4NXNT

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4nxnT00
4JI1T 4X66T 4LF9T 1HNWT 3T1YT 4LF7T 2UUCT 4KHPT 2UU9T 5LMNT 4NXNT 1IBMT 2HHHT 3OTOT 4DR2T 4DV4T 1FJGT 4DR1T 4DUYT 3T1HT 2UUAT 4DUZT 4DV6T 4X65T 4AQYT 4DV2T 4DV7T 1HNZT 2UUBT 4GKJT 1N32T 2UXCT 4B3MT 2VQET 4JI6T 2ZM6T 2VQFT 4DR5T 4B3ST 4DV1T 1XMOT 1IBKT 1XMQT 4LF8T 4LFCT 4JYAT 1XNRT 2E5LT 4DV5T 4JI4T 2UXDT 4DR7T 1IBLT 4JI2T 4YY3T 4LF4T 4DV3T 4DR6T 1J5ET 4YHHT 5IWAT 1HR0T 5LMUT 4DR3T 4JV5T 4LFAT 5BR8T 1HNXT 1N34T 4B3RT 4JI3T 4JI5T 4NXMT 1N33T 4DV0T 4LFBT 4JI7T 4GKKT 4X64T 4JI8T 4B3TT 4OX9T 4X62T 4DR4T 2F4VT 4JI0T 4LF5T 1N36T 4K0KT 1XNQT 4LF6T 1I94T 2UXBT
chains in the Genus database with same CATH superfamily
1WCRA 5AQHB 1X79A 2XPKA 1UK5A 2VKJA 2VWAA 3NBXX 3UUBA 4YFSA 4DMVA 5FVKA 1OEDB 3AA1B 3BQKA 2X9HA 2XHEB 2QYWA 2Z6EA 4DV4T 2BG9C 3CKDA 2W67A 3FZHB 3Q5DA 5H6RB 2E9XD 1QSDA 2XQ8A 2VQET 3M3ZB 2BBJA 4ZI3C 3TLVA 4BJNA 4U7YA 2SPCA 3C4ZA 4OHFA 4B3ST 3H3AA 3NRYA 1XMOT 4EOZB 2WAUA 3UU5A 5LCYA 4O2AE 2XAJB 1D0ZA 3Q9DA 5AQQB 3RIFA 4HFVA 3HKDE 1S94A 3TLTA 4DMWA 2W0GA 5LNKA 3P4WA 3VRBA 4EGWA 5LMUT 2V6XA 3RF1A 3ZSTA 4TWDA 4YXDA 3TKLB 2XZEA 3N9PA 1MIYA 4CN6A 1FMVA 4DV0T 3G06A 1W0AA 2VVSA 4GKKT 3UQ4A 2YDQA 4J2CA 2JQHA 4YHJA 3JADA 3JC6C 3I0QA 2D9DA 3EVYA 1BR4A 5ABGA 4KUMB 4AIUA 4G63A 5LJMA 2QRXA 4CN1A 3O4XE 3RRWA 2KNDA 2PTFA 5DABA 1WLXA 2V7KA 3ONLC 1W09A 2ES0A 2V5CA 5TAOA 2J1DG 2UUBT 5KDMC 2IMLA 5HWXA 3CVRA 4P1NA 3RIAA 4QH5A 2D0UA 1X9BA 2OLTA 4LFCT 2H88A 3WAKA 3KINB 4G2AA 2ZLYA 2KMFA 3MACA 3TLWA 4EYYR 2D2SA 5IYZE 1LVFA 5IWAT 4H9SE 2H3RA 4U2YA 4HEAA 1OEDA 4TUYE 2V7MA 3UUXB 2YU1A 3P4PA 4ISTA 3DTOA 5AQGB 2BVMA 2BG9B 3S4UA 3GN5B 3ZYLA 4UF0B 5EZYE 5CGMA 1MNEA 1XZYA 3SWHA 4WBNE 3K3NA 3N9LA 4YSXA 4KBMB 2KINB 2RP4A 5JDQA 5AQUB 3OTOT 4AKGA 5CB4E 3ONJA 2PBIA 5JDGA 2VL8A 2M67A 4OK0A 4HWIB 1QUUA 3GA8A 2NW7A 5JR9C 3PDYA 4TX5A 3RQUA 1KNRA 3LBXB 3E0ZA 2D5UA 4DV1T 1Y01A 1XMQT 2CHNA 2J62A 2NTYA 2UXDT 1HTJF 5LJNA 2KLQA 1WRDA 3AAEB 3KBTA 3BQLA 4A5XA 3HR0A 5FP3A 2BKOA 1MMAA 3L3PA 4YJ2E 3QC9A 3KVAA 4MALA 1HNXT 4U33A 4JI3T 4CXWA 2VURA 4N78D 3AEDA 3V5SA 1SE7A 3N9NA 2C0SA 4HFCA 2K9AA 4JEUB 3RGLA 4BAYB 2LLYA 3KDSE 1N36T 1UX4A 3X1DA 2D0TA 5HEOA 3CWZB 2KXPB 4L5GA 5JH7E 3PU3A 1US7B 2CCQA 5AQOB 3I9YA 4ZS3A 3UUMA 3U78A 2UXCT 2LSKA 2YDSA 2VL0A 3AVSA 5LG4A 4DVDA 1UCUA 3AE7A 2LM2A 3AEGA 3AA7B 4JBWF 2ZM6T 4JLEA 4UV9B 3VHLA 3KV5A 1WR0A 2BDEA 3OVUA 2KWIB 3TLSA 2WM9A 2FJDA 5C3JA 3B57A 4JI4T 3ZKRA 2BG9A 2QGSA 3PV0F 3GN5A 2XAFB 5FXZA 3HKCE 4WW0A 2QA7A 1B7TA 2E2AA 2CM0A 3ONXA 4DR6T 4NUUA 3AB3B 2ZM0A 2ZMAA 2LE8A 1WFDA 4KMCA 4UVCB 5HAXA 3UFGA 3CMLA 1JNRA 1GQEA 2PG8A 2DNXA 4LFBT 3ESLA 4GYRA 3V5UA 2W4XA 4WBOA 2LSGA 3AEFA 4HFIA 5HCJA 1DU2A 2UXXB 3FXDB 3K3QC 4K0KT 2N2NA 4M1PA 4YJ3E 3OKQA 5A1LA 2IAKA 1VCTA 2WBLA 4ERRA 5JR9B 5L3CB 4LMJA 5LGUB 1HG2A 4UR9A 4WYVA 2JQQA 1HFAA 1ZHCA 2LM9A 2WCAA 4X65T 2DHRA 2DWKA 3FB2A 4IT4A 2IHR1 3AE3A 4CI3B 4EB6E 2JPFA 5FXVA 3R6NA 4DR5T 5FYMA 2FJAA 3EABA 3JAEA 4ZS2A 1W9RA 2DLRA 4ZZBA 4HWFA 2W2UA 3ZJ2A 2E5LT 3KV9A 3QB5K 5LYJE 4IDZA 2M6IA 3B5MA 2CE7A 2MPKA 2EHOD 3UFEA 3SFDA 4HWDA 3H37A 3ZMTB 3ZC1A 1UUSA 2VB6A 4TZ4C 1BR1A 4OFZA 3OYZA 4HFBA 2WWVA 2WDRA 2I59A 2JIWA 5ABEA 3P4QA 2DWGA 1OXZA 4ILUA 2YK0A 5LB7B 4H9OC 2LSJA 3VR9A 3ABVA 3P8CD 4YTMA 4X66T 4PJNA 2X0LB 3T1YT 5J2TE 2V7LA 4HKAA 4KX6A 5EK4A 4ZXLA 4MBQA 2WMOA 4CXYA 3ZLIA 4ILBA 3O9XA 2WU2A 5AQSB 4GKJT 4AKRB 3AE4A 4B3MT 3C98B 5DJQC 3N2KE 4YSZA 3ZC0A 4AKLA 5HEUA 3LSVA 4E7SA 3OBVE 5FMNA 2ACXA 2XQ7A 3PUSA 2CBJA 4DV5T 3PUVF 2IIUA 3PUYF 1D0YA 2FUPA 5ADXL 4CZZB 2B1EA 2WWUA 1YQ4A 4IDPA 4ILAA 3IBPA 5FXWA 3RYCE 1MIWA 4UEMA 4EYUA 2LJLA 1IJ5A 4UVAB 4LMLA 4PFPA 4TV9E 4IE6A 4PW8A 3ZMSB 1J5WA 5JR9A 2WB5A 3AXJB 3LDQB 2WDQA 2ZM8A 3GWHA 3ANWA 2NR4A 5BMVE 3RC3A 4FJOA 4JI7T 1CUNA 2V5DA 5CA0E 4DR4T 1ZP0A 4TWFA 3F57A 1AJ3A 2X67A 2YOEA 2K5BB 3Q2MA 3ZYKA 2FBWA 5LHGB 4HWHA 4PAGA 1OEDE 5LMNT 4MFRA 3J7Yq 5LP6E 2LSYA 2MOZA 4EIWA 1HNZT 2HH7A 3RIUC 1Z0PA 2KSRA 4QKNA 3FZMB 4GYSA 2YKSA 2NOXA 2L8KA 2JMHA 4X1IE 1FEWA 5LBQB 1Y64B 2WDVA 4P0AA 4DBQA 3EHZA 2Q9QD 5JTGA 2DL1A 1ZEEA 3QOFA 4HE8A 2XM2A 5CJ5A 4DR3T 2QVAA 4JV5T 2ZM2A 3UU4A 4B3RT 3PUGA 4GK5E 3AE1A 4IE7A 1IZNB 3CIRA 1VCSA 4PK4A 4JI0T 2ODUA 5AQPB 4B6XA 4IIJE 3W15B 4AKIA 3C50A 4FI5A 1FJGT 4X20E 3A5XA 3HA4A 4ASKA 4QHOA 5KXJA 3DP7A 3CX7B 4QXHB 5LGTB 4LF7T 3E22E 3U3IA 1KFYA 2LKHA 1LVKA 3UU6A 4TV8E 5J0ZA 1ZKEA 3WAJA 4DV2T 2XSBA 3ETVA 1SA0E 3I0OA 2XAGB 4YLHA 3AXJA 5L3DB 1KF6A 5FY1A 4AISA 2G0UA 4AQGA 3KBUA 4JYAT 3SOLA 4DR7T 4EXTA 4XAXB 5L4EA 1NWMX 3KVBA 4WZXA 1CHUA 4HN9A 2WS3A 4MLKA 4EEDA 2WSSV 4ZOLE 2FJBA 4O8SA 4V1Av 2E9XC 2A3DA 4QX8B 4U3CA 1N33T 1NEKA 5HWYA 3P4SA 5LXTE 4H9RC 3FHNA 3AEBA 2C5KT 2WMNA 3AE9A 1MNDA 4ANJA 1T8BA 3ZCJA 3AAIA 3RX6A 5FNVE 1HNWT 2DCFA 4KHPT 3RYFE 2AE9A 2A9UA 2X66A 3SFEA 3P7IA 4F8HA 1SUMB 3ZT7A 3ZT5A 2CRBA 2YU2A 2UUAT 3PJAJ 4DV6T 5EK2A 5L3BB 3PUQA 1HX8A 4O4LE 2NW8A 5KX5E 2NTXA 3AECA 4YTNA 2A2FX 1XWMA 4JI6T 2V7IA 1M7KA 4YTPA 4OYKA 5LOVE 2DI4A 2PJQA 3ZN0B 3LK42 4IHJE 2XQYA 3B13A 3LG7A 3Q5WA 4ZHQE 4BA9A 4CI2B 2BZBA 1WR6A 1J5ET 2WZHA 3GMIA 1MIVA 2JRKA 2W62A 3J9X1 3PUXF 2IC6A 4X1YE 2VVNA 2HN2A 4LFAT 2CWYA 1UGOA 4UIGA 3VKGA 2Q9QC 5AQTB 3VU7H 5HXHA 4IGUA 4XZCA 4Q25A 3HKBE 5HXEA 3BK9A 4QXBB 5JRCB 2F4VT 4LF5T 3HL6A 2X9YA 2CLYC 3RYHE 3FXEB 3FZKB 3QB5A 3NWIA 4XBFB 2X0HA 4YSYA 5J2UE 5AQRB 4A97A 4ISSA 3N2OA 3EDVA 3EAMA 4DBRA 2I6HA 1OEDC 5JDMA 5FKYA 1EZ3A 4DR1T 2JMKA 1D0XA 4DUZT 5LA6E 4O4HE 1Z8UA 3DJBA 3QNUA 3O1JA 4ZI2D 4QWNB 3AVRA 5JDNA 4WNKA 1U5PA 2WP9A 3ANWB 1IBKT 4LF8T 2XASB 2E9XB 5HXRA 1XNRT 2BS4A 5L47A 1I6ZA 1LRZA 4HGAA 3QUJA 4O2BE 3RIUA 4U2ZA 4UELA 3AA6B 4UXNB 3R84B 3EUHA 1M62A 2LRKA 3F2EA 2C5IT 1FIOA 3PUZF 4IL9A 3M65A 3TLUA 4JI5T 4ZZCA 5JDHA 2Y6XA 4I55E 3ZPOA 4U74A 1BR2A 4OYJA 5KMGP 3NZQA 1D1CA 4X1KE 3A7MA 2VKOA 2WQYA 3N9OA 5LBMA 5JDLA 3VKHA 5HEGA 5AQLB 3ZYMA 5AQIB 2UXBT 4EZHA 1O3XA 4AI6A 3UT5E 1T72A 4JEHB 3OPCA 1UURA 2LKGA 4H63V 4I43B 5FVLA 3PTRB 2CXLA 2HHHT 4DR2T 5F3JA 5FY0A 1KEYA 2XQ5A 3FBZA 3CX8B 4IDNA 1HX1B 5AQMB 4Z90A 2CBIA 2LRLA 2CPTA 2V8SV 3ZEFB 4GK0E 3VRAA 4ZEYA 3AEAA 5J1GA 2Q9QB 3EDUA 5JRCA 2NW9A 4TWHA 3ETUA 3HI2A 5F8PA 4PK5A 4EV6A 4JI2T 5LHHB 1XDPA 1FMWA 4QXCB 1VOMA 1YXRA 1HR0T 4CN4A 3CK6A 5LG3A 3MK7C 3MA9A 2XQAA 3ZCIA 2LEHA 5CFBA 1YKHB 3K8PC 5FL0A 2I0MA 4HFEA 3CPZA 5ETWA 4NXMT 5IUXA 3UULA 4HFHA 3T8OA 2HPLA 3C51A 5AQJB 5CA1E 4X62T 4TNWA 2B76A 3L09A 2OV9A 5AQFB 2J4GA 3K1SA 1I94T 2XQ9A 4NPPA 3RQWA 4EEBA 3IA3A 2VASA 5EK3A 2E9XA 4KHZF 3FBLA 5DQWA 3KV4A 4HTEA 2BS2A 3LK3B 2BS3A 1XDOA 3N9MA 3QK6A 4PFOA 1KNZA 3HKEE 3NRXA 5E0OA 4H63H 3Q5XA 1HCIA 1S35A 4A98A 4GIWA 1YQ3A 4MHCA 2V6YA 2VK9A 5AQNB 4AQFC 5M4YA 1L0VA 3EI0A 4ZI2C 5HCMA 1YD8G 5IHYA 4IE0A 3MKDA 2K3WA 2YN6A 4LF4T 4QX7B 3P50A 1T98A 2PFVA 1ZOYA 2MBGA 1N34T 2LHRA 5HXCA 1T7SA 3MZKB 5HYAA 2LT3A 2Y48B 3BQIA 2IW5B 4IDQA 5FY7A 4PJMA 3JCFA 3N9QA 3F31A 4IE5A 2KZ7B 3WI3A 2LSIA 4H9PC 2WY2A 4CXXA 4JUYA 2N9DA 3KV6A 2GK9A 4LF9T 2CHOA 3LJCA 1BR0A 2UUCT 2IDOB 2Q9QA 3JAFA 3AE6A 2KT9A 4DIDB 1J1JA 2XY8B 2EHOC 3RKOA 3AAAB 2A72A 2NP9A 2XQ6A 4DV7T 5F5WA 2ACZA 4UV8B 3PUWF 1N32T 2FJEA 3MXZA 4PNIA 2M6BA 2CMRA 4F6RC 4DNDA 3MJXA 4DO0A 2H7OA 2MAWA 5L2LA 5HEJA 3RLFF 4ADZA 2IUBA 1H7CA 2OA5A 1VRBA 3KFWX 4EZ4A 5HXSA 1MMGA 1KK7A 2XQ3A 2CXDA 3PE0A 5AQVB 2LOPA 2P9BA 4CQIA 3AA0B 2CWOA 3ZSSA 4X5TA 2MYSA 3NKZA 1D1AA 4ZI7E 3UUNA 3RH3A 2X9XA 3RI5A 2JQ9A 3C64A 4PJLA 2KWHA 2W63A 1G8XA 2Y8DA 4A56A 4TN7B 1XNQT 4LF6T 5JVDE 1ZV4X 4UVBB 2W00A 4JI1T 3AEEA 3K3OA 2YEVC 3O1HA 3ZMZB 5LGNB 2UU9T 2X0YA 4NXNT 2X68A 4AXPA 1IBMT 2N1GA 2BG9E 4I4TE 5AQKB 4C90A 1IJ6A 3T1HT 1E2AA 2AXDS 2CXFA 1NENA 3I9WA 4O4IE 4U31A 1U4QA 2W61A 2BKNA 4H9NC 3LK2B 5HEHA 3RYIE 4E7ZA 2CEAA 4IE4A 3CQXC 3PU8A 3I1AA 4TNVA 3H3MA 2K48A 1IBLT 5FXXA 4HFDA 4LMKA 4L0RA 4KP3C 5JREA 2L3LA 2XJ7A 3N2GE 5L3EB 4I0UA 3PURA 3RHWA 3FZLB 5ABFB 1JNZA 2E8IA 4H9QC 5L4HA 1LKXA 3AE8A 5GONE 4L9IA 3NZPA 4JI8T 3OYXA 4P09A 1G73A 4NIQA 1W0BA 2EHOB 1IAPA 2XAHB 5AFUL 3RRCA 3A8YC 2XSAA 1V9DA 3SS1A 2X9WA 3IHRA 4AKHA 4CI1B 3PJAA 2MTQA 2YDRA 4BJMA 3VR8A 3O1IA 2R6GF 3CQGB 3ZMUB 3IF8B 3RC8A 5FL1A 4ZI3D 5JQGE 1MMNA 4P0BA 2VKHA 4QH4A 1D1BA 4YT0A 1OWAA 4O4JE 2XTLA 4Z91A 4HWCA 1UX5A 2V26A 4UF0A 3RPUA 1YKEB 3ZN1B 2VQFT 4K0UA 2RPAA 4U72A 3C4WA 3UU8A 1E7PA 3CX6B 1SHZC 3AE5A 5L3FB 3SRZA 3FZFB 2K24A 5C8YE 4PK6A 4YY3T 2VKDA 4DV3T 2XAQB 3UQ7A 3C4XA 2HN1A 3JC6D 4I50E 3ZT6A 5BR8T 4COFA 4AQFA 3LBXA 2E5VA 2C5JA 5C2TA 2BKPA 3Q5EA 2ODVA 2W66A 4Z8XA 2L9QA 3LFMA 4X64T 3PUAA 2RA1A 2IC9A 1KNPA 3IEEA 2YINA 3ZMVB 2XM1A 5DQVA 1MMDA 2V6YB 4GOUA 3E08A 4IDOA 1HS7A 4NUVA 5L3GB 2JJ9A 4PJJA 1HF8A 3UTKA 4DUYT 2LHNA 4AQYT 4QH1A 3UU3A 3N5LA 3OJAA 2X51A 3RKGA 4U7IA 1HG5A 2J47A 5ABFA 2H7VC 2WZIA 1QLBA 3L39A 1NAFA 2EHOA 1YW0A 5JDFA 3L8RA 4EAHA 2XQ4A 2LOSA 2HPJA 2XUEA 4C91A 2JQKA 4YHHT 3CQCB 2BBHA 3AE2A 1R8IA 4IREA 4KI0F 5ABHA 5H6QB 4ILCA 1WYCA 2WU5A 3ZJ1A 3D0TA 2BVLA 2NWBA 4IL4A 4B3TT 2V1DB 4OX9T 2V7JA 3P4RA 2CA5A 1E1HB 2CLYB 5LHIB 2UXNB 1WYBA 3NVOA 2H89A
chains in the Genus database with same CATH topology
4JI1T 4X66T 4LF9T 1HNWT 3T1YT 4LF7T 2UUCT 4KHPT 2UU9T 5LMNT 4NXNT 1IBMT 2HHHT 3OTOT 4DR2T 4DV4T 1FJGT 4DR1T 4DUYT 3T1HT 2UUAT 4DUZT 4DV6T 4X65T 4AQYT 4DV2T 4DV7T 1HNZT 2UUBT 4GKJT 1N32T 2UXCT 4B3MT 2VQET 4JI6T 2ZM6T 2VQFT 4DR5T 4B3ST 4DV1T 1XMOT 1IBKT 1XMQT 4LF8T 4LFCT 4JYAT 1XNRT 2E5LT 4DV5T 4JI4T 2UXDT 4DR7T 1IBLT 4JI2T 4YY3T 4LF4T 4DV3T 4DR6T 1J5ET 4YHHT 5IWAT 1HR0T 5LMUT 4DR3T 4JV5T 4LFAT 5BR8T 1HNXT 1N34T 4B3RT 4JI3T 4JI5T 4NXMT 1N33T 4DV0T 4LFBT 4JI7T 4GKKT 4X64T 4JI8T 4B3TT 4OX9T 4X62T 4DR4T 2F4VT 4JI0T 4LF5T 1N36T 4K0KT 1XNQT 4LF6T 1I94T 2UXBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 T;  4X66 T;  4LF9 T;  1HNW T;  3T1Y T;  4LF7 T;  2UUC T;  4KHP T;  2UU9 T;  5LMN T;  4NXN T;  1IBM T;  2HHH T;  3OTO T;  4DR2 T;  4DV4 T;  1FJG T;  4DR1 T;  4DUY T;  3T1H T;  2UUA T;  4DUZ T;  4DV6 T;  4X65 T;  4AQY T;  4DV2 T;  4DV7 T;  1HNZ T;  2UUB T;  4GKJ T;  1N32 T;  2UXC T;  4B3M T;  2VQE T;  4JI6 T;  2ZM6 T;  2VQF T;  4DR5 T;  4B3S T;  4DV1 T;  1XMO T;  1IBK T;  1XMQ T;  4LF8 T;  4LFC T;  4JYA T;  1XNR T;  2E5L T;  4DV5 T;  4JI4 T;  2UXD T;  4DR7 T;  1IBL T;  4JI2 T;  4YY3 T;  4LF4 T;  4DV3 T;  4DR6 T;  1J5E T;  4YHH T;  5IWA T;  1HR0 T;  5LMU T;  4DR3 T;  4JV5 T;  4LFA T;  5BR8 T;  1HNX T;  1N34 T;  4B3R T;  4JI3 T;  4JI5 T;  4NXM T;  1N33 T;  4DV0 T;  4LFB T;  4JI7 T;  4GKK T;  4X64 T;  4JI8 T;  4B3T T;  4OX9 T;  4X62 T;  4DR4 T;  2F4V T;  4JI0 T;  4LF5 T;  1N36 T;  4K0K T;  1XNQ T;  4LF6 T;  1I94 T;  2UXB T; 
#chains in the Genus database with same CATH topology
 1WCR A;  5AQH B;  1X79 A;  2XPK A;  1UK5 A;  2VKJ A;  2VWA A;  3NBX X;  3UUB A;  4YFS A;  4DMV A;  5FVK A;  1OED B;  3AA1 B;  3BQK A;  2X9H A;  2XHE B;  2QYW A;  2Z6E A;  4DV4 T;  2BG9 C;  3CKD A;  2W67 A;  3FZH B;  3Q5D A;  5H6R B;  2E9X D;  1QSD A;  2XQ8 A;  2VQE T;  3M3Z B;  2BBJ A;  4ZI3 C;  3TLV A;  4BJN A;  4U7Y A;  2SPC A;  3C4Z A;  4OHF A;  4B3S T;  3H3A A;  3NRY A;  1XMO T;  4EOZ B;  2WAU A;  3UU5 A;  5LCY A;  4O2A E;  2XAJ B;  1D0Z A;  3Q9D A;  5AQQ B;  3RIF A;  4HFV A;  3HKD E;  1S94 A;  3TLT A;  4DMW A;  2W0G A;  5LNK A;  3P4W A;  3VRB A;  4EGW A;  5LMU T;  2V6X A;  3RF1 A;  3ZST A;  4TWD A;  4YXD A;  3TKL B;  2XZE A;  3N9P A;  1MIY A;  4CN6 A;  1FMV A;  4DV0 T;  3G06 A;  1W0A A;  2VVS A;  4GKK T;  3UQ4 A;  2YDQ A;  4J2C A;  2JQH A;  4YHJ A;  3JAD A;  3JC6 C;  3I0Q A;  2D9D A;  3EVY A;  1BR4 A;  5ABG A;  4KUM B;  4AIU A;  4G63 A;  5LJM A;  2QRX A;  4CN1 A;  3O4X E;  3RRW A;  2KND A;  2PTF A;  5DAB A;  1WLX A;  2V7K A;  3ONL C;  1W09 A;  2ES0 A;  2V5C A;  5TAO A;  2J1D G;  2UUB T;  5KDM C;  2IML A;  5HWX A;  3CVR A;  4P1N A;  3RIA A;  4QH5 A;  2D0U A;  1X9B A;  2OLT A;  4LFC T;  2H88 A;  3WAK A;  3KIN B;  4G2A A;  2ZLY A;  2KMF A;  3MAC A;  3TLW A;  4EYY R;  2D2S A;  5IYZ E;  1LVF A;  5IWA T;  4H9S E;  2H3R A;  4U2Y A;  4HEA A;  1OED A;  4TUY E;  2V7M A;  3UUX B;  2YU1 A;  3P4P A;  4IST A;  3DTO A;  5AQG B;  2BVM A;  2BG9 B;  3S4U A;  3GN5 B;  3ZYL A;  4UF0 B;  5EZY E;  5CGM A;  1MNE A;  1XZY A;  3SWH A;  4WBN E;  3K3N A;  3N9L A;  4YSX A;  4KBM B;  2KIN B;  2RP4 A;  5JDQ A;  5AQU B;  3OTO T;  4AKG A;  5CB4 E;  3ONJ A;  2PBI A;  5JDG A;  2VL8 A;  2M67 A;  4OK0 A;  4HWI B;  1QUU A;  3GA8 A;  2NW7 A;  5JR9 C;  3PDY A;  4TX5 A;  3RQU A;  1KNR A;  3LBX B;  3E0Z A;  2D5U A;  4DV1 T;  1Y01 A;  1XMQ T;  2CHN A;  2J62 A;  2NTY A;  2UXD T;  1HTJ F;  5LJN A;  2KLQ A;  1WRD A;  3AAE B;  3KBT A;  3BQL A;  4A5X A;  3HR0 A;  5FP3 A;  2BKO A;  1MMA A;  3L3P A;  4YJ2 E;  3QC9 A;  3KVA A;  4MAL A;  1HNX T;  4U33 A;  4JI3 T;  4CXW A;  2VUR A;  4N78 D;  3AED A;  3V5S A;  1SE7 A;  3N9N A;  2C0S A;  4HFC A;  2K9A A;  4JEU B;  3RGL A;  4BAY B;  2LLY A;  3KDS E;  1N36 T;  1UX4 A;  3X1D A;  2D0T A;  5HEO A;  3CWZ B;  2KXP B;  4L5G A;  5JH7 E;  3PU3 A;  1US7 B;  2CCQ A;  5AQO B;  3I9Y A;  4ZS3 A;  3UUM A;  3U78 A;  2UXC T;  2LSK A;  2YDS A;  2VL0 A;  3AVS A;  5LG4 A;  4DVD A;  1UCU A;  3AE7 A;  2LM2 A;  3AEG A;  3AA7 B;  4JBW F;  2ZM6 T;  4JLE A;  4UV9 B;  3VHL A;  3KV5 A;  1WR0 A;  2BDE A;  3OVU A;  2KWI B;  3TLS A;  2WM9 A;  2FJD A;  5C3J A;  3B57 A;  4JI4 T;  3ZKR A;  2BG9 A;  2QGS A;  3PV0 F;  3GN5 A;  2XAF B;  5FXZ A;  3HKC E;  4WW0 A;  2QA7 A;  1B7T A;  2E2A A;  2CM0 A;  3ONX A;  4DR6 T;  4NUU A;  3AB3 B;  2ZM0 A;  2ZMA A;  2LE8 A;  1WFD A;  4KMC A;  4UVC B;  5HAX A;  3UFG A;  3CML A;  1JNR A;  1GQE A;  2PG8 A;  2DNX A;  4LFB T;  3ESL A;  4GYR A;  3V5U A;  2W4X A;  4WBO A;  2LSG A;  3AEF A;  4HFI A;  5HCJ A;  1DU2 A;  2UXX B;  3FXD B;  3K3Q C;  4K0K T;  2N2N A;  4M1P A;  4YJ3 E;  3OKQ A;  5A1L A;  2IAK A;  1VCT A;  2WBL A;  4ERR A;  5JR9 B;  5L3C B;  4LMJ A;  5LGU B;  1HG2 A;  4UR9 A;  4WYV A;  2JQQ A;  1HFA A;  1ZHC A;  2LM9 A;  2WCA A;  4X65 T;  2DHR A;  2DWK A;  3FB2 A;  4IT4 A;  2IHR 1;  3AE3 A;  4CI3 B;  4EB6 E;  2JPF A;  5FXV A;  3R6N A;  4DR5 T;  5FYM A;  2FJA A;  3EAB A;  3JAE A;  4ZS2 A;  1W9R A;  2DLR A;  4ZZB A;  4HWF A;  2W2U A;  3ZJ2 A;  2E5L T;  3KV9 A;  3QB5 K;  5LYJ E;  4IDZ A;  2M6I A;  3B5M A;  2CE7 A;  2MPK A;  2EHO D;  3UFE A;  3SFD A;  4HWD A;  3H37 A;  3ZMT B;  3ZC1 A;  1UUS A;  2VB6 A;  4TZ4 C;  1BR1 A;  4OFZ A;  3OYZ A;  4HFB A;  2WWV A;  2WDR A;  2I59 A;  2JIW A;  5ABE A;  3P4Q A;  2DWG A;  1OXZ A;  4ILU A;  2YK0 A;  5LB7 B;  4H9O C;  2LSJ A;  3VR9 A;  3ABV A;  3P8C D;  4YTM A;  4X66 T;  4PJN A;  2X0L B;  3T1Y T;  5J2T E;  2V7L A;  4HKA A;  4KX6 A;  5EK4 A;  4ZXL A;  4MBQ A;  2WMO A;  4CXY A;  3ZLI A;  4ILB A;  3O9X A;  2WU2 A;  5AQS B;  4GKJ T;  4AKR B;  3AE4 A;  4B3M T;  3C98 B;  5DJQ C;  3N2K E;  4YSZ A;  3ZC0 A;  4AKL A;  5HEU A;  3LSV A;  4E7S A;  3OBV E;  5FMN A;  2ACX A;  2XQ7 A;  3PUS A;  2CBJ A;  4DV5 T;  3PUV F;  2IIU A;  3PUY F;  1D0Y A;  2FUP A;  5ADX L;  4CZZ B;  2B1E A;  2WWU A;  1YQ4 A;  4IDP A;  4ILA A;  3IBP A;  5FXW A;  3RYC E;  1MIW A;  4UEM A;  4EYU A;  2LJL A;  1IJ5 A;  4UVA B;  4LML A;  4PFP A;  4TV9 E;  4IE6 A;  4PW8 A;  3ZMS B;  1J5W A;  5JR9 A;  2WB5 A;  3AXJ B;  3LDQ B;  2WDQ A;  2ZM8 A;  3GWH A;  3ANW A;  2NR4 A;  5BMV E;  3RC3 A;  4FJO A;  4JI7 T;  1CUN A;  2V5D A;  5CA0 E;  4DR4 T;  1ZP0 A;  4TWF A;  3F57 A;  1AJ3 A;  2X67 A;  2YOE A;  2K5B B;  3Q2M A;  3ZYK A;  2FBW A;  5LHG B;  4HWH A;  4PAG A;  1OED E;  5LMN T;  4MFR A;  3J7Y q;  5LP6 E;  2LSY A;  2MOZ A;  4EIW A;  1HNZ T;  2HH7 A;  3RIU C;  1Z0P A;  2KSR A;  4QKN A;  3FZM B;  4GYS A;  2YKS A;  2NOX A;  2L8K A;  2JMH A;  4X1I E;  1FEW A;  5LBQ B;  1Y64 B;  2WDV A;  4P0A A;  4DBQ A;  3EHZ A;  2Q9Q D;  5JTG A;  2DL1 A;  1ZEE A;  3QOF A;  4HE8 A;  2XM2 A;  5CJ5 A;  4DR3 T;  2QVA A;  4JV5 T;  2ZM2 A;  3UU4 A;  4B3R T;  3PUG A;  4GK5 E;  3AE1 A;  4IE7 A;  1IZN B;  3CIR A;  1VCS A;  4PK4 A;  4JI0 T;  2ODU A;  5AQP B;  4B6X A;  4IIJ E;  3W15 B;  4AKI A;  3C50 A;  4FI5 A;  1FJG T;  4X20 E;  3A5X A;  3HA4 A;  4ASK A;  4QHO A;  5KXJ A;  3DP7 A;  3CX7 B;  4QXH B;  5LGT B;  4LF7 T;  3E22 E;  3U3I A;  1KFY A;  2LKH A;  1LVK A;  3UU6 A;  4TV8 E;  5J0Z A;  1ZKE A;  3WAJ A;  4DV2 T;  2XSB A;  3ETV A;  1SA0 E;  3I0O A;  2XAG B;  4YLH A;  3AXJ A;  5L3D B;  1KF6 A;  5FY1 A;  4AIS A;  2G0U A;  4AQG A;  3KBU A;  4JYA T;  3SOL A;  4DR7 T;  4EXT A;  4XAX B;  5L4E A;  1NWM X;  3KVB A;  4WZX A;  1CHU A;  4HN9 A;  2WS3 A;  4MLK A;  4EED A;  2WSS V;  4ZOL E;  2FJB A;  4O8S A;  4V1A v;  2E9X C;  2A3D A;  4QX8 B;  4U3C A;  1N33 T;  1NEK A;  5HWY A;  3P4S A;  5LXT E;  4H9R C;  3FHN A;  3AEB A;  2C5K T;  2WMN A;  3AE9 A;  1MND A;  4ANJ A;  1T8B A;  3ZCJ A;  3AAI A;  3RX6 A;  5FNV E;  1HNW T;  2DCF A;  4KHP T;  3RYF E;  2AE9 A;  2A9U A;  2X66 A;  3SFE A;  3P7I A;  4F8H A;  1SUM B;  3ZT7 A;  3ZT5 A;  2CRB A;  2YU2 A;  2UUA T;  3PJA J;  4DV6 T;  5EK2 A;  5L3B B;  3PUQ A;  1HX8 A;  4O4L E;  2NW8 A;  5KX5 E;  2NTX A;  3AEC A;  4YTN A;  2A2F X;  1XWM A;  4JI6 T;  2V7I A;  1M7K A;  4YTP A;  4OYK A;  5LOV E;  2DI4 A;  2PJQ A;  3ZN0 B;  3LK4 2;  4IHJ E;  2XQY A;  3B13 A;  3LG7 A;  3Q5W A;  4ZHQ E;  4BA9 A;  4CI2 B;  2BZB A;  1WR6 A;  1J5E T;  2WZH A;  3GMI A;  1MIV A;  2JRK A;  2W62 A;  3J9X 1;  3PUX F;  2IC6 A;  4X1Y E;  2VVN A;  2HN2 A;  4LFA T;  2CWY A;  1UGO A;  4UIG A;  3VKG A;  2Q9Q C;  5AQT B;  3VU7 H;  5HXH A;  4IGU A;  4XZC A;  4Q25 A;  3HKB E;  5HXE A;  3BK9 A;  4QXB B;  5JRC B;  2F4V T;  4LF5 T;  3HL6 A;  2X9Y A;  2CLY C;  3RYH E;  3FXE B;  3FZK B;  3QB5 A;  3NWI A;  4XBF B;  2X0H A;  4YSY A;  5J2U E;  5AQR B;  4A97 A;  4ISS A;  3N2O A;  3EDV A;  3EAM A;  4DBR A;  2I6H A;  1OED C;  5JDM A;  5FKY A;  1EZ3 A;  4DR1 T;  2JMK A;  1D0X A;  4DUZ T;  5LA6 E;  4O4H E;  1Z8U A;  3DJB A;  3QNU A;  3O1J A;  4ZI2 D;  4QWN B;  3AVR A;  5JDN A;  4WNK A;  1U5P A;  2WP9 A;  3ANW B;  1IBK T;  4LF8 T;  2XAS B;  2E9X B;  5HXR A;  1XNR T;  2BS4 A;  5L47 A;  1I6Z A;  1LRZ A;  4HGA A;  3QUJ A;  4O2B E;  3RIU A;  4U2Z A;  4UEL A;  3AA6 B;  4UXN B;  3R84 B;  3EUH A;  1M62 A;  2LRK A;  3F2E A;  2C5I T;  1FIO A;  3PUZ F;  4IL9 A;  3M65 A;  3TLU A;  4JI5 T;  4ZZC A;  5JDH A;  2Y6X A;  4I55 E;  3ZPO A;  4U74 A;  1BR2 A;  4OYJ A;  5KMG P;  3NZQ A;  1D1C A;  4X1K E;  3A7M A;  2VKO A;  2WQY A;  3N9O A;  5LBM A;  5JDL A;  3VKH A;  5HEG A;  5AQL B;  3ZYM A;  5AQI B;  2UXB T;  4EZH A;  1O3X A;  4AI6 A;  3UT5 E;  1T72 A;  4JEH B;  3OPC A;  1UUR A;  2LKG A;  4H63 V;  4I43 B;  5FVL A;  3PTR B;  2CXL A;  2HHH T;  4DR2 T;  5F3J A;  5FY0 A;  1KEY A;  2XQ5 A;  3FBZ A;  3CX8 B;  4IDN A;  1HX1 B;  5AQM B;  4Z90 A;  2CBI A;  2LRL A;  2CPT A;  2V8S V;  3ZEF B;  4GK0 E;  3VRA A;  4ZEY A;  3AEA A;  5J1G A;  2Q9Q B;  3EDU A;  5JRC A;  2NW9 A;  4TWH A;  3ETU A;  3HI2 A;  5F8P A;  4PK5 A;  4EV6 A;  4JI2 T;  5LHH B;  1XDP A;  1FMW A;  4QXC B;  1VOM A;  1YXR A;  1HR0 T;  4CN4 A;  3CK6 A;  5LG3 A;  3MK7 C;  3MA9 A;  2XQA A;  3ZCI A;  2LEH A;  5CFB A;  1YKH B;  3K8P C;  5FL0 A;  2I0M A;  4HFE A;  3CPZ A;  5ETW A;  4NXM T;  5IUX A;  3UUL A;  4HFH A;  3T8O A;  2HPL A;  3C51 A;  5AQJ B;  5CA1 E;  4X62 T;  4TNW A;  2B76 A;  3L09 A;  2OV9 A;  5AQF B;  2J4G A;  3K1S A;  1I94 T;  2XQ9 A;  4NPP A;  3RQW A;  4EEB A;  3IA3 A;  2VAS A;  5EK3 A;  2E9X A;  4KHZ F;  3FBL A;  5DQW A;  3KV4 A;  4HTE A;  2BS2 A;  3LK3 B;  2BS3 A;  1XDO A;  3N9M A;  3QK6 A;  4PFO A;  1KNZ A;  3HKE E;  3NRX A;  5E0O A;  4H63 H;  3Q5X A;  1HCI A;  1S35 A;  4A98 A;  4GIW A;  1YQ3 A;  4MHC A;  2V6Y A;  2VK9 A;  5AQN B;  4AQF C;  5M4Y A;  1L0V A;  3EI0 A;  4ZI2 C;  5HCM A;  1YD8 G;  5IHY A;  4IE0 A;  3MKD A;  2K3W A;  2YN6 A;  4LF4 T;  4QX7 B;  3P50 A;  1T98 A;  2PFV A;  1ZOY A;  2MBG A;  1N34 T;  2LHR A;  5HXC A;  1T7S A;  3MZK B;  5HYA A;  2LT3 A;  2Y48 B;  3BQI A;  2IW5 B;  4IDQ A;  5FY7 A;  4PJM A;  3JCF A;  3N9Q A;  3F31 A;  4IE5 A;  2KZ7 B;  3WI3 A;  2LSI A;  4H9P C;  2WY2 A;  4CXX A;  4JUY A;  2N9D A;  3KV6 A;  2GK9 A;  4LF9 T;  2CHO A;  3LJC A;  1BR0 A;  2UUC T;  2IDO B;  2Q9Q A;  3JAF A;  3AE6 A;  2KT9 A;  4DID B;  1J1J A;  2XY8 B;  2EHO C;  3RKO A;  3AAA B;  2A72 A;  2NP9 A;  2XQ6 A;  4DV7 T;  5F5W A;  2ACZ A;  4UV8 B;  3PUW F;  1N32 T;  2FJE A;  3MXZ A;  4PNI A;  2M6B A;  2CMR A;  4F6R C;  4DND A;  3MJX A;  4DO0 A;  2H7O A;  2MAW A;  5L2L A;  5HEJ A;  3RLF F;  4ADZ A;  2IUB A;  1H7C A;  2OA5 A;  1VRB A;  3KFW X;  4EZ4 A;  5HXS A;  1MMG A;  1KK7 A;  2XQ3 A;  2CXD A;  3PE0 A;  5AQV B;  2LOP A;  2P9B A;  4CQI A;  3AA0 B;  2CWO A;  3ZSS A;  4X5T A;  2MYS A;  3NKZ A;  1D1A A;  4ZI7 E;  3UUN A;  3RH3 A;  2X9X A;  3RI5 A;  2JQ9 A;  3C64 A;  4PJL A;  2KWH A;  2W63 A;  1G8X A;  2Y8D A;  4A56 A;  4TN7 B;  1XNQ T;  4LF6 T;  5JVD E;  1ZV4 X;  4UVB B;  2W00 A;  4JI1 T;  3AEE A;  3K3O A;  2YEV C;  3O1H A;  3ZMZ B;  5LGN B;  2UU9 T;  2X0Y A;  4NXN T;  2X68 A;  4AXP A;  1IBM T;  2N1G A;  2BG9 E;  4I4T E;  5AQK B;  4C90 A;  1IJ6 A;  3T1H T;  1E2A A;  2AXD S;  2CXF A;  1NEN A;  3I9W A;  4O4I E;  4U31 A;  1U4Q A;  2W61 A;  2BKN A;  4H9N C;  3LK2 B;  5HEH A;  3RYI E;  4E7Z A;  2CEA A;  4IE4 A;  3CQX C;  3PU8 A;  3I1A A;  4TNV A;  3H3M A;  2K48 A;  1IBL T;  5FXX A;  4HFD A;  4LMK A;  4L0R A;  4KP3 C;  5JRE A;  2L3L A;  2XJ7 A;  3N2G E;  5L3E B;  4I0U A;  3PUR A;  3RHW A;  3FZL B;  5ABF B;  1JNZ A;  2E8I A;  4H9Q C;  5L4H A;  1LKX A;  3AE8 A;  5GON E;  4L9I A;  3NZP A;  4JI8 T;  3OYX A;  4P09 A;  1G73 A;  4NIQ A;  1W0B A;  2EHO B;  1IAP A;  2XAH B;  5AFU L;  3RRC A;  3A8Y C;  2XSA A;  1V9D A;  3SS1 A;  2X9W A;  3IHR A;  4AKH A;  4CI1 B;  3PJA A;  2MTQ A;  2YDR A;  4BJM A;  3VR8 A;  3O1I A;  2R6G F;  3CQG B;  3ZMU B;  3IF8 B;  3RC8 A;  5FL1 A;  4ZI3 D;  5JQG E;  1MMN A;  4P0B A;  2VKH A;  4QH4 A;  1D1B A;  4YT0 A;  1OWA A;  4O4J E;  2XTL A;  4Z91 A;  4HWC A;  1UX5 A;  2V26 A;  4UF0 A;  3RPU A;  1YKE B;  3ZN1 B;  2VQF T;  4K0U A;  2RPA A;  4U72 A;  3C4W A;  3UU8 A;  1E7P A;  3CX6 B;  1SHZ C;  3AE5 A;  5L3F B;  3SRZ A;  3FZF B;  2K24 A;  5C8Y E;  4PK6 A;  4YY3 T;  2VKD A;  4DV3 T;  2XAQ B;  3UQ7 A;  3C4X A;  2HN1 A;  3JC6 D;  4I50 E;  3ZT6 A;  5BR8 T;  4COF A;  4AQF A;  3LBX A;  2E5V A;  2C5J A;  5C2T A;  2BKP A;  3Q5E A;  2ODV A;  2W66 A;  4Z8X A;  2L9Q A;  3LFM A;  4X64 T;  3PUA A;  2RA1 A;  2IC9 A;  1KNP A;  3IEE A;  2YIN A;  3ZMV B;  2XM1 A;  5DQV A;  1MMD A;  2V6Y B;  4GOU A;  3E08 A;  4IDO A;  1HS7 A;  4NUV A;  5L3G B;  2JJ9 A;  4PJJ A;  1HF8 A;  3UTK A;  4DUY T;  2LHN A;  4AQY T;  4QH1 A;  3UU3 A;  3N5L A;  3OJA A;  2X51 A;  3RKG A;  4U7I A;  1HG5 A;  2J47 A;  5ABF A;  2H7V C;  2WZI A;  1QLB A;  3L39 A;  1NAF A;  2EHO A;  1YW0 A;  5JDF A;  3L8R A;  4EAH A;  2XQ4 A;  2LOS A;  2HPJ A;  2XUE A;  4C91 A;  2JQK A;  4YHH T;  3CQC B;  2BBH A;  3AE2 A;  1R8I A;  4IRE A;  4KI0 F;  5ABH A;  5H6Q B;  4ILC A;  1WYC A;  2WU5 A;  3ZJ1 A;  3D0T A;  2BVL A;  2NWB A;  4IL4 A;  4B3T T;  2V1D B;  4OX9 T;  2V7J A;  3P4R A;  2CA5 A;  1E1H B;  2CLY B;  5LHI B;  2UXN B;  1WYB A;  3NVO A;  2H89 A; 
#chains in the Genus database with same CATH homology
 4JI1 T;  4X66 T;  4LF9 T;  1HNW T;  3T1Y T;  4LF7 T;  2UUC T;  4KHP T;  2UU9 T;  5LMN T;  4NXN T;  1IBM T;  2HHH T;  3OTO T;  4DR2 T;  4DV4 T;  1FJG T;  4DR1 T;  4DUY T;  3T1H T;  2UUA T;  4DUZ T;  4DV6 T;  4X65 T;  4AQY T;  4DV2 T;  4DV7 T;  1HNZ T;  2UUB T;  4GKJ T;  1N32 T;  2UXC T;  4B3M T;  2VQE T;  4JI6 T;  2ZM6 T;  2VQF T;  4DR5 T;  4B3S T;  4DV1 T;  1XMO T;  1IBK T;  1XMQ T;  4LF8 T;  4LFC T;  4JYA T;  1XNR T;  2E5L T;  4DV5 T;  4JI4 T;  2UXD T;  4DR7 T;  1IBL T;  4JI2 T;  4YY3 T;  4LF4 T;  4DV3 T;  4DR6 T;  1J5E T;  4YHH T;  5IWA T;  1HR0 T;  5LMU T;  4DR3 T;  4JV5 T;  4LFA T;  5BR8 T;  1HNX T;  1N34 T;  4B3R T;  4JI3 T;  4JI5 T;  4NXM T;  1N33 T;  4DV0 T;  4LFB T;  4JI7 T;  4GKK T;  4X64 T;  4JI8 T;  4B3T T;  4OX9 T;  4X62 T;  4DR4 T;  2F4V T;  4JI0 T;  4LF5 T;  1N36 T;  4K0K T;  1XNQ T;  4LF6 T;  1I94 T;  2UXB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...