4NXNT

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4nxnT00
1HNZT 1N32T 4JI0T 2UXCT 5IWAT 1IBMT 4DR2T 4DV6T 4LF6T 4DV3T 4JI8T 4DV2T 4DV0T 4B3TT 4DR5T 1XMQT 2HHHT 4OX9T 4K0KT 2UXDT 2UU9T 4JI4T 4LF8T 1N33T 1IBKT 4DV1T 2UXBT 3T1HT 4JI6T 1IBLT 4B3ST 1J5ET 2UUBT 4X66T 4X65T 1XMOT 4KHPT 4DR1T 4DV4T 4LF9T 4DV7T 2E5LT 4LF4T 5BR8T 4JI1T 4JV5T 2VQFT 4LF7T 1N36T 4DR4T 4JI7T 4LFBT 2UUAT 4DR6T 4YHHT 4X62T 1HNXT 4DV5T 2F4VT 4JYAT 4JI5T 4DR3T 4JI2T 4NXMT 4DR7T 4GKJT 4X64T 4LFAT 1I94T 4B3RT 4B3MT 4JI3T 1N34T 4GKKT 4LF5T 1FJGT 1HNWT 3OTOT 4DUYT 3T1YT 2ZM6T 5LMUT 1XNRT 1HR0T 1XNQT 5LMNT 2UUCT 4NXNT 2VQET 4YY3T 4DUZT 4LFCT 4AQYT
chains in the Genus database with same CATH superfamily
1XWMA 3P4QA 5FXVA 3RGLA 2WZHA 4OHFA 5LGUB 1D0XA 3Q5XA 1N32T 2UXCT 5AQQB 3AE3A 4YFSA 1KNRA 1BR0A 3PUAA 2JMKA 3RIFA 3DJBA 4DR2T 2NP9A 1YD8G 3PJAA 3V5UA 2RA1A 4LMJA 3OYXA 4DV3T 5HXCA 4JI8T 1CUNA 3N5LA 5LA6E 5AQGB 4DV2T 2Y6XA 2J47A 1WFDA 2XUEA 4B3TT 3ZSTA 3RIUC 1FIOA 5FY1A 5JTGA 2N2NA 1JNRA 3ZMUB 5L3CB 2MPKA 4H63H 3U78A 3EVYA 3AA6B 2D5UA 1CHUA 4EB6E 4HFHA 4ZS3A 3ETVA 3LDQB 2ODVA 3AXJA 3EUHA 3PURA 4AI6A 2V26A 1O3XA 4TWDA 2SPCA 2LSYA 3QB5A 2LOPA 3K1SA 3C51A 3SRZA 2WQYA 4ZHQE 1KNZA 2UXBT 1J1JA 2EHOC 2LE8A 1KNPA 1MNDA 2HPJA 3CX8B 3IHRA 2JQKA 4H9RC 4IREA 2X0LB 3RF1A 1J5ET 3OKQA 4U72A 2UUBT 4TNVA 4BJMA 3VKHA 2KNDA 2YU2A 3AE6A 2UXXB 3C50A 3UFGA 5KXJA 3AEAA 5ABFA 2CXDA 2KZ7B 1YW0A 4PFPA 2E5VA 4X66T 4DR1T 4I50E 2XQ9A 4KHPT 2NWBA 2CM0A 1Z8UA 2LT3A 3ONXA 1OEDB 5FY0A 2L9QA 2V5CA 3ZYLA 3QNUA 2IMLA 3AVSA 4OK0A 3LK3B 4IL4A 2IAKA 3ETUA 1UURA 1VOMA 2WDRA 4NUUA 4TUYE 5EZYE 3IA3A 3ANWB 4MBQA 5C3JA 5BR8T 1SUMB 1WCRA 2CLYB 5JDLA 4MFRA 4PK6A 3WAKA 2N1GA 4ZI3D 2QYWA 3N2GE 4G63A 3W15B 2W4XA 4ADZA 3LSVA 2GK9A 5LOVE 4YT0A 2CHNA 2WP9A 3EDUA 4Z91A 2X67A 2XAFB 5AQUB 4EEDA 2UUAT 3EAMA 2C5KT 4X62T 3C4XA 4BAYB 1MIVA 3CQXC 2IUBA 3CPZA 2CA5A 3AECA 3C4WA 3P4SA 3L39A 2D0UA 4U2YA 2XAQB 4IT4A 2OV9A 3CQCB 5DJQC 1X9BA 5AQRB 3PU3A 4I0UA 2RPAA 2X9XA 2YKSA 4HFVA 4XZCA 5HXSA 4DR3T 1W9RA 4KUMB 4JI2T 4ZI2D 5KX5E 4NXMT 2QVAA 2NW7A 3K3NA 2XTLA 4MALA 4PW8A 5AQOB 1XDOA 5HCMA 1WYCA 3ESLA 4EEBA 1M7KA 3ABVA 2V7MA 4X1KE 5DABA 5J1GA 4B3RT 1XDPA 2V6XA 3HKCE 1BR1A 5FXZA 4ZI3C 1MMGA 3EI0A 4HFCA 2VKOA 5AQHB 2QRXA 4H9QC 1FJGT 3AAEB 1FMVA 4UVCB 2JJ9A 1ZHCA 3KDSE 3N2OA 5FXXA 3OVUA 5F5WA 3TLTA 3UFEA 4O8SA 1NEKA 4UIGA 2C5IT 5LHIB 3AA1B 3KBUA 1HNWT 1VCSA 3AB3B 4DUYT 3RC8A 3AE8A 4JEHB 4XBFB 1D0YA 3FHNA 1L0VA 2M6BA 3LK2B 4ILBA 4UR9A 2XJ7A 4I43B 3P7IA 3B13A 1WR6A 4TN7B 5JDNA 3MJXA 2J62A 4HE8A 2ZMAA 3SFDA 3UT5E 2LKGA 2V6YB 5LBMA 2W63A 3O9XA 3H3MA 1HS7A 5FKYA 3KV6A 1QUUA 2DWKA 2WWUA 2YK0A 2WY2A 2X0YA 2VQET 2PJQA 1MIWA 1KFYA 5JR9B 3AE1A 4EZ4A 4AQYT 3PV0F 2CXLA 3OYZA 2CHOA 1LRZA 2EHOD 4H9SE 3ZN0B 1HCIA 2CBJA 4WNKA 1KF6A 3ZN1B 4Z8XA 1G8XA 3O1JA 4AQGA 5JDMA 5LHHB 5IWAT 2FBWA 5EK4A 5A1LA 3NZPA 4IHJE 3PE0A 5AQVB 4AKHA 4PK5A 3RYHE 4QH4A 1UX4A 4NIQA 5AQLB 3MA9A 2YEVC 3PUQA 2PFVA 3V5SA 4PK4A 5LGTB 2KMFA 5LNKA 4DR5T 3B5MA 1V9DA 2LKHA 3AAIA 3QK6A 3FZKB 2HN1A 4UEMA 2G0UA 1UUSA 2IW5B 2KWHA 3HKDE 4OX9T 5FMNA 2XY8B 3FXDB 4ZI2C 4ZZCA 4K0KT 2IIUA 2CEAA 4ISTA 2XSAA 3E0ZA 2WS3A 5AQSB 5L4HA 5AQTB 5FVLA 2V1DB 4DBQA 2JQQA 3HI2A 5HXRA 3BQKA 3SWHA 4HWDA 4WYVA 3SS1A 2H7OA 2WBLA 3ZKRA 1D1CA 5AQFB 2A3DA 3F2EA 1IZNB 2FUPA 2X68A 3EDVA 5FP3A 2YOEA 4I55E 3FZMB 4J2CA 3X1DA 3T1HT 2DI4A 4P0BA 3N9PA 4GK5E 2WAUA 4U7YA 2WDVA 3RQUA 2B76A 5JQGE 3ZC0A 2WMNA 4IDPA 4ILCA 3RPUA 4AKIA 3VHLA 1XMOT 2PG8A 4DV4T 4CN4A 4DMVA 1N33T 3ZYMA 2WU5A 2JPFA 2XHEB 3CKDA 2E5LT 3KVAA 3OBVE 5F8PA 2BG9B 2YDRA 4HFEA 4M1PA 4WW0A 4JI1T 2KINB 4O4LE 1T72A 2BS4A 2D0TA 2DCFA 3FZLB 4QHOA 3Q5EA 3LFMA 2I59A 3MKDA 3RI5A 3ZT7A 5JVDE 2CXFA 1XZYA 4X1IE 4YXDA 3Q5DA 4QWNB 3VR8A 2V7LA 3EHZA 4HEAA 4LF7T 1N36T 2XQ5A 2VKHA 4TWFA 2K9AA 2VKJA 3N9LA 4E7ZA 4DR6T 2L8KA 4YHHT 3P50A 1R8IA 3RQWA 4CI2B 2X51A 3FBLA 3CQGB 2A9UA 3AE4A 5L3FB 3R84B 5LYJE 1HNXT 4DV5T 2XQ3A 4ZS2A 1YKEB 2W61A 1VRBA 5EK2A 5L3GB 3PUSA 4QX7B 1HX8A 3D0TA 4PFOA 2B1EA 4L5GA 4IDQA 1SHZC 4H63V 5HWYA 3ZC1A 2KSRA 4IE6A 4IDZA 4UVAB 2Q9QB 2K48A 1H7CA 1U4QA 1J5WA 4MLKA 4GYRA 2E9XD 2WSSV 2MBGA 1VCTA 3TLWA 3PUYF 1LVFA 1Z0PA 3LK42 4IE5A 2XQ6A 4ILAA 4AISA 2X9WA 4YJ2E 2ES0A 3UUBA 2XQ8A 1YXRA 4PJNA 1S94A 4PJJA 3MXZA 3UU5A 4ILUA 5ADXL 4LF5T 1D1AA 4G2AA 3PU8A 4GIWA 2LOSA 3RC3A 4BA9A 3HKBE 3E22E 3BQIA 3Q5WA 3AEGA 4K0UA 2BVLA 2X66A 3PJAJ 4U31A 3SFEA 3ZMVB 4DNDA 4EIWA 2BBHA 3NKZA 1JNZA 3IBPA 3RLFF 1MMAA 2J4GA 4ANJA 2LJLA 1ZV4X 2CWYA 3K3QC 5HXEA 1MMNA 2CCQA 3R6NA 4UV8B 3U3IA 1I6ZA 2NTXA 3VKGA 1KEYA 2L3LA 1XNRT 2CWOA 2LEHA 1HR0T 4H9OC 2BG9C 2VL8A 5CA0E 2LHNA 4CN6A 2MAWA 2ZM2A 4X5TA 4ZXLA 2DL1A 5JDHA 4O4IE 4PJLA 2AXDS 2UUCT 3C4ZA 4NXNT 2UXNB 5E0OA 2DLRA 3AEBA 4EOZB 2H88A 2E9XA 4KBMB 2H89A 4HN9A 1S35A 1GQEA 4O4JE 4FJOA 3TLUA 2V5DA 2FJEA 3CK6A 2R6GF 1HNZT 5HWXA 3AA7B 4P0AA 2EHOB 2EHOA 4QH5A 3L09A 5JH7E 2XQYA 3PUWF 2M6IA 2V7JA 3FB2A 4KP3C 4CXYA 4I4TE 5HCJA 4UV9B 3NBXX 4LF6T 3PUZF 1W0BA 5TAOA 2VASA 4YJ3E 4A97A 4Z90A 1YKHB 2XM1A 4FI5A 3RYIE 3JADA 1FMWA 4GYSA 2X0HA 4DVDA 4YSYA 5CFBA 4CN1A 3UU6A 4B6XA 3A7MA 5LHGB 2CMRA 2E8IA 4AKLA 4WBNE 5DQWA 3RRCA 4U7IA 3K3OA 2HHHT 3K8PC 5AQJB 4COFA 5ABFB 4TV8E 3CMLA 4Q25A 3KFWX 2UU9T 3Q9DA 3ZSSA 5L2LA 3QB5K 4HGAA 4LF8T 4QXBB 5JRCB 4HKAA 1MIYA 3UTKA 3UU3A 2BG9E 4PJMA 2IDOB 1UGOA 2YDSA 2XM2A 2VWAA 3QOFA 4UF0B 4KHZF 5HEUA 2XQ7A 2LLYA 1BR4A 3I1AA 4A5XA 4YTPA 4X20E 1IBKT 4HFIA 3F31A 4CZZB 3IEEA 3DP7A 2MTQA 3CIRA 3AVRA 2Y48B 4A56A 1G73A 3N9OA 1OEDC 2JIWA 4B3ST 1E7PA 2ACXA 5LG4A 5FNVE 1MNEA 2W00A 3L3PA 2XAHB 2LSKA 2VVNA 3GN5A 4ZZBA 5J2TE 3AE9A 2BVMA 2YU1A 2HPLA 5ABEA 4OYJA 2BZBA 2VL0A 4LF9T 3RIUA 4DV7T 4JI0T 4A98A 2I0MA 3AEDA 3NWIA 3J9X1 3RYFE 4BJNA 2BS3A 3J7Yq 3SOLA 2NOXA 1OWAA 4TX5A 4WZXA 3ONJA 4HTEA 5HEHA 1W09A 3CVRA 5AQPB 4UXNB 1Y01A 2XASB 2WU2A 4JV5T 2K3WA 2W67A 2WMOA 4QXCB 4ISSA 5L4EA 4F8HA 3UU8A 3P4RA 1MMDA 2V7IA 2VQFT 3ZCIA 4EYUA 2XAJB 4JI7T 1UX5A 4DR4T 2CE7A 4YSXA 1US7B 4LFBT 2LSGA 2FJBA 2IC9A 3HA4A 2LRLA 4IE4A 3RRWA 4UVBB 4JLEA 2BG9A 2A72A 4U3CA 4JYAT 2X9YA 2KXPB 5AQIB 1OEDE 2WB5A 4N78D 4AXPA 1M62A 4IE0A 3PUVF 5AFUL 2Q9QA 4HFBA 4IGUA 2J1DG 4U33A 2I6HA 2Q9QD 2E9XC 4X1YE 5LCYA 3UUXB 2BBJA 4AIUA 4X64T 2DWGA 3O1IA 2WZIA 4DO0A 2PBIA 2MOZA 4UELA 3UU4A 5HAXA 3VU7H 2WM9A 4AQFC 1NWMX 5LP6E 4ERRA 2YDQA 2HN2A 2VK9A 3NZQA 1HX1B 3MZKB 4GKKT 2XZEA 3FXEB 4O2BE 2P9BA 3AAAB 4IL9A 5KMGP 4TZ4C 4HWFA 2NW9A 3AEEA 1HG2A 5J2UE 3OTOT 1D0ZA 1T8BA 2A2FX 4E7SA 1YQ4A 5C2TA 4YSZA 1HTJF 2NR4A 3LBXB 3KV4A 5HXHA 5CJ5A 3G06A 5L3BB 1B7TA 1OXZA 3C64A 3ZMTB 2ODUA 2C0SA 4CXWA 5IUXA 3PDYA 2DNXA 5FL0A 3QUJA 3UUNA 5JREA 3BQLA 1W0AA 1IAPA 2ZM0A 3GN5B 3FZHB 3I0QA 3I9WA 5FYMA 2BKPA 5H6RB 1XNQT 3E08A 3VR9A 1E1HB 3KBTA 3M65A 2BDEA 1QSDA 5AQNB 2LSJA 4YHJA 2LRKA 4O4HE 3DTOA 3IF8B 3RHWA 1NENA 2E9XB 4DUZT 4LFCT 2LM2A 4KX6A 4IE7A 3B57A 3ANWA 1SE7A 3RX6A 3RKGA 5CGMA 3S4UA 3AEFA 3KV5A 4H9PC 4KMCA 4QKNA 4QX8B 4YTNA 5JDGA 1BR2A 1IBMT 1T98A 3AA0B 1OEDA 3LBXA 5AQMB 4ZEYA 5JRCA 4P09A 2XQ4A 2WDQA 2MYSA 2WWVA 4CI1B 4DV6T 2QA7A 2OLTA 2LHRA 2Z6EA 3AE7A 4NUVA 3C98B 4IDOA 1IJ5A 5LXTE 3OJAA 3UUMA 4PNIA 5JDFA 3JC6D 3WI3A 2KLQA 3A5XA 3I9YA 1ZKEA 5LG3A 3P4PA 4DV0T 4DIDB 5HEJA 2M67A 4HWHA 4DMWA 5HYAA 2YN6A 4V1Av 2JMHA 5FY7A 1XMQT 1AJ3A 4QXHB 4ZI7E 5C8YE 3T8OA 5LB7B 1WLXA 2NTYA 2C5JA 1UK5A 4KI0F 5F3JA 5LGNB 1WYBA 3I0OA 4OFZA 4EZHA 3FZFB 2F4VT 2UXDT 1WR0A 4JI4T 3KV9A 2W2UA 3F57A 3O1HA 3RYCE 4LMLA 3AXJB 2VURA 3M3ZB 3PUXF 4HFDA 3FBZA 2ZLYA 4DBRA 3N9QA 4EV6A 2OA5A 3PTRB 4LMKA 1YQ3A 5BMVE 5IHYA 4DR7T 4TV9E 3UQ7A 3ZMZB 3O4XE 4DV1T 5LJNA 4AKRB 3PUGA 5CB4E 2QGSA 2JQHA 3TLSA 5JDQA 4JI6T 4GKJT 1IBLT 1LKXA 2DHRA 1ZEEA 4U2ZA 3A8YC 3GMIA 4F6RC 3ZPOA 5CA1E 3H3AA 4YTMA 1Y64B 4X65T 2N9DA 4P1NA 2D9DA 4EGWA 2NW8A 1HF8A 2E2AA 1ZOYA 3NVOA 4O2AE 5DQVA 2Q9QC 3RH3A 2RP4A 2V7KA 4GOUA 5ETWA 3ZCJA 4LF4T 4GK0E 5L3DB 4CI3B 5L47A 5FL1A 2K24A 4C90A 2LSIA 4YLHA 5ABGA 3JAFA 2W66A 4IIJE 5GONE 4CXXA 2Y8DA 1ZP0A 4IDNA 2IC6A 4HWCA 4H9NC 2JRKA 2VVSA 3HR0A 3QC9A 4MHCA 4XAXB 3VRBA 3ZYKA 3KINB 3ZT5A 3NRXA 3LJCA 1QLBA 5H6QB 4EYYR 2W62A 3ZJ2A 2X9HA 5KDMC 3P4WA 3P8CD 1EZ3A 3ZMSB 3MK7C 3HKEE 2CRBA 5FXWA 3ZLIA 1X79A 2KT9A 3EABA 3WAJA 3RKOA 3MACA 3TLVA 2BKNA 2VB6A 2H7VC 4UF0A 2IHR1 4JI5T 3N9NA 3RIAA 2ZM8A 4EXTA 1LVKA 1E2AA 2W0GA 2BS2A 2ACZA 5AQKB 3UULA 1NAFA 3CWZB 3JAEA 4JEUB 4LFAT 4PAGA 1I94T 5IYZE 2YINA 3ZJ1A 4U74A 5LJMA 4HWIB 2V6YA 4B3MT 4JI3T 1DU2A 1N34T 4OYKA 1WRDA 3LG7A 2FJAA 2JQ9A 2VKDA 4TNWA 2XQAA 3JCFA 1KK7A 3KVBA 4ASKA 2XSBA 5JR9C 2KWIB 5J0ZA 5LBQB 3VRAA 5ABHA 2XAGB 3N2KE 1IJ6A 2WCAA 4JBWF 4ZOLE 5HEOA 4TWHA 4AKGA 1UCUA 3H37A 3JC6C 3T1YT 3UQ4A 4NPPA 2ZM6T 2D2SA 3HL6A 4JUYA 3AE2A 3L8RA 3OPCA 4QH1A 4WBOA 3BK9A 3TKLB 5LMUT 2CBIA 1D1BA 5L3EB 2V8SV 3ONLC 2LM9A 3GA8A 1U5PA 5M4YA 4EAHA 2H3RA 1HG5A 1SA0E 1FEWA 5FVKA 4AQFA 3ZT6A 4CQIA 1T7SA 4C91A 5EK3A 2PTFA 2AE9A 4L9IA 3AE5A 5LMNT 4L0RA 2BKOA 2XPKA 3N9MA 3GWHA 2CPTA 2FJDA 3Q2MA 5HEGA 3NRYA 3CX7B 2K5BB 4YY3T 1HFAA 5JR9A 3ZEFB 3CX6B 2HH7A 2CLYC
chains in the Genus database with same CATH topology
1HNZT 1N32T 4JI0T 2UXCT 5IWAT 1IBMT 4DR2T 4DV6T 4LF6T 4DV3T 4JI8T 4DV2T 4DV0T 4B3TT 4DR5T 1XMQT 2HHHT 4OX9T 4K0KT 2UXDT 2UU9T 4JI4T 4LF8T 1N33T 1IBKT 4DV1T 2UXBT 3T1HT 4JI6T 1IBLT 4B3ST 1J5ET 2UUBT 4X66T 4X65T 1XMOT 4KHPT 4DR1T 4DV4T 4LF9T 4DV7T 2E5LT 4LF4T 5BR8T 4JI1T 4JV5T 2VQFT 4LF7T 1N36T 4DR4T 4JI7T 4LFBT 2UUAT 4DR6T 4YHHT 4X62T 1HNXT 4DV5T 2F4VT 4JYAT 4JI5T 4DR3T 4JI2T 4NXMT 4DR7T 4GKJT 4X64T 4LFAT 1I94T 4B3RT 4B3MT 4JI3T 1N34T 4GKKT 4LF5T 1FJGT 1HNWT 3OTOT 4DUYT 3T1YT 2ZM6T 5LMUT 1XNRT 1HR0T 1XNQT 5LMNT 2UUCT 4NXNT 2VQET 4YY3T 4DUZT 4LFCT 4AQYT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ T;  1N32 T;  4JI0 T;  2UXC T;  5IWA T;  1IBM T;  4DR2 T;  4DV6 T;  4LF6 T;  4DV3 T;  4JI8 T;  4DV2 T;  4DV0 T;  4B3T T;  4DR5 T;  1XMQ T;  2HHH T;  4OX9 T;  4K0K T;  2UXD T;  2UU9 T;  4JI4 T;  4LF8 T;  1N33 T;  1IBK T;  4DV1 T;  2UXB T;  3T1H T;  4JI6 T;  1IBL T;  4B3S T;  1J5E T;  2UUB T;  4X66 T;  4X65 T;  1XMO T;  4KHP T;  4DR1 T;  4DV4 T;  4LF9 T;  4DV7 T;  2E5L T;  4LF4 T;  5BR8 T;  4JI1 T;  4JV5 T;  2VQF T;  4LF7 T;  1N36 T;  4DR4 T;  4JI7 T;  4LFB T;  2UUA T;  4DR6 T;  4YHH T;  4X62 T;  1HNX T;  4DV5 T;  2F4V T;  4JYA T;  4JI5 T;  4DR3 T;  4JI2 T;  4NXM T;  4DR7 T;  4GKJ T;  4X64 T;  4LFA T;  1I94 T;  4B3R T;  4B3M T;  4JI3 T;  1N34 T;  4GKK T;  4LF5 T;  1FJG T;  1HNW T;  3OTO T;  4DUY T;  3T1Y T;  2ZM6 T;  5LMU T;  1XNR T;  1HR0 T;  1XNQ T;  5LMN T;  2UUC T;  4NXN T;  2VQE T;  4YY3 T;  4DUZ T;  4LFC T;  4AQY T; 
#chains in the Genus database with same CATH topology
 1XWM A;  3P4Q A;  5FXV A;  3RGL A;  2WZH A;  4OHF A;  5LGU B;  1D0X A;  3Q5X A;  1N32 T;  2UXC T;  5AQQ B;  3AE3 A;  4YFS A;  1KNR A;  1BR0 A;  3PUA A;  2JMK A;  3RIF A;  3DJB A;  4DR2 T;  2NP9 A;  1YD8 G;  3PJA A;  3V5U A;  2RA1 A;  4LMJ A;  3OYX A;  4DV3 T;  5HXC A;  4JI8 T;  1CUN A;  3N5L A;  5LA6 E;  5AQG B;  4DV2 T;  2Y6X A;  2J47 A;  1WFD A;  2XUE A;  4B3T T;  3ZST A;  3RIU C;  1FIO A;  5FY1 A;  5JTG A;  2N2N A;  1JNR A;  3ZMU B;  5L3C B;  2MPK A;  4H63 H;  3U78 A;  3EVY A;  3AA6 B;  2D5U A;  1CHU A;  4EB6 E;  4HFH A;  4ZS3 A;  3ETV A;  3LDQ B;  2ODV A;  3AXJ A;  3EUH A;  3PUR A;  4AI6 A;  2V26 A;  1O3X A;  4TWD A;  2SPC A;  2LSY A;  3QB5 A;  2LOP A;  3K1S A;  3C51 A;  3SRZ A;  2WQY A;  4ZHQ E;  1KNZ A;  2UXB T;  1J1J A;  2EHO C;  2LE8 A;  1KNP A;  1MND A;  2HPJ A;  3CX8 B;  3IHR A;  2JQK A;  4H9R C;  4IRE A;  2X0L B;  3RF1 A;  1J5E T;  3OKQ A;  4U72 A;  2UUB T;  4TNV A;  4BJM A;  3VKH A;  2KND A;  2YU2 A;  3AE6 A;  2UXX B;  3C50 A;  3UFG A;  5KXJ A;  3AEA A;  5ABF A;  2CXD A;  2KZ7 B;  1YW0 A;  4PFP A;  2E5V A;  4X66 T;  4DR1 T;  4I50 E;  2XQ9 A;  4KHP T;  2NWB A;  2CM0 A;  1Z8U A;  2LT3 A;  3ONX A;  1OED B;  5FY0 A;  2L9Q A;  2V5C A;  3ZYL A;  3QNU A;  2IML A;  3AVS A;  4OK0 A;  3LK3 B;  4IL4 A;  2IAK A;  3ETU A;  1UUR A;  1VOM A;  2WDR A;  4NUU A;  4TUY E;  5EZY E;  3IA3 A;  3ANW B;  4MBQ A;  5C3J A;  5BR8 T;  1SUM B;  1WCR A;  2CLY B;  5JDL A;  4MFR A;  4PK6 A;  3WAK A;  2N1G A;  4ZI3 D;  2QYW A;  3N2G E;  4G63 A;  3W15 B;  2W4X A;  4ADZ A;  3LSV A;  2GK9 A;  5LOV E;  4YT0 A;  2CHN A;  2WP9 A;  3EDU A;  4Z91 A;  2X67 A;  2XAF B;  5AQU B;  4EED A;  2UUA T;  3EAM A;  2C5K T;  4X62 T;  3C4X A;  4BAY B;  1MIV A;  3CQX C;  2IUB A;  3CPZ A;  2CA5 A;  3AEC A;  3C4W A;  3P4S A;  3L39 A;  2D0U A;  4U2Y A;  2XAQ B;  4IT4 A;  2OV9 A;  3CQC B;  5DJQ C;  1X9B A;  5AQR B;  3PU3 A;  4I0U A;  2RPA A;  2X9X A;  2YKS A;  4HFV A;  4XZC A;  5HXS A;  4DR3 T;  1W9R A;  4KUM B;  4JI2 T;  4ZI2 D;  5KX5 E;  4NXM T;  2QVA A;  2NW7 A;  3K3N A;  2XTL A;  4MAL A;  4PW8 A;  5AQO B;  1XDO A;  5HCM A;  1WYC A;  3ESL A;  4EEB A;  1M7K A;  3ABV A;  2V7M A;  4X1K E;  5DAB A;  5J1G A;  4B3R T;  1XDP A;  2V6X A;  3HKC E;  1BR1 A;  5FXZ A;  4ZI3 C;  1MMG A;  3EI0 A;  4HFC A;  2VKO A;  5AQH B;  2QRX A;  4H9Q C;  1FJG T;  3AAE B;  1FMV A;  4UVC B;  2JJ9 A;  1ZHC A;  3KDS E;  3N2O A;  5FXX A;  3OVU A;  5F5W A;  3TLT A;  3UFE A;  4O8S A;  1NEK A;  4UIG A;  2C5I T;  5LHI B;  3AA1 B;  3KBU A;  1HNW T;  1VCS A;  3AB3 B;  4DUY T;  3RC8 A;  3AE8 A;  4JEH B;  4XBF B;  1D0Y A;  3FHN A;  1L0V A;  2M6B A;  3LK2 B;  4ILB A;  4UR9 A;  2XJ7 A;  4I43 B;  3P7I A;  3B13 A;  1WR6 A;  4TN7 B;  5JDN A;  3MJX A;  2J62 A;  4HE8 A;  2ZMA A;  3SFD A;  3UT5 E;  2LKG A;  2V6Y B;  5LBM A;  2W63 A;  3O9X A;  3H3M A;  1HS7 A;  5FKY A;  3KV6 A;  1QUU A;  2DWK A;  2WWU A;  2YK0 A;  2WY2 A;  2X0Y A;  2VQE T;  2PJQ A;  1MIW A;  1KFY A;  5JR9 B;  3AE1 A;  4EZ4 A;  4AQY T;  3PV0 F;  2CXL A;  3OYZ A;  2CHO A;  1LRZ A;  2EHO D;  4H9S E;  3ZN0 B;  1HCI A;  2CBJ A;  4WNK A;  1KF6 A;  3ZN1 B;  4Z8X A;  1G8X A;  3O1J A;  4AQG A;  5JDM A;  5LHH B;  5IWA T;  2FBW A;  5EK4 A;  5A1L A;  3NZP A;  4IHJ E;  3PE0 A;  5AQV B;  4AKH A;  4PK5 A;  3RYH E;  4QH4 A;  1UX4 A;  4NIQ A;  5AQL B;  3MA9 A;  2YEV C;  3PUQ A;  2PFV A;  3V5S A;  4PK4 A;  5LGT B;  2KMF A;  5LNK A;  4DR5 T;  3B5M A;  1V9D A;  2LKH A;  3AAI A;  3QK6 A;  3FZK B;  2HN1 A;  4UEM A;  2G0U A;  1UUS A;  2IW5 B;  2KWH A;  3HKD E;  4OX9 T;  5FMN A;  2XY8 B;  3FXD B;  4ZI2 C;  4ZZC A;  4K0K T;  2IIU A;  2CEA A;  4IST A;  2XSA A;  3E0Z A;  2WS3 A;  5AQS B;  5L4H A;  5AQT B;  5FVL A;  2V1D B;  4DBQ A;  2JQQ A;  3HI2 A;  5HXR A;  3BQK A;  3SWH A;  4HWD A;  4WYV A;  3SS1 A;  2H7O A;  2WBL A;  3ZKR A;  1D1C A;  5AQF B;  2A3D A;  3F2E A;  1IZN B;  2FUP A;  2X68 A;  3EDV A;  5FP3 A;  2YOE A;  4I55 E;  3FZM B;  4J2C A;  3X1D A;  3T1H T;  2DI4 A;  4P0B A;  3N9P A;  4GK5 E;  2WAU A;  4U7Y A;  2WDV A;  3RQU A;  2B76 A;  5JQG E;  3ZC0 A;  2WMN A;  4IDP A;  4ILC A;  3RPU A;  4AKI A;  3VHL A;  1XMO T;  2PG8 A;  4DV4 T;  4CN4 A;  4DMV A;  1N33 T;  3ZYM A;  2WU5 A;  2JPF A;  2XHE B;  3CKD A;  2E5L T;  3KVA A;  3OBV E;  5F8P A;  2BG9 B;  2YDR A;  4HFE A;  4M1P A;  4WW0 A;  4JI1 T;  2KIN B;  4O4L E;  1T72 A;  2BS4 A;  2D0T A;  2DCF A;  3FZL B;  4QHO A;  3Q5E A;  3LFM A;  2I59 A;  3MKD A;  3RI5 A;  3ZT7 A;  5JVD E;  2CXF A;  1XZY A;  4X1I E;  4YXD A;  3Q5D A;  4QWN B;  3VR8 A;  2V7L A;  3EHZ A;  4HEA A;  4LF7 T;  1N36 T;  2XQ5 A;  2VKH A;  4TWF A;  2K9A A;  2VKJ A;  3N9L A;  4E7Z A;  4DR6 T;  2L8K A;  4YHH T;  3P50 A;  1R8I A;  3RQW A;  4CI2 B;  2X51 A;  3FBL A;  3CQG B;  2A9U A;  3AE4 A;  5L3F B;  3R84 B;  5LYJ E;  1HNX T;  4DV5 T;  2XQ3 A;  4ZS2 A;  1YKE B;  2W61 A;  1VRB A;  5EK2 A;  5L3G B;  3PUS A;  4QX7 B;  1HX8 A;  3D0T A;  4PFO A;  2B1E A;  4L5G A;  4IDQ A;  1SHZ C;  4H63 V;  5HWY A;  3ZC1 A;  2KSR A;  4IE6 A;  4IDZ A;  4UVA B;  2Q9Q B;  2K48 A;  1H7C A;  1U4Q A;  1J5W A;  4MLK A;  4GYR A;  2E9X D;  2WSS V;  2MBG A;  1VCT A;  3TLW A;  3PUY F;  1LVF A;  1Z0P A;  3LK4 2;  4IE5 A;  2XQ6 A;  4ILA A;  4AIS A;  2X9W A;  4YJ2 E;  2ES0 A;  3UUB A;  2XQ8 A;  1YXR A;  4PJN A;  1S94 A;  4PJJ A;  3MXZ A;  3UU5 A;  4ILU A;  5ADX L;  4LF5 T;  1D1A A;  4G2A A;  3PU8 A;  4GIW A;  2LOS A;  3RC3 A;  4BA9 A;  3HKB E;  3E22 E;  3BQI A;  3Q5W A;  3AEG A;  4K0U A;  2BVL A;  2X66 A;  3PJA J;  4U31 A;  3SFE A;  3ZMV B;  4DND A;  4EIW A;  2BBH A;  3NKZ A;  1JNZ A;  3IBP A;  3RLF F;  1MMA A;  2J4G A;  4ANJ A;  2LJL A;  1ZV4 X;  2CWY A;  3K3Q C;  5HXE A;  1MMN A;  2CCQ A;  3R6N A;  4UV8 B;  3U3I A;  1I6Z A;  2NTX A;  3VKG A;  1KEY A;  2L3L A;  1XNR T;  2CWO A;  2LEH A;  1HR0 T;  4H9O C;  2BG9 C;  2VL8 A;  5CA0 E;  2LHN A;  4CN6 A;  2MAW A;  2ZM2 A;  4X5T A;  4ZXL A;  2DL1 A;  5JDH A;  4O4I E;  4PJL A;  2AXD S;  2UUC T;  3C4Z A;  4NXN T;  2UXN B;  5E0O A;  2DLR A;  3AEB A;  4EOZ B;  2H88 A;  2E9X A;  4KBM B;  2H89 A;  4HN9 A;  1S35 A;  1GQE A;  4O4J E;  4FJO A;  3TLU A;  2V5D A;  2FJE A;  3CK6 A;  2R6G F;  1HNZ T;  5HWX A;  3AA7 B;  4P0A A;  2EHO B;  2EHO A;  4QH5 A;  3L09 A;  5JH7 E;  2XQY A;  3PUW F;  2M6I A;  2V7J A;  3FB2 A;  4KP3 C;  4CXY A;  4I4T E;  5HCJ A;  4UV9 B;  3NBX X;  4LF6 T;  3PUZ F;  1W0B A;  5TAO A;  2VAS A;  4YJ3 E;  4A97 A;  4Z90 A;  1YKH B;  2XM1 A;  4FI5 A;  3RYI E;  3JAD A;  1FMW A;  4GYS A;  2X0H A;  4DVD A;  4YSY A;  5CFB A;  4CN1 A;  3UU6 A;  4B6X A;  3A7M A;  5LHG B;  2CMR A;  2E8I A;  4AKL A;  4WBN E;  5DQW A;  3RRC A;  4U7I A;  3K3O A;  2HHH T;  3K8P C;  5AQJ B;  4COF A;  5ABF B;  4TV8 E;  3CML A;  4Q25 A;  3KFW X;  2UU9 T;  3Q9D A;  3ZSS A;  5L2L A;  3QB5 K;  4HGA A;  4LF8 T;  4QXB B;  5JRC B;  4HKA A;  1MIY A;  3UTK A;  3UU3 A;  2BG9 E;  4PJM A;  2IDO B;  1UGO A;  2YDS A;  2XM2 A;  2VWA A;  3QOF A;  4UF0 B;  4KHZ F;  5HEU A;  2XQ7 A;  2LLY A;  1BR4 A;  3I1A A;  4A5X A;  4YTP A;  4X20 E;  1IBK T;  4HFI A;  3F31 A;  4CZZ B;  3IEE A;  3DP7 A;  2MTQ A;  3CIR A;  3AVR A;  2Y48 B;  4A56 A;  1G73 A;  3N9O A;  1OED C;  2JIW A;  4B3S T;  1E7P A;  2ACX A;  5LG4 A;  5FNV E;  1MNE A;  2W00 A;  3L3P A;  2XAH B;  2LSK A;  2VVN A;  3GN5 A;  4ZZB A;  5J2T E;  3AE9 A;  2BVM A;  2YU1 A;  2HPL A;  5ABE A;  4OYJ A;  2BZB A;  2VL0 A;  4LF9 T;  3RIU A;  4DV7 T;  4JI0 T;  4A98 A;  2I0M A;  3AED A;  3NWI A;  3J9X 1;  3RYF E;  4BJN A;  2BS3 A;  3J7Y q;  3SOL A;  2NOX A;  1OWA A;  4TX5 A;  4WZX A;  3ONJ A;  4HTE A;  5HEH A;  1W09 A;  3CVR A;  5AQP B;  4UXN B;  1Y01 A;  2XAS B;  2WU2 A;  4JV5 T;  2K3W A;  2W67 A;  2WMO A;  4QXC B;  4ISS A;  5L4E A;  4F8H A;  3UU8 A;  3P4R A;  1MMD A;  2V7I A;  2VQF T;  3ZCI A;  4EYU A;  2XAJ B;  4JI7 T;  1UX5 A;  4DR4 T;  2CE7 A;  4YSX A;  1US7 B;  4LFB T;  2LSG A;  2FJB A;  2IC9 A;  3HA4 A;  2LRL A;  4IE4 A;  3RRW A;  4UVB B;  4JLE A;  2BG9 A;  2A72 A;  4U3C A;  4JYA T;  2X9Y A;  2KXP B;  5AQI B;  1OED E;  2WB5 A;  4N78 D;  4AXP A;  1M62 A;  4IE0 A;  3PUV F;  5AFU L;  2Q9Q A;  4HFB A;  4IGU A;  2J1D G;  4U33 A;  2I6H A;  2Q9Q D;  2E9X C;  4X1Y E;  5LCY A;  3UUX B;  2BBJ A;  4AIU A;  4X64 T;  2DWG A;  3O1I A;  2WZI A;  4DO0 A;  2PBI A;  2MOZ A;  4UEL A;  3UU4 A;  5HAX A;  3VU7 H;  2WM9 A;  4AQF C;  1NWM X;  5LP6 E;  4ERR A;  2YDQ A;  2HN2 A;  2VK9 A;  3NZQ A;  1HX1 B;  3MZK B;  4GKK T;  2XZE A;  3FXE B;  4O2B E;  2P9B A;  3AAA B;  4IL9 A;  5KMG P;  4TZ4 C;  4HWF A;  2NW9 A;  3AEE A;  1HG2 A;  5J2U E;  3OTO T;  1D0Z A;  1T8B A;  2A2F X;  4E7S A;  1YQ4 A;  5C2T A;  4YSZ A;  1HTJ F;  2NR4 A;  3LBX B;  3KV4 A;  5HXH A;  5CJ5 A;  3G06 A;  5L3B B;  1B7T A;  1OXZ A;  3C64 A;  3ZMT B;  2ODU A;  2C0S A;  4CXW A;  5IUX A;  3PDY A;  2DNX A;  5FL0 A;  3QUJ A;  3UUN A;  5JRE A;  3BQL A;  1W0A A;  1IAP A;  2ZM0 A;  3GN5 B;  3FZH B;  3I0Q A;  3I9W A;  5FYM A;  2BKP A;  5H6R B;  1XNQ T;  3E08 A;  3VR9 A;  1E1H B;  3KBT A;  3M65 A;  2BDE A;  1QSD A;  5AQN B;  2LSJ A;  4YHJ A;  2LRK A;  4O4H E;  3DTO A;  3IF8 B;  3RHW A;  1NEN A;  2E9X B;  4DUZ T;  4LFC T;  2LM2 A;  4KX6 A;  4IE7 A;  3B57 A;  3ANW A;  1SE7 A;  3RX6 A;  3RKG A;  5CGM A;  3S4U A;  3AEF A;  3KV5 A;  4H9P C;  4KMC A;  4QKN A;  4QX8 B;  4YTN A;  5JDG A;  1BR2 A;  1IBM T;  1T98 A;  3AA0 B;  1OED A;  3LBX A;  5AQM B;  4ZEY A;  5JRC A;  4P09 A;  2XQ4 A;  2WDQ A;  2MYS A;  2WWV A;  4CI1 B;  4DV6 T;  2QA7 A;  2OLT A;  2LHR A;  2Z6E A;  3AE7 A;  4NUV A;  3C98 B;  4IDO A;  1IJ5 A;  5LXT E;  3OJA A;  3UUM A;  4PNI A;  5JDF A;  3JC6 D;  3WI3 A;  2KLQ A;  3A5X A;  3I9Y A;  1ZKE A;  5LG3 A;  3P4P A;  4DV0 T;  4DID B;  5HEJ A;  2M67 A;  4HWH A;  4DMW A;  5HYA A;  2YN6 A;  4V1A v;  2JMH A;  5FY7 A;  1XMQ T;  1AJ3 A;  4QXH B;  4ZI7 E;  5C8Y E;  3T8O A;  5LB7 B;  1WLX A;  2NTY A;  2C5J A;  1UK5 A;  4KI0 F;  5F3J A;  5LGN B;  1WYB A;  3I0O A;  4OFZ A;  4EZH A;  3FZF B;  2F4V T;  2UXD T;  1WR0 A;  4JI4 T;  3KV9 A;  2W2U A;  3F57 A;  3O1H A;  3RYC E;  4LML A;  3AXJ B;  2VUR A;  3M3Z B;  3PUX F;  4HFD A;  3FBZ A;  2ZLY A;  4DBR A;  3N9Q A;  4EV6 A;  2OA5 A;  3PTR B;  4LMK A;  1YQ3 A;  5BMV E;  5IHY A;  4DR7 T;  4TV9 E;  3UQ7 A;  3ZMZ B;  3O4X E;  4DV1 T;  5LJN A;  4AKR B;  3PUG A;  5CB4 E;  2QGS A;  2JQH A;  3TLS A;  5JDQ A;  4JI6 T;  4GKJ T;  1IBL T;  1LKX A;  2DHR A;  1ZEE A;  4U2Z A;  3A8Y C;  3GMI A;  4F6R C;  3ZPO A;  5CA1 E;  3H3A A;  4YTM A;  1Y64 B;  4X65 T;  2N9D A;  4P1N A;  2D9D A;  4EGW A;  2NW8 A;  1HF8 A;  2E2A A;  1ZOY A;  3NVO A;  4O2A E;  5DQV A;  2Q9Q C;  3RH3 A;  2RP4 A;  2V7K A;  4GOU A;  5ETW A;  3ZCJ A;  4LF4 T;  4GK0 E;  5L3D B;  4CI3 B;  5L47 A;  5FL1 A;  2K24 A;  4C90 A;  2LSI A;  4YLH A;  5ABG A;  3JAF A;  2W66 A;  4IIJ E;  5GON E;  4CXX A;  2Y8D A;  1ZP0 A;  4IDN A;  2IC6 A;  4HWC A;  4H9N C;  2JRK A;  2VVS A;  3HR0 A;  3QC9 A;  4MHC A;  4XAX B;  3VRB A;  3ZYK A;  3KIN B;  3ZT5 A;  3NRX A;  3LJC A;  1QLB A;  5H6Q B;  4EYY R;  2W62 A;  3ZJ2 A;  2X9H A;  5KDM C;  3P4W A;  3P8C D;  1EZ3 A;  3ZMS B;  3MK7 C;  3HKE E;  2CRB A;  5FXW A;  3ZLI A;  1X79 A;  2KT9 A;  3EAB A;  3WAJ A;  3RKO A;  3MAC A;  3TLV A;  2BKN A;  2VB6 A;  2H7V C;  4UF0 A;  2IHR 1;  4JI5 T;  3N9N A;  3RIA A;  2ZM8 A;  4EXT A;  1LVK A;  1E2A A;  2W0G A;  2BS2 A;  2ACZ A;  5AQK B;  3UUL A;  1NAF A;  3CWZ B;  3JAE A;  4JEU B;  4LFA T;  4PAG A;  1I94 T;  5IYZ E;  2YIN A;  3ZJ1 A;  4U74 A;  5LJM A;  4HWI B;  2V6Y A;  4B3M T;  4JI3 T;  1DU2 A;  1N34 T;  4OYK A;  1WRD A;  3LG7 A;  2FJA A;  2JQ9 A;  2VKD A;  4TNW A;  2XQA A;  3JCF A;  1KK7 A;  3KVB A;  4ASK A;  2XSB A;  5JR9 C;  2KWI B;  5J0Z A;  5LBQ B;  3VRA A;  5ABH A;  2XAG B;  3N2K E;  1IJ6 A;  2WCA A;  4JBW F;  4ZOL E;  5HEO A;  4TWH A;  4AKG A;  1UCU A;  3H37 A;  3JC6 C;  3T1Y T;  3UQ4 A;  4NPP A;  2ZM6 T;  2D2S A;  3HL6 A;  4JUY A;  3AE2 A;  3L8R A;  3OPC A;  4QH1 A;  4WBO A;  3BK9 A;  3TKL B;  5LMU T;  2CBI A;  1D1B A;  5L3E B;  2V8S V;  3ONL C;  2LM9 A;  3GA8 A;  1U5P A;  5M4Y A;  4EAH A;  2H3R A;  1HG5 A;  1SA0 E;  1FEW A;  5FVK A;  4AQF A;  3ZT6 A;  4CQI A;  1T7S A;  4C91 A;  5EK3 A;  2PTF A;  2AE9 A;  4L9I A;  3AE5 A;  5LMN T;  4L0R A;  2BKO A;  2XPK A;  3N9M A;  3GWH A;  2CPT A;  2FJD A;  3Q2M A;  5HEG A;  3NRY A;  3CX7 B;  2K5B B;  4YY3 T;  1HFA A;  5JR9 A;  3ZEF B;  3CX6 B;  2HH7 A;  2CLY C; 
#chains in the Genus database with same CATH homology
 1HNZ T;  1N32 T;  4JI0 T;  2UXC T;  5IWA T;  1IBM T;  4DR2 T;  4DV6 T;  4LF6 T;  4DV3 T;  4JI8 T;  4DV2 T;  4DV0 T;  4B3T T;  4DR5 T;  1XMQ T;  2HHH T;  4OX9 T;  4K0K T;  2UXD T;  2UU9 T;  4JI4 T;  4LF8 T;  1N33 T;  1IBK T;  4DV1 T;  2UXB T;  3T1H T;  4JI6 T;  1IBL T;  4B3S T;  1J5E T;  2UUB T;  4X66 T;  4X65 T;  1XMO T;  4KHP T;  4DR1 T;  4DV4 T;  4LF9 T;  4DV7 T;  2E5L T;  4LF4 T;  5BR8 T;  4JI1 T;  4JV5 T;  2VQF T;  4LF7 T;  1N36 T;  4DR4 T;  4JI7 T;  4LFB T;  2UUA T;  4DR6 T;  4YHH T;  4X62 T;  1HNX T;  4DV5 T;  2F4V T;  4JYA T;  4JI5 T;  4DR3 T;  4JI2 T;  4NXM T;  4DR7 T;  4GKJ T;  4X64 T;  4LFA T;  1I94 T;  4B3R T;  4B3M T;  4JI3 T;  1N34 T;  4GKK T;  4LF5 T;  1FJG T;  1HNW T;  3OTO T;  4DUY T;  3T1Y T;  2ZM6 T;  5LMU T;  1XNR T;  1HR0 T;  1XNQ T;  5LMN T;  2UUC T;  4NXN T;  2VQE T;  4YY3 T;  4DUZ T;  4LFC T;  4AQY T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...