2LSYA

Structure of the c-terminal domain from human rev1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords DNA repair protein REV1
total genus 35
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsyA00
2LSJA 2LSIA 4GK0E 3VU7H 4GK5E 2LSKA 4BA9A 2LSYA 2LSGA 2N1GA 4FJOA 4EXTA
chains in the Genus database with same CATH superfamily
1LVKA 1I6ZA 2K24A 3ZKRA 5JDNA 2BVMA 3F2EA 4CXYA 5BR8T 4JI4T 4O4LE 1D1AA 5JR9A 2YDQA 2WS3A 4AKRB 1AJ3A 2V7JA 1T8BA 3U78A 2FUPA 3A8YC 4HFIA 3RPUA 3JADA 3NZQA 2KWHA 1E2AA 2LOPA 4EV6A 4L5GA 5AQGB 2E9XA 2ZMAA 2XHEB 3C51A 4HTEA 4YT0A 2OLTA 2W61A 1NEKA 4DV2T 4QHOA 2IDOB 3VR8A 2JRKA 3P4WA 5KX5E 4AKGA 3AVRA 2KSRA 4X1YE 2K3WA 2EHOC 2C0SA 2A72A 2YEVC 3PU3A 4OK0A 2N2NA 4UV8B 3U3IA 3ZJ2A 2XASB 1KNPA 4GKJT 2VKJA 1M62A 3AEBA 1R8IA 4DUZT 2CXFA 2CWOA 3S4UA 4LFCT 2I59A 4JUYA 4NIQA 1UURA 4QX7B 4CXXA 3SFEA 2J47A 2ZM0A 2BS3A 5HEUA 2Y48B 4UR9A 3FZKB 3N2GE 2J1DG 4LFBT 2LSJA 2WZHA 1X9BA 4EOZB 3RH3A 5AQFB 3CPZA 2KLQA 2PBIA 2WDRA 2E9XD 2XM1A 3ONXA 1YW0A 2XAHB 3OJAA 4IE6A 2CM0A 3C50A 2B76A 4MALA 2RP4A 4G63A 4BJMA 5HYAA 1T72A 1HS7A 3KVAA 3NKZA 3DP7A 4U7YA 1FJGT 4PJNA 2VK9A 3EHZA 2YINA 5HCJA 2IIUA 3ZN0B 4PJMA 2UXDT 4LMKA 4DV3T 4LFAT 4ZZBA 2CXDA 2KNDA 4IE7A 5HXRA 2HHHT 3UU8A 4LF4T 1LRZA 2ES0A 3K3QC 2WWUA 2MAWA 2ACXA 4A56A 3P4SA 3ZCJA 3L8RA 5TAOA 2WY2A 2Y6XA 2YK0A 3P8CD 2D5UA 3UUNA 3P4RA 4DR5T 2LKGA 2E9XB 3NRXA 1VCSA 4YTMA 3OTOT 1J5ET 3ESLA 4U2YA 2XQYA 4P0AA 1M7KA 2JQKA 1BR4A 5H6RB 3CWZB 1YQ3A 2ACZA 2DNXA 3PUXF 2X9XA 4HWFA 4EEDA 2JQHA 3HI2A 5M4YA 5F5WA 2BKNA 5LA6E 2X68A 4IDZA 1G73A 2JIWA 4UIGA 1XWMA 2H88A 3NRYA 4U33A 4F6RC 2HPJA 1YXRA 2E5VA 3RYHE 3IHRA 4LF6T 3AB3B 3PE0A 4H63V 4TWHA 4XZCA 2C5KT 3PUSA 2VVSA 2V1DB 4HWDA 2LM2A 4U74A 5JQGE 2VASA 3FBZA 1KNZA 2LOSA 3L3PA 2DHRA 2CCQA 3AE9A 4KUMB 3AA1B 5L4HA 3UU6A 3AEDA 3N2OA 1UGOA 4DV5T 2BVLA 5KDMC 4BAYB 1UCUA 1V9DA 2IMLA 3NBXX 3P7IA 4HFCA 3W15B 3OPCA 4B3ST 1KK7A 1XNQT 3VKGA 2WZIA 5DQVA 5JDLA 1Y01A 3Q5EA 2NR4A 3NZPA 3Q5WA 2LSKA 3VR9A 2CRBA 1B7TA 2XQ6A 5FY7A 1XDPA 5HXHA 3IA3A 4DR4T 1D1CA 1N32T 4CXWA 4TUYE 4XAXB 5LOVE 3LK3B 5AFUL 1IJ6A 4I43B 2WWVA 3LBXA 3EUHA 5L3BB 3PUVF 4JI7T 4JV5T 5LCYA 2XQ3A 5IYZE 3C4XA 4YSYA 1U5PA 1WRDA 3UULA 4DVDA 1MIWA 3AEGA 4TWDA 4YSXA 4GK5E 5J0ZA 3HKEE 3AXJB 4UVBB 1W09A 1MMGA 3BQIA 5HEGA 3AE8A 2CLYB 5HEOA 4OHFA 1W9RA 1HG2A 2XSBA 2XZEA 3K8PC 5LGTB 2ZM6T 4V1Av 2X67A 4ZEYA 3RLFF 5LJNA 2BZBA 3CQXC 2W67A 3L39A 3CQCB 3ZT6A 2JQQA 2QVAA 2Y8DA 1GQEA 3E0ZA 3H3MA 4HWCA 5LYJE 3AE6A 4TWFA 2X0YA 3KDSE 3Q9DA 2XQ8A 4TV9E 3RX6A 3PJAA 2FBWA 5LP6E 1N33T 3RC3A 1US7B 3PUQA 5ABEA 5F3JA 5IUXA 4Z8XA 3KINB 4GIWA 1OWAA 4ILUA 5L3DB 3LG7A 2YOEA 3PV0F 2MTQA 4MLKA 2IC6A 2X0LB 2V7MA 3FZFB 3HL6A 5AQQB 3V5SA 2BBHA 5HXEA 2CE7A 2AE9A 2PFVA 2WDVA 3LK2B 2D9DA 3AXJA 1FMVA 4ZS3A 3TKLB 4BA9A 2V5DA 4IE4A 4A98A 3BQLA 2D0UA 5LHHB 3MXZA 3PUWF 3ZYMA 3I0QA 2W62A 1WFDA 4O4IE 5CA0E 4X64T 2JPFA 4UEMA 1D1BA 5JR9B 4X65T 1J1JA 4BJNA 3FBLA 5AQSB 1D0YA 2V7LA 2LM9A 3E08A 3CX7B 3M65A 1OEDE 3CIRA 2LEHA 2UXXB 4GYRA 3TLTA 3ZT5A 3TLWA 5AQKB 5C3JA 4JI3T 3ZMUB 3UQ4A 1CUNA 1NENA 5ABFA 2ZM8A 3VHLA 3RRCA 4HWIB 3P4QA 4J2CA 3I9WA 2VKHA 4PW8A 4QWNB 2C5IT 2YKSA 3ZT7A 1XMOT 5L3EB 1HCIA 2CMRA 4MHCA 4ZI2D 3A5XA 2ZLYA 3CKDA 4O2AE 2CPTA 3LJCA 5AQUB 5IWAT 5LMNT 4A97A 5L4EA 1OXZA 4H63H 2JQ9A 3RHWA 4JI0T 2XPKA 1OEDC 3KV6A 4IDOA 2SPCA 4L9IA 4AXPA 4EZHA 2L8KA 3H3AA 3N9NA 4U2ZA 3ZMZB 2NW7A 4AISA 1IBKT 1KF6A 3J7Yq 4HGAA 2V6YA 2VKDA 4IL9A 4DR2T 3AA6B 3RIUC 3KVBA 2BKPA 5AQTB 3MJXA 2I0MA 3O1IA 4K0KT 5JRCB 4IREA 3SFDA 5HXSA 3GMIA 2IAKA 4IDPA 4QH1A 2IW5B 4WW0A 3BK9A 2YDSA 2KZ7B 3AEFA 2XQ5A 3HKCE 4GKKT 2WU2A 2X9HA 4ADZA 2FJAA 3OYZA 3QC9A 3UU3A 2J4GA 4CZZB 3UTKA 1JNRA 5HEJA 1VCTA 3MZKB 3PTRB 5AQNB 4JI8T 2H7VC 2IC9A 2XQAA 3QB5K 4WYVA 2NW9A 3TLUA 5HXCA 4TNWA 2YDRA 3FZHB 4X5TA 3K3NA 3ZLIA 5EK2A 2F4VT 1HF8A 5JDGA 4LF8T 4B6XA 3PDYA 4O4HE 4EB6E 3SWHA 1Y64B 2CXLA 4HN9A 2BG9A 2N1GA 3F57A 3AEAA 4KP3C 1YKHB 3N9PA 3LDQB 2WBLA 4X1IE 3OKQA 1YD8G 5LB7B 2GK9A 3UFEA 1G8XA 3EABA 2KWIB 1N36T 3IF8B 4EYUA 4L0RA 3GA8A 4QH5A 3ZYKA 4FI5A 3UU4A 4DNDA 3ZN1B 2XTLA 4B3TT 3C4ZA 4PAGA 5EZYE 1IBMT 3AEEA 1YQ4A 2XAJB 1Z0PA 2CHNA 2LSYA 4JEUB 2WDQA 3NVOA 4YFSA 4DR7T 1HX8A 3FZMB 3J9X1 1ZKEA 4YLHA 2A2FX 3CMLA 5LG3A 3C64A 4E7SA 3B13A 1UX4A 4DIDB 2LJLA 4NXMT 3EAMA 4IDQA 3P4PA 5FXXA 1CHUA 4DO0A 1QLBA 3PUYF 4PK4A 5FMNA 1T7SA 1OEDA 3DTOA 3PUZF 4ZS2A 3RYIE 2UXCT 2BBJA 2Q9QA 2BS4A 2LSIA 1XDOA 4C91A 3L09A 4ZXLA 4ASKA 4EYYR 2WM9A 4FJOA 1SE7A 2W4XA 4PFOA 3QOFA 4TZ4C 4CN1A 2W66A 4JI5T 2JMHA 5DJQC 2LHRA 2WMOA 1YKEB 3KBTA 3KV5A 2QA7A 1IBLT 2UU9T 2V26A 3AE7A 4H9NC 4UXNB 4ERRA 2MPKA 3O1HA 3JAEA 1EZ3A 2K9AA 2Q9QB 3AA0B 4U72A 5ETWA 4DBRA 3UQ7A 2G0UA 4Z90A 4CQIA 3VKHA 1BR0A 4LMLA 5LGNB 2DL1A 2PTFA 3F31A 1I94T 3PJAJ 3QNUA 4QH4A 3ZMTB 5J2TE 1S94A 3AA7B 5L3GB 2R6GF 1O3XA 2UUAT 4YHHT 4IGUA 3N9LA 5AQVB 3RIFA 3AE3A 3O1JA 3T1HT 3HKBE 2M6IA 1MMNA 2BG9E 1ZEEA 2L3LA 2X9WA 3M3ZB 4NUUA 4UF0B 4ZI7E 4DBQA 1BR2A 1UUSA 1ZOYA 3IBPA 1HFAA 4IT4A 5ABGA 3FXEB 4HEAA 4AQFA 3AAIA 2V6YB 5ADXL 5FL1A 3NWIA 3FZLB 4DR1T 1N34T 2ODVA 3AE2A 3HR0A 5HEHA 1T98A 3JAFA 3ZYLA 2C5JA 5LG4A 5LJMA 2LRLA 4TX5A 4YSZA 3ANWA 4OFZA 4ZI3D 4K0UA 4AQGA 5FXZA 2VKOA 2FJBA 5LBMA 2DLRA 2XQ4A 1WR0A 3JCFA 4ZHQE 2BG9B 3ONJA 2L9QA 4HKAA 3UU5A 1XMQT 1UK5A 2XAGB 4UELA 2MOZA 3AAEB 2WP9A 4CI2B 2XQ7A 2LLYA 2WSSV 2YU1A 4AQFC 4PK6A 2WB5A 2V7IA 1U4QA 4GYSA 1WYCA 5FXWA 3ZPOA 4CI3B 5LGUB 2E9XC 1MMAA 1OEDB 5FP3A 4DV1T 2PG8A 4EZ4A 2CLYC 1UX5A 5CA1E 1L0VA 4I0UA 1HNWT 4EAHA 1J5WA 3TLVA 2HN1A 2QYWA 4EXTA 5FKYA 5L47A 2UUCT 3QB5A 4HFHA 4DV7T 2YN6A 3FHNA 4C90A 4YJ3E 4P1NA 5LNKA 3FB2A 5F8PA 3RQUA 3MKDA 3Q5DA 2OV9A 2P9BA 2E8IA 2DI4A 2KINB 1FIOA 4EGWA 5CGMA 4DR3T 2HPLA 5GONE 1BR1A 3ZCIA 5L3CB 2W00A 3WAJA 3X1DA 3ETVA 5L3FB 4KX6A 2NTXA 3EVYA 4OYKA 4YJ2E 2LHNA 5DABA 3ZJ1A 4LF7T 3RC8A 1LKXA 2XY8B 3RQWA 2KMFA 4H9SE 5AQHB 3ZMSB 3RKOA 3VRAA 4COFA 3E22E 3K1SA 2D2SA 5JDMA 3OVUA 1IZNB 2K5BB 5IHYA 2A3DA 2B1EA 1WYBA 2WCAA 2LRKA 3AE1A 3BQKA 4PJJA 4UVAB 3I9YA 4M1PA 4WBOA 2IHR1 4CI1B 3AECA 3ANWB 1LVFA 1NAFA 2QGSA 4AI6A 3ZSSA 1SHZC 2BDEA 4PFPA 4WNKA 1QSDA 4WBNE 1ZP0A 3RIAA 4U7IA 3FXDB 1D0ZA 2YU2A 4GOUA 4CN6A 4QXHB 1W0AA 2FJEA 4DV4T 4JEHB 2NTYA 4JBWF 4JYAT 2UUBT 4EIWA 4IIJE 5JTGA 1E1HB 2RA1A 3MK7C 1MNEA 4EEBA 2MBGA 4UV9B 4O4JE 2J62A 3N5LA 3PU8A 4HFEA 1KFYA 4TNVA 4ZOLE 5EK3A 4YTNA 3R84B 1JNZA 1KNRA 5HWYA 1QUUA 2VB6A 3B5MA 3V5UA 4CN4A 3UUXB 1FMWA 4ZZCA 4KHPT 3ONLC 4JI6T 2WAUA 3Q5XA 4HE8A 4F8HA 3UT5E 4NXNT 2VL0A 3PUGA 4LF9T 1X79A 2CEAA 4WZXA 5AQJB 2Q9QD 1MNDA 5KXJA 4GK0E 4X20E 5H6QB 3RYCE 3OYXA 2ZM2A 4AKHA 2DWKA 3N2KE 2NP9A 1H7CA 2XQ9A 4ANJA 5JDQA 5JDHA 3PURA 2W0GA 4HFBA 1D0XA 5LMUT 3MA9A 4TV8E 5JVDE 3ETUA 3QUJA 4E7ZA 5C8YE 4P0BA 4JI1T 4IL4A 3I1AA 4A5XA 4O2BE 3MACA 5JREA 3H37A 2VURA 4ILBA 2CWYA 1KEYA 4ILCA 5AQMB 4IDNA 2AXDS 3CVRA 3N9QA 2BKOA 2XUEA 5JR9C 4AQYT 4DMVA 4PNIA 2XJ7A 4B3MT 5JRCA 5FY1A 2N9DA 2VWAA 3GWHA 3RI5A 1HG5A 4KMCA 4Z91A 3AE5A 4H9QC 4QKNA 3RF1A 3UUBA 4DMWA 3RIUA 4YY3T 4AKIA 5LXTE 4X1KE 2VL8A 3KFWX 1FEWA 4ISSA 5BMVE 1IAPA 2D0TA 3RGLA 4AKLA 5E0OA 2VQFT 3C98B 4NPPA 4DR6T 4KI0F 4LF5T 1HNXT 5JDFA 4DV0T 5AQIB 3CQGB 4TN7B 3D0TA 1MIVA 2EHOB 4ZI3C 3VU7H 2VQET 2K48A 3HKDE 1HX1B 5C2TA 2DWGA 3IEEA 4OYJA 2M67A 4O8SA 2H89A 2X9YA 2RPAA 5AQLB 4MFRA 4PJLA 2CBJA 4ISTA 2UXNB 2WQYA 3EDVA 3UUMA 5LHGB 1HNZT 4IE5A 2XSAA 2WMNA 3EI0A 2W63A 3VRBA 2KT9A 4ZI2C 4X66T 3RKGA 4HWHA 5AQRB 5FXVA 4JI2T 3WAKA 2JMKA 4LMJA 2JJ9A 2DCFA 2H7OA 4HFVA 3ZEFB 5ABHA 2FJDA 3DJBA 1SA0E 3PUAA 3SRZA 4UVCB 2M6BA 3KV9A 2A9UA 5EK4A 2LSGA 1ZV4X 2LKHA 3C4WA 2XM2A 5KMGP 1Z8UA 3GN5B 3AAAB 2E5LT 3AVSA 3QK6A 2H3RA 3K3OA 1WR6A 2X51A 3CX6B 4QXBB 5FYMA 3ZMVB 5J2UE 1HR0T 2VVNA 3Q2MA 3R6NA 3CX8B 4X62T 4YTPA 2KXPB 4H9OC 4U3CA 2BG9C 3RYFE 5L2LA 4B3RT 1MMDA 4I50E 4H9RC 4AIUA 3AE4A 2V5CA 2EHOD 2NWBA 2V6XA 3KV4A 5JH7E 4I4TE 5CB4E 2XAFB 4DV6T 2Q9QC 3A7MA 5CJ5A 4U31A 3GN5A 3ABVA 3OBVE 1DU2A 2QRXA 3CK6A 3T8OA 2CBIA 4YXDA 2IUBA 2X0HA 1HTJF 4IE0A 3HA4A 3ZSTA 4MBQA 2V7KA 3G06A 1MIYA 1XZYA 4JLEA 2CHOA 2LE8A 2HH7A 3JC6D 4Q25A 4DUYT 2E2AA 5HWXA 5DQWA 2V8SV 5FY0A 3RRWA 4PK5A 2MYSA 3ZC1A 5A1LA 3LBXB 4ILAA 1WLXA 3LK42 5FNVE 2CA5A 1W0BA 4N78D 2I6HA 3ZC0A 2HN2A 1VOMA 4H9PC 4G2AA 2NW8A 3I0OA 4YHJA 4IHJE 3JC6C 2NOXA 2Z6EA 3B57A 4KHZF 3LSVA 5CFBA 4QX8B 3LFMA 1E7PA 5HAXA 3KBUA 2WU5A 3TLSA 4QXCB 3SS1A 1SUMB 3N9OA 5LHIB 5HCMA 3UFGA 2EHOA 2UXBT 5J1GA 2OA5A 4NUVA 5FVKA 4P09A 1XNRT 2W2UA 1VRBA 4XBFB 3O9XA 5AQPB 2ODUA 5AQOB 1ZHCA 3SOLA 4OX9T 1WCRA 4HFDA 1S35A 2X66A 3EDUA 2PJQA 4I55E 3T1YT 3N9MA 5FL0A 2LT3A 3O4XE 2XAQB 3WI3A 5ABFB 5FVLA 2BS2A 1IJ5A 1NWMX 3P50A 4UF0A 4KBMB 5LBQB
chains in the Genus database with same CATH topology
1LVKA 2K24A 5JDNA 2BVMA 3F2EA 4CXYA 4O4LE 1D1AA 5JR9A 4AKRB 1AJ3A 2V7JA 3U78A 3RPUA 3NZQA 2KWHA 2LOPA 4L5GA 2E9XA 2ZMAA 2XHEB 3C51A 4HTEA 2W61A 4QHOA 2JRKA 5KX5E 4AKGA 3AVRA 4X1YE 2EHOC 2C0SA 2A72A 2YEVC 3PU3A 4OK0A 2N2NA 4UV8B 3U3IA 3ZJ2A 2XASB 2VKJA 2CXFA 2CWOA 3S4UA 2I59A 4JUYA 4QX7B 4CXXA 2ZM0A 2Y48B 3N2GE 2J1DG 2LSJA 4EOZB 3RH3A 3CPZA 2KLQA 2PBIA 3ONXA 2E9XD 3OJAA 4IE6A 1YW0A 2XAHB 5LA6E 5HYAA 2CM0A 3C50A 4MALA 4BJMA 2RP4A 4G63A 1HS7A 3KVAA 3DP7A 4PJNA 2VK9A 2YINA 4PJMA 2CXDA 2KNDA 4IE7A 5HXRA 1LRZA 2ES0A 3K3QC 2WWUA 4A56A 2ACXA 3ZCJA 5TAOA 2Y6XA 2YK0A 3P8CD 2D5UA 3UUNA 2E9XB 3NRXA 3ESLA 2XQYA 4P0AA 5H6RB 1BR4A 3CWZB 2DNXA 2X9XA 5M4YA 3HI2A 2X68A 4IDZA 1G73A 4UIGA 4F6RC 3NRYA 2HPJA 3RYHE 3IHRA 3AB3B 3PE0A 4H63V 4XZCA 2C5KT 3PUSA 2V1DB 4U74A 5JQGE 1KNZA 2VASA 3FBZA 2LOSA 3L3PA 2DHRA 2CCQA 4KUMB 3AA1B 3N2OA 2BVLA 5KDMC 1UCUA 1V9DA 3P7IA 3NBXX 3W15B 1KK7A 3VKGA 5DQVA 5JDLA 3NZPA 3Q5WA 2LSKA 1B7TA 5FY7A 5HXHA 1D1CA 4CXWA 4TUYE 4XAXB 5LOVE 3LK3B 5AFUL 1IJ6A 4I43B 3LBXA 3EUHA 5L3BB 5LCYA 5IYZE 5JREA 3C4XA 1U5PA 1WRDA 3UULA 4DVDA 1MIWA 4GK5E 3HKEE 4UVBB 1MMGA 3BQIA 2CLYB 4OHFA 3K8PC 1HG2A 5LGTB 4V1Av 2X67A 5LJNA 2BZBA 3CQXC 3CQCB 2JQQA 2Y8DA 3E0ZA 5LYJE 3KDSE 3Q9DA 4TV9E 5LP6E 3RX6A 3RC3A 1US7B 3PUQA 5F3JA 4Z8XA 3KINB 4GIWA 1OWAA 4ILUA 5L3DB 3LG7A 4MLKA 2MTQA 2IC6A 2X0LB 2V7MA 3HL6A 3V5SA 5HXEA 2CE7A 2PFVA 4ZS3A 3LK2B 4BA9A 3TKLB 1FMVA 4IE4A 3BQLA 2D0UA 5LHHB 3MXZA 3ZYMA 3I0QA 2W62A 4O4IE 5CA0E 2JPFA 4UEMA 1D1BA 5JR9B 4BJNA 3FBLA 1D0YA 2V7LA 2LM9A 3E08A 3CX7B 3M65A 2LEHA 2UXXB 4GYRA 3ZMUB 1CUNA 2ZM8A 3VHLA 3RRCA 4J2CA 3I9WA 2VKHA 4PW8A 4QWNB 2C5IT 5L3EB 1HCIA 2CMRA 4MHCA 4ZI2D 3A5XA 2ZLYA 3CKDA 4O2AE 3LJCA 1OXZA 4H63H 4EZHA 4L9IA 3KV6A 2SPCA 4AXPA 2L8KA 3H3AA 3N9NA 3ZMZB 2NW7A 3J7Yq 4HGAA 2VKDA 3AA6B 3KVBA 3MJXA 3O1IA 5JRCB 5HXSA 3GMIA 2IAKA 2IW5B 4WW0A 3BK9A 2KZ7B 3HKCE 2X9HA 4ADZA 3OYZA 3QC9A 4CZZB 3UTKA 3MZKB 3PTRB 2H7VC 2IC9A 2NW9A 5HXCA 5EK2A 3K3NA 3ZLIA 1HF8A 5JDGA 4B6XA 3PDYA 4O4HE 4EB6E 3SWHA 1Y64B 2CXLA 4HN9A 3F57A 2N1GA 4KP3C 1YKHB 3N9PA 4X1IE 2WBLA 3OKQA 1YD8G 2GK9A 3UFEA 1G8XA 2KWIB 3IF8B 4EYUA 4L0RA 3GA8A 3ZYKA 4FI5A 4DNDA 3ZN1B 2XTLA 3C4ZA 4PAGA 5EZYE 4JEUB 2XAJB 1Z0PA 2LSYA 4YFSA 1HX8A 3J9X1 1ZKEA 4YLHA 2A2FX 3CMLA 3C64A 4E7SA 3B13A 1UX4A 2LJLA 5FXXA 4DO0A 4PK4A 5FMNA 3DTOA 3RYIE 4ZS2A 2Q9QA 2LSIA 4C91A 3L09A 4ASKA 4EYYR 2WM9A 4FJOA 4PFOA 4TZ4C 2JMHA 5DJQC 2LHRA 2WMOA 1YKEB 3KBTA 3KV5A 2QA7A 2V26A 4H9NC 4UXNB 4ERRA 3O1HA 4DBRA 1EZ3A 2K9AA 2Q9QB 3AA0B 4U72A 5ETWA 2G0UA 4CQIA 3VKHA 1BR0A 5LGNB 3F31A 3ZMTB 5J2TE 1S94A 3AA7B 5L3GB 1O3XA 4IGUA 3N9LA 3O1JA 3HKBE 1MMNA 4ZI7E 1ZEEA 2L3LA 2X9WA 4NUUA 4UF0B 4DBQA 1BR2A 3IBPA 1HFAA 5ADXL 3FXEB 4HEAA 4AQFA 3AAIA 2ODVA 3HR0A 5LJMA 1T98A 3ZYLA 2C5JA 5LG4A 4TX5A 4ZI3D 3ANWA 4OFZA 4K0UA 4AQGA 5FXZA 2VKOA 5LBMA 2DLRA 4ZHQE 2L9QA 4HKAA 2XAGB 4UELA 2MOZA 3AAEB 4CI2B 2WSSV 2YU1A 4AQFC 4PK6A 2V7IA 1U4QA 4GYSA 1WYCA 5FXWA 3ZPOA 4CI3B 5LGUB 2E9XC 1MMAA 5FP3A 2PG8A 4EZ4A 2CLYC 1UX5A 5CA1E 4EAHA 4EXTA 4C90A 3FHNA 5LNKA 4YJ3E 3FB2A 5F8PA 3ZN0B 3MKDA 2P9BA 2E8IA 2DI4A 2KINB 1FIOA 2HPLA 5GONE 1BR1A 3ZCIA 5L3CB 2W00A 3WAJA 3ETVA 5L3FB 2NTXA 3EVYA 4OYKA 4YJ2E 2LHNA 5DABA 3ZJ1A 3RC8A 1LKXA 3ZMSB 2KMFA 4H9SE 5JDMA 3RKOA 3E22E 2D2SA 1IZNB 2K5BB 5IHYA 2A3DA 2B1EA 1WYBA 3BQKA 4PJJA 4WBOA 4UVAB 4BAYB 4CI1B 3I9YA 4M1PA 3ANWB 1LVFA 1NAFA 2QGSA 4AI6A 1SHZC 2BDEA 4PFPA 4WNKA 1QSDA 4WBNE 3FXDB 1D0ZA 2YU2A 4GOUA 4QXHB 4JEHB 2NTYA 4EIWA 4IIJE 1E1HB 2RA1A 3MK7C 1MNEA 2MBGA 4UV9B 4O4JE 3N5LA 3PU8A 5EK3A 4ZOLE 3R84B 5HWYA 1QUUA 2VB6A 3V5UA 3UUXB 1FMWA 2WAUA 3Q5XA 4HE8A 3UT5E 3PUGA 1X79A 2CEAA 2Q9QD 1MNDA 4GK0E 4X20E 5H6QB 3RYCE 3OYXA 2ZM2A 4AKHA 2DWKA 3N2KE 2NP9A 1H7CA 4ANJA 5JDQA 5JDHA 3PURA 2W0GA 1D0XA 3MA9A 4TV8E 5JVDE 3ETUA 3QUJA 4E7ZA 5C8YE 4P0BA 3I1AA 4O2BE 3MACA 3H37A 2CWYA 3CVRA 3N9QA 2XUEA 5JR9C 4DMVA 4PNIA 5JRCA 5FY1A 2N9DA 2VWAA 3GWHA 1HG5A 4KMCA 4H9QC 4QKNA 4DMWA 4AKIA 5LXTE 4X1KE 2VL8A 3KFWX 1FEWA 4ISSA 5BMVE 1IAPA 2D0TA 4AKLA 5E0OA 3C98B 5JDFA 3CQGB 4TN7B 3D0TA 1MIVA 2EHOB 4ZI3C 3VU7H 2K48A 3HKDE 2DWGA 3IEEA 4OYJA 2M67A 4O8SA 2X9YA 4MFRA 4PJLA 4ISTA 2UXNB 3UUMA 3EDVA 5LHGB 4IE5A 2WMNA 2W63A 2KT9A 4ZI2C 3WAKA 5FXVA 2JMKA 2JJ9A 2DCFA 2H7OA 4HFVA 3ZEFB 3DJBA 1SA0E 3PUAA 3SRZA 4UVCB 5EK4A 3KV9A 2LSGA 1ZV4X 3C4WA 5KMGP 3GN5B 3AAAB 3AVSA 3QK6A 2H3RA 3K3OA 1WR6A 2X51A 3CX6B 4QXBB 5FYMA 3ZMVB 5J2UE 3Q2MA 3R6NA 3CX8B 2KXPB 4H9OC 3RYFE 5L2LA 1MMDA 4I50E 4H9RC 2EHOD 2NWBA 3KV4A 5JH7E 4I4TE 5CB4E 2XAFB 2Q9QC 3GN5A 3OBVE 3T8OA 1HTJF 4IE0A 3HA4A 4MBQA 2V7KA 1MIYA 4JLEA 2LE8A 2HH7A 3JC6D 5HWXA 5DQWA 5FY0A 3RRWA 4PK5A 2MYSA 3ZC1A 5A1LA 3LBXB 1WLXA 3LK42 5FNVE 2CA5A 4N78D 3ZC0A 1VOMA 4H9PC 4G2AA 2NW8A 3I0OA 4YHJA 4IHJE 3JC6C 2NOXA 2Z6EA 3B57A 4QX8B 3LFMA 5HAXA 3KBUA 5LHIB 4QXCB 3SS1A 3N9OA 2EHOA 5J1GA 2OA5A 4NUVA 4P09A 1VRBA 4XBFB 3O9XA 2ODUA 1ZHCA 3SOLA 1S35A 2X66A 3EDUA 2PJQA 4I55E 3N9MA 2LT3A 3O4XE 2XAQB 3WI3A 4UF0A 1IJ5A 1NWMX 4KBMB 5LBQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSJ A;  2LSI A;  4GK0 E;  3VU7 H;  4GK5 E;  2LSK A;  4BA9 A;  2LSY A;  2LSG A;  2N1G A;  4FJO A;  4EXT A; 
#chains in the Genus database with same CATH topology
 1LVK A;  1I6Z A;  2K24 A;  3ZKR A;  5JDN A;  2BVM A;  3F2E A;  4CXY A;  5BR8 T;  4JI4 T;  4O4L E;  1D1A A;  5JR9 A;  2YDQ A;  2WS3 A;  4AKR B;  1AJ3 A;  2V7J A;  1T8B A;  3U78 A;  2FUP A;  3A8Y C;  4HFI A;  3RPU A;  3JAD A;  3NZQ A;  2KWH A;  1E2A A;  2LOP A;  4EV6 A;  4L5G A;  5AQG B;  2E9X A;  2ZMA A;  2XHE B;  3C51 A;  4HTE A;  4YT0 A;  2OLT A;  2W61 A;  1NEK A;  4DV2 T;  4QHO A;  2IDO B;  3VR8 A;  2JRK A;  3P4W A;  5KX5 E;  4AKG A;  3AVR A;  2KSR A;  4X1Y E;  2K3W A;  2EHO C;  2C0S A;  2A72 A;  2YEV C;  3PU3 A;  4OK0 A;  2N2N A;  4UV8 B;  3U3I A;  3ZJ2 A;  2XAS B;  1KNP A;  4GKJ T;  2VKJ A;  1M62 A;  3AEB A;  1R8I A;  4DUZ T;  2CXF A;  2CWO A;  3S4U A;  4LFC T;  2I59 A;  4JUY A;  4NIQ A;  1UUR A;  4QX7 B;  4CXX A;  3SFE A;  2J47 A;  2ZM0 A;  2BS3 A;  5HEU A;  2Y48 B;  4UR9 A;  3FZK B;  3N2G E;  2J1D G;  4LFB T;  2LSJ A;  2WZH A;  1X9B A;  4EOZ B;  3RH3 A;  5AQF B;  3CPZ A;  2KLQ A;  2PBI A;  2WDR A;  2E9X D;  2XM1 A;  3ONX A;  1YW0 A;  2XAH B;  3OJA A;  4IE6 A;  2CM0 A;  3C50 A;  2B76 A;  4MAL A;  2RP4 A;  4G63 A;  4BJM A;  5HYA A;  1T72 A;  1HS7 A;  3KVA A;  3NKZ A;  3DP7 A;  4U7Y A;  1FJG T;  4PJN A;  2VK9 A;  3EHZ A;  2YIN A;  5HCJ A;  2IIU A;  3ZN0 B;  4PJM A;  2UXD T;  4LMK A;  4DV3 T;  4LFA T;  4ZZB A;  2CXD A;  2KND A;  4IE7 A;  5HXR A;  2HHH T;  3UU8 A;  4LF4 T;  1LRZ A;  2ES0 A;  3K3Q C;  2WWU A;  2MAW A;  2ACX A;  4A56 A;  3P4S A;  3ZCJ A;  3L8R A;  5TAO A;  2WY2 A;  2Y6X A;  2YK0 A;  3P8C D;  2D5U A;  3UUN A;  3P4R A;  4DR5 T;  2LKG A;  2E9X B;  3NRX A;  1VCS A;  4YTM A;  3OTO T;  1J5E T;  3ESL A;  4U2Y A;  2XQY A;  4P0A A;  1M7K A;  2JQK A;  1BR4 A;  5H6R B;  3CWZ B;  1YQ3 A;  2ACZ A;  2DNX A;  3PUX F;  2X9X A;  4HWF A;  4EED A;  2JQH A;  3HI2 A;  5M4Y A;  5F5W A;  2BKN A;  5LA6 E;  2X68 A;  4IDZ A;  1G73 A;  2JIW A;  4UIG A;  1XWM A;  2H88 A;  3NRY A;  4U33 A;  4F6R C;  2HPJ A;  1YXR A;  2E5V A;  3RYH E;  3IHR A;  4LF6 T;  3AB3 B;  3PE0 A;  4H63 V;  4TWH A;  4XZC A;  2C5K T;  3PUS A;  2VVS A;  2V1D B;  4HWD A;  2LM2 A;  4U74 A;  5JQG E;  2VAS A;  3FBZ A;  1KNZ A;  2LOS A;  3L3P A;  2DHR A;  2CCQ A;  3AE9 A;  4KUM B;  3AA1 B;  5L4H A;  3UU6 A;  3AED A;  3N2O A;  1UGO A;  4DV5 T;  2BVL A;  5KDM C;  4BAY B;  1UCU A;  1V9D A;  2IML A;  3NBX X;  3P7I A;  4HFC A;  3W15 B;  3OPC A;  4B3S T;  1KK7 A;  1XNQ T;  3VKG A;  2WZI A;  5DQV A;  5JDL A;  1Y01 A;  3Q5E A;  2NR4 A;  3NZP A;  3Q5W A;  2LSK A;  3VR9 A;  2CRB A;  1B7T A;  2XQ6 A;  5FY7 A;  1XDP A;  5HXH A;  3IA3 A;  4DR4 T;  1D1C A;  1N32 T;  4CXW A;  4TUY E;  4XAX B;  5LOV E;  3LK3 B;  5AFU L;  1IJ6 A;  4I43 B;  2WWV A;  3LBX A;  3EUH A;  5L3B B;  3PUV F;  4JI7 T;  4JV5 T;  5LCY A;  2XQ3 A;  5IYZ E;  3C4X A;  4YSY A;  1U5P A;  1WRD A;  3UUL A;  4DVD A;  1MIW A;  3AEG A;  4TWD A;  4YSX A;  4GK5 E;  5J0Z A;  3HKE E;  3AXJ B;  4UVB B;  1W09 A;  1MMG A;  3BQI A;  5HEG A;  3AE8 A;  2CLY B;  5HEO A;  4OHF A;  1W9R A;  1HG2 A;  2XSB A;  2XZE A;  3K8P C;  5LGT B;  2ZM6 T;  4V1A v;  2X67 A;  4ZEY A;  3RLF F;  5LJN A;  2BZB A;  3CQX C;  2W67 A;  3L39 A;  3CQC B;  3ZT6 A;  2JQQ A;  2QVA A;  2Y8D A;  1GQE A;  3E0Z A;  3H3M A;  4HWC A;  5LYJ E;  3AE6 A;  4TWF A;  2X0Y A;  3KDS E;  3Q9D A;  2XQ8 A;  4TV9 E;  3RX6 A;  3PJA A;  2FBW A;  5LP6 E;  1N33 T;  3RC3 A;  1US7 B;  3PUQ A;  5ABE A;  5F3J A;  5IUX A;  4Z8X A;  3KIN B;  4GIW A;  1OWA A;  4ILU A;  5L3D B;  3LG7 A;  2YOE A;  3PV0 F;  2MTQ A;  4MLK A;  2IC6 A;  2X0L B;  2V7M A;  3FZF B;  3HL6 A;  5AQQ B;  3V5S A;  2BBH A;  5HXE A;  2CE7 A;  2AE9 A;  2PFV A;  2WDV A;  3LK2 B;  2D9D A;  3AXJ A;  1FMV A;  4ZS3 A;  3TKL B;  4BA9 A;  2V5D A;  4IE4 A;  4A98 A;  3BQL A;  2D0U A;  5LHH B;  3MXZ A;  3PUW F;  3ZYM A;  3I0Q A;  2W62 A;  1WFD A;  4O4I E;  5CA0 E;  4X64 T;  2JPF A;  4UEM A;  1D1B A;  5JR9 B;  4X65 T;  1J1J A;  4BJN A;  3FBL A;  5AQS B;  1D0Y A;  2V7L A;  2LM9 A;  3E08 A;  3CX7 B;  3M65 A;  1OED E;  3CIR A;  2LEH A;  2UXX B;  4GYR A;  3TLT A;  3ZT5 A;  3TLW A;  5AQK B;  5C3J A;  4JI3 T;  3ZMU B;  3UQ4 A;  1CUN A;  1NEN A;  5ABF A;  2ZM8 A;  3VHL A;  3RRC A;  4HWI B;  3P4Q A;  4J2C A;  3I9W A;  2VKH A;  4PW8 A;  4QWN B;  2C5I T;  2YKS A;  3ZT7 A;  1XMO T;  5L3E B;  1HCI A;  2CMR A;  4MHC A;  4ZI2 D;  3A5X A;  2ZLY A;  3CKD A;  4O2A E;  2CPT A;  3LJC A;  5AQU B;  5IWA T;  5LMN T;  4A97 A;  5L4E A;  1OXZ A;  4H63 H;  2JQ9 A;  3RHW A;  4JI0 T;  2XPK A;  1OED C;  3KV6 A;  4IDO A;  2SPC A;  4L9I A;  4AXP A;  4EZH A;  2L8K A;  3H3A A;  3N9N A;  4U2Z A;  3ZMZ B;  2NW7 A;  4AIS A;  1IBK T;  1KF6 A;  3J7Y q;  4HGA A;  2V6Y A;  2VKD A;  4IL9 A;  4DR2 T;  3AA6 B;  3RIU C;  3KVB A;  2BKP A;  5AQT B;  3MJX A;  2I0M A;  3O1I A;  4K0K T;  5JRC B;  4IRE A;  3SFD A;  5HXS A;  3GMI A;  2IAK A;  4IDP A;  4QH1 A;  2IW5 B;  4WW0 A;  3BK9 A;  2YDS A;  2KZ7 B;  3AEF A;  2XQ5 A;  3HKC E;  4GKK T;  2WU2 A;  2X9H A;  4ADZ A;  2FJA A;  3OYZ A;  3QC9 A;  3UU3 A;  2J4G A;  4CZZ B;  3UTK A;  1JNR A;  5HEJ A;  1VCT A;  3MZK B;  3PTR B;  5AQN B;  4JI8 T;  2H7V C;  2IC9 A;  2XQA A;  3QB5 K;  4WYV A;  2NW9 A;  3TLU A;  5HXC A;  4TNW A;  2YDR A;  3FZH B;  4X5T A;  3K3N A;  3ZLI A;  5EK2 A;  2F4V T;  1HF8 A;  5JDG A;  4LF8 T;  4B6X A;  3PDY A;  4O4H E;  4EB6 E;  3SWH A;  1Y64 B;  2CXL A;  4HN9 A;  2BG9 A;  2N1G A;  3F57 A;  3AEA A;  4KP3 C;  1YKH B;  3N9P A;  3LDQ B;  2WBL A;  4X1I E;  3OKQ A;  1YD8 G;  5LB7 B;  2GK9 A;  3UFE A;  1G8X A;  3EAB A;  2KWI B;  1N36 T;  3IF8 B;  4EYU A;  4L0R A;  3GA8 A;  4QH5 A;  3ZYK A;  4FI5 A;  3UU4 A;  4DND A;  3ZN1 B;  2XTL A;  4B3T T;  3C4Z A;  4PAG A;  5EZY E;  1IBM T;  3AEE A;  1YQ4 A;  2XAJ B;  1Z0P A;  2CHN A;  2LSY A;  4JEU B;  2WDQ A;  3NVO A;  4YFS A;  4DR7 T;  1HX8 A;  3FZM B;  3J9X 1;  1ZKE A;  4YLH A;  2A2F X;  3CML A;  5LG3 A;  3C64 A;  4E7S A;  3B13 A;  1UX4 A;  4DID B;  2LJL A;  4NXM T;  3EAM A;  4IDQ A;  3P4P A;  5FXX A;  1CHU A;  4DO0 A;  1QLB A;  3PUY F;  4PK4 A;  5FMN A;  1T7S A;  1OED A;  3DTO A;  3PUZ F;  4ZS2 A;  3RYI E;  2UXC T;  2BBJ A;  2Q9Q A;  2BS4 A;  2LSI A;  1XDO A;  4C91 A;  3L09 A;  4ZXL A;  4ASK A;  4EYY R;  2WM9 A;  4FJO A;  1SE7 A;  2W4X A;  4PFO A;  3QOF A;  4TZ4 C;  4CN1 A;  2W66 A;  4JI5 T;  2JMH A;  5DJQ C;  2LHR A;  2WMO A;  1YKE B;  3KBT A;  3KV5 A;  2QA7 A;  1IBL T;  2UU9 T;  2V26 A;  3AE7 A;  4H9N C;  4UXN B;  4ERR A;  2MPK A;  3O1H A;  3JAE A;  1EZ3 A;  2K9A A;  2Q9Q B;  3AA0 B;  4U72 A;  5ETW A;  4DBR A;  3UQ7 A;  2G0U A;  4Z90 A;  4CQI A;  3VKH A;  1BR0 A;  4LML A;  5LGN B;  2DL1 A;  2PTF A;  3F31 A;  1I94 T;  3PJA J;  3QNU A;  4QH4 A;  3ZMT B;  5J2T E;  1S94 A;  3AA7 B;  5L3G B;  2R6G F;  1O3X A;  2UUA T;  4YHH T;  4IGU A;  3N9L A;  5AQV B;  3RIF A;  3AE3 A;  3O1J A;  3T1H T;  3HKB E;  2M6I A;  1MMN A;  2BG9 E;  1ZEE A;  2L3L A;  2X9W A;  3M3Z B;  4NUU A;  4UF0 B;  4ZI7 E;  4DBQ A;  1BR2 A;  1UUS A;  1ZOY A;  3IBP A;  1HFA A;  4IT4 A;  5ABG A;  3FXE B;  4HEA A;  4AQF A;  3AAI A;  2V6Y B;  5ADX L;  5FL1 A;  3NWI A;  3FZL B;  4DR1 T;  1N34 T;  2ODV A;  3AE2 A;  3HR0 A;  5HEH A;  1T98 A;  3JAF A;  3ZYL A;  2C5J A;  5LG4 A;  5LJM A;  2LRL A;  4TX5 A;  4YSZ A;  3ANW A;  4OFZ A;  4ZI3 D;  4K0U A;  4AQG A;  5FXZ A;  2VKO A;  2FJB A;  5LBM A;  2DLR A;  2XQ4 A;  1WR0 A;  3JCF A;  4ZHQ E;  2BG9 B;  3ONJ A;  2L9Q A;  4HKA A;  3UU5 A;  1XMQ T;  1UK5 A;  2XAG B;  4UEL A;  2MOZ A;  3AAE B;  2WP9 A;  4CI2 B;  2XQ7 A;  2LLY A;  2WSS V;  2YU1 A;  4AQF C;  4PK6 A;  2WB5 A;  2V7I A;  1U4Q A;  4GYS A;  1WYC A;  5FXW A;  3ZPO A;  4CI3 B;  5LGU B;  2E9X C;  1MMA A;  1OED B;  5FP3 A;  4DV1 T;  2PG8 A;  4EZ4 A;  2CLY C;  1UX5 A;  5CA1 E;  1L0V A;  4I0U A;  1HNW T;  4EAH A;  1J5W A;  3TLV A;  2HN1 A;  2QYW A;  4EXT A;  5FKY A;  5L47 A;  2UUC T;  3QB5 A;  4HFH A;  4DV7 T;  2YN6 A;  3FHN A;  4C90 A;  4YJ3 E;  4P1N A;  5LNK A;  3FB2 A;  5F8P A;  3RQU A;  3MKD A;  3Q5D A;  2OV9 A;  2P9B A;  2E8I A;  2DI4 A;  2KIN B;  1FIO A;  4EGW A;  5CGM A;  4DR3 T;  2HPL A;  5GON E;  1BR1 A;  3ZCI A;  5L3C B;  2W00 A;  3WAJ A;  3X1D A;  3ETV A;  5L3F B;  4KX6 A;  2NTX A;  3EVY A;  4OYK A;  4YJ2 E;  2LHN A;  5DAB A;  3ZJ1 A;  4LF7 T;  3RC8 A;  1LKX A;  2XY8 B;  3RQW A;  2KMF A;  4H9S E;  5AQH B;  3ZMS B;  3RKO A;  3VRA A;  4COF A;  3E22 E;  3K1S A;  2D2S A;  5JDM A;  3OVU A;  1IZN B;  2K5B B;  5IHY A;  2A3D A;  2B1E A;  1WYB A;  2WCA A;  2LRK A;  3AE1 A;  3BQK A;  4PJJ A;  4UVA B;  3I9Y A;  4M1P A;  4WBO A;  2IHR 1;  4CI1 B;  3AEC A;  3ANW B;  1LVF A;  1NAF A;  2QGS A;  4AI6 A;  3ZSS A;  1SHZ C;  2BDE A;  4PFP A;  4WNK A;  1QSD A;  4WBN E;  1ZP0 A;  3RIA A;  4U7I A;  3FXD B;  1D0Z A;  2YU2 A;  4GOU A;  4CN6 A;  4QXH B;  1W0A A;  2FJE A;  4DV4 T;  4JEH B;  2NTY A;  4JBW F;  4JYA T;  2UUB T;  4EIW A;  4IIJ E;  5JTG A;  1E1H B;  2RA1 A;  3MK7 C;  1MNE A;  4EEB A;  2MBG A;  4UV9 B;  4O4J E;  2J62 A;  3N5L A;  3PU8 A;  4HFE A;  1KFY A;  4TNV A;  4ZOL E;  5EK3 A;  4YTN A;  3R84 B;  1JNZ A;  1KNR A;  5HWY A;  1QUU A;  2VB6 A;  3B5M A;  3V5U A;  4CN4 A;  3UUX B;  1FMW A;  4ZZC A;  4KHP T;  3ONL C;  4JI6 T;  2WAU A;  3Q5X A;  4HE8 A;  4F8H A;  3UT5 E;  4NXN T;  2VL0 A;  3PUG A;  4LF9 T;  1X79 A;  2CEA A;  4WZX A;  5AQJ B;  2Q9Q D;  1MND A;  5KXJ A;  4GK0 E;  4X20 E;  5H6Q B;  3RYC E;  3OYX A;  2ZM2 A;  4AKH A;  2DWK A;  3N2K E;  2NP9 A;  1H7C A;  2XQ9 A;  4ANJ A;  5JDQ A;  5JDH A;  3PUR A;  2W0G A;  4HFB A;  1D0X A;  5LMU T;  3MA9 A;  4TV8 E;  5JVD E;  3ETU A;  3QUJ A;  4E7Z A;  5C8Y E;  4P0B A;  4JI1 T;  4IL4 A;  3I1A A;  4A5X A;  4O2B E;  3MAC A;  5JRE A;  3H37 A;  2VUR A;  4ILB A;  2CWY A;  1KEY A;  4ILC A;  5AQM B;  4IDN A;  2AXD S;  3CVR A;  3N9Q A;  2BKO A;  2XUE A;  5JR9 C;  4AQY T;  4DMV A;  4PNI A;  2XJ7 A;  4B3M T;  5JRC A;  5FY1 A;  2N9D A;  2VWA A;  3GWH A;  3RI5 A;  1HG5 A;  4KMC A;  4Z91 A;  3AE5 A;  4H9Q C;  4QKN A;  3RF1 A;  3UUB A;  4DMW A;  3RIU A;  4YY3 T;  4AKI A;  5LXT E;  4X1K E;  2VL8 A;  3KFW X;  1FEW A;  4ISS A;  5BMV E;  1IAP A;  2D0T A;  3RGL A;  4AKL A;  5E0O A;  2VQF T;  3C98 B;  4NPP A;  4DR6 T;  4KI0 F;  4LF5 T;  1HNX T;  5JDF A;  4DV0 T;  5AQI B;  3CQG B;  4TN7 B;  3D0T A;  1MIV A;  2EHO B;  4ZI3 C;  3VU7 H;  2VQE T;  2K48 A;  3HKD E;  1HX1 B;  5C2T A;  2DWG A;  3IEE A;  4OYJ A;  2M67 A;  4O8S A;  2H89 A;  2X9Y A;  2RPA A;  5AQL B;  4MFR A;  4PJL A;  2CBJ A;  4IST A;  2UXN B;  2WQY A;  3EDV A;  3UUM A;  5LHG B;  1HNZ T;  4IE5 A;  2XSA A;  2WMN A;  3EI0 A;  2W63 A;  3VRB A;  2KT9 A;  4ZI2 C;  4X66 T;  3RKG A;  4HWH A;  5AQR B;  5FXV A;  4JI2 T;  3WAK A;  2JMK A;  4LMJ A;  2JJ9 A;  2DCF A;  2H7O A;  4HFV A;  3ZEF B;  5ABH A;  2FJD A;  3DJB A;  1SA0 E;  3PUA A;  3SRZ A;  4UVC B;  2M6B A;  3KV9 A;  2A9U A;  5EK4 A;  2LSG A;  1ZV4 X;  2LKH A;  3C4W A;  2XM2 A;  5KMG P;  1Z8U A;  3GN5 B;  3AAA B;  2E5L T;  3AVS A;  3QK6 A;  2H3R A;  3K3O A;  1WR6 A;  2X51 A;  3CX6 B;  4QXB B;  5FYM A;  3ZMV B;  5J2U E;  1HR0 T;  2VVN A;  3Q2M A;  3R6N A;  3CX8 B;  4X62 T;  4YTP A;  2KXP B;  4H9O C;  4U3C A;  2BG9 C;  3RYF E;  5L2L A;  4B3R T;  1MMD A;  4I50 E;  4H9R C;  4AIU A;  3AE4 A;  2V5C A;  2EHO D;  2NWB A;  2V6X A;  3KV4 A;  5JH7 E;  4I4T E;  5CB4 E;  2XAF B;  4DV6 T;  2Q9Q C;  3A7M A;  5CJ5 A;  4U31 A;  3GN5 A;  3ABV A;  3OBV E;  1DU2 A;  2QRX A;  3CK6 A;  3T8O A;  2CBI A;  4YXD A;  2IUB A;  2X0H A;  1HTJ F;  4IE0 A;  3HA4 A;  3ZST A;  4MBQ A;  2V7K A;  3G06 A;  1MIY A;  1XZY A;  4JLE A;  2CHO A;  2LE8 A;  2HH7 A;  3JC6 D;  4Q25 A;  4DUY T;  2E2A A;  5HWX A;  5DQW A;  2V8S V;  5FY0 A;  3RRW A;  4PK5 A;  2MYS A;  3ZC1 A;  5A1L A;  3LBX B;  4ILA A;  1WLX A;  3LK4 2;  5FNV E;  2CA5 A;  1W0B A;  4N78 D;  2I6H A;  3ZC0 A;  2HN2 A;  1VOM A;  4H9P C;  4G2A A;  2NW8 A;  3I0O A;  4YHJ A;  4IHJ E;  3JC6 C;  2NOX A;  2Z6E A;  3B57 A;  4KHZ F;  3LSV A;  5CFB A;  4QX8 B;  3LFM A;  1E7P A;  5HAX A;  3KBU A;  2WU5 A;  3TLS A;  4QXC B;  3SS1 A;  1SUM B;  3N9O A;  5LHI B;  5HCM A;  3UFG A;  2EHO A;  2UXB T;  5J1G A;  2OA5 A;  4NUV A;  5FVK A;  4P09 A;  1XNR T;  2W2U A;  1VRB A;  4XBF B;  3O9X A;  5AQP B;  2ODU A;  5AQO B;  1ZHC A;  3SOL A;  4OX9 T;  1WCR A;  4HFD A;  1S35 A;  2X66 A;  3EDU A;  2PJQ A;  4I55 E;  3T1Y T;  3N9M A;  5FL0 A;  2LT3 A;  3O4X E;  2XAQ B;  3WI3 A;  5ABF B;  5FVL A;  2BS2 A;  1IJ5 A;  1NWM X;  3P50 A;  4UF0 A;  4KBM B;  5LBQ B; 
#chains in the Genus database with same CATH homology
 1LVK A;  2K24 A;  5JDN A;  2BVM A;  3F2E A;  4CXY A;  4O4L E;  1D1A A;  5JR9 A;  4AKR B;  1AJ3 A;  2V7J A;  3U78 A;  3RPU A;  3NZQ A;  2KWH A;  2LOP A;  4L5G A;  2E9X A;  2ZMA A;  2XHE B;  3C51 A;  4HTE A;  2W61 A;  4QHO A;  2JRK A;  5KX5 E;  4AKG A;  3AVR A;  4X1Y E;  2EHO C;  2C0S A;  2A72 A;  2YEV C;  3PU3 A;  4OK0 A;  2N2N A;  4UV8 B;  3U3I A;  3ZJ2 A;  2XAS B;  2VKJ A;  2CXF A;  2CWO A;  3S4U A;  2I59 A;  4JUY A;  4QX7 B;  4CXX A;  2ZM0 A;  2Y48 B;  3N2G E;  2J1D G;  2LSJ A;  4EOZ B;  3RH3 A;  3CPZ A;  2KLQ A;  2PBI A;  3ONX A;  2E9X D;  3OJA A;  4IE6 A;  1YW0 A;  2XAH B;  5LA6 E;  5HYA A;  2CM0 A;  3C50 A;  4MAL A;  4BJM A;  2RP4 A;  4G63 A;  1HS7 A;  3KVA A;  3DP7 A;  4PJN A;  2VK9 A;  2YIN A;  4PJM A;  2CXD A;  2KND A;  4IE7 A;  5HXR A;  1LRZ A;  2ES0 A;  3K3Q C;  2WWU A;  4A56 A;  2ACX A;  3ZCJ A;  5TAO A;  2Y6X A;  2YK0 A;  3P8C D;  2D5U A;  3UUN A;  2E9X B;  3NRX A;  3ESL A;  2XQY A;  4P0A A;  5H6R B;  1BR4 A;  3CWZ B;  2DNX A;  2X9X A;  5M4Y A;  3HI2 A;  2X68 A;  4IDZ A;  1G73 A;  4UIG A;  4F6R C;  3NRY A;  2HPJ A;  3RYH E;  3IHR A;  3AB3 B;  3PE0 A;  4H63 V;  4XZC A;  2C5K T;  3PUS A;  2V1D B;  4U74 A;  5JQG E;  1KNZ A;  2VAS A;  3FBZ A;  2LOS A;  3L3P A;  2DHR A;  2CCQ A;  4KUM B;  3AA1 B;  3N2O A;  2BVL A;  5KDM C;  1UCU A;  1V9D A;  3P7I A;  3NBX X;  3W15 B;  1KK7 A;  3VKG A;  5DQV A;  5JDL A;  3NZP A;  3Q5W A;  2LSK A;  1B7T A;  5FY7 A;  5HXH A;  1D1C A;  4CXW A;  4TUY E;  4XAX B;  5LOV E;  3LK3 B;  5AFU L;  1IJ6 A;  4I43 B;  3LBX A;  3EUH A;  5L3B B;  5LCY A;  5IYZ E;  5JRE A;  3C4X A;  1U5P A;  1WRD A;  3UUL A;  4DVD A;  1MIW A;  4GK5 E;  3HKE E;  4UVB B;  1MMG A;  3BQI A;  2CLY B;  4OHF A;  3K8P C;  1HG2 A;  5LGT B;  4V1A v;  2X67 A;  5LJN A;  2BZB A;  3CQX C;  3CQC B;  2JQQ A;  2Y8D A;  3E0Z A;  5LYJ E;  3KDS E;  3Q9D A;  4TV9 E;  5LP6 E;  3RX6 A;  3RC3 A;  1US7 B;  3PUQ A;  5F3J A;  4Z8X A;  3KIN B;  4GIW A;  1OWA A;  4ILU A;  5L3D B;  3LG7 A;  4MLK A;  2MTQ A;  2IC6 A;  2X0L B;  2V7M A;  3HL6 A;  3V5S A;  5HXE A;  2CE7 A;  2PFV A;  4ZS3 A;  3LK2 B;  4BA9 A;  3TKL B;  1FMV A;  4IE4 A;  3BQL A;  2D0U A;  5LHH B;  3MXZ A;  3ZYM A;  3I0Q A;  2W62 A;  4O4I E;  5CA0 E;  2JPF A;  4UEM A;  1D1B A;  5JR9 B;  4BJN A;  3FBL A;  1D0Y A;  2V7L A;  2LM9 A;  3E08 A;  3CX7 B;  3M65 A;  2LEH A;  2UXX B;  4GYR A;  3ZMU B;  1CUN A;  2ZM8 A;  3VHL A;  3RRC A;  4J2C A;  3I9W A;  2VKH A;  4PW8 A;  4QWN B;  2C5I T;  5L3E B;  1HCI A;  2CMR A;  4MHC A;  4ZI2 D;  3A5X A;  2ZLY A;  3CKD A;  4O2A E;  3LJC A;  1OXZ A;  4H63 H;  4EZH A;  4L9I A;  3KV6 A;  2SPC A;  4AXP A;  2L8K A;  3H3A A;  3N9N A;  3ZMZ B;  2NW7 A;  3J7Y q;  4HGA A;  2VKD A;  3AA6 B;  3KVB A;  3MJX A;  3O1I A;  5JRC B;  5HXS A;  3GMI A;  2IAK A;  2IW5 B;  4WW0 A;  3BK9 A;  2KZ7 B;  3HKC E;  2X9H A;  4ADZ A;  3OYZ A;  3QC9 A;  4CZZ B;  3UTK A;  3MZK B;  3PTR B;  2H7V C;  2IC9 A;  2NW9 A;  5HXC A;  5EK2 A;  3K3N A;  3ZLI A;  1HF8 A;  5JDG A;  4B6X A;  3PDY A;  4O4H E;  4EB6 E;  3SWH A;  1Y64 B;  2CXL A;  4HN9 A;  3F57 A;  2N1G A;  4KP3 C;  1YKH B;  3N9P A;  4X1I E;  2WBL A;  3OKQ A;  1YD8 G;  2GK9 A;  3UFE A;  1G8X A;  2KWI B;  3IF8 B;  4EYU A;  4L0R A;  3GA8 A;  3ZYK A;  4FI5 A;  4DND A;  3ZN1 B;  2XTL A;  3C4Z A;  4PAG A;  5EZY E;  4JEU B;  2XAJ B;  1Z0P A;  2LSY A;  4YFS A;  1HX8 A;  3J9X 1;  1ZKE A;  4YLH A;  2A2F X;  3CML A;  3C64 A;  4E7S A;  3B13 A;  1UX4 A;  2LJL A;  5FXX A;  4DO0 A;  4PK4 A;  5FMN A;  3DTO A;  3RYI E;  4ZS2 A;  2Q9Q A;  2LSI A;  4C91 A;  3L09 A;  4ASK A;  4EYY R;  2WM9 A;  4FJO A;  4PFO A;  4TZ4 C;  2JMH A;  5DJQ C;  2LHR A;  2WMO A;  1YKE B;  3KBT A;  3KV5 A;  2QA7 A;  2V26 A;  4H9N C;  4UXN B;  4ERR A;  3O1H A;  4DBR A;  1EZ3 A;  2K9A A;  2Q9Q B;  3AA0 B;  4U72 A;  5ETW A;  2G0U A;  4CQI A;  3VKH A;  1BR0 A;  5LGN B;  3F31 A;  3ZMT B;  5J2T E;  1S94 A;  3AA7 B;  5L3G B;  1O3X A;  4IGU A;  3N9L A;  3O1J A;  3HKB E;  1MMN A;  4ZI7 E;  1ZEE A;  2L3L A;  2X9W A;  4NUU A;  4UF0 B;  4DBQ A;  1BR2 A;  3IBP A;  1HFA A;  5ADX L;  3FXE B;  4HEA A;  4AQF A;  3AAI A;  2ODV A;  3HR0 A;  5LJM A;  1T98 A;  3ZYL A;  2C5J A;  5LG4 A;  4TX5 A;  4ZI3 D;  3ANW A;  4OFZ A;  4K0U A;  4AQG A;  5FXZ A;  2VKO A;  5LBM A;  2DLR A;  4ZHQ E;  2L9Q A;  4HKA A;  2XAG B;  4UEL A;  2MOZ A;  3AAE B;  4CI2 B;  2WSS V;  2YU1 A;  4AQF C;  4PK6 A;  2V7I A;  1U4Q A;  4GYS A;  1WYC A;  5FXW A;  3ZPO A;  4CI3 B;  5LGU B;  2E9X C;  1MMA A;  5FP3 A;  2PG8 A;  4EZ4 A;  2CLY C;  1UX5 A;  5CA1 E;  4EAH A;  4EXT A;  4C90 A;  3FHN A;  5LNK A;  4YJ3 E;  3FB2 A;  5F8P A;  3ZN0 B;  3MKD A;  2P9B A;  2E8I A;  2DI4 A;  2KIN B;  1FIO A;  2HPL A;  5GON E;  1BR1 A;  3ZCI A;  5L3C B;  2W00 A;  3WAJ A;  3ETV A;  5L3F B;  2NTX A;  3EVY A;  4OYK A;  4YJ2 E;  2LHN A;  5DAB A;  3ZJ1 A;  3RC8 A;  1LKX A;  3ZMS B;  2KMF A;  4H9S E;  5JDM A;  3RKO A;  3E22 E;  2D2S A;  1IZN B;  2K5B B;  5IHY A;  2A3D A;  2B1E A;  1WYB A;  3BQK A;  4PJJ A;  4WBO A;  4UVA B;  4BAY B;  4CI1 B;  3I9Y A;  4M1P A;  3ANW B;  1LVF A;  1NAF A;  2QGS A;  4AI6 A;  1SHZ C;  2BDE A;  4PFP A;  4WNK A;  1QSD A;  4WBN E;  3FXD B;  1D0Z A;  2YU2 A;  4GOU A;  4QXH B;  4JEH B;  2NTY A;  4EIW A;  4IIJ E;  1E1H B;  2RA1 A;  3MK7 C;  1MNE A;  2MBG A;  4UV9 B;  4O4J E;  3N5L A;  3PU8 A;  5EK3 A;  4ZOL E;  3R84 B;  5HWY A;  1QUU A;  2VB6 A;  3V5U A;  3UUX B;  1FMW A;  2WAU A;  3Q5X A;  4HE8 A;  3UT5 E;  3PUG A;  1X79 A;  2CEA A;  2Q9Q D;  1MND A;  4GK0 E;  4X20 E;  5H6Q B;  3RYC E;  3OYX A;  2ZM2 A;  4AKH A;  2DWK A;  3N2K E;  2NP9 A;  1H7C A;  4ANJ A;  5JDQ A;  5JDH A;  3PUR A;  2W0G A;  1D0X A;  3MA9 A;  4TV8 E;  5JVD E;  3ETU A;  3QUJ A;  4E7Z A;  5C8Y E;  4P0B A;  3I1A A;  4O2B E;  3MAC A;  3H37 A;  2CWY A;  3CVR A;  3N9Q A;  2XUE A;  5JR9 C;  4DMV A;  4PNI A;  5JRC A;  5FY1 A;  2N9D A;  2VWA A;  3GWH A;  1HG5 A;  4KMC A;  4H9Q C;  4QKN A;  4DMW A;  4AKI A;  5LXT E;  4X1K E;  2VL8 A;  3KFW X;  1FEW A;  4ISS A;  5BMV E;  1IAP A;  2D0T A;  4AKL A;  5E0O A;  3C98 B;  5JDF A;  3CQG B;  4TN7 B;  3D0T A;  1MIV A;  2EHO B;  4ZI3 C;  3VU7 H;  2K48 A;  3HKD E;  2DWG A;  3IEE A;  4OYJ A;  2M67 A;  4O8S A;  2X9Y A;  4MFR A;  4PJL A;  4IST A;  2UXN B;  3UUM A;  3EDV A;  5LHG B;  4IE5 A;  2WMN A;  2W63 A;  2KT9 A;  4ZI2 C;  3WAK A;  5FXV A;  2JMK A;  2JJ9 A;  2DCF A;  2H7O A;  4HFV A;  3ZEF B;  3DJB A;  1SA0 E;  3PUA A;  3SRZ A;  4UVC B;  5EK4 A;  3KV9 A;  2LSG A;  1ZV4 X;  3C4W A;  5KMG P;  3GN5 B;  3AAA B;  3AVS A;  3QK6 A;  2H3R A;  3K3O A;  1WR6 A;  2X51 A;  3CX6 B;  4QXB B;  5FYM A;  3ZMV B;  5J2U E;  3Q2M A;  3R6N A;  3CX8 B;  2KXP B;  4H9O C;  3RYF E;  5L2L A;  1MMD A;  4I50 E;  4H9R C;  2EHO D;  2NWB A;  3KV4 A;  5JH7 E;  4I4T E;  5CB4 E;  2XAF B;  2Q9Q C;  3GN5 A;  3OBV E;  3T8O A;  1HTJ F;  4IE0 A;  3HA4 A;  4MBQ A;  2V7K A;  1MIY A;  4JLE A;  2LE8 A;  2HH7 A;  3JC6 D;  5HWX A;  5DQW A;  5FY0 A;  3RRW A;  4PK5 A;  2MYS A;  3ZC1 A;  5A1L A;  3LBX B;  1WLX A;  3LK4 2;  5FNV E;  2CA5 A;  4N78 D;  3ZC0 A;  1VOM A;  4H9P C;  4G2A A;  2NW8 A;  3I0O A;  4YHJ A;  4IHJ E;  3JC6 C;  2NOX A;  2Z6E A;  3B57 A;  4QX8 B;  3LFM A;  5HAX A;  3KBU A;  5LHI B;  4QXC B;  3SS1 A;  3N9O A;  2EHO A;  5J1G A;  2OA5 A;  4NUV A;  4P09 A;  1VRB A;  4XBF B;  3O9X A;  2ODU A;  1ZHC A;  3SOL A;  1S35 A;  2X66 A;  3EDU A;  2PJQ A;  4I55 E;  3N9M A;  2LT3 A;  3O4X E;  2XAQ B;  3WI3 A;  4UF0 A;  1IJ5 A;  1NWM X;  4KBM B;  5LBQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...