5AQK B;  2X9Y A;  2WZH A;  4IGU A;  2BKP A;  5HXC A;  4ADZ A;  2VKJ A;  1Z0P A;  5IUX A;  1KEY A;  2ZM0 A;  2MOZ A;  2E8I A;  2BG9 A;  4ILC A;  2NW8 A;  3FXE B;  5LCY A;  2QVA A;  2V6X A;  3K8P C;  2B1E A;  4AIS A;  1BR0 A;  2ZM8 A;  3KV9 A;  2CE7 A;  4QH1 A;  1OWA A;  3ZN1 B;  1M7K A;  3JCF A;  4XAX B;  2E2A A;  1HX1 B;  5ABE A;  3FHN A;  2LSK A;  4PFP A;  4CQI A;  3AEE A;  1LVK A;  2FJD A;  2HH7 A;  3N9Q A;  2ODU A;  1XWM A;  4U2Z A;  1X9B A;  4YTN A;  3ZMS B;  1LRZ A;  2SPC A;  2BKO A;  4JI8 T;  4EEB A;  4B3R T;  2N9D A;  2A9U A;  3CX7 B;  4HFV A;  5HEJ A;  3MK7 C;  3H37 A;  4EOZ B;  2UUC T;  4IIJ E;  3AA1 B;  3IHR A;  4YTM A;  2Q9Q C;  3Q5D A;  1FMW A;  3ZCJ A;  4QWN B;  4EV6 A;  3HR0 A;  2JQQ A;  1OED A;  2BS3 A;  4AQF C;  5L3F B;  5AQF B;  3AE5 A;  3UFG A;  4EYY R;  3CPZ A;  4FI5 A;  2WDR A;  4UF0 B;  3UTK A;  1YXR A;  2WDV A;  4H9S E;  2BKN A;  2LJL A;  3PDY A; 
#chains in the Genus database with same CATH homology
 3Q5X A;  2M67 A;  2V7L A;  1MMN A;  3ANW A;  3KV6 A;  3I1A A;  4PK5 A;  4BJN A;  3EDU A;  4H9R C;  3UUN A;  2W0G A;  3F2E A;  1EZ3 A;  3GMI A;  3V5U A;  1WRD A;  2VK9 A;  1IJ6 A;  1G73 A;  3KBU A;  2MTQ A;  3ZC1 A;  3EVY A;  5A1L A;  5FY1 A;  3NZQ A;  1MMA A;  2ZLY A;  1IAP A;  4O8S A;  4J2C A;  2K24 A;  2N1G A;  3AAI A;  3C50 A;  3CKD A;  3MXZ A;  2PFV A;  3VKH A;  2ES0 A;  2K5B B;  3ZMV B;  5FXV A;  3AAA B;  4C91 A;  2LHN A;  4GK0 E;  4UF0 A;  5LGN B;  3P8C D;  1D1B A;  2YIN A;  3RYF E;  3NRY A;  3SS1 A;  2Y48 B;  4AKR B;  4F6R C;  1IZN B;  4DBQ A;  4TV8 E;  1HS7 A;  5ETW A;  4ZI2 C;  2X68 A;  4L9I A;  3KIN B;  3O1J A;  4U72 A;  2ZM2 A;  2GK9 A;  2XAH B;  3K3O A;  2NW7 A;  4V1A v;  3JC6 D;  2I59 A;  2ACX A;  2BZB A;  2PBI A;  4OHF A;  5JDN A;  4KMC A;  3WAJ A;  3JC6 C;  5JQG E;  2IC6 A;  1NAF A;  2XUE A;  2XAF B;  3ZMZ B;  4O4H E;  2X9W A;  4CXX A;  2X0L B;  3C64 A;  1HF8 A;  2D0U A;  4GOU A;  3ZN0 B;  2LT3 A;  5JDG A;  4O2A E;  2XQY A;  4IE4 A;  3N9P A;  4ZOL E;  1S35 A;  2XHE B;  3N9O A;  2YU2 A;  4CXW A;  1YD8 G;  4O4I E;  2QA7 A;  1ZEE A;  2KZ7 B;  2VWA A;  3E22 E;  3LK2 B;  1B7T A;  4P0A A;  4FJO A;  3I0Q A;  2CLY B;  1MNE A;  5E0O A;  3MZK B;  4C90 A;  5JDQ A;  2WMO A;  2MBG A;  1MIY A;  2W62 A;  3CX8 B;  2V7M A;  3R84 B;  5LGT B;  4TZ4 C;  4KUM B;  3ZLI A;  1HTJ F;  3RX6 A;  5JDH A;  1HFA A;  3KV5 A;  5HXH A;  2DWK A;  3KDS E;  4BA9 A;  4CI2 B;  4WNK A;  2JJ9 A;  4TV9 E;  2XAJ B;  1BR2 A;  3AVR A;  5FY7 A;  1LVF A;  3MKD A;  1FEW A;  4UVC B;  3OKQ A;  2XTL A;  4AQG A;  4ZI3 D;  3ZPO A;  4NUU A;  4ZI3 C;  4H63 V;  4ZS3 A;  2H7V C;  4UV9 B;  3E08 A;  2L3L A;  3RRW A;  4A56 A;  2D5U A;  2LHR A;  4EYU A;  5HXE A;  2Y6X A;  3BQL A;  2CXL A;  4YJ3 E;  4PJN A;  3RYC E;  3O9X A;  4H9N C;  4H63 H;  4JUY A;  3D0T A;  2CCQ A;  2DI4 A;  4GYS A;  3DJB A;  5HXR A;  2V7J A;  5L3G B;  1X79 A;  3N9M A;  5HYA A;  2IAK A;  4NUV A;  3IBP A;  3LG7 A;  2UXX B;  4DBR A;  1KK7 A;  5LGU B;  3PUA A;  4AKH A;  2VKD A;  4DO0 A;  5JR9 B;  3AA6 B;  3N2G E;  4PAG A;  3DP7 A;  3C51 A;  4IST A;  3J7Y q;  5J2U E;  2LM9 A;  1WYB A;  5L3E B;  3A5X A;  5HWY A;  3CX6 B;  5CA1 E;  5LP6 E;  3S4U A;  3P7I A;  2LOS A;  2LOP A;  3M65 A;  4X1Y E;  2KLQ A;  2LSG A;  4EXT A;  5EK3 A;  2JRK A;  4UV8 B;  5H6R B;  3OJA A;  3RRC A;  4UVA B;  3I0O A;  2DWG A;  2UXN B;  4PJM A;  2D0T A;  5KMG P;  2W61 A;  2C5I T;  3O1I A;  2E9X A;  5JH7 E;  4X1K E;  3TKL B;  1US7 B;  2X9X A;  3CML A;  3MAC A;  5JR9 A;  3MA9 A;  1ZHC A;  2JPF A;  4IE6 A;  2DLR A;  3LK4 2;  5KX5 E;  1VOM A;  3B57 A;  3O1H A;  4L0R A;  3KBT A;  5FNV E;  3F57 A;  2MYS A;  1AJ3 A;  2CWY A;  2YU1 A;  1D0Z A;  3UUX B;  2L9Q A;  5J1G A;  4QX8 B;  5HXS A;  1BR1 A;  3Q5W A;  3RYI E;  3OYZ A;  1T98 A;  2WWU A;  5IYZ E;  2H7O A;  5JDF A;  4DVD A;  2KT9 A;  4HKA A;  1VRB A;  5DAB A;  5LBQ B;  3ZMU B;  5F8P A;  3RPU A;  3H3A A;  3UT5 E;  3RC8 A;  2WAU A;  4UVB B;  3ZYL A;  2H3R A;  3AA0 B;  3CQX C;  4IE5 A;  4PJJ A;  5CB4 E;  3SWH A;  3LFM A;  4OYK A;  3Q2M A;  2CLY C;  5LBM A;  2BVL A;  4ERR A;  3ZCI A;  2KWH A;  1Y64 B;  4QX7 B;  5GON E;  3WAK A;  4B6X A;  4QXH B;  2BDE A;  4E7S A;  5LYJ E;  2G0U A;  4EZH A;  3L09 A;  3AA7 B;  4AKG A;  2L8K A;  3HA4 A;  4H9P C;  2QGS A;  2A3D A;  2K48 A;  4UEM A;  2VKH A;  2WBL A;  3QK6 A;  2CWO A;  4I43 B;  4G2A A;  2WM9 A;  4IE0 A;  3OYX A;  3N2K E;  4ISS A;  3U3I A;  3W15 B;  1SA0 E;  3PU8 A;  4AKL A;  4I55 E;  3QUJ A;  4M1P A;  4PW8 A;  4CI1 B;  5HWX A;  3I9W A;  5FXZ A;  2LE8 A;  4U74 A;  5JRE A;  4JLE A;  3PUG A;  4O2B E;  2NTX A;  1MMG A;  2YK0 A;  4E7Z A;  4YJ2 E;  2K9A A;  2VL8 A;  3HI2 A;  2C5K T;  2HPL A;  4ZS2 A;  5L3D B;  4EIW A;  5DQW A;  3MJX A;  3OBV E;  5EK4 A;  5LOV E;  4ZI7 E;  3AVS A;  3KVB A;  3RYH E;  5L3C B;  1YW0 A;  4UXN B;  4ILU A;  2JMH A;  2E9X D;  4CI3 B;  1KNZ A;  4HN9 A;  4YHJ A;  2PJQ A;  2E9X C;  2KIN B;  4GIW A;  4DND A;  3GA8 A;  3K3Q C;  5C8Y E;  4X1I E;  1CUN A;  5JR9 C;  3LBX B;  1NWM X;  1H7C A;  3NRX A;  4GYR A;  4TUY E;  5DQV A;  5LJM A;  3K3N A;  1YKH B;  4EAH A;  5AFU L;  3PUR A;  3QC9 A;  4AI6 A;  2NTY A;  4MBQ A;  4O4L E;  5FMN A;  3N9L A;  5HAX A;  2E9X B;  2EHO A;  3GN5 A;  5JRC A;  2A2F X;  3AB3 B;  3UFE A;  4BAY B;  4WBN E;  2IW5 B;  5LHH B;  3EUH A;  5H6Q B;  1MND A;  3C4X A;  2BVM A;  4HGA A;  3KV4 A;  4TX5 A;  1HX8 A;  3ETU A;  3BQK A;  3HL6 A;  4QKN A;  2CMR A;  3UUL A;  2CA5 A;  2XAQ B;  3LJC A;  4ANJ A;  2VB6 A;  1D0Y A;  3RC3 A;  3LBX A;  3SRZ A;  1HG5 A;  3BQI A;  2A72 A;  4XZC A;  3CQC B;  2LSJ A;  3NZP A;  3PUS A;  1LKX A;  4HTE A;  3HKD E;  4DMV A;  3LK3 B;  5J2T E;  1BR4 A;  2X9H A;  2V26 A;  1U4Q A;  5FXW A;  1WLX A;  1D1C A;  2NP9 A;  5FP3 A;  3UUM A;  2CXD A;  2NOX A;  4X20 E;  2Q9Q B;  1SHZ C;  2NWB A;  2V7K A;  2Y8D A;  4PK6 A;  1D0X A;  1MMD A;  5CA0 E;  5LA6 E;  2J1D G;  4PFO A;  3CQG B;  5F3J A;  3Q9D A;  4OYJ A;  3N5L A;  2W63 A;  2P9B A;  4I50 E;  3RKO A;  2C0S A;  1D1A A;  2N2N A;  5LNK A;  4Z8X A;  4DMW A;  4UIG A;  1FMV A;  2KMF A;  4QXC B;  1S94 A;  2YEV C;  2CXF A;  4EB6 E;  4OFZ A;  2LSI A;  4ZHQ E;  3IEE A;  3ZJ1 A;  4BJM A;  5KDM C;  4KP3 C;  4N78 D;  3KVA A;  4JEU B;  3J9X 1;  1QSD A;  4P0B A;  4QHO A;  4AXP A;  2X9Y A;  3HKE E;  5LXT E;  4IGU A;  3ZC0 A;  3N2O A;  1ZKE A;  3HKC E;  2Q9Q A;  5HXC A;  5TAO A;  4PNI A;  2LSY A;  2RA1 A;  4ADZ A;  4K0U A;  2VKJ A;  4IDZ A;  1Z0P A;  3C98 B;  4WW0 A;  3WI3 A;  2DNX A;  2Z6E A;  2ZM0 A;  4MFR A;  2MOZ A;  4YLH A;  4IE7 A;  4QXB B;  2E8I A;  4ZI2 D;  2NW8 A;  3FXE B;  1UX4 A;  3VHL A;  5M4Y A;  3T8O A;  3PUQ A;  2LEH A;  4OK0 A;  2EHO D;  5LCY A;  4AQF A;  3VU7 H;  1HG2 A;  3K8P C;  4TN7 B;  2EHO C;  2B1E A;  1FIO A;  3EDV A;  1QUU A;  5IHY A;  5LHI B;  2IC9 A;  1BR0 A;  2ZM8 A;  1IJ5 A;  2X51 A;  1E1H B;  3KV9 A;  1U5P A;  2CE7 A;  3VKG A;  4MLK A;  2ZMA A;  2KND A;  3NBX X;  3HKB E;  3CWZ B;  1OWA A;  3ETV A;  1WR6 A;  2HPJ A;  2D2S A;  2VAS A;  4MAL A;  1G8X A;  3ZN1 B;  1UX5 A;  5ADX L;  1O3X A;  4PK4 A;  5L3B B;  4XAX B;  2EHO B;  3GN5 B;  3PU3 A;  5JRC B;  3R6N A;  4HEA A;  3FHN A;  4UEL A;  2LSK A;  3DTO A;  1MIV A;  4PFP A;  5DJQ C;  2V1D B;  3FBZ A;  4CQI A;  1LVK A;  4IHJ E;  2HH7 A;  2CM0 A;  3ZYK A;  3N9Q A;  3ZEF B;  2ODU A;  5LG4 A;  4H9Q C;  2JMK A;  1MIW A;  3O4X E;  5JVD E;  4P09 A;  3ZMS B;  1LRZ A;  1WYC A;  2SPC A;  5BMV E;  3ZYM A;  2KWI B;  3IF8 B;  1V9D A;  3F31 A;  4HE8 A;  4ASK A;  5L2L A;  2N9D A;  4XBF B;  3C4Z A;  3ONX A;  5FY0 A;  1ZV4 X;  1HCI A;  3FBL A;  3KFW X;  2WMN A;  3CX7 B;  4HFV A;  3ZJ2 A;  3MK7 C;  3H37 A;  4WBO A;  4EOZ B;  5LHG B;  4IIJ E;  4O4J E;  3ZMT B;  3AA1 B;  4CXY A;  4MHC A;  3AAE B;  2XAG B;  2VKO A;  4L5G A;  2X66 A;  3IHR A;  5EZY E;  3N9N A;  3I9Y A;  4JEH B;  4YFS A;  3L3P A;  2Q9Q D;  1YKE B;  2KXP B;  2Q9Q C;  3B13 A;  3CVR A;  4I4T E;  4CZZ B;  4KBM B;  1FMW A;  3C4W A;  3ESL A;  4AKI A;  1OXZ A;  3RH3 A;  3FXD B;  3ANW B;  3FB2 A;  3GWH A;  5FYM A;  3ZCJ A;  2C5J A;  4PJL A;  3E0Z A;  5EK2 A;  3PE0 A;  2PG8 A;  4GK5 E;  5LJN A;  4QWN B;  3V5S A;  3HR0 A;  2JQQ A;  5JDM A;  3BK9 A;  3PTR B;  2W00 A;  4AQF C;  2CEA A;  2DHR A;  2X67 A;  5L3F B;  4H9O C;  5JDL A;  4EYY R;  2XAS B;  2ODV A;  2V7I A;  3CPZ A;  4FI5 A;  4G63 A;  2DCF A;  2RP4 A;  4UF0 B;  2NW9 A;  2WSS V;  3UTK A;  4H9S E;  5FXX A;  4EZ4 A;  1UCU A;  2OA5 A;  3SOL A;  3U78 A;  2LJL A;  3PDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...