2LSYA

Structure of the c-terminal domain from human rev1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsyA00
4BA9A 2LSIA 2LSYA 2LSJA 4FJOA 4EXTA 4GK0E 2LSKA 3VU7H 2N1GA 2LSGA 4GK5E
chains in the Genus database with same CATH superfamily
3UT5E 1XWMA 1YKEB 5LJNA 2CPTA 3I9YA 3CWZB 3LJCA 1Z0PA 4X64T 4LF7T 3L39A 3CKDA 2V26A 5J1GA 2FBWA 2LSYA 5HXHA 1XDPA 4ANJA 4DUZT 2LSGA 2YDSA 4TWFA 5LGTB 2ZMAA 3R84B 1D1BA 4L5GA 2D9DA 3RQWA 4ZZBA 4AKHA 2VB6A 5J2TE 2CHOA 4DV0T 4UV9B 1U4QA 2K3WA 4UIGA 4AQFA 4QH4A 2J47A 1T72A 3RQUA 2Q9QB 1US7B 2A2FX 2DI4A 4UEMA 3CQCB 5AQSB 3F57A 2WWVA 4JYAT 1NEKA 2JMKA 1O3XA 2XPKA 3FB2A 3K8PC 2V7IA 2BVMA 4EEBA 1MMNA 3N9OA 3TLVA 4F8HA 1M62A 2KWIB 2CM0A 3ABVA 1KF6A 1T8BA 5IYZE 4CN1A 3N5LA 4G2AA 2JIWA 2FJBA 4A98A 3V5UA 4GYRA 3N2GE 4AKRB 2NTYA 5AQNB 4QX7B 4WBNE 3PUQA 4UELA 5DQVA 4NXNT 2N2NA 4JI7T 3B13A 5IUXA 2V1DB 1R8IA 2XQ3A 5LXTE 2JQQA 3RKOA 4GYSA 1WYCA 2X51A 3LFMA 2MPKA 3AE6A 4I50E 3DP7A 2BG9A 3F2EA 2Y48B 4KI0F 1L0VA 4GOUA 4IDQA 1WFDA 4LMKA 2C5KT 2E9XD 4JLEA 1HFAA 1G73A 2E5VA 2HN1A 2UXNB 3TLUA 2V7JA 2X9HA 2XQ7A 2FJEA 2RP4A 3MA9A 3FZFB 1T7SA 4A5XA 5LA6E 5IHYA 3EABA 4OYKA 2ODUA 3L3PA 4WYVA 1YQ3A 2DWGA 1HCIA 5JREA 2LSIA 2J4GA 3ZMVB 2NW7A 5LOVE 4Q25A 1XMQT 4CXXA 3PUGA 4IHJE 3ZMSB 3LBXB 1Z8UA 4IGUA 5ABGA 4PK4A 2BKOA 3JC6D 2YDRA 5L3FB 1N33T 4GIWA 2I59A 4XAXB 2QRXA 2JQHA 2GK9A 3RLFF 5F3JA 3ETUA 3C50A 3IHRA 5CJ5A 1NWMX 4X5TA 1FEWA 3N2OA 4EYUA 3CMLA 2I0MA 3SOLA 1S94A 4H9PC 4X1YE 2EHOD 3PUXF 3FZMB 3I1AA 4TWHA 4KHPT 3AXJA 4P0BA 3E0ZA 3LK42 2XAHB 4CI3B 4H9OC 3KBUA 4AKLA 2NR4A 5L3GB 2LRLA 4DUYT 5HEGA 3AEAA 5FKYA 2VVNA 1Y64B 3AE4A 3ANWA 2KLQA 1QLBA 4PK6A 4KHZF 5CA1E 3UUMA 4IT4A 4H9NC 5CA0E 3K3NA 2XASB 2L3LA 2UXCT 1FMWA 4DR1T 4TN7B 2X9XA 3TKLB 3J7Yq 5LG4A 1VRBA 3N9QA 2WU5A 2KMFA 2VKJA 5HWYA 1YKHB 4HWHA 3ZMTB 4ZZCA 2KWHA 2VKOA 2IAKA 3VRAA 2R6GF 4I55E 2HH7A 2RPAA 3OJAA 2QYWA 5JR9C 5IWAT 4QXHB 2M67A 4DNDA 4OX9T 3UU6A 1ZEEA 2ACXA 4QXBB 4EZ4A 4YXDA 4HE8A 5FL0A 3N9LA 4V1Av 5AQQB 2I6HA 3AE7A 2CWYA 3GMIA 2E5LT 2D0UA 1ZP0A 3OKQA 2W00A 2LEHA 4YT0A 1KNPA 2DHRA 2PG8A 3P8CD 3N2KE 3OBVE 2CHNA 3RIUC 3UQ4A 1OEDC 3AEEA 4YSYA 4ADZA 3HR0A 3ZPOA 3N9PA 5LNKA 2V7MA 3KINB 1S35A 3ZMUB 5L47A 4IL9A 2X0YA 2X9WA 1NAFA 2DCFA 2Q9QD 2ZM0A 3AA0B 1M7KA 5EK2A 4QXCB 2VQET 3JAEA 3I0QA 4KBMB 4TNVA 4TZ4C 4JI1T 1IAPA 2XAQB 5CB4E 5LHHB 2EHOC 2W61A 2V7LA 4ISSA 3VR8A 4P09A 5HAXA 3PU8A 4OK0A 3QUJA 2PTFA 3ZLIA 3KDSE 2W62A 4U31A 2BG9B 3H37A 5ETWA 2UU9T 5BR8T 3ONLC 2WP9A 4O8SA 3TLSA 3UULA 4HWCA 3PUVF 4JI2T 3NRYA 3HA4A 1D0ZA 5JQGE 1IBLT 1FIOA 3JCFA 3DJBA 5FY7A 4O4IE 5HEUA 5AQGB 1T98A 5L4EA 4EOZB 3C51A 5L3EB 5JVDE 5HEHA 2AXDS 1XNRT 2N9DA 4IDNA 4J2CA 3CPZA 5FY0A 2XJ7A 3QB5A 2VVSA 5LGUB 2WM9A 3PJAA 2H89A 4AKIA 1KK7A 2XUEA 2BS3A 2BZBA 3Q5WA 2MTQA 1XZYA 3HL6A 4DV7T 3AE2A 1QUUA 4M1PA 3A8YC 3AE3A 4X1KE 3E08A 4JBWF 5C8YE 4UVAB 1OEDE 2WB5A 3FZKB 4K0KT 4UXNB 4G63A 4HWFA 1N32T 3EAMA 5HCMA 2CRBA 3LG7A 4QH1A 3AXJB 5M4YA 4WW0A 3NZQA 4ZS2A 3MXZA 3ANWB 4OHFA 3RC8A 5AQTB 1YD8G 5L3BB 3UTKA 2OA5A 2MOZA 3ZN1B 2WZHA 3NZPA 4HWDA 2W66A 2V6YA 2DNXA 3T1HT 1WYBA 2JRKA 4BA9A 1SE7A 2A9UA 3RRCA 5ADXL 2LKHA 4PW8A 5AQMB 3KV6A 3QNUA 1VOMA 3ZKRA 3KBTA 2M6IA 2FJAA 4EYYR 5ABHA 4MALA 4EGWA 2H7VC 2W63A 4Z91A 2YEVC 1HG5A 3AEDA 2CCQA 2BS2A 3UQ7A 2L8KA 2CBJA 2UUAT 3G06A 5H6RB 2WSSV 3NRXA 4YSZA 2WWUA 5TAOA 3IF8B 2G0UA 2X9YA 5HEOA 5LHIB 4ZI2D 5A1LA 2XM2A 2D5UA 3O1JA 2IC6A 5ABFA 2ZM2A 3PUYF 3LK2B 3CX8B 4HFHA 4HFVA 5FXVA 5AQVB 4IDPA 1WLXA 3NKZA 4QH5A 5JR9A 5BMVE 4LF4T 4U72A 4AIUA 3MK7C 1MMDA 2XAFB 3J9X1 3KFWX 3P4PA 4U3CA 1UCUA 4JEHB 2LT3A 5JDLA 3AE1A 2WY2A 3Q5EA 3PJAJ 2HN2A 1UGOA 2UXBT 5LJMA 4DO0A 4N78D 3ONXA 2D0TA 4JV5T 1E7PA 4KUMB 4IE4A 4TUYE 4QHOA 1FMVA 5JDMA 1CHUA 2QVAA 3OTOT 2A72A 2ES0A 3RHWA 3RIUA 3UUXB 2ODVA 3AAAB 2KXPB 1GQEA 3AEFA 3PV0F 4NUVA 4UVCB 4YJ3E 1UURA 4TWDA 2YK0A 3HKEE 1MNDA 3Q5DA 4YJ2E 4EIWA 4K0UA 4DV5T 3B5MA 3RF1A 4YTMA 2DWKA 3NVOA 5FY1A 2CLYB 2WDRA 1HNXT 4X62T 1YQ4A 2W4XA 3UUNA 3TLWA 2DLRA 2KZ7B 4O4LE 5EZYE 3I0OA 3MJXA 4U74A 2VQFT 3UU4A 4NIQA 3PE0A 3RIFA 4COFA 3C4WA 1CUNA 3SFEA 3V5SA 2B1EA 2WBLA 2FUPA 5LMNT 2E8IA 2XAGB 4YTNA 3VHLA 3IBPA 1W0AA 3P4RA 5ABEA 4O4JE 1NENA 5HXCA 5LB7B 1WR0A 3KV4A 5JDGA 4UF0A 5LCYA 4NPPA 2DL1A 4YHJA 2LM2A 2QA7A 5AQJB 1DU2A 2ZLYA 2WMOA 5JH7E 4PJMA 3CQGB 1HNZT 5LBQB 3C98B 3JADA 5AQFB 5FVKA 4DIDB 2XZEA 3T8OA 3ZJ2A 4LF8T 1E1HB 2NOXA 5L4HA 1ZHCA 4JI3T 3OVUA 2LJLA 5J0ZA 1Y01A 3ESLA 3EUHA 5JDNA 3ZYLA 2IUBA 3ZT6A 4AQYT 2BDEA 5KMGP 3FXEB 5H6QB 2IIUA 3KV5A 3GWHA 5AQPB 4QKNA 5DQWA 2LOSA 2V6YB 4OFZA 4EV6A 4ZI3D 4CXWA 2NW9A 5FMNA 4YSXA 5AQUB 3SS1A 3LK3B 4CI1B 2C0SA 2VURA 2WAUA 2W0GA 3FXDB 2PJQA 3ZC0A 2E9XC 3AEBA 4O4HE 4DR4T 2JQ9A 4LMLA 3C4XA 4YY3T 3ZN0B 2CXFA 3FHNA 1VCSA 4QX8B 1U5PA 3ZYMA 1LRZA 4X65T 5ABFB 3S4UA 2CBIA 4WZXA 4U7IA 3UU3A 5JR9B 3RH3A 4EZHA 3JC6C 3FZHB 3P50A 5FNVE 5HXEA 4OYJA 5FXZA 2XSAA 2XQYA 2J1DG 4DR2T 5LP6E 3WI3A 4JUYA 2ZM6T 2MBGA 3UU5A 4ILBA 1LVFA 2KNDA 4UV8B 2NTXA 2XQ9A 1X79A 2W2UA 4JI8T 2QGSA 2P9BA 3C4ZA 2Z6EA 4DV6T 2LE8A 4EXTA 4YHHT 2V6XA 3RYFE 3QB5K 2A3DA 3AA1B 5KX5E 3ZYKA 2E2AA 2NWBA 2LSJA 3RI5A 3AE8A 4PJJA 4C90A 2WQYA 4DR6T 3F31A 3RYHE 3AAEB 4TNWA 2BVLA 3ZCJA 2VK9A 4MLKA 1V9DA 4HFEA 3ZT5A 3EI0A 4CXYA 3X1DA 2XQAA 3P4QA 5J2UE 4TV8E 5FYMA 4HEAA 4YFSA 1HTJF 4L9IA 3A7MA 2CWOA 4CN4A 4LF9T 3BK9A 3W15B 4NXMT 4A56A 2LM9A 2F4VT 4ZI3C 3BQKA 1ZV4X 5JRCA 3H3MA 1HF8A 4LFAT 5AQKB 2CA5A 2XQ4A 1VCTA 1BR0A 4IREA 3IEEA 4UF0B 4PJNA 2J62A 2C5JA 1D1CA 5JDFA 2UUCT 4ZI7E 3CIRA 1UX4A 1N34T 4BJNA 4TV9E 4GKKT 3AEGA 2ZM8A 1UX5A 2UXXB 3ZC1A 1KEYA 2WDQA 3ONJA 3JAFA 4H9SE 2WZIA 5HEJA 4AXPA 4U33A 2N1GA 1JNRA 3N9NA 3GN5A 3RRWA 3WAKA 1IBMT 2JQKA 4AI6A 3CK6A 3ZCIA 4JI6T 4B3ST 2YKSA 4BJMA 4DVDA 4B3RT 2VL8A 1SHZC 3ZT7A 4TX5A 5AQOB 1SUMB 4HFCA 5HYAA 1W09A 3SRZA 4CQIA 2Q9QC 3PDYA 2FJDA 2YU2A 3U3IA 1HS7A 2LHNA 4U2YA 1N36T 4ASKA 1MIWA 4BAYB 3B57A 4IE0A 2VL0A 4I43B 4HFDA 2V8SV 2BKNA 3ZSSA 2VKHA 3PTRB 5DJQC 4HTEA 1BR4A 3AVSA 1MNEA 1HX1B 2CXLA 3KVAA 3FBLA 2KINB 3GA8A 2W67A 2WDVA 3RIAA 3AECA 4HFBA 2WS3A 4ZEYA 2V5CA 2CXDA 5F5WA 3Q9DA 3MZKB 2KT9A 1IZNB 2LOPA 4A97A 4DR5T 2ACZA 1BR1A 4O2BE 4IDOA 1X9BA 2X67A 3MKDA 2RA1A 5FVLA 4HGAA 2C5IT 5AQHB 2IMLA 1D1AA 2LRKA 2OV9A 3BQIA 4YLHA 3O4XE 2PBIA 4DR7T 4IL4A 3LDQB 2VKDA 5GONE 4XBFB 3RPUA 1AJ3A 4IDZA 4UVBB 4E7SA 4Z8XA 2E9XA 2K24A 5EK4A 2UUBT 4JI4T 2BBHA 3O1IA 4DV2T 4WBOA 3UUBA 4MBQA 1MMGA 4NUUA 4DV3T 3AVRA 2CLYC 2XHEB 3RX6A 4PAGA 2JPFA 4DMVA 4F6RC 4PNIA 4DBRA 3O9XA 1OEDA 4JEUB 4FI5A 4ERRA 1IJ5A 5LYJE 2CE7A 5LMUT 4HFIA 2JJ9A 1QSDA 2WCAA 2WU2A 4FJOA 3KVBA 2XM1A 2MAWA 2YINA 2LKGA 4ILAA 3TLTA 2PFVA 4P0AA 2LSKA 4XZCA 4AKGA 5KDMC 5HWXA 1I94T 1MIYA 2SPCA 4IE5A 2IC9A 4AQGA 1OWAA 3VU7H 4CN6A 2K48A 2EHOA 1SA0E 2Y8DA 4CZZB 2XSBA 1W9RA 2BBJA 2OLTA 2BS4A 3PU3A 4PJLA 4C91A 4LFCT 3HI2A 3I9WA 2YDQA 3RC3A 2HHHT 2WMNA 3QOFA 2YU1A 1MIVA 3WAJA 5JRCB 5L2LA 1J5WA 2XTLA 3AA6B 2LLYA 5HXSA 5LHGB 1XDOA 1HR0T 1JNZA 4KP3C 3VRBA 4B3MT 4X66T 3BQLA 3P7IA 3RYCE 1ZKEA 2BKPA 5HXRA 2XY8B 1EZ3A 3NWIA 3FZLB 3PUZF 4HKAA 2X66A 1HNWT 3PURA 4ZI2C 2JMHA 4U7YA 4B3TT 2K9AA 4IE6A 3UFGA 3RYIE 1E2AA 4LMJA 3AE5A 5AQRB 5AQLB 4CI2B 3SWHA 3GN5B 2UXDT 2D2SA 1ZOYA 3ZSTA 3SFDA 3DTOA 3FBZA 5DABA 3K3OA 3EHZA 5LG3A 3U78A 1UK5A 4ZOLE 4ISTA 2H88A 3M65A 1G8XA 4AQFC 3VR9A 5FL1A 2Y6XA 3EVYA 4MHCA 2V7KA 5AQIB 2XQ5A 4ZS3A 1YW0A 4H63H 3ZMZB 3AE9A 1UUSA 2H7OA 3UU8A 3P4SA 1B7TA 5LGNB 4PFOA 4HWIB 4I0UA 4JI5T 5L3DB 4IE7A 1KFYA 3H3AA 3A5XA 3Q5XA 3HKDE 2Q9QA 1D0XA 4EB6E 1D0YA 4ILCA 4L0RA 3D0TA 1IBKT 3RGLA 3OPCA 2NW8A 1WRDA 3OYZA 3VKHA 4JI0T 3C64A 4ILUA 4QWNB 4IIJE 2NP9A 3K1SA 4HN9A 4X1IE 3ZEFB 2XAJB 1J1JA 3KV9A 3T1YT 3CX6B 2H3RA 1KNZA 3MACA 4ZHQE 3Q2MA 4GKJT 4YTPA 4WNKA 3AAIA 2HPLA 3CQXC 4H9RC 1WCRA 2E9XB 5FXXA 3IA3A 2V5DA 2HPJA 2M6BA 3M3ZB 2MYSA 2BG9C 5JTGA 5CGMA 4O2AE 5HCJA 4DBQA 4DV1T 1IJ6A 3L8RA 1I6ZA 3PUAA 2VASA 4PFPA 5EK3A 1KNRA 2B76A 3P4WA 3OYXA 5E0OA 4DV4T 3LSVA 2IDOB 2IHR1 4GK0E 1OEDB 2AE9A 1MMAA 3NBXX 4B6XA 3R6NA 3VKGA 3L09A 5JDQA 1FJGT 3HKCE 4KMCA 3EDVA 2LHRA 4UR9A 2CEAA 2XQ8A 3O1HA 1WR6A 1W0BA 3RKGA 5JDHA 4MFRA 3CX7B 3PUWF 2X0HA 4GK5E 4H9QC 4I4TE 1BR2A 3EDUA 4LF5T 4KX6A 2EHOB 3AB3B 5F8PA 1XNQT 3N9MA 5CFBA 3QC9A 5LBMA 3LBXA 4AISA 5FP3A 4P1NA 3K3QC 4H63V 3ETVA 1XMOT 3UFEA 4X20E 2X0LB 4EEDA 3CVRA 5FXWA 5C2TA 4LFBT 5KXJA 1LVKA 3AA7B 3QK6A 2YN6A 5L3CB 1YXRA 1LKXA 4U2ZA 2VWAA 3HKBE 4DMWA 2L9QA 4E7ZA 2K5BB 2X68A 2XQ6A 1J5ET 3E22E 4ZXLA 1HG2A 4LF6T 2KSRA 2BG9E 1H7CA 4Z90A 1HX8A 2CMRA 3ZJ1A 3PUSA 4DR3T 2YOEA 4PK5A 4EAHA 2IW5B 5C3JA 1OXZA 5AFUL
chains in the Genus database with same CATH topology
3UT5E 3AVRA 2CLYC 3I0QA 4KBMB 2XHEB 3RX6A 4PAGA 2JPFA 1YKEB 4DMVA 4F6RC 2LJLA 4TZ4C 5LJNA 1IAPA 4PNIA 2XAQB 4DBRA 3O9XA 4JEUB 3ESLA 4FI5A 5CB4E 4ERRA 3EUHA 5LHHB 3I9YA 1IJ5A 2EHOC 5LYJE 3CWZB 5JDNA 2CE7A 2W61A 3ZYLA 2V7LA 4ISSA 2BDEA 5KMGP 2JJ9A 1Z0PA 1QSDA 3LJCA 3CKDA 3FXEB 2V26A 5H6QB 4P09A 5HAXA 3PU8A 4FJOA 3KVBA 4OK0A 3KV5A 3QUJA 3ZLIA 3GWHA 3KDSE 5J1GA 2YINA 2W62A 2LSYA 5HXHA 2PFVA 3H37A 4QKNA 4P0AA 5ETWA 2LSKA 5DQWA 4XZCA 4ANJA 4AKGA 2LSGA 2LOSA 5KDMC 4OFZA 5LGTB 5HWXA 4O8SA 1MIYA 2SPCA 2ZMAA 4IE5A 3UULA 3R84B 4ZI3D 1D1BA 2IC9A 4L5GA 4CXWA 2NW9A 3NRYA 3HA4A 4AQGA 1OWAA 3VU7H 1D0ZA 4AKHA 2VB6A 5JQGE 1FIOA 5FMNA 2K48A 5J2TE 3DJBA 2EHOA 1SA0E 2Y8DA 4O4IE 5FY7A 4CZZB 3SS1A 1T98A 3LK3B 4EOZB 4UV9B 4CI1B 2C0SA 2WAUA 3C51A 1U4QA 5L3EB 2W0GA 3FXDB 5JVDE 2PJQA 3ZC0A 2E9XC 4UIGA 3PU3A 4O4HE 4PJLA 4C91A 4AQFA 3HI2A 2N9DA 3C4XA 4J2CA 3CPZA 2CXFA 3FHNA 3I9WA 2Q9QB 4QX8B 3ZN0B 1U5PA 1US7B 3RC3A 5FY0A 3ZYMA 2A2FX 2WMNA 2DI4A 5LGUB 1LRZA 2YU1A 4UEMA 3CQCB 2WM9A 1MIVA 3WAJA 5JRCB 4AKIA 5L2LA 1KK7A 2XTLA 2XUEA 3F57A 2BZBA 3AA6B 5HXSA 2JMKA 5LHGB 1O3XA 3Q5WA 2MTQA 4KP3C 3FB2A 3K8PC 3BQLA 3HL6A 3P7IA 3S4UA 3RYCE 2V7IA 1ZKEA 2BVMA 5HXRA 1MMNA 3N9OA 1EZ3A 1QUUA 4M1PA 4HKAA 5JR9B 3RH3A 4EZHA 4X1KE 3E08A 2X66A 3JC6C 3PURA 2KWIB 2CM0A 5C8YE 5FNVE 5HXEA 4UVAB 4OYJA 5FXZA 4UXNB 4ZI2C 2JMHA 4G63A 5IYZE 2XQYA 2J1DG 5LP6E 3N5LA 4G2AA 3WI3A 2K9AA 4JUYA 4IE6A 3LG7A 3V5UA 4GYRA 2MBGA 3N2GE 3RYIE 4AKRB 2NTYA 4QX7B 4WBNE 3PUQA 5M4YA 1LVFA 2KNDA 4UELA 4CI2B 4WW0A 4UV8B 3SWHA 3NZQA 5DQVA 2N2NA 2NTXA 3GN5B 3B13A 1X79A 2D2SA 4ZS2A 2V1DB 3DTOA 3MXZA 2QGSA 3FBZA 5DABA 2P9BA 3C4ZA 5LXTE 2JQQA 3K3OA 3ANWB 3RKOA 4GYSA 4OHFA 3U78A 3RC8A 2Z6EA 1WYCA 4ZOLE 2LE8A 4ISTA 4EXTA 3RYFE 2X51A 3M65A 3LFMA 1G8XA 4AQFC 2A3DA 3AA1B 1YD8G 5KX5E 3ZYKA 5L3BB 4I50E 2Y6XA 2NWBA 3UTKA 2OA5A 2MOZA 3DP7A 3EVYA 3ZN1B 3F2EA 2LSJA 4MHCA 3NZPA 2Y48B 2DNXA 4GOUA 2V7KA 4PJJA 2C5KT 1WYBA 4C90A 2E9XD 4JLEA 1HFAA 2JRKA 1G73A 4ZS3A 4BA9A 2UXNB 3F31A 3RRCA 1YW0A 2V7JA 4H63H 3ZMZB 3RYHE 5ADXL 3AAEB 2X9HA 4PW8A 2H7OA 2RP4A 2BVLA 3MA9A 1B7TA 3ZCJA 2VK9A 4MLKA 1V9DA 3KV6A 5LA6E 5IHYA 5LGNB 4OYKA 4CXYA 2ODUA 4PFOA 3L3PA 2DWGA 1HCIA 5J2UE 1VOMA 4TV8E 5FYMA 4HEAA 4YFSA 5L3DB 5JREA 2LSIA 1HTJF 4IE7A 3ZMVB 2NW7A 4L9IA 2CWOA 3KBTA 5LOVE 3H3AA 3A5XA 4EYYR 3Q5XA 4MALA 2H7VC 3BK9A 2W63A 2Q9QA 2YEVC 1D0XA 1HG5A 3HKDE 3PUGA 4CXXA 4EB6E 1D0YA 2CCQA 4IHJE 3W15B 4A56A 2LM9A 3ZMSB 4ZI3C 3BQKA 3LBXB 4L0RA 2L8KA 1ZV4X 3D0TA 5JRCA 4IGUA 4PK4A 5H6RB 2WSSV 3NRXA 3JC6D 1HF8A 2WWUA 5TAOA 3IF8B 2G0UA 2NW8A 5L3FB 1WRDA 4GIWA 2I59A 2X9YA 3OYZA 3VKHA 4XAXB 5LHIB 3C64A 4ZI2D 4ILUA 4QWNB 5A1LA 4IIJE 2D5UA 3O1JA 2CA5A 2IC6A 2NP9A 2ZM2A 4HN9A 2GK9A 4X1IE 5F3JA 3ETUA 3ZEFB 3LK2B 2XAJB 3CX8B 3C50A 4HFVA 3KV9A 3CX6B 3IHRA 5FXVA 2H3RA 1KNZA 1NWMX 3MACA 4ZHQE 3Q2MA 1BR0A 1FEWA 1WLXA 3N2OA 3IEEA 4EYUA 5JR9A 5BMVE 4UF0B 4U72A 4WNKA 3MK7C 3AAIA 3CMLA 4PJNA 3SOLA 1MMDA 2HPLA 2XAFB 2C5JA 3CQXC 4H9RC 1S94A 3KFWX 1D1CA 3J9X1 4H9PC 5JDFA 2E9XB 4X1YE 5FXXA 4ZI7E 1UCUA 2EHOD 4JEHB 2LT3A 2HPJA 2MYSA 1UX4A 5JDLA 4BJNA 4TV9E 3I1AA 2ZM8A 1UX5A 4O2AE 2UXXB 3ZC1A 5LJMA 4DBQA 4DO0A 4P0BA 1IJ6A 3E0ZA 4N78D 3PUAA 2VASA 2XAHB 3LK42 4H9SE 4CI3B 2N1GA 3N9NA 4H9OC 3RRWA 3GN5A 3KBUA 3ONXA 3WAKA 4AKLA 4AXPA 4PFPA 5EK3A 2D0TA 4AI6A 5L3GB 4KUMB 4IE4A 4TUYE 3OYXA 5E0OA 3ZCIA 4QHOA 1FMVA 1Y64B 5JDMA 3ANWA 2KLQA 4BJMA 4DVDA 2VL8A 4PK6A 1SHZC 2A72A 4GK0E 5CA1E 2ES0A 3UUMA 4TX5A 3UUXB 2ODVA 3AAAB 4H9NC 5CA0E 5HYAA 1MMAA 3NBXX 2KXPB 4B6XA 3K3NA 2XASB 4NUVA 2L3LA 3R6NA 3VKGA 1FMWA 3SRZA 4UVCB 3L09A 4CQIA 5JDQA 4YJ3E 2Q9QC 3PDYA 3HKCE 2YK0A 3HKEE 1MNDA 4TN7B 2YU2A 2X9XA 4YJ2E 3U3IA 1HS7A 2LHNA 3TKLB 4EIWA 4KMCA 3EDVA 3J7Yq 4K0UA 4ASKA 5LG4A 1VRBA 3N9QA 1MIWA 2LHRA 3B57A 4IE0A 2KMFA 2CEAA 4BAYB 3O1HA 4I43B 1WR6A 2VKJA 5HWYA 1YKHB 3ZMTB 2VKHA 2KWHA 3PTRB 5DJQC 4HTEA 2VKOA 1BR4A 2DWKA 3AVSA 2IAKA 1MNEA 2CXLA 5FY1A 3KVAA 5JDHA 4MFRA 3CX7B 3FBLA 2CLYB 2KINB 3GA8A 4GK5E 4H9QC 4I4TE 1BR2A 4I55E 3EDUA 2HH7A 3OJAA 5JR9C 2EHOB 3AB3B 5F8PA 2CXDA 3UUNA 4QXHB 2M67A 3N9MA 3Q9DA 2DLRA 4DNDA 2KZ7B 3MZKB 2KT9A 3QC9A 4O4LE 5LBMA 1ZEEA 5EZYE 1IZNB 2LOPA 3I0OA 3MJXA 1BR1A 4U74A 3LBXA 2ACXA 4QXBB 4O2BE 4EZ4A 3PE0A 3C4WA 1CUNA 5FP3A 3V5SA 2B1EA 3K3QC 2WBLA 4HE8A 4H63V 3ETVA 2X67A 2E8IA 2XAGB 3MKDA 3N9LA 2RA1A 4V1Av 4HGAA 2C5IT 3VHLA 5AFUL 1D1AA 3IBPA 3UFEA 4X20E 2X0LB 3BQIA 4O4JE 3CVRA 5HXCA 2CWYA 3GMIA 4YLHA 3O4XE 2D0UA 5FXWA 3KV4A 3OKQA 5JDGA 2PBIA 1LVKA 2W00A 3AA7B 2LEHA 3QK6A 2DHRA 5L3CB 4UF0A 2PG8A 5LCYA 2VKDA 3P8CD 4YHJA 1LKXA 2QA7A 3N2KE 5GONE 4XBFB 3OBVE 3RPUA 1AJ3A 2VWAA 2ZLYA 3HKBE 2WMOA 4IDZA 4UVBB 4DMWA 4E7SA 4PJMA 4Z8XA 2E9XA 5JH7E 3CQGB 2L9QA 5LBQB 4ADZA 3HR0A 4E7ZA 3C98B 3ZPOA 2K24A 3N9PA 5EK4A 5LNKA 2V7MA 2K5BB 2X68A 3KINB 3O1IA 3E22E 1HG2A 1S35A 4WBOA 3ZMUB 3T8OA 4MBQA 1H7CA 1HX8A 3ZJ2A 1MMGA 2X9WA 2CMRA 4NUUA 3ZJ1A 3PUSA 1NAFA 1E1HB 2DCFA 2Q9QD 2NOXA 2ZM0A 3AA0B 4PK5A 5EK2A 4QXCB 2IW5B 4EAHA 1OXZA 1ZHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA9 A;  2LSI A;  2LSY A;  2LSJ A;  4FJO A;  4EXT A;  4GK0 E;  2LSK A;  3VU7 H;  2N1G A;  2LSG A;  4GK5 E; 
#chains in the Genus database with same CATH topology
 3UT5 E;  1XWM A;  1YKE B;  5LJN A;  2CPT A;  3I9Y A;  3CWZ B;  3LJC A;  1Z0P A;  4X64 T;  4LF7 T;  3L39 A;  3CKD A;  2V26 A;  5J1G A;  2FBW A;  2LSY A;  5HXH A;  1XDP A;  4ANJ A;  4DUZ T;  2LSG A;  2YDS A;  4TWF A;  5LGT B;  2ZMA A;  3R84 B;  1D1B A;  4L5G A;  2D9D A;  3RQW A;  4ZZB A;  4AKH A;  2VB6 A;  5J2T E;  2CHO A;  4DV0 T;  4UV9 B;  1U4Q A;  2K3W A;  4UIG A;  4AQF A;  4QH4 A;  2J47 A;  1T72 A;  3RQU A;  2Q9Q B;  1US7 B;  2A2F X;  2DI4 A;  4UEM A;  3CQC B;  5AQS B;  3F57 A;  2WWV A;  4JYA T;  1NEK A;  2JMK A;  1O3X A;  2XPK A;  3FB2 A;  3K8P C;  2V7I A;  2BVM A;  4EEB A;  1MMN A;  3N9O A;  3TLV A;  4F8H A;  1M62 A;  2KWI B;  2CM0 A;  3ABV A;  1KF6 A;  1T8B A;  5IYZ E;  4CN1 A;  3N5L A;  4G2A A;  2JIW A;  2FJB A;  4A98 A;  3V5U A;  4GYR A;  3N2G E;  4AKR B;  2NTY A;  5AQN B;  4QX7 B;  4WBN E;  3PUQ A;  4UEL A;  5DQV A;  4NXN T;  2N2N A;  4JI7 T;  3B13 A;  5IUX A;  2V1D B;  1R8I A;  2XQ3 A;  5LXT E;  2JQQ A;  3RKO A;  4GYS A;  1WYC A;  2X51 A;  3LFM A;  2MPK A;  3AE6 A;  4I50 E;  3DP7 A;  2BG9 A;  3F2E A;  2Y48 B;  4KI0 F;  1L0V A;  4GOU A;  4IDQ A;  1WFD A;  4LMK A;  2C5K T;  2E9X D;  4JLE A;  1HFA A;  1G73 A;  2E5V A;  2HN1 A;  2UXN B;  3TLU A;  2V7J A;  2X9H A;  2XQ7 A;  2FJE A;  2RP4 A;  3MA9 A;  3FZF B;  1T7S A;  4A5X A;  5LA6 E;  5IHY A;  3EAB A;  4OYK A;  2ODU A;  3L3P A;  4WYV A;  1YQ3 A;  2DWG A;  1HCI A;  5JRE A;  2LSI A;  2J4G A;  3ZMV B;  2NW7 A;  5LOV E;  4Q25 A;  1XMQ T;  4CXX A;  3PUG A;  4IHJ E;  3ZMS B;  3LBX B;  1Z8U A;  4IGU A;  5ABG A;  4PK4 A;  2BKO A;  3JC6 D;  2YDR A;  5L3F B;  1N33 T;  4GIW A;  2I59 A;  4XAX B;  2QRX A;  2JQH A;  2GK9 A;  3RLF F;  5F3J A;  3ETU A;  3C50 A;  3IHR A;  5CJ5 A;  1NWM X;  4X5T A;  1FEW A;  3N2O A;  4EYU A;  3CML A;  2I0M A;  3SOL A;  1S94 A;  4H9P C;  4X1Y E;  2EHO D;  3PUX F;  3FZM B;  3I1A A;  4TWH A;  4KHP T;  3AXJ A;  4P0B A;  3E0Z A;  3LK4 2;  2XAH B;  4CI3 B;  4H9O C;  3KBU A;  4AKL A;  2NR4 A;  5L3G B;  2LRL A;  4DUY T;  5HEG A;  3AEA A;  5FKY A;  2VVN A;  1Y64 B;  3AE4 A;  3ANW A;  2KLQ A;  1QLB A;  4PK6 A;  4KHZ F;  5CA1 E;  3UUM A;  4IT4 A;  4H9N C;  5CA0 E;  3K3N A;  2XAS B;  2L3L A;  2UXC T;  1FMW A;  4DR1 T;  4TN7 B;  2X9X A;  3TKL B;  3J7Y q;  5LG4 A;  1VRB A;  3N9Q A;  2WU5 A;  2KMF A;  2VKJ A;  5HWY A;  1YKH B;  4HWH A;  3ZMT B;  4ZZC A;  2KWH A;  2VKO A;  2IAK A;  3VRA A;  2R6G F;  4I55 E;  2HH7 A;  2RPA A;  3OJA A;  2QYW A;  5JR9 C;  5IWA T;  4QXH B;  2M67 A;  4DND A;  4OX9 T;  3UU6 A;  1ZEE A;  2ACX A;  4QXB B;  4EZ4 A;  4YXD A;  4HE8 A;  5FL0 A;  3N9L A;  4V1A v;  5AQQ B;  2I6H A;  3AE7 A;  2CWY A;  3GMI A;  2E5L T;  2D0U A;  1ZP0 A;  3OKQ A;  2W00 A;  2LEH A;  4YT0 A;  1KNP A;  2DHR A;  2PG8 A;  3P8C D;  3N2K E;  3OBV E;  2CHN A;  3RIU C;  3UQ4 A;  1OED C;  3AEE A;  4YSY A;  4ADZ A;  3HR0 A;  3ZPO A;  3N9P A;  5LNK A;  2V7M A;  3KIN B;  1S35 A;  3ZMU B;  5L47 A;  4IL9 A;  2X0Y A;  2X9W A;  1NAF A;  2DCF A;  2Q9Q D;  2ZM0 A;  3AA0 B;  1M7K A;  5EK2 A;  4QXC B;  2VQE T;  3JAE A;  3I0Q A;  4KBM B;  4TNV A;  4TZ4 C;  4JI1 T;  1IAP A;  2XAQ B;  5CB4 E;  5LHH B;  2EHO C;  2W61 A;  2V7L A;  4ISS A;  3VR8 A;  4P09 A;  5HAX A;  3PU8 A;  4OK0 A;  3QUJ A;  2PTF A;  3ZLI A;  3KDS E;  2W62 A;  4U31 A;  2BG9 B;  3H37 A;  5ETW A;  2UU9 T;  5BR8 T;  3ONL C;  2WP9 A;  4O8S A;  3TLS A;  3UUL A;  4HWC A;  3PUV F;  4JI2 T;  3NRY A;  3HA4 A;  1D0Z A;  5JQG E;  1IBL T;  1FIO A;  3JCF A;  3DJB A;  5FY7 A;  4O4I E;  5HEU A;  5AQG B;  1T98 A;  5L4E A;  4EOZ B;  3C51 A;  5L3E B;  5JVD E;  5HEH A;  2AXD S;  1XNR T;  2N9D A;  4IDN A;  4J2C A;  3CPZ A;  5FY0 A;  2XJ7 A;  3QB5 A;  2VVS A;  5LGU B;  2WM9 A;  3PJA A;  2H89 A;  4AKI A;  1KK7 A;  2XUE A;  2BS3 A;  2BZB A;  3Q5W A;  2MTQ A;  1XZY A;  3HL6 A;  4DV7 T;  3AE2 A;  1QUU A;  4M1P A;  3A8Y C;  3AE3 A;  4X1K E;  3E08 A;  4JBW F;  5C8Y E;  4UVA B;  1OED E;  2WB5 A;  3FZK B;  4K0K T;  4UXN B;  4G63 A;  4HWF A;  1N32 T;  3EAM A;  5HCM A;  2CRB A;  3LG7 A;  4QH1 A;  3AXJ B;  5M4Y A;  4WW0 A;  3NZQ A;  4ZS2 A;  3MXZ A;  3ANW B;  4OHF A;  3RC8 A;  5AQT B;  1YD8 G;  5L3B B;  3UTK A;  2OA5 A;  2MOZ A;  3ZN1 B;  2WZH A;  3NZP A;  4HWD A;  2W66 A;  2V6Y A;  2DNX A;  3T1H T;  1WYB A;  2JRK A;  4BA9 A;  1SE7 A;  2A9U A;  3RRC A;  5ADX L;  2LKH A;  4PW8 A;  5AQM B;  3KV6 A;  3QNU A;  1VOM A;  3ZKR A;  3KBT A;  2M6I A;  2FJA A;  4EYY R;  5ABH A;  4MAL A;  4EGW A;  2H7V C;  2W63 A;  4Z91 A;  2YEV C;  1HG5 A;  3AED A;  2CCQ A;  2BS2 A;  3UQ7 A;  2L8K A;  2CBJ A;  2UUA T;  3G06 A;  5H6R B;  2WSS V;  3NRX A;  4YSZ A;  2WWU A;  5TAO A;  3IF8 B;  2G0U A;  2X9Y A;  5HEO A;  5LHI B;  4ZI2 D;  5A1L A;  2XM2 A;  2D5U A;  3O1J A;  2IC6 A;  5ABF A;  2ZM2 A;  3PUY F;  3LK2 B;  3CX8 B;  4HFH A;  4HFV A;  5FXV A;  5AQV B;  4IDP A;  1WLX A;  3NKZ A;  4QH5 A;  5JR9 A;  5BMV E;  4LF4 T;  4U72 A;  4AIU A;  3MK7 C;  1MMD A;  2XAF B;  3J9X 1;  3KFW X;  3P4P A;  4U3C A;  1UCU A;  4JEH B;  2LT3 A;  5JDL A;  3AE1 A;  2WY2 A;  3Q5E A;  3PJA J;  2HN2 A;  1UGO A;  2UXB T;  5LJM A;  4DO0 A;  4N78 D;  3ONX A;  2D0T A;  4JV5 T;  1E7P A;  4KUM B;  4IE4 A;  4TUY E;  4QHO A;  1FMV A;  5JDM A;  1CHU A;  2QVA A;  3OTO T;  2A72 A;  2ES0 A;  3RHW A;  3RIU A;  3UUX B;  2ODV A;  3AAA B;  2KXP B;  1GQE A;  3AEF A;  3PV0 F;  4NUV A;  4UVC B;  4YJ3 E;  1UUR A;  4TWD A;  2YK0 A;  3HKE E;  1MND A;  3Q5D A;  4YJ2 E;  4EIW A;  4K0U A;  4DV5 T;  3B5M A;  3RF1 A;  4YTM A;  2DWK A;  3NVO A;  5FY1 A;  2CLY B;  2WDR A;  1HNX T;  4X62 T;  1YQ4 A;  2W4X A;  3UUN A;  3TLW A;  2DLR A;  2KZ7 B;  4O4L E;  5EZY E;  3I0O A;  3MJX A;  4U74 A;  2VQF T;  3UU4 A;  4NIQ A;  3PE0 A;  3RIF A;  4COF A;  3C4W A;  1CUN A;  3SFE A;  3V5S A;  2B1E A;  2WBL A;  2FUP A;  5LMN T;  2E8I A;  2XAG B;  4YTN A;  3VHL A;  3IBP A;  1W0A A;  3P4R A;  5ABE A;  4O4J E;  1NEN A;  5HXC A;  5LB7 B;  1WR0 A;  3KV4 A;  5JDG A;  4UF0 A;  5LCY A;  4NPP A;  2DL1 A;  4YHJ A;  2LM2 A;  2QA7 A;  5AQJ B;  1DU2 A;  2ZLY A;  2WMO A;  5JH7 E;  4PJM A;  3CQG B;  1HNZ T;  5LBQ B;  3C98 B;  3JAD A;  5AQF B;  5FVK A;  4DID B;  2XZE A;  3T8O A;  3ZJ2 A;  4LF8 T;  1E1H B;  2NOX A;  5L4H A;  1ZHC A;  4JI3 T;  3OVU A;  2LJL A;  5J0Z A;  1Y01 A;  3ESL A;  3EUH A;  5JDN A;  3ZYL A;  2IUB A;  3ZT6 A;  4AQY T;  2BDE A;  5KMG P;  3FXE B;  5H6Q B;  2IIU A;  3KV5 A;  3GWH A;  5AQP B;  4QKN A;  5DQW A;  2LOS A;  2V6Y B;  4OFZ A;  4EV6 A;  4ZI3 D;  4CXW A;  2NW9 A;  5FMN A;  4YSX A;  5AQU B;  3SS1 A;  3LK3 B;  4CI1 B;  2C0S A;  2VUR A;  2WAU A;  2W0G A;  3FXD B;  2PJQ A;  3ZC0 A;  2E9X C;  3AEB A;  4O4H E;  4DR4 T;  2JQ9 A;  4LML A;  3C4X A;  4YY3 T;  3ZN0 B;  2CXF A;  3FHN A;  1VCS A;  4QX8 B;  1U5P A;  3ZYM A;  1LRZ A;  4X65 T;  5ABF B;  3S4U A;  2CBI A;  4WZX A;  4U7I A;  3UU3 A;  5JR9 B;  3RH3 A;  4EZH A;  3JC6 C;  3FZH B;  3P50 A;  5FNV E;  5HXE A;  4OYJ A;  5FXZ A;  2XSA A;  2XQY A;  2J1D G;  4DR2 T;  5LP6 E;  3WI3 A;  4JUY A;  2ZM6 T;  2MBG A;  3UU5 A;  4ILB A;  1LVF A;  2KND A;  4UV8 B;  2NTX A;  2XQ9 A;  1X79 A;  2W2U A;  4JI8 T;  2QGS A;  2P9B A;  3C4Z A;  2Z6E A;  4DV6 T;  2LE8 A;  4EXT A;  4YHH T;  2V6X A;  3RYF E;  3QB5 K;  2A3D A;  3AA1 B;  5KX5 E;  3ZYK A;  2E2A A;  2NWB A;  2LSJ A;  3RI5 A;  3AE8 A;  4PJJ A;  4C90 A;  2WQY A;  4DR6 T;  3F31 A;  3RYH E;  3AAE B;  4TNW A;  2BVL A;  3ZCJ A;  2VK9 A;  4MLK A;  1V9D A;  4HFE A;  3ZT5 A;  3EI0 A;  4CXY A;  3X1D A;  2XQA A;  3P4Q A;  5J2U E;  4TV8 E;  5FYM A;  4HEA A;  4YFS A;  1HTJ F;  4L9I A;  3A7M A;  2CWO A;  4CN4 A;  4LF9 T;  3BK9 A;  3W15 B;  4NXM T;  4A56 A;  2LM9 A;  2F4V T;  4ZI3 C;  3BQK A;  1ZV4 X;  5JRC A;  3H3M A;  1HF8 A;  4LFA T;  5AQK B;  2CA5 A;  2XQ4 A;  1VCT A;  1BR0 A;  4IRE A;  3IEE A;  4UF0 B;  4PJN A;  2J62 A;  2C5J A;  1D1C A;  5JDF A;  2UUC T;  4ZI7 E;  3CIR A;  1UX4 A;  1N34 T;  4BJN A;  4TV9 E;  4GKK T;  3AEG A;  2ZM8 A;  1UX5 A;  2UXX B;  3ZC1 A;  1KEY A;  2WDQ A;  3ONJ A;  3JAF A;  4H9S E;  2WZI A;  5HEJ A;  4AXP A;  4U33 A;  2N1G A;  1JNR A;  3N9N A;  3GN5 A;  3RRW A;  3WAK A;  1IBM T;  2JQK A;  4AI6 A;  3CK6 A;  3ZCI A;  4JI6 T;  4B3S T;  2YKS A;  4BJM A;  4DVD A;  4B3R T;  2VL8 A;  1SHZ C;  3ZT7 A;  4TX5 A;  5AQO B;  1SUM B;  4HFC A;  5HYA A;  1W09 A;  3SRZ A;  4CQI A;  2Q9Q C;  3PDY A;  2FJD A;  2YU2 A;  3U3I A;  1HS7 A;  2LHN A;  4U2Y A;  1N36 T;  4ASK A;  1MIW A;  4BAY B;  3B57 A;  4IE0 A;  2VL0 A;  4I43 B;  4HFD A;  2V8S V;  2BKN A;  3ZSS A;  2VKH A;  3PTR B;  5DJQ C;  4HTE A;  1BR4 A;  3AVS A;  1MNE A;  1HX1 B;  2CXL A;  3KVA A;  3FBL A;  2KIN B;  3GA8 A;  2W67 A;  2WDV A;  3RIA A;  3AEC A;  4HFB A;  2WS3 A;  4ZEY A;  2V5C A;  2CXD A;  5F5W A;  3Q9D A;  3MZK B;  2KT9 A;  1IZN B;  2LOP A;  4A97 A;  4DR5 T;  2ACZ A;  1BR1 A;  4O2B E;  4IDO A;  1X9B A;  2X67 A;  3MKD A;  2RA1 A;  5FVL A;  4HGA A;  2C5I T;  5AQH B;  2IML A;  1D1A A;  2LRK A;  2OV9 A;  3BQI A;  4YLH A;  3O4X E;  2PBI A;  4DR7 T;  4IL4 A;  3LDQ B;  2VKD A;  5GON E;  4XBF B;  3RPU A;  1AJ3 A;  4IDZ A;  4UVB B;  4E7S A;  4Z8X A;  2E9X A;  2K24 A;  5EK4 A;  2UUB T;  4JI4 T;  2BBH A;  3O1I A;  4DV2 T;  4WBO A;  3UUB A;  4MBQ A;  1MMG A;  4NUU A;  4DV3 T;  3AVR A;  2CLY C;  2XHE B;  3RX6 A;  4PAG A;  2JPF A;  4DMV A;  4F6R C;  4PNI A;  4DBR A;  3O9X A;  1OED A;  4JEU B;  4FI5 A;  4ERR A;  1IJ5 A;  5LYJ E;  2CE7 A;  5LMU T;  4HFI A;  2JJ9 A;  1QSD A;  2WCA A;  2WU2 A;  4FJO A;  3KVB A;  2XM1 A;  2MAW A;  2YIN A;  2LKG A;  4ILA A;  3TLT A;  2PFV A;  4P0A A;  2LSK A;  4XZC A;  4AKG A;  5KDM C;  5HWX A;  1I94 T;  1MIY A;  2SPC A;  4IE5 A;  2IC9 A;  4AQG A;  1OWA A;  3VU7 H;  4CN6 A;  2K48 A;  2EHO A;  1SA0 E;  2Y8D A;  4CZZ B;  2XSB A;  1W9R A;  2BBJ A;  2OLT A;  2BS4 A;  3PU3 A;  4PJL A;  4C91 A;  4LFC T;  3HI2 A;  3I9W A;  2YDQ A;  3RC3 A;  2HHH T;  2WMN A;  3QOF A;  2YU1 A;  1MIV A;  3WAJ A;  5JRC B;  5L2L A;  1J5W A;  2XTL A;  3AA6 B;  2LLY A;  5HXS A;  5LHG B;  1XDO A;  1HR0 T;  1JNZ A;  4KP3 C;  3VRB A;  4B3M T;  4X66 T;  3BQL A;  3P7I A;  3RYC E;  1ZKE A;  2BKP A;  5HXR A;  2XY8 B;  1EZ3 A;  3NWI A;  3FZL B;  3PUZ F;  4HKA A;  2X66 A;  1HNW T;  3PUR A;  4ZI2 C;  2JMH A;  4U7Y A;  4B3T T;  2K9A A;  4IE6 A;  3UFG A;  3RYI E;  1E2A A;  4LMJ A;  3AE5 A;  5AQR B;  5AQL B;  4CI2 B;  3SWH A;  3GN5 B;  2UXD T;  2D2S A;  1ZOY A;  3ZST A;  3SFD A;  3DTO A;  3FBZ A;  5DAB A;  3K3O A;  3EHZ A;  5LG3 A;  3U78 A;  1UK5 A;  4ZOL E;  4IST A;  2H88 A;  3M65 A;  1G8X A;  4AQF C;  3VR9 A;  5FL1 A;  2Y6X A;  3EVY A;  4MHC A;  2V7K A;  5AQI B;  2XQ5 A;  4ZS3 A;  1YW0 A;  4H63 H;  3ZMZ B;  3AE9 A;  1UUS A;  2H7O A;  3UU8 A;  3P4S A;  1B7T A;  5LGN B;  4PFO A;  4HWI B;  4I0U A;  4JI5 T;  5L3D B;  4IE7 A;  1KFY A;  3H3A A;  3A5X A;  3Q5X A;  3HKD E;  2Q9Q A;  1D0X A;  4EB6 E;  1D0Y A;  4ILC A;  4L0R A;  3D0T A;  1IBK T;  3RGL A;  3OPC A;  2NW8 A;  1WRD A;  3OYZ A;  3VKH A;  4JI0 T;  3C64 A;  4ILU A;  4QWN B;  4IIJ E;  2NP9 A;  3K1S A;  4HN9 A;  4X1I E;  3ZEF B;  2XAJ B;  1J1J A;  3KV9 A;  3T1Y T;  3CX6 B;  2H3R A;  1KNZ A;  3MAC A;  4ZHQ E;  3Q2M A;  4GKJ T;  4YTP A;  4WNK A;  3AAI A;  2HPL A;  3CQX C;  4H9R C;  1WCR A;  2E9X B;  5FXX A;  3IA3 A;  2V5D A;  2HPJ A;  2M6B A;  3M3Z B;  2MYS A;  2BG9 C;  5JTG A;  5CGM A;  4O2A E;  5HCJ A;  4DBQ A;  4DV1 T;  1IJ6 A;  3L8R A;  1I6Z A;  3PUA A;  2VAS A;  4PFP A;  5EK3 A;  1KNR A;  2B76 A;  3P4W A;  3OYX A;  5E0O A;  4DV4 T;  3LSV A;  2IDO B;  2IHR 1;  4GK0 E;  1OED B;  2AE9 A;  1MMA A;  3NBX X;  4B6X A;  3R6N A;  3VKG A;  3L09 A;  5JDQ A;  1FJG T;  3HKC E;  4KMC A;  3EDV A;  2LHR A;  4UR9 A;  2CEA A;  2XQ8 A;  3O1H A;  1WR6 A;  1W0B A;  3RKG A;  5JDH A;  4MFR A;  3CX7 B;  3PUW F;  2X0H A;  4GK5 E;  4H9Q C;  4I4T E;  1BR2 A;  3EDU A;  4LF5 T;  4KX6 A;  2EHO B;  3AB3 B;  5F8P A;  1XNQ T;  3N9M A;  5CFB A;  3QC9 A;  5LBM A;  3LBX A;  4AIS A;  5FP3 A;  4P1N A;  3K3Q C;  4H63 V;  3ETV A;  1XMO T;  3UFE A;  4X20 E;  2X0L B;  4EED A;  3CVR A;  5FXW A;  5C2T A;  4LFB T;  5KXJ A;  1LVK A;  3AA7 B;  3QK6 A;  2YN6 A;  5L3C B;  1YXR A;  1LKX A;  4U2Z A;  2VWA A;  3HKB E;  4DMW A;  2L9Q A;  4E7Z A;  2K5B B;  2X68 A;  2XQ6 A;  1J5E T;  3E22 E;  4ZXL A;  1HG2 A;  4LF6 T;  2KSR A;  2BG9 E;  1H7C A;  4Z90 A;  1HX8 A;  2CMR A;  3ZJ1 A;  3PUS A;  4DR3 T;  2YOE A;  4PK5 A;  4EAH A;  2IW5 B;  5C3J A;  1OXZ A;  5AFU L; 
#chains in the Genus database with same CATH homology
 3UT5 E;  3AVR A;  2CLY C;  3I0Q A;  4KBM B;  2XHE B;  3RX6 A;  4PAG A;  2JPF A;  1YKE B;  4DMV A;  4F6R C;  2LJL A;  4TZ4 C;  5LJN A;  1IAP A;  4PNI A;  2XAQ B;  4DBR A;  3O9X A;  4JEU B;  3ESL A;  4FI5 A;  5CB4 E;  4ERR A;  3EUH A;  5LHH B;  3I9Y A;  1IJ5 A;  2EHO C;  5LYJ E;  3CWZ B;  5JDN A;  2CE7 A;  2W61 A;  3ZYL A;  2V7L A;  4ISS A;  2BDE A;  5KMG P;  2JJ9 A;  1Z0P A;  1QSD A;  3LJC A;  3CKD A;  3FXE B;  2V26 A;  5H6Q B;  4P09 A;  5HAX A;  3PU8 A;  4FJO A;  3KVB A;  4OK0 A;  3KV5 A;  3QUJ A;  3ZLI A;  3GWH A;  3KDS E;  5J1G A;  2YIN A;  2W62 A;  2LSY A;  5HXH A;  2PFV A;  3H37 A;  4QKN A;  4P0A A;  5ETW A;  2LSK A;  5DQW A;  4XZC A;  4ANJ A;  4AKG A;  2LSG A;  2LOS A;  5KDM C;  4OFZ A;  5LGT B;  5HWX A;  4O8S A;  1MIY A;  2SPC A;  2ZMA A;  4IE5 A;  3UUL A;  3R84 B;  4ZI3 D;  1D1B A;  2IC9 A;  4L5G A;  4CXW A;  2NW9 A;  3NRY A;  3HA4 A;  4AQG A;  1OWA A;  3VU7 H;  1D0Z A;  4AKH A;  2VB6 A;  5JQG E;  1FIO A;  5FMN A;  2K48 A;  5J2T E;  3DJB A;  2EHO A;  1SA0 E;  2Y8D A;  4O4I E;  5FY7 A;  4CZZ B;  3SS1 A;  1T98 A;  3LK3 B;  4EOZ B;  4UV9 B;  4CI1 B;  2C0S A;  2WAU A;  3C51 A;  1U4Q A;  5L3E B;  2W0G A;  3FXD B;  5JVD E;  2PJQ A;  3ZC0 A;  2E9X C;  4UIG A;  3PU3 A;  4O4H E;  4PJL A;  4C91 A;  4AQF A;  3HI2 A;  2N9D A;  3C4X A;  4J2C A;  3CPZ A;  2CXF A;  3FHN A;  3I9W A;  2Q9Q B;  4QX8 B;  3ZN0 B;  1U5P A;  1US7 B;  3RC3 A;  5FY0 A;  3ZYM A;  2A2F X;  2WMN A;  2DI4 A;  5LGU B;  1LRZ A;  2YU1 A;  4UEM A;  3CQC B;  2WM9 A;  1MIV A;  3WAJ A;  5JRC B;  4AKI A;  5L2L A;  1KK7 A;  2XTL A;  2XUE A;  3F57 A;  2BZB A;  3AA6 B;  5HXS A;  2JMK A;  5LHG B;  1O3X A;  3Q5W A;  2MTQ A;  4KP3 C;  3FB2 A;  3K8P C;  3BQL A;  3HL6 A;  3P7I A;  3S4U A;  3RYC E;  2V7I A;  1ZKE A;  2BVM A;  5HXR A;  1MMN A;  3N9O A;  1EZ3 A;  1QUU A;  4M1P A;  4HKA A;  5JR9 B;  3RH3 A;  4EZH A;  4X1K E;  3E08 A;  2X66 A;  3JC6 C;  3PUR A;  2KWI B;  2CM0 A;  5C8Y E;  5FNV E;  5HXE A;  4UVA B;  4OYJ A;  5FXZ A;  4UXN B;  4ZI2 C;  2JMH A;  4G63 A;  5IYZ E;  2XQY A;  2J1D G;  5LP6 E;  3N5L A;  4G2A A;  3WI3 A;  2K9A A;  4JUY A;  4IE6 A;  3LG7 A;  3V5U A;  4GYR A;  2MBG A;  3N2G E;  3RYI E;  4AKR B;  2NTY A;  4QX7 B;  4WBN E;  3PUQ A;  5M4Y A;  1LVF A;  2KND A;  4UEL A;  4CI2 B;  4WW0 A;  4UV8 B;  3SWH A;  3NZQ A;  5DQV A;  2N2N A;  2NTX A;  3GN5 B;  3B13 A;  1X79 A;  2D2S A;  4ZS2 A;  2V1D B;  3DTO A;  3MXZ A;  2QGS A;  3FBZ A;  5DAB A;  2P9B A;  3C4Z A;  5LXT E;  2JQQ A;  3K3O A;  3ANW B;  3RKO A;  4GYS A;  4OHF A;  3U78 A;  3RC8 A;  2Z6E A;  1WYC A;  4ZOL E;  2LE8 A;  4IST A;  4EXT A;  3RYF E;  2X51 A;  3M65 A;  3LFM A;  1G8X A;  4AQF C;  2A3D A;  3AA1 B;  1YD8 G;  5KX5 E;  3ZYK A;  5L3B B;  4I50 E;  2Y6X A;  2NWB A;  3UTK A;  2OA5 A;  2MOZ A;  3DP7 A;  3EVY A;  3ZN1 B;  3F2E A;  2LSJ A;  4MHC A;  3NZP A;  2Y48 B;  2DNX A;  4GOU A;  2V7K A;  4PJJ A;  2C5K T;  1WYB A;  4C90 A;  2E9X D;  4JLE A;  1HFA A;  2JRK A;  1G73 A;  4ZS3 A;  4BA9 A;  2UXN B;  3F31 A;  3RRC A;  1YW0 A;  2V7J A;  4H63 H;  3ZMZ B;  3RYH E;  5ADX L;  3AAE B;  2X9H A;  4PW8 A;  2H7O A;  2RP4 A;  2BVL A;  3MA9 A;  1B7T A;  3ZCJ A;  2VK9 A;  4MLK A;  1V9D A;  3KV6 A;  5LA6 E;  5IHY A;  5LGN B;  4OYK A;  4CXY A;  2ODU A;  4PFO A;  3L3P A;  2DWG A;  1HCI A;  5J2U E;  1VOM A;  4TV8 E;  5FYM A;  4HEA A;  4YFS A;  5L3D B;  5JRE A;  2LSI A;  1HTJ F;  4IE7 A;  3ZMV B;  2NW7 A;  4L9I A;  2CWO A;  3KBT A;  5LOV E;  3H3A A;  3A5X A;  4EYY R;  3Q5X A;  4MAL A;  2H7V C;  3BK9 A;  2W63 A;  2Q9Q A;  2YEV C;  1D0X A;  1HG5 A;  3HKD E;  3PUG A;  4CXX A;  4EB6 E;  1D0Y A;  2CCQ A;  4IHJ E;  3W15 B;  4A56 A;  2LM9 A;  3ZMS B;  4ZI3 C;  3BQK A;  3LBX B;  4L0R A;  2L8K A;  1ZV4 X;  3D0T A;  5JRC A;  4IGU A;  4PK4 A;  5H6R B;  2WSS V;  3NRX A;  3JC6 D;  1HF8 A;  2WWU A;  5TAO A;  3IF8 B;  2G0U A;  2NW8 A;  5L3F B;  1WRD A;  4GIW A;  2I59 A;  2X9Y A;  3OYZ A;  3VKH A;  4XAX B;  5LHI B;  3C64 A;  4ZI2 D;  4ILU A;  4QWN B;  5A1L A;  4IIJ E;  2D5U A;  3O1J A;  2CA5 A;  2IC6 A;  2NP9 A;  2ZM2 A;  4HN9 A;  2GK9 A;  4X1I E;  5F3J A;  3ETU A;  3ZEF B;  3LK2 B;  2XAJ B;  3CX8 B;  3C50 A;  4HFV A;  3KV9 A;  3CX6 B;  3IHR A;  5FXV A;  2H3R A;  1KNZ A;  1NWM X;  3MAC A;  4ZHQ E;  3Q2M A;  1BR0 A;  1FEW A;  1WLX A;  3N2O A;  3IEE A;  4EYU A;  5JR9 A;  5BMV E;  4UF0 B;  4U72 A;  4WNK A;  3MK7 C;  3AAI A;  3CML A;  4PJN A;  3SOL A;  1MMD A;  2HPL A;  2XAF B;  2C5J A;  3CQX C;  4H9R C;  1S94 A;  3KFW X;  1D1C A;  3J9X 1;  4H9P C;  5JDF A;  2E9X B;  4X1Y E;  5FXX A;  4ZI7 E;  1UCU A;  2EHO D;  4JEH B;  2LT3 A;  2HPJ A;  2MYS A;  1UX4 A;  5JDL A;  4BJN A;  4TV9 E;  3I1A A;  2ZM8 A;  1UX5 A;  4O2A E;  2UXX B;  3ZC1 A;  5LJM A;  4DBQ A;  4DO0 A;  4P0B A;  1IJ6 A;  3E0Z A;  4N78 D;  3PUA A;  2VAS A;  2XAH B;  3LK4 2;  4H9S E;  4CI3 B;  2N1G A;  3N9N A;  4H9O C;  3RRW A;  3GN5 A;  3KBU A;  3ONX A;  3WAK A;  4AKL A;  4AXP A;  4PFP A;  5EK3 A;  2D0T A;  4AI6 A;  5L3G B;  4KUM B;  4IE4 A;  4TUY E;  3OYX A;  5E0O A;  3ZCI A;  4QHO A;  1FMV A;  1Y64 B;  5JDM A;  3ANW A;  2KLQ A;  4BJM A;  4DVD A;  2VL8 A;  4PK6 A;  1SHZ C;  2A72 A;  4GK0 E;  5CA1 E;  2ES0 A;  3UUM A;  4TX5 A;  3UUX B;  2ODV A;  3AAA B;  4H9N C;  5CA0 E;  5HYA A;  1MMA A;  3NBX X;  2KXP B;  4B6X A;  3K3N A;  2XAS B;  4NUV A;  2L3L A;  3R6N A;  3VKG A;  1FMW A;  3SRZ A;  4UVC B;  3L09 A;  4CQI A;  5JDQ A;  4YJ3 E;  2Q9Q C;  3PDY A;  3HKC E;  2YK0 A;  3HKE E;  1MND A;  4TN7 B;  2YU2 A;  2X9X A;  4YJ2 E;  3U3I A;  1HS7 A;  2LHN A;  3TKL B;  4EIW A;  4KMC A;  3EDV A;  3J7Y q;  4K0U A;  4ASK A;  5LG4 A;  1VRB A;  3N9Q A;  1MIW A;  2LHR A;  3B57 A;  4IE0 A;  2KMF A;  2CEA A;  4BAY B;  3O1H A;  4I43 B;  1WR6 A;  2VKJ A;  5HWY A;  1YKH B;  3ZMT B;  2VKH A;  2KWH A;  3PTR B;  5DJQ C;  4HTE A;  2VKO A;  1BR4 A;  2DWK A;  3AVS A;  2IAK A;  1MNE A;  2CXL A;  5FY1 A;  3KVA A;  5JDH A;  4MFR A;  3CX7 B;  3FBL A;  2CLY B;  2KIN B;  3GA8 A;  4GK5 E;  4H9Q C;  4I4T E;  1BR2 A;  4I55 E;  3EDU A;  2HH7 A;  3OJA A;  5JR9 C;  2EHO B;  3AB3 B;  5F8P A;  2CXD A;  3UUN A;  4QXH B;  2M67 A;  3N9M A;  3Q9D A;  2DLR A;  4DND A;  2KZ7 B;  3MZK B;  2KT9 A;  3QC9 A;  4O4L E;  5LBM A;  1ZEE A;  5EZY E;  1IZN B;  2LOP A;  3I0O A;  3MJX A;  1BR1 A;  4U74 A;  3LBX A;  2ACX A;  4QXB B;  4O2B E;  4EZ4 A;  3PE0 A;  3C4W A;  1CUN A;  5FP3 A;  3V5S A;  2B1E A;  3K3Q C;  2WBL A;  4HE8 A;  4H63 V;  3ETV A;  2X67 A;  2E8I A;  2XAG B;  3MKD A;  3N9L A;  2RA1 A;  4V1A v;  4HGA A;  2C5I T;  3VHL A;  5AFU L;  1D1A A;  3IBP A;  3UFE A;  4X20 E;  2X0L B;  3BQI A;  4O4J E;  3CVR A;  5HXC A;  2CWY A;  3GMI A;  4YLH A;  3O4X E;  2D0U A;  5FXW A;  3KV4 A;  3OKQ A;  5JDG A;  2PBI A;  1LVK A;  2W00 A;  3AA7 B;  2LEH A;  3QK6 A;  2DHR A;  5L3C B;  4UF0 A;  2PG8 A;  5LCY A;  2VKD A;  3P8C D;  4YHJ A;  1LKX A;  2QA7 A;  3N2K E;  5GON E;  4XBF B;  3OBV E;  3RPU A;  1AJ3 A;  2VWA A;  2ZLY A;  3HKB E;  2WMO A;  4IDZ A;  4UVB B;  4DMW A;  4E7S A;  4PJM A;  4Z8X A;  2E9X A;  5JH7 E;  3CQG B;  2L9Q A;  5LBQ B;  4ADZ A;  3HR0 A;  4E7Z A;  3C98 B;  3ZPO A;  2K24 A;  3N9P A;  5EK4 A;  5LNK A;  2V7M A;  2K5B B;  2X68 A;  3KIN B;  3O1I A;  3E22 E;  1HG2 A;  1S35 A;  4WBO A;  3ZMU B;  3T8O A;  4MBQ A;  1H7C A;  1HX8 A;  3ZJ2 A;  1MMG A;  2X9W A;  2CMR A;  4NUU A;  3ZJ1 A;  3PUS A;  1NAF A;  1E1H B;  2DCF A;  2Q9Q D;  2NOX A;  2ZM0 A;  3AA0 B;  4PK5 A;  5EK2 A;  4QXC B;  2IW5 B;  4EAH A;  1OXZ A;  1ZHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...