2LSYA

Structure of the c-terminal domain from human rev1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsyA00
4GK0E 2LSYA 2N1GA 4EXTA 3VU7H 4GK5E 4BA9A 2LSJA 2LSKA 2LSIA 4FJOA 2LSGA
chains in the Genus database with same CATH superfamily
2XAQB 3CWZB 4QWNB 1FMWA 1HNXT 3RC8A 3OYZA 2OLTA 2IW5B 5LMNT 4AQYT 1KFYA 4OYJA 1T7SA 5AQMB 4GK5E 4YXDA 2XQ9A 5JQGE 2LHNA 1SUMB 1KF6A 3CKDA 2NW9A 1BR4A 5KXJA 4ISTA 4YSXA 2DLRA 4HEAA 4DBQA 4I0UA 1XNRT 1HX8A 2L8KA 2IC9A 2JPFA 2V1DB 2B76A 4I43B 1QSDA 3TKLB 1XMOT 2A3DA 4UXNB 2WBLA 3C64A 4BAYB 4B6XA 4AI6A 3RIUC 3H3AA 3UUNA 4X1YE 3J7Yq 2CHNA 5IWAT 4UVCB 5IHYA 2VASA 1MMGA 1W0AA 5FL0A 4ZZCA 2XQ7A 4JI5T 3AVSA 1WYBA 5AQNB 4A5XA 3ZSTA 2WDRA 1FJGT 2PFVA 3VR9A 3NZPA 4I50E 3RQWA 2NW8A 1Z0PA 1QUUA 5LXTE 1BR2A 4EYYR 5JREA 1HCIA 2LSJA 4UIGA 4DV2T 3CVRA 3AE3A 2I6HA 2A72A 2YU2A 2E9XD 3ZEFB 3KV9A 2LSKA 3PURA 4JI3T 2KXPB 3Q5WA 4DV4T 4ILAA 2UXDT 2P9BA 3UU3A 2WZHA 4IL9A 3CQCB 4LMKA 2YDSA 5GONE 1YXRA 3FXEB 3ZC0A 4H9NC 2QRXA 3FZLB 3GWHA 5AQPB 4GKKT 1OEDA 4H9RC 2I0MA 4WBOA 3FZFB 4IDNA 1UX5A 2E9XB 4NXNT 2X67A 2G0UA 4KP3C 3RYFE 5TAOA 2WM9A 5ABFB 2Q9QA 2PJQA 3KV5A 4ZZBA 3LSVA 3MKDA 2R6GF 4KMCA 4P09A 2MPKA 3TLTA 4FJOA 4PK4A 1XDOA 3WAKA 3ZMUB 2KZ7B 1DU2A 4DR1T 1B7TA 5FXZA 5KMGP 4ZI3D 4AKHA 3N9QA 4DMWA 3Q5XA 4HWHA 1Z8UA 3RRWA 1NAFA 2J4GA 2ODUA 4OHFA 1IJ5A 3SWHA 4EYUA 2BBJA 3U3IA 5JDNA 4DO0A 2XTLA 5EK4A 5LHGB 2QA7A 3AXJA 2I59A 3W15B 4HN9A 3R6NA 3FZKB 3RYIE 2KWHA 2XQYA 3UQ4A 4U2YA 4L9IA 4LF4T 1D1CA 3NWIA 3AE2A 2W0GA 3OBVE 2BKNA 1WR0A 5FXVA 3ZMTB 3LBXA 2X68A 2ZM6T 2V7JA 3P4SA 3ZMZB 2H7OA 2HN1A 4JUYA 2EHOC 4QKNA 1CHUA 2BZBA 2XAJB 3TLWA 4ZS3A 1ZKEA 3E08A 3MZKB 4XBFB 1WFDA 3HKDE 4EOZB 1Y01A 2ZMAA 3B13A 4ILBA 2WCAA 4KX6A 5ABEA 2HH7A 5JDLA 1I94T 3UULA 3ZT5A 4X62T 2LRKA 3N9LA 2PG8A 3CIRA 3HA4A 4TWHA 3CK6A 2CBJA 5FNVE 2NTXA 4EEBA 3KFWX 1YW0A 4EZ4A 2E9XC 5LBQB 2WMNA 2XAHB 4H9OC 2MBGA 1HNWT 1T98A 2VKDA 3ONXA 2X9WA 2JQ9A 1IZNB 3FZHB 2XQAA 2J1DG 4CXXA 3ZJ2A 1YKEB 4IE7A 5HXEA 3PUZF 3V5SA 1G8XA 2YOEA 2UU9T 5AQTB 5ABHA 2XM1A 4GK0E 4CZZB 5AQHB 2XSAA 3P4PA 1XZYA 2KWIB 4G2AA 2IC6A 2JRKA 3RC3A 2KNDA 3I0QA 1E7PA 2VKHA 4F6RC 3OPCA 4ZEYA 3AE7A 4MALA 2PTFA 1UUSA 3L8RA 1M7KA 1ZOYA 1HNZT 3PUAA 2IUBA 2CWYA 4QXHB 2CCQA 2K48A 5AQLB 4H9SE 2LSGA 3K3QC 4WZXA 1D0XA 3AEDA 4YY3T 5DQWA 1HTJF 2LSYA 1VCSA 4ZI3C 4A56A 3LG7A 5LA6E 4LMJA 1MMNA 4UF0A 2XSBA 4DNDA 3PE0A 2XQ4A 2BKOA 1HS7A 4IIJE 2XM2A 3VKGA 4WW0A 3MXZA 1W0BA 4LFAT 4HFIA 3HKCE 1LVKA 1MIVA 5E0OA 3PUQA 4WNKA 2W4XA 3T1YT 4PJMA 5L3GB 2C0SA 2W67A 4GYSA 4JBWF 3HKEE 4G63A 5KX5E 2ZM8A 4IE4A 5LGTB 1MMAA 3N9NA 2X9XA 5JDFA 4JI6T 1J5ET 4AQGA 2VKOA 3VHLA 3F2EA 1MIYA 2HN2A 3HI2A 4TV8E 4OX9T 3PUXF 3C4WA 5F8PA 4HFEA 2UXBT 2W2UA 5FY7A 3ESLA 3JADA 3AVRA 3B57A 4CI1B 1L0VA 4AISA 4PK6A 5ETWA 5LJNA 5JR9A 3GN5B 1LRZA 2WMOA 4E7SA 2W63A 5H6QB 3BQIA 2VVSA 2XQ5A 4Z90A 5C3JA 4QX8B 3JAFA 1J1JA 2CEAA 3FB2A 4TZ4C 5FXXA 2LOPA 2C5KT 4JI7T 4JI8T 4CQIA 3NRYA 4DR2T 1XDPA 2MYSA 2LM2A 3QC9A 5L3CB 3RX6A 4P0AA 3RLFF 2BG9E 4AQFC 3ZPOA 3CQXC 2UXCT 4H63V 2D0TA 2CMRA 2YKSA 1UCUA 4YTMA 4BJNA 2VKJA 3CMLA 3PV0F 4DUYT 4BJMA 3KVAA 3Q2MA 5LOVE 5C2TA 3PUGA 2E8IA 4U33A 2LE8A 5FVKA 3H37A 4B3MT 1D0YA 2LRLA 4EZHA 3ZYKA 3QB5K 3AEAA 2W61A 5LP6E 4U7IA 2ACXA 3AECA 1WYCA 3S4UA 4QH5A 1HFAA 5DJQC 3HR0A 4B3ST 2X0LB 4DR3T 1UGOA 3OJAA 4TV9E 4YT0A 5CFBA 4AXPA 1ZEEA 3MJXA 5JDQA 3P7IA 4X65T 2XHEB 5J2UE 2UXNB 4UV8B 5LHIB 2WU2A 4H9PC 5AQJB 3FZMB 2KT9A 5HXCA 3ZJ1A 2V7KA 4O4JE 2V5DA 2EHOD 4Q25A 4O4IE 2Z6EA 3FHNA 5HXRA 3UU4A 2LJLA 2LEHA 4AIUA 3UUBA 3ABVA 2V8SV 2MTQA 5FYMA 1IBMT 3UU8A 3ZYMA 4HWCA 2GK9A 3SRZA 4MLKA 2V6XA 5LNKA 2VB6A 2KLQA 2D2SA 2WU5A 4DVDA 4U72A 3OKQA 4UELA 3C50A 5FP3A 4IHJE 1UX4A 1D0ZA 4JI4T 3PUWF 3C51A 1IBLT 3P4RA 3PUSA 1FIOA 1IAPA 3AE6A 2EHOB 2DHRA 3ZCIA 3UU6A 5HWYA 2HHHT 2OA5A 3P4WA 3K3NA 2MOZA 4ZS2A 3Q5DA 4LFBT 2X66A 3KVBA 2WS3A 3AAEB 2CE7A 2V6YA 5FY1A 1Y64B 4HWDA 4ANJA 2Q9QD 4MHCA 2NP9A 4ZXLA 1KEYA 5L4EA 2LHRA 4ZI7E 3ZN0B 3PU3A 1XMQT 1AJ3A 5C8YE 4DUZT 3LK2B 4JI1T 3DTOA 1D1BA 1KNZA 1OEDB 5HEGA 2IAKA 2JIWA 4JV5T 4V1Av 5AQRB 4EXTA 4IT4A 1N33T 3AAAB 3VRBA 2W00A 2D0UA 3T1HT 2Q9QB 5J2TE 2FJDA 2CPTA 3PU8A 1HG2A 3PJAA 4EIWA 5HAXA 5JDGA 3H3MA 1ZHCA 2CM0A 3IF8B 5L47A 2M6BA 2JMKA 5FMNA 1NEKA 1S35A 4DR4T 3AE9A 2N9DA 5AQQB 3EVYA 2XY8B 5CA0E 5BMVE 5EZYE 5JDMA 3N2KE 4ERRA 4TNWA 1EZ3A 1MIWA 3RPUA 1MNEA 4DV7T 3BK9A 1JNZA 4QH4A 4HKAA 3OYXA 2VWAA 2BG9A 3AA6B 2H3RA 3NKZA 4GKJT 3AE8A 2LLYA 4YFSA 4EV6A 1T8BA 1X9BA 1G73A 2N1GA 2HPJA 2RPAA 3F57A 4PW8A 3LBXB 3O1IA 2CWOA 4KBMB 5EK3A 5J0ZA 2Y48B 4YLHA 4X5TA 1NENA 1VOMA 1VRBA 3TLVA 3C98B 2YINA 3RIFA 1XWMA 4IE6A 2X9YA 4ZOLE 2QGSA 5CB4E 3RI5A 3R84B 5IUXA 2PBIA 5LBMA 3K1SA 1YQ4A 1OEDC 4QX7B 3AA0B 4IE5A 1X79A 4IDZA 3N5LA 2W66A 5JRCA 2BVLA 4YSYA 2Q9QC 3VU7H 2E5LT 1YD8G 4A97A 2YU1A 4TUYE 3N2GE 3ZMSB 4H63H 3E0ZA 4U74A 4X1IE 3C4XA 3F31A 1U4QA 3ZT7A 4X20E 1E2AA 2BS4A 2N2NA 4UEMA 2VL8A 3ZC1A 3BQLA 5F5WA 3WI3A 3K8PC 4CXYA 3O1HA 5M4YA 3OTOT 2M6IA 5AQFB 2K3WA 3RGLA 3RF1A 5AQOB 4L0RA 2A2FX 4JI2T 4LF5T 4O2AE 5F3JA 3EI0A 2XUEA 2XAFB 2ZLYA 4TNVA 1J5WA 2WZIA 3N9OA 2BBHA 4L5GA 3TLUA 2V7MA 4P1NA 4DV5T 1IBKT 3MACA 4UF0B 4WBNE 2HPLA 4DR7T 4DV0T 2WDVA 5FKYA 2VQET 3RIUA 3RYHE 4JLEA 2XQ8A 2YN6A 4PK5A 2D9DA 3NZQA 4J2CA 3JCFA 4DMVA 3SFEA 3NBXX 2NTYA 4OYKA 4CI3B 4HFDA 4PJNA 3KV4A 3T8OA 5HYAA 4E7ZA 5KDMC 2SPCA 5L3EB 2VQFT 3JAEA 3X1DA 3K3OA 4EB6E 5HXHA 3ZT6A 3B5MA 5HEUA 5AQVB 2KINB 3ZLIA 4LF6T 1E1HB 4LF7T 3A8YC 2KMFA 3RRCA 3O9XA 1N32T 4TN7B 4HFBA 3UFEA 1HG5A 2X51A 1SHZC 2BS2A 3ANWA 3N9PA 2VK9A 3KBUA 4Z8XA 2JMHA 1UK5A 3I9YA 4U3CA 4GYRA 3NRXA 3L39A 1XNQT 2QYWA 4NIQA 2CA5A 4PJJA 5ADXL 2UUCT 5JR9B 2DWGA 4CN1A 3HKBE 2UUBT 3KV6A 3M65A 4IGUA 4EEDA 4X64T 4QHOA 2FJAA 2BS3A 3E22E 2LOSA 3LJCA 5JVDE 2OV9A 5AQKB 3RH3A 4KHZF 3QB5A 5ABGA 4ADZA 3SS1A 2IHR1 2B1EA 2J47A 4WYVA 3Q9DA 3GMIA 4DV3T 3RQUA 1OXZA 4A98A 2BVMA 4CN4A 2D5UA 2DWKA 1D1AA 4AKGA 4F8HA 1GQEA 5FVLA 5IYZE 1KNPA 3KINB 2IMLA 4ASKA 3ETVA 2FJEA 2WB5A 2V26A 2XJ7A 2K5BB 5JH7E 3FBLA 4O4LE 2NW7A 3L3PA 5CJ5A 2ZM2A 4UR9A 2C5IT 2WP9A 1IJ6A 3UUXB 4TWFA 4B3TT 3NVOA 4YJ3E 1MNDA 4GIWA 2X0HA 3BQKA 4TX5A 3V5UA 2CXDA 1WLXA 4HWIB 4IDPA 3AE1A 2WSSV 3PUVF 5AFUL 3C4ZA 4TWDA 2XASB 3G06A 4IE0A 4UVAB 4YTNA 4BA9A 5LGNB 4N78D 3LDQB 1T72A 2YK0A 5AQIB 4CI2B 3AEEA 2EHOA 2CXFA 3AEBA 2LM9A 1ZV4X 2A9UA 1V9DA 4ILCA 3EABA 4FI5A 3ZSSA 3EDVA 2FJBA 2XAGB 4O8SA 5JR9C 3GA8A 3UFGA 3PUYF 1W9RA 4YHJA 2WWUA 5LHHB 2AE9A 4JYAT 3A7MA 3EAMA 5L3DB 2X9HA 1US7B 3IBPA 5A1LA 2E9XA 3O4XE 4IDOA 5ABFA 2V6YB 3O1JA 2UXXB 3RHWA 1ZP0A 2ES0A 3I9WA 3KDSE 4I55E 4HFCA 2LSIA 3FXDB 2ACZA 3RYCE 2XQ6A 4DIDB 4Z91A 3VKHA 4QXBB 3RKGA 4ZI2D 3PJAJ 4LF9T 1JNRA 1FMVA 2K24A 3P8CD 4X66T 4U2ZA 2L9QA 3SOLA 1VCTA 4DV6T 3A5XA 4NXMT 4AKRB 2YDQA 3OVUA 3P50A 3MK7C 5L3FB 3ONLC 5AQGB 5LB7B 4NPPA 1FEWA 4DBRA 3UT5E 3ETUA 4JEUB 5EK2A 5LYJE 3AE5A 1N36T 3WAJA 2NOXA 3AE4A 3HL6A 3FBZA 4O4HE 3AXJB 5L2LA 2AXDS 4OK0A 2WWVA 3TLSA 5LJMA 1BR1A 4ISSA 4QXCB 4HE8A 4HTEA 4JI0T 3EHZA 3ZMVB 3LK3B 4AKIA 2BKPA 4LF8T 5FL1A 1OWAA 2CLYB 5HXSA 4HFHA 1MMDA 5HCMA 1WRDA 4U31A 3L09A 2YDRA 4PAGA 2BG9B 2QVAA 4IDQA 2L3LA 5CA1E 2XPKA 2CRBA 5LGUB 2JQQA 3JC6D 1HX1B 4XAXB 2RA1A 1YKHB 4LMLA 4B3RT 2ODVA 2E2AA 4HGAA 5BR8T 4DV1T 3DJBA 4GOUA 2IDOB 2JQKA 3QK6A 3UU5A 2IIUA 2W62A 4LFCT 3ZKRA 4YJ2E 1HF8A 2J62A 5H6RB 2H7VC 5HWXA 4PNIA 4IREA 5FY0A 4AKLA 4ILUA 4EGWA 3EDUA 2VL0A 3VRAA 2Y8DA 2JJ9A 3CX8B 3PDYA 5DQVA 2X0YA 4AQFA 4KI0F 2LKHA 2FUPA 5LMUT 5JRCB 4HFVA 4PFOA 3IHRA 4KHPT 2CXLA 2LKGA 1YQ3A 2DNXA 2BDEA 3I0OA 1WCRA 2VURA 1U5PA 2E5VA 1R8IA 2WY2A 4K0KT 4ZI2C 2YEVC 2V7LA 5JDHA 5L3BB 5AQUB 2XQ3A 4CN6A 2F4VT 3CPZA 2NR4A 1SE7A 1CUNA 2XZEA 3ONJA 2LT3A 2JQHA 4YTPA 4ZHQE 2WDQA 4HWFA 2FBWA 4COFA 3CX7B 3PTRB 3J9X1 4UVBB 3ZCJA 1HR0T 5CGMA 3LK42 4X1KE 2CBIA 1QLBA 3CQGB 5J1GA 4P0BA 2MAWA 1OEDE 3M3ZB 4DR5T 3UTKA 2CLYC 4MFRA 4M1PA 4DR6T 2M67A 1NWMX 2H88A 1H7CA 5FXWA 3ZN1B 4UV9B 2CHOA 3U78A 1UURA 4NUUA 1KK7A 1LVFA 3QNUA 2BG9C 3DP7A 3ZYLA 3MA9A 3RIAA 3N2OA 4XZCA 2DI4A 3LFMA 3AAIA 5JTGA 4C90A 4MBQA 4NUVA 3UQ7A 3IA3A 5HCJA 3AB3B 5AQSB 4OFZA 2NWBA 3QUJA 1M62A 4QH1A 4K0UA 4IL4A 2VVNA 4C91A 2KSRA 3AA1B 2C5JA 2Y6XA 2ZM0A 2V7IA 1KNRA 4KUMB 3QOFA 4H9QC 3GN5A 2V5CA 3CX6B 1SA0E 3AA7B 3N9MA 4I4TE 4YSZA 1N34T 2UUAT 4U7YA 5LG4A 3AEFA 3I1AA 3D0TA 5HEHA 3KBTA 1WR6A 3UUMA 4YHHT 3EUHA 1W09A 3JC6C 2WAUA 3IEEA 2RP4A 3RKOA 4EAHA 2DL1A 3ANWB 5L4HA 2WQYA 1O3XA 2K9AA 3VR8A 5HEJA 4O2BE 2H89A 3Q5EA 1S94A 5LCYA 3SFDA 1BR0A 1I6ZA 4PJLA 4JEHB 5HEOA 1LKXA 3P4QA 5LG3A 4CXWA 5DABA 4PFPA 2DCFA 3AEGA
chains in the Genus database with same CATH topology
2XAQB 3CWZB 4QWNB 4YFSA 1FMWA 4DNDA 3RC8A 3OYZA 3PE0A 1G73A 2N1GA 2HPJA 3F57A 4PW8A 3LBXB 2IW5B 2X9HA 1US7B 5L3DB 1HS7A 4IIJE 3IBPA 3O1IA 5A1LA 4OYJA 2CWOA 4KBMB 5EK3A 2E9XA 2Y48B 4YLHA 3VKGA 4GK5E 5JQGE 3O4XE 2LHNA 1VOMA 1VRBA 4WW0A 3MXZA 3CKDA 2NW9A 1BR4A 4ISTA 3HKCE 1LVKA 1MIVA 5E0OA 2DLRA 3PUQA 4WNKA 3O1JA 4HEAA 4DBQA 2UXXB 1HX8A 2L8KA 2ES0A 3I9WA 2IC9A 3KDSE 4I55E 4PJMA 2JPFA 5L3GB 2LSIA 3FXDB 2V1DB 3RYCE 3C98B 2YINA 2C0SA 3VKHA 4GYSA 4IE6A 4I43B 2X9YA 3HKEE 4ZOLE 1QSDA 2QGSA 4QXBB 5CB4E 4G63A 5KX5E 3TKLB 3R84B 2ZM8A 2A3DA 2PBIA 4ZI2D 4UXNB 4IE4A 2WBLA 5LGTB 3C64A 1MMAA 4BAYB 3N9NA 1FMVA 5LBMA 2K24A 2X9XA 5JDFA 3P8CD 4B6XA 4AI6A 3H3AA 2L9QA 3SOLA 3UUNA 4X1YE 3A5XA 4AQGA 2VKOA 4AKRB 3VHLA 3J7Yq 3F2EA 1MIYA 3HI2A 4QX7B 4UVCB 4TV8E 3AA0B 4IE5A 5IHYA 1X79A 3MK7C 4IDZA 5L3FB 2VASA 1MMGA 3N5LA 3C4WA 5F8PA 5JRCA 2BVLA 5FY7A 3ESLA 2Q9QC 3AVRA 1FEWA 3VU7H 4DBRA 3UT5E 3ETUA 3B57A 4JEUB 5EK2A 4CI1B 5LYJE 1YD8G 4PK6A 5ETWA 5LJNA 3AVSA 2YU1A 1WYBA 4TUYE 5JR9A 3GN5B 3N2GE 3ZMSB 1LRZA 4H63H 2WMOA 3E0ZA 4E7SA 4U74A 2PFVA 3NZPA 4X1IE 3C4XA 2W63A 5H6QB 3F31A 4I50E 3WAJA 3BQIA 2NW8A 2NOXA 1Z0PA 1U4QA 1QUUA 3HL6A 4QX8B 5LXTE 3FBZA 4O4HE 1BR2A 2CEAA 3FB2A 4TZ4C 5FXXA 4X20E 4EYYR 5L2LA 2LOPA 2N2NA 4UEMA 2C5KT 5JREA 2VL8A 1HCIA 3ZC1A 4CQIA 3BQLA 3NRYA 3WI3A 2MYSA 2LSJA 4OK0A 4UIGA 3K8PC 3QC9A 4CXYA 5L3CB 3RX6A 5LJMA 3CVRA 1BR1A 3O1HA 5M4YA 4P0AA 4ISSA 2A72A 2YU2A 4QXCB 4HE8A 4HTEA 4AQFC 3ZPOA 2E9XD 3CQXC 3ZEFB 3KV9A 3ZMVB 2LSKA 3PURA 3LK3B 2KXPB 4H63V 4AKIA 3Q5WA 4L0RA 2A2FX 2D0TA 2CMRA 1UCUA 4BJNA 1OWAA 4O2AE 5F3JA 2VKJA 2CLYB 3CMLA 5HXSA 2XUEA 4BJMA 2XAFB 3KVAA 2ZLYA 2P9BA 3Q2MA 5LOVE 1MMDA 3PUGA 3CQCB 2E8IA 3N9OA 4L5GA 1WRDA 2LE8A 2V7MA 5GONE 3L09A 3FXEB 3H37A 3ZC0A 4PAGA 4H9NC 1D0YA 3MACA 4UF0B 4WBNE 2HPLA 3GWHA 4EZHA 3ZYKA 3RYHE 4H9RC 2L3LA 4WBOA 4JLEA 5CA1E 4PK5A 3NZQA 4DMVA 4J2CA 5LGUB 2JQQA 3JC6D 4XAXB 2RA1A 2W61A 1UX5A 1YKHB 2E9XB 3NBXX 2X67A 2NTYA 4OYKA 4CI3B 5LP6E 4PJNA 2G0UA 3KV4A 4KP3C 2ODVA 2ACXA 3T8OA 4HGAA 3RYFE 5HYAA 1WYCA 5TAOA 2WM9A 3DJBA 4GOUA 3S4UA 4E7ZA 2SPCA 5KDMC 2Q9QA 5L3EB 1HFAA 2PJQA 5DJQC 3KV5A 3HR0A 3QK6A 3MKDA 3K3OA 2W62A 4KMCA 4EB6E 4P09A 5HXHA 2X0LB 4FJOA 4TV9E 3OJAA 4YJ2E 4PK4A 1HF8A 4AXPA 5H6RB 3WAKA 1ZEEA 3ZMUB 2KZ7B 2KINB 3MJXA 3ZLIA 5JDQA 3P7IA 2H7VC 2XHEB 1B7TA 5J2UE 2UXNB 5FXZA 5HWXA 4PNIA 5KMGP 4ZI3D 1E1HB 4UV8B 5FY0A 5LHIB 4AKLA 4AKHA 4H9PC 3N9QA 4ILUA 2KMFA 3RRCA 4DMWA 3O9XA 3Q5XA 4TN7B 2KT9A 5HXCA 3RRWA 3ZJ1A 1NAFA 2V7KA 3EDUA 4O4JE 2EHOD 4O4IE 2Z6EA 2ODUA 3FHNA 3UFEA 1HG5A 2X51A 4OHFA 1IJ5A 2Y8DA 1SHZC 3ANWA 5HXRA 3SWHA 3N9PA 2VK9A 2JJ9A 3KBUA 4Z8XA 3CX8B 4EYUA 3U3IA 5JDNA 2JMHA 4DO0A 3PDYA 2LJLA 2LEHA 2XTLA 3I9YA 5EK4A 5DQVA 5LHGB 4AQFA 4GYRA 2QA7A 2MTQA 5FYMA 3NRXA 3ZYMA 5JRCB 2GK9A 2I59A 4HFVA 3IHRA 4PFOA 3SRZA 2CXLA 4MLKA 3W15B 2CA5A 2DNXA 4HN9A 2BDEA 4PJJA 5ADXL 5LNKA 2VB6A 3I0OA 3R6NA 1U5PA 2KLQA 2D2SA 3RYIE 2KWHA 4DVDA 2XQYA 4U72A 4ZI2C 2YEVC 3OKQA 3C50A 4UELA 5JR9B 4L9IA 5FP3A 4IHJE 1UX4A 2V7LA 1D0ZA 2DWGA 3C51A 1D1CA 3PUSA 3HKBE 5JDHA 3KV6A 3M65A 4IGUA 5L3BB 1FIOA 3CPZA 4QHOA 1CUNA 1IAPA 2EHOB 2W0GA 3OBVE 2LT3A 3E22E 2DHRA 2LOSA 3ZCIA 3LJCA 5FXVA 3ZMTB 4ZHQE 3LBXA 2X68A 5HWYA 5JVDE 2V7JA 2OA5A 3RH3A 3CX7B 3PTRB 3ZMZB 2H7OA 4ADZA 3J9X1 3K3NA 3SS1A 2MOZA 4UVBB 4JUYA 4ZS2A 3ZCJA 2B1EA 3LK42 2X66A 4X1KE 2EHOC 3CQGB 5J1GA 4QKNA 3KVBA 2BZBA 2XAJB 4P0BA 3AAEB 2CE7A 4ZS3A 1ZKEA 3E08A 3Q9DA 3UTKA 3GMIA 3MZKB 2CLYC 4MFRA 5FY1A 4XBFB 4M1PA 1OXZA 1Y64B 2M67A 3HKDE 2Q9QD 4ANJA 4EOZB 1NWMX 2ZMAA 3B13A 4MHCA 1H7CA 2NP9A 2BVMA 5FXWA 3ZN1B 4UV9B 2D5UA 2DWKA 2LHRA 4ZI7E 3U78A 2HH7A 1D1AA 5JDLA 4AKGA 3UULA 3ZN0B 4NUUA 1KK7A 1LVFA 3PU3A 3DP7A 3ZYLA 3MA9A 1AJ3A 3N9LA 5C8YE 3N2OA 5IYZE 4XZCA 2DI4A 2PG8A 3AAIA 3LFMA 3LK2B 4C90A 3DTOA 1D1BA 4MBQA 3HA4A 3KINB 1KNZA 4ASKA 3ETVA 4NUVA 5FNVE 2NTXA 2V26A 2K5BB 2IAKA 3KFWX 5JH7E 3AB3B 1YW0A 4V1Av 4EZ4A 2E9XC 3FBLA 4OFZA 4O4LE 4EXTA 5LBQB 2NW7A 2WMNA 3AAAB 2NWBA 2XAHB 3QUJA 4H9OC 2MBGA 3L3PA 1T98A 2VKDA 4K0UA 3ONXA 2X9WA 2ZM2A 2C5IT 2W00A 1IZNB 4C91A 2D0UA 3AA1B 2Q9QB 2C5JA 1IJ6A 2Y6XA 2ZM0A 2V7IA 4KUMB 3UUXB 5J2TE 2J1DG 4CXXA 4H9QC 3ZJ2A 1YKEB 4IE7A 3GN5A 3CX6B 5HXEA 3PU8A 1HG2A 4YJ3E 1SA0E 4EIWA 3AA7B 5HAXA 3V5SA 5JDGA 3N9MA 4I4TE 1G8XA 1MNDA 4GIWA 1ZHCA 5LG4A 3BQKA 2CM0A 3I1AA 3IF8B 4TX5A 3D0TA 3V5UA 2CXDA 1WLXA 4GK0E 4CZZB 3KBTA 2JMKA 1WR6A 3UUMA 2KWIB 2WSSV 4G2AA 5FMNA 2IC6A 3EUHA 2JRKA 5AFUL 3RC3A 1S35A 2KNDA 3JC6C 2WAUA 3C4ZA 3I0QA 2XASB 2VKHA 3IEEA 4F6RC 2N9DA 4IE0A 3EVYA 2RP4A 5CA0E 3RKOA 4UVAB 4EAHA 5BMVE 5EZYE 3ANWB 1O3XA 4MALA 2K9AA 4BA9A 5JDMA 5LGNB 4N78D 3N2KE 4O2BE 4ERRA 1S94A 3PUAA 2YK0A 4CI2B 2EHOA 5LCYA 2CWYA 4QXHB 2CXFA 2CCQA 2K48A 2LM9A 1ZV4X 1EZ3A 1BR0A 1V9DA 4PJLA 4JEHB 4H9SE 2LSGA 3K3QC 4FI5A 1D0XA 1MIWA 3EDVA 1LKXA 2XAGB 3RPUA 4O8SA 1MNEA 5JR9C 5DQWA 3GA8A 4CXWA 1HTJF 2LSYA 4ZI3C 4A56A 3LG7A 5LA6E 3BK9A 4HKAA 3OYXA 5DABA 4PFPA 2VWAA 2DCFA 4YHJA 2WWUA 4UF0A 3AA6B 2H3RA 5LHHB 1MMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GK0 E;  2LSY A;  2N1G A;  4EXT A;  3VU7 H;  4GK5 E;  4BA9 A;  2LSJ A;  2LSK A;  2LSI A;  4FJO A;  2LSG A; 
#chains in the Genus database with same CATH topology
 2XAQ B;  3CWZ B;  4QWN B;  1FMW A;  1HNX T;  3RC8 A;  3OYZ A;  2OLT A;  2IW5 B;  5LMN T;  4AQY T;  1KFY A;  4OYJ A;  1T7S A;  5AQM B;  4GK5 E;  4YXD A;  2XQ9 A;  5JQG E;  2LHN A;  1SUM B;  1KF6 A;  3CKD A;  2NW9 A;  1BR4 A;  5KXJ A;  4IST A;  4YSX A;  2DLR A;  4HEA A;  4DBQ A;  4I0U A;  1XNR T;  1HX8 A;  2L8K A;  2IC9 A;  2JPF A;  2V1D B;  2B76 A;  4I43 B;  1QSD A;  3TKL B;  1XMO T;  2A3D A;  4UXN B;  2WBL A;  3C64 A;  4BAY B;  4B6X A;  4AI6 A;  3RIU C;  3H3A A;  3UUN A;  4X1Y E;  3J7Y q;  2CHN A;  5IWA T;  4UVC B;  5IHY A;  2VAS A;  1MMG A;  1W0A A;  5FL0 A;  4ZZC A;  2XQ7 A;  4JI5 T;  3AVS A;  1WYB A;  5AQN B;  4A5X A;  3ZST A;  2WDR A;  1FJG T;  2PFV A;  3VR9 A;  3NZP A;  4I50 E;  3RQW A;  2NW8 A;  1Z0P A;  1QUU A;  5LXT E;  1BR2 A;  4EYY R;  5JRE A;  1HCI A;  2LSJ A;  4UIG A;  4DV2 T;  3CVR A;  3AE3 A;  2I6H A;  2A72 A;  2YU2 A;  2E9X D;  3ZEF B;  3KV9 A;  2LSK A;  3PUR A;  4JI3 T;  2KXP B;  3Q5W A;  4DV4 T;  4ILA A;  2UXD T;  2P9B A;  3UU3 A;  2WZH A;  4IL9 A;  3CQC B;  4LMK A;  2YDS A;  5GON E;  1YXR A;  3FXE B;  3ZC0 A;  4H9N C;  2QRX A;  3FZL B;  3GWH A;  5AQP B;  4GKK T;  1OED A;  4H9R C;  2I0M A;  4WBO A;  3FZF B;  4IDN A;  1UX5 A;  2E9X B;  4NXN T;  2X67 A;  2G0U A;  4KP3 C;  3RYF E;  5TAO A;  2WM9 A;  5ABF B;  2Q9Q A;  2PJQ A;  3KV5 A;  4ZZB A;  3LSV A;  3MKD A;  2R6G F;  4KMC A;  4P09 A;  2MPK A;  3TLT A;  4FJO A;  4PK4 A;  1XDO A;  3WAK A;  3ZMU B;  2KZ7 B;  1DU2 A;  4DR1 T;  1B7T A;  5FXZ A;  5KMG P;  4ZI3 D;  4AKH A;  3N9Q A;  4DMW A;  3Q5X A;  4HWH A;  1Z8U A;  3RRW A;  1NAF A;  2J4G A;  2ODU A;  4OHF A;  1IJ5 A;  3SWH A;  4EYU A;  2BBJ A;  3U3I A;  5JDN A;  4DO0 A;  2XTL A;  5EK4 A;  5LHG B;  2QA7 A;  3AXJ A;  2I59 A;  3W15 B;  4HN9 A;  3R6N A;  3FZK B;  3RYI E;  2KWH A;  2XQY A;  3UQ4 A;  4U2Y A;  4L9I A;  4LF4 T;  1D1C A;  3NWI A;  3AE2 A;  2W0G A;  3OBV E;  2BKN A;  1WR0 A;  5FXV A;  3ZMT B;  3LBX A;  2X68 A;  2ZM6 T;  2V7J A;  3P4S A;  3ZMZ B;  2H7O A;  2HN1 A;  4JUY A;  2EHO C;  4QKN A;  1CHU A;  2BZB A;  2XAJ B;  3TLW A;  4ZS3 A;  1ZKE A;  3E08 A;  3MZK B;  4XBF B;  1WFD A;  3HKD E;  4EOZ B;  1Y01 A;  2ZMA A;  3B13 A;  4ILB A;  2WCA A;  4KX6 A;  5ABE A;  2HH7 A;  5JDL A;  1I94 T;  3UUL A;  3ZT5 A;  4X62 T;  2LRK A;  3N9L A;  2PG8 A;  3CIR A;  3HA4 A;  4TWH A;  3CK6 A;  2CBJ A;  5FNV E;  2NTX A;  4EEB A;  3KFW X;  1YW0 A;  4EZ4 A;  2E9X C;  5LBQ B;  2WMN A;  2XAH B;  4H9O C;  2MBG A;  1HNW T;  1T98 A;  2VKD A;  3ONX A;  2X9W A;  2JQ9 A;  1IZN B;  3FZH B;  2XQA A;  2J1D G;  4CXX A;  3ZJ2 A;  1YKE B;  4IE7 A;  5HXE A;  3PUZ F;  3V5S A;  1G8X A;  2YOE A;  2UU9 T;  5AQT B;  5ABH A;  2XM1 A;  4GK0 E;  4CZZ B;  5AQH B;  2XSA A;  3P4P A;  1XZY A;  2KWI B;  4G2A A;  2IC6 A;  2JRK A;  3RC3 A;  2KND A;  3I0Q A;  1E7P A;  2VKH A;  4F6R C;  3OPC A;  4ZEY A;  3AE7 A;  4MAL A;  2PTF A;  1UUS A;  3L8R A;  1M7K A;  1ZOY A;  1HNZ T;  3PUA A;  2IUB A;  2CWY A;  4QXH B;  2CCQ A;  2K48 A;  5AQL B;  4H9S E;  2LSG A;  3K3Q C;  4WZX A;  1D0X A;  3AED A;  4YY3 T;  5DQW A;  1HTJ F;  2LSY A;  1VCS A;  4ZI3 C;  4A56 A;  3LG7 A;  5LA6 E;  4LMJ A;  1MMN A;  4UF0 A;  2XSB A;  4DND A;  3PE0 A;  2XQ4 A;  2BKO A;  1HS7 A;  4IIJ E;  2XM2 A;  3VKG A;  4WW0 A;  3MXZ A;  1W0B A;  4LFA T;  4HFI A;  3HKC E;  1LVK A;  1MIV A;  5E0O A;  3PUQ A;  4WNK A;  2W4X A;  3T1Y T;  4PJM A;  5L3G B;  2C0S A;  2W67 A;  4GYS A;  4JBW F;  3HKE E;  4G63 A;  5KX5 E;  2ZM8 A;  4IE4 A;  5LGT B;  1MMA A;  3N9N A;  2X9X A;  5JDF A;  4JI6 T;  1J5E T;  4AQG A;  2VKO A;  3VHL A;  3F2E A;  1MIY A;  2HN2 A;  3HI2 A;  4TV8 E;  4OX9 T;  3PUX F;  3C4W A;  5F8P A;  4HFE A;  2UXB T;  2W2U A;  5FY7 A;  3ESL A;  3JAD A;  3AVR A;  3B57 A;  4CI1 B;  1L0V A;  4AIS A;  4PK6 A;  5ETW A;  5LJN A;  5JR9 A;  3GN5 B;  1LRZ A;  2WMO A;  4E7S A;  2W63 A;  5H6Q B;  3BQI A;  2VVS A;  2XQ5 A;  4Z90 A;  5C3J A;  4QX8 B;  3JAF A;  1J1J A;  2CEA A;  3FB2 A;  4TZ4 C;  5FXX A;  2LOP A;  2C5K T;  4JI7 T;  4JI8 T;  4CQI A;  3NRY A;  4DR2 T;  1XDP A;  2MYS A;  2LM2 A;  3QC9 A;  5L3C B;  3RX6 A;  4P0A A;  3RLF F;  2BG9 E;  4AQF C;  3ZPO A;  3CQX C;  2UXC T;  4H63 V;  2D0T A;  2CMR A;  2YKS A;  1UCU A;  4YTM A;  4BJN A;  2VKJ A;  3CML A;  3PV0 F;  4DUY T;  4BJM A;  3KVA A;  3Q2M A;  5LOV E;  5C2T A;  3PUG A;  2E8I A;  4U33 A;  2LE8 A;  5FVK A;  3H37 A;  4B3M T;  1D0Y A;  2LRL A;  4EZH A;  3ZYK A;  3QB5 K;  3AEA A;  2W61 A;  5LP6 E;  4U7I A;  2ACX A;  3AEC A;  1WYC A;  3S4U A;  4QH5 A;  1HFA A;  5DJQ C;  3HR0 A;  4B3S T;  2X0L B;  4DR3 T;  1UGO A;  3OJA A;  4TV9 E;  4YT0 A;  5CFB A;  4AXP A;  1ZEE A;  3MJX A;  5JDQ A;  3P7I A;  4X65 T;  2XHE B;  5J2U E;  2UXN B;  4UV8 B;  5LHI B;  2WU2 A;  4H9P C;  5AQJ B;  3FZM B;  2KT9 A;  5HXC A;  3ZJ1 A;  2V7K A;  4O4J E;  2V5D A;  2EHO D;  4Q25 A;  4O4I E;  2Z6E A;  3FHN A;  5HXR A;  3UU4 A;  2LJL A;  2LEH A;  4AIU A;  3UUB A;  3ABV A;  2V8S V;  2MTQ A;  5FYM A;  1IBM T;  3UU8 A;  3ZYM A;  4HWC A;  2GK9 A;  3SRZ A;  4MLK A;  2V6X A;  5LNK A;  2VB6 A;  2KLQ A;  2D2S A;  2WU5 A;  4DVD A;  4U72 A;  3OKQ A;  4UEL A;  3C50 A;  5FP3 A;  4IHJ E;  1UX4 A;  1D0Z A;  4JI4 T;  3PUW F;  3C51 A;  1IBL T;  3P4R A;  3PUS A;  1FIO A;  1IAP A;  3AE6 A;  2EHO B;  2DHR A;  3ZCI A;  3UU6 A;  5HWY A;  2HHH T;  2OA5 A;  3P4W A;  3K3N A;  2MOZ A;  4ZS2 A;  3Q5D A;  4LFB T;  2X66 A;  3KVB A;  2WS3 A;  3AAE B;  2CE7 A;  2V6Y A;  5FY1 A;  1Y64 B;  4HWD A;  4ANJ A;  2Q9Q D;  4MHC A;  2NP9 A;  4ZXL A;  1KEY A;  5L4E A;  2LHR A;  4ZI7 E;  3ZN0 B;  3PU3 A;  1XMQ T;  1AJ3 A;  5C8Y E;  4DUZ T;  3LK2 B;  4JI1 T;  3DTO A;  1D1B A;  1KNZ A;  1OED B;  5HEG A;  2IAK A;  2JIW A;  4JV5 T;  4V1A v;  5AQR B;  4EXT A;  4IT4 A;  1N33 T;  3AAA B;  3VRB A;  2W00 A;  2D0U A;  3T1H T;  2Q9Q B;  5J2T E;  2FJD A;  2CPT A;  3PU8 A;  1HG2 A;  3PJA A;  4EIW A;  5HAX A;  5JDG A;  3H3M A;  1ZHC A;  2CM0 A;  3IF8 B;  5L47 A;  2M6B A;  2JMK A;  5FMN A;  1NEK A;  1S35 A;  4DR4 T;  3AE9 A;  2N9D A;  5AQQ B;  3EVY A;  2XY8 B;  5CA0 E;  5BMV E;  5EZY E;  5JDM A;  3N2K E;  4ERR A;  4TNW A;  1EZ3 A;  1MIW A;  3RPU A;  1MNE A;  4DV7 T;  3BK9 A;  1JNZ A;  4QH4 A;  4HKA A;  3OYX A;  2VWA A;  2BG9 A;  3AA6 B;  2H3R A;  3NKZ A;  4GKJ T;  3AE8 A;  2LLY A;  4YFS A;  4EV6 A;  1T8B A;  1X9B A;  1G73 A;  2N1G A;  2HPJ A;  2RPA A;  3F57 A;  4PW8 A;  3LBX B;  3O1I A;  2CWO A;  4KBM B;  5EK3 A;  5J0Z A;  2Y48 B;  4YLH A;  4X5T A;  1NEN A;  1VOM A;  1VRB A;  3TLV A;  3C98 B;  2YIN A;  3RIF A;  1XWM A;  4IE6 A;  2X9Y A;  4ZOL E;  2QGS A;  5CB4 E;  3RI5 A;  3R84 B;  5IUX A;  2PBI A;  5LBM A;  3K1S A;  1YQ4 A;  1OED C;  4QX7 B;  3AA0 B;  4IE5 A;  1X79 A;  4IDZ A;  3N5L A;  2W66 A;  5JRC A;  2BVL A;  4YSY A;  2Q9Q C;  3VU7 H;  2E5L T;  1YD8 G;  4A97 A;  2YU1 A;  4TUY E;  3N2G E;  3ZMS B;  4H63 H;  3E0Z A;  4U74 A;  4X1I E;  3C4X A;  3F31 A;  1U4Q A;  3ZT7 A;  4X20 E;  1E2A A;  2BS4 A;  2N2N A;  4UEM A;  2VL8 A;  3ZC1 A;  3BQL A;  5F5W A;  3WI3 A;  3K8P C;  4CXY A;  3O1H A;  5M4Y A;  3OTO T;  2M6I A;  5AQF B;  2K3W A;  3RGL A;  3RF1 A;  5AQO B;  4L0R A;  2A2F X;  4JI2 T;  4LF5 T;  4O2A E;  5F3J A;  3EI0 A;  2XUE A;  2XAF B;  2ZLY A;  4TNV A;  1J5W A;  2WZI A;  3N9O A;  2BBH A;  4L5G A;  3TLU A;  2V7M A;  4P1N A;  4DV5 T;  1IBK T;  3MAC A;  4UF0 B;  4WBN E;  2HPL A;  4DR7 T;  4DV0 T;  2WDV A;  5FKY A;  2VQE T;  3RIU A;  3RYH E;  4JLE A;  2XQ8 A;  2YN6 A;  4PK5 A;  2D9D A;  3NZQ A;  4J2C A;  3JCF A;  4DMV A;  3SFE A;  3NBX X;  2NTY A;  4OYK A;  4CI3 B;  4HFD A;  4PJN A;  3KV4 A;  3T8O A;  5HYA A;  4E7Z A;  5KDM C;  2SPC A;  5L3E B;  2VQF T;  3JAE A;  3X1D A;  3K3O A;  4EB6 E;  5HXH A;  3ZT6 A;  3B5M A;  5HEU A;  5AQV B;  2KIN B;  3ZLI A;  4LF6 T;  1E1H B;  4LF7 T;  3A8Y C;  2KMF A;  3RRC A;  3O9X A;  1N32 T;  4TN7 B;  4HFB A;  3UFE A;  1HG5 A;  2X51 A;  1SHZ C;  2BS2 A;  3ANW A;  3N9P A;  2VK9 A;  3KBU A;  4Z8X A;  2JMH A;  1UK5 A;  3I9Y A;  4U3C A;  4GYR A;  3NRX A;  3L39 A;  1XNQ T;  2QYW A;  4NIQ A;  2CA5 A;  4PJJ A;  5ADX L;  2UUC T;  5JR9 B;  2DWG A;  4CN1 A;  3HKB E;  2UUB T;  3KV6 A;  3M65 A;  4IGU A;  4EED A;  4X64 T;  4QHO A;  2FJA A;  2BS3 A;  3E22 E;  2LOS A;  3LJC A;  5JVD E;  2OV9 A;  5AQK B;  3RH3 A;  4KHZ F;  3QB5 A;  5ABG A;  4ADZ A;  3SS1 A;  2IHR 1;  2B1E A;  2J47 A;  4WYV A;  3Q9D A;  3GMI A;  4DV3 T;  3RQU A;  1OXZ A;  4A98 A;  2BVM A;  4CN4 A;  2D5U A;  2DWK A;  1D1A A;  4AKG A;  4F8H A;  1GQE A;  5FVL A;  5IYZ E;  1KNP A;  3KIN B;  2IML A;  4ASK A;  3ETV A;  2FJE A;  2WB5 A;  2V26 A;  2XJ7 A;  2K5B B;  5JH7 E;  3FBL A;  4O4L E;  2NW7 A;  3L3P A;  5CJ5 A;  2ZM2 A;  4UR9 A;  2C5I T;  2WP9 A;  1IJ6 A;  3UUX B;  4TWF A;  4B3T T;  3NVO A;  4YJ3 E;  1MND A;  4GIW A;  2X0H A;  3BQK A;  4TX5 A;  3V5U A;  2CXD A;  1WLX A;  4HWI B;  4IDP A;  3AE1 A;  2WSS V;  3PUV F;  5AFU L;  3C4Z A;  4TWD A;  2XAS B;  3G06 A;  4IE0 A;  4UVA B;  4YTN A;  4BA9 A;  5LGN B;  4N78 D;  3LDQ B;  1T72 A;  2YK0 A;  5AQI B;  4CI2 B;  3AEE A;  2EHO A;  2CXF A;  3AEB A;  2LM9 A;  1ZV4 X;  2A9U A;  1V9D A;  4ILC A;  3EAB A;  4FI5 A;  3ZSS A;  3EDV A;  2FJB A;  2XAG B;  4O8S A;  5JR9 C;  3GA8 A;  3UFG A;  3PUY F;  1W9R A;  4YHJ A;  2WWU A;  5LHH B;  2AE9 A;  4JYA T;  3A7M A;  3EAM A;  5L3D B;  2X9H A;  1US7 B;  3IBP A;  5A1L A;  2E9X A;  3O4X E;  4IDO A;  5ABF A;  2V6Y B;  3O1J A;  2UXX B;  3RHW A;  1ZP0 A;  2ES0 A;  3I9W A;  3KDS E;  4I55 E;  4HFC A;  2LSI A;  3FXD B;  2ACZ A;  3RYC E;  2XQ6 A;  4DID B;  4Z91 A;  3VKH A;  4QXB B;  3RKG A;  4ZI2 D;  3PJA J;  4LF9 T;  1JNR A;  1FMV A;  2K24 A;  3P8C D;  4X66 T;  4U2Z A;  2L9Q A;  3SOL A;  1VCT A;  4DV6 T;  3A5X A;  4NXM T;  4AKR B;  2YDQ A;  3OVU A;  3P50 A;  3MK7 C;  5L3F B;  3ONL C;  5AQG B;  5LB7 B;  4NPP A;  1FEW A;  4DBR A;  3UT5 E;  3ETU A;  4JEU B;  5EK2 A;  5LYJ E;  3AE5 A;  1N36 T;  3WAJ A;  2NOX A;  3AE4 A;  3HL6 A;  3FBZ A;  4O4H E;  3AXJ B;  5L2L A;  2AXD S;  4OK0 A;  2WWV A;  3TLS A;  5LJM A;  1BR1 A;  4ISS A;  4QXC B;  4HE8 A;  4HTE A;  4JI0 T;  3EHZ A;  3ZMV B;  3LK3 B;  4AKI A;  2BKP A;  4LF8 T;  5FL1 A;  1OWA A;  2CLY B;  5HXS A;  4HFH A;  1MMD A;  5HCM A;  1WRD A;  4U31 A;  3L09 A;  2YDR A;  4PAG A;  2BG9 B;  2QVA A;  4IDQ A;  2L3L A;  5CA1 E;  2XPK A;  2CRB A;  5LGU B;  2JQQ A;  3JC6 D;  1HX1 B;  4XAX B;  2RA1 A;  1YKH B;  4LML A;  4B3R T;  2ODV A;  2E2A A;  4HGA A;  5BR8 T;  4DV1 T;  3DJB A;  4GOU A;  2IDO B;  2JQK A;  3QK6 A;  3UU5 A;  2IIU A;  2W62 A;  4LFC T;  3ZKR A;  4YJ2 E;  1HF8 A;  2J62 A;  5H6R B;  2H7V C;  5HWX A;  4PNI A;  4IRE A;  5FY0 A;  4AKL A;  4ILU A;  4EGW A;  3EDU A;  2VL0 A;  3VRA A;  2Y8D A;  2JJ9 A;  3CX8 B;  3PDY A;  5DQV A;  2X0Y A;  4AQF A;  4KI0 F;  2LKH A;  2FUP A;  5LMU T;  5JRC B;  4HFV A;  4PFO A;  3IHR A;  4KHP T;  2CXL A;  2LKG A;  1YQ3 A;  2DNX A;  2BDE A;  3I0O A;  1WCR A;  2VUR A;  1U5P A;  2E5V A;  1R8I A;  2WY2 A;  4K0K T;  4ZI2 C;  2YEV C;  2V7L A;  5JDH A;  5L3B B;  5AQU B;  2XQ3 A;  4CN6 A;  2F4V T;  3CPZ A;  2NR4 A;  1SE7 A;  1CUN A;  2XZE A;  3ONJ A;  2LT3 A;  2JQH A;  4YTP A;  4ZHQ E;  2WDQ A;  4HWF A;  2FBW A;  4COF A;  3CX7 B;  3PTR B;  3J9X 1;  4UVB B;  3ZCJ A;  1HR0 T;  5CGM A;  3LK4 2;  4X1K E;  2CBI A;  1QLB A;  3CQG B;  5J1G A;  4P0B A;  2MAW A;  1OED E;  3M3Z B;  4DR5 T;  3UTK A;  2CLY C;  4MFR A;  4M1P A;  4DR6 T;  2M67 A;  1NWM X;  2H88 A;  1H7C A;  5FXW A;  3ZN1 B;  4UV9 B;  2CHO A;  3U78 A;  1UUR A;  4NUU A;  1KK7 A;  1LVF A;  3QNU A;  2BG9 C;  3DP7 A;  3ZYL A;  3MA9 A;  3RIA A;  3N2O A;  4XZC A;  2DI4 A;  3LFM A;  3AAI A;  5JTG A;  4C90 A;  4MBQ A;  4NUV A;  3UQ7 A;  3IA3 A;  5HCJ A;  3AB3 B;  5AQS B;  4OFZ A;  2NWB A;  3QUJ A;  1M62 A;  4QH1 A;  4K0U A;  4IL4 A;  2VVN A;  4C91 A;  2KSR A;  3AA1 B;  2C5J A;  2Y6X A;  2ZM0 A;  2V7I A;  1KNR A;  4KUM B;  3QOF A;  4H9Q C;  3GN5 A;  2V5C A;  3CX6 B;  1SA0 E;  3AA7 B;  3N9M A;  4I4T E;  4YSZ A;  1N34 T;  2UUA T;  4U7Y A;  5LG4 A;  3AEF A;  3I1A A;  3D0T A;  5HEH A;  3KBT A;  1WR6 A;  3UUM A;  4YHH T;  3EUH A;  1W09 A;  3JC6 C;  2WAU A;  3IEE A;  2RP4 A;  3RKO A;  4EAH A;  2DL1 A;  3ANW B;  5L4H A;  2WQY A;  1O3X A;  2K9A A;  3VR8 A;  5HEJ A;  4O2B E;  2H89 A;  3Q5E A;  1S94 A;  5LCY A;  3SFD A;  1BR0 A;  1I6Z A;  4PJL A;  4JEH B;  5HEO A;  1LKX A;  3P4Q A;  5LG3 A;  4CXW A;  5DAB A;  4PFP A;  2DCF A;  3AEG A; 
#chains in the Genus database with same CATH homology
 2XAQ B;  3CWZ B;  4QWN B;  4YFS A;  1FMW A;  4DND A;  3RC8 A;  3OYZ A;  3PE0 A;  1G73 A;  2N1G A;  2HPJ A;  3F57 A;  4PW8 A;  3LBX B;  2IW5 B;  2X9H A;  1US7 B;  5L3D B;  1HS7 A;  4IIJ E;  3IBP A;  3O1I A;  5A1L A;  4OYJ A;  2CWO A;  4KBM B;  5EK3 A;  2E9X A;  2Y48 B;  4YLH A;  3VKG A;  4GK5 E;  5JQG E;  3O4X E;  2LHN A;  1VOM A;  1VRB A;  4WW0 A;  3MXZ A;  3CKD A;  2NW9 A;  1BR4 A;  4IST A;  3HKC E;  1LVK A;  1MIV A;  5E0O A;  2DLR A;  3PUQ A;  4WNK A;  3O1J A;  4HEA A;  4DBQ A;  2UXX B;  1HX8 A;  2L8K A;  2ES0 A;  3I9W A;  2IC9 A;  3KDS E;  4I55 E;  4PJM A;  2JPF A;  5L3G B;  2LSI A;  3FXD B;  2V1D B;  3RYC E;  3C98 B;  2YIN A;  2C0S A;  3VKH A;  4GYS A;  4IE6 A;  4I43 B;  2X9Y A;  3HKE E;  4ZOL E;  1QSD A;  2QGS A;  4QXB B;  5CB4 E;  4G63 A;  5KX5 E;  3TKL B;  3R84 B;  2ZM8 A;  2A3D A;  2PBI A;  4ZI2 D;  4UXN B;  4IE4 A;  2WBL A;  5LGT B;  3C64 A;  1MMA A;  4BAY B;  3N9N A;  1FMV A;  5LBM A;  2K24 A;  2X9X A;  5JDF A;  3P8C D;  4B6X A;  4AI6 A;  3H3A A;  2L9Q A;  3SOL A;  3UUN A;  4X1Y E;  3A5X A;  4AQG A;  2VKO A;  4AKR B;  3VHL A;  3J7Y q;  3F2E A;  1MIY A;  3HI2 A;  4QX7 B;  4UVC B;  4TV8 E;  3AA0 B;  4IE5 A;  5IHY A;  1X79 A;  3MK7 C;  4IDZ A;  5L3F B;  2VAS A;  1MMG A;  3N5L A;  3C4W A;  5F8P A;  5JRC A;  2BVL A;  5FY7 A;  3ESL A;  2Q9Q C;  3AVR A;  1FEW A;  3VU7 H;  4DBR A;  3UT5 E;  3ETU A;  3B57 A;  4JEU B;  5EK2 A;  4CI1 B;  5LYJ E;  1YD8 G;  4PK6 A;  5ETW A;  5LJN A;  3AVS A;  2YU1 A;  1WYB A;  4TUY E;  5JR9 A;  3GN5 B;  3N2G E;  3ZMS B;  1LRZ A;  4H63 H;  2WMO A;  3E0Z A;  4E7S A;  4U74 A;  2PFV A;  3NZP A;  4X1I E;  3C4X A;  2W63 A;  5H6Q B;  3F31 A;  4I50 E;  3WAJ A;  3BQI A;  2NW8 A;  2NOX A;  1Z0P A;  1U4Q A;  1QUU A;  3HL6 A;  4QX8 B;  5LXT E;  3FBZ A;  4O4H E;  1BR2 A;  2CEA A;  3FB2 A;  4TZ4 C;  5FXX A;  4X20 E;  4EYY R;  5L2L A;  2LOP A;  2N2N A;  4UEM A;  2C5K T;  5JRE A;  2VL8 A;  1HCI A;  3ZC1 A;  4CQI A;  3BQL A;  3NRY A;  3WI3 A;  2MYS A;  2LSJ A;  4OK0 A;  4UIG A;  3K8P C;  3QC9 A;  4CXY A;  5L3C B;  3RX6 A;  5LJM A;  3CVR A;  1BR1 A;  3O1H A;  5M4Y A;  4P0A A;  4ISS A;  2A72 A;  2YU2 A;  4QXC B;  4HE8 A;  4HTE A;  4AQF C;  3ZPO A;  2E9X D;  3CQX C;  3ZEF B;  3KV9 A;  3ZMV B;  2LSK A;  3PUR A;  3LK3 B;  2KXP B;  4H63 V;  4AKI A;  3Q5W A;  4L0R A;  2A2F X;  2D0T A;  2CMR A;  1UCU A;  4BJN A;  1OWA A;  4O2A E;  5F3J A;  2VKJ A;  2CLY B;  3CML A;  5HXS A;  2XUE A;  4BJM A;  2XAF B;  3KVA A;  2ZLY A;  2P9B A;  3Q2M A;  5LOV E;  1MMD A;  3PUG A;  3CQC B;  2E8I A;  3N9O A;  4L5G A;  1WRD A;  2LE8 A;  2V7M A;  5GON E;  3L09 A;  3FXE B;  3H37 A;  3ZC0 A;  4PAG A;  4H9N C;  1D0Y A;  3MAC A;  4UF0 B;  4WBN E;  2HPL A;  3GWH A;  4EZH A;  3ZYK A;  3RYH E;  4H9R C;  2L3L A;  4WBO A;  4JLE A;  5CA1 E;  4PK5 A;  3NZQ A;  4DMV A;  4J2C A;  5LGU B;  2JQQ A;  3JC6 D;  4XAX B;  2RA1 A;  2W61 A;  1UX5 A;  1YKH B;  2E9X B;  3NBX X;  2X67 A;  2NTY A;  4OYK A;  4CI3 B;  5LP6 E;  4PJN A;  2G0U A;  3KV4 A;  4KP3 C;  2ODV A;  2ACX A;  3T8O A;  4HGA A;  3RYF E;  5HYA A;  1WYC A;  5TAO A;  2WM9 A;  3DJB A;  4GOU A;  3S4U A;  4E7Z A;  2SPC A;  5KDM C;  2Q9Q A;  5L3E B;  1HFA A;  2PJQ A;  5DJQ C;  3KV5 A;  3HR0 A;  3QK6 A;  3MKD A;  3K3O A;  2W62 A;  4KMC A;  4EB6 E;  4P09 A;  5HXH A;  2X0L B;  4FJO A;  4TV9 E;  3OJA A;  4YJ2 E;  4PK4 A;  1HF8 A;  4AXP A;  5H6R B;  3WAK A;  1ZEE A;  3ZMU B;  2KZ7 B;  2KIN B;  3MJX A;  3ZLI A;  5JDQ A;  3P7I A;  2H7V C;  2XHE B;  1B7T A;  5J2U E;  2UXN B;  5FXZ A;  5HWX A;  4PNI A;  5KMG P;  4ZI3 D;  1E1H B;  4UV8 B;  5FY0 A;  5LHI B;  4AKL A;  4AKH A;  4H9P C;  3N9Q A;  4ILU A;  2KMF A;  3RRC A;  4DMW A;  3O9X A;  3Q5X A;  4TN7 B;  2KT9 A;  5HXC A;  3RRW A;  3ZJ1 A;  1NAF A;  2V7K A;  3EDU A;  4O4J E;  2EHO D;  4O4I E;  2Z6E A;  2ODU A;  3FHN A;  3UFE A;  1HG5 A;  2X51 A;  4OHF A;  1IJ5 A;  2Y8D A;  1SHZ C;  3ANW A;  5HXR A;  3SWH A;  3N9P A;  2VK9 A;  2JJ9 A;  3KBU A;  4Z8X A;  3CX8 B;  4EYU A;  3U3I A;  5JDN A;  2JMH A;  4DO0 A;  3PDY A;  2LJL A;  2LEH A;  2XTL A;  3I9Y A;  5EK4 A;  5DQV A;  5LHG B;  4AQF A;  4GYR A;  2QA7 A;  2MTQ A;  5FYM A;  3NRX A;  3ZYM A;  5JRC B;  2GK9 A;  2I59 A;  4HFV A;  3IHR A;  4PFO A;  3SRZ A;  2CXL A;  4MLK A;  3W15 B;  2CA5 A;  2DNX A;  4HN9 A;  2BDE A;  4PJJ A;  5ADX L;  5LNK A;  2VB6 A;  3I0O A;  3R6N A;  1U5P A;  2KLQ A;  2D2S A;  3RYI E;  2KWH A;  4DVD A;  2XQY A;  4U72 A;  4ZI2 C;  2YEV C;  3OKQ A;  3C50 A;  4UEL A;  5JR9 B;  4L9I A;  5FP3 A;  4IHJ E;  1UX4 A;  2V7L A;  1D0Z A;  2DWG A;  3C51 A;  1D1C A;  3PUS A;  3HKB E;  5JDH A;  3KV6 A;  3M65 A;  4IGU A;  5L3B B;  1FIO A;  3CPZ A;  4QHO A;  1CUN A;  1IAP A;  2EHO B;  2W0G A;  3OBV E;  2LT3 A;  3E22 E;  2DHR A;  2LOS A;  3ZCI A;  3LJC A;  5FXV A;  3ZMT B;  4ZHQ E;  3LBX A;  2X68 A;  5HWY A;  5JVD E;  2V7J A;  2OA5 A;  3RH3 A;  3CX7 B;  3PTR B;  3ZMZ B;  2H7O A;  4ADZ A;  3J9X 1;  3K3N A;  3SS1 A;  2MOZ A;  4UVB B;  4JUY A;  4ZS2 A;  3ZCJ A;  2B1E A;  3LK4 2;  2X66 A;  4X1K E;  2EHO C;  3CQG B;  5J1G A;  4QKN A;  3KVB A;  2BZB A;  2XAJ B;  4P0B A;  3AAE B;  2CE7 A;  4ZS3 A;  1ZKE A;  3E08 A;  3Q9D A;  3UTK A;  3GMI A;  3MZK B;  2CLY C;  4MFR A;  5FY1 A;  4XBF B;  4M1P A;  1OXZ A;  1Y64 B;  2M67 A;  3HKD E;  2Q9Q D;  4ANJ A;  4EOZ B;  1NWM X;  2ZMA A;  3B13 A;  4MHC A;  1H7C A;  2NP9 A;  2BVM A;  5FXW A;  3ZN1 B;  4UV9 B;  2D5U A;  2DWK A;  2LHR A;  4ZI7 E;  3U78 A;  2HH7 A;  1D1A A;  5JDL A;  4AKG A;  3UUL A;  3ZN0 B;  4NUU A;  1KK7 A;  1LVF A;  3PU3 A;  3DP7 A;  3ZYL A;  3MA9 A;  1AJ3 A;  3N9L A;  5C8Y E;  3N2O A;  5IYZ E;  4XZC A;  2DI4 A;  2PG8 A;  3AAI A;  3LFM A;  3LK2 B;  4C90 A;  3DTO A;  1D1B A;  4MBQ A;  3HA4 A;  3KIN B;  1KNZ A;  4ASK A;  3ETV A;  4NUV A;  5FNV E;  2NTX A;  2V26 A;  2K5B B;  2IAK A;  3KFW X;  5JH7 E;  3AB3 B;  1YW0 A;  4V1A v;  4EZ4 A;  2E9X C;  3FBL A;  4OFZ A;  4O4L E;  4EXT A;  5LBQ B;  2NW7 A;  2WMN A;  3AAA B;  2NWB A;  2XAH B;  3QUJ A;  4H9O C;  2MBG A;  3L3P A;  1T98 A;  2VKD A;  4K0U A;  3ONX A;  2X9W A;  2ZM2 A;  2C5I T;  2W00 A;  1IZN B;  4C91 A;  2D0U A;  3AA1 B;  2Q9Q B;  2C5J A;  1IJ6 A;  2Y6X A;  2ZM0 A;  2V7I A;  4KUM B;  3UUX B;  5J2T E;  2J1D G;  4CXX A;  4H9Q C;  3ZJ2 A;  1YKE B;  4IE7 A;  3GN5 A;  3CX6 B;  5HXE A;  3PU8 A;  1HG2 A;  4YJ3 E;  1SA0 E;  4EIW A;  3AA7 B;  5HAX A;  3V5S A;  5JDG A;  3N9M A;  4I4T E;  1G8X A;  1MND A;  4GIW A;  1ZHC A;  5LG4 A;  3BQK A;  2CM0 A;  3I1A A;  3IF8 B;  4TX5 A;  3D0T A;  3V5U A;  2CXD A;  1WLX A;  4GK0 E;  4CZZ B;  3KBT A;  2JMK A;  1WR6 A;  3UUM A;  2KWI B;  2WSS V;  4G2A A;  5FMN A;  2IC6 A;  3EUH A;  2JRK A;  5AFU L;  3RC3 A;  1S35 A;  2KND A;  3JC6 C;  2WAU A;  3C4Z A;  3I0Q A;  2XAS B;  2VKH A;  3IEE A;  4F6R C;  2N9D A;  4IE0 A;  3EVY A;  2RP4 A;  5CA0 E;  3RKO A;  4UVA B;  4EAH A;  5BMV E;  5EZY E;  3ANW B;  1O3X A;  4MAL A;  2K9A A;  4BA9 A;  5JDM A;  5LGN B;  4N78 D;  3N2K E;  4O2B E;  4ERR A;  1S94 A;  3PUA A;  2YK0 A;  4CI2 B;  2EHO A;  5LCY A;  2CWY A;  4QXH B;  2CXF A;  2CCQ A;  2K48 A;  2LM9 A;  1ZV4 X;  1EZ3 A;  1BR0 A;  1V9D A;  4PJL A;  4JEH B;  4H9S E;  2LSG A;  3K3Q C;  4FI5 A;  1D0X A;  1MIW A;  3EDV A;  1LKX A;  2XAG B;  3RPU A;  4O8S A;  1MNE A;  5JR9 C;  5DQW A;  3GA8 A;  4CXW A;  1HTJ F;  2LSY A;  4ZI3 C;  4A56 A;  3LG7 A;  5LA6 E;  3BK9 A;  4HKA A;  3OYX A;  5DAB A;  4PFP A;  2VWA A;  2DCF A;  4YHJ A;  2WWU A;  4UF0 A;  3AA6 B;  2H3R A;  5LHH B;  1MMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...