4NXNT

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4nxnT00
4JI3T 1FJGT 2UU9T 3OTOT 4OX9T 1XMOT 1XNQT 4LF7T 2ZM6T 4DV5T 4YHHT 4DV4T 1HNWT 1N34T 4DV7T 4DV1T 3T1YT 4DR7T 2E5LT 4DR3T 4DR1T 4X64T 4JI4T 4DV6T 2UUCT 4B3TT 4JI7T 4DR5T 4LFBT 1HNXT 4YY3T 1N32T 4AQYT 4X66T 1XMQT 4JI5T 1HNZT 4DUYT 4LF4T 4K0KT 3T1HT 4B3MT 2F4VT 4JV5T 4JI0T 2UXCT 1IBKT 4JYAT 4JI6T 4B3RT 4KHPT 2VQET 1N33T 4LF6T 4NXNT 5LMUT 4LFCT 4JI8T 2VQFT 1J5ET 4DV0T 4DV2T 4LF5T 2UUBT 4LFAT 4NXMT 2UXDT 4GKJT 1HR0T 4DR6T 1XNRT 5BR8T 5LMNT 2UXBT 4JI2T 2HHHT 4GKKT 1I94T 4LF9T 4JI1T 1N36T 4B3ST 4X65T 4DR2T 4DUZT 5IWAT 4DV3T 4LF8T 4DR4T 2UUAT 1IBMT 4X62T 1IBLT
chains in the Genus database with same CATH superfamily
4HTEA 3ZYMA 2IAKA 3P4WA 3IHRA 2XY8B 3H3AA 3GA8A 1VOMA 4HWCA 3ESLA 3PU3A 2CA5A 5H6QB 3PUWF 3F2EA 2E5LT 3N2GE 4PJMA 3OVUA 3OYXA 4ILAA 1UX5A 3LSVA 1OEDB 4CXWA 2QVAA 2LJLA 4JYAT 3SS1A 3QK6A 3M65A 5CA0E 3K8PC 4OYKA 4IREA 5HWXA 3UU8A 2H3RA 3ABVA 2ACZA 5HXRA 2GK9A 1QUUA 1WR0A 5IHYA 3B57A 3JC6D 2UXXB 3E0ZA 5JQGE 1YXRA 3UUBA 3GN5A 3RF1A 3DP7A 3N9MA 1WCRA 2Q9QA 5J2UE 1VCSA 1G8XA 3ETVA 1QSDA 4TWHA 3ZMZB 1G73A 2R6GF 4HFIA 5FVLA 4DUZT 5IYZE 4NUUA 1J1JA 3A7MA 5FMNA 2XAGB 5L3BB 5FXWA 1UGOA 4A5XA 4UXNB 2V5CA 3NVOA 2FJAA 4OFZA 3V5SA 3P8CD 2BKPA 5AQPB 4P09A 2CRBA 3P50A 3RIFA 4JLEA 4I4TE 2WDVA 3I9WA 2CMRA 5HEOA 3RYHE 2JQHA 3ZT6A 5JDFA 4GYSA 1N33T 3RPUA 4YXDA 5H6RB 2Y8DA 1NEKA 5CGMA 2XZEA 3EHZA 1XZYA 2LHNA 3VKHA 4BAYB 2UXBT 1IJ5A 4PFPA 1MMAA 1W09A 2QGSA 4JEUB 2BG9A 3E08A 4EB6E 3PU8A 2V1DB 1IAPA 1UURA 2RA1A 2X0YA 5J1GA 4JUYA 2XPKA 3UU5A 1IZNB 4GIWA 2HN2A 3HL6A 1ZP0A 3TLWA 3JCFA 4ZOLE 4TN7B 2QA7A 3OTOT 3HR0A 3N9NA 3E22E 4EYUA 4GYRA 4AQFC 5KX5E 3ETUA 4HFBA 2OV9A 2W61A 3N2KE 3FBLA 2BDEA 2HN1A 2BKOA 2BS2A 1N34T 3I1AA 4UEMA 5TAOA 4YJ3E 3X1DA 3L39A 4YT0A 2W2UA 4TNWA 4O2BE 1B7TA 3J9X1 3TKLB 3R6NA 1E1HB 1FMWA 4K0KT 5IUXA 3VRAA 3AE7A 2E9XD 3NRYA 1ZOYA 4AXPA 4ILCA 4V1Av 1XDPA 2VASA 2CWOA 4IDPA 4PAGA 2MOZA 4KHZF 2X0HA 2KXPB 4U31A 3AEDA 4OK0A 2MTQA 4MALA 2WM9A 3SRZA 4DO0A 3C64A 4P0BA 2DL1A 5HXSA 5CJ5A 3AVSA 3M3ZB 1I94T 4O2AE 4JI1T 3IBPA 2CHOA 1WYCA 2V7MA 3FZHB 1JNZA 3VKGA 4EGWA 2KMFA 5AQMB 3ZN1B 2D9DA 1FIOA 3FXDB 1X79A 4QX8B 3CX8B 4HWIB 4OX9T 5M4YA 4I50E 2CCQA 2XM1A 3CPZA 4PJNA 4C91A 4DV4T 3ZN0B 3KBTA 4ZI7E 2NW9A 2EHOA 4X5TA 3O1IA 3KV5A 4E7ZA 3AE8A 3VU7H 4IE6A 4MHCA 2ES0A 1HG2A 4JI7T 1OEDC 4YY3T 3HKCE 3UTKA 3ZCIA 4CXXA 1XMQT 3AAAB 5JR9A 4B3MT 2D2SA 2OA5A 3R84B 4LF6T 5LMUT 4QXBB 4U3CA 4DV2T 3UFEA 2LSJA 4IE5A 3PUAA 4YSYA 3KBUA 4IE0A 2ZM2A 4P1NA 2IC6A 4COFA 1D1AA 2H7OA 2DCFA 2WP9A 2E5VA 3AEEA 2MBGA 2MPKA 3QOFA 3H3MA 4DR2T 5CFBA 1XWMA 3UUNA 3O1HA 4CN6A 1KFYA 3PUSA 4WYVA 5HCJA 5AQGB 5JTGA 4ERRA 4LF7T 3LG7A 3UQ4A 4TV8E 2RP4A 5F8PA 1MNEA 2D0TA 3T1YT 4Z90A 5BMVE 4ZS2A 2PFVA 2RPAA 4EEDA 3ZT5A 2PBIA 4WBNE 2UUCT 3MK7C 4E7SA 4DMWA 4QKNA 4IL4A 4LF4T 4HFEA 2ACXA 3ZKRA 3RIUC 2WU2A 5CB4E 2YU2A 1MIWA 5AQTB 4B3RT 2I6HA 3ZT7A 4DBQA 3JAFA 3ZMTB 3HI2A 2WS3A 2UXNB 2E2AA 1T72A 2K48A 3LBXB 2J1DG 2UUBT 4IIJE 2UXDT 1OXZA 2CWYA 2JQQA 3PJAA 3BQLA 3KV4A 4O4JE 5AFUL 2N2NA 4BA9A 2X0LB 3H37A 4U72A 1T8BA 5L47A 3AE2A 2E9XB 3W15B 4YLHA 2B76A 1UUSA 1BR4A 1KF6A 3ZPOA 3CIRA 3LJCA 1MMNA 4H9QC 4AKHA 2FBWA 5LNKA 3DTOA 3AA0B 3JAEA 1Z0PA 1IBLT 1MIYA 3P7IA 2VVSA 2IW5B 5JDLA 3K3QC 3I9YA 2WBLA 2Y48B 4DBRA 3FBZA 4DV5T 1HNWT 3ANWB 3O1JA 1UK5A 3QC9A 4DV1T 2IMLA 2KZ7B 3JADA 3UUXB 3C4ZA 4IDQA 2V6XA 1D0XA 4WW0A 5EZYE 4UV8B 3N5LA 4PJJA 5F3JA 5CA1E 1WLXA 2FJDA 2LSYA 4UVAB 1NAFA 4FI5A 5F5WA 4QX7B 5HYAA 5J2TE 5DQWA 1SA0E 2XAFB 3I0OA 2NTXA 3AECA 3ZC0A 2M6BA 4PK5A 2NW7A 3QUJA 3ONLC 3QB5K 2KNDA 3P4RA 5AQIB 1T7SA 1XDOA 4DR6T 2YK0A 2MYSA 2BG9E 5LOVE 4LMLA 2LOPA 3QB5A 4PK6A 2VKDA 2XQ4A 4IHJE 4X20E 5IWAT 4KMCA 4Z91A 3WAKA 3ONJA 2BBHA 4EOZB 4AQFA 4X62T 1QLBA 1S94A 5LP6E 5A1LA 2BVMA 3C51A 5GONE 1R8IA 3IA3A 4B6XA 1FEWA 3NRXA 3V5UA 5C2TA 1HFAA 4A97A 2X9YA 2AE9A 4DNDA 1WR6A 4CI3B 3UU6A 4YFSA 3RIAA 3F31A 3A8YC 4U33A 4QH5A 2XQ6A 2K24A 2WCAA 4DUYT 2Z6EA 4MFRA 4XBFB 3AE4A 3PUYF 2XSBA 5ABEA 4HFHA 2WDRA 2CEAA 2YU1A 1CHUA 4ZI3D 2BS3A 4IDOA 5C8YE 4ILBA 2X9HA 1HR0T 3HKEE 5LHIB 3RC8A 2DLRA 3PUGA 1MMGA 2LKHA 2V6YB 3UU3A 2KLQA 5AQVB 1ZKEA 3EVYA 5JRCA 2YDQA 4IDZA 3FB2A 2BZBA 3AEBA 3MACA 4CXYA 5AQNB 4ZI2D 1SHZC 1M62A 2LM9A 3RGLA 2LSIA 3AE9A 4XAXB 4G63A 1MMDA 4WBOA 4EIWA 5L4HA 1OWAA 3EAMA 3D0TA 3RQUA 3RKOA 1M7KA 1VRBA 2WZIA 2X9XA 3N9LA 5L3EB 1E7PA 1OEDA 2IHR1 4QHOA 3PE0A 4AKGA 4HFDA 5FNVE 2JRKA 4IGUA 2HPJA 3UFGA 4ISTA 5FY0A 2D5UA 2XTLA 5LB7B 5LBMA 4GOUA 2W67A 3RYCE 1W9RA 2PG8A 2LM2A 2KWHA 1Y64B 2Q9QD 5HEGA 1BR2A 5AQRB 3EDUA 2IC9A 1ZEEA 3N2OA 4I55E 1BR0A 4GK0E 4CN1A 4HN9A 2K3WA 2E9XC 3C98B 4KUMB 5ABGA 1H7CA 3G06A 1W0BA 2V7LA 3LK3B 5AQLB 5E0OA 4ILUA 5AQUB 2V7JA 2NW8A 3AB3B 2DWGA 4KBMB 1LVFA 4U7IA 5JDMA 2WWVA 2LT3A 1Z8UA 2ZM6T 3AVRA 3LFMA 5KMGP 3PUZF 4XZCA 4HKAA 1D0YA 3Q5XA 4IDNA 3ONXA 2L3LA 1L0VA 2JMKA 2C0SA 2YDSA 2K9AA 2N9DA 2FUPA 4IE4A 1N32T 3RIUA 3CQXC 5EK3A 2XAJB 2UXCT 4JI6T 2ZM0A 4JI8T 4TNVA 3NZQA 3UUMA 4U74A 4TZ4C 1KEYA 4O4HE 1WRDA 4YJ2E 4QXHB 3CK6A 4H9NC 5FXZA 3ZEFB 3TLSA 4ZEYA 3HA4A 3ZJ2A 3CX7B 2VL8A 2E8IA 1HX1B 2DI4A 4TUYE 5LHHB 3Q9DA 4O4IE 2W4XA 3ZC1A 2V7KA 2LRLA 2UUAT 3EI0A 5LCYA 1IBMT 2L8KA 3AAEB 2LOSA 2XQ8A 5HEUA 3KVAA 2V7IA 4QH4A 1XNQT 5HXEA 2X66A 1EZ3A 3S4UA 4YSZA 2NOXA 3TLUA 2VVNA 1NENA 5L2LA 4U2YA 3RRWA 4P0AA 2WSSV 4YSXA 4HWHA 1HTJF 4H63H 2QRXA 4AKRB 3ZYLA 4EZHA 1V9DA 3L8RA 2V26A 4AQYT 5AQSB 4X66T 3CMLA 1LRZA 2VKOA 4WNKA 3AE3A 3C4WA 4H9RC 4KHPT 5JDGA 5EK4A 2WAUA 3B13A 4PW8A 3AEFA 5KXJA 3F57A 2NWBA 2A9UA 4DVDA 4ZS3A 3SFEA 5HEJA 2NP9A 4LF9T 3GN5B 2C5JA 3HKBE 3RYFE 3KV9A 5JVDE 3HKDE 2Q9QB 4AIUA 2XSAA 4IL9A 1YW0A 4DV3T 3B5MA 3KDSE 2VURA 3T8OA 3Q5EA 5L3GB 2JPFA 3OYZA 3PUXF 3U3IA 3RH3A 4JI3T 4UF0B 2WWUA 5FL0A 3IEEA 2EHOD 1J5WA 2WDQA 3EUHA 2KSRA 4CI1B 3CWZB 4Q25A 2W63A 2CLYB 2FJBA 2X51A 3LK42 2PTFA 3RLFF 3BQIA 5LYJE 2DWKA 2VL0A 4CI2B 2X9WA 4KI0F 3L09A 4JI4T 3ZMSB 3NZPA 4FJOA 5JREA 3ZCJA 4ZZCA 1U4QA 2XQ5A 3PUQA 4Z8XA 4JV5T 5DABA 5FXVA 4QH1A 5FVKA 2LKGA 3K1SA 3VRBA 4CQIA 4I0UA 5FP3A 2XAHB 2X68A 4PNIA 2CXFA 2JQKA 5HWYA 4JI2T 2V8SV 2WQYA 4O8SA 5LJNA 1I6ZA 3O4XE 5HAXA 1N36T 2A72A 2FJEA 5FYMA 2LHRA 3ZMVB 1HF8A 5KDMC 2BG9B 2ZMAA 4TV9E 2IIUA 4MBQA 3KVBA 4H9PC 3AAIA 3MJXA 1YD8G 5LGTB 3VR9A 2DHRA 2X67A 4JEHB 2HPLA 1US7B 2L9QA 1OEDE 3JC6C 4WZXA 4PJLA 3SWHA 3N9PA 1SUMB 2XQ7A 2CE7A 3P4PA 3C50A 3KINB 4AISA 3BQKA 2KINB 2XHEB 3L3PA 3MKDA 4LFBT 1HNXT 1FMVA 5HXCA 3AXJB 3AEAA 1D1BA 4QXCB 2LSKA 2YOEA 1YQ3A 4JI5T 3CKDA 3RYIE 2WU5A 4JI0T 1MIVA 4MLKA 1U5PA 3LBXA 4AKIA 3ZSTA 2WMOA 4G2AA 5HEHA 1YKHB 2YKSA 4DV0T 2IDOB 2VK9A 3FZFB 4H63V 4ZXLA 4UVCB 2P9BA 4X1YE 4LFAT 1HS7A 2E9XA 4UR9A 3EABA 4UF0A 2XQYA 5AQFB 3ZJ1A 3K3NA 2H88A 5FL1A 3IF8B 4LMKA 4HGAA 4ZI3C 2YEVC 3OBVE 1WFDA 3WAJA 4EYYR 4B3ST 4U7YA 4YHJA 4AKLA 2G0UA 4F6RC 5FXXA 3ANWA 3CQCB 1XMOT 5ABFB 1LKXA 5LHGB 2Y6XA 3LDQB 3N9OA 2C5KT 4YHHT 4M1PA 1VCTA 2CXLA 3SOLA 4DV7T 3AA7B 2YN6A 1GQEA 4K0UA 3RC3A 3Q2MA 2I0MA 4ZI2C 4DV6T 4QWNB 3UULA 4ADZA 3J7Yq 2LRKA 4DR5T 2CBIA 2EHOB 2M6IA 5L3DB 2H7VC 5AQQB 4DIDB 3T1HT 2LE8A 2SPCA 4UV9B 3SFDA 5AQOB 1HG5A 5JR9B 4AI6A 4HFCA 4ANJA 1XNRT 2W66A 4KX6A 3FZMB 5FKYA 5LA6E 2Q9QC 2WZHA 4YTMA 4L9IA 1MNDA 1WYBA 4X1IE 2CBJA 4DR4T 3AXJA 2H89A 3CVRA 2VWAA 3OKQA 1FJGT 5ABHA 3A5XA 2XJ7A 1KNPA 3I0QA 4OYJA 2CLYC 2JQ9A 3UT5E 3AE5A 4UIGA 5LGUB 4YTNA 2XQ3A 2A2FX 5J0ZA 4HEAA 4L0RA 4TWFA 4DR1T 4DR3T 4EV6A 2OLTA 1NWMX 1X9BA 2CPTA 3TLVA 1D1CA 2VB6A 3GWHA 3AA6B 1YKEB 4OHFA 1UX4A 1HX8A 4TWDA 4L5GA 3MXZA 5DQVA 3KFWX 2W0GA 4I43B 5AQHB 5FY7A 2BS4A 1IBKT 3PUVF 5LXTE 2VQET 3ZMUB 4PK4A 2QYWA 2VQFT 2YINA 5HXHA 2JJ9A 1HCIA 3PURA 2VKJA 4ISSA 4H9SE 4LF5T 2LSGA 2WY2A 2BVLA 2V6YA 1ZHCA 3PV0F 3OPCA 2IUBA 4O4LE 3RKGA 5BR8T 1YQ4A 3NKZA 5ABFA 4U2ZA 4NIQA 5HCMA 3NBXX 2XUEA 3MA9A 2NTYA 4C90A 4H9OC 1KK7A 2CM0A 3RX6A 2BG9C 4X65T 3N9QA 2VKHA 5LG3A 4YTPA 1CUNA 2LEHA 1SE7A 5DJQC 4BJNA 3GMIA 4HWFA 2JIWA 2NR4A 1IJ6A 1DU2A 3PJAJ 3FHNA 4AQGA 4LMJA 2JMHA 4EEBA 2YDRA 2ZM8A 4DR7T 4ZZBA 2C5IT 4X64T 2DNXA 3WI3A 3RI5A 4B3TT 5ETWA 5JDHA 1Y01A 3EDVA 4BJMA 3NWIA 2ODVA 2ODUA 4NUVA 4TX5A 4A98A 2XASB 3AEGA 4UELA 2F4VT 2XQAA 2J47A 4DMVA 2CXDA 2BKNA 2CHNA 4LFCT 3BK9A 3MZKB 3QNUA 1J5ET 2V5DA 5LJMA 4X1KE 3DJBA 3KV6A 1JNRA 3PTRB 4IT4A 5JDNA 4GKJT 1T98A 4EZ4A 3FZKB 2N1GA 3Q5WA 2I59A 5AQJB 1LVKA 3K3OA 2LLYA 2HHHT 3UU4A 4GK5E 2K5BB 4EAHA 2WMNA 4GKKT 3ZLIA 2KT9A 4N78D 2J62A 2AXDS 3OJAA 5JDQA 5EK2A 4EXTA 1E2AA 5L3FB 2XAQB 3CX6B 5LG4A 1D0ZA 3P4SA 4LF8T 3VHLA 2UU9T 3PDYA 2ZLYA 3P4QA 5C3JA 1S35A 2PJQA 5LGNB 3TLTA 2B1EA 4A56A 5L4EA 2XM2A 3AA1B 1AJ3A 4JBWF 3AE1A 5AQKB 3ZYKA 1O3XA 4CN4A 1W0AA 2EHOC 3UQ7A 3U78A 3CQGB 3VR8A 5L3CB 2J4GA 3O9XA 1HNZT 3AE6A 3RQWA 3LK2B 4ASKA 2XQ9A 4ZHQE 4NXNT 4J2CA 5JR9C 5FY1A 2KWIB 2D0UA 1KNRA 4HE8A 4NXMT 2W00A 1KNZA 2HH7A 4IE7A 2M67A 2BBJA 2A3DA 4CZZB 5LMNT 5JH7E 1UCUA 1BR1A 5ADXL 4PFOA 2W62A 5LBQB 3RRCA 4HWDA 3FZLB 3Q5DA 2MAWA 4UVBB 3C4XA 1ZV4X 3RHWA 3ZSSA 3FXEB 2WB5A 4NPPA 4HFVA 4KP3C 4F8HA 5JRCB
chains in the Genus database with same CATH topology
4JI3T 1FJGT 2UU9T 3OTOT 4OX9T 1XMOT 1XNQT 4LF7T 2ZM6T 4DV5T 4YHHT 4DV4T 1HNWT 1N34T 4DV7T 4DV1T 3T1YT 4DR7T 2E5LT 4DR3T 4DR1T 4X64T 4JI4T 4DV6T 2UUCT 4B3TT 4JI7T 4DR5T 4LFBT 1HNXT 4YY3T 1N32T 4AQYT 4X66T 1XMQT 4JI5T 1HNZT 4DUYT 4LF4T 4K0KT 3T1HT 4B3MT 2F4VT 4JV5T 4JI0T 2UXCT 1IBKT 4JYAT 4JI6T 4B3RT 4KHPT 2VQET 1N33T 4LF6T 4NXNT 5LMUT 4LFCT 4JI8T 2VQFT 1J5ET 4DV0T 4DV2T 4LF5T 2UUBT 4LFAT 4NXMT 2UXDT 4GKJT 1HR0T 4DR6T 1XNRT 5BR8T 5LMNT 2UXBT 4JI2T 2HHHT 4GKKT 1I94T 4LF9T 4JI1T 1N36T 4B3ST 4X65T 4DR2T 4DUZT 5IWAT 4DV3T 4LF8T 4DR4T 2UUAT 1IBMT 4X62T 1IBLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 T;  1FJG T;  2UU9 T;  3OTO T;  4OX9 T;  1XMO T;  1XNQ T;  4LF7 T;  2ZM6 T;  4DV5 T;  4YHH T;  4DV4 T;  1HNW T;  1N34 T;  4DV7 T;  4DV1 T;  3T1Y T;  4DR7 T;  2E5L T;  4DR3 T;  4DR1 T;  4X64 T;  4JI4 T;  4DV6 T;  2UUC T;  4B3T T;  4JI7 T;  4DR5 T;  4LFB T;  1HNX T;  4YY3 T;  1N32 T;  4AQY T;  4X66 T;  1XMQ T;  4JI5 T;  1HNZ T;  4DUY T;  4LF4 T;  4K0K T;  3T1H T;  4B3M T;  2F4V T;  4JV5 T;  4JI0 T;  2UXC T;  1IBK T;  4JYA T;  4JI6 T;  4B3R T;  4KHP T;  2VQE T;  1N33 T;  4LF6 T;  4NXN T;  5LMU T;  4LFC T;  4JI8 T;  2VQF T;  1J5E T;  4DV0 T;  4DV2 T;  4LF5 T;  2UUB T;  4LFA T;  4NXM T;  2UXD T;  4GKJ T;  1HR0 T;  4DR6 T;  1XNR T;  5BR8 T;  5LMN T;  2UXB T;  4JI2 T;  2HHH T;  4GKK T;  1I94 T;  4LF9 T;  4JI1 T;  1N36 T;  4B3S T;  4X65 T;  4DR2 T;  4DUZ T;  5IWA T;  4DV3 T;  4LF8 T;  4DR4 T;  2UUA T;  1IBM T;  4X62 T;  1IBL T; 
#chains in the Genus database with same CATH topology
 4HTE A;  3ZYM A;  2IAK A;  3P4W A;  3IHR A;  2XY8 B;  3H3A A;  3GA8 A;  1VOM A;  4HWC A;  3ESL A;  3PU3 A;  2CA5 A;  5H6Q B;  3PUW F;  3F2E A;  2E5L T;  3N2G E;  4PJM A;  3OVU A;  3OYX A;  4ILA A;  1UX5 A;  3LSV A;  1OED B;  4CXW A;  2QVA A;  2LJL A;  4JYA T;  3SS1 A;  3QK6 A;  3M65 A;  5CA0 E;  3K8P C;  4OYK A;  4IRE A;  5HWX A;  3UU8 A;  2H3R A;  3ABV A;  2ACZ A;  5HXR A;  2GK9 A;  1QUU A;  1WR0 A;  5IHY A;  3B57 A;  3JC6 D;  2UXX B;  3E0Z A;  5JQG E;  1YXR A;  3UUB A;  3GN5 A;  3RF1 A;  3DP7 A;  3N9M A;  1WCR A;  2Q9Q A;  5J2U E;  1VCS A;  1G8X A;  3ETV A;  1QSD A;  4TWH A;  3ZMZ B;  1G73 A;  2R6G F;  4HFI A;  5FVL A;  4DUZ T;  5IYZ E;  4NUU A;  1J1J A;  3A7M A;  5FMN A;  2XAG B;  5L3B B;  5FXW A;  1UGO A;  4A5X A;  4UXN B;  2V5C A;  3NVO A;  2FJA A;  4OFZ A;  3V5S A;  3P8C D;  2BKP A;  5AQP B;  4P09 A;  2CRB A;  3P50 A;  3RIF A;  4JLE A;  4I4T E;  2WDV A;  3I9W A;  2CMR A;  5HEO A;  3RYH E;  2JQH A;  3ZT6 A;  5JDF A;  4GYS A;  1N33 T;  3RPU A;  4YXD A;  5H6R B;  2Y8D A;  1NEK A;  5CGM A;  2XZE A;  3EHZ A;  1XZY A;  2LHN A;  3VKH A;  4BAY B;  2UXB T;  1IJ5 A;  4PFP A;  1MMA A;  1W09 A;  2QGS A;  4JEU B;  2BG9 A;  3E08 A;  4EB6 E;  3PU8 A;  2V1D B;  1IAP A;  1UUR A;  2RA1 A;  2X0Y A;  5J1G A;  4JUY A;  2XPK A;  3UU5 A;  1IZN B;  4GIW A;  2HN2 A;  3HL6 A;  1ZP0 A;  3TLW A;  3JCF A;  4ZOL E;  4TN7 B;  2QA7 A;  3OTO T;  3HR0 A;  3N9N A;  3E22 E;  4EYU A;  4GYR A;  4AQF C;  5KX5 E;  3ETU A;  4HFB A;  2OV9 A;  2W61 A;  3N2K E;  3FBL A;  2BDE A;  2HN1 A;  2BKO A;  2BS2 A;  1N34 T;  3I1A A;  4UEM A;  5TAO A;  4YJ3 E;  3X1D A;  3L39 A;  4YT0 A;  2W2U A;  4TNW A;  4O2B E;  1B7T A;  3J9X 1;  3TKL B;  3R6N A;  1E1H B;  1FMW A;  4K0K T;  5IUX A;  3VRA A;  3AE7 A;  2E9X D;  3NRY A;  1ZOY A;  4AXP A;  4ILC A;  4V1A v;  1XDP A;  2VAS A;  2CWO A;  4IDP A;  4PAG A;  2MOZ A;  4KHZ F;  2X0H A;  2KXP B;  4U31 A;  3AED A;  4OK0 A;  2MTQ A;  4MAL A;  2WM9 A;  3SRZ A;  4DO0 A;  3C64 A;  4P0B A;  2DL1 A;  5HXS A;  5CJ5 A;  3AVS A;  3M3Z B;  1I94 T;  4O2A E;  4JI1 T;  3IBP A;  2CHO A;  1WYC A;  2V7M A;  3FZH B;  1JNZ A;  3VKG A;  4EGW A;  2KMF A;  5AQM B;  3ZN1 B;  2D9D A;  1FIO A;  3FXD B;  1X79 A;  4QX8 B;  3CX8 B;  4HWI B;  4OX9 T;  5M4Y A;  4I50 E;  2CCQ A;  2XM1 A;  3CPZ A;  4PJN A;  4C91 A;  4DV4 T;  3ZN0 B;  3KBT A;  4ZI7 E;  2NW9 A;  2EHO A;  4X5T A;  3O1I A;  3KV5 A;  4E7Z A;  3AE8 A;  3VU7 H;  4IE6 A;  4MHC A;  2ES0 A;  1HG2 A;  4JI7 T;  1OED C;  4YY3 T;  3HKC E;  3UTK A;  3ZCI A;  4CXX A;  1XMQ T;  3AAA B;  5JR9 A;  4B3M T;  2D2S A;  2OA5 A;  3R84 B;  4LF6 T;  5LMU T;  4QXB B;  4U3C A;  4DV2 T;  3UFE A;  2LSJ A;  4IE5 A;  3PUA A;  4YSY A;  3KBU A;  4IE0 A;  2ZM2 A;  4P1N A;  2IC6 A;  4COF A;  1D1A A;  2H7O A;  2DCF A;  2WP9 A;  2E5V A;  3AEE A;  2MBG A;  2MPK A;  3QOF A;  3H3M A;  4DR2 T;  5CFB A;  1XWM A;  3UUN A;  3O1H A;  4CN6 A;  1KFY A;  3PUS A;  4WYV A;  5HCJ A;  5AQG B;  5JTG A;  4ERR A;  4LF7 T;  3LG7 A;  3UQ4 A;  4TV8 E;  2RP4 A;  5F8P A;  1MNE A;  2D0T A;  3T1Y T;  4Z90 A;  5BMV E;  4ZS2 A;  2PFV A;  2RPA A;  4EED A;  3ZT5 A;  2PBI A;  4WBN E;  2UUC T;  3MK7 C;  4E7S A;  4DMW A;  4QKN A;  4IL4 A;  4LF4 T;  4HFE A;  2ACX A;  3ZKR A;  3RIU C;  2WU2 A;  5CB4 E;  2YU2 A;  1MIW A;  5AQT B;  4B3R T;  2I6H A;  3ZT7 A;  4DBQ A;  3JAF A;  3ZMT B;  3HI2 A;  2WS3 A;  2UXN B;  2E2A A;  1T72 A;  2K48 A;  3LBX B;  2J1D G;  2UUB T;  4IIJ E;  2UXD T;  1OXZ A;  2CWY A;  2JQQ A;  3PJA A;  3BQL A;  3KV4 A;  4O4J E;  5AFU L;  2N2N A;  4BA9 A;  2X0L B;  3H37 A;  4U72 A;  1T8B A;  5L47 A;  3AE2 A;  2E9X B;  3W15 B;  4YLH A;  2B76 A;  1UUS A;  1BR4 A;  1KF6 A;  3ZPO A;  3CIR A;  3LJC A;  1MMN A;  4H9Q C;  4AKH A;  2FBW A;  5LNK A;  3DTO A;  3AA0 B;  3JAE A;  1Z0P A;  1IBL T;  1MIY A;  3P7I A;  2VVS A;  2IW5 B;  5JDL A;  3K3Q C;  3I9Y A;  2WBL A;  2Y48 B;  4DBR A;  3FBZ A;  4DV5 T;  1HNW T;  3ANW B;  3O1J A;  1UK5 A;  3QC9 A;  4DV1 T;  2IML A;  2KZ7 B;  3JAD A;  3UUX B;  3C4Z A;  4IDQ A;  2V6X A;  1D0X A;  4WW0 A;  5EZY E;  4UV8 B;  3N5L A;  4PJJ A;  5F3J A;  5CA1 E;  1WLX A;  2FJD A;  2LSY A;  4UVA B;  1NAF A;  4FI5 A;  5F5W A;  4QX7 B;  5HYA A;  5J2T E;  5DQW A;  1SA0 E;  2XAF B;  3I0O A;  2NTX A;  3AEC A;  3ZC0 A;  2M6B A;  4PK5 A;  2NW7 A;  3QUJ A;  3ONL C;  3QB5 K;  2KND A;  3P4R A;  5AQI B;  1T7S A;  1XDO A;  4DR6 T;  2YK0 A;  2MYS A;  2BG9 E;  5LOV E;  4LML A;  2LOP A;  3QB5 A;  4PK6 A;  2VKD A;  2XQ4 A;  4IHJ E;  4X20 E;  5IWA T;  4KMC A;  4Z91 A;  3WAK A;  3ONJ A;  2BBH A;  4EOZ B;  4AQF A;  4X62 T;  1QLB A;  1S94 A;  5LP6 E;  5A1L A;  2BVM A;  3C51 A;  5GON E;  1R8I A;  3IA3 A;  4B6X A;  1FEW A;  3NRX A;  3V5U A;  5C2T A;  1HFA A;  4A97 A;  2X9Y A;  2AE9 A;  4DND A;  1WR6 A;  4CI3 B;  3UU6 A;  4YFS A;  3RIA A;  3F31 A;  3A8Y C;  4U33 A;  4QH5 A;  2XQ6 A;  2K24 A;  2WCA A;  4DUY T;  2Z6E A;  4MFR A;  4XBF B;  3AE4 A;  3PUY F;  2XSB A;  5ABE A;  4HFH A;  2WDR A;  2CEA A;  2YU1 A;  1CHU A;  4ZI3 D;  2BS3 A;  4IDO A;  5C8Y E;  4ILB A;  2X9H A;  1HR0 T;  3HKE E;  5LHI B;  3RC8 A;  2DLR A;  3PUG A;  1MMG A;  2LKH A;  2V6Y B;  3UU3 A;  2KLQ A;  5AQV B;  1ZKE A;  3EVY A;  5JRC A;  2YDQ A;  4IDZ A;  3FB2 A;  2BZB A;  3AEB A;  3MAC A;  4CXY A;  5AQN B;  4ZI2 D;  1SHZ C;  1M62 A;  2LM9 A;  3RGL A;  2LSI A;  3AE9 A;  4XAX B;  4G63 A;  1MMD A;  4WBO A;  4EIW A;  5L4H A;  1OWA A;  3EAM A;  3D0T A;  3RQU A;  3RKO A;  1M7K A;  1VRB A;  2WZI A;  2X9X A;  3N9L A;  5L3E B;  1E7P A;  1OED A;  2IHR 1;  4QHO A;  3PE0 A;  4AKG A;  4HFD A;  5FNV E;  2JRK A;  4IGU A;  2HPJ A;  3UFG A;  4IST A;  5FY0 A;  2D5U A;  2XTL A;  5LB7 B;  5LBM A;  4GOU A;  2W67 A;  3RYC E;  1W9R A;  2PG8 A;  2LM2 A;  2KWH A;  1Y64 B;  2Q9Q D;  5HEG A;  1BR2 A;  5AQR B;  3EDU A;  2IC9 A;  1ZEE A;  3N2O A;  4I55 E;  1BR0 A;  4GK0 E;  4CN1 A;  4HN9 A;  2K3W A;  2E9X C;  3C98 B;  4KUM B;  5ABG A;  1H7C A;  3G06 A;  1W0B A;  2V7L A;  3LK3 B;  5AQL B;  5E0O A;  4ILU A;  5AQU B;  2V7J A;  2NW8 A;  3AB3 B;  2DWG A;  4KBM B;  1LVF A;  4U7I A;  5JDM A;  2WWV A;  2LT3 A;  1Z8U A;  2ZM6 T;  3AVR A;  3LFM A;  5KMG P;  3PUZ F;  4XZC A;  4HKA A;  1D0Y A;  3Q5X A;  4IDN A;  3ONX A;  2L3L A;  1L0V A;  2JMK A;  2C0S A;  2YDS A;  2K9A A;  2N9D A;  2FUP A;  4IE4 A;  1N32 T;  3RIU A;  3CQX C;  5EK3 A;  2XAJ B;  2UXC T;  4JI6 T;  2ZM0 A;  4JI8 T;  4TNV A;  3NZQ A;  3UUM A;  4U74 A;  4TZ4 C;  1KEY A;  4O4H E;  1WRD A;  4YJ2 E;  4QXH B;  3CK6 A;  4H9N C;  5FXZ A;  3ZEF B;  3TLS A;  4ZEY A;  3HA4 A;  3ZJ2 A;  3CX7 B;  2VL8 A;  2E8I A;  1HX1 B;  2DI4 A;  4TUY E;  5LHH B;  3Q9D A;  4O4I E;  2W4X A;  3ZC1 A;  2V7K A;  2LRL A;  2UUA T;  3EI0 A;  5LCY A;  1IBM T;  2L8K A;  3AAE B;  2LOS A;  2XQ8 A;  5HEU A;  3KVA A;  2V7I A;  4QH4 A;  1XNQ T;  5HXE A;  2X66 A;  1EZ3 A;  3S4U A;  4YSZ A;  2NOX A;  3TLU A;  2VVN A;  1NEN A;  5L2L A;  4U2Y A;  3RRW A;  4P0A A;  2WSS V;  4YSX A;  4HWH A;  1HTJ F;  4H63 H;  2QRX A;  4AKR B;  3ZYL A;  4EZH A;  1V9D A;  3L8R A;  2V26 A;  4AQY T;  5AQS B;  4X66 T;  3CML A;  1LRZ A;  2VKO A;  4WNK A;  3AE3 A;  3C4W A;  4H9R C;  4KHP T;  5JDG A;  5EK4 A;  2WAU A;  3B13 A;  4PW8 A;  3AEF A;  5KXJ A;  3F57 A;  2NWB A;  2A9U A;  4DVD A;  4ZS3 A;  3SFE A;  5HEJ A;  2NP9 A;  4LF9 T;  3GN5 B;  2C5J A;  3HKB E;  3RYF E;  3KV9 A;  5JVD E;  3HKD E;  2Q9Q B;  4AIU A;  2XSA A;  4IL9 A;  1YW0 A;  4DV3 T;  3B5M A;  3KDS E;  2VUR A;  3T8O A;  3Q5E A;  5L3G B;  2JPF A;  3OYZ A;  3PUX F;  3U3I A;  3RH3 A;  4JI3 T;  4UF0 B;  2WWU A;  5FL0 A;  3IEE A;  2EHO D;  1J5W A;  2WDQ A;  3EUH A;  2KSR A;  4CI1 B;  3CWZ B;  4Q25 A;  2W63 A;  2CLY B;  2FJB A;  2X51 A;  3LK4 2;  2PTF A;  3RLF F;  3BQI A;  5LYJ E;  2DWK A;  2VL0 A;  4CI2 B;  2X9W A;  4KI0 F;  3L09 A;  4JI4 T;  3ZMS B;  3NZP A;  4FJO A;  5JRE A;  3ZCJ A;  4ZZC A;  1U4Q A;  2XQ5 A;  3PUQ A;  4Z8X A;  4JV5 T;  5DAB A;  5FXV A;  4QH1 A;  5FVK A;  2LKG A;  3K1S A;  3VRB A;  4CQI A;  4I0U A;  5FP3 A;  2XAH B;  2X68 A;  4PNI A;  2CXF A;  2JQK A;  5HWY A;  4JI2 T;  2V8S V;  2WQY A;  4O8S A;  5LJN A;  1I6Z A;  3O4X E;  5HAX A;  1N36 T;  2A72 A;  2FJE A;  5FYM A;  2LHR A;  3ZMV B;  1HF8 A;  5KDM C;  2BG9 B;  2ZMA A;  4TV9 E;  2IIU A;  4MBQ A;  3KVB A;  4H9P C;  3AAI A;  3MJX A;  1YD8 G;  5LGT B;  3VR9 A;  2DHR A;  2X67 A;  4JEH B;  2HPL A;  1US7 B;  2L9Q A;  1OED E;  3JC6 C;  4WZX A;  4PJL A;  3SWH A;  3N9P A;  1SUM B;  2XQ7 A;  2CE7 A;  3P4P A;  3C50 A;  3KIN B;  4AIS A;  3BQK A;  2KIN B;  2XHE B;  3L3P A;  3MKD A;  4LFB T;  1HNX T;  1FMV A;  5HXC A;  3AXJ B;  3AEA A;  1D1B A;  4QXC B;  2LSK A;  2YOE A;  1YQ3 A;  4JI5 T;  3CKD A;  3RYI E;  2WU5 A;  4JI0 T;  1MIV A;  4MLK A;  1U5P A;  3LBX A;  4AKI A;  3ZST A;  2WMO A;  4G2A A;  5HEH A;  1YKH B;  2YKS A;  4DV0 T;  2IDO B;  2VK9 A;  3FZF B;  4H63 V;  4ZXL A;  4UVC B;  2P9B A;  4X1Y E;  4LFA T;  1HS7 A;  2E9X A;  4UR9 A;  3EAB A;  4UF0 A;  2XQY A;  5AQF B;  3ZJ1 A;  3K3N A;  2H88 A;  5FL1 A;  3IF8 B;  4LMK A;  4HGA A;  4ZI3 C;  2YEV C;  3OBV E;  1WFD A;  3WAJ A;  4EYY R;  4B3S T;  4U7Y A;  4YHJ A;  4AKL A;  2G0U A;  4F6R C;  5FXX A;  3ANW A;  3CQC B;  1XMO T;  5ABF B;  1LKX A;  5LHG B;  2Y6X A;  3LDQ B;  3N9O A;  2C5K T;  4YHH T;  4M1P A;  1VCT A;  2CXL A;  3SOL A;  4DV7 T;  3AA7 B;  2YN6 A;  1GQE A;  4K0U A;  3RC3 A;  3Q2M A;  2I0M A;  4ZI2 C;  4DV6 T;  4QWN B;  3UUL A;  4ADZ A;  3J7Y q;  2LRK A;  4DR5 T;  2CBI A;  2EHO B;  2M6I A;  5L3D B;  2H7V C;  5AQQ B;  4DID B;  3T1H T;  2LE8 A;  2SPC A;  4UV9 B;  3SFD A;  5AQO B;  1HG5 A;  5JR9 B;  4AI6 A;  4HFC A;  4ANJ A;  1XNR T;  2W66 A;  4KX6 A;  3FZM B;  5FKY A;  5LA6 E;  2Q9Q C;  2WZH A;  4YTM A;  4L9I A;  1MND A;  1WYB A;  4X1I E;  2CBJ A;  4DR4 T;  3AXJ A;  2H89 A;  3CVR A;  2VWA A;  3OKQ A;  1FJG T;  5ABH A;  3A5X A;  2XJ7 A;  1KNP A;  3I0Q A;  4OYJ A;  2CLY C;  2JQ9 A;  3UT5 E;  3AE5 A;  4UIG A;  5LGU B;  4YTN A;  2XQ3 A;  2A2F X;  5J0Z A;  4HEA A;  4L0R A;  4TWF A;  4DR1 T;  4DR3 T;  4EV6 A;  2OLT A;  1NWM X;  1X9B A;  2CPT A;  3TLV A;  1D1C A;  2VB6 A;  3GWH A;  3AA6 B;  1YKE B;  4OHF A;  1UX4 A;  1HX8 A;  4TWD A;  4L5G A;  3MXZ A;  5DQV A;  3KFW X;  2W0G A;  4I43 B;  5AQH B;  5FY7 A;  2BS4 A;  1IBK T;  3PUV F;  5LXT E;  2VQE T;  3ZMU B;  4PK4 A;  2QYW A;  2VQF T;  2YIN A;  5HXH A;  2JJ9 A;  1HCI A;  3PUR A;  2VKJ A;  4ISS A;  4H9S E;  4LF5 T;  2LSG A;  2WY2 A;  2BVL A;  2V6Y A;  1ZHC A;  3PV0 F;  3OPC A;  2IUB A;  4O4L E;  3RKG A;  5BR8 T;  1YQ4 A;  3NKZ A;  5ABF A;  4U2Z A;  4NIQ A;  5HCM A;  3NBX X;  2XUE A;  3MA9 A;  2NTY A;  4C90 A;  4H9O C;  1KK7 A;  2CM0 A;  3RX6 A;  2BG9 C;  4X65 T;  3N9Q A;  2VKH A;  5LG3 A;  4YTP A;  1CUN A;  2LEH A;  1SE7 A;  5DJQ C;  4BJN A;  3GMI A;  4HWF A;  2JIW A;  2NR4 A;  1IJ6 A;  1DU2 A;  3PJA J;  3FHN A;  4AQG A;  4LMJ A;  2JMH A;  4EEB A;  2YDR A;  2ZM8 A;  4DR7 T;  4ZZB A;  2C5I T;  4X64 T;  2DNX A;  3WI3 A;  3RI5 A;  4B3T T;  5ETW A;  5JDH A;  1Y01 A;  3EDV A;  4BJM A;  3NWI A;  2ODV A;  2ODU A;  4NUV A;  4TX5 A;  4A98 A;  2XAS B;  3AEG A;  4UEL A;  2F4V T;  2XQA A;  2J47 A;  4DMV A;  2CXD A;  2BKN A;  2CHN A;  4LFC T;  3BK9 A;  3MZK B;  3QNU A;  1J5E T;  2V5D A;  5LJM A;  4X1K E;  3DJB A;  3KV6 A;  1JNR A;  3PTR B;  4IT4 A;  5JDN A;  4GKJ T;  1T98 A;  4EZ4 A;  3FZK B;  2N1G A;  3Q5W A;  2I59 A;  5AQJ B;  1LVK A;  3K3O A;  2LLY A;  2HHH T;  3UU4 A;  4GK5 E;  2K5B B;  4EAH A;  2WMN A;  4GKK T;  3ZLI A;  2KT9 A;  4N78 D;  2J62 A;  2AXD S;  3OJA A;  5JDQ A;  5EK2 A;  4EXT A;  1E2A A;  5L3F B;  2XAQ B;  3CX6 B;  5LG4 A;  1D0Z A;  3P4S A;  4LF8 T;  3VHL A;  2UU9 T;  3PDY A;  2ZLY A;  3P4Q A;  5C3J A;  1S35 A;  2PJQ A;  5LGN B;  3TLT A;  2B1E A;  4A56 A;  5L4E A;  2XM2 A;  3AA1 B;  1AJ3 A;  4JBW F;  3AE1 A;  5AQK B;  3ZYK A;  1O3X A;  4CN4 A;  1W0A A;  2EHO C;  3UQ7 A;  3U78 A;  3CQG B;  3VR8 A;  5L3C B;  2J4G A;  3O9X A;  1HNZ T;  3AE6 A;  3RQW A;  3LK2 B;  4ASK A;  2XQ9 A;  4ZHQ E;  4NXN T;  4J2C A;  5JR9 C;  5FY1 A;  2KWI B;  2D0U A;  1KNR A;  4HE8 A;  4NXM T;  2W00 A;  1KNZ A;  2HH7 A;  4IE7 A;  2M67 A;  2BBJ A;  2A3D A;  4CZZ B;  5LMN T;  5JH7 E;  1UCU A;  1BR1 A;  5ADX L;  4PFO A;  2W62 A;  5LBQ B;  3RRC A;  4HWD A;  3FZL B;  3Q5D A;  2MAW A;  4UVB B;  3C4X A;  1ZV4 X;  3RHW A;  3ZSS A;  3FXE B;  2WB5 A;  4NPP A;  4HFV A;  4KP3 C;  4F8H A;  5JRC B; 
#chains in the Genus database with same CATH homology
 4JI3 T;  1FJG T;  2UU9 T;  3OTO T;  4OX9 T;  1XMO T;  1XNQ T;  4LF7 T;  2ZM6 T;  4DV5 T;  4YHH T;  4DV4 T;  1HNW T;  1N34 T;  4DV7 T;  4DV1 T;  3T1Y T;  4DR7 T;  2E5L T;  4DR3 T;  4DR1 T;  4X64 T;  4JI4 T;  4DV6 T;  2UUC T;  4B3T T;  4JI7 T;  4DR5 T;  4LFB T;  1HNX T;  4YY3 T;  1N32 T;  4AQY T;  4X66 T;  1XMQ T;  4JI5 T;  1HNZ T;  4DUY T;  4LF4 T;  4K0K T;  3T1H T;  4B3M T;  2F4V T;  4JV5 T;  4JI0 T;  2UXC T;  1IBK T;  4JYA T;  4JI6 T;  4B3R T;  4KHP T;  2VQE T;  1N33 T;  4LF6 T;  4NXN T;  5LMU T;  4LFC T;  4JI8 T;  2VQF T;  1J5E T;  4DV0 T;  4DV2 T;  4LF5 T;  2UUB T;  4LFA T;  4NXM T;  2UXD T;  4GKJ T;  1HR0 T;  4DR6 T;  1XNR T;  5BR8 T;  5LMN T;  2UXB T;  4JI2 T;  2HHH T;  4GKK T;  1I94 T;  4LF9 T;  4JI1 T;  1N36 T;  4B3S T;  4X65 T;  4DR2 T;  4DUZ T;  5IWA T;  4DV3 T;  4LF8 T;  4DR4 T;  2UUA T;  1IBM T;  4X62 T;  1IBL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...