4NXNT

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4nxnT00
4JV5T 4AQYT 4B3RT 1HR0T 4OX9T 4JI2T 4DR2T 4DR1T 1XMQT 4B3ST 4YHHT 4DV6T 5LMNT 1N36T 4LF9T 4DV0T 4YY3T 4JYAT 1XMOT 1N32T 4DR6T 2UXBT 4JI3T 4LF7T 4LFBT 4LF6T 2E5LT 2UUCT 2HHHT 1J5ET 4X65T 3OTOT 4DV7T 4LFAT 1I94T 4LFCT 2ZM6T 4LF4T 4X64T 4LF5T 4X66T 1N33T 4K0KT 4B3MT 4NXNT 4DR7T 4GKJT 1HNZT 4JI1T 5BR8T 5LMUT 4DV3T 2UUAT 4X62T 1N34T 2UU9T 4DV2T 1FJGT 2VQFT 5IWAT 4DR5T 2UXCT 4JI5T 4DUZT 4DV1T 4DV4T 4DV5T 1XNRT 1XNQT 4JI7T 1HNXT 1IBKT 4DR4T 1IBMT 2F4VT 4JI6T 3T1YT 4KHPT 4JI8T 4DR3T 2UXDT 4JI4T 4DUYT 4JI0T 2UUBT 4LF8T 4NXMT 1IBLT 2VQET 3T1HT 1HNWT 4B3TT 4GKKT
chains in the Genus database with same CATH superfamily
5DABA 4GYSA 2DWGA 2YEVC 3MKDA 4EZHA 2HPJA 4YHHT 2H7OA 3WAJA 5C3JA 5LXTE 1W0AA 2WWUA 1SA0E 1Z8UA 4HWDA 3DJBA 3PJAA 2W2UA 1E1HB 4ZI3D 4O4HE 4HEAA 2V8SV 3UT5E 4CN1A 2FJAA 2K9AA 3IEEA 4V1Av 3ZMUB 5LOVE 4L5GA 4Z8XA 2QA7A 4K0KT 1MIYA 2V6YA 2WSSV 1B7TA 4KX6A 5HEUA 1HFAA 3QK6A 2IW5B 4BJMA 5L2LA 1M62A 4AIUA 4JI5T 4JEHB 4UV9B 4PJJA 5IYZE 2XQ8A 3KBTA 3NVOA 2XAHB 5ABEA 2F4VT 5LBQB 2MTQA 3OYXA 3C64A 2VVSA 2HH7A 2NOXA 4DVDA 3RYFE 4LMJA 3GMIA 4IDPA 1OXZA 3AXJB 2MBGA 5F3JA 3LBXA 3ONLC 3C4XA 2Q9QB 3FZLB 3LG7A 4AKGA 3EHZA 2JIWA 4NUUA 2A2FX 3SRZA 4LF9T 5IUXA 1GQEA 2XQ7A 5ABHA 3D0TA 3HKBE 1WYCA 4DO0A 2LSGA 3GA8A 4ILAA 3ZT6A 1US7B 3PU3A 3FBLA 2WMNA 3HI2A 1X79A 2WAUA 3ZT7A 2DCFA 1J5ET 3AAIA 1KFYA 5L3DB 1HG2A 3F2EA 3V5SA 4DNDA 2DLRA 4ILBA 5BR8T 4GIWA 2WY2A 1UK5A 2WZIA 4O4JE 2XTLA 2IIUA 3U3IA 3AE5A 3ZN1B 5FP3A 1HS7A 3AE4A 1W09A 4Z90A 2ACZA 2XQYA 2K24A 5J2UE 1YQ3A 1J1JA 1KNZA 4DIDB 3KV6A 2H3RA 2OLTA 4IE4A 1R8IA 5AQMB 2YOEA 3P4QA 3ZMZB 4KHPT 3L39A 4JI4T 1ZP0A 3AAEB 4AQFA 4L0RA 5JRCA 3VKGA 4UIGA 4NPPA 4ISSA 2FJDA 1XDOA 1HR0T 4B3ST 1UUSA 1ZEEA 2BG9B 3ABVA 2JMKA 3RIUC 1HF8A 3CQGB 1D1CA 4YFSA 2E9XB 5FXZA 4KUMB 2LSJA 4C90A 1MMNA 4DR6T 5HEGA 1MMDA 2NWBA 4LMKA 4HTEA 4ILUA 5AFUL 3AEAA 2CLYB 4LFCT 3RF1A 3MJXA 3AB3B 2WBLA 2AE9A 1IZNB 1CHUA 3K3NA 2C5KT 4I0UA 4PK4A 1LVFA 1O3XA 4QH4A 5LGUB 3AEEA 4TWHA 4DR7T 2L8KA 3VU7H 2XZEA 3FZFB 4QXCB 3K3QC 5L47A 1YD8G 2XQAA 2LE8A 5JDHA 1YKHB 3I9YA 2L3LA 4U7IA 3KFWX 1L0VA 2UXCT 5AQNB 2IUBA 5AQOB 4YJ2E 4LMLA 4TWDA 5AQTB 4QKNA 3VRAA 4U2YA 2JRKA 1HG5A 3OPCA 4H9OC 2X0HA 3FZHB 2IMLA 4YLHA 3PUYF 3KBUA 4OFZA 4UXNB 3NRXA 4DBRA 4CQIA 2V7KA 3ZPOA 5JTGA 1HTJF 1KEYA 3PUSA 4FI5A 1M7KA 5HXRA 4ZHQE 3PUQA 4ZS3A 4YY3T 2DI4A 1N32T 4JI3T 2KLQA 2LSKA 2V6YB 2D5UA 2UUCT 2HHHT 2ZMAA 3UUXB 2VKDA 4LFAT 3ZC0A 1D0XA 1OWAA 4LF4T 1V9DA 2W4XA 4LF5T 3ZT5A 3ZEFB 4IDZA 3IHRA 3L3PA 3H3AA 3AA6B 3QUJA 4KP3C 4DR5T 5AQFB 2VVNA 4TNVA 3UU3A 2VL8A 1OEDA 3LBXB 5H6QB 3V5UA 4OHFA 2WQYA 3CK6A 4WZXA 2ZLYA 1J5WA 4QH1A 2WCAA 2XAQB 2A9UA 3N9PA 3EUHA 2CXLA 4I50E 1X9BA 2L9QA 3LJCA 4IDNA 3ETUA 1BR2A 2XQ9A 2IAKA 2CBJA 4I4TE 3ZLIA 2J1DG 2V1DB 5JDFA 3TKLB 3IBPA 4U31A 2BKOA 4GYRA 3UUNA 3HKEE 1HX1B 4X1KE 5AQKB 3RQUA 2CPTA 5LJMA 3CX6B 2DL1A 4CXXA 2YU1A 3BK9A 2LRKA 2CLYC 2JMHA 4X66T 2J47A 2FBWA 3A7MA 4NXNT 4COFA 3S4UA 5LG3A 2LT3A 2BS3A 3ZSTA 1DU2A 4GK0E 2V5CA 3CPZA 2XAJB 1ZV4X 2XSAA 1FJGT 3NZQA 3RHWA 2VKOA 1ZKEA 3AE3A 4ZXLA 2N2NA 4F6RC 4ZZBA 2LEHA 3ZCIA 2CCQA 5JRCB 2LKHA 1IBKT 4X1YE 3AVSA 1IBMT 4FJOA 2QVAA 3P7IA 4M1PA 3OVUA 1KF6A 3FZMB 3KV4A 3TLWA 1IJ5A 1G8XA 3DP7A 2UUBT 1NWMX 3QOFA 3P4WA 4F8HA 5JH7E 2CHNA 3N5LA 2H89A 3M3ZB 4QH5A 2WU2A 4DR2T 4DR1T 1ZOYA 5ABFA 1QLBA 4IHJE 2LLYA 4IREA 3UULA 2X9XA 3RKOA 1LVKA 2Z6EA 3ZYKA 1E7PA 1D0ZA 4IE5A 1XMOT 3RRWA 5AQVB 5EK3A 5F8PA 5E0OA 4U7YA 3PUXF 4X1IE 4I55E 3I0QA 2LOSA 4X65T 1IAPA 2Q9QD 2Y8DA 2WDQA 4Q25A 4MFRA 2XASB 4KI0F 5FXVA 2X9YA 4AKHA 3RGLA 4ZZCA 2KSRA 3CQCB 4IT4A 3LK2B 4PFPA 3AA0B 2H88A 3PE0A 1I6ZA 3HL6A 4IDOA 3RYHE 2XUEA 3AVRA 2NW7A 2B1EA 4DV4T 2HN1A 4H63H 2W67A 5FVKA 2DHRA 4WYVA 3JAEA 4HWCA 1MNDA 3ONXA 4TV9E 2BG9E 2XQ3A 3CWZB 3PUZF 3ZYMA 2E2AA 3IF8B 5CB4E 5ETWA 4DR3T 5M4YA 2LM2A 2KT9A 2V7JA 3UUMA 5KDMC 3RPUA 5FKYA 2VL0A 2VQET 4KHZF 4H9PC 1SHZC 5JDGA 5BMVE 4JV5T 2X66A 2VURA 2LHNA 2I0MA 4CXYA 3VR9A 5L3FB 2MPKA 1BR1A 2W63A 2LSYA 5J0ZA 4EYYR 3LFMA 3AEDA 2LRLA 3N9QA 1QUUA 4ILCA 4UR9A 5AQIB 2K48A 2CWOA 3TLSA 4HFBA 1CUNA 4EEBA 1HNZT 2XAFB 2RPAA 4QXHB 2E9XD 4UEMA 4YXDA 2KWIB 1OEDB 4U72A 5JVDE 3GN5B 5LYJE 2X0YA 2W66A 4IL4A 2DWKA 2VQFT 2W0GA 5AQJB 4TUYE 2NR4A 3AE6A 3EDUA 3K1SA 2WWVA 2JQHA 3EVYA 3N9MA 3LDQB 2GK9A 1KNRA 4ADZA 4AQFC 3CX7B 3TLVA 2PJQA 1YXRA 2D9DA 4JI0T 5AQGB 3O1IA 3AE7A 3ZKRA 1HNWT 2V5DA 2IC9A 1KNPA 4AQYT 4IGUA 4OK0A 2YN6A 3RYIE 4A5XA 3SS1A 3NRYA 3MA9A 3CIRA 5TAOA 3CVRA 2V6XA 3ESLA 4WBOA 5AQHB 4HWFA 3KVBA 5DQVA 2X0LB 5LG4A 4PJNA 2YKSA 4AISA 4PAGA 5L3GB 3F31A 2QYWA 4LF6T 5FNVE 4DV7T 5HCJA 3ZN0B 2BS4A 5EK4A 5DQWA 1Y01A 4G63A 4XZCA 1XDPA 4HGAA 2X51A 4XBFB 3UQ4A 4CI1B 5KXJA 3VR8A 4GOUA 4DV2T 4U33A 5LCYA 2K5BB 3K8PC 1S94A 2WZHA 3W15B 4AI6A 2M6IA 3LK42 4DV5T 4YSYA 1NEKA 4DBQA 5L3EB 2V7IA 4DMWA 2YDSA 4A97A 4EAHA 4EZ4A 2H7VC 4YSXA 2WDVA 5ABFB 1SE7A 3VHLA 4O4IE 4DUYT 3SFEA 5CJ5A 3FXEB 2XAGB 2EHOA 2NW8A 5IHYA 2KWHA 3PTRB 3UQ7A 4OYKA 4WNKA 1XWMA 4ZI2C 2V7MA 2C5JA 5CGMA 5CA1E 2ES0A 4ZOLE 5HEHA 5LNKA 5ABGA 1FEWA 3WI3A 3NZPA 4LF7T 2LM9A 5AQUB 2A3DA 3ZJ1A 4TX5A 2JQQA 3L8RA 1SUMB 1U5PA 2Q9QC 2BVLA 3AA1B 4G2AA 4OYJA 5FXXA 4X20E 3AEFA 4HFDA 1VCTA 1LKXA 3KVAA 2WMOA 5LMUT 1T8BA 3C4WA 1UGOA 3JC6C 5HXEA 2ODUA 1QSDA 1OEDC 4YSZA 4EYUA 4DV1T 3FHNA 2M67A 4H9SE 2B76A 4YTPA 1NAFA 3LSVA 3E0ZA 4YT0A 4AKIA 2KNDA 1UCUA 3N9LA 4JI6T 3NKZA 3C98B 1YW0A 2J4GA 4WW0A 5LA6E 4AXPA 3VRBA 5LHIB 4NXMT 3OKQA 5FYMA 3SFDA 4PW8A 1H7CA 5HYAA 3PV0F 2D0TA 3GN5A 3OJAA 2CA5A 1AJ3A 2WU5A 3BQIA 3PUAA 1E2AA 5CFBA 4A98A 3JAFA 2WB5A 2WDRA 4UF0A 5LHGB 2HN2A 4BJNA 4JEUB 4J2CA 3AEGA 3OBVE 4H9NC 4IE0A 1I94T 3I0OA 2WM9A 5L3CB 1VRBA 5A1LA 4X64T 1MMAA 5DJQC 2BG9C 3AA7B 3PUGA 4B3MT 1MMGA 2KXPB 2JPFA 4HE8A 5J2TE 2E9XC 5EK2A 2WP9A 4L9IA 4WBNE 4DV3T 2XY8B 4MHCA 3JADA 2BDEA 3KINB 3BQKA 3PUVF 2JQ9A 4YJ3E 4ASKA 2IHR1 3UFGA 3FBZA 4U74A 2X68A 1HNXT 4JBWF 2CRBA 2J62A 4JI8T 5FL0A 1MIVA 2XM1A 3CQXC 1XZYA 4P09A 2LHRA 5AQQB 2BKPA 1VCSA 4HN9A 2CBIA 4O2AE 4X5TA 3R6NA 3Q5EA 4U2ZA 2VB6A 4OX9T 2LKGA 5JR9A 3Q9DA 3RC8A 2LOPA 2E5VA 5KX5E 1WR6A 1OEDE 3AE8A 2X67A 4H9QC 4YTMA 2CE7A 4DMVA 4ZI2D 3QB5K 2DNXA 2BKNA 2MYSA 1G73A 4TN7B 3ZJ2A 5LB7B 4NUVA 5FL1A 3ZSSA 3C50A 4EOZB 4ZI7E 1JNRA 4H9RC 2XHEB 4AQGA 1YQ4A 5F5WA 2WS3A 2PFVA 3H3MA 2CXDA 3HKCE 1Z0PA 5FXWA 2XM2A 5AQRB 2LJLA 3ONJA 1XNQT 4JI7T 4IIJE 3VKHA 3CMLA 2EHOB 4DR4T 2I6HA 3PUWF 2QGSA 2ZM2A 3PDYA 2ZM8A 2MAWA 3JC6D 3T1YT 4O2BE 4UVBB 2YK0A 3Q5XA 2N1GA 2BZBA 1JNZA 3ZYLA 5HEOA 3LK3B 4JLEA 3TLTA 2W61A 2W62A 4EV6A 4QX7B 3NWIA 4P1NA 3RIFA 1BR0A 2KMFA 2YDRA 4HFEA 3UU4A 2UXBT 4C91A 1NENA 4HWHA 1HCIA 2IDOB 4A56A 3HR0A 2HPLA 3E22E 1MNEA 2C5IT 2XJ7A 4P0BA 3UUBA 1WR0A 4UVCB 4GKJT 3J9X1 4E7ZA 5L4HA 2UUAT 5FMNA 1UX5A 5HXHA 4X62T 3L09A 2P9BA 2RA1A 5IWAT 1W9RA 4HKAA 4DUZT 5FY0A 1XNRT 3UTKA 3C4ZA 4TZ4C 3AE1A 5FY7A 4QX8B 4IE7A 1FIOA 1HX8A 2JJ9A 3UU5A 1UURA 1ZHCA 1S35A 3N2KE 2QRXA 2FJBA 4UF0B 4UVAB 3ANWA 3FXDB 4GKKT 3H37A 1UX4A 3KV9A 4BA9A 5GONE 3PJAJ 4JI2T 3UFEA 1WRDA 3C51A 4KMCA 2ODVA 1Y64B 3ZMSB 2ACXA 2VWAA 4LFBT 2OA5A 3BQLA 2M6BA 1EZ3A 3O4XE 3KDSE 5HWXA 4TWFA 3X1DA 2ZM6T 4CI3B 3RRCA 3MXZA 2N9DA 3O1JA 5JDMA 3EDVA 4BAYB 3HA4A 4HFVA 4IL9A 3RH3A 2PBIA 3P50A 3MZKB 2ZM0A 4AKRB 2UU9T 3RC3A 4QXBB 4EEDA 3WAKA 4HFCA 4ZS2A 5ADXL 2X9HA 1VOMA 2V26A 3UU6A 3Q2MA 3JCFA 5HXCA 3RQWA 3ZMTB 2EHOC 2Y6XA 2C0SA 5JR9B 3AE2A 4E7SA 3EABA 3T1HT 4EB6E 2CMRA 5LJNA 4CXWA 4UV8B 1XMQT 4DV6T 2YINA 3P8CD 5JDNA 2CEAA 3KV5A 3N2OA 2JQKA 5C2TA 5LGTB 3U78A 3RIUA 4O8SA 2E5LT 4TNWA 1FMVA 4EIWA 2R6GF 3I1AA 4UELA 4ANJA 2Y48B 3TLUA 4ISTA 5AQPB 4NIQA 1KK7A 4HFHA 4O4LE 2OV9A 2PG8A 1T72A 2NTYA 2KZ7B 2YDQA 1T98A 4IE6A 2VKJA 2BS2A 3N2GE 1N34T 2FJEA 5EZYE 1W0BA 5CA0E 4CZZB 1FMWA 3F57A 4AKLA 4MALA 3A8YC 5H6RB 3B57A 3AAAB 4LF8T 5HXSA 5J1GA 2XPKA 4ZI3C 4MLKA 2UXXB 4B3TT 3N9OA 4PFOA 4KBMB 4XAXB 2CWYA 2KINB 4N78D 5C8YE 3P4RA 2I59A 2E8IA 4CN6A 5LMNT 2UXNB 3UU8A 3AXJA 1N36T 1LRZA 3AEBA 2MOZA 4DV0T 3QNUA 5LP6E 4JYAT 5KMGP 5FVLA 2CXFA 1WYBA 3QC9A 5HWYA 3AECA 3P4PA 5LBMA 2Q9QA 4TV8E 3PU8A 5FY1A 2VK9A 3OTOT 3I9WA 2IC6A 4H63V 4PJLA 3EI0A 2X9WA 3FZKB 5L4EA 4Z91A 3CKDA 2CM0A 1T7SA 3A5XA 4JI1T 2D2SA 5HEJA 5JREA 3K3OA 1WCRA 3J7Yq 2AXDS 2K3WA 3ETVA 3RKGA 3CX8B 4EXTA 2BBJA 1D1BA 2A72A 2PTFA 3Q5DA 2V7LA 5HAXA 4ERRA 5LGNB 2NW9A 4ZEYA 3ZMVB 3ANWB 2VASA 1IJ6A 3O1HA 1MIWA 2XQ4A 3PURA 3ZC1A 3QB5A 5JQGE 3B13A 5AQSB 5JR9C 5AQLB 2NTXA 3SWHA 2G0UA 4IDQA 5HCMA 4PNIA 4PJMA 2RP4A 3RX6A 3T8OA 4B3RT 5LHHB 3OYZA 4QHOA 4U3CA 2EHOD 2XQ6A 2BVMA 3SOLA 1BR4A 3FB2A 3EAMA 4GK5E 2VKHA 3DTOA 1WFDA 3B5MA 3N9NA 2BG9A 3RYCE 4QWNB 3HKDE 4YTNA 3RLFF 2E9XA 2W00A 3O9XA 4I43B 4YHJA 4P0AA 3G06A 1N33T 3MACA 2NP9A 4HFIA 2XQ5A 3AE9A 2XSBA 4CN4A 2D0UA 4JUYA 2LSIA 3RIAA 3Q5WA 4K0UA 1WLXA 1U4QA 3ZCJA 3GWHA 3MK7C 1D1AA 2BBHA 2FUPA 4EGWA 5JDQA 3M65A 1D0YA 1YKEB 2CHOA 2SPCA 3P4SA 3RI5A 4HWIB 3NBXX 4MBQA 3R84B 2UXDT 5JDLA 2YU2A 3IA3A 4PK6A 4B6XA 4CI2B 1IBLT 3E08A 5L3BB 4PK5A
chains in the Genus database with same CATH topology
4JV5T 4AQYT 4B3RT 1HR0T 4OX9T 4JI2T 4DR2T 4DR1T 1XMQT 4B3ST 4YHHT 4DV6T 5LMNT 1N36T 4LF9T 4DV0T 4YY3T 4JYAT 1XMOT 1N32T 4DR6T 2UXBT 4JI3T 4LF7T 4LFBT 4LF6T 2E5LT 2UUCT 2HHHT 1J5ET 4X65T 3OTOT 4DV7T 4LFAT 1I94T 4LFCT 2ZM6T 4LF4T 4X64T 4LF5T 4X66T 1N33T 4K0KT 4B3MT 4NXNT 4DR7T 4GKJT 1HNZT 4JI1T 5BR8T 5LMUT 4DV3T 2UUAT 4X62T 1N34T 2UU9T 4DV2T 1FJGT 2VQFT 5IWAT 4DR5T 2UXCT 4JI5T 4DUZT 4DV1T 4DV4T 4DV5T 1XNRT 1XNQT 4JI7T 1HNXT 1IBKT 4DR4T 1IBMT 2F4VT 4JI6T 3T1YT 4KHPT 4JI8T 4DR3T 2UXDT 4JI4T 4DUYT 4JI0T 2UUBT 4LF8T 4NXMT 1IBLT 2VQET 3T1HT 1HNWT 4B3TT 4GKKT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 T;  4AQY T;  4B3R T;  1HR0 T;  4OX9 T;  4JI2 T;  4DR2 T;  4DR1 T;  1XMQ T;  4B3S T;  4YHH T;  4DV6 T;  5LMN T;  1N36 T;  4LF9 T;  4DV0 T;  4YY3 T;  4JYA T;  1XMO T;  1N32 T;  4DR6 T;  2UXB T;  4JI3 T;  4LF7 T;  4LFB T;  4LF6 T;  2E5L T;  2UUC T;  2HHH T;  1J5E T;  4X65 T;  3OTO T;  4DV7 T;  4LFA T;  1I94 T;  4LFC T;  2ZM6 T;  4LF4 T;  4X64 T;  4LF5 T;  4X66 T;  1N33 T;  4K0K T;  4B3M T;  4NXN T;  4DR7 T;  4GKJ T;  1HNZ T;  4JI1 T;  5BR8 T;  5LMU T;  4DV3 T;  2UUA T;  4X62 T;  1N34 T;  2UU9 T;  4DV2 T;  1FJG T;  2VQF T;  5IWA T;  4DR5 T;  2UXC T;  4JI5 T;  4DUZ T;  4DV1 T;  4DV4 T;  4DV5 T;  1XNR T;  1XNQ T;  4JI7 T;  1HNX T;  1IBK T;  4DR4 T;  1IBM T;  2F4V T;  4JI6 T;  3T1Y T;  4KHP T;  4JI8 T;  4DR3 T;  2UXD T;  4JI4 T;  4DUY T;  4JI0 T;  2UUB T;  4LF8 T;  4NXM T;  1IBL T;  2VQE T;  3T1H T;  1HNW T;  4B3T T;  4GKK T; 
#chains in the Genus database with same CATH topology
 5DAB A;  4GYS A;  2DWG A;  2YEV C;  3MKD A;  4EZH A;  2HPJ A;  4YHH T;  2H7O A;  3WAJ A;  5C3J A;  5LXT E;  1W0A A;  2WWU A;  1SA0 E;  1Z8U A;  4HWD A;  3DJB A;  3PJA A;  2W2U A;  1E1H B;  4ZI3 D;  4O4H E;  4HEA A;  2V8S V;  3UT5 E;  4CN1 A;  2FJA A;  2K9A A;  3IEE A;  4V1A v;  3ZMU B;  5LOV E;  4L5G A;  4Z8X A;  2QA7 A;  4K0K T;  1MIY A;  2V6Y A;  2WSS V;  1B7T A;  4KX6 A;  5HEU A;  1HFA A;  3QK6 A;  2IW5 B;  4BJM A;  5L2L A;  1M62 A;  4AIU A;  4JI5 T;  4JEH B;  4UV9 B;  4PJJ A;  5IYZ E;  2XQ8 A;  3KBT A;  3NVO A;  2XAH B;  5ABE A;  2F4V T;  5LBQ B;  2MTQ A;  3OYX A;  3C64 A;  2VVS A;  2HH7 A;  2NOX A;  4DVD A;  3RYF E;  4LMJ A;  3GMI A;  4IDP A;  1OXZ A;  3AXJ B;  2MBG A;  5F3J A;  3LBX A;  3ONL C;  3C4X A;  2Q9Q B;  3FZL B;  3LG7 A;  4AKG A;  3EHZ A;  2JIW A;  4NUU A;  2A2F X;  3SRZ A;  4LF9 T;  5IUX A;  1GQE A;  2XQ7 A;  5ABH A;  3D0T A;  3HKB E;  1WYC A;  4DO0 A;  2LSG A;  3GA8 A;  4ILA A;  3ZT6 A;  1US7 B;  3PU3 A;  3FBL A;  2WMN A;  3HI2 A;  1X79 A;  2WAU A;  3ZT7 A;  2DCF A;  1J5E T;  3AAI A;  1KFY A;  5L3D B;  1HG2 A;  3F2E A;  3V5S A;  4DND A;  2DLR A;  4ILB A;  5BR8 T;  4GIW A;  2WY2 A;  1UK5 A;  2WZI A;  4O4J E;  2XTL A;  2IIU A;  3U3I A;  3AE5 A;  3ZN1 B;  5FP3 A;  1HS7 A;  3AE4 A;  1W09 A;  4Z90 A;  2ACZ A;  2XQY A;  2K24 A;  5J2U E;  1YQ3 A;  1J1J A;  1KNZ A;  4DID B;  3KV6 A;  2H3R A;  2OLT A;  4IE4 A;  1R8I A;  5AQM B;  2YOE A;  3P4Q A;  3ZMZ B;  4KHP T;  3L39 A;  4JI4 T;  1ZP0 A;  3AAE B;  4AQF A;  4L0R A;  5JRC A;  3VKG A;  4UIG A;  4NPP A;  4ISS A;  2FJD A;  1XDO A;  1HR0 T;  4B3S T;  1UUS A;  1ZEE A;  2BG9 B;  3ABV A;  2JMK A;  3RIU C;  1HF8 A;  3CQG B;  1D1C A;  4YFS A;  2E9X B;  5FXZ A;  4KUM B;  2LSJ A;  4C90 A;  1MMN A;  4DR6 T;  5HEG A;  1MMD A;  2NWB A;  4LMK A;  4HTE A;  4ILU A;  5AFU L;  3AEA A;  2CLY B;  4LFC T;  3RF1 A;  3MJX A;  3AB3 B;  2WBL A;  2AE9 A;  1IZN B;  1CHU A;  3K3N A;  2C5K T;  4I0U A;  4PK4 A;  1LVF A;  1O3X A;  4QH4 A;  5LGU B;  3AEE A;  4TWH A;  4DR7 T;  2L8K A;  3VU7 H;  2XZE A;  3FZF B;  4QXC B;  3K3Q C;  5L47 A;  1YD8 G;  2XQA A;  2LE8 A;  5JDH A;  1YKH B;  3I9Y A;  2L3L A;  4U7I A;  3KFW X;  1L0V A;  2UXC T;  5AQN B;  2IUB A;  5AQO B;  4YJ2 E;  4LML A;  4TWD A;  5AQT B;  4QKN A;  3VRA A;  4U2Y A;  2JRK A;  1HG5 A;  3OPC A;  4H9O C;  2X0H A;  3FZH B;  2IML A;  4YLH A;  3PUY F;  3KBU A;  4OFZ A;  4UXN B;  3NRX A;  4DBR A;  4CQI A;  2V7K A;  3ZPO A;  5JTG A;  1HTJ F;  1KEY A;  3PUS A;  4FI5 A;  1M7K A;  5HXR A;  4ZHQ E;  3PUQ A;  4ZS3 A;  4YY3 T;  2DI4 A;  1N32 T;  4JI3 T;  2KLQ A;  2LSK A;  2V6Y B;  2D5U A;  2UUC T;  2HHH T;  2ZMA A;  3UUX B;  2VKD A;  4LFA T;  3ZC0 A;  1D0X A;  1OWA A;  4LF4 T;  1V9D A;  2W4X A;  4LF5 T;  3ZT5 A;  3ZEF B;  4IDZ A;  3IHR A;  3L3P A;  3H3A A;  3AA6 B;  3QUJ A;  4KP3 C;  4DR5 T;  5AQF B;  2VVN A;  4TNV A;  3UU3 A;  2VL8 A;  1OED A;  3LBX B;  5H6Q B;  3V5U A;  4OHF A;  2WQY A;  3CK6 A;  4WZX A;  2ZLY A;  1J5W A;  4QH1 A;  2WCA A;  2XAQ B;  2A9U A;  3N9P A;  3EUH A;  2CXL A;  4I50 E;  1X9B A;  2L9Q A;  3LJC A;  4IDN A;  3ETU A;  1BR2 A;  2XQ9 A;  2IAK A;  2CBJ A;  4I4T E;  3ZLI A;  2J1D G;  2V1D B;  5JDF A;  3TKL B;  3IBP A;  4U31 A;  2BKO A;  4GYR A;  3UUN A;  3HKE E;  1HX1 B;  4X1K E;  5AQK B;  3RQU A;  2CPT A;  5LJM A;  3CX6 B;  2DL1 A;  4CXX A;  2YU1 A;  3BK9 A;  2LRK A;  2CLY C;  2JMH A;  4X66 T;  2J47 A;  2FBW A;  3A7M A;  4NXN T;  4COF A;  3S4U A;  5LG3 A;  2LT3 A;  2BS3 A;  3ZST A;  1DU2 A;  4GK0 E;  2V5C A;  3CPZ A;  2XAJ B;  1ZV4 X;  2XSA A;  1FJG T;  3NZQ A;  3RHW A;  2VKO A;  1ZKE A;  3AE3 A;  4ZXL A;  2N2N A;  4F6R C;  4ZZB A;  2LEH A;  3ZCI A;  2CCQ A;  5JRC B;  2LKH A;  1IBK T;  4X1Y E;  3AVS A;  1IBM T;  4FJO A;  2QVA A;  3P7I A;  4M1P A;  3OVU A;  1KF6 A;  3FZM B;  3KV4 A;  3TLW A;  1IJ5 A;  1G8X A;  3DP7 A;  2UUB T;  1NWM X;  3QOF A;  3P4W A;  4F8H A;  5JH7 E;  2CHN A;  3N5L A;  2H89 A;  3M3Z B;  4QH5 A;  2WU2 A;  4DR2 T;  4DR1 T;  1ZOY A;  5ABF A;  1QLB A;  4IHJ E;  2LLY A;  4IRE A;  3UUL A;  2X9X A;  3RKO A;  1LVK A;  2Z6E A;  3ZYK A;  1E7P A;  1D0Z A;  4IE5 A;  1XMO T;  3RRW A;  5AQV B;  5EK3 A;  5F8P A;  5E0O A;  4U7Y A;  3PUX F;  4X1I E;  4I55 E;  3I0Q A;  2LOS A;  4X65 T;  1IAP A;  2Q9Q D;  2Y8D A;  2WDQ A;  4Q25 A;  4MFR A;  2XAS B;  4KI0 F;  5FXV A;  2X9Y A;  4AKH A;  3RGL A;  4ZZC A;  2KSR A;  3CQC B;  4IT4 A;  3LK2 B;  4PFP A;  3AA0 B;  2H88 A;  3PE0 A;  1I6Z A;  3HL6 A;  4IDO A;  3RYH E;  2XUE A;  3AVR A;  2NW7 A;  2B1E A;  4DV4 T;  2HN1 A;  4H63 H;  2W67 A;  5FVK A;  2DHR A;  4WYV A;  3JAE A;  4HWC A;  1MND A;  3ONX A;  4TV9 E;  2BG9 E;  2XQ3 A;  3CWZ B;  3PUZ F;  3ZYM A;  2E2A A;  3IF8 B;  5CB4 E;  5ETW A;  4DR3 T;  5M4Y A;  2LM2 A;  2KT9 A;  2V7J A;  3UUM A;  5KDM C;  3RPU A;  5FKY A;  2VL0 A;  2VQE T;  4KHZ F;  4H9P C;  1SHZ C;  5JDG A;  5BMV E;  4JV5 T;  2X66 A;  2VUR A;  2LHN A;  2I0M A;  4CXY A;  3VR9 A;  5L3F B;  2MPK A;  1BR1 A;  2W63 A;  2LSY A;  5J0Z A;  4EYY R;  3LFM A;  3AED A;  2LRL A;  3N9Q A;  1QUU A;  4ILC A;  4UR9 A;  5AQI B;  2K48 A;  2CWO A;  3TLS A;  4HFB A;  1CUN A;  4EEB A;  1HNZ T;  2XAF B;  2RPA A;  4QXH B;  2E9X D;  4UEM A;  4YXD A;  2KWI B;  1OED B;  4U72 A;  5JVD E;  3GN5 B;  5LYJ E;  2X0Y A;  2W66 A;  4IL4 A;  2DWK A;  2VQF T;  2W0G A;  5AQJ B;  4TUY E;  2NR4 A;  3AE6 A;  3EDU A;  3K1S A;  2WWV A;  2JQH A;  3EVY A;  3N9M A;  3LDQ B;  2GK9 A;  1KNR A;  4ADZ A;  4AQF C;  3CX7 B;  3TLV A;  2PJQ A;  1YXR A;  2D9D A;  4JI0 T;  5AQG B;  3O1I A;  3AE7 A;  3ZKR A;  1HNW T;  2V5D A;  2IC9 A;  1KNP A;  4AQY T;  4IGU A;  4OK0 A;  2YN6 A;  3RYI E;  4A5X A;  3SS1 A;  3NRY A;  3MA9 A;  3CIR A;  5TAO A;  3CVR A;  2V6X A;  3ESL A;  4WBO A;  5AQH B;  4HWF A;  3KVB A;  5DQV A;  2X0L B;  5LG4 A;  4PJN A;  2YKS A;  4AIS A;  4PAG A;  5L3G B;  3F31 A;  2QYW A;  4LF6 T;  5FNV E;  4DV7 T;  5HCJ A;  3ZN0 B;  2BS4 A;  5EK4 A;  5DQW A;  1Y01 A;  4G63 A;  4XZC A;  1XDP A;  4HGA A;  2X51 A;  4XBF B;  3UQ4 A;  4CI1 B;  5KXJ A;  3VR8 A;  4GOU A;  4DV2 T;  4U33 A;  5LCY A;  2K5B B;  3K8P C;  1S94 A;  2WZH A;  3W15 B;  4AI6 A;  2M6I A;  3LK4 2;  4DV5 T;  4YSY A;  1NEK A;  4DBQ A;  5L3E B;  2V7I A;  4DMW A;  2YDS A;  4A97 A;  4EAH A;  4EZ4 A;  2H7V C;  4YSX A;  2WDV A;  5ABF B;  1SE7 A;  3VHL A;  4O4I E;  4DUY T;  3SFE A;  5CJ5 A;  3FXE B;  2XAG B;  2EHO A;  2NW8 A;  5IHY A;  2KWH A;  3PTR B;  3UQ7 A;  4OYK A;  4WNK A;  1XWM A;  4ZI2 C;  2V7M A;  2C5J A;  5CGM A;  5CA1 E;  2ES0 A;  4ZOL E;  5HEH A;  5LNK A;  5ABG A;  1FEW A;  3WI3 A;  3NZP A;  4LF7 T;  2LM9 A;  5AQU B;  2A3D A;  3ZJ1 A;  4TX5 A;  2JQQ A;  3L8R A;  1SUM B;  1U5P A;  2Q9Q C;  2BVL A;  3AA1 B;  4G2A A;  4OYJ A;  5FXX A;  4X20 E;  3AEF A;  4HFD A;  1VCT A;  1LKX A;  3KVA A;  2WMO A;  5LMU T;  1T8B A;  3C4W A;  1UGO A;  3JC6 C;  5HXE A;  2ODU A;  1QSD A;  1OED C;  4YSZ A;  4EYU A;  4DV1 T;  3FHN A;  2M67 A;  4H9S E;  2B76 A;  4YTP A;  1NAF A;  3LSV A;  3E0Z A;  4YT0 A;  4AKI A;  2KND A;  1UCU A;  3N9L A;  4JI6 T;  3NKZ A;  3C98 B;  1YW0 A;  2J4G A;  4WW0 A;  5LA6 E;  4AXP A;  3VRB A;  5LHI B;  4NXM T;  3OKQ A;  5FYM A;  3SFD A;  4PW8 A;  1H7C A;  5HYA A;  3PV0 F;  2D0T A;  3GN5 A;  3OJA A;  2CA5 A;  1AJ3 A;  2WU5 A;  3BQI A;  3PUA A;  1E2A A;  5CFB A;  4A98 A;  3JAF A;  2WB5 A;  2WDR A;  4UF0 A;  5LHG B;  2HN2 A;  4BJN A;  4JEU B;  4J2C A;  3AEG A;  3OBV E;  4H9N C;  4IE0 A;  1I94 T;  3I0O A;  2WM9 A;  5L3C B;  1VRB A;  5A1L A;  4X64 T;  1MMA A;  5DJQ C;  2BG9 C;  3AA7 B;  3PUG A;  4B3M T;  1MMG A;  2KXP B;  2JPF A;  4HE8 A;  5J2T E;  2E9X C;  5EK2 A;  2WP9 A;  4L9I A;  4WBN E;  4DV3 T;  2XY8 B;  4MHC A;  3JAD A;  2BDE A;  3KIN B;  3BQK A;  3PUV F;  2JQ9 A;  4YJ3 E;  4ASK A;  2IHR 1;  3UFG A;  3FBZ A;  4U74 A;  2X68 A;  1HNX T;  4JBW F;  2CRB A;  2J62 A;  4JI8 T;  5FL0 A;  1MIV A;  2XM1 A;  3CQX C;  1XZY A;  4P09 A;  2LHR A;  5AQQ B;  2BKP A;  1VCS A;  4HN9 A;  2CBI A;  4O2A E;  4X5T A;  3R6N A;  3Q5E A;  4U2Z A;  2VB6 A;  4OX9 T;  2LKG A;  5JR9 A;  3Q9D A;  3RC8 A;  2LOP A;  2E5V A;  5KX5 E;  1WR6 A;  1OED E;  3AE8 A;  2X67 A;  4H9Q C;  4YTM A;  2CE7 A;  4DMV A;  4ZI2 D;  3QB5 K;  2DNX A;  2BKN A;  2MYS A;  1G73 A;  4TN7 B;  3ZJ2 A;  5LB7 B;  4NUV A;  5FL1 A;  3ZSS A;  3C50 A;  4EOZ B;  4ZI7 E;  1JNR A;  4H9R C;  2XHE B;  4AQG A;  1YQ4 A;  5F5W A;  2WS3 A;  2PFV A;  3H3M A;  2CXD A;  3HKC E;  1Z0P A;  5FXW A;  2XM2 A;  5AQR B;  2LJL A;  3ONJ A;  1XNQ T;  4JI7 T;  4IIJ E;  3VKH A;  3CML A;  2EHO B;  4DR4 T;  2I6H A;  3PUW F;  2QGS A;  2ZM2 A;  3PDY A;  2ZM8 A;  2MAW A;  3JC6 D;  3T1Y T;  4O2B E;  4UVB B;  2YK0 A;  3Q5X A;  2N1G A;  2BZB A;  1JNZ A;  3ZYL A;  5HEO A;  3LK3 B;  4JLE A;  3TLT A;  2W61 A;  2W62 A;  4EV6 A;  4QX7 B;  3NWI A;  4P1N A;  3RIF A;  1BR0 A;  2KMF A;  2YDR A;  4HFE A;  3UU4 A;  2UXB T;  4C91 A;  1NEN A;  4HWH A;  1HCI A;  2IDO B;  4A56 A;  3HR0 A;  2HPL A;  3E22 E;  1MNE A;  2C5I T;  2XJ7 A;  4P0B A;  3UUB A;  1WR0 A;  4UVC B;  4GKJ T;  3J9X 1;  4E7Z A;  5L4H A;  2UUA T;  5FMN A;  1UX5 A;  5HXH A;  4X62 T;  3L09 A;  2P9B A;  2RA1 A;  5IWA T;  1W9R A;  4HKA A;  4DUZ T;  5FY0 A;  1XNR T;  3UTK A;  3C4Z A;  4TZ4 C;  3AE1 A;  5FY7 A;  4QX8 B;  4IE7 A;  1FIO A;  1HX8 A;  2JJ9 A;  3UU5 A;  1UUR A;  1ZHC A;  1S35 A;  3N2K E;  2QRX A;  2FJB A;  4UF0 B;  4UVA B;  3ANW A;  3FXD B;  4GKK T;  3H37 A;  1UX4 A;  3KV9 A;  4BA9 A;  5GON E;  3PJA J;  4JI2 T;  3UFE A;  1WRD A;  3C51 A;  4KMC A;  2ODV A;  1Y64 B;  3ZMS B;  2ACX A;  2VWA A;  4LFB T;  2OA5 A;  3BQL A;  2M6B A;  1EZ3 A;  3O4X E;  3KDS E;  5HWX A;  4TWF A;  3X1D A;  2ZM6 T;  4CI3 B;  3RRC A;  3MXZ A;  2N9D A;  3O1J A;  5JDM A;  3EDV A;  4BAY B;  3HA4 A;  4HFV A;  4IL9 A;  3RH3 A;  2PBI A;  3P50 A;  3MZK B;  2ZM0 A;  4AKR B;  2UU9 T;  3RC3 A;  4QXB B;  4EED A;  3WAK A;  4HFC A;  4ZS2 A;  5ADX L;  2X9H A;  1VOM A;  2V26 A;  3UU6 A;  3Q2M A;  3JCF A;  5HXC A;  3RQW A;  3ZMT B;  2EHO C;  2Y6X A;  2C0S A;  5JR9 B;  3AE2 A;  4E7S A;  3EAB A;  3T1H T;  4EB6 E;  2CMR A;  5LJN A;  4CXW A;  4UV8 B;  1XMQ T;  4DV6 T;  2YIN A;  3P8C D;  5JDN A;  2CEA A;  3KV5 A;  3N2O A;  2JQK A;  5C2T A;  5LGT B;  3U78 A;  3RIU A;  4O8S A;  2E5L T;  4TNW A;  1FMV A;  4EIW A;  2R6G F;  3I1A A;  4UEL A;  4ANJ A;  2Y48 B;  3TLU A;  4IST A;  5AQP B;  4NIQ A;  1KK7 A;  4HFH A;  4O4L E;  2OV9 A;  2PG8 A;  1T72 A;  2NTY A;  2KZ7 B;  2YDQ A;  1T98 A;  4IE6 A;  2VKJ A;  2BS2 A;  3N2G E;  1N34 T;  2FJE A;  5EZY E;  1W0B A;  5CA0 E;  4CZZ B;  1FMW A;  3F57 A;  4AKL A;  4MAL A;  3A8Y C;  5H6R B;  3B57 A;  3AAA B;  4LF8 T;  5HXS A;  5J1G A;  2XPK A;  4ZI3 C;  4MLK A;  2UXX B;  4B3T T;  3N9O A;  4PFO A;  4KBM B;  4XAX B;  2CWY A;  2KIN B;  4N78 D;  5C8Y E;  3P4R A;  2I59 A;  2E8I A;  4CN6 A;  5LMN T;  2UXN B;  3UU8 A;  3AXJ A;  1N36 T;  1LRZ A;  3AEB A;  2MOZ A;  4DV0 T;  3QNU A;  5LP6 E;  4JYA T;  5KMG P;  5FVL A;  2CXF A;  1WYB A;  3QC9 A;  5HWY A;  3AEC A;  3P4P A;  5LBM A;  2Q9Q A;  4TV8 E;  3PU8 A;  5FY1 A;  2VK9 A;  3OTO T;  3I9W A;  2IC6 A;  4H63 V;  4PJL A;  3EI0 A;  2X9W A;  3FZK B;  5L4E A;  4Z91 A;  3CKD A;  2CM0 A;  1T7S A;  3A5X A;  4JI1 T;  2D2S A;  5HEJ A;  5JRE A;  3K3O A;  1WCR A;  3J7Y q;  2AXD S;  2K3W A;  3ETV A;  3RKG A;  3CX8 B;  4EXT A;  2BBJ A;  1D1B A;  2A72 A;  2PTF A;  3Q5D A;  2V7L A;  5HAX A;  4ERR A;  5LGN B;  2NW9 A;  4ZEY A;  3ZMV B;  3ANW B;  2VAS A;  1IJ6 A;  3O1H A;  1MIW A;  2XQ4 A;  3PUR A;  3ZC1 A;  3QB5 A;  5JQG E;  3B13 A;  5AQS B;  5JR9 C;  5AQL B;  2NTX A;  3SWH A;  2G0U A;  4IDQ A;  5HCM A;  4PNI A;  4PJM A;  2RP4 A;  3RX6 A;  3T8O A;  4B3R T;  5LHH B;  3OYZ A;  4QHO A;  4U3C A;  2EHO D;  2XQ6 A;  2BVM A;  3SOL A;  1BR4 A;  3FB2 A;  3EAM A;  4GK5 E;  2VKH A;  3DTO A;  1WFD A;  3B5M A;  3N9N A;  2BG9 A;  3RYC E;  4QWN B;  3HKD E;  4YTN A;  3RLF F;  2E9X A;  2W00 A;  3O9X A;  4I43 B;  4YHJ A;  4P0A A;  3G06 A;  1N33 T;  3MAC A;  2NP9 A;  4HFI A;  2XQ5 A;  3AE9 A;  2XSB A;  4CN4 A;  2D0U A;  4JUY A;  2LSI A;  3RIA A;  3Q5W A;  4K0U A;  1WLX A;  1U4Q A;  3ZCJ A;  3GWH A;  3MK7 C;  1D1A A;  2BBH A;  2FUP A;  4EGW A;  5JDQ A;  3M65 A;  1D0Y A;  1YKE B;  2CHO A;  2SPC A;  3P4S A;  3RI5 A;  4HWI B;  3NBX X;  4MBQ A;  3R84 B;  2UXD T;  5JDL A;  2YU2 A;  3IA3 A;  4PK6 A;  4B6X A;  4CI2 B;  1IBL T;  3E08 A;  5L3B B;  4PK5 A; 
#chains in the Genus database with same CATH homology
 4JV5 T;  4AQY T;  4B3R T;  1HR0 T;  4OX9 T;  4JI2 T;  4DR2 T;  4DR1 T;  1XMQ T;  4B3S T;  4YHH T;  4DV6 T;  5LMN T;  1N36 T;  4LF9 T;  4DV0 T;  4YY3 T;  4JYA T;  1XMO T;  1N32 T;  4DR6 T;  2UXB T;  4JI3 T;  4LF7 T;  4LFB T;  4LF6 T;  2E5L T;  2UUC T;  2HHH T;  1J5E T;  4X65 T;  3OTO T;  4DV7 T;  4LFA T;  1I94 T;  4LFC T;  2ZM6 T;  4LF4 T;  4X64 T;  4LF5 T;  4X66 T;  1N33 T;  4K0K T;  4B3M T;  4NXN T;  4DR7 T;  4GKJ T;  1HNZ T;  4JI1 T;  5BR8 T;  5LMU T;  4DV3 T;  2UUA T;  4X62 T;  1N34 T;  2UU9 T;  4DV2 T;  1FJG T;  2VQF T;  5IWA T;  4DR5 T;  2UXC T;  4JI5 T;  4DUZ T;  4DV1 T;  4DV4 T;  4DV5 T;  1XNR T;  1XNQ T;  4JI7 T;  1HNX T;  1IBK T;  4DR4 T;  1IBM T;  2F4V T;  4JI6 T;  3T1Y T;  4KHP T;  4JI8 T;  4DR3 T;  2UXD T;  4JI4 T;  4DUY T;  4JI0 T;  2UUB T;  4LF8 T;  4NXM T;  1IBL T;  2VQE T;  3T1H T;  1HNW T;  4B3T T;  4GKK T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...