2LSYA

Structure of the c-terminal domain from human rev1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords DNA repair protein REV1
publication title NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsyA00
2LSIA 2LSYA 3VU7H 4EXTA 2N1GA 4BA9A 4GK5E 2LSGA 4GK0E 2LSKA 2LSJA 4FJOA
chains in the Genus database with same CATH superfamily
4UEMA 3GN5B 4GYSA 3UTKA 1D1CA 4IE7A 4UV8B 3NKZA 1NEKA 1HG5A 3ZJ2A 2V6XA 1D0XA 3Q2MA 2E5LT 5EK2A 3N2GE 2NW8A 1M62A 4ZI3C 3HL6A 4NPPA 4QXBB 5AQQB 4ADZA 3LK2B 3LSVA 4JUYA 3E08A 4XZCA 3NZQA 4O8SA 4GKJT 3AXJA 4TV8E 3H37A 2WZHA 3SFDA 2V7IA 3JAFA 1BR4A 3NRXA 5FXWA 4NXNT 5JR9C 4HTEA 4ILUA 3QOFA 3UU6A 5FNVE 4IE5A 5M4YA 3CK6A 5HCMA 2KMFA 2BZBA 5JH7E 3VRAA 2V1DB 3ZMTB 3I9YA 3ZSSA 3C4WA 4YHJA 1YQ3A 2YKSA 3RYIE 2VKHA 1T72A 5LGNB 2Y6XA 2LSGA 1YW0A 4DV3T 4H9NC 3E22E 2YDSA 2X9XA 4PNIA 4KHPT 3ANWB 1Z0PA 2JQKA 4DR1T 3KV9A 4HWFA 1N33T 2WU5A 5AQOB 4ZOLE 2NW7A 1HX1B 1ZEEA 3IF8B 3D0TA 1UCUA 2DCFA 4IREA 4AQFC 2D0UA 2XSAA 3HA4A 2W61A 3UQ4A 1IBMT 3P4SA 5F5WA 2YINA 4IDZA 1FEWA 4UIGA 1E1HB 2PG8A 3WAKA 1W9RA 3AE5A 3L3PA 2CHOA 4QH5A 1HFAA 4YSYA 3OBVE 4U2ZA 5H6QB 1QLBA 3Q5XA 2CE7A 2XAFB 4GOUA 3ZYLA 3ZT5A 4M1PA 5AQFB 3ZCJA 4DMVA 4H63V 3EVYA 5AQIB 3AE2A 4QXHB 5L2LA 2UUBT 5FY0A 5JVDE 2R6GF 3RIAA 4DUZT 1SUMB 5HXRA 2WS3A 3KBUA 4ERRA 4AXPA 3AEBA 1FIOA 3KVAA 4QHOA 4X20E 4C91A 5BR8T 3OKQA 1R8IA 5LHGB 1YQ4A 1MIVA 2MYSA 3L8RA 4L9IA 2PTFA 3QB5A 3ZN1B 3AE1A 4TN7B 2M67A 2ZLYA 5LBMA 4IL9A 3AA7B 5AQUB 1OEDB 1HNWT 3CPZA 2LOPA 4B3RT 4ZI7E 4DV6T 4IGUA 2BBJA 4BAYB 3I1AA 1IBKT 2CEAA 2QRXA 2E9XC 4G63A 2VKJA 3KDSE 4CN1A 4Z8XA 2WQYA 1E2AA 2X9WA 4O4LE 3HR0A 2LHRA 4EIWA 4JV5T 5FYMA 4JEHB 5ETWA 3I0QA 3GA8A 3ZEFB 5IUXA 5FXXA 3TKLB 5J0ZA 2XM2A 1VCSA 3IEEA 2YU1A 2ZMAA 4EB6E 3O1JA 2XQYA 4EV6A 2NP9A 2MBGA 1ZOYA 3UUBA 4LMKA 3E0ZA 2BS3A 3HKEE 4YJ2E 4TUYE 4IDOA 1KEYA 3RC8A 2MTQA 4DV2T 3CKDA 2VVNA 2EHOC 3I9WA 5AQJB 5HXHA 4B3ST 2DL1A 1UGOA 1MNEA 4HWCA 2CHNA 1VOMA 5CGMA 1MIWA 2BG9A 2XM1A 3C50A 2LSYA 2B76A 1HS7A 4JBWF 4ILBA 5BMVE 3QC9A 4E7SA 3VHLA 1UUSA 1LKXA 2YU2A 5JDNA 2QGSA 2CBJA 3RI5A 4GKKT 2CPTA 3GN5A 2CRBA 3RC3A 3WAJA 4WBNE 1CHUA 2HN1A 4PW8A 5L3BB 3WI3A 3LFMA 4ZEYA 4YTPA 3AA6B 1I6ZA 3FXEB 2QYWA 5JRCB 4PAGA 4U74A 2IUBA 2X9YA 2FUPA 3JCFA 2VWAA 2W4XA 1JNRA 2JQQA 1WR0A 3UU4A 5LB7B 1SE7A 1NAFA 2ACZA 2WSSV 4YY3T 5JR9B 5EK4A 3FHNA 3S4UA 3NWIA 5LG3A 2Z6EA 2B1EA 2XPKA 3T8OA 2CWYA 2LEHA 5CA1E 3CQXC 3AA0B 2K48A 2J4GA 1CUNA 4DV1T 4YTMA 3ZLIA 4DV7T 3LK42 2WU2A 2BVMA 4QKNA 1KNPA 4OHFA 5CFBA 5AQKB 5IWAT 5JTGA 2X68A 5AQNB 2UXCT 4PJMA 2XAHB 3CIRA 5EZYE 2ES0A 3P4RA 3UUMA 4ISTA 1UURA 4IDPA 3BQKA 5JREA 4ZZBA 5F3JA 2JIWA 3KINB 3OJAA 4WYVA 3PUXF 4GYRA 3ZPOA 2J62A 4U7YA 2NW9A 5ABHA 2WM9A 2DNXA 4IIJE 2WY2A 5HAXA 4PJLA 2OV9A 3PUGA 3AEDA 2QA7A 2NOXA 1LVFA 2LSIA 3AE8A 3ONLC 3N9LA 2LE8A 2XAGB 2XAJB 4HWDA 5L4HA 4X1IE 4HKAA 3ZC1A 2ZM8A 3C98B 2LKGA 2X0HA 1YKEB 4UXNB 1HG2A 2LSKA 2FJBA 2ODVA 3AEGA 3JAEA 4O4JE 5L47A 5C3JA 2OLTA 2K3WA 4B3TT 5C2TA 3LBXA 3M3ZB 1D0YA 4QX8B 2V5DA 2Q9QB 4EEBA 2WP9A 3P50A 2N9DA 2WMOA 4YTNA 2LOSA 2JJ9A 4JI4T 4PFPA 5ADXL 4Q25A 2X66A 5KDMC 5LGUB 1D1AA 3LK3B 3GWHA 3Q5DA 5J2UE 2E9XB 3ESLA 4P09A 3PUYF 1S94A 3J9X1 4PK6A 4HE8A 4A98A 2W00A 4OX9T 1I94T 5FXVA 2XZEA 1QSDA 3P7IA 3RF1A 4CI2B 2MPKA 3O9XA 2YOEA 3MKDA 4NIQA 3HI2A 3EABA 3ONXA 5F8PA 3BQIA 2KXPB 2AE9A 1Y64B 5A1LA 3RPUA 1QUUA 4HFHA 2C5JA 1GQEA 3KBTA 2DLRA 5HXCA 2UU9T 2UXNB 2W67A 3AAIA 4O4IE 4AISA 1J5ET 3PDYA 2BVLA 5CA0E 5E0OA 4COFA 3BK9A 3FZLB 2KSRA 4ZZCA 4HGAA 4H9RC 2EHOB 3JC6C 2LM9A 4TNWA 4TWFA 3J7Yq 2DWKA 4DBQA 4IE4A 2LHNA 4HFDA 4HFVA 4X1KE 2W63A 2XQ5A 3A5XA 4JI1T 3DP7A 2N1GA 4EYYR 4CI3B 2BBHA 3RYHE 5JQGE 4X65T 4AIUA 2RP4A 2XQ9A 5L3GB 3JADA 3N9MA 3HKBE 2L9QA 3N9PA 1SA0E 3K3OA 5LA6E 3SOLA 2XSBA 3TLTA 5HEUA 2ZM6T 4TNVA 3NZPA 2JMHA 4PJNA 4DMWA 3RRCA 2I59A 5L4EA 4AKIA 2VB6A 4HFCA 2JQ9A 2KT9A 5FVLA 2V6YA 4IL4A 5ABFA 4KX6A 3OPCA 4EGWA 4LF7T 5JDHA 4DR2T 4P0BA 2CBIA 3PUVF 4ZHQE 3MZKB 3PUWF 5HEHA 4YXDA 2XQ4A 5FVKA 4ASKA 4H63H 1U4QA 3Q9DA 4DUYT 3RIUC 4DBRA 1IAPA 2IAKA 4F6RC 1FJGT 2QVAA 3V5SA 2HN2A 3AA1B 2UXDT 2XQ6A 3FXDB 3QB5K 3AECA 4UR9A 2IIUA 2WBLA 3NVOA 2C5IT 2Q9QC 3PUZF 5LYJE 2KNDA 4DR5T 1U5PA 4DIDB 3PU3A 5TAOA 1WCRA 5EK3A 1UK5A 4GIWA 3UULA 2HH7A 2F4VT 3RQUA 2FJEA 2J47A 3ZMVB 4U33A 4AQFA 2A2FX 4BJMA 1B7TA 3CMLA 4E7ZA 1HCIA 3PUQA 3RGLA 4TWHA 4XBFB 1IZNB 1OXZA 3QUJA 3ZCIA 4ANJA 4PFOA 2UXBT 5IYZE 3AXJB 3ZMUB 4MHCA 5L3DB 3UU3A 3P8CD 2YN6A 3ZN0B 4LF4T 4GK5E 2VL8A 2XTLA 4H9PC 3B5MA 4DR4T 3ZYKA 4JI6T 4MALA 2VL0A 4I4TE 4KI0F 2GK9A 5C8YE 4LFCT 1WR6A 1OWAA 5AQRB 4CN6A 3KVBA 3CQGB 1H7CA 3F57A 2A3DA 2IC9A 4QWNB 4DNDA 3C64A 4PK5A 4QH4A 3DJBA 4UELA 2JMKA 1MMGA 5AQGB 5AQVB 1HTJF 2E5VA 2V26A 2XAQB 4UF0A 3UU5A 4A56A 3FZFB 4TV9E 4UVBB 3AE6A 3N5LA 3AE7A 3F31A 1Z8UA 3TLUA 3C4ZA 1LRZA 3A8YC 5L3FB 1NWMX 2CCQA 4KMCA 4OK0A 5H6RB 2LT3A 3X1DA 3PUSA 3ETVA 3EDUA 3K3NA 4YLHA 4TZ4C 2V7KA 5LMUT 2UXXB 3PJAJ 1VCTA 2J1DG 4YSZA 5HCJA 4KP3C 3N9OA 2E9XA 2W62A 2BG9E 2I0MA 4HFBA 5IHYA 4AKRB 2XY8B 4DVDA 2WZIA 4B6XA 2CMRA 2DI4A 4Z90A 4DV4T 4UVCB 3PE0A 3CX6B 3N9QA 3RHWA 5FL1A 2A9UA 4CQIA 4EXTA 2KWIB 5LCYA 4DR3T 5DABA 1W09A 3LDQB 4PJJA 3CVRA 3H3MA 3TLWA 1UX4A 4X62T 1YKHB 1YXRA 3O1HA 2IC6A 3OVUA 1FMVA 4Z91A 2IW5B 3FZHB 4AKGA 2EHOA 2NTYA 1HF8A 5DQWA 4JI0T 4HFIA 4ILCA 5HYAA 3AE4A 2UUAT 4NUUA 3FZMB 3ANWA 3VKHA 1KFYA 5LMNT 4ZS3A 3DTOA 3RKOA 1EZ3A 5LNKA 1X79A 3LG7A 2Y8DA 2ACXA 2AXDS 1ZHCA 3RYCE 3UUNA 4P0AA 2CXLA 2D2SA 3FZKB 4L5GA 3C51A 3FBLA 5HXSA 2V7MA 1XNRT 3RQWA 2CWOA 4EEDA 5JDMA 5JDQA 2W2UA 4NXMT 2PJQA 4X64T 2X0YA 1XMOT 4LF5T 2BS2A 4ZXLA 1IJ6A 2WCAA 4ILAA 4ZI2D 2XQ8A 1D0ZA 4CZZB 3UUXB 2SPCA 3O4XE 4OYJA 2M6IA 1VRBA 5LP6E 3ZJ1A 4I43B 5LXTE 2N2NA 1DU2A 2VK9A 2E8IA 2RA1A 1N34T 3PJAA 3MXZA 4IE6A 4CXXA 4L0RA 3GMIA 3EUHA 1X9BA 4WW0A 1ZP0A 4KBMB 3OTOT 2VVSA 3AAAB 2I6HA 5AQPB 3M65A 3SFEA 3AEEA 1T7SA 3UU8A 4BJNA 4YHHT 4QH1A 2D0TA 5HWXA 1UX5A 2WDRA 4P1NA 5HWYA 4AQGA 5DJQC 4U31A 1ZKEA 3PURA 1G73A 4IHJE 3MK7C 4EYUA 2CA5A 1WFDA 1KK7A 4OYKA 2V8SV 2PFVA 3UQ7A 4ZI3D 3AE3A 1OEDA 1KF6A 2NTXA 3AAEB 4PK4A 3AEAA 2VASA 2DWGA 1HNZT 1J1JA 3KV6A 1MMNA 3R6NA 2JPFA 3FB2A 4MBQA 3HKDE 5FY7A 5CB4E 3ZKRA 1WRDA 3MJXA 4X5TA 1MMDA 1OEDE 3VR9A 1FMWA 4EAHA 2E2AA 3W15B 2H7VC 2LRLA 3JC6D 3T1YT 5LHHB 1W0AA 5LJNA 3ABVA 3OYXA 3PTRB 1W0BA 2BKNA 5KX5E 5LBQB 3ZMZB 5LG4A 2JQHA 3EDVA 4YFSA 4HFEA 3P4QA 2BS4A 2X0LB 4O2BE 3T1HT 1NENA 5JDFA 2FBWA 2H89A 5AQLB 3V5UA 3CQCB 1XMQT 2X9HA 2BKOA 4MFRA 3CX8B 3RRWA 4H9OC 3ZT6A 4QX7B 3G06A 3OYZA 5LOVE 4CN4A 2LM2A 4FI5A 2VQET 5JRCA 4LFAT 1MMAA 4MLKA 4EZHA 1N36T 1Y01A 3RH3A 2HPJA 4KHZF 4LF8T 5HEOA 4JEUB 3QNUA 3N9NA 3CWZB 4DR7T 2H7OA 3K1SA 4F8HA 3N2KE 5AQMB 5L3EB 5JR9A 4DR6T 3L09A 4JI2T 2V7JA 4TX5A 3KV4A 2W66A 1WYBA 2X51A 4YJ3E 4ISSA 1MIYA 1V9DA 4TWDA 3ZMSB 3B57A 2VURA 4V1Av 5FP3A 2OA5A 4LF6T 1BR2A 4KUMB 4A97A 3LBXB 1E7PA 4UV9B 2MAWA 2ZM0A 4I50E 4O2AE 3U3IA 2FJAA 2Q9QD 2BG9C 4HWIB 4WBOA 1ZV4X 1G8XA 3KFWX 4JI5T 2D5UA 4HEAA 2WWVA 3RYFE 2CLYC 3H3AA 2YEVC 2L8KA 1T98A 3C4XA 1XDPA 3ZYMA 2WB5A 1IBLT 1WYCA 2E9XD 3SWHA 2H3RA 3P4WA 3MACA 5KXJA 3RLFF 4ZS2A 2LLYA 1D1BA 3F2EA 2A72A 1US7B 2LRKA 1N32T 4YSXA 2WDVA 2C0SA 2ZM2A 2MOZA 5FY1A 3ETUA 1L0VA 1XDOA 2P9BA 3TLSA 1M7KA 5L3CB 2K5BB 4N78D 1YD8G 3B13A 4UVAB 3VU7H 3UFGA 5ABEA 3NBXX 5JDLA 3RIUA 5JDGA 5FXZA 2NR4A 4EZ4A 2EHOD 3Q5WA 4B3MT 2WAUA 4I55E 2D9DA 3IBPA 1XWMA 5AQTB 2V5CA 3ZSTA 1HX8A 1T8BA 2H88A 3MA9A 2Q9QA 3IA3A 1SHZC 4WZXA 4X66T 5CJ5A 3BQLA 2G0UA 4G2AA 2PBIA 3UT5E 2VQFT 3LJCA 2YDQA 2KWHA 4GK0E 5HXEA 4AKHA 2X67A 5J1GA 2XUEA 3SS1A 1IJ5A 3PU8A 2K24A 2WMNA 1J5WA 3A7MA 4H9QC 2XQ7A 1JNZA 3K8PC 3VR8A 4EOZB 3Q5EA 4JI7T 4DV0T 3VKGA 1BR0A 2CXFA 3EAMA 2V6YB 5ABFB 3AB3B 2XQ3A 2XHEB 2YDRA 2Y48B 4YT0A 4AKLA 4LF9T 3PV0F 4X1YE 4DV5T 1XZYA 1HNXT 4BA9A 4OFZA 3FBZA 1LVKA 2KZ7B 2LSJA 2IDOB 4JI3T 4LMLA 4JI8T 2K9AA 2LJLA 1XNQT 2XJ7A 4IE0A 2VKOA 3AE9A 4AI6A 2HPLA 3SRZA 2WWUA 3HKCE 2XQAA 3AVSA 4U2YA 5LHIB 5ABGA 4U3CA 3N2OA 5AQSB 3QK6A 4U7IA 4HN9A 2HHHT 2LKHA 5J2TE 2JRKA 5AFUL 4C90A 3VRBA 5HEGA 2V7LA 2YK0A 5DQVA 2C5KT 3EHZA 4NUVA 2WDQA 3ZT7A 2VKDA 4IDQA 4FJOA 4HWHA 2CM0A 1OEDC 4IDNA 4AQYT 1WLXA 1AJ3A 3NRYA 4CXYA 2IHR1 4LFBT 4LMJA 1BR1A 2RPAA 4CXWA 4K0UA 4J2CA 3U78A 3ONJA 5FKYA 3EI0A 2KINB 4QXCB 4WNKA 3RIFA 4ZI2C 5FMNA 2W0GA 4JLEA 2KLQA 3RKGA 4XAXB 3RX6A 3KV5A 4H9SE 2L3LA 2DHRA 3CX7B 5AQHB 2BDEA 3AEFA 2NWBA 4O4HE 4JYAT 3I0OA 3K3QC 3TLVA 3PUAA 2FJDA 5KMGP 1S35A 5HEJA 3O1IA 5LGTB 1KNZA 2ODUA 1KNRA 5FL0A 2IMLA 3ZC0A 3L39A 2M6BA 4A5XA 1HR0T 4U72A 1O3XA 2XASB 4UF0B 2BG9B 2BKPA 3R84B 3AVRA 5GONE 4K0KT 1MNDA 3UFEA 3IHRA 2CLYB 4CI1B 2UUCT 2CXDA 3P4PA 4IT4A 4DO0A 4I0UA 5LJMA
chains in the Genus database with same CATH topology
4FI5A 4UEMA 3ZLIA 5JRCA 3GN5B 1MMAA 3LK42 4I4TE 4GYSA 2BVMA 4MLKA 3UTKA 4EZHA 1D1CA 4QKNA 4IE7A 4OHFA 2GK9A 4UV8B 3RH3A 5C8YE 2HPJA 1WR6A 1OWAA 1HG5A 3ZJ2A 4JEUB 3KVBA 3CQGB 1D0XA 1H7CA 3N9NA 3CWZB 3Q2MA 5EK2A 3N2GE 2NW8A 2H7OA 2X68A 3F57A 2A3DA 4ZI3C 3HL6A 3N2KE 2IC9A 4QXBB 4QWNB 4DNDA 4ADZA 4PJMA 5L3EB 2XAHB 3C64A 5JR9A 3LK2B 4PK5A 2ES0A 5EZYE 4JUYA 3DJBA 4UELA 2JMKA 3L09A 3E08A 1MMGA 2V7JA 4TX5A 4XZCA 3KV4A 3UUMA 2X51A 1WYBA 1HTJF 4YJ3E 2V26A 2XAQB 4UF0A 4A56A 3NZQA 4O8SA 4ISTA 4TV9E 4UVBB 4ISSA 1MIYA 1V9DA 3N5LA 3ZMSB 3BQKA 4TV8E 3B57A 3F31A 4V1Av 5JREA 5FP3A 2OA5A 3H37A 3C4ZA 1LRZA 1BR2A 5F3JA 4KUMB 3KINB 3OJAA 5L3FB 1NWMX 2CCQA 2V7IA 1BR4A 3LBXB 4KMCA 4GYRA 3NRXA 4OK0A 2LT3A 5H6RB 5FXWA 3ZPOA 4UV9B 3PUSA 5JR9C 4HTEA 4ILUA 2ZM0A 5FNVE 4IE5A 5M4YA 2NW9A 4I50E 3ETVA 2WM9A 2DNXA 3EDUA 3K3NA 4IIJE 4O2AE 2V7KA 4TZ4C 4YLHA 2KMFA 2UXXB 3U3IA 2Q9QD 2BZBA 5JH7E 5HAXA 4PJLA 4WBOA 2V1DB 2J1DG 3ZMTB 3I9YA 3PUGA 1ZV4X 4KP3C 2QA7A 3C4WA 1G8XA 2NOXA 3KFWX 3N9OA 2E9XA 1LVFA 2LSIA 2W62A 2D5UA 4HEAA 4YHJA 3RYFE 5IHYA 3N9LA 2CLYC 3RYIE 2VKHA 2LE8A 2XAGB 2XAJB 3H3AA 4AKRB 5LGNB 2Y6XA 2L8KA 2LSGA 2YEVC 4DVDA 1YW0A 4H9NC 1T98A 3C4XA 3E22E 4X1IE 4HKAA 3ZYMA 4B6XA 3ZC1A 3C98B 2ZM8A 2X9XA 1WYCA 2CMRA 2DI4A 1YKEB 2E9XD 4PNIA 4UXNB 3SWHA 1HG2A 2H3RA 2LSKA 3ANWB 1Z0PA 3MACA 2ODVA 4UVCB 3KV9A 3PE0A 4O4JE 3CX6B 3N9QA 4CQIA 4EXTA 4ZS2A 2KWIB 4ZOLE 5LCYA 1D1BA 2NW7A 3F2EA 5DABA 2A72A 1ZEEA 3LBXA 3IF8B 3D0TA 1UCUA 4PJJA 1US7B 3CVRA 1D0YA 4QX8B 1UX4A 2DCFA 2C0SA 2ZM2A 1YKHB 2Q9QB 4AQFC 3O1HA 2MOZA 5FY1A 2D0UA 3ETUA 2IC6A 2P9BA 2N9DA 3HA4A 2WMOA 2LOSA 1FMVA 2JJ9A 2W61A 5L3CB 2K5BB 4N78D 1YD8G 2IW5B 4PFPA 5ADXL 3B13A 4UVAB 4AKGA 2YINA 2EHOA 4IDZA 1FEWA 4UIGA 2X66A 3VU7H 1E1HB 5KDMC 2NTYA 2PG8A 3WAKA 5LGUB 1D1AA 1HF8A 3LK3B 3NBXX 5DQWA 5JDLA 3L3PA 5JDGA 3GWHA 5HYAA 5FXZA 5J2UE 2E9XB 3ESLA 4P09A 1HFAA 1S94A 3J9X1 4NUUA 4PK6A 3ANWA 3OBVE 4HE8A 3VKHA 5H6QB 4EZ4A 2EHOD 4ZS3A 3DTOA 3Q5WA 2W00A 3Q5XA 3RKOA 5FXVA 1QSDA 3P7IA 1EZ3A 2CE7A 2WAUA 1X79A 2XAFB 4I55E 4CI2B 5LNKA 3IBPA 3LG7A 4GOUA 2Y8DA 3ZYLA 3O9XA 2ACXA 4M1PA 3MKDA 3ZCJA 4DMVA 1ZHCA 3RYCE 3UUNA 3HI2A 3ONXA 4H63V 5F8PA 3EVYA 4P0AA 2CXLA 2D2SA 3BQIA 2KXPB 4L5GA 4QXHB 3C51A 1HX8A 5L2LA 1Y64B 3MA9A 5FY0A 3FBLA 5JVDE 5A1LA 3RPUA 2Q9QA 5HXSA 2V7MA 1SHZC 5HXRA 1QUUA 2CWOA 5JDMA 5JDQA 2C5JA 3BQLA 5LOVE 2G0UA 3KBTA 2DLRA 2PJQA 4G2AA 3KBUA 5HXCA 2PBIA 2UXNB 3UT5E 3AAIA 4O4IE 4ERRA 4AXPA 3PDYA 2BVLA 3LJCA 1FIOA 3KVAA 5LJMA 5CA0E 4QHOA 4X20E 2KWHA 5E0OA 4C91A 1IJ6A 3BK9A 4GK0E 5HXEA 3OKQA 4AKHA 2X67A 5J1GA 2XUEA 5LHGB 3SS1A 1IJ5A 3PU8A 2K24A 1MIVA 2MYSA 2WMNA 4L9IA 4ZI2D 3ZN1B 4H9QC 1D0ZA 4CZZB 3UUXB 2SPCA 3K8PC 4TN7B 4HGAA 4H9RC 2EHOB 3O4XE 2M67A 2ZLYA 5LBMA 4OYJA 4EOZB 3JC6C 1VRBA 2LM9A 5LP6E 3ZJ1A 4I43B 5LXTE 2N2NA 3J7Yq 2VK9A 3VKGA 2E8IA 2RA1A 1BR0A 3AA7B 2DWKA 4DBQA 4IE4A 3MXZA 2CXFA 4IE6A 2LHNA 4CXXA 4L0RA 3CPZA 2LOPA 3AB3B 3GMIA 4HFVA 4ZI7E 3EUHA 4X1KE 2W63A 4IGUA 2XHEB 4WW0A 3A5XA 2Y48B 4BAYB 3I1AA 4KBMB 3AAAB 2CEAA 3DP7A 4AKLA 2N1GA 4EYYR 2E9XC 4G63A 4CI3B 3M65A 3RYHE 2VKJA 3KDSE 4X1YE 5JQGE 4BA9A 4BJNA 4OFZA 4Z8XA 2D0TA 2RP4A 5HWXA 1UX5A 3FBZA 5L3GB 1LVKA 2KZ7B 2X9WA 3N9MA 2LSJA 3HKBE 2L9QA 3N9PA 4O4LE 1SA0E 3HR0A 2LHRA 3K3OA 4EIWA 5FYMA 5LA6E 3SOLA 4JEHB 5ETWA 5HWYA 4AQGA 3I0QA 5DJQC 3GA8A 3ZEFB 2K9AA 1ZKEA 3PURA 2LJLA 1G73A 4IHJE 4IE0A 2VKOA 3NZPA 2JMHA 4PJNA 4AI6A 2HPLA 3MK7C 5FXXA 3SRZA 4DMWA 3TKLB 2WWUA 3RRCA 4EYUA 2CA5A 3IEEA 3HKCE 2I59A 1KK7A 2YU1A 4OYKA 4AKIA 2PFVA 2ZMAA 4EB6E 4ZI3D 2VB6A 3AVSA 5LHIB 3O1JA 2KT9A 3N2OA 2XQYA 2NP9A 3QK6A 2MBGA 4HN9A 2NTXA 3E0ZA 3AAEB 4PK4A 5J2TE 2JRKA 3HKEE 4YJ2E 5AFUL 4TUYE 5JDHA 2VASA 4P0BA 2DWGA 4ZHQE 3RC8A 2MTQA 4C90A 3MZKB 3CKDA 2EHOC 2V7LA 2YK0A 5DQVA 2C5KT 3I9WA 4ASKA 4H63H 5HXHA 1U4QA 3Q9DA 1MNEA 3KV6A 4NUVA 1VOMA 1MMNA 4DBRA 1IAPA 2VKDA 3R6NA 2IAKA 2JPFA 3FB2A 4FJOA 1MIWA 4F6RC 3C50A 4MBQA 3V5SA 2LSYA 2CM0A 3HKDE 1HS7A 3AA1B 5FY7A 5BMVE 3QC9A 5CB4E 4E7SA 3VHLA 1WRDA 3MJXA 1WLXA 1LKXA 1MMDA 2YU2A 3FXDB 5JDNA 2QGSA 1AJ3A 3NRYA 4CXYA 3OYZA 1FMWA 3GN5A 3RC3A 3WAJA 4WBNE 1BR1A 4EAHA 4PW8A 2WBLA 5L3BB 3WI3A 4CXWA 4K0UA 4J2CA 3U78A 3LFMA 2C5IT 2Q9QC 3W15B 2H7VC 3AA6B 5LYJE 2KNDA 2KINB 1U5PA 4QXCB 3FXEB 3JC6D 3PU3A 4WNKA 5TAOA 5LHHB 5EK3A 5JRCB 4ZI2C 4PAGA 4U74A 5FMNA 2W0GA 4JLEA 2KLQA 2X9YA 4XAXB 3RX6A 5LJNA 4GIWA 3UULA 2VWAA 3KV5A 2HH7A 2JQQA 3OYXA 4H9SE 2L3LA 2DHRA 3CX7B 2BDEA 3PTRB 2NWBA 4O4HE 3ZMVB 5KX5E 4AQFA 1NAFA 3I0OA 3K3QC 5LBQB 3ZMZB 2A2FX 4BJMA 1B7TA 5LG4A 2WSSV 3CMLA 3PUAA 3EDVA 4E7ZA 5KMGP 5JR9B 1HCIA 3PUQA 5EK4A 1S35A 4YFSA 3O1IA 4XBFB 5LGTB 1KNZA 1IZNB 1OXZA 2ODUA 3QUJA 3FHNA 3S4UA 2X0LB 4O2BE 3ZC0A 4U72A 3ZCIA 1O3XA 5JDFA 4ANJA 2XASB 2Z6EA 4UF0B 2B1EA 4PFOA 3R84B 3AVRA 5GONE 5IYZE 3V5UA 3T8OA 2CWYA 1MNDA 3ZMUB 3CQCB 4MHCA 2LEHA 3UFEA 5L3DB 3P8CD 3ZN0B 5CA1E 2X9HA 4GK5E 4MFRA 2VL8A 3CX8B 3CQXC 3AA0B 3RRWA 4H9OC 2K48A 4QX7B 2XTLA 3IHRA 2CLYB 4H9PC 4CI1B 2CXDA 3ZYKA 4DO0A 1CUNA 4MALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSI A;  2LSY A;  3VU7 H;  4EXT A;  2N1G A;  4BA9 A;  4GK5 E;  2LSG A;  4GK0 E;  2LSK A;  2LSJ A;  4FJO A; 
#chains in the Genus database with same CATH topology
 4UEM A;  3GN5 B;  4GYS A;  3UTK A;  1D1C A;  4IE7 A;  4UV8 B;  3NKZ A;  1NEK A;  1HG5 A;  3ZJ2 A;  2V6X A;  1D0X A;  3Q2M A;  2E5L T;  5EK2 A;  3N2G E;  2NW8 A;  1M62 A;  4ZI3 C;  3HL6 A;  4NPP A;  4QXB B;  5AQQ B;  4ADZ A;  3LK2 B;  3LSV A;  4JUY A;  3E08 A;  4XZC A;  3NZQ A;  4O8S A;  4GKJ T;  3AXJ A;  4TV8 E;  3H37 A;  2WZH A;  3SFD A;  2V7I A;  3JAF A;  1BR4 A;  3NRX A;  5FXW A;  4NXN T;  5JR9 C;  4HTE A;  4ILU A;  3QOF A;  3UU6 A;  5FNV E;  4IE5 A;  5M4Y A;  3CK6 A;  5HCM A;  2KMF A;  2BZB A;  5JH7 E;  3VRA A;  2V1D B;  3ZMT B;  3I9Y A;  3ZSS A;  3C4W A;  4YHJ A;  1YQ3 A;  2YKS A;  3RYI E;  2VKH A;  1T72 A;  5LGN B;  2Y6X A;  2LSG A;  1YW0 A;  4DV3 T;  4H9N C;  3E22 E;  2YDS A;  2X9X A;  4PNI A;  4KHP T;  3ANW B;  1Z0P A;  2JQK A;  4DR1 T;  3KV9 A;  4HWF A;  1N33 T;  2WU5 A;  5AQO B;  4ZOL E;  2NW7 A;  1HX1 B;  1ZEE A;  3IF8 B;  3D0T A;  1UCU A;  2DCF A;  4IRE A;  4AQF C;  2D0U A;  2XSA A;  3HA4 A;  2W61 A;  3UQ4 A;  1IBM T;  3P4S A;  5F5W A;  2YIN A;  4IDZ A;  1FEW A;  4UIG A;  1E1H B;  2PG8 A;  3WAK A;  1W9R A;  3AE5 A;  3L3P A;  2CHO A;  4QH5 A;  1HFA A;  4YSY A;  3OBV E;  4U2Z A;  5H6Q B;  1QLB A;  3Q5X A;  2CE7 A;  2XAF B;  4GOU A;  3ZYL A;  3ZT5 A;  4M1P A;  5AQF B;  3ZCJ A;  4DMV A;  4H63 V;  3EVY A;  5AQI B;  3AE2 A;  4QXH B;  5L2L A;  2UUB T;  5FY0 A;  5JVD E;  2R6G F;  3RIA A;  4DUZ T;  1SUM B;  5HXR A;  2WS3 A;  3KBU A;  4ERR A;  4AXP A;  3AEB A;  1FIO A;  3KVA A;  4QHO A;  4X20 E;  4C91 A;  5BR8 T;  3OKQ A;  1R8I A;  5LHG B;  1YQ4 A;  1MIV A;  2MYS A;  3L8R A;  4L9I A;  2PTF A;  3QB5 A;  3ZN1 B;  3AE1 A;  4TN7 B;  2M67 A;  2ZLY A;  5LBM A;  4IL9 A;  3AA7 B;  5AQU B;  1OED B;  1HNW T;  3CPZ A;  2LOP A;  4B3R T;  4ZI7 E;  4DV6 T;  4IGU A;  2BBJ A;  4BAY B;  3I1A A;  1IBK T;  2CEA A;  2QRX A;  2E9X C;  4G63 A;  2VKJ A;  3KDS E;  4CN1 A;  4Z8X A;  2WQY A;  1E2A A;  2X9W A;  4O4L E;  3HR0 A;  2LHR A;  4EIW A;  4JV5 T;  5FYM A;  4JEH B;  5ETW A;  3I0Q A;  3GA8 A;  3ZEF B;  5IUX A;  5FXX A;  3TKL B;  5J0Z A;  2XM2 A;  1VCS A;  3IEE A;  2YU1 A;  2ZMA A;  4EB6 E;  3O1J A;  2XQY A;  4EV6 A;  2NP9 A;  2MBG A;  1ZOY A;  3UUB A;  4LMK A;  3E0Z A;  2BS3 A;  3HKE E;  4YJ2 E;  4TUY E;  4IDO A;  1KEY A;  3RC8 A;  2MTQ A;  4DV2 T;  3CKD A;  2VVN A;  2EHO C;  3I9W A;  5AQJ B;  5HXH A;  4B3S T;  2DL1 A;  1UGO A;  1MNE A;  4HWC A;  2CHN A;  1VOM A;  5CGM A;  1MIW A;  2BG9 A;  2XM1 A;  3C50 A;  2LSY A;  2B76 A;  1HS7 A;  4JBW F;  4ILB A;  5BMV E;  3QC9 A;  4E7S A;  3VHL A;  1UUS A;  1LKX A;  2YU2 A;  5JDN A;  2QGS A;  2CBJ A;  3RI5 A;  4GKK T;  2CPT A;  3GN5 A;  2CRB A;  3RC3 A;  3WAJ A;  4WBN E;  1CHU A;  2HN1 A;  4PW8 A;  5L3B B;  3WI3 A;  3LFM A;  4ZEY A;  4YTP A;  3AA6 B;  1I6Z A;  3FXE B;  2QYW A;  5JRC B;  4PAG A;  4U74 A;  2IUB A;  2X9Y A;  2FUP A;  3JCF A;  2VWA A;  2W4X A;  1JNR A;  2JQQ A;  1WR0 A;  3UU4 A;  5LB7 B;  1SE7 A;  1NAF A;  2ACZ A;  2WSS V;  4YY3 T;  5JR9 B;  5EK4 A;  3FHN A;  3S4U A;  3NWI A;  5LG3 A;  2Z6E A;  2B1E A;  2XPK A;  3T8O A;  2CWY A;  2LEH A;  5CA1 E;  3CQX C;  3AA0 B;  2K48 A;  2J4G A;  1CUN A;  4DV1 T;  4YTM A;  3ZLI A;  4DV7 T;  3LK4 2;  2WU2 A;  2BVM A;  4QKN A;  1KNP A;  4OHF A;  5CFB A;  5AQK B;  5IWA T;  5JTG A;  2X68 A;  5AQN B;  2UXC T;  4PJM A;  2XAH B;  3CIR A;  5EZY E;  2ES0 A;  3P4R A;  3UUM A;  4IST A;  1UUR A;  4IDP A;  3BQK A;  5JRE A;  4ZZB A;  5F3J A;  2JIW A;  3KIN B;  3OJA A;  4WYV A;  3PUX F;  4GYR A;  3ZPO A;  2J62 A;  4U7Y A;  2NW9 A;  5ABH A;  2WM9 A;  2DNX A;  4IIJ E;  2WY2 A;  5HAX A;  4PJL A;  2OV9 A;  3PUG A;  3AED A;  2QA7 A;  2NOX A;  1LVF A;  2LSI A;  3AE8 A;  3ONL C;  3N9L A;  2LE8 A;  2XAG B;  2XAJ B;  4HWD A;  5L4H A;  4X1I E;  4HKA A;  3ZC1 A;  2ZM8 A;  3C98 B;  2LKG A;  2X0H A;  1YKE B;  4UXN B;  1HG2 A;  2LSK A;  2FJB A;  2ODV A;  3AEG A;  3JAE A;  4O4J E;  5L47 A;  5C3J A;  2OLT A;  2K3W A;  4B3T T;  5C2T A;  3LBX A;  3M3Z B;  1D0Y A;  4QX8 B;  2V5D A;  2Q9Q B;  4EEB A;  2WP9 A;  3P50 A;  2N9D A;  2WMO A;  4YTN A;  2LOS A;  2JJ9 A;  4JI4 T;  4PFP A;  5ADX L;  4Q25 A;  2X66 A;  5KDM C;  5LGU B;  1D1A A;  3LK3 B;  3GWH A;  3Q5D A;  5J2U E;  2E9X B;  3ESL A;  4P09 A;  3PUY F;  1S94 A;  3J9X 1;  4PK6 A;  4HE8 A;  4A98 A;  2W00 A;  4OX9 T;  1I94 T;  5FXV A;  2XZE A;  1QSD A;  3P7I A;  3RF1 A;  4CI2 B;  2MPK A;  3O9X A;  2YOE A;  3MKD A;  4NIQ A;  3HI2 A;  3EAB A;  3ONX A;  5F8P A;  3BQI A;  2KXP B;  2AE9 A;  1Y64 B;  5A1L A;  3RPU A;  1QUU A;  4HFH A;  2C5J A;  1GQE A;  3KBT A;  2DLR A;  5HXC A;  2UU9 T;  2UXN B;  2W67 A;  3AAI A;  4O4I E;  4AIS A;  1J5E T;  3PDY A;  2BVL A;  5CA0 E;  5E0O A;  4COF A;  3BK9 A;  3FZL B;  2KSR A;  4ZZC A;  4HGA A;  4H9R C;  2EHO B;  3JC6 C;  2LM9 A;  4TNW A;  4TWF A;  3J7Y q;  2DWK A;  4DBQ A;  4IE4 A;  2LHN A;  4HFD A;  4HFV A;  4X1K E;  2W63 A;  2XQ5 A;  3A5X A;  4JI1 T;  3DP7 A;  2N1G A;  4EYY R;  4CI3 B;  2BBH A;  3RYH E;  5JQG E;  4X65 T;  4AIU A;  2RP4 A;  2XQ9 A;  5L3G B;  3JAD A;  3N9M A;  3HKB E;  2L9Q A;  3N9P A;  1SA0 E;  3K3O A;  5LA6 E;  3SOL A;  2XSB A;  3TLT A;  5HEU A;  2ZM6 T;  4TNV A;  3NZP A;  2JMH A;  4PJN A;  4DMW A;  3RRC A;  2I59 A;  5L4E A;  4AKI A;  2VB6 A;  4HFC A;  2JQ9 A;  2KT9 A;  5FVL A;  2V6Y A;  4IL4 A;  5ABF A;  4KX6 A;  3OPC A;  4EGW A;  4LF7 T;  5JDH A;  4DR2 T;  4P0B A;  2CBI A;  3PUV F;  4ZHQ E;  3MZK B;  3PUW F;  5HEH A;  4YXD A;  2XQ4 A;  5FVK A;  4ASK A;  4H63 H;  1U4Q A;  3Q9D A;  4DUY T;  3RIU C;  4DBR A;  1IAP A;  2IAK A;  4F6R C;  1FJG T;  2QVA A;  3V5S A;  2HN2 A;  3AA1 B;  2UXD T;  2XQ6 A;  3FXD B;  3QB5 K;  3AEC A;  4UR9 A;  2IIU A;  2WBL A;  3NVO A;  2C5I T;  2Q9Q C;  3PUZ F;  5LYJ E;  2KND A;  4DR5 T;  1U5P A;  4DID B;  3PU3 A;  5TAO A;  1WCR A;  5EK3 A;  1UK5 A;  4GIW A;  3UUL A;  2HH7 A;  2F4V T;  3RQU A;  2FJE A;  2J47 A;  3ZMV B;  4U33 A;  4AQF A;  2A2F X;  4BJM A;  1B7T A;  3CML A;  4E7Z A;  1HCI A;  3PUQ A;  3RGL A;  4TWH A;  4XBF B;  1IZN B;  1OXZ A;  3QUJ A;  3ZCI A;  4ANJ A;  4PFO A;  2UXB T;  5IYZ E;  3AXJ B;  3ZMU B;  4MHC A;  5L3D B;  3UU3 A;  3P8C D;  2YN6 A;  3ZN0 B;  4LF4 T;  4GK5 E;  2VL8 A;  2XTL A;  4H9P C;  3B5M A;  4DR4 T;  3ZYK A;  4JI6 T;  4MAL A;  2VL0 A;  4I4T E;  4KI0 F;  2GK9 A;  5C8Y E;  4LFC T;  1WR6 A;  1OWA A;  5AQR B;  4CN6 A;  3KVB A;  3CQG B;  1H7C A;  3F57 A;  2A3D A;  2IC9 A;  4QWN B;  4DND A;  3C64 A;  4PK5 A;  4QH4 A;  3DJB A;  4UEL A;  2JMK A;  1MMG A;  5AQG B;  5AQV B;  1HTJ F;  2E5V A;  2V26 A;  2XAQ B;  4UF0 A;  3UU5 A;  4A56 A;  3FZF B;  4TV9 E;  4UVB B;  3AE6 A;  3N5L A;  3AE7 A;  3F31 A;  1Z8U A;  3TLU A;  3C4Z A;  1LRZ A;  3A8Y C;  5L3F B;  1NWM X;  2CCQ A;  4KMC A;  4OK0 A;  5H6R B;  2LT3 A;  3X1D A;  3PUS A;  3ETV A;  3EDU A;  3K3N A;  4YLH A;  4TZ4 C;  2V7K A;  5LMU T;  2UXX B;  3PJA J;  1VCT A;  2J1D G;  4YSZ A;  5HCJ A;  4KP3 C;  3N9O A;  2E9X A;  2W62 A;  2BG9 E;  2I0M A;  4HFB A;  5IHY A;  4AKR B;  2XY8 B;  4DVD A;  2WZI A;  4B6X A;  2CMR A;  2DI4 A;  4Z90 A;  4DV4 T;  4UVC B;  3PE0 A;  3CX6 B;  3N9Q A;  3RHW A;  5FL1 A;  2A9U A;  4CQI A;  4EXT A;  2KWI B;  5LCY A;  4DR3 T;  5DAB A;  1W09 A;  3LDQ B;  4PJJ A;  3CVR A;  3H3M A;  3TLW A;  1UX4 A;  4X62 T;  1YKH B;  1YXR A;  3O1H A;  2IC6 A;  3OVU A;  1FMV A;  4Z91 A;  2IW5 B;  3FZH B;  4AKG A;  2EHO A;  2NTY A;  1HF8 A;  5DQW A;  4JI0 T;  4HFI A;  4ILC A;  5HYA A;  3AE4 A;  2UUA T;  4NUU A;  3FZM B;  3ANW A;  3VKH A;  1KFY A;  5LMN T;  4ZS3 A;  3DTO A;  3RKO A;  1EZ3 A;  5LNK A;  1X79 A;  3LG7 A;  2Y8D A;  2ACX A;  2AXD S;  1ZHC A;  3RYC E;  3UUN A;  4P0A A;  2CXL A;  2D2S A;  3FZK B;  4L5G A;  3C51 A;  3FBL A;  5HXS A;  2V7M A;  1XNR T;  3RQW A;  2CWO A;  4EED A;  5JDM A;  5JDQ A;  2W2U A;  4NXM T;  2PJQ A;  4X64 T;  2X0Y A;  1XMO T;  4LF5 T;  2BS2 A;  4ZXL A;  1IJ6 A;  2WCA A;  4ILA A;  4ZI2 D;  2XQ8 A;  1D0Z A;  4CZZ B;  3UUX B;  2SPC A;  3O4X E;  4OYJ A;  2M6I A;  1VRB A;  5LP6 E;  3ZJ1 A;  4I43 B;  5LXT E;  2N2N A;  1DU2 A;  2VK9 A;  2E8I A;  2RA1 A;  1N34 T;  3PJA A;  3MXZ A;  4IE6 A;  4CXX A;  4L0R A;  3GMI A;  3EUH A;  1X9B A;  4WW0 A;  1ZP0 A;  4KBM B;  3OTO T;  2VVS A;  3AAA B;  2I6H A;  5AQP B;  3M65 A;  3SFE A;  3AEE A;  1T7S A;  3UU8 A;  4BJN A;  4YHH T;  4QH1 A;  2D0T A;  5HWX A;  1UX5 A;  2WDR A;  4P1N A;  5HWY A;  4AQG A;  5DJQ C;  4U31 A;  1ZKE A;  3PUR A;  1G73 A;  4IHJ E;  3MK7 C;  4EYU A;  2CA5 A;  1WFD A;  1KK7 A;  4OYK A;  2V8S V;  2PFV A;  3UQ7 A;  4ZI3 D;  3AE3 A;  1OED A;  1KF6 A;  2NTX A;  3AAE B;  4PK4 A;  3AEA A;  2VAS A;  2DWG A;  1HNZ T;  1J1J A;  3KV6 A;  1MMN A;  3R6N A;  2JPF A;  3FB2 A;  4MBQ A;  3HKD E;  5FY7 A;  5CB4 E;  3ZKR A;  1WRD A;  3MJX A;  4X5T A;  1MMD A;  1OED E;  3VR9 A;  1FMW A;  4EAH A;  2E2A A;  3W15 B;  2H7V C;  2LRL A;  3JC6 D;  3T1Y T;  5LHH B;  1W0A A;  5LJN A;  3ABV A;  3OYX A;  3PTR B;  1W0B A;  2BKN A;  5KX5 E;  5LBQ B;  3ZMZ B;  5LG4 A;  2JQH A;  3EDV A;  4YFS A;  4HFE A;  3P4Q A;  2BS4 A;  2X0L B;  4O2B E;  3T1H T;  1NEN A;  5JDF A;  2FBW A;  2H89 A;  5AQL B;  3V5U A;  3CQC B;  1XMQ T;  2X9H A;  2BKO A;  4MFR A;  3CX8 B;  3RRW A;  4H9O C;  3ZT6 A;  4QX7 B;  3G06 A;  3OYZ A;  5LOV E;  4CN4 A;  2LM2 A;  4FI5 A;  2VQE T;  5JRC A;  4LFA T;  1MMA A;  4MLK A;  4EZH A;  1N36 T;  1Y01 A;  3RH3 A;  2HPJ A;  4KHZ F;  4LF8 T;  5HEO A;  4JEU B;  3QNU A;  3N9N A;  3CWZ B;  4DR7 T;  2H7O A;  3K1S A;  4F8H A;  3N2K E;  5AQM B;  5L3E B;  5JR9 A;  4DR6 T;  3L09 A;  4JI2 T;  2V7J A;  4TX5 A;  3KV4 A;  2W66 A;  1WYB A;  2X51 A;  4YJ3 E;  4ISS A;  1MIY A;  1V9D A;  4TWD A;  3ZMS B;  3B57 A;  2VUR A;  4V1A v;  5FP3 A;  2OA5 A;  4LF6 T;  1BR2 A;  4KUM B;  4A97 A;  3LBX B;  1E7P A;  4UV9 B;  2MAW A;  2ZM0 A;  4I50 E;  4O2A E;  3U3I A;  2FJA A;  2Q9Q D;  2BG9 C;  4HWI B;  4WBO A;  1ZV4 X;  1G8X A;  3KFW X;  4JI5 T;  2D5U A;  4HEA A;  2WWV A;  3RYF E;  2CLY C;  3H3A A;  2YEV C;  2L8K A;  1T98 A;  3C4X A;  1XDP A;  3ZYM A;  2WB5 A;  1IBL T;  1WYC A;  2E9X D;  3SWH A;  2H3R A;  3P4W A;  3MAC A;  5KXJ A;  3RLF F;  4ZS2 A;  2LLY A;  1D1B A;  3F2E A;  2A72 A;  1US7 B;  2LRK A;  1N32 T;  4YSX A;  2WDV A;  2C0S A;  2ZM2 A;  2MOZ A;  5FY1 A;  3ETU A;  1L0V A;  1XDO A;  2P9B A;  3TLS A;  1M7K A;  5L3C B;  2K5B B;  4N78 D;  1YD8 G;  3B13 A;  4UVA B;  3VU7 H;  3UFG A;  5ABE A;  3NBX X;  5JDL A;  3RIU A;  5JDG A;  5FXZ A;  2NR4 A;  4EZ4 A;  2EHO D;  3Q5W A;  4B3M T;  2WAU A;  4I55 E;  2D9D A;  3IBP A;  1XWM A;  5AQT B;  2V5C A;  3ZST A;  1HX8 A;  1T8B A;  2H88 A;  3MA9 A;  2Q9Q A;  3IA3 A;  1SHZ C;  4WZX A;  4X66 T;  5CJ5 A;  3BQL A;  2G0U A;  4G2A A;  2PBI A;  3UT5 E;  2VQF T;  3LJC A;  2YDQ A;  2KWH A;  4GK0 E;  5HXE A;  4AKH A;  2X67 A;  5J1G A;  2XUE A;  3SS1 A;  1IJ5 A;  3PU8 A;  2K24 A;  2WMN A;  1J5W A;  3A7M A;  4H9Q C;  2XQ7 A;  1JNZ A;  3K8P C;  3VR8 A;  4EOZ B;  3Q5E A;  4JI7 T;  4DV0 T;  3VKG A;  1BR0 A;  2CXF A;  3EAM A;  2V6Y B;  5ABF B;  3AB3 B;  2XQ3 A;  2XHE B;  2YDR A;  2Y48 B;  4YT0 A;  4AKL A;  4LF9 T;  3PV0 F;  4X1Y E;  4DV5 T;  1XZY A;  1HNX T;  4BA9 A;  4OFZ A;  3FBZ A;  1LVK A;  2KZ7 B;  2LSJ A;  2IDO B;  4JI3 T;  4LML A;  4JI8 T;  2K9A A;  2LJL A;  1XNQ T;  2XJ7 A;  4IE0 A;  2VKO A;  3AE9 A;  4AI6 A;  2HPL A;  3SRZ A;  2WWU A;  3HKC E;  2XQA A;  3AVS A;  4U2Y A;  5LHI B;  5ABG A;  4U3C A;  3N2O A;  5AQS B;  3QK6 A;  4U7I A;  4HN9 A;  2HHH T;  2LKH A;  5J2T E;  2JRK A;  5AFU L;  4C90 A;  3VRB A;  5HEG A;  2V7L A;  2YK0 A;  5DQV A;  2C5K T;  3EHZ A;  4NUV A;  2WDQ A;  3ZT7 A;  2VKD A;  4IDQ A;  4FJO A;  4HWH A;  2CM0 A;  1OED C;  4IDN A;  4AQY T;  1WLX A;  1AJ3 A;  3NRY A;  4CXY A;  2IHR 1;  4LFB T;  4LMJ A;  1BR1 A;  2RPA A;  4CXW A;  4K0U A;  4J2C A;  3U78 A;  3ONJ A;  5FKY A;  3EI0 A;  2KIN B;  4QXC B;  4WNK A;  3RIF A;  4ZI2 C;  5FMN A;  2W0G A;  4JLE A;  2KLQ A;  3RKG A;  4XAX B;  3RX6 A;  3KV5 A;  4H9S E;  2L3L A;  2DHR A;  3CX7 B;  5AQH B;  2BDE A;  3AEF A;  2NWB A;  4O4H E;  4JYA T;  3I0O A;  3K3Q C;  3TLV A;  3PUA A;  2FJD A;  5KMG P;  1S35 A;  5HEJ A;  3O1I A;  5LGT B;  1KNZ A;  2ODU A;  1KNR A;  5FL0 A;  2IML A;  3ZC0 A;  3L39 A;  2M6B A;  4A5X A;  1HR0 T;  4U72 A;  1O3X A;  2XAS B;  4UF0 B;  2BG9 B;  2BKP A;  3R84 B;  3AVR A;  5GON E;  4K0K T;  1MND A;  3UFE A;  3IHR A;  2CLY B;  4CI1 B;  2UUC T;  2CXD A;  3P4P A;  4IT4 A;  4DO0 A;  4I0U A;  5LJM A; 
#chains in the Genus database with same CATH homology
 4FI5 A;  4UEM A;  3ZLI A;  5JRC A;  3GN5 B;  1MMA A;  3LK4 2;  4I4T E;  4GYS A;  2BVM A;  4MLK A;  3UTK A;  4EZH A;  1D1C A;  4QKN A;  4IE7 A;  4OHF A;  2GK9 A;  4UV8 B;  3RH3 A;  5C8Y E;  2HPJ A;  1WR6 A;  1OWA A;  1HG5 A;  3ZJ2 A;  4JEU B;  3KVB A;  3CQG B;  1D0X A;  1H7C A;  3N9N A;  3CWZ B;  3Q2M A;  5EK2 A;  3N2G E;  2NW8 A;  2H7O A;  2X68 A;  3F57 A;  2A3D A;  4ZI3 C;  3HL6 A;  3N2K E;  2IC9 A;  4QXB B;  4QWN B;  4DND A;  4ADZ A;  4PJM A;  5L3E B;  2XAH B;  3C64 A;  5JR9 A;  3LK2 B;  4PK5 A;  2ES0 A;  5EZY E;  4JUY A;  3DJB A;  4UEL A;  2JMK A;  3L09 A;  3E08 A;  1MMG A;  2V7J A;  4TX5 A;  4XZC A;  3KV4 A;  3UUM A;  2X51 A;  1WYB A;  1HTJ F;  4YJ3 E;  2V26 A;  2XAQ B;  4UF0 A;  4A56 A;  3NZQ A;  4O8S A;  4IST A;  4TV9 E;  4UVB B;  4ISS A;  1MIY A;  1V9D A;  3N5L A;  3ZMS B;  3BQK A;  4TV8 E;  3B57 A;  3F31 A;  4V1A v;  5JRE A;  5FP3 A;  2OA5 A;  3H37 A;  3C4Z A;  1LRZ A;  1BR2 A;  5F3J A;  4KUM B;  3KIN B;  3OJA A;  5L3F B;  1NWM X;  2CCQ A;  2V7I A;  1BR4 A;  3LBX B;  4KMC A;  4GYR A;  3NRX A;  4OK0 A;  2LT3 A;  5H6R B;  5FXW A;  3ZPO A;  4UV9 B;  3PUS A;  5JR9 C;  4HTE A;  4ILU A;  2ZM0 A;  5FNV E;  4IE5 A;  5M4Y A;  2NW9 A;  4I50 E;  3ETV A;  2WM9 A;  2DNX A;  3EDU A;  3K3N A;  4IIJ E;  4O2A E;  2V7K A;  4TZ4 C;  4YLH A;  2KMF A;  2UXX B;  3U3I A;  2Q9Q D;  2BZB A;  5JH7 E;  5HAX A;  4PJL A;  4WBO A;  2V1D B;  2J1D G;  3ZMT B;  3I9Y A;  3PUG A;  1ZV4 X;  4KP3 C;  2QA7 A;  3C4W A;  1G8X A;  2NOX A;  3KFW X;  3N9O A;  2E9X A;  1LVF A;  2LSI A;  2W62 A;  2D5U A;  4HEA A;  4YHJ A;  3RYF E;  5IHY A;  3N9L A;  2CLY C;  3RYI E;  2VKH A;  2LE8 A;  2XAG B;  2XAJ B;  3H3A A;  4AKR B;  5LGN B;  2Y6X A;  2L8K A;  2LSG A;  2YEV C;  4DVD A;  1YW0 A;  4H9N C;  1T98 A;  3C4X A;  3E22 E;  4X1I E;  4HKA A;  3ZYM A;  4B6X A;  3ZC1 A;  3C98 B;  2ZM8 A;  2X9X A;  1WYC A;  2CMR A;  2DI4 A;  1YKE B;  2E9X D;  4PNI A;  4UXN B;  3SWH A;  1HG2 A;  2H3R A;  2LSK A;  3ANW B;  1Z0P A;  3MAC A;  2ODV A;  4UVC B;  3KV9 A;  3PE0 A;  4O4J E;  3CX6 B;  3N9Q A;  4CQI A;  4EXT A;  4ZS2 A;  2KWI B;  4ZOL E;  5LCY A;  1D1B A;  2NW7 A;  3F2E A;  5DAB A;  2A72 A;  1ZEE A;  3LBX A;  3IF8 B;  3D0T A;  1UCU A;  4PJJ A;  1US7 B;  3CVR A;  1D0Y A;  4QX8 B;  1UX4 A;  2DCF A;  2C0S A;  2ZM2 A;  1YKH B;  2Q9Q B;  4AQF C;  3O1H A;  2MOZ A;  5FY1 A;  2D0U A;  3ETU A;  2IC6 A;  2P9B A;  2N9D A;  3HA4 A;  2WMO A;  2LOS A;  1FMV A;  2JJ9 A;  2W61 A;  5L3C B;  2K5B B;  4N78 D;  1YD8 G;  2IW5 B;  4PFP A;  5ADX L;  3B13 A;  4UVA B;  4AKG A;  2YIN A;  2EHO A;  4IDZ A;  1FEW A;  4UIG A;  2X66 A;  3VU7 H;  1E1H B;  5KDM C;  2NTY A;  2PG8 A;  3WAK A;  5LGU B;  1D1A A;  1HF8 A;  3LK3 B;  3NBX X;  5DQW A;  5JDL A;  3L3P A;  5JDG A;  3GWH A;  5HYA A;  5FXZ A;  5J2U E;  2E9X B;  3ESL A;  4P09 A;  1HFA A;  1S94 A;  3J9X 1;  4NUU A;  4PK6 A;  3ANW A;  3OBV E;  4HE8 A;  3VKH A;  5H6Q B;  4EZ4 A;  2EHO D;  4ZS3 A;  3DTO A;  3Q5W A;  2W00 A;  3Q5X A;  3RKO A;  5FXV A;  1QSD A;  3P7I A;  1EZ3 A;  2CE7 A;  2WAU A;  1X79 A;  2XAF B;  4I55 E;  4CI2 B;  5LNK A;  3IBP A;  3LG7 A;  4GOU A;  2Y8D A;  3ZYL A;  3O9X A;  2ACX A;  4M1P A;  3MKD A;  3ZCJ A;  4DMV A;  1ZHC A;  3RYC E;  3UUN A;  3HI2 A;  3ONX A;  4H63 V;  5F8P A;  3EVY A;  4P0A A;  2CXL A;  2D2S A;  3BQI A;  2KXP B;  4L5G A;  4QXH B;  3C51 A;  1HX8 A;  5L2L A;  1Y64 B;  3MA9 A;  5FY0 A;  3FBL A;  5JVD E;  5A1L A;  3RPU A;  2Q9Q A;  5HXS A;  2V7M A;  1SHZ C;  5HXR A;  1QUU A;  2CWO A;  5JDM A;  5JDQ A;  2C5J A;  3BQL A;  5LOV E;  2G0U A;  3KBT A;  2DLR A;  2PJQ A;  4G2A A;  3KBU A;  5HXC A;  2PBI A;  2UXN B;  3UT5 E;  3AAI A;  4O4I E;  4ERR A;  4AXP A;  3PDY A;  2BVL A;  3LJC A;  1FIO A;  3KVA A;  5LJM A;  5CA0 E;  4QHO A;  4X20 E;  2KWH A;  5E0O A;  4C91 A;  1IJ6 A;  3BK9 A;  4GK0 E;  5HXE A;  3OKQ A;  4AKH A;  2X67 A;  5J1G A;  2XUE A;  5LHG B;  3SS1 A;  1IJ5 A;  3PU8 A;  2K24 A;  1MIV A;  2MYS A;  2WMN A;  4L9I A;  4ZI2 D;  3ZN1 B;  4H9Q C;  1D0Z A;  4CZZ B;  3UUX B;  2SPC A;  3K8P C;  4TN7 B;  4HGA A;  4H9R C;  2EHO B;  3O4X E;  2M67 A;  2ZLY A;  5LBM A;  4OYJ A;  4EOZ B;  3JC6 C;  1VRB A;  2LM9 A;  5LP6 E;  3ZJ1 A;  4I43 B;  5LXT E;  2N2N A;  3J7Y q;  2VK9 A;  3VKG A;  2E8I A;  2RA1 A;  1BR0 A;  3AA7 B;  2DWK A;  4DBQ A;  4IE4 A;  3MXZ A;  2CXF A;  4IE6 A;  2LHN A;  4CXX A;  4L0R A;  3CPZ A;  2LOP A;  3AB3 B;  3GMI A;  4HFV A;  4ZI7 E;  3EUH A;  4X1K E;  2W63 A;  4IGU A;  2XHE B;  4WW0 A;  3A5X A;  2Y48 B;  4BAY B;  3I1A A;  4KBM B;  3AAA B;  2CEA A;  3DP7 A;  4AKL A;  2N1G A;  4EYY R;  2E9X C;  4G63 A;  4CI3 B;  3M65 A;  3RYH E;  2VKJ A;  3KDS E;  4X1Y E;  5JQG E;  4BA9 A;  4BJN A;  4OFZ A;  4Z8X A;  2D0T A;  2RP4 A;  5HWX A;  1UX5 A;  3FBZ A;  5L3G B;  1LVK A;  2KZ7 B;  2X9W A;  3N9M A;  2LSJ A;  3HKB E;  2L9Q A;  3N9P A;  4O4L E;  1SA0 E;  3HR0 A;  2LHR A;  3K3O A;  4EIW A;  5FYM A;  5LA6 E;  3SOL A;  4JEH B;  5ETW A;  5HWY A;  4AQG A;  3I0Q A;  5DJQ C;  3GA8 A;  3ZEF B;  2K9A A;  1ZKE A;  3PUR A;  2LJL A;  1G73 A;  4IHJ E;  4IE0 A;  2VKO A;  3NZP A;  2JMH A;  4PJN A;  4AI6 A;  2HPL A;  3MK7 C;  5FXX A;  3SRZ A;  4DMW A;  3TKL B;  2WWU A;  3RRC A;  4EYU A;  2CA5 A;  3IEE A;  3HKC E;  2I59 A;  1KK7 A;  2YU1 A;  4OYK A;  4AKI A;  2PFV A;  2ZMA A;  4EB6 E;  4ZI3 D;  2VB6 A;  3AVS A;  5LHI B;  3O1J A;  2KT9 A;  3N2O A;  2XQY A;  2NP9 A;  3QK6 A;  2MBG A;  4HN9 A;  2NTX A;  3E0Z A;  3AAE B;  4PK4 A;  5J2T E;  2JRK A;  3HKE E;  4YJ2 E;  5AFU L;  4TUY E;  5JDH A;  2VAS A;  4P0B A;  2DWG A;  4ZHQ E;  3RC8 A;  2MTQ A;  4C90 A;  3MZK B;  3CKD A;  2EHO C;  2V7L A;  2YK0 A;  5DQV A;  2C5K T;  3I9W A;  4ASK A;  4H63 H;  5HXH A;  1U4Q A;  3Q9D A;  1MNE A;  3KV6 A;  4NUV A;  1VOM A;  1MMN A;  4DBR A;  1IAP A;  2VKD A;  3R6N A;  2IAK A;  2JPF A;  3FB2 A;  4FJO A;  1MIW A;  4F6R C;  3C50 A;  4MBQ A;  3V5S A;  2LSY A;  2CM0 A;  3HKD E;  1HS7 A;  3AA1 B;  5FY7 A;  5BMV E;  3QC9 A;  5CB4 E;  4E7S A;  3VHL A;  1WRD A;  3MJX A;  1WLX A;  1LKX A;  1MMD A;  2YU2 A;  3FXD B;  5JDN A;  2QGS A;  1AJ3 A;  3NRY A;  4CXY A;  3OYZ A;  1FMW A;  3GN5 A;  3RC3 A;  3WAJ A;  4WBN E;  1BR1 A;  4EAH A;  4PW8 A;  2WBL A;  5L3B B;  3WI3 A;  4CXW A;  4K0U A;  4J2C A;  3U78 A;  3LFM A;  2C5I T;  2Q9Q C;  3W15 B;  2H7V C;  3AA6 B;  5LYJ E;  2KND A;  2KIN B;  1U5P A;  4QXC B;  3FXE B;  3JC6 D;  3PU3 A;  4WNK A;  5TAO A;  5LHH B;  5EK3 A;  5JRC B;  4ZI2 C;  4PAG A;  4U74 A;  5FMN A;  2W0G A;  4JLE A;  2KLQ A;  2X9Y A;  4XAX B;  3RX6 A;  5LJN A;  4GIW A;  3UUL A;  2VWA A;  3KV5 A;  2HH7 A;  2JQQ A;  3OYX A;  4H9S E;  2L3L A;  2DHR A;  3CX7 B;  2BDE A;  3PTR B;  2NWB A;  4O4H E;  3ZMV B;  5KX5 E;  4AQF A;  1NAF A;  3I0O A;  3K3Q C;  5LBQ B;  3ZMZ B;  2A2F X;  4BJM A;  1B7T A;  5LG4 A;  2WSS V;  3CML A;  3PUA A;  3EDV A;  4E7Z A;  5KMG P;  5JR9 B;  1HCI A;  3PUQ A;  5EK4 A;  1S35 A;  4YFS A;  3O1I A;  4XBF B;  5LGT B;  1KNZ A;  1IZN B;  1OXZ A;  2ODU A;  3QUJ A;  3FHN A;  3S4U A;  2X0L B;  4O2B E;  3ZC0 A;  4U72 A;  3ZCI A;  1O3X A;  5JDF A;  4ANJ A;  2XAS B;  2Z6E A;  4UF0 B;  2B1E A;  4PFO A;  3R84 B;  3AVR A;  5GON E;  5IYZ E;  3V5U A;  3T8O A;  2CWY A;  1MND A;  3ZMU B;  3CQC B;  4MHC A;  2LEH A;  3UFE A;  5L3D B;  3P8C D;  3ZN0 B;  5CA1 E;  2X9H A;  4GK5 E;  4MFR A;  2VL8 A;  3CX8 B;  3CQX C;  3AA0 B;  3RRW A;  4H9O C;  2K48 A;  4QX7 B;  2XTL A;  3IHR A;  2CLY B;  4H9P C;  4CI1 B;  2CXD A;  3ZYK A;  4DO0 A;  1CUN A;  4MAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...