2LSYA

Structure of the c-terminal domain from human rev1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
b'GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
molecule tags Protein binding
source organism Homo sapiens
publication title NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta.
pubmed doi rcsb
total genus 35
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsyA00
2N1GA 2LSJA 4EXTA 4BA9A 4GK0E 4GK5E 4FJOA 3VU7H 2LSKA 2LSIA 2LSYA 2LSGA
chains in the Genus database with same CATH superfamily
2J4GA 2X0YA 1XNRT 3J7Yq 1HNWT 4DBRA 2X68A 5FXVA 3N9NA 3S4UA 1WRDA 4EEDA 3OVUA 4YTPA 1IBKT 2W2UA 3L8RA 3HKDE 4HEAA 5LG3A 3AEFA 2WU5A 2CXDA 1O3XA 4Z90A 2BG9B 4X66T 4YT0A 5AQKB 1D0ZA 2XPKA 1W0BA 4H9NC 5HCJA 4EZ4A 2BKPA 1OEDC 3AE3A 4CN1A 2CHOA 1D0XA 2V5CA 2WQYA 3CQXC 5JDLA 2JMKA 3FXDB 1HX1B 4QXCB 2MBGA 3EI0A 4L5GA 4DMVA 3PJAJ 5FY7A 3ZSTA 1ZHCA 5L3FB 5J2TE 2YU1A 3RYIE 1E2AA 2SPCA 1FJGT 1OWAA 3RF1A 1LRZA 1T98A 4OK0A 4YSZA 4JI8T 4DV6T 4DUYT 1WLXA 5AQUB 2CWOA 2VKJA 3AAIA 1W09A 5KX5E 1XMOT 2UUAT 2BVMA 2KWHA 2QRXA 4QKNA 4WNKA 4YHJA 3AE1A 2LOSA 5JVDE 2V6YA 2VASA 4DR2T 4O2BE 2H3RA 2WZIA 3RKGA 4JI3T 3UUMA 3PE0A 4MALA 1UCUA 2FJAA 1XDPA 2XQAA 5L3CB 4UELA 5JR9B 5LJNA 5AQOB 3T1HT 4PW8A 4LF7T 1I6ZA 2BKNA 1D1CA 2K24A 4LF5T 2KZ7B 3CQGB 4Z91A 4QXHB 2W63A 3CPZA 2YN6A 4UXNB 2DL1A 2D2SA 4DV1T 3RC3A 4KBMB 2V7JA 2CBJA 2WP9A 5TAOA 3M3ZB 3UU6A 3LBXB 3Q5DA 2E9XC 3QUJA 4H63H 4ZI7E 2JJ9A 4V1Av 5ABEA 3AA7B 3RQWA 2NOXA 2Q9QC 3CQCB 3K3QC 2WWVA 4X62T 3AE2A 2LLYA 2XM2A 3AAAB 3C50A 3HR0A 3IHRA 5LB7B 2IMLA 2ZLYA 5DQWA 2YDQA 4U2YA 4UF0A 4DV5T 2UU9T 3L39A 2AE9A 2DI4A 4TWDA 3PUYF 2NP9A 2ZM8A 4N78D 2X9XA 5FMNA 3AXJB 3MA9A 3SRZA 3FBZA 4GYSA 2NTYA 4ILUA 5H6RB 2W67A 3MXZA 2Y8DA 4BAYB 4F6RC 5LGNB 5IYZE 4ZI3C 1WYBA 3ZYKA 4OFZA 4JEHB 3FZFB 4NIQA 3CX7B 3O1IA 5HEOA 3QC9A 5JDMA 4P1NA 3U78A 4X64T 2YINA 4HWCA 5AQVB 2WDRA 2XTLA 5KDMC 4IHJE 1OEDE 4H9OC 2D0UA 2JRKA 2KNDA 1IBMT 4AISA 1JNRA 2X9HA 4COFA 4DR6T 5LNKA 4DV2T 1SUMB 1CUNA 1MMGA 3DP7A 4UF0B 4EAHA 4O4JE 1VCTA 5LG4A 2XQYA 2XQ6A 3NZPA 4LMJA 4U2ZA 1MNEA 3RLFF 4EGWA 4H9RC 3D0TA 5CJ5A 1I94T 1DU2A 1KEYA 2CWYA 2XSBA 4TV8E 4EEBA 4LFBT 2EHOB 3BK9A 3SFEA 1UUSA 1WR6A 2LKHA 2XJ7A 3CIRA 3K1SA 4I4TE 2KINB 3CKDA 4MHCA 4QH1A 3PJAA 3ZJ2A 4QX8B 4A5XA 3EUHA 3PUVF 4EOZB 2D9DA 1J1JA 1XWMA 4X1YE 5IWAT 2W0GA 4ZOLE 1X9BA 2IIUA 4KMCA 4DO0A 3LFMA 1YQ3A 3EVYA 3LBXA 4JBWF 2NTXA 2BG9E 4IDNA 1LVKA 2C5IT 4QX7B 1QUUA 2ODVA 3BQKA 3C64A 5AQNB 2UXDT 3KV9A 5AQHB 4BJNA 1KFYA 3PUGA 4K0UA 4ZZBA 1N36T 4HTEA 2A72A 1LVFA 2YKSA 3ETUA 3QNUA 5AQTB 2LHRA 2XAJB 3AE6A 3F57A 3C4ZA 2UXNB 4QHOA 2LSKA 1BR1A 2ZM6T 2XUEA 2CM0A 3ZT5A 1Y64B 2FJEA 2LOPA 2VL0A 4IIJE 2W61A 4YY3T 4ILBA 4LF6T 2WS3A 2IC6A 5AQRB 2DWKA 2LE8A 3CK6A 5JRCA 2WMNA 3ZYLA 2XQ3A 2XSAA 3ONXA 4MFRA 4YLHA 1OXZA 4M1PA 2WMOA 4X5TA 5DABA 4EYUA 3P4QA 2J47A 1H7CA 2MAWA 4HE8A 3AE8A 4IGUA 3OKQA 3WAJA 1KNZA 2OLTA 2A3DA 2CLYC 2WWUA 4JUYA 4WW0A 5CB4E 3RYHE 2G0UA 3ZCIA 4BA9A 3RRCA 3F2EA 3JC6C 3OYXA 2CEAA 2VVNA 4H9SE 5H6QB 1Z0PA 2K48A 3FB2A 3N2KE 4P0AA 2WY2A 3KFWX 4DBQA 1D1AA 1MIYA 5HEUA 2LM2A 3SFDA 5L3EB 5LXTE 3A5XA 3DJBA 3ZMVB 1SE7A 3UFGA 3VR9A 2V6YB 4CI2B 4B3RT 1ZKEA 2PBIA 5CFBA 3ETVA 1MMDA 2JQ9A 2D0TA 5HXCA 2DLRA 2KMFA 2KT9A 2X0LB 2C5JA 2V5DA 2VB6A 4YFSA 5EK3A 4E7SA 4DVDA 1J5ET 1NEKA 2VQET 2X9WA 3UQ7A 5LBMA 3BQLA 4JI6T 4BJMA 4NUVA 4B3MT 5FL1A 4AXPA 3U3IA 2QYWA 4IT4A 3EDUA 4TUYE 4UVCB 5ETWA 4YJ3E 3ZMZB 3SOLA 5ABFA 4QH5A 4DR7T 2N9DA 4ZS3A 3ZPOA 2W4XA 3JAFA 4GOUA 1XMQT 3LDQB 4PFPA 4WBNE 1YD8G 3ANWB 3DTOA 2V6XA 2KWIB 2VKHA 5JDQA 1GQEA 5LMUT 4LF4T 4L0RA 3LK2B 2K3WA 3RKOA 3C51A 5DQVA 2HHHT 4U33A 4FJOA 4IE6A 4IE7A 2KLQA 3UQ4A 1IAPA 1R8IA 3OJAA 1IJ6A 2KSRA 2XM1A 3B5MA 2W62A 3H37A 5JREA 1SHZC 1T8BA 3GA8A 4PK6A 2ES0A 4P09A 4AKRB 3GWHA 2XAFB 4AQYT 4LFAT 3P4PA 4HFBA 3ZJ1A 3ONJA 2V1DB 5AQPB 3AE5A 4YHHT 2JQKA 2NW7A 3EABA 3ZMSB 3FZLB 4ZEYA 2BS2A 3PTRB 5FP3A 2L9QA 3TLUA 5AQLB 3K3OA 1QSDA 2B1EA 3CVRA 5L4HA 4HFDA 3PDYA 4IDOA 3ZN0B 1ZP0A 4ZI3D 2E5LT 2CA5A 3T1YT 3V5SA 2BBJA 1MNDA 2H7VC 3PUAA 2J1DG 4ZZCA 4G63A 5C8YE 4EYYR 4GKKT 1N32T 2LKGA 3IBPA 3WAKA 5AFUL 1HG5A 1YQ4A 2X67A 1HS7A 4H9QC 3GN5A 1XZYA 2ACXA 3B57A 5HCMA 3VKHA 5HEJA 2L8KA 3I1AA 4I55E 4DV3T 2BKOA 3RIAA 2WBLA 4X1KE 3RIUC 2DWGA 4U72A 1IZNB 4CN4A 5LHIB 1WR0A 3G06A 3R6NA 3OTOT 2LRKA 4DV0T 4CXYA 3Q5WA 3ZCJA 4IDZA 4ERRA 2MPKA 2JPFA 1VCSA 4I43B 4OYKA 3VRBA 3NBXX 5EZYE 4AQGA 4O8SA 2MTQA 2Q9QB 3UUBA 4AQFC 1T72A 2LT3A 3ZLIA 5LA6E 3O4XE 3ZSSA 3LK3B 3Q5EA 5KXJA 2NW8A 4KI0F 4WYVA 5HWXA 1M62A 1UURA 4O4LE 4WBOA 3N2GE 4DR1T 4EV6A 5FL0A 4EB6E 1LKXA 2CLYB 3AEAA 5LHGB 5J1GA 3ZN1B 2DCFA 2UXXB 1MMAA 4ZI2C 2Y48B 3K8PC 4KHZF 5FXXA 4ZXLA 2VKDA 5JR9C 3P8CD 1B7TA 2A9UA 2OV9A 3ZEFB 1YXRA 4GYRA 5LOVE 4TWFA 2B76A 5C2TA 3UU8A 3JADA 2C0SA 1S94A 5ADXL 3GN5B 4KP3C 1U4QA 4UVBB 5AQQB 2LRLA 5LHHB 2W66A 1Z8UA 2BS4A 4HKAA 3KV6A 1U5PA 4ANJA 3UT5E 2HN2A 4EXTA 2H89A 3F31A 3KV4A 4TNVA 4CI1B 3P4RA 2LEHA 3MKDA 4H63V 2ZM2A 2IHR1 3RGLA 4AQFA 5L2LA 4U3CA 4AKLA 1HF8A 2V7KA 2MOZA 4LMLA 5HEGA 4B3ST 4TWHA 3KBUA 2XY8B 3KINB 3AE7A 4YTNA 3KVAA 4ISSA 2VK9A 4UV8B 3ZC0A 2IC9A 4CI3B 1FEWA 3AEDA 4A56A 2IUBA 3I0QA 4EIWA 4J2CA 2VL8A 4ADZA 4LFCT 4JYAT 1N33T 1UK5A 1L0VA 4CXWA 4JI0T 2XQ8A 3RIUA 1WCRA 2LSIA 4U7IA 4OX9T 2JIWA 4IE0A 3LSVA 3PUSA 2X51A 3E08A 1S35A 1CHUA 2YOEA 4O4HE 4DUZT 3QB5A 1ZEEA 4JI7T 1YKHB 2JMHA 4TZ4C 1NAFA 4JLEA 4QH4A 2UUBT 2WU2A 4PFOA 3J9X1 2EHOC 3GMIA 5AQMB 3CX6B 2UUCT 3VR8A 1HTJF 4NXMT 4KX6A 1KK7A 5DJQC 3W15B 5L3GB 2CMRA 4PJLA 3HA4A 2WAUA 1ZV4X 3N9QA 3TLSA 4AIUA 3A8YC 3PUWF 5HWYA 3UU3A 2WZHA 3MACA 5HXSA 4DR4T 4OYJA 1VRBA 3LJCA 3JAEA 5FVLA 4C90A 2V7IA 4C91A 2E2AA 2LJLA 2V8SV 4YSYA 4HFCA 2X66A 3HKCE 5JH7E 4LMKA 1JNZA 2HPLA 4WZXA 4E7ZA 3MK7C 1WFDA 2XAQB 2Z6EA 3NVOA 5AQGB 3VHLA 3ZMTB 1BR0A 5CA0E 3WI3A 2VKOA 4YJ2E 4IL4A 4UIGA 5F5WA 4O2AE 4OHFA 2WCAA 4TV9E 2ODUA 2JQQA 4U31A 1VOMA 3AEGA 3KDSE 4HFIA 3KBTA 4UEMA 4YXDA 1BR4A 3LG7A 3P50A 1G8XA 3AVSA 3AA6B 4XAXB 3NZQA 3HI2A 2LSJA 1HFAA 3V5UA 4YTMA 3PURA 1US7B 2QVAA 4AKIA 2H7OA 1D0YA 4NUUA 2M6IA 3TLTA 1XNQT 2E9XB 4A98A 2ZM0A 4GK0E 3AE4A 4Z8XA 1QLBA 2JQHA 2W00A 2IW5B 2LHNA 4CXXA 5C3JA 3CX8B 2LM9A 4QWNB 3N9PA 4UVAB 3AECA 3O1HA 5AQJB 3TKLB 3ESLA 2V26A 5F8PA 4ZI2D 4GK5E 5ABFB 5J0ZA 2X9YA 3KVBA 4PNIA 2KXPB 2K9AA 4Q25A 3RRWA 1KF6A 3SWHA 3LK42 3UULA 4DV4T 3N9OA 4MBQA 5FNVE 2CBIA 5HXHA 2XAHB 2NWBA 5L3DB 4CZZB 5CA1E 2VURA 2K5BB 5EK4A 3FBLA 1IJ5A 3C4XA 1T7SA 2YDSA 2CXLA 4IDPA 3RI5A 3P4SA 4DMWA 2AXDS 2M6BA 2ZMAA 4JI1T 1FIOA 3HKBE 3OYZA 4HFHA 3ZT7A 2DNXA 1AJ3A 5FXWA 2XAGB 2A2FX 3FZMB 3ABVA 5ABHA 1NENA 2BS3A 4HWHA 3FZHB 1N34T 3FZKB 3NRXA 4HWIB 1V9DA 2P9BA 5HEHA 1Y01A 2IAKA 3VRAA 3RC8A 3UUNA 1MIVA 5HYAA 4X65T 3NRYA 5IHYA 4GKJT 2I6HA 1OEDB 1X79A 4PK5A 2LSYA 4HN9A 4I50E 5CGMA 4K0KT 3QB5K 2Q9QD 2E9XA 2XQ5A 3L09A 3N5LA 3Q2MA 4YSXA 5KMGP 1IBLT 4JI4T 4IE5A 2BG9C 3ANWA 5L3BB 5A1LA 4AI6A 4CN6A 4QXBB 4DV7T 5FKYA 3EHZA 4I0UA 4PJMA 4AKGA 4B3TT 1NWMX 2BG9A 1UX5A 5L4EA 2I59A 3ZKRA 3X1DA 1D1BA 2UXBT 5FYMA 1BR2A 2HPJA 2EHOA 2RP4A 3IEEA 5JDHA 4DR3T 5BMVE 4TX5A 5JDGA 1ZOYA 4ZHQE 2XASB 1W9RA 2WSSV 3VU7H 5FXZA 1HNXT 2BZBA 2NW9A 2X0HA 3E22E 3HL6A 3B13A 3H3MA 1MMNA 4UV9B 3AA0B 2IDOB 2XHEB 3ONLC 2VQFT 3PUZF 4TNWA 5FY1A 2VWAA 3C98B 3K3NA 4IL9A 3MJXA 3ZYMA 3SS1A 3EDVA 2F4VT 5JDNA 1HG2A 1FMVA 2BDEA 4KHPT 3Q9DA 1OEDA 2WM9A 2N1GA 3N9MA 4CQIA 4XBFB 1J5WA 2XQ4A 3AEEA 3CMLA 4IE4A 4DIDB 4NXNT 3R84B 2E5VA 3JCFA 3AEBA 2FUPA 3PV0F 5AQIB 5GONE 4HWDA 4U7YA 1E7PA 2OA5A 5LBQB 3T8OA 4KUMB 5M4YA 2HN1A 2V7MA 3PU3A 2DHRA 4U74A 5FVKA 3BQIA 3N2OA 4JI5T 1FMWA 3ZMUB 4GIWA 5JRCB 2HH7A 2C5KT 3IF8B 4NPPA 5L47A 1UX4A 3KV5A 2I0MA 5JR9A 3RHWA 4DR5T 1HCIA 2WB5A 3I9WA 3AB3B 2RPAA 1SA0E 4F8HA 2UXCT 2CE7A 5LJMA 2PFVA 2YEVC 3QOFA 3VKGA 5ABGA 3JC6D 4XZCA 2D5UA 2H88A 4IDQA 4ISTA 1E1HB 2R6GF 4H9PC 3RYCE 3AXJA 5LP6E 1UGOA 5LGTB 3Q5XA 3OPCA 3QK6A 1W0AA 2WDVA 4MLKA 2CHNA 3C4WA 2N2NA 1G73A 2RA1A 4UR9A 3M65A 4ZS2A 2Q9QA 3ZT6A 2V7LA 2PJQA 3ZC1A 3P4WA 4PK4A 4EZHA 5LGUB 2PTFA 4JI2T 2EHOD 4O4IE 5HXRA 2Y6XA 4JEUB 3UUXB 4FI5A 1KNPA 2XZEA 3PU8A 4HFEA 3RYFE 4ASKA 3EAMA 3IA3A 3RIFA 4X20E 3UU5A 5HXEA 4HGAA 3I9YA 5AQSB 4B6XA 2CCQA 2FBWA 4A97A 5JTGA 1HNZT 4PJNA 3RX6A 1YKEB 2FJBA 3P7IA 3UFEA 2L3LA 2CXFA 2M67A 5IUXA 2BBHA 3FHNA 2BVLA 4X1IE 2MYSA 4HWFA 2XQ9A 3A7MA 3FXEB 4DNDA 5HAXA 4LF8T 3AE9A 5FY0A 5BR8T 2NR4A 3CWZB 4IREA 3UTKA 2ACZA 4JV5T 1KNRA 4HFVA 4AKHA 3L3PA 5LMNT 2PG8A 2CPTA 2YU2A 5EK2A 2FJDA 3MZKB 3NKZA 5LCYA 3H3AA 3AVRA 5F3JA 2E8IA 2XQ7A 2YDRA 1HR0T 4PJJA 3TLWA 1WYCA 1XDOA 4TN7B 2CRBA 3TLVA 4L9IA 3AA1B 1EZ3A 1HX8A 4PAGA 5E0OA 2QA7A 5JQGE 3N9LA 3O1JA 1MIWA 4P0BA 3RQUA 3RPUA 5LYJE 4ILCA 1M7KA 2GK9A 2J62A 5JDFA 3RH3A 3UU4A 2LSGA 3PUQA 3O9XA 2E9XD 3AAEB 5J2UE 4ILAA 2VVSA 3NWIA 4G2AA 2QGSA 3E0ZA 5AQFB 2WDQA 2YK0A 4LF9T 1YW0A 3PUXF 3I0OA 3OBVE 3HKEE
chains in the Genus database with same CATH topology
3J7Yq 4DBRA 2X68A 5FXVA 3N9NA 3S4UA 1WRDA 3HKDE 4HEAA 2CXDA 1O3XA 1D0ZA 4H9NC 4EZ4A 1D0XA 3CQXC 5JDLA 2JMKA 3FXDB 4QXCB 2MBGA 4DMVA 4L5GA 5L3FB 5FY7A 1ZHCA 5J2TE 2YU1A 3RYIE 2SPCA 1OWAA 1LRZA 1T98A 4OK0A 1WLXA 3AAIA 2CWOA 2VKJA 5KX5E 2BVMA 2KWHA 4QKNA 4WNKA 4YHJA 5JVDE 2LOSA 2VASA 4O2BE 2H3RA 3UUMA 3PE0A 4MALA 1UCUA 5LJNA 5L3CB 4UELA 5JR9B 4PW8A 1D1CA 2K24A 2KZ7B 3CQGB 4QXHB 2W63A 3CPZA 4UXNB 2D2SA 3RC3A 4KBMB 2V7JA 5TAOA 5L3GB 3LBXB 4H63H 2E9XC 3QUJA 4ZI7E 2JJ9A 4V1Av 3AA7B 2NOXA 2Q9QC 3CQCB 3K3QC 3AAAB 3C50A 3HR0A 3IHRA 2ZLYA 5DQWA 4UF0A 2DI4A 2NP9A 2ZM8A 4N78D 2X9XA 5FMNA 3SRZA 3MA9A 3FBZA 4GYSA 2NTYA 4ILUA 5H6RB 4F6RC 3MXZA 2Y8DA 4BAYB 5IYZE 4ZI3C 1WYBA 3ZYKA 4OFZA 4JEHB 3CX7B 3O1IA 3QC9A 5JDMA 3U78A 2YINA 2XTLA 5KDMC 4IHJE 4H9OC 2D0UA 2JRKA 2KNDA 2X9HA 5LNKA 1CUNA 1MMGA 3DP7A 4UF0B 4EAHA 4O4JE 2XQYA 3NZPA 1MNEA 4H9RC 3D0TA 2CWYA 4TV8E 2EHOB 3BK9A 1WR6A 4BJNA 4I4TE 3ZJ2A 4MHCA 2KINB 3CKDA 4QX8B 3EUHA 4EOZB 4X1YE 2W0GA 4ZOLE 4KMCA 4DO0A 3LFMA 3EVYA 3LBXA 2NTXA 1LVKA 2C5IT 4QX7B 1QUUA 2ODVA 3BQKA 3C64A 3KV9A 3PUGA 4K0UA 4HTEA 2A72A 1LVFA 3ETUA 2LHRA 2XAJB 3F57A 3C4ZA 2UXNB 4QHOA 2LSKA 1BR1A 2XUEA 2CM0A 1Y64B 2LOPA 4IIJE 2W61A 2IC6A 2DWKA 2LE8A 5JRCA 2WMNA 3ZYLA 4MFRA 3ONXA 4YLHA 1OXZA 4M1PA 2WMOA 5DABA 4EYUA 4IGUA 1H7CA 4HE8A 3WAJA 3OKQA 1KNZA 2WWUA 2A3DA 2CLYC 4JUYA 4WW0A 3RYHE 5CB4E 3ZCIA 2G0UA 4CXXA 4BA9A 3RRCA 3F2EA 3JC6C 3OYXA 2CEAA 5H6QB 4H9SE 1Z0PA 2K48A 3FB2A 3N2KE 4P0AA 3KFWX 4DBQA 3VKHA 1D1AA 1MIYA 5L3EB 5LXTE 3A5XA 3DJBA 3ZMVB 4CI2B 1ZKEA 2PBIA 3ETVA 1MMDA 5HXCA 2D0TA 3UTKA 2DLRA 2KMFA 2KT9A 2X0LB 2C5JA 5EK3A 2VB6A 4YFSA 4E7SA 4DVDA 2X9WA 5LBMA 3BQLA 4BJMA 4NUVA 4AXPA 3U3IA 5ETWA 5LHGB 3EDUA 4TUYE 4UVCB 3ZMZB 4YJ3E 3SOLA 2N9DA 4ZS3A 3ZPOA 4GOUA 4PFPA 4WBNE 1YD8G 3ANWB 3DTOA 5JDQA 2KWIB 2VKHA 4L0RA 3LK2B 3RKOA 3C51A 5DQVA 4FJOA 4IE6A 4IE7A 2KLQA 1IAPA 3OJAA 1IJ6A 5JREA 3H37A 2W62A 1SHZC 3GA8A 4PK6A 2ES0A 4P09A 4AKRB 3GWHA 2XAFB 3ZJ1A 2V1DB 2NW7A 3ZMSB 3PTRB 5FP3A 2L9QA 3K3OA 1QSDA 2B1EA 3CVRA 4ZI3D 5LG4A 3PDYA 3ZN0B 5LGNB 2CA5A 3V5SA 1MNDA 2H7VC 3PUAA 2J1DG 4G63A 4EYYR 3WAKA 3IBPA 5AFUL 1HG5A 2X67A 1HS7A 4H9QC 3GN5A 2ACXA 3B57A 2L8KA 3I1AA 4I55E 2WBLA 4X1KE 5LHIB 2DWGA 4U72A 1IZNB 3R6NA 4CXYA 3Q5WA 3ZCJA 4IDZA 4ERRA 2JPFA 4I43B 4OYKA 4AQGA 3NBXX 5EZYE 4O8SA 2MTQA 2Q9QB 4AQFC 2LT3A 3ZLIA 5LA6E 3O4XE 3LK3B 2NW8A 5HWXA 4O4LE 4WBOA 3N2GE 4EB6E 1LKXA 2CLYB 5J1GA 3ZN1B 2DCFA 2UXXB 1MMAA 4ZI2C 2Y48B 3K8PC 5FXXA 2VKDA 5JR9C 3P8CD 1B7TA 3ZEFB 4GYRA 5LOVE 2C0SA 1S94A 5ADXL 3GN5B 4KP3C 1U4QA 4UVBB 5LHHB 4HKAA 4ANJA 3KV6A 1U5PA 5HXSA 3UT5E 4EXTA 4CI1B 3F31A 3KV4A 2LEHA 3MKDA 4H63V 2ZM2A 4AQFA 5L2LA 4AKLA 1HF8A 2V7KA 2MOZA 3KBUA 3KINB 3KVAA 4ISSA 2VK9A 4UV8B 3ZC0A 2IC9A 4CI3B 1FEWA 4A56A 3I0QA 4EIWA 4J2CA 2VL8A 4ADZA 4CXWA 2LSIA 4IE0A 3PUSA 2X51A 3E08A 1S35A 4O4HE 1ZEEA 1YKHB 2JMHA 4TZ4C 1NAFA 4JLEA 4PFOA 3J9X1 2EHOC 3GMIA 3CX6B 1HTJF 1KK7A 5DJQC 3W15B 2CMRA 4PJLA 3HA4A 2WAUA 1ZV4X 3N9QA 5HWYA 3MACA 4OYJA 1VRBA 3LJCA 4C90A 4C91A 2V7IA 2LJLA 2X66A 3HKCE 5JH7E 4E7ZA 2HPLA 3MK7C 2XAQB 2Z6EA 1BR0A 3VHLA 3ZMTB 5CA0E 3WI3A 2VKOA 4YJ2E 4UIGA 4O2AE 4OHFA 4TV9E 2ODUA 2JQQA 1VOMA 3KDSE 4UEMA 3KBTA 1BR4A 3LG7A 1G8XA 3AVSA 3AA6B 4XAXB 3NZQA 3HI2A 2LSJA 1HFAA 3V5UA 3PURA 1US7B 4AKIA 2H7OA 1D0YA 4NUUA 2E9XB 2ZM0A 4GK0E 4Z8XA 2IW5B 2W00A 2LHNA 3CX8B 2LM9A 4QWNB 3N9PA 4UVAB 3O1HA 3TKLB 3ESLA 2V26A 5F8PA 4ZI2D 4GK5E 2X9YA 3KVBA 4PNIA 2KXPB 2K9AA 3RRWA 3SWHA 3UULA 3LK42 3N9OA 4MBQA 5FNVE 5HXHA 2XAHB 2NWBA 4CZZB 5CA1E 2K5BB 5EK4A 3FBLA 1IJ5A 3C4XA 5C8YE 2CXLA 4DMWA 2ZMAA 1FIOA 3HKBE 3OYZA 2DNXA 1AJ3A 5FXWA 2XAGB 2A2FX 3NRXA 1V9DA 2P9BA 3RC8A 2IAKA 3UUNA 1MIVA 5HYAA 3NRYA 5IHYA 1X79A 4PK5A 2LSYA 4HN9A 4I50E 2Q9QD 2E9XA 3L09A 3N5LA 3Q2MA 5KMGP 4IE5A 3ANWA 5L3BB 5A1LA 4AI6A 4QXBB 4PJMA 4AKGA 1NWMX 1UX5A 2I59A 1D1BA 5FYMA 1BR2A 2HPJA 2EHOA 2RP4A 3IEEA 5JDHA 5BMVE 4TX5A 5JDGA 4ZHQE 2XASB 2WSSV 3VU7H 5FXZA 2BZBA 2NW9A 3E22E 3HL6A 3B13A 1MMNA 4UV9B 3AA0B 2XHEB 5FY1A 2VWAA 3C98B 3K3NA 3ZYMA 3MJXA 3SS1A 3EDVA 5JDNA 1HG2A 1FMVA 2BDEA 3Q9DA 2WM9A 2N1GA 3N9MA 4CQIA 4XBFB 3CMLA 4IE4A 3R84B 5GONE 3T8OA 5LBQB 2OA5A 5M4YA 4KUMB 3PU3A 2V7MA 2DHRA 4U74A 3ZMUB 3BQIA 3N2OA 1FMWA 4GIWA 5JRCB 2HH7A 2C5KT 3IF8B 1UX4A 3KV5A 5JR9A 1HCIA 3I9WA 3AB3B 1SA0E 2CE7A 5LJMA 2PFVA 2YEVC 3VKGA 3JC6D 4XZCA 2D5UA 4ISTA 1E1HB 4H9PC 3RYCE 5LP6E 5LGTB 3Q5XA 3QK6A 4MLKA 3C4WA 2N2NA 1G73A 2RA1A 3M65A 4ZS2A 2Q9QA 4EZHA 2V7LA 2PJQA 3ZC1A 5L3DB 4PK4A 5LGUB 2EHOD 4O4IE 5HXRA 2Y6XA 4JEUB 3UUXB 4FI5A 3PU8A 3RYFE 4ASKA 4X20E 5HXEA 4HGAA 3I9YA 4B6XA 2CCQA 4PJNA 3RX6A 1YKEB 3P7IA 3UFEA 2L3LA 2CXFA 2M67A 3FHNA 2BVLA 4X1IE 2MYSA 3FXEB 4DNDA 5HAXA 5FY0A 3CWZB 4HFVA 4AKHA 3L3PA 2PG8A 2YU2A 5EK2A 3MZKB 5LCYA 5F3JA 3H3AA 3AVRA 2E8IA 4PJJA 1WYCA 4TN7B 4L9IA 3AA1B 1EZ3A 1HX8A 4PAGA 5E0OA 2QA7A 5JQGE 3N9LA 3O1JA 1MIWA 4P0BA 5LYJE 3RPUA 2GK9A 5JDFA 3RH3A 2LSGA 3PUQA 3O9XA 3AAEB 2E9XD 5J2UE 4G2AA 2QGSA 3E0ZA 2YK0A 1YW0A 3I0OA 3OBVE 3HKEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1G A;  2LSJ A;  4EXT A;  4BA9 A;  4GK0 E;  4GK5 E;  4FJO A;  3VU7 H;  2LSK A;  2LSI A;  2LSY A;  2LSG A; 
#chains in the Genus database with same CATH topology
 2J4G A;  2X0Y A;  1XNR T;  3J7Y q;  1HNW T;  4DBR A;  2X68 A;  5FXV A;  3N9N A;  3S4U A;  1WRD A;  4EED A;  3OVU A;  4YTP A;  1IBK T;  2W2U A;  3L8R A;  3HKD E;  4HEA A;  5LG3 A;  3AEF A;  2WU5 A;  2CXD A;  1O3X A;  4Z90 A;  2BG9 B;  4X66 T;  4YT0 A;  5AQK B;  1D0Z A;  2XPK A;  1W0B A;  4H9N C;  5HCJ A;  4EZ4 A;  2BKP A;  1OED C;  3AE3 A;  4CN1 A;  2CHO A;  1D0X A;  2V5C A;  2WQY A;  3CQX C;  5JDL A;  2JMK A;  3FXD B;  1HX1 B;  4QXC B;  2MBG A;  3EI0 A;  4L5G A;  4DMV A;  3PJA J;  5FY7 A;  3ZST A;  1ZHC A;  5L3F B;  5J2T E;  2YU1 A;  3RYI E;  1E2A A;  2SPC A;  1FJG T;  1OWA A;  3RF1 A;  1LRZ A;  1T98 A;  4OK0 A;  4YSZ A;  4JI8 T;  4DV6 T;  4DUY T;  1WLX A;  5AQU B;  2CWO A;  2VKJ A;  3AAI A;  1W09 A;  5KX5 E;  1XMO T;  2UUA T;  2BVM A;  2KWH A;  2QRX A;  4QKN A;  4WNK A;  4YHJ A;  3AE1 A;  2LOS A;  5JVD E;  2V6Y A;  2VAS A;  4DR2 T;  4O2B E;  2H3R A;  2WZI A;  3RKG A;  4JI3 T;  3UUM A;  3PE0 A;  4MAL A;  1UCU A;  2FJA A;  1XDP A;  2XQA A;  5L3C B;  4UEL A;  5JR9 B;  5LJN A;  5AQO B;  3T1H T;  4PW8 A;  4LF7 T;  1I6Z A;  2BKN A;  1D1C A;  2K24 A;  4LF5 T;  2KZ7 B;  3CQG B;  4Z91 A;  4QXH B;  2W63 A;  3CPZ A;  2YN6 A;  4UXN B;  2DL1 A;  2D2S A;  4DV1 T;  3RC3 A;  4KBM B;  2V7J A;  2CBJ A;  2WP9 A;  5TAO A;  3M3Z B;  3UU6 A;  3LBX B;  3Q5D A;  2E9X C;  3QUJ A;  4H63 H;  4ZI7 E;  2JJ9 A;  4V1A v;  5ABE A;  3AA7 B;  3RQW A;  2NOX A;  2Q9Q C;  3CQC B;  3K3Q C;  2WWV A;  4X62 T;  3AE2 A;  2LLY A;  2XM2 A;  3AAA B;  3C50 A;  3HR0 A;  3IHR A;  5LB7 B;  2IML A;  2ZLY A;  5DQW A;  2YDQ A;  4U2Y A;  4UF0 A;  4DV5 T;  2UU9 T;  3L39 A;  2AE9 A;  2DI4 A;  4TWD A;  3PUY F;  2NP9 A;  2ZM8 A;  4N78 D;  2X9X A;  5FMN A;  3AXJ B;  3MA9 A;  3SRZ A;  3FBZ A;  4GYS A;  2NTY A;  4ILU A;  5H6R B;  2W67 A;  3MXZ A;  2Y8D A;  4BAY B;  4F6R C;  5LGN B;  5IYZ E;  4ZI3 C;  1WYB A;  3ZYK A;  4OFZ A;  4JEH B;  3FZF B;  4NIQ A;  3CX7 B;  3O1I A;  5HEO A;  3QC9 A;  5JDM A;  4P1N A;  3U78 A;  4X64 T;  2YIN A;  4HWC A;  5AQV B;  2WDR A;  2XTL A;  5KDM C;  4IHJ E;  1OED E;  4H9O C;  2D0U A;  2JRK A;  2KND A;  1IBM T;  4AIS A;  1JNR A;  2X9H A;  4COF A;  4DR6 T;  5LNK A;  4DV2 T;  1SUM B;  1CUN A;  1MMG A;  3DP7 A;  4UF0 B;  4EAH A;  4O4J E;  1VCT A;  5LG4 A;  2XQY A;  2XQ6 A;  3NZP A;  4LMJ A;  4U2Z A;  1MNE A;  3RLF F;  4EGW A;  4H9R C;  3D0T A;  5CJ5 A;  1I94 T;  1DU2 A;  1KEY A;  2CWY A;  2XSB A;  4TV8 E;  4EEB A;  4LFB T;  2EHO B;  3BK9 A;  3SFE A;  1UUS A;  1WR6 A;  2LKH A;  2XJ7 A;  3CIR A;  3K1S A;  4I4T E;  2KIN B;  3CKD A;  4MHC A;  4QH1 A;  3PJA A;  3ZJ2 A;  4QX8 B;  4A5X A;  3EUH A;  3PUV F;  4EOZ B;  2D9D A;  1J1J A;  1XWM A;  4X1Y E;  5IWA T;  2W0G A;  4ZOL E;  1X9B A;  2IIU A;  4KMC A;  4DO0 A;  3LFM A;  1YQ3 A;  3EVY A;  3LBX A;  4JBW F;  2NTX A;  2BG9 E;  4IDN A;  1LVK A;  2C5I T;  4QX7 B;  1QUU A;  2ODV A;  3BQK A;  3C64 A;  5AQN B;  2UXD T;  3KV9 A;  5AQH B;  4BJN A;  1KFY A;  3PUG A;  4K0U A;  4ZZB A;  1N36 T;  4HTE A;  2A72 A;  1LVF A;  2YKS A;  3ETU A;  3QNU A;  5AQT B;  2LHR A;  2XAJ B;  3AE6 A;  3F57 A;  3C4Z A;  2UXN B;  4QHO A;  2LSK A;  1BR1 A;  2ZM6 T;  2XUE A;  2CM0 A;  3ZT5 A;  1Y64 B;  2FJE A;  2LOP A;  2VL0 A;  4IIJ E;  2W61 A;  4YY3 T;  4ILB A;  4LF6 T;  2WS3 A;  2IC6 A;  5AQR B;  2DWK A;  2LE8 A;  3CK6 A;  5JRC A;  2WMN A;  3ZYL A;  2XQ3 A;  2XSA A;  3ONX A;  4MFR A;  4YLH A;  1OXZ A;  4M1P A;  2WMO A;  4X5T A;  5DAB A;  4EYU A;  3P4Q A;  2J47 A;  1H7C A;  2MAW A;  4HE8 A;  3AE8 A;  4IGU A;  3OKQ A;  3WAJ A;  1KNZ A;  2OLT A;  2A3D A;  2CLY C;  2WWU A;  4JUY A;  4WW0 A;  5CB4 E;  3RYH E;  2G0U A;  3ZCI A;  4BA9 A;  3RRC A;  3F2E A;  3JC6 C;  3OYX A;  2CEA A;  2VVN A;  4H9S E;  5H6Q B;  1Z0P A;  2K48 A;  3FB2 A;  3N2K E;  4P0A A;  2WY2 A;  3KFW X;  4DBQ A;  1D1A A;  1MIY A;  5HEU A;  2LM2 A;  3SFD A;  5L3E B;  5LXT E;  3A5X A;  3DJB A;  3ZMV B;  1SE7 A;  3UFG A;  3VR9 A;  2V6Y B;  4CI2 B;  4B3R T;  1ZKE A;  2PBI A;  5CFB A;  3ETV A;  1MMD A;  2JQ9 A;  2D0T A;  5HXC A;  2DLR A;  2KMF A;  2KT9 A;  2X0L B;  2C5J A;  2V5D A;  2VB6 A;  4YFS A;  5EK3 A;  4E7S A;  4DVD A;  1J5E T;  1NEK A;  2VQE T;  2X9W A;  3UQ7 A;  5LBM A;  3BQL A;  4JI6 T;  4BJM A;  4NUV A;  4B3M T;  5FL1 A;  4AXP A;  3U3I A;  2QYW A;  4IT4 A;  3EDU A;  4TUY E;  4UVC B;  5ETW A;  4YJ3 E;  3ZMZ B;  3SOL A;  5ABF A;  4QH5 A;  4DR7 T;  2N9D A;  4ZS3 A;  3ZPO A;  2W4X A;  3JAF A;  4GOU A;  1XMQ T;  3LDQ B;  4PFP A;  4WBN E;  1YD8 G;  3ANW B;  3DTO A;  2V6X A;  2KWI B;  2VKH A;  5JDQ A;  1GQE A;  5LMU T;  4LF4 T;  4L0R A;  3LK2 B;  2K3W A;  3RKO A;  3C51 A;  5DQV A;  2HHH T;  4U33 A;  4FJO A;  4IE6 A;  4IE7 A;  2KLQ A;  3UQ4 A;  1IAP A;  1R8I A;  3OJA A;  1IJ6 A;  2KSR A;  2XM1 A;  3B5M A;  2W62 A;  3H37 A;  5JRE A;  1SHZ C;  1T8B A;  3GA8 A;  4PK6 A;  2ES0 A;  4P09 A;  4AKR B;  3GWH A;  2XAF B;  4AQY T;  4LFA T;  3P4P A;  4HFB A;  3ZJ1 A;  3ONJ A;  2V1D B;  5AQP B;  3AE5 A;  4YHH T;  2JQK A;  2NW7 A;  3EAB A;  3ZMS B;  3FZL B;  4ZEY A;  2BS2 A;  3PTR B;  5FP3 A;  2L9Q A;  3TLU A;  5AQL B;  3K3O A;  1QSD A;  2B1E A;  3CVR A;  5L4H A;  4HFD A;  3PDY A;  4IDO A;  3ZN0 B;  1ZP0 A;  4ZI3 D;  2E5L T;  2CA5 A;  3T1Y T;  3V5S A;  2BBJ A;  1MND A;  2H7V C;  3PUA A;  2J1D G;  4ZZC A;  4G63 A;  5C8Y E;  4EYY R;  4GKK T;  1N32 T;  2LKG A;  3IBP A;  3WAK A;  5AFU L;  1HG5 A;  1YQ4 A;  2X67 A;  1HS7 A;  4H9Q C;  3GN5 A;  1XZY A;  2ACX A;  3B57 A;  5HCM A;  3VKH A;  5HEJ A;  2L8K A;  3I1A A;  4I55 E;  4DV3 T;  2BKO A;  3RIA A;  2WBL A;  4X1K E;  3RIU C;  2DWG A;  4U72 A;  1IZN B;  4CN4 A;  5LHI B;  1WR0 A;  3G06 A;  3R6N A;  3OTO T;  2LRK A;  4DV0 T;  4CXY A;  3Q5W A;  3ZCJ A;  4IDZ A;  4ERR A;  2MPK A;  2JPF A;  1VCS A;  4I43 B;  4OYK A;  3VRB A;  3NBX X;  5EZY E;  4AQG A;  4O8S A;  2MTQ A;  2Q9Q B;  3UUB A;  4AQF C;  1T72 A;  2LT3 A;  3ZLI A;  5LA6 E;  3O4X E;  3ZSS A;  3LK3 B;  3Q5E A;  5KXJ A;  2NW8 A;  4KI0 F;  4WYV A;  5HWX A;  1M62 A;  1UUR A;  4O4L E;  4WBO A;  3N2G E;  4DR1 T;  4EV6 A;  5FL0 A;  4EB6 E;  1LKX A;  2CLY B;  3AEA A;  5LHG B;  5J1G A;  3ZN1 B;  2DCF A;  2UXX B;  1MMA A;  4ZI2 C;  2Y48 B;  3K8P C;  4KHZ F;  5FXX A;  4ZXL A;  2VKD A;  5JR9 C;  3P8C D;  1B7T A;  2A9U A;  2OV9 A;  3ZEF B;  1YXR A;  4GYR A;  5LOV E;  4TWF A;  2B76 A;  5C2T A;  3UU8 A;  3JAD A;  2C0S A;  1S94 A;  5ADX L;  3GN5 B;  4KP3 C;  1U4Q A;  4UVB B;  5AQQ B;  2LRL A;  5LHH B;  2W66 A;  1Z8U A;  2BS4 A;  4HKA A;  3KV6 A;  1U5P A;  4ANJ A;  3UT5 E;  2HN2 A;  4EXT A;  2H89 A;  3F31 A;  3KV4 A;  4TNV A;  4CI1 B;  3P4R A;  2LEH A;  3MKD A;  4H63 V;  2ZM2 A;  2IHR 1;  3RGL A;  4AQF A;  5L2L A;  4U3C A;  4AKL A;  1HF8 A;  2V7K A;  2MOZ A;  4LML A;  5HEG A;  4B3S T;  4TWH A;  3KBU A;  2XY8 B;  3KIN B;  3AE7 A;  4YTN A;  3KVA A;  4ISS A;  2VK9 A;  4UV8 B;  3ZC0 A;  2IC9 A;  4CI3 B;  1FEW A;  3AED A;  4A56 A;  2IUB A;  3I0Q A;  4EIW A;  4J2C A;  2VL8 A;  4ADZ A;  4LFC T;  4JYA T;  1N33 T;  1UK5 A;  1L0V A;  4CXW A;  4JI0 T;  2XQ8 A;  3RIU A;  1WCR A;  2LSI A;  4U7I A;  4OX9 T;  2JIW A;  4IE0 A;  3LSV A;  3PUS A;  2X51 A;  3E08 A;  1S35 A;  1CHU A;  2YOE A;  4O4H E;  4DUZ T;  3QB5 A;  1ZEE A;  4JI7 T;  1YKH B;  2JMH A;  4TZ4 C;  1NAF A;  4JLE A;  4QH4 A;  2UUB T;  2WU2 A;  4PFO A;  3J9X 1;  2EHO C;  3GMI A;  5AQM B;  3CX6 B;  2UUC T;  3VR8 A;  1HTJ F;  4NXM T;  4KX6 A;  1KK7 A;  5DJQ C;  3W15 B;  5L3G B;  2CMR A;  4PJL A;  3HA4 A;  2WAU A;  1ZV4 X;  3N9Q A;  3TLS A;  4AIU A;  3A8Y C;  3PUW F;  5HWY A;  3UU3 A;  2WZH A;  3MAC A;  5HXS A;  4DR4 T;  4OYJ A;  1VRB A;  3LJC A;  3JAE A;  5FVL A;  4C90 A;  2V7I A;  4C91 A;  2E2A A;  2LJL A;  2V8S V;  4YSY A;  4HFC A;  2X66 A;  3HKC E;  5JH7 E;  4LMK A;  1JNZ A;  2HPL A;  4WZX A;  4E7Z A;  3MK7 C;  1WFD A;  2XAQ B;  2Z6E A;  3NVO A;  5AQG B;  3VHL A;  3ZMT B;  1BR0 A;  5CA0 E;  3WI3 A;  2VKO A;  4YJ2 E;  4IL4 A;  4UIG A;  5F5W A;  4O2A E;  4OHF A;  2WCA A;  4TV9 E;  2ODU A;  2JQQ A;  4U31 A;  1VOM A;  3AEG A;  3KDS E;  4HFI A;  3KBT A;  4UEM A;  4YXD A;  1BR4 A;  3LG7 A;  3P50 A;  1G8X A;  3AVS A;  3AA6 B;  4XAX B;  3NZQ A;  3HI2 A;  2LSJ A;  1HFA A;  3V5U A;  4YTM A;  3PUR A;  1US7 B;  2QVA A;  4AKI A;  2H7O A;  1D0Y A;  4NUU A;  2M6I A;  3TLT A;  1XNQ T;  2E9X B;  4A98 A;  2ZM0 A;  4GK0 E;  3AE4 A;  4Z8X A;  1QLB A;  2JQH A;  2W00 A;  2IW5 B;  2LHN A;  4CXX A;  5C3J A;  3CX8 B;  2LM9 A;  4QWN B;  3N9P A;  4UVA B;  3AEC A;  3O1H A;  5AQJ B;  3TKL B;  3ESL A;  2V26 A;  5F8P A;  4ZI2 D;  4GK5 E;  5ABF B;  5J0Z A;  2X9Y A;  3KVB A;  4PNI A;  2KXP B;  2K9A A;  4Q25 A;  3RRW A;  1KF6 A;  3SWH A;  3LK4 2;  3UUL A;  4DV4 T;  3N9O A;  4MBQ A;  5FNV E;  2CBI A;  5HXH A;  2XAH B;  2NWB A;  5L3D B;  4CZZ B;  5CA1 E;  2VUR A;  2K5B B;  5EK4 A;  3FBL A;  1IJ5 A;  3C4X A;  1T7S A;  2YDS A;  2CXL A;  4IDP A;  3RI5 A;  3P4S A;  4DMW A;  2AXD S;  2M6B A;  2ZMA A;  4JI1 T;  1FIO A;  3HKB E;  3OYZ A;  4HFH A;  3ZT7 A;  2DNX A;  1AJ3 A;  5FXW A;  2XAG B;  2A2F X;  3FZM B;  3ABV A;  5ABH A;  1NEN A;  2BS3 A;  4HWH A;  3FZH B;  1N34 T;  3FZK B;  3NRX A;  4HWI B;  1V9D A;  2P9B A;  5HEH A;  1Y01 A;  2IAK A;  3VRA A;  3RC8 A;  3UUN A;  1MIV A;  5HYA A;  4X65 T;  3NRY A;  5IHY A;  4GKJ T;  2I6H A;  1OED B;  1X79 A;  4PK5 A;  2LSY A;  4HN9 A;  4I50 E;  5CGM A;  4K0K T;  3QB5 K;  2Q9Q D;  2E9X A;  2XQ5 A;  3L09 A;  3N5L A;  3Q2M A;  4YSX A;  5KMG P;  1IBL T;  4JI4 T;  4IE5 A;  2BG9 C;  3ANW A;  5L3B B;  5A1L A;  4AI6 A;  4CN6 A;  4QXB B;  4DV7 T;  5FKY A;  3EHZ A;  4I0U A;  4PJM A;  4AKG A;  4B3T T;  1NWM X;  2BG9 A;  1UX5 A;  5L4E A;  2I59 A;  3ZKR A;  3X1D A;  1D1B A;  2UXB T;  5FYM A;  1BR2 A;  2HPJ A;  2EHO A;  2RP4 A;  3IEE A;  5JDH A;  4DR3 T;  5BMV E;  4TX5 A;  5JDG A;  1ZOY A;  4ZHQ E;  2XAS B;  1W9R A;  2WSS V;  3VU7 H;  5FXZ A;  1HNX T;  2BZB A;  2NW9 A;  2X0H A;  3E22 E;  3HL6 A;  3B13 A;  3H3M A;  1MMN A;  4UV9 B;  3AA0 B;  2IDO B;  2XHE B;  3ONL C;  2VQF T;  3PUZ F;  4TNW A;  5FY1 A;  2VWA A;  3C98 B;  3K3N A;  4IL9 A;  3MJX A;  3ZYM A;  3SS1 A;  3EDV A;  2F4V T;  5JDN A;  1HG2 A;  1FMV A;  2BDE A;  4KHP T;  3Q9D A;  1OED A;  2WM9 A;  2N1G A;  3N9M A;  4CQI A;  4XBF B;  1J5W A;  2XQ4 A;  3AEE A;  3CML A;  4IE4 A;  4DID B;  4NXN T;  3R84 B;  2E5V A;  3JCF A;  3AEB A;  2FUP A;  3PV0 F;  5AQI B;  5GON E;  4HWD A;  4U7Y A;  1E7P A;  2OA5 A;  5LBQ B;  3T8O A;  4KUM B;  5M4Y A;  2HN1 A;  2V7M A;  3PU3 A;  2DHR A;  4U74 A;  5FVK A;  3BQI A;  3N2O A;  4JI5 T;  1FMW A;  3ZMU B;  4GIW A;  5JRC B;  2HH7 A;  2C5K T;  3IF8 B;  4NPP A;  5L47 A;  1UX4 A;  3KV5 A;  2I0M A;  5JR9 A;  3RHW A;  4DR5 T;  1HCI A;  2WB5 A;  3I9W A;  3AB3 B;  2RPA A;  1SA0 E;  4F8H A;  2UXC T;  2CE7 A;  5LJM A;  2PFV A;  2YEV C;  3QOF A;  3VKG A;  5ABG A;  3JC6 D;  4XZC A;  2D5U A;  2H88 A;  4IDQ A;  4IST A;  1E1H B;  2R6G F;  4H9P C;  3RYC E;  3AXJ A;  5LP6 E;  1UGO A;  5LGT B;  3Q5X A;  3OPC A;  3QK6 A;  1W0A A;  2WDV A;  4MLK A;  2CHN A;  3C4W A;  2N2N A;  1G73 A;  2RA1 A;  4UR9 A;  3M65 A;  4ZS2 A;  2Q9Q A;  3ZT6 A;  2V7L A;  2PJQ A;  3ZC1 A;  3P4W A;  4PK4 A;  4EZH A;  5LGU B;  2PTF A;  4JI2 T;  2EHO D;  4O4I E;  5HXR A;  2Y6X A;  4JEU B;  3UUX B;  4FI5 A;  1KNP A;  2XZE A;  3PU8 A;  4HFE A;  3RYF E;  4ASK A;  3EAM A;  3IA3 A;  3RIF A;  4X20 E;  3UU5 A;  5HXE A;  4HGA A;  3I9Y A;  5AQS B;  4B6X A;  2CCQ A;  2FBW A;  4A97 A;  5JTG A;  1HNZ T;  4PJN A;  3RX6 A;  1YKE B;  2FJB A;  3P7I A;  3UFE A;  2L3L A;  2CXF A;  2M67 A;  5IUX A;  2BBH A;  3FHN A;  2BVL A;  4X1I E;  2MYS A;  4HWF A;  2XQ9 A;  3A7M A;  3FXE B;  4DND A;  5HAX A;  4LF8 T;  3AE9 A;  5FY0 A;  5BR8 T;  2NR4 A;  3CWZ B;  4IRE A;  3UTK A;  2ACZ A;  4JV5 T;  1KNR A;  4HFV A;  4AKH A;  3L3P A;  5LMN T;  2PG8 A;  2CPT A;  2YU2 A;  5EK2 A;  2FJD A;  3MZK B;  3NKZ A;  5LCY A;  3H3A A;  3AVR A;  5F3J A;  2E8I A;  2XQ7 A;  2YDR A;  1HR0 T;  4PJJ A;  3TLW A;  1WYC A;  1XDO A;  4TN7 B;  2CRB A;  3TLV A;  4L9I A;  3AA1 B;  1EZ3 A;  1HX8 A;  4PAG A;  5E0O A;  2QA7 A;  5JQG E;  3N9L A;  3O1J A;  1MIW A;  4P0B A;  3RQU A;  3RPU A;  5LYJ E;  4ILC A;  1M7K A;  2GK9 A;  2J62 A;  5JDF A;  3RH3 A;  3UU4 A;  2LSG A;  3PUQ A;  3O9X A;  2E9X D;  3AAE B;  5J2U E;  4ILA A;  2VVS A;  3NWI A;  4G2A A;  2QGS A;  3E0Z A;  5AQF B;  2WDQ A;  2YK0 A;  4LF9 T;  1YW0 A;  3PUX F;  3I0O A;  3OBV E;  3HKE E; 
#chains in the Genus database with same CATH homology
 3J7Y q;  4DBR A;  2X68 A;  5FXV A;  3N9N A;  3S4U A;  1WRD A;  3HKD E;  4HEA A;  2CXD A;  1O3X A;  1D0Z A;  4H9N C;  4EZ4 A;  1D0X A;  3CQX C;  5JDL A;  2JMK A;  3FXD B;  4QXC B;  2MBG A;  4DMV A;  4L5G A;  5L3F B;  5FY7 A;  1ZHC A;  5J2T E;  2YU1 A;  3RYI E;  2SPC A;  1OWA A;  1LRZ A;  1T98 A;  4OK0 A;  1WLX A;  3AAI A;  2CWO A;  2VKJ A;  5KX5 E;  2BVM A;  2KWH A;  4QKN A;  4WNK A;  4YHJ A;  5JVD E;  2LOS A;  2VAS A;  4O2B E;  2H3R A;  3UUM A;  3PE0 A;  4MAL A;  1UCU A;  5LJN A;  5L3C B;  4UEL A;  5JR9 B;  4PW8 A;  1D1C A;  2K24 A;  2KZ7 B;  3CQG B;  4QXH B;  2W63 A;  3CPZ A;  4UXN B;  2D2S A;  3RC3 A;  4KBM B;  2V7J A;  5TAO A;  5L3G B;  3LBX B;  4H63 H;  2E9X C;  3QUJ A;  4ZI7 E;  2JJ9 A;  4V1A v;  3AA7 B;  2NOX A;  2Q9Q C;  3CQC B;  3K3Q C;  3AAA B;  3C50 A;  3HR0 A;  3IHR A;  2ZLY A;  5DQW A;  4UF0 A;  2DI4 A;  2NP9 A;  2ZM8 A;  4N78 D;  2X9X A;  5FMN A;  3SRZ A;  3MA9 A;  3FBZ A;  4GYS A;  2NTY A;  4ILU A;  5H6R B;  4F6R C;  3MXZ A;  2Y8D A;  4BAY B;  5IYZ E;  4ZI3 C;  1WYB A;  3ZYK A;  4OFZ A;  4JEH B;  3CX7 B;  3O1I A;  3QC9 A;  5JDM A;  3U78 A;  2YIN A;  2XTL A;  5KDM C;  4IHJ E;  4H9O C;  2D0U A;  2JRK A;  2KND A;  2X9H A;  5LNK A;  1CUN A;  1MMG A;  3DP7 A;  4UF0 B;  4EAH A;  4O4J E;  2XQY A;  3NZP A;  1MNE A;  4H9R C;  3D0T A;  2CWY A;  4TV8 E;  2EHO B;  3BK9 A;  1WR6 A;  4BJN A;  4I4T E;  3ZJ2 A;  4MHC A;  2KIN B;  3CKD A;  4QX8 B;  3EUH A;  4EOZ B;  4X1Y E;  2W0G A;  4ZOL E;  4KMC A;  4DO0 A;  3LFM A;  3EVY A;  3LBX A;  2NTX A;  1LVK A;  2C5I T;  4QX7 B;  1QUU A;  2ODV A;  3BQK A;  3C64 A;  3KV9 A;  3PUG A;  4K0U A;  4HTE A;  2A72 A;  1LVF A;  3ETU A;  2LHR A;  2XAJ B;  3F57 A;  3C4Z A;  2UXN B;  4QHO A;  2LSK A;  1BR1 A;  2XUE A;  2CM0 A;  1Y64 B;  2LOP A;  4IIJ E;  2W61 A;  2IC6 A;  2DWK A;  2LE8 A;  5JRC A;  2WMN A;  3ZYL A;  4MFR A;  3ONX A;  4YLH A;  1OXZ A;  4M1P A;  2WMO A;  5DAB A;  4EYU A;  4IGU A;  1H7C A;  4HE8 A;  3WAJ A;  3OKQ A;  1KNZ A;  2WWU A;  2A3D A;  2CLY C;  4JUY A;  4WW0 A;  3RYH E;  5CB4 E;  3ZCI A;  2G0U A;  4CXX A;  4BA9 A;  3RRC A;  3F2E A;  3JC6 C;  3OYX A;  2CEA A;  5H6Q B;  4H9S E;  1Z0P A;  2K48 A;  3FB2 A;  3N2K E;  4P0A A;  3KFW X;  4DBQ A;  3VKH A;  1D1A A;  1MIY A;  5L3E B;  5LXT E;  3A5X A;  3DJB A;  3ZMV B;  4CI2 B;  1ZKE A;  2PBI A;  3ETV A;  1MMD A;  5HXC A;  2D0T A;  3UTK A;  2DLR A;  2KMF A;  2KT9 A;  2X0L B;  2C5J A;  5EK3 A;  2VB6 A;  4YFS A;  4E7S A;  4DVD A;  2X9W A;  5LBM A;  3BQL A;  4BJM A;  4NUV A;  4AXP A;  3U3I A;  5ETW A;  5LHG B;  3EDU A;  4TUY E;  4UVC B;  3ZMZ B;  4YJ3 E;  3SOL A;  2N9D A;  4ZS3 A;  3ZPO A;  4GOU A;  4PFP A;  4WBN E;  1YD8 G;  3ANW B;  3DTO A;  5JDQ A;  2KWI B;  2VKH A;  4L0R A;  3LK2 B;  3RKO A;  3C51 A;  5DQV A;  4FJO A;  4IE6 A;  4IE7 A;  2KLQ A;  1IAP A;  3OJA A;  1IJ6 A;  5JRE A;  3H37 A;  2W62 A;  1SHZ C;  3GA8 A;  4PK6 A;  2ES0 A;  4P09 A;  4AKR B;  3GWH A;  2XAF B;  3ZJ1 A;  2V1D B;  2NW7 A;  3ZMS B;  3PTR B;  5FP3 A;  2L9Q A;  3K3O A;  1QSD A;  2B1E A;  3CVR A;  4ZI3 D;  5LG4 A;  3PDY A;  3ZN0 B;  5LGN B;  2CA5 A;  3V5S A;  1MND A;  2H7V C;  3PUA A;  2J1D G;  4G63 A;  4EYY R;  3WAK A;  3IBP A;  5AFU L;  1HG5 A;  2X67 A;  1HS7 A;  4H9Q C;  3GN5 A;  2ACX A;  3B57 A;  2L8K A;  3I1A A;  4I55 E;  2WBL A;  4X1K E;  5LHI B;  2DWG A;  4U72 A;  1IZN B;  3R6N A;  4CXY A;  3Q5W A;  3ZCJ A;  4IDZ A;  4ERR A;  2JPF A;  4I43 B;  4OYK A;  4AQG A;  3NBX X;  5EZY E;  4O8S A;  2MTQ A;  2Q9Q B;  4AQF C;  2LT3 A;  3ZLI A;  5LA6 E;  3O4X E;  3LK3 B;  2NW8 A;  5HWX A;  4O4L E;  4WBO A;  3N2G E;  4EB6 E;  1LKX A;  2CLY B;  5J1G A;  3ZN1 B;  2DCF A;  2UXX B;  1MMA A;  4ZI2 C;  2Y48 B;  3K8P C;  5FXX A;  2VKD A;  5JR9 C;  3P8C D;  1B7T A;  3ZEF B;  4GYR A;  5LOV E;  2C0S A;  1S94 A;  5ADX L;  3GN5 B;  4KP3 C;  1U4Q A;  4UVB B;  5LHH B;  4HKA A;  4ANJ A;  3KV6 A;  1U5P A;  5HXS A;  3UT5 E;  4EXT A;  4CI1 B;  3F31 A;  3KV4 A;  2LEH A;  3MKD A;  4H63 V;  2ZM2 A;  4AQF A;  5L2L A;  4AKL A;  1HF8 A;  2V7K A;  2MOZ A;  3KBU A;  3KIN B;  3KVA A;  4ISS A;  2VK9 A;  4UV8 B;  3ZC0 A;  2IC9 A;  4CI3 B;  1FEW A;  4A56 A;  3I0Q A;  4EIW A;  4J2C A;  2VL8 A;  4ADZ A;  4CXW A;  2LSI A;  4IE0 A;  3PUS A;  2X51 A;  3E08 A;  1S35 A;  4O4H E;  1ZEE A;  1YKH B;  2JMH A;  4TZ4 C;  1NAF A;  4JLE A;  4PFO A;  3J9X 1;  2EHO C;  3GMI A;  3CX6 B;  1HTJ F;  1KK7 A;  5DJQ C;  3W15 B;  2CMR A;  4PJL A;  3HA4 A;  2WAU A;  1ZV4 X;  3N9Q A;  5HWY A;  3MAC A;  4OYJ A;  1VRB A;  3LJC A;  4C90 A;  4C91 A;  2V7I A;  2LJL A;  2X66 A;  3HKC E;  5JH7 E;  4E7Z A;  2HPL A;  3MK7 C;  2XAQ B;  2Z6E A;  1BR0 A;  3VHL A;  3ZMT B;  5CA0 E;  3WI3 A;  2VKO A;  4YJ2 E;  4UIG A;  4O2A E;  4OHF A;  4TV9 E;  2ODU A;  2JQQ A;  1VOM A;  3KDS E;  4UEM A;  3KBT A;  1BR4 A;  3LG7 A;  1G8X A;  3AVS A;  3AA6 B;  4XAX B;  3NZQ A;  3HI2 A;  2LSJ A;  1HFA A;  3V5U A;  3PUR A;  1US7 B;  4AKI A;  2H7O A;  1D0Y A;  4NUU A;  2E9X B;  2ZM0 A;  4GK0 E;  4Z8X A;  2IW5 B;  2W00 A;  2LHN A;  3CX8 B;  2LM9 A;  4QWN B;  3N9P A;  4UVA B;  3O1H A;  3TKL B;  3ESL A;  2V26 A;  5F8P A;  4ZI2 D;  4GK5 E;  2X9Y A;  3KVB A;  4PNI A;  2KXP B;  2K9A A;  3RRW A;  3SWH A;  3UUL A;  3LK4 2;  3N9O A;  4MBQ A;  5FNV E;  5HXH A;  2XAH B;  2NWB A;  4CZZ B;  5CA1 E;  2K5B B;  5EK4 A;  3FBL A;  1IJ5 A;  3C4X A;  5C8Y E;  2CXL A;  4DMW A;  2ZMA A;  1FIO A;  3HKB E;  3OYZ A;  2DNX A;  1AJ3 A;  5FXW A;  2XAG B;  2A2F X;  3NRX A;  1V9D A;  2P9B A;  3RC8 A;  2IAK A;  3UUN A;  1MIV A;  5HYA A;  3NRY A;  5IHY A;  1X79 A;  4PK5 A;  2LSY A;  4HN9 A;  4I50 E;  2Q9Q D;  2E9X A;  3L09 A;  3N5L A;  3Q2M A;  5KMG P;  4IE5 A;  3ANW A;  5L3B B;  5A1L A;  4AI6 A;  4QXB B;  4PJM A;  4AKG A;  1NWM X;  1UX5 A;  2I59 A;  1D1B A;  5FYM A;  1BR2 A;  2HPJ A;  2EHO A;  2RP4 A;  3IEE A;  5JDH A;  5BMV E;  4TX5 A;  5JDG A;  4ZHQ E;  2XAS B;  2WSS V;  3VU7 H;  5FXZ A;  2BZB A;  2NW9 A;  3E22 E;  3HL6 A;  3B13 A;  1MMN A;  4UV9 B;  3AA0 B;  2XHE B;  5FY1 A;  2VWA A;  3C98 B;  3K3N A;  3ZYM A;  3MJX A;  3SS1 A;  3EDV A;  5JDN A;  1HG2 A;  1FMV A;  2BDE A;  3Q9D A;  2WM9 A;  2N1G A;  3N9M A;  4CQI A;  4XBF B;  3CML A;  4IE4 A;  3R84 B;  5GON E;  3T8O A;  5LBQ B;  2OA5 A;  5M4Y A;  4KUM B;  3PU3 A;  2V7M A;  2DHR A;  4U74 A;  3ZMU B;  3BQI A;  3N2O A;  1FMW A;  4GIW A;  5JRC B;  2HH7 A;  2C5K T;  3IF8 B;  1UX4 A;  3KV5 A;  5JR9 A;  1HCI A;  3I9W A;  3AB3 B;  1SA0 E;  2CE7 A;  5LJM A;  2PFV A;  2YEV C;  3VKG A;  3JC6 D;  4XZC A;  2D5U A;  4IST A;  1E1H B;  4H9P C;  3RYC E;  5LP6 E;  5LGT B;  3Q5X A;  3QK6 A;  4MLK A;  3C4W A;  2N2N A;  1G73 A;  2RA1 A;  3M65 A;  4ZS2 A;  2Q9Q A;  4EZH A;  2V7L A;  2PJQ A;  3ZC1 A;  5L3D B;  4PK4 A;  5LGU B;  2EHO D;  4O4I E;  5HXR A;  2Y6X A;  4JEU B;  3UUX B;  4FI5 A;  3PU8 A;  3RYF E;  4ASK A;  4X20 E;  5HXE A;  4HGA A;  3I9Y A;  4B6X A;  2CCQ A;  4PJN A;  3RX6 A;  1YKE B;  3P7I A;  3UFE A;  2L3L A;  2CXF A;  2M67 A;  3FHN A;  2BVL A;  4X1I E;  2MYS A;  3FXE B;  4DND A;  5HAX A;  5FY0 A;  3CWZ B;  4HFV A;  4AKH A;  3L3P A;  2PG8 A;  2YU2 A;  5EK2 A;  3MZK B;  5LCY A;  5F3J A;  3H3A A;  3AVR A;  2E8I A;  4PJJ A;  1WYC A;  4TN7 B;  4L9I A;  3AA1 B;  1EZ3 A;  1HX8 A;  4PAG A;  5E0O A;  2QA7 A;  5JQG E;  3N9L A;  3O1J A;  1MIW A;  4P0B A;  5LYJ E;  3RPU A;  2GK9 A;  5JDF A;  3RH3 A;  2LSG A;  3PUQ A;  3O9X A;  3AAE B;  2E9X D;  5J2U E;  4G2A A;  2QGS A;  3E0Z A;  2YK0 A;  1YW0 A;  3I0O A;  3OBV E;  3HKE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...