1VCTA

Crystal structure of putative potassium channel related protein from pyrococcus horikoshii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH0236
total genus 69
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 1vctA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 1vctA02
2BKOA 3RBZA 2AEJA 1SUMB 2OGUA 2BKPA 2AEMA 2FY8A 4J91A 3KXDA 4J90A 4J9VA 2IIUA 4YS2A 4XTTA 1VCTA 4GVLA 4G65A 3JXOA 1LNQA 4L75A 3L39A 3RBXA 2AEFA 2BKNA 1T72A 4L74A 3L4BC 4L76A 2OLTA 4L73A 4J9UE 4J7CA 1XWMA 4RO0A 4Q25A 2I0MA 1T8BA 4EI2A
chains in the Genus database with same CATH superfamily
3D9BA 3P4RA 4HTIA 5LSLA 3T6JA 1WKKA 5TAOA 3DLEA 4I2QB 2A2CA 2ZJPQ 1ZM9A 2XQ4A 3FNNA 2J0XA 1LFPA 5CXTA 4HN9A 2BM1A 3T1YJ 5HXHA 2YWKA 1KQKA 3DJBA 1JMTA 3BQ1A 3CJKB 4BWMA 1QLNA 2HFUA 4CO5A 3QWUA 4ERDA 3VAGA 1D8YA 4M95A 4RNMA 5LHIB 1CQNA 2VQFF 2ZOFA 1SC4B 1ZM4A 3K5PA 2FY1A 4RL1A 2R8HA 2XQ7A 2GZOA 2P9EA 1R0AB 2OD6A 4GK0E 3TLVA 4DSLA 1FXDA 4KHRA 1KVIA 4C3LA 1FWPA 1XK8A 1R89A 4PZVA 2UU9J 1PYTA 2VA2A 4QXHB 2XSBA 4UR9A 4ADZA 4C0OC 1KQFB 3RYHE 3US5A 4JI3F 4NCGB 4K4WA 3HD1A 4M8LA 3SRZA 3MMAB 1SC3B 3QGGA 1RHKB 3MM8B 3IBCB 2N4DA 4C8LA 3MMAA 4RPFA 8RUCA 1EKSA 1HNIB 4ILUA 3GYNA 3CDWA 1U5PA 4AE5A 4GYRA 3EDUA 1UW9A 1UGOA 1CPZA 1FRHA 2QRRA 2M88A 4G63A 2FGCA 1Q95G 2K3IA 1RU2A 2AZ3A 3HXMA 1E7PA 1RGVA 4RR5A 1XERA 4GVBB 1E6VA 5FXXA 2MY7A 1XMOT 2WQYA 4UELA 3D6FB 3OJUA 3HKCE 2QV6A 3MUTP 3UFEA 4A56A 3HX9A 1TK8A 5AQKB 4H54A 1FCAA 1T02A 2OD4A 1SUQB 1FNXH 1D0XA 2Q9QA 4YDDB 4UEMA 2KXPB 3UUXB 1RT7B 2J6TA 3VZIA 2PI5A 3W9IA 1VQYA 2CRLA 5JVDE 3EGZA 2BEFA 3W2VA 3W9HA 3W9JA 2V2QA 3AD9C 2Y48B 1XQIA 2YKNB 3W2WB 2OAUA 5BR8F 3NAIA 4J9VA 3FC9A 5IS2A 3TVYA 4UQGA 1HHTP 3D6HB 1S0OA 1NH7A 1D1CA 3F44A 1UEKA 1I5OB 4TKTA 1CJVB 5IQQA 3TI0A 2AJ4A 5D78A 2WDQA 2PEHA 2OLWA 2ADCA 1Y00A 3T1HJ 1CLFA 4PFOA 5L1LA 4K5RA 1SJ3P 2AKWB 2YQ3A 3I55S 3ULHA 3ONJA 1NH8A 4YSZA 4CM2A 1F9EB 1QTMA 1HNIA 4ES2A 2PN6A 1YXRA 3GIRA 3IRXA 4LF6J 4X4SA 2AYEA 4Q2MA 4IDZA 1G3OA 1IKXB 1G2EA 4ZLLA 4RO0A 2HIYA 2I0MA 2IDEA 4J2CA 3KLHA 4N76A 3QAEA 4OZJA 4DR3T 1W2IA 4DV5J 3KWMA 4XAKA 3ZEFB 1FE4A 4I67A 3SFUA 2WCXA 2QX0A 3PZPA 2E5LJ 2BM0A 2AU0A 3B57A 1U4QA 3C6UA 2DEJA 2RP4A 1IBMF 2KG0A 1RTZA 3PW7A 2GFFA 3F56A 4LRCA 4FYDA 5F8IA 5C3JA 3Q24A 1VRQC 4JP8A 1LNQA 2CA5A 3I0QA 4QWAA 1C4AA 4HWHA 3PTWA 1T72A 3OBIA 2F4VF 7FDRA 2V4RA 4ZPWR 3VGTA 3KHRA 4DR3J 5JR9C 1YJ7A 3NEKA 3OXFA 3ZZ0A 1V3SA 8ATCB 5F5WA 5HYAA 4JI0T 3CIZA 4ATNA 3W7BA 3V4IA 2BKPA 3D6TB 3IS9B 5HVHA 2IIUA 3D0TA 3BQ0A 2WDRA 5ABHA 2VJUA 2Y1IA 1K47A 3M8QA 2E9TA 4C8YA 3UFGA 1OY8A 2MSTA 2ZH4A 4E7ZA 3TUJC 4YN3B 4PQAA 1RWNB 4URSA 3V5SA 4MYUA 3DDKA 3EVOA 3SQGB 3RAMA 1BR0A 4DV4T 1NK7A 2YXLA 2CHNA 1C1BA 3EXCX 5KT5A 3PDNA 1XJWB 4JI3T 2SXLA 2N3LA 4KY3A 4PFPA 4CH7A 3IXQA 4WZQA 4ES1A 2YPYA 1US7B 3TX8A 1CS4B 2Y8DA 3SCJE 4M5LA 4Y2KA 2IVFB 3FZLB 1U2RA 2YOEA 2RPAA 2KHDA 2C3UA 3J7ZT 3RB4A 3QJLA 2EG2A 3FMBA 3Q2SC 2NOXA 1K44A 1GAOA 3BQKA 2W8KA 4NYOA 2HNZB 2P2CB 3VR1A 1C0UA 4MHCA 4WU2A 2ZJRQ 4AQYJ 4CLUA 1TAUA 3OTOT 1RB0A 1QUPA 5CCMA 4FI5A 4FN5A 2FYXA 3H7HB 3AECA 2QEXS 2W25A 4X62J 1TTHB 1E1HB 3OR2B 3Q2MA 1FEEA 5DETA 1AXQA 1QAJA 3THVA 5J2MB 2J6SA 3VAIA 4TX5A 4G2AA 5M2UA 1D1UA 1H2UX 4W98A 1HNZF 1WDTA 2V8HA 1T05B 5AQPB 3JTOA 5J2PB 4BC7A 2ASJA 1ZPVA 4B08A 5J2TE 3CGIA 3ZSTA 3PUZF 3TVKA 3DRPB 3QB5K 4URGA 4GKJF 1QSYA 2IC3A 4I7FA 3RYFE 3PR4A 2XSJB 1YSJA 4ZI2C 3LBXB 4ZKAA 5C8YE 2CG4A 2Z8QA 2Y1JA 4QIFA 5HN0A 4Z7YA 5KFUA 3VCDA 4IDKA 3QYYA 3OPCA 3DRRB 4ZPVR 2D3O1 1H74A 4LIRA 1AW0A 1O51A 2AWZA 5I3UA 3RX6A 2ZJQQ 1WSRA 2OSQA 2E29A 1QVFR 2DPJA 2VPWB 2DIVA 1IBLT 1E2AA 5BYQA 1R8AA 4DR1F 2YNHB 1YKEB 3NCRA 3DOMA 2A72A 4U7YA 4PRFA 2V7LA 5B09A 3M32A 4GIWA 5K8PA 2PEBA 3MTKA 2VHGA 1KEKA 4QYRA 4FS2A 2E7XA 1JXVA 3VWSA 4JI1J 5D3GA 3BGOP 4LMLA 4LF8T 2DNHA 3J80U 2UVRA 3RRCA 2QSFA 2M8DB 3RKGA 3OTBA 2DHRA 1ZOTA 1D1AA 1R31A 3I5CA 1RT3B 2NSBA 2YNGB 1HBNB 1OMSA 4PEOA 4BLGA 2VKZG 2ODUA 2UXCF 4IQXA 4OZ0A 1SE7A 1N0VC 4MFBB 3RYCE 3SXLA 1LWFB 4YTMA 2FC8A 3TVZA 4DQRA 4DR7F 4CO4A 4G1QA 4ZHRA 4JI5J 1FT8A 4H63V 4A8FA 1HWKA 4QU6A 3N9UC 4NA2A 3J7YI 5DQIA 3F41A 3AFGA 2FLNA 5DZ6A 1NSAA 4CO2A 5EX3A 3M8RA 2RIJA 4HFBA 4LSZB 1SJFA 1L3TA 3TZZA 4RUHA 1BR2A 3H59A 4HE8A 5F9LA 1GH8A 2FHJD 1UFLA 2YU2A 3LFMA 2CKWA 3VQTA 4G3IA 3RC8A 1Q79A 2YNIB 2PMZD 2MHEA 3A3NB 4M1PA 1U2CA 5LGTB 4K8RA 1WYBA 3L39A 2ZM2A 5HANA 2XS5A 3PO4A 4CRJA 1VISA 4L9IA 3NZPA 4EI2A 3DP7A 3PE0A 2D3OR 4M5KA 2BE2B 1U8WA 1SKRA 1RTDB 4B3OB 4LR7A 3T8OA 1LRZA 1QDUB 2JL9A 2HBRB 2ACYA 1VQLS 1JNZB 4EZ6A 3BBCA 3A1YG 2CE7A 2D3ZA 2XZTB 1NSPA 3HHLD 3AA8A 2AIRB 2BDEA 1I94T 1G7CB 3OD2A 4K59A 4IR1A 4F8RA 4W4MA 4I69A 1B4SA 5AT1B 1KNRA 3P45B 1HA1A 2NYHA 4JI6F 5D0RA 2IMOA 2VDHA 1J27A 4JI6J 5G0RA 2DRAA 4K4SA 3M8PB 2HFNA 3BDPA 1Q81T 1L3KA 2OPPA 4JI0F 3HZEA 3IHRA 4UZBA 5G0RB 2E7VA 4EK2A 4LF5J 4CN1A 4DI6A 4P52A 3ZNJ1 1EZZB 1ZKEA 3DYAB 3ITHB 4WIQA 1N33T 4OK0A 4Q0BA 2D74B 1ZYQA 2HMIA 2V7MA 4I0UA 3PU3A 1T0TV 2LXUA 1WC4A 2C5IT 1QE1B 3JAMY 2L9DA 1OJ4A 2NTYA 3BJYA 3B6BA 1TL3A 1ITPA 1SH0A 3SEOA 3FBLA 1VK3A 3UU5A 4DQQA 2A3DA 4ILRA 4CP5A 4LF5F 5HBMA 2VICA 1YJNS 2C22A 2CIMA 1RAOA 3HHLA 4JI1T 2PG8A 2EHOC 4HWIB 4QXBB 4LF8J 4H4KA 4BHQA 1MWQA 4PXEA 5F8PA 1N56A 1KLMB 4I4BA 4CLKA 1P27B 3PR5B 2LA4A 3KK1A 1YKWA 5CYMB 4IT4A 4DCOB 4NLSA 2UXXB 1OQ6A 2D2SA 2UU9T 2YWGA 4ILCA 4LIWA 1KVJA 1H73A 2IRYA 2BZBA 3KHHA 2RD5C 3MEEA 3ZT6A 4YHHF 2I38A 2PTFA 3O6QA 4F02A 2F5GA 3TA2A 2BJ8A 3K8VA 3UD4P 3MEEB 2X9WA 4ZVQB 2OEJA 2IA0A 1BHNA 1HNXF 2KSRA 5CA0E 2KLQA 4TNWA 4CWBA 3WX4A 3ILLA 5LG4A 5FYMA 2Z6EA 2BOAA 1D0EA 1CJVA 1LW0B 2WVCA 5JREA 2BKOA 1K73T 4RLEA 2QFJA 2MKKA 3CCRS 2DR5A 1AJ3A 1KSPA 3VRAA 2JVOA 2UXBF 3SSQA 1A0OB 3GJTB 1CC7A 1MN9A 3QOFA 1WD6A 2VODA 3FBZA 5LNKA 3PUVF 4RX6A 4UF0A 5JVGQ 1NMEB 2G2OA 4ZMMA 4AKRB 2AYGA 2VKOA 1WC3A 4BWJA 5FY0A 2F9JA 4BS2A 2V7JA 3C2PA 2Z30B 3M9MB 3KJVA 3H8YA 4XPEA 3MCSA 5L39A 1CVJA 5KFAA 1VBYA 3OTCA 5L9XA 4WF9Q 4ZOSA 1S7HA 2WBLA 4P09A 3KV5A 4ZZCA 3DFEA 5L46A 3AODA 3A8KA 1U09A 2DEIA 1YKHB 3VV2B 3WI3A 2E1PA 4LSLB 1Q5YA 2MZRA 2HN1A 1Y4ZB 2WW4A 2CWOA 3RIUA 3U3IA 3BO2A 1WHYA 5KFFA 2FVQA 3MGJA 1CJTA 4C9DA 1NK6A 4N8NA 4HEAA 3NS6A 1HWLA 2RU9A 2XG8A 2GGPA 1FX2A 4NLYA 3RPUA 3SSSA 2UUAF 2R7XA 4ETZA 2OEMA 5LMNT 2CA9A 4ED8A 3DYAA 1U0HA 4PK5A 3HVTA 1SKSA 3PVXA 4I68A 3GFHA 4DV6T 4UY85 5K5MA 3PW2A 5IT0A 4HWCA 3AAWB 1RT6B 3CMLA 4YB6A 3JSMA 4JI4T 5ABFA 3LP1A 3O1LA 2EG1A 4KGMA 3HVRA 3K0JA 1IQTA 3E22E 5HL7Q 3BEGB 3WX8A 1K1SA 1HHQA 1S59A 3OSPA 3RB3A 4DV5F 4IO1A 4C8ZA 3L3PA 5DLFA 2R8IA 1D0YA 2BE7D 2UUCJ 5ABFB 3LP1B 2WONA 3C51A 4JUYA 3MURP 4U74A 4J9MA 1H0HB 1S4EA 1J5WA 2L9QA 4DV3F 2OV9A 5CYMA 3ZC1A 2LSJA 1I6JA 2FY8A 4B9UA 3TOQA 3HT3A 1JLAB 3M2RA 1ULRA 3CJKA 4LF9J 2V5CA 4ED6A 4C8KA 2ZMAA 1RHRB 3FJ2A 1UETA 2L3LA 2DCFA 4DMZA 4ECUA 2CPYA 4K0UA 1VRBA 1TKXA 4QWBA 2U1AA 2WSCC 5B08A 2DNMA 3GZ7A 2V4QA 2KI2A 1HR0F 2ZZNA 3Q8QB 5KOXA 4AQGA 2CJBA 4I43B 2K1RA 5AQTB 3IG1B 2X67A 1RAAB 1MROA 2GVDB 3BO4A 2J0QD 1VQ5S 1XTZA 4C0HA 4P73A 5A2QY 4A8KA 2H7OA 4JI2J 1W0BA 3SFEA 2XB2D 1OYEA 4HKAA 3EZOA 1AFIA 4OHFA 2DGOA 3GN5B 4RKUC 4GK5E 5GMKa 5L2LA 4AQYT 2HFVA 4EFAC 4EOZB 3LQVA 4AL7A 5IQ6A 3DOKA 2N1GA 3SFDA 4B3RJ 3O3LA 1MU2B 2XHEB 2RF2B 2NTXA 5EX0A 3NS7B 4DR5F 3MACA 1RWXB 3P4PA 4K4TA 2ZFHA 3AB3B 1HYSA 2R8KA 2R7OA 2IC9A 4USJC 2ZNZA 4RZRA 5JDMA 2CNOB 3J81U 2ZD1A 2ZKUA 3D7SB 4P7VA 3B13A 3QFWA 1J5ET 4B3RT 1HHSA 1RTJB 2VG6A 2C3MA 1F0XA 3JCFA 4CXYA 4C90A 4OYIA 4EYYR 5LM7E 1M1GA 4LFBT 4ISTA 5KFLA 4FBTA 5ETNA 3DC2A 1S1UB 1T9UA 1Y11A 5F8JA 2E5VA 3AJDA 5U47A 2BA9A 2RUSA 3BKTA 2EBEA 1KWMA 2HLUA 3X3UA 2NXEA 2LQ9A 1R6VA 3N2OA 1PBAA 3TWZA 4TNOA 3C16A 1W0AA 4EEBA 1PYOB 3DOLA 1S79A 1RT4B 2P6TA 1XMQT 2ZWPA 5A8RB 4DV2J 4M5DB 4ECRA 2RA1A 3E0ZA 3DM2B 2VVSA 3D28A 3HD2A 5FP3A 3VAMA 3OW2R 4PWDB 3M6UA 4I55E 1JLCB 2DRDA 4DV0J 1NRKA 2LM2A 5DJBA 3CULA 5HATA 1HFEL 4YDXA 1UURA 1S5ZA 3B54A 3EGWB 3I0RA 2E9XC 4ANJA 1BUXA 5FDLA 1FEWA 2W2OP 2RH3A 1NDLA 3LPEA 2FHOB 1UWBA 3LJCA 1WDDA 5KFXA 3UCZP 2HHHJ 4JI4F 4DFJA 4P9SA 5CYQB 3K3QC 1FVQA 3OTOF 4X66F 4MJKA 2VFTA 3PKYA 2V4JB 4JI7F 4F4KA 4IE5A 4OI1A 1K1QA 2MZSA 4KC5A 3DGPB 1DAXA 4LF6F 2ZH6A 1QAYA 2IJRA 4DR1J 3PU8A 3ZT5A 1LW0A 3R27A 4ID8A 2ZH2A 2VV5A 2J9DE 3IS9A 4PR6A 3OVAA 4HFDA 2F1FA 2PFVA 4IFVA 2KYZA 4HWDA 3ZTOA 3I82A 2R7WA 2FVSA 2ZKTA 4OQJA 5KXJA 5A8KB 2Y1RI 3U78A 5HXSA 1L3VA 1XNQF 1YI2S 2BUNA 2HNYA 4AIUA 3EICA 1Y0HA 3IA0A 3C4WA 1VK8A 4WFXA 4NLQA 1TL3B 3C50A 5FKYA 2MTLA 4TUYE 1TFYA 4CH0S 4ZJQA 5HQLA 2AE9A 3R2DJ 5MLCV 2ADBA 1G4CA 1V9DA 1O3XA 3J81j 4CLZA 5GMEA 4YHJA 2DL1A 4EBEA 3PUGA 3AE4A 2E9ZA 2EHOB 3OXLA 5F8HA 3O9XA 4I2PA 3ZZUA 2B4PA 2ZH1A 2FVPA 2P5VA 1N5YA 2KDOA 3MECA 3M4XA 1IAPA 1R8IA 4OYXA 2NPIA 2BS3A 4KHPF 4M5JA 1N5YB 2X68A 2KKHA 3CXCR 1FKOA 2XASB 1N0UA 1NPKA 4RW6A 3OVUA 2Y0BB 5AQSB 2W2UA 2RILA 2UU9F 2ALYB 5GAGU 3IBPA 2KJWA 4BC9A 2IM0A 4JV1A 2FJAB 5IV4A 2GGPB 3ZXWA 1FWKA 4L5GA 3HHLB 1GK8A 2I9SA 1SHZC 5KG0A 3P8CD 1PCAA 2EWHA 1TKZA 4Y6IA 4IE4A 4KHPT 4AKHA 4ED1A 3AXJA 4R0EA 5AXKA 4LF5T 1S99A 4QIWD 2PA3A 3AY0A 1FHTA 1R3NA 5D15A 5HJYA 4ERRA 2XYHB 1HBUA 4MYTA 3ZC0A 4H4OA 2W62A 3N2KE 5DM7Q 1TL7A 4FXWA 4CLYA 4USKA 1GT8A 3C15A 5IZHA 3PJAA 3ZTQA 2XO7A 2DD8S 2UZAA 2FLPA 3MOJB 2XZEA 2KO1A 3U1MA 2LEAA 2AEJA 3RU0A 2RAQA 3I9V9 3PUSA 3FBEA 1NU4A 3CCVS 2JJ9A 4IR9A 1NAFA 3GYXB 1X9BA 4BJNA 2HHSA 2HBZB 1JLEB 3QT6A 3CDAA 5C24A 4DNDA 5B7WA 4HLBA 1XNQT 1JNRA 3ET6B 4B3SJ 2W1BA 3ZMUB 4Q7AA 2HRYA 3RRGA 4FYVB 4K4UA 4Z91A 5H9EK 1T9VA 1FFWB 3QIDA 2WONB 2G4BA 3BO3A 1HFAA 4ENOA 1RWMB 5ETQA 2LHNA 2K06A 2Y3YA 2MOZA 4LBPA 4OMFG 5SUHA 2ROPA 3OL6A 1XZYA 1M0SA 2C0SA 4HGAA 5MAOA 4C11B 5HQ8A 3A4TA 1O0PA 1PILA 2WHOA 2HQGA 4A8YA 1VS3A 2QMWA 3P5BP 2IAKA 2PJQA 1SUQA 2YTCA 4O44B 3NNHA 1MW7A 1KNZA 5E5NA 4DR4J 2YQ0A 3PFOA 4JI7J 2WB4A 1SIZA 3A8YC 4B9NA 1EX8A 2QE5A 1FESA 2EI5A 1YZ6A 4F36A 3D0GE 1LWFA 4AXJA 3NRBA 3ZTRA 4DSKA 3HVAA 3OHAA 1HS7A 3GE9A 3PYDA 2WDVA 3G71S 4ZVHA 4HTJA 4X4OA 1HI1A 1RTIA 1MMNA 1BR1A 2L08A 2ZUAA 2HQCA 4ED2A 2FJDA 3BH6B 4YTNA 4RJVA 2E5LF 4JI7T 2NUHA 2K7JA 3RW6A 4NYZA 1UA0A 3KNGA 2DGVA 2V67A 4IO9Q 3Q8PB 3TQEA 3QO9B 3MEGA 1KDNA 5CQGA 2UXDJ 1ZH5A 2BG9A 4HH1A 5JMNA 4OYAA 3G4SS 3GIIA 4LQ9A 4CO3A 1IKYA 1MWZA 3IN5A 2AHOB 1U45A 4QIEA 4UVCB 1MSWD 2HMIB 2CJXB 2CNNB 1TL4A 4GKKF 2KM8C 1O8BA 3PV8A 1CUNA 3MM5B 1D9AA 4NLDA 3Q8YA 3NOCA 1FKAF 2R6GF 3DI6A 3J9X1 2OO4A 3VR8A 4IG3A 1J5EF 3I56S 3N9OA 1T7PA 1HPZB 3GG0A 2W2QP 1RTJA 2VG6B 1Q82T 3CO0P 2VIHA 5FY7A 4K50A 5AJ3J 2GHPA 1JLGB 5D4OA 2PMWA 3SV4A 4ZVFA 3H5YA 1S0NA 3KJNB 1D9DA 4WIIA 2CJ9A 3LP2B 4FPIA 3WC2A 2LJLA 1JQGA 1TKDA 2GVDA 5ETVA 3GJSB 5BR8J 1RQ0A 3LBXA 2IAJA 1CG2A 1NJXA 3LF0A 3UN2A 4CI2B 2JQHA 1NZAA 5KFMA 5LBQB 4RUAA 1LWEB 1RTIB 2VB6A 1EZ3A 4Y2IA 2ZBIA 3GJQB 2B9YA 3CIRA 4FKYA 3WQPA 3AAIA 2YWEA 2MZQA 5KAKA 3ZCIA 5DG8A 2C28A 5CYJA 2DHGA 2KYXA 2MY8A 3SDEA 5LHHB 5IYZE 2VQET 1T8BA 5J1PA 4DR7T 2V68A 4DDFA 2YBVA 2QYCA 1X79A 4QXCB 1GNKA 4TLRA 5AQIB 1AZSA 2IM1A 5C5JA 3UQSA 3TRGA 5L3BB 1EQ0A 4HFCA 1YJWS 2DR6A 5A8KA 1YJRA 4LR9A 5IXUA 1E6YA 4WFYA 1NDPA 3QPIA 3PM9A 2CQ4A 3VALA 1YHQS 1W25A 3TLWA 2C3YA 1VFJA 1WELA 2GJIA 4HT5A 1DZ5A 3KVBA 2HPUA 1YQ4A 4FBUA 1TQLA 1QLBA 2XQYA 3HHKA 3H3AA 4UUXA 4H4KC 3OYZA 3NGUA 3QC9A 2DNZA 2M3DA 1TR0A 4DUYJ 3M9NB 3RAXA 3HFZB 1X4GA 3FHNA 4ES3A 2MPUA 2YX7A 2HVZA 1X9MA 1S9EB 3NKZA 3S1TA 4FF4A 4ZPDA 5ETRA 2WVEA 5GONE 3G8SA 2WW8A 5B0DA 3I4PA 3W61A 4LJMA 2KM8B 4DV3J 3KMQA 4DOZA 4L75A 1U4BA 4KHZF 3OVBA 2YKMA 3W8PA 2HAFA 4DBQA 2ZH7A 1VHFA 4USHA 3B8HA 4U7UK 1I3OB 2FJEA 3MPUB 5HWYA 1WLXA 4ZN1A 3FUYA 1SJQA 3PKMA 5AQJB 1D1BA 5HXCA 1CULB 2H1YA 4PYAA 2LRLA 3PUXF 4YY3T 3CKDA 1WF1A 1TKZB 4QHOA 4LT6A 1BQXA 1PJ6A 4F50A 4QPXA 2BBHA 3OVSA 4EO6A 1I1GA 4KGXB 1M1KT 3K58A 5C42B 1HI0P 2DNYA 4N41A 5C2CA 1W9RA 2MKSA 2X66A 3MAAA 4TV8E 4DR2F 1WCRA 2QC3A 5C42A 4B3OA 3H90A 4WPAA 1XR7A 4ZOLE 5HEHA 2XLIA 3UDVA 4O2BE 2ZBPA 4QWNB 2KZZA 1PKUA 3BQLA 4YY3J 3BSCA 2G0CA 2XMAA 2XWYA 1WG1A 4B3MF 2LU2A 1S1WB 4DX6A 1VRUA 2F4VT 1JIHA 1S6QA 5D77A 1S1WA 2XSFA 2B4UA 2JEIA 4TN2A 3H0PA 1LW2A 3OSNA 3UUNA 3PACA 3C6TA 3SSRA 2M5YA 3J7A1 2ZH9A 2UXNB 5IWAF 3CD0A 2RRBA 4X65J 3GR1A 4M5NA 1KHWA 4YFUA 3QK6A 2ZE2B 4DV7T 3N9PA 1P6TA 4MAKA 3C46A 3MPDA 3I5BA 3EE3A 4NA3A 5I3QA 2HEKA 3CMAS 1XMQJ 1XMOJ 1YITS 3G86A 1RKJA 2QMXA 1LXJA 3UDEA 3GA8A 3ZNUA 2WOMB 4KTQA 4FDFA 2JWNA 5LL6d 4HHHA 2CDQA 3JSBA 1KP6A 2XZWA 5KT6A 4ID5B 2FJXA 3UQ7A 4C6AA 2O5DA 1FD2A 4X65T 2MQQA 5AJ3F 3BYPA 3CJ3A 4RW8A 1N6QB 2HWIA 3CCSS 4F4YA 2DXEA 1HW9A 4WXWA 4EZ4A 1U1LA 1TUWA 4FXDA 2RNEA 5A0YA 1S97A 3V6DB 3LSVA 3TA0A 1LFWA 4LF4F 1ROFA 2L41A 4FPRA 4DPXA 1HW8A 3MMCB 4CLWA 4C2MA 2MEWA 3SIPB 4GMKA 1SJRA 4G1IA 1REVA 4KH1B 1OWXA 3R7SB 4RUBA 4J90A 3MMCA 4DCJB 1FJ7A 1WEZA 2ZH8A 4KO0B 1UVLA 2CVEA 3CK6A 3OUYB 4RBUA 2YKAA 3VRBA 3CDEA 2BG9B 4YR3A 3HHDA 1SB6A 1D8ZA 4ETXA 2RB7A 5L3EB 2F4FA 1A7GE 1YVFA 3JSRA 4P0AA 2H7VC 4U31A 1FJGJ 4ZP6A 2N9DA 5L1JA 4QQBA 3N6MA 4QJVA 4YTPA 2GW8A 4YP3A 2OIHA 1NK4A 2Q66A 4F4WA 5JDFA 4URQU 4L0RA 2QL9B 2LP4A 2G0JA 3ZZZA 3UPFA 4M94A 4QOTA 5H1SV 2OFGX 1NJZA 4IG0A 2QL7B 3EAMA 1TV6B 4DPTA 1UX5A 1F5AA 4A8XA 4C98A 2WBRA 2E1CA 2DHSA 5DGAA 2VFVA 4JI2T 2W9AA 3TUZC 2W7OA 4LFAT 1SH2A 2DR9A 1NAQA 4HFIA 1BGXT 3NVOA 4ECXA 5J2NA 4OX8A 2CXDA 1QM9A 2DNNA 2V7KA 4LFCF 1FVSA 5E33A 4ECTA 2GAGC 1LVKA 4A8SA 1U25A 3TP2A 3SCLE 5K8NA 4KYZA 3N0VA 2WB5A 3W2WA 5AQUB 1JLBB 5LMUJ 4ZCLA 1YBTA 3TA1A 3AJ1A 4K0KJ 1FNMA 4OX7A 2DT9A 3DGVA 3DCAA 1JLBA 2J7KA 3G82A 4H9PC 2LQBA 2XNQA 1HNVA 2W8LA 2MHNA 2CPFA 1TFWA 2ZC3A 2MKYA 2WS3A 3IAS9 3DXBA 2XQ5A 4JV5T 4ECVA 1IBKF 2NZCA 4OL8A 2ASYA 3KTQA 2PT0A 1FI4A 4OJGA 2X51A 1VQKS 4DSFA 3CJ8A 1F2GA 2HN2A 3EX7B 5C7PA 4NCAA 4NLGA 1DHMA 2DY1A 2AX1A 5LOVE 2OPQB 1IKXA 3V5RA 4DR1T 4N5SA 3AD8C 1IKYB 4IDPA 3DRSB 4ZI3C 3HSGA 3DLLQ 4X4PA 1FK9B 1G1XA 2FHMA 1VBZA 4Q43A 3W3SA 1YDLA 2R7TA 3I9ZA 4FYXB 3ENQA 3R5AA 3IP0A 4AISA 3FCWA 2RHSB 3P7IA 4JI5T 3SCKE 3D4JA 2ERRA 2UUCF 4ICLA 3LPYA 3QAUA 1KS2A 3M05A 3KK2B 1UVJA 4KBIA 2FLOA 4DR4T 1RT2B 4DLEA 2MMYA 4OJHA 2RRAA 1Z2LA 2V2KA 2OP5A 3CDBA 2HHHT 2E7WA 2E9RX 2BXJA 5HAOA 3LANA 5B0BA 3LW5C 3FFIA 3GILA 1NKEA 1RT3A 3AEAA 2QA1A 2APOA 3N2GE 1ELOA 4WTOB 4MFBA 2UVWA 1RXOB 5ETTA 4DV4J 1F5BA 5GAHI 2QA4G 4J9KA 5L3CB 1X4AA 2HZAA 4CN4A 2X1FA 1UVMA 4XZCA 2B5JB 4KT0C 2XMJA 2R9LA 1XR6A 2KVIA 2HNDB 3V81A 1L3UA 1YX2A 4HHUA 3VGVA 3O1JA 2VQEF 2VZ9A 2P9BA 2D1CA 1LVFA 5LJMA 3ZKRA 3P4UB 1FE0A 2QLWA 2ZZMA 4OHZA 5KG3A 1RLDA 2R2SA 2NXNA 5AQNB 2JFKA 1J5EJ 4DQIA 3SMZA 1EAYC 2MGZA 4E98A 3PX4A 3PTRB 2XI3A 1URRA 3PHEA 1TK0A 2MDAA 3D0HE 3R2CJ 2KN4A 2GNKA 4B9VA 1IBCB 3UVJB 4XTTA 2QFIA 1IBLF 3Q5DA 3RW7A 1QUVA 4I1TA 1ZTWA 3NS5A 2R2TA 2YNHA 2WU5A 4P2FA 1IUJA 1B7TA 3N6NA 2M4MA 3R6NA 2DTJA 1HQEA 2A1BA 4MLKA 3V2UC 3BK9A 1UCUA 4OI3A 4EXTA 2FTRA 2E5HA 5EWEA 2MYFA 1BR4A 4P7TA 2YPZA 5E7OB 2RT3A 1F2HA 1X4EA 2WSSV 3M3ZB 5HLFB 3GFZA 4O4LE 3HA4A 1WHXA 1UW4A 1Q1KA 2VC0A 4JLEA 2IFXA 3M8SA 2FUPA 2HYIB 4F2SA 3CTRA 4U7CA 2AYBA 1MNEA 3OFFA 1N36T 3MAHA 5EHHA 2Z2LA 4UZCA 1XNRJ 3DLKA 4AKLA 4ZVEA 1DTQA 2W00A 3PUYF 1IBKT 4J9NA 1SQGA 3EDVA 3MI7X 3DRSA 1K8AT 2Q9QC 3H37A 4U96A 1SA0E 2E66A 1HWJA 1JKHB 2VKRA 2W7PA 5F0WA 4QH1A 2VVNA 5A6PA 3DU5A 5A0YB 2LFVA 4L72B 1YW0A 1Z1ZA 1GMWD 4F0KA 1SVDA 4G1QB 2POKA 3UVJA 4JI6T 4C0BA 3N4WA 3QO9A 7AT1B 1YGYA 4F8HA 1RAHB 2G2YA 3P4SA 3CJ4A 1WC1A 2HGMA 4L3KA 2AT1B 1JLFB 1Y7PA 2IVYA 2IVMA 8AT1B 3WBZA 1S1VA 2XQ3A 3VTIA 5DQGA 2WU2A 5CGMA 1IJ5A 2JH3A 4DF4A 1BQNA 1HI8A 2KT5A 4A4JA 4F3OA 1WTBA 4DV1T 3K5MA 3BM7A 2BJ9A 5D0GA 3PNIA 2BJ1A 3CD5A 3OJAA 4OHYA 3P50A 3LO3A 1U1NA 1OY9A 2VK9A 2DNGA 5AQMB 3V6JA 3RRHA 1M90T 3FRZA 3DMJB 3RC3A 1UK5A 4QYZK 3AA9A 1SKWA 1T3OA 3H2UB 1HQ2A 3MA9A 2R7UA 4KBMB 5HMXA 3JC6C 2BW7A 3GCXP 3GYGA 2QSWA 2Y6XA 4AKIA 3THTA 5J2QA 2CWKA 4FZVA 4DF8A 3SV3A 5LCYA 2AGPA 1R6YA 1U48A 4M5GA 3H40A 1N33F 3EVMA 3TO8A 2ZM0A 3SYZA 4FF1A 1MU2A 5CH7B 2LYVA 3PEHA 4O3QA 4KKOA 3ZTPA 4NE9C 4K4XA 3HR0A 4LMJA 4HFVA 1WWHA 5EK3A 4KHPJ 1SI9A 4U67Q 4X1IE 3T5JA 3D3CJ 4GVBA 3E2EA 4HTEA 2JQ9A 5ABGA 5LMNJ 3KV4A 1CQMA 3IFEA 4ITSA 4NIQA 1QSSA 3DXSX 2DH9A 4ELUA 1HBOB 3KUGA 3TW0A 2R3VA 1IKVA 3C4ZA 3PYEA 3ILIA 1F3FA 3MCOA 3GQCA 5J0ZA 3OL8A 1VQPS 1N34F 3ESLA 3QT8A 4LSLA 4HT7A 4BDPA 4R8UA 1VLYA 2AJFE 2W9CA 3GLJA 3EABA 4CO1A 3BB5A 2WBMA 2OUGA 2F8EX 5HSPA 2A10A 2M67A 1RTHA 3TLUA 2B6AA 1AB8A 2KT2A 1UTAA 2L48A 4B3ST 3MM6B 4GKKJ 5EWGA 2AF6A 1FX4A 1OIAA 2LQ8A 5L1KA 2WAQD 3MMBB 2RDJA 2DPIA 2XSAA 4DS5A 1HNXT 3DRXA 4FF3A 4TY8B 3NMRA 2JIWA 4RNNA 2FJWA 1NPRA 1NNDA 3E8OA 4YR0A 2HFOA 2C2NA 2XMWA 4YLHA 3FZKB 2XAHB 1IKWA 2XBPA 2YVSA 3NGRA 1RWPB 2DNXA 4U6PA 3UU3A 1JLEA 2VASA 4EB6E 5KG4A 1XMOF 2YDSA 5J1EA 2YH1A 1RE1B 2AJ1A 5D3GB 3F0NA 1SQEA 5KMGP 2JFDA 4AL5A 2RVJA 3IEEA 3W5XA 5LT5A 3PYFA 2CWXA 3MM7A 1NJWA 2H3RA 1RCOB 3RQWA 1ICEB 3M1VA 4U3CA 4ZJOA 3VAFA 2DIUA 3AXKA 4MIBA 4IE6A 3KINB 1CJKB 3QT5A 2DK2A 4F2RA 2B7CB 2HRTA 1U26A 4X66J 5T7LB 3C14A 3UUMA 3AQPA 1BD6A 3RBDA 5EUHA 2QYWA 2IPOB 1XIQA 2H5IB 3JXOA 2A3JA 1X5OA 5FNVE 3OFGA 4P1NA 5BYRA 1RYSA 4DUYF 2E5JA 4L74A 2BVLA 2I59A 4RW9B 1SKUB 2ASLA 3PFEA 2K24A 4C8OA 2XHWA 2CQPA 1IJFB 1X4BA 2PC6A 1HIYA 4O4GA 3AE8A 4FJOA 4H9NC 3NCQA 3GV8B 2A9UA 1KQGB 4RW9A 2Q6CA 1YBUA 4OI6A 2KG1A 3JQJA 1VIXA 4F4XA 5AQVB 1IN0A 5A8WA 3QMQA 2VONA 3UWTA 1C1CA 1D0ZA 1HR0T 2JQKA 1VRTB 3POTA 3G06A 1UFKA 5EWFA 2WVDA 2BKNA 1JJ2R 4B3TJ 4UV8B 3D68A 3CQCB 4KIAA 4NUVA 3ONXA 1L5UA 3K1SA 4DL6A 3EVYA 2Q3PA 1I94F 4ED3A 1Q0NA 2X0HA 3F73A 1SL2A 3R5BA 4LQ3A 3NZQA 4OI4A 1LW2B 1RISA 3BF4A 2N7YA 4PUOA 2CDRB 4B3RF 4OHWA 1Q8BA 4X1KE 1IKVB 2H5JB 4OX9T 1X0PA 4PAGA 4DBRA 5JXSA 4DR6F 4C8NA 4DL5A 2A6MA 2ZH3A 1XEZA 2GO9A 1QSDA 4PK4A 5LB7B 3IWXA 3VGSA 5CD4A 4K0KF 2IMLA 1FDDA 2JHEA 1WC0A 4JI5F 4DO0A 4DUZF 4DR6T 2XNRA 1MWYA 4LF7J 4J9LA 4OLOA 1FA0A 1T05A 1FEHA 1WG5A 1P9YA 3BGRB 4DX5A 5ADXL 4ILBA 5AQHB 5F8GA 4QWDA 4GKKT 2NREA 1H98A 3DLKB 2HPJA 5K20B 4ZHRB 3IR6B 5HQMA 1N5VA 3CEDA 3HFKA 2NP9A 2N4CA 1RAIB 1KNPA 4ZIWA 1Q5VA 1D3WA 5CD4H 3UNYA 1YJVA 3RGLA 4ZI7E 2CRBA 3JB9k 4DUZJ 4QH5A 3W1YC 5CZXA 2H3EB 1S1XA 5KFOA 2B8PA 3H25A 2CEAA 3JC6D 3Q22A 3FK4A 3HFVA 1N54B 4WP9A 5K8OA 3OKQA 1V6HA 1OEDE 3PW0A 2HQDA 2CPDA 4S0MA 3RIUC 1Q16B 5LJ5Y 5KTQA 3CUNA 5ETOA 4ZS2A 2ROEA 4Q8EA 4KV8B 5FVLA 2J7WA 1Z8UA 4MALA 2MLXA 2Z56B 3P8BB 1FJCA 1NHKL 5C24B 3C6UB 2IHR1 2X1BA 4DUTA 4LR8A 2J8SA 4K4VA 1XDPA 3LOUA 2HS0A 3HHEA 2O01C 4DV5T 1YRXA 3HI9A 3VQSA 2HHQA 1VDHA 5DQVA 3MEDB 4RW7A 3RGIA 4WZMA 2YNIA 3W63A 1WRDA 1RBOB 3NAHA 4LMZA 4DG1B 4YSYA 2ZBQA 3UDLA 1HG5A 1S6PB 3IR7B 3GP9A 2HHTA 3MECB 2ZVSA 2JOQA 3CJSA 3N28A 1V3ZA 4H63H 1U8SA 1HX8A 3MJXA 3CSKA 3MMJA 1NKCA 3CPWR 1KBRA 4USIA 4EZ9A 3A13A 5H6RB 2G0UA 1ZS6A 2DWKA 2Q9QD 5L1IA 4ED0A 2DI4A 2I0XA 1X4HA 5AQFB 1EJ7L 2BBEA 5FL1A 4GO7X 3UNGC 3CE8A 5HLFA 3Q5WA 4F26A 3NBPA 2GHWA 3EI0A 4DEZA 4KSEB 2Z58B 2U2FA 4DR3F 1URNA 2KXFA 3MEGB 3CX8B 3T1YT 4YS2A 3L7UA 2YWWA 3G2XA 5DDOC 5M2PA 3K3NA 3IGNA 2JX2A 2CJKA 5BJRA 3R7NB 4JI8J 3CCMS 2OPSA 2QT7A 2NUUG 3D6MB 4MKAA 3TAMA 4LFAF 4LFAJ 1C1BB 1IBMJ 2OPQA 1N34J 4MK7A 3R84B 2YDRA 1FXLA 1X4FA 3W65A 2C2RA 4I2PB 3D3BJ 3O1HA 2FZCB 5E41A 1VI7A 3IRXB 1NK9A 5FXVA 3R1HA 1F6TA 2LEPA 3AE3A 1U24A 4ZPTR 5M2RA 2RUGA 4LF9T 3H3MA 2M52A 3VVTA 2LEBA 3CCWA 1Q8KA 1U1PA 4WBNE 3CJ2A 3R5JB 5KFNA 4XPCA 3VZHA 1YJTA 2UV8A 2MKJA 2CZ4A 3E01B 1M5HA 2V6YA 5ETKA 2UUCT 3T3FA 2J76E 3UD3P 2KVQE 2YKSA 5I42A 3JQMA 2CZVC 1S1TB 3QRPA 5HCJA 1YZ7A 4ZVRB 5KOWA 5LXYA 2OKQA 3ZN0B 3ELHA 3QUJA 2E2AA 1HCIA 2V34A 4WFZA 4MKVA 1IWGA 4LRDA 1GFWB 3HP6A 1LWEA 2EFNA 3OT9A 1KLMA 1SC6A 4USWA 3DM2A 5E2QA 2JEGA 4LF7F 2XPKA 1XBWA 4AKGA 1TL1A 3GONA 2C3OA 4NXMT 1C0TB 4TV9E 3GMGA 3L7PA 1ZOYA 1WR6A 3OR1B 3O1IA 3IWNC 3SDEB 4NI2A 2BZ2A 3NBXX 1S1UA 4O0NA 4DU8A 1YRUA 5DG7A 4P72A 3NNCA 2MQMA 1DTTB 3B4MA 4C3KA 2LOSA 2W24A 4WBOA 1GX5A 3V6HA 2QN6B 3IF8B 3M6WA 4CH1A 2R8JA 2QTWA 4CLPA 1KN6A 2MAWA 2M6BA 3C8YA 4DV1F 1GXTA 3DRYA 1PBUA 4OZ2A 4ZPBA 3RH3A 5AE3A 3KVAA 3IWLA 2A18A 4A98A 1SCJB 5CJ5A 4MFRA 3A3PB 4QWCA 1N5TA 2VURA 1GXLA 4UOFA 1N8RT 3QWPA 2HVDA 4KGKA 1H7XA 5LHGB 2CNLB 2QRXA 5IWAT 4LFCT 4EEYA 4OFZA 2IJNA 1YJUA 4EYIB 4DL7A 3KBUA 3CCTA 2OMLA 4F4AA 3HO1A 5FIIA 1ZV4X 1ZZNA 2XS2A 1VQ9S 3UULA 1WR0A 1U6FA 5KFKA 2BABA 2HVIA 2YINA 4LF9F 4DR5T 4DJBA 4DIDB 3PURA 1DQ8A 1IJEB 5B0AA 3SFGA 2CPHA 3AEFA 1PYSB 4F3QA 3OTOJ 4K2JA 2FC9A 5AXNA 2NW9A 3BN4A 4OZ3A 2BR0A 1UVNA 3NL0A 4WYLA 3OR2A 1YQ3A 4X62T 3Q83A 3N6LA 1B7FA 1IZNB 2D9OA 2IUBA 2EC0A 2W67A 4C97A 2VKJA 2JJ4D 4A8OA 5B0FA 3BKUA 4TU8A 4EV6A 3MM8A 3RBXA 2QGSA 1LOUA 1UP1A 5IC4B 2C3PA 3DRPA 3AA6B 4NLOA 3FSYA 4JI8F 3LGNA 4UW2A 1B64A 1FTRA 1GMWA 2NZ4A 4XDDA 1GEHA 2RE1A 3AEDA 1H2VZ 3TAQA 3T1AA 2XZDB 1RHUB 2Z4PA 4DZ6A 4NCBA 4YT0A 5CAAA 5D8HB 1TZ0A 2MQ8A 3G6XA 4IIJE 1Y9OA 1TP7A 5HCMA 3QSYB 2Q43A 1AFJA 1S76D 3GPAA 4DV0T 2GQ2A 4CTAB 4DR7J 4CYUA 2D9DA 4HI1A 1JLQA 3QLHA 1IQZA 5GAEU 2ZC4A 1HARA 4B17A 1KR4A 3A8JA 4DL4A 4YEAA 2V9KA 2XAFB 3BS9A 5K14B 2X9HA 2PDAA 2UV8G 3BPDA 2M8HA 3HL6A 3QZ8A 3RBEA 2BQRA 2VG7B 4ZVOB 3CDUA 3EZUA 4NLVA 4I50E 1JLAA 2J9CA 1Z0PA 1OYDA 2W2MP 2IYIA 3CW2C 2IDLA 1H7CA 3ADAC 3H42A 1MMAA 3TJ8A 4TWHA 4NZ7A 2OH2A 5D6GA 3GV5B 1KRPA 2N7CA 3WDOA 5KFYA 1IBKJ 1VC5A 1HTJF 1HG2A 4OX6A 5C25A 1ZAXA 3V4IB 1X5SA 3ISNC 1SJ1A 4ZN3A 1DBDA 4Z2XA 5F8NA 1MLAA 4E2FB 2UUAJ 1ZAVA 3M8QB 3ITHA 3H4BA 2CPTA 3AQOA 1RWUA 2NLWA 3D54A 3POTB 3PX0A 4LF4J 5FL0A 4PPZA 1RT5B 2P9CA 1TKTB 2ZZTA 3IC1A 2BS4A 3PW5A 1NDCA 4WFAQ 4PWWA 3T6BA 3ZO7A 3KJVB 3EZ5A 4RUCA 1VCSA 1UUSA 3N9QA 3MXHP 3F57A 3T1HF 4WBFA 5B0CA 2JMKA 2ZD1B 2K9AA 5HAXA 3X1DA 4N7TA 2V94A 2CFXA 3QIPB 1CEZA 3QBCA 4ZEYA 3CCUS 4J7CA 4J37A 3HDSA 1VLOA 4QR1A 4PKDB 4NEZA 2PIIA 2XQCA 4MT1A 3M2UB 4QPTA 3RZAA 3RB6A 4IREA 4ZVPB 2HQFA 4JB8B 3HKEE 2CBJA 3OQ2A 3W2VB 2E5IA 4N56A 1VRUB 4GKJT 3FZMB 3V5UA 3OLAA 2RDIA 3DMJA 4A47A 3JS9A 2YNFA 4HYKA 2EXUA 3KLEA 1H38A 1XNQJ 1RAEB 2RQKA 5HP1B 2V2VA 3BQIA 4OYJA 4UIGA 2YKOA 4ZP8A 4V19J 5KT3A 3VF0B 1E6VB 4ZS6A 2BX6A 4USMA 6AT1B 5D4NA 3EJMA 4O3SA 1HL6A 4N77A 2YKNA 3QZ7A 2W01A 5M4YA 2RU3A 4CI0B 5LMNF 2DB1A 1YTYA 2WTFA 1L0VA 4ZPCA 4LBHA 3P3DA 1SUMB 2XM2A 3EGNA 4DL0C 1KVKA 1M5PC 1RAJA 2OSRA 4TY8A 4BJMA 3AE6A 2PMHA 3RRWA 3TEHB 4J9PA 4PW8A 2UXBJ 2L3MA 2RQCA 2G2ZA 2ZDOA 2X7IA 1LK7A 2LHRA 1S6QB 4ECYA 1OEDA 4FKXA 2YKPA 2LQ5A 3LGMA 3WAJA 3MAQA 1LKXA 1T03B 4AQFA 2VPXB 3W15B 4LF2A 5EDWA 3I1AA 2LKZA 3VHLA 2BE2A 2VD3A 1VQ8S 2XY8B 4DPYA 2WAUA 5L3GB 3CX7B 5FDLB 2LA6A 2ACXA 1N32J 2EK1A 2UXBT 2OI2A 4TLQA 5GADI 3OBVE 3KJFB 2MKCA 1NK0A 2ASDA 2BMBA 3AB4B 2IRXA 4F0HA 3CIMA 3MM9A 1TMJA 2CPEA 2CLYC 4WTYA 2ZDPA 1RWKB 1RT4A 4B3TT 3UDCA 3VVUA 4QR2A 1FMWA 1I6ZA 3PW4A 2UUTA 1H7WA 3IO1A 3K7RA 2FDNA 1KEYA 1MROB 3KUHA 4COFA 1HNWF 2PD1A 2HVEA 4ELVA 1NB2A 2WSFC 1OPZA 4EUVA 2LSYA 4DV1J 2M9KA 3Q8SB 3W66A 2RKIA 3AVRA 4DUYT 1EP4A 2XMVA 2EHOD 1OEDC 2LCWA 4PK6A 2F63A 4B3SF 3MD3A 2CVIA 1N4LA 3NRXA 1VIOA 2P8IA 3VR9A 4HEA9 3TJ9A 4DPOA 1BE4A 1NCLA 1C2PA 3CT9A 2KL8A 4JV2A 4UOCA 3CCES 3RBZA 4U2YA 2GMHA 3PIPQ 4MTPA 4NRTA 3GG1A 1IM6A 1H3DA 2NR0A 1UCNA 5ITHA 2WMNA 2DYAA 5E3CA 4MBQA 2QGFB 4WNKA 4RW4A 3BBBA 3RF1A 5A76A 4A8MP 5HVFA 2CBIA 4RWXA 4IFYA 4OYKA 4NCGA 4ZVSB 1Q4RA 5F3TA 4IFVB 5IT4A 3ISZA 2ALZA 2FQQB 3TAMB 1RT1A 4CLLA 3O5TB 2XYPB 4WK1A 2YN6A 4IFYB 2HH7A 1OWAA 1Q8IA 1QY7A 1IM4A 1RKIA 2OJ3A 4FNHA 5AE2A 1F60B 2VC1A 1FRKA 4IKAA 2I1RA 4NEYA 3T1YF 2CWYA 2BW2A 3TANA 5IUXA 2F7VA 2NXJA 3J81Y 3EWGA 1U47A 2PSZA 2MKHA 1KFSA 1FJGT 3AEGA 4KX6A 1VQ4S 2UUBT 4JYAT 2RSQA 3K17A 1TL7B 1BMQB 2GA7A 2HWTA 3KG1A 4RW8B 3MWBA 4WFBQ 3N01A 5LSOA 3CCQS 2F8HA 3ZMVB 1U1RA 1VQSA 1WHVA 3GCWP 4Z7CA 3M2VA 3MR6A 4IOBA 3KG0A 2Z0GA 3RYLA 3K89A 4DZDA 2XQAA 2GJ2A 2QLJB 2CYYA 3RKOA 4DV7J 2PBIA 2YY3A 1V5IB 2DLRA 2BS2A 1VR6A 3JSMB 4ZVGA 1HPZA 2E1MC 3G82B 3DOMB 3ZPOA 2G1HA 2V5DA 1BY9A 2OHDA 3OL9A 1XNRF 1Y64B 1B0PA 2GIFA 3PO5A 2CQ2A 3W64A 4OV1A 1VQ6S 2HW3A 4N78D 2E9XA 5C2TA 4DR6J 2H54B 2MJNA 4MK8A 5KG5A 5J2PA 3Q86A 2BG9C 1Y01A 4EBCA 3PV0F 3NLCA 4JI3J 3T9NA 4IDKB 3HI2A 1QAIA 2FIUA 3BQ2A 1J5OB 5E3AA 3E08A 3MEDA 4RW7B 1R8PA 4X4QA 4BA9A 4LFBJ 6FDRA 2H9ZA 1M5SA 3KMSA 3X1LB 4U7UD 1ZAWA 4M5DA 3G6YA 3FSXA 2KHCA 2E1RA 1V9OA 3QNWB 4I64A 1NSQA 5LMUT 4X65F 4HH0A 2PE8A 2I5JB 4HFHA 3HKWA 2NR4A 2XC9A 3ET6A 4WXOA 3ILJA 4W90B 5B0GA 3TX0A 3HKDE 3RRKA 2RKIB 2OTJS 2JNJA 2NPFA 3CJRA 5L9NA 1KK7A 3GFYA 3V4MA 3CMQA 1S35A 1RHQB 5JR9A 3JYTB 3NMAA 3VKGA 2UUWA 4CQ1A 1V3RA 1OO0B 3NY0A 2W4DA 1NPPA 3M2RB 3S01A 1ZM3A 1PIEA 2X1GA 3N9LA 3B4DA 1F3VA 3I4HX 4B3MT 1UFWA 4H9SE 2VA3A 3CCLS 3J7Yq 3NWRA 5FLXU 4R5PB 2MSSA 1RP5A 3F31A 2VG5B 1PAEX 3UU4A 2F4VJ 1TAQA 3ZZRA 4Y34A 4V19X 1ZHCA 1S9FA 2B4VA 5ADZA 1IWAA 5AQGB 3ISND 5C25B 2H48B 2XCAA 3GWHA 4J5OA 1W2BR 4C91A 3RTVA 4P6QA 3FGVA 5J2QB 3JTPA 1TMMA 3NGDA 2ILZA 3DDNA 3RAQA 3P4QA 4GO5X 4IRCA 5CA5A 2UXCT 2YEVC 2AMCB 3PDYA 1OSDA 2JC0A 4DSIA 5CB4E 2W4XA 1WOSA 2KWHA 2UUBJ 3PJ9A 4NLUA 4JYAJ 4K7QA 3ZYLA 1B7YB 3ABVA 3L7OA 4JUZA 4H9QC 2XULA 2QA7A 4NXMJ 4K0KT 3IM9A 1VMBA 5ETMA 4EIWA 1A9NB 4DLGA 1IXKA 2CCQA 1UMJA 1HBMB 3BSNA 2DWGA 1SL1A 4PXDA 3AE9A 3EHZA 4ECZA 2MLYA 3SBMA 2UXCJ 1KF6A 3CNQP 4QW9A 2KFZA 2WRMA 5AE1A 3A7MA 5J2NB 3D1QA 1T7SA 5KG1A 3KOAA 4USTA 1WC6A 3HSZA 5HMWA 4D3HA 3HM9A 1M5VC 4O3RA 4DN9A 2HIQA 2VBWA 3MM7B 1HKAA 2D69A 5KFEA 2OLTA 1DFDA 4AYBD 4Y00A 2GO8A 3GIJA 3FBCA 4E0DA 3LK3B 1WFDA 5CYQA 1RBLA 3TYTA 1S48A 4ZVTB 3VU7H 5AFUL 1K9MT 3PEJA 1X0FA 2HGNA 4IDQA 3M8YA 4M1KA 3C15B 4USVA 4KR0B 2XGQA 3OUYA 5F9NA 4TYBA 2CXFA 1YQHA 1U1MA 4DX8H 2JLEA 3EUNA 3KXDA 2FGOA 4V1Av 3DDIA 2D3UA 3FCVA 2DNKA 2UUAT 4PG4A 4N47A 2CNKB 5DDRC 3MMBA 4ZP9A 2DITA 3AJ2A 2HRUA 3HVTB 2J4GA 1CC8A 1RABB 3PRVA 3SZ2A 2DHAA 4HHJA 1X4CA 2X9XA 3CF5Q 2LT3A 5DZ7A 5D4LA 3HPOA 1KTVA 2ZHAA 4NX9A 4QKNA 3AHPA 2KU7A 5CHCB 3AB2B 4EYUA 1ZEEA 4Q8FA 1VJWA 3OPKA 4P2SA 2C42A 3HULA 3L09A 5KT7A 4KGVB 4EYHB 3JYTA 2D0TA 2Y8YA 2VJVA 1JLFA 2FPHX 3U02A 4WYWA 4K4YA 1VQMS 1UVIA 1FDBA 3PXGa 4YR2A 4X62F 4KUMB 2LSKA 2ES0A 3MCMA 3G9CA 4NXNJ 5L3DB 3FRYA 5JJBA 1PC4A 2CQ3A 2CQBA 4PNIA 4IOAQ 5FXZA 3NG8A 5KFGA 3DLGB 3MD1A 2FJBA 3FBFA 1JX4A 2JPFA 3ZT7A 3IMQJ 2V8DA 1FRIA 4LREA 2DNRA 2B8QA 1GMVA 2B76A 4JI1F 4RW6B 1T9XA 1Y5NB 2HNZA 4KGZB 1QTNB 1RHJB 3LGHA 5IM0B 4NASA 3ICLA 4O4GB 1IBMT 2LEHA 2QVAA 2HNYB 5HEJA 2YQ1A 2DY9A 1BWEA 5GVQA 3PUAA 2FVRA 4LRFA 2MBGA 1HYSB 2Y8WA 5KDMC 3QGIA 1X5PA 3BDEA 3A12A 2H51B 2EFGA 4NOHA 2R7QA 3BN7A 5GADU 3QJPA 4F4ZA 4CI1B 2AJ0A 2LKGA 5HEOA 4U8VA 4YQWA 3C4XA 3K5OA 1WKJA 4U9RA 1ZTTA 4DQPA 3DHWC 1AT1B 3UO0A 2ACZA 1DU2A 1N5QA 4WJBA 2DR8A 4P75A 2EBGA 4OV6A 4KH0B 2CQIA 4UVAB 1VRTA 1KOOA 1U0SA 2WK4A 3MK7C 4DV7F 2K2PA 3SWHA 2KXHA 2UXDT 5K8MA 1NJYA 5DLGA 2DHHA 3RR8A 5KT2A 4OYZA 1T95A 1T8EA 2WY2A 3THPA 4NXMF 4DR2J 4NPOA 5E3RA 1PC5A 2ZM6J 2QMUB 2O3DA 1SIWB 5LXTE 2QG9B 1QE1A 3KLFB 1W26A 2XMTA 1J5OA 2KFNA 1LK5A 5I3UB 3BPSP 4CTAA 1UEUA 4ANDA 1RU1A 4DX7A 2SPCA 3H4DA 3Q2TC 2XY5A 2UUBF 4JYAF 4IDNA 2ZNYA 3TEGA 1JLQB 1RJJA 5IFMA 1TL5A 2CQ1A 3M32B 3CWZB 3M8PA 1C0TA 2M0GB 3LK2B 4PJJA 5KT4A 3UU8A 4KE5A 3J7Z5 3U7JA 1F9FA 2CQ0A 1WOOA 2YDQA 2QZ8A 5JH7E 5HEGA 4OHXA 4C11A 4PG5A 2DGUA 1B0TA 1TKXB 3NGSA 4Y2MA 1OY6A 1NDKA 3CMES 3R5DA 4YY3F 3N5LA 1W09A 2LE8A 2NXUA 4G6VB 3M2UA 4ZXLA 1DURA 5EK2A 1UKUA 1JK9B 1IJ6A 2GQCA 1S57A 3OJSA 2IYGA 3M8ZA 3NWIA 3ZCJA 4M5HA 5L4HA 2J6UA 2N2NA 3M6VA 5KG7A 2WWUA 2BVZA 2RHQB 1JJCB 3EUHA 2Z2YB 3I87A 3T5KA 3QQCD 2G1DA 2VBXA 4YJ2E 2A0FB 1RWOB 4ELTA 3LWLA 5L4EA 1FFSB 3R9LA 3ZYKA 2XTJP 2YWHA 4PQUB 5A8WB 1FWLA 1YIJS 1MIWA 4O2AE 1NBEB 4FNIA 2CQHA 4NMLA 1HD0A 3DOKB 2LDIA 4NLRA 1N36F 1MMGA 5HO4A 3UN3A 2ZLYA 3CVKA 5DG9A 4AL6A 4UVBB 3CX6B 2MQLA 1UJ5A 2MJUA 2EW9A 2QLXA 1DQ9A 3JAFA 4LMKA 2P6SA 3AT1B 4NZ6A 3HK2A 1LKZA 4DFPA 4YOEA 3WC0A 2PGCA 2ZUGA 2KWIB 4P74A 4DV2F 1OEDB 2AGOA 1JWWA 1DJ0A 2CADA 1M1HA 1WC5A 5DS7A 3S6EA 1WOPA 4IL4A 2YKQA 4ZPAA 3QJJA 2J9DA 4GKJJ 3ENWA 3ANWB 1PAUB 2HBYB 2CAJA 2CG8A 2JRSA 3W5ZA 1NB7A 2KFYA 6FD1A 1FRLA 4U95A 2AEMA 1U0HB 4AUKA 2H5EA 2IBOA 3C66A 3MFIA 1QD1A 3DKDA 3AE1A 3M9OB 1YRTA 3KDOA 1SV5A 5AQLB 1L3SA 2G13A 3H2LA 4YHHJ 1FRXA 4ECWA 1EETB 2C5KT 2EVZA 2HSEB 4ILLA 4V1Ak 4FF2A 1YLXA 2DNPA 3CO9A 1REGX 1WEYA 2DXFA 5GAEI 2M2BA 4ER8A 3CD7A 2V8SV 4AXPA 5DJQC 1HMVB 1TK5A 3M30B 1VC6A 1VBKA 2C2DA 1N5SA 3MF5A 1E6YB 4TZ4C 2C2KB 1P8GA 4ZLNA 4DWIA 2V6YB 3LTOA 2BOPA 5J2MA 1UL3A 2P9GA 1HR0J 5LSRA 3EXYA 4MMOA 1RI7A 2LRKA 5I42B 4K4ZA 2WVBA 5KFPA 4U33A 3DLEB 3UD5A 2W61A 2LSIA 1GMUA 3MR7A 4H4MB 5HEUA 1S94A 4JEHB 2DGWA 3AAEB 2IM3A 3AE5A 2IC3B 1HNXJ 2A2DA 4F04B 3M8WA 3DGPA 2KMFA 4A46A 3KLIA 4HI2A 3FFIB 3DHXA 2FB0A 3IBFB 2XYGB 2JDJA 3ETMA 5KFZA 5KG2A 2ZEJA 1UWBB 3P6YC 3AOAA 4X4NA 2E9XB 1VGYA 2XAGB 4QW8A 4O44A 2EFVA 3Q9DA 5F41A 2VBYA 4ID5A 4Q5VA 3LG7A 1AZSB 2M7SA 4AT1B 5LG3A 2B0GA 3HT0A 2LXIA 2XHCA 2BRLA 4OYMA 2W7AA 4RNHA 3RI5A 2FLLA 2L8KA 2VQFT 5JDNA 3C3LA 2IM2A 4O23A 2CXLA 2ZBCA 4NA1A 1HNZT 3SI8A 4A48A 1EIYB 1LQ9A 3P96A 2E5LT 2WWVA 4DSEA 4YB7A 3L4BC 1HD1A 3C14B 4UUWA 2KB2A 3TUIC 4ZIVA 3BKFA 1T98A 2RS8A 4KAIA 4YSXA 2C2OB 5CCLA 2CJQA 3U27A 2KXNB 1HBNA 4I6WA 1RT7A 3VKHA 2VG5A 3SQOP 3T5LA 3OYXA 4CNZA 4RW4B 2HK3A 2AXDS 1N34T 1PO6A 2X0YA 3N9NA 1LXNA 1HLWA 5JRCA 2J47A 4OYWA 2E5GA 4JV5F 5FLXY 4WKRA 2RQMA 4CXWA 5L3FB 3SCIE 4OX9F 1T94A 3FEXB 5DGBA 4LSNA 4L6V3 3QIPA 4PXCA 2R7SA 2VPYB 4O4RA 5F0UA 1KQSR 1NZ8A 1S0VA 1UPPA 1YD8G 2OPRB 1A6LA 1M5KC 3TZXA 1LWCB 4Z90A 3NP5A 2VG7A 1CJTB 2GS8A 3TLTA 4PABA 3TZWA 2VBZA 3IA3A 1RCXB 3KK3A 2VH7A 4AXIA 2W9BA 3U1NA 2ZBRA 4OJ1A 5KFQA 2KZ7B 2VL1A 4FP9A 3AVSA 1CSJA 5LP6E 3CJ0A 2OPPB 1S77D 4XBFB 5A1LA 4TQRA 2K48A 2OEKA 4CXXA 2CQGA 4OLPA 3RIFA 3RB0A 3PYGA 1FKOB 3UR0A 3ZZYA 2EC2A 2DISA 2B7BB 4HVZA 4DV3T 2CUYA 3ZJ1A 2W4PA 1S9GA 4A8WA 4GVLA 2DGQA 5LJ3Y 2DGXA 4X4UA 4O4JE 3Q5XA 4YFSA 4CN6A 3AOBA 2CZ9A 1ZZFA 5FVKA 1FDAA 3GIMA 4PAAA 3KV6A 2NW7A 5K9FA 3TKLB 4CI3B 2BRKA 2PFDA 2GV1A 2L9WA 2O67A 1LV5A 3I0RB 5DO2A 5K14A 4DR4F 4Q44A 3BH7B 4NLTA 4NUUA 3RJMB 2WMOA 1MN7A 3QGPA 4CIOA 1T03A 1APSA 2FBWA 2V26A 2F65A 3R5CA 2IRUA 2HS4A 5L8RC 3MM6A 4WW0A 3HVWA 2MKIA 4DU7A 1U1OA 3FZFB 2HK2A 1HBUB 4B3MJ 5DM6Q 1M7KA 3BR8A 3GR0A 4HDGA 5E0OA 2GVZA 2LLYA 5AQQB 3MPYA 4P2XA 1F1BB 2UVVA 4LFCJ 1R0AA 4TVAB 4Q0BB 5IHYA 1MMLA 4YB5A 4YMEA 1Q53A 2HFZA 2LVWA 4NL5A 3M65A 4FYWB 4PXBA 3RHWA 1KONA 3EPGA 2V0NA 4FS1A 1DLOA 4DR5J 2CPIA 4E7SA 3HLUA 3IRWP 1HNZJ 2NCKL 1VQNS 1AUDA 4NLWA 4H9RC 3FZ2A 3RIAA 2D41A 3LA0A 3MPWA 2AP6A 1S4FA 4MKBA 3OLBA 3AA7B 3CB4A 1FO1A 2LKHA 4ZDNA 3OHBA 2A6OA 3BZQA 5FMNA 4YUDA 1I51B 1NK8A 1X31C 1BQNB 2J0SD 2MQPA 2WB1D 2MXYA 3P49B 2VOPA 4KV8A 3AXMA 4C8MA 3MHYA 3CCJS 4DS4A 2ZWOA 4B9TA 3FXDB 1R27B 1OSCA 1ZA2B 2VL0A 1XDOA 3FEYB 4KQZA 4EBDA 3D5MA 3RYIE 3W60A 1HQUB 4JI8T 1QJHA 4CQIA 2FD2A 1FMVA 3ENVA 3UUBA 3ILOA 1J1JA 4LVNP 3T5HA 4K5SA 2LXFA 2BANA 4Q25A 3R3TA 1X9WA 3KFWX 2XS7A 2O66A 3EPIA 2W9BB 2V6XA 3CPZA 4UF4A 2EFQA 2KT9A 3D1HA 4Z37A 4IL9A 4CLFA 4ZA1A 2CPXA 2C1EB 3CJTA 2HQ3A 2EHOA 3AA1B 1H72C 1JLGA 2Z2MA 1WUUA 1HWUA 4MK9A 3DLHA 1T11A 3KUEA 3C98B 2HAIA 4USUA 4PJNA 2B3TB 1C0UB 5DABA 3SS1A 1UWAA 3J7YU 3MUMP 1WEXA 3K57A 1JJ4A 1NM2A 2OMOA 4O4HE 3MUVP 2OGUA 3CC4S 4KKOB 4KI0F 2V50A 1IR0A 1FTCA 2ATLA 4E8UA 5H9EJ 3M2VB 4BBYA 3N9MA 4PG6A 3RG6A 4ISSA 4MIWA 2MPKA 2F9DA 4TQSA 3G8TA 3MR5A 1N52B 4ZVUB 1RSCA 1UEVA 3HCXA 2XGPA 4KP3C 3BR9A 3MTJA 2OA5A 1S1VB 2XLKA 3N5FA 2W9CB 3HKZD 3ZLIA 2BDPA 2XMKA 4KFBA 1N48A 1DY3A 2XMUA 1RHMB 3RR7A 4J9OA 4NYPA 1MIVA 1VHIA 3V6DA 1X9SA 1IBLJ 2V63A 3KLIB 1DTQB 1EARA 4OZNA 1B0VA 5RUBA 3MOZA 2DNQA 1WACA 5KFJA 2Q79A 4G65A 2J5AA 2CMRA 4ASKA 2B6AB 2MQOA 5ETWA 2QA2A 5C2GA 3MZKB 4GRSA 2DH8A 2ZVIA 1OS5A 1RA6A 3GWCA 4D3GA 5KFTA 4R0JA 4O0IA 1RT5A 1Q78A 2D5UA 3HSDA 2GIRA 3BGUA 4PJLA 5ABEA 4TNVA 3RUBL 2Y1LB 1WHWA 2HPLA 4OYBA 3NRYA 1XMQF 1NKBA 1RK8A 1NHUA 1DTTA 3DLJA 2YH0A 4LFBF 1UZHA 1ZBTA 2QLBB 4JV5J 4J9QA 7FD1A 4CT8A 1QVGR 4CCHA 5IWAJ 1JKHA 3GN5A 3OTEA 2IC6A 5HMZA 1AUSL 4DVDA 3AH6A 1H2TZ 1SXLA 3TR5A 2FJBB 2VUGA 3KDSE 3UW1A 1FXRA 5EZYE 3TUPA 2X3DA 2M70A 2Q6BA 4ZI3D 5GAHU 1VCTA 2LOPA 5CFBA 3Q8UA 5KFCA 4NXNT 5JTGA 3DI6B 4OI2A 1GQEA 2BQ3A 4JI0J 2DJWA 3J7AN 1KFYA 2AV5A 5KFRA 4KB7A 4EMDA 4IH6A 2XUEA 3M30A 3HZGA 3AA0B 4NXNF 4LSNB 1JB0C 2I8EA 2NSCA 4OYPA 1WORA 3W8GA 2H89A 1JXEA 3LP2A 2FJEB 3PUWF 5ETPA 2QIFA 3SQGA 2HVHA 2FHJA 4OHVA 2HBQB 1HQEB 4XIUA 2I2YA 3D1OA 1NWMX 1NXIA 5AXMA 4WWSA 3LUYA 2MZ1A 3S4UA 3NWGA 1TV6A 5AQRB 5HI7A 3I0OA 5ETLA 2ODVA 3ZTSA 3PJWA 4NZ0A 1X7VA 4DV4F 4P0BA 2DCLA 4JBCA 1U6BA 2CPZA 3CQGB 4KPYA 3CJQA 2MGZB 5LXRA 4B9MA 2KJVA 4A8QA 4M63A 5A8RA 1S9GB 2CJYB 3MR3A 4ALZA 5DQWA 4EWTA 1SH3A 2BACA 1HNVB 1WF2A 3DTOA 5J1EB 4PPDA 1RWVB 5T14A 1U1KA 3N79A 2AW0A 1GXUA 4I6AA 3D0IE 1JJHA 4CM0A 3U1LA 4LRBA 3OXGA 2DH7A 2PI4A 3H20A 5LBMA 3R97A 2F3JA 4NLXA 1HX1B 4L76A 1JNZA 5HBMB 3ZC4A 2YX4A 3ZFVA 2D7SA 1REVB 3JTNA 4CNYA 1VBXA 1RYRA 2ABYA 3OL7A 5JDQA 1NJIT 1U1QA 1X8DA 4IGUA 4X2BA 2UP1A 1EB0A 3IGVA 3WAKA 1HWIA 1H6KX 4DQSA 4OIXA 3FZBA 2EPIA 4DXLA 5J1GA 1BQMA 3R7BB 3LH2S 5HMYA 4TWFA 3FEZA 1WYCA 3I32A 3BGRA 3W62A 1FRMA 5LGUB 2FHKA 2VQFJ 3EM1A 3DOLB 5IV3A 1F9HA 2B4OA 1DRZA 2ACMA 2VPZB 5CABA 5EGYA 3EVWA 2BJ3A 3ZZTA 4UOHA 3TNVA 5THWA 4ZHQE 5KX5E 3QRRA 2R7RA 4IRKA 4QU7A 5IT9U 3TQ1A 3PIOQ 5F8LA 4UF0B 1R0BG 1PSDA 4DPWA 3DN9A 3MAAB 5JR9B 1YWXA 2Y0SD 2H4YB 3KHGA 2MZTA 2W2NP 3FMWA 3WHIA 1SL0A 3IM8A 1AYEA 1GTEA 4RU2A 1N36J 2YK0A 2MZJA 2Z57B 2JVRA 4C3MA 4QYZJ 3NXZA 1XNRT 4IHJE 4OZLA 4IRDA 2DKOB 3G87A 3ZYMA 1RACB 3V6KA 4GYSA 2GK9A 4B02A 2W66A 3JAMU 3M6XA 2JMHA 5G4DA 2XWXA 4UOGA 2I6HA 3MM5A 1CS4A 2XY7A 1Z4UA 1BLUA 5CA1E 2E1AA 1QUUA 4LVOP 3K59A 4YB1P 4DV0F 4UV9B 1MMDA 1VQOS 2BJDA 4ZCKA 2RS2A 5HK4A 5FY1A 1O6XA 3R6GB 5T7LA 2LLZA 5JUMA 2H88A 3FZHB 1BQMB 4RU9A 4PWUA 2B1EA 3A8IA 4Y65A 1GTHA 4UT4A 3KJQB 5D0EA 4CZCA 1IR1A 3KBTA 3I0SA 4QX8B 3LAKA 4IG3B 3GB0A 4CLTA 1X4DA 1PJ5A 1EHWA 4LBIA 1RAGB 3ETUA 4F0MA 2IY5B 2BJEA 1FJEB 1AA1B 2LMIA 1VOMA 1RTHB 3TAPA 3F2EA 3BREA 2GCFA 2LDYA 2XM3A 2ATCB 3JSYA 1ZM2A 2E9XD 4R8UB 5HJXA 4Y28C 3I5AA 5DRKA 2ZM6T 1KHVA 2HHWA 1KOHA 3FB2A 1CBKA 4DMWA 4O3NA 4ZLJA 2XM1A 3AEBA 2F8MA 2GX8A 3GJRB 3ZZOA 3AE7A 4NMXA 4H4OB 2B56A 4TU9A 4YHHT 2XSJA 3KLGB 2X9YA 1UA1A 1ZP0A 4RNOA 3OR1A 4TYAA 3DRRA 4ANEA 4B6XA 1XMBA 4F6RC 1NK5A 2DRBA 5H6QB 3PJAJ 2VKHA 1TELA 4DN0A 2MB0B 2FZKB 1VC0A 2ZM6F 3MM9B 3K5NA 3L3CA 5EK4A 4IE7A 4F3MA 1FKPA 3ONLC 4C48A 3TJAA 4HDHA 2C2EA 4B3TF 2X3GA 2NWBA 4KO0A 4QBUA 5FD1A 1HBMA 3FVYA 3KLFA 1J2VA 2DBBA 3DU6A 1LEOA 3PRDA 3R5GA 4X4RA 2AX0A 2AQ4A 4I2QA 2J0WA 2CHOA 1BXNA 5KFSA 4U2ZA 1R8CA 1Y5IB 4HR2A 2GVZB 3UCGA 3E01A 2HHVA 4PJMA 2J7UA 3Q8RB 4LF6T 1T9TA 4NRUA 5F3JA 4PG7A 1K0TA 4ZS3A 1TUVA 2DHXA 3UN5A 4BAYB 1P1TA 5E3QA 3AEEA 4WCEQ 1S6OA 3FCHA 5B0EA 4I4TE 4J9SA 1ZPWX 2DNOA 5I3PA 1OPIA 1Y3KA 3BSAA 2QA4S 4AQFC 1U6ZA 5KFHA 1N6QA 2WZHA 4WP3A 1S10A 2I5JA 3MPVA 3IR5B 3GFXA 3N5BA 3FQKA 4DFMA 4Q45A 2UVUA 3OFHA 1XWMA 2NW8A 3ZMZB 1LWCA 3S7RA 4M5IA 2J1DG 4CZZB 1LWXA 3KLGA 2ZM8A 1YK9A 3VAJA 4IUFA 2V5HG 4ZP7A 2QO3A 3R8YA 3UCUP 4X84A 1KKHA 3KV9A 2ZOGA 2OPSB 2ZHBA 4I56A 2D0UA 3ETVA 2D9PA 2BYCA 1HNWT 1XWLA 5HWXA 2B5JA 1EP4B 4IQMA 4IG0B 1BWVA 3IBWA 4ED4A 5KFVA 4FVCA 4ED5A 2EFPA 4WZXA 3T9ZA 1WNEA 2WZIA 3I6PA 4GC7A 4UTGA 3NOGA 3GV7B 1FIOA 3AD7C 3I31A 2JLGA 2OFHX 4X4TA 1SJ4P 1Q8LA 5LA6E 4OZ1A 4EZHA 3FBBA 1Y10A 2JSXA 1NEEA 4A97A 3D67A 3GSIA 1TUGB 5D4PA 2J62A 3ZN1B 3OFEA 3MCNA 1FERA 1VJQA 4DPUA 4QH4A 5EN1A 1ACMB 3PJXA 4WU3A 3LALA 5J1NA 2YNFB 1TVRA 5HVGA 4U7IA 1RLCL 3CCZA 4MKYA 2W63A 3QGHA 4OX9J 4Y2AA 3IAM9 1SV5B 3CC7S 4ZCIA 5LGNB 2XMMA 3R1LA 1WF0A 2XAQB 1GX6A 5HXEA 3GIKA 3C6TB 4WKYA 1EETA 3PRBA 2BE9B 3UI3A 4CDIA 3ENAA 4LRAA 3QSIA 5F8MA 3KYLA 1N32T 4GC6A 3EYZA 1KLNA 2JQQA 1PGZA 4O3OA 4LF7T 2DO0A 4RWWA 3A8EA 4IH7A 5IC6B 4EGWA 1R7IA 4RBTA 4C7QA 4LUBA 2HZCA 2GAHC 3ONQA 2J8AA 4G1PA 3LDQB 3CQXC 1P9QC 2ROGA 1S0MA 2DVIA 2PO4A 5KFDA 2FVCA 3VAHA 2BJ7A 3GTYX 2CQDA 3GU0A 1TKTA 4X64F 1R8HA 5AXLA 1JLCA 4F25A 1DLOB 4PCQA 2R42A 3NKYA 1IR2A 2HLTA 3S8SA 2H65B 3GSDA 4J9UE 3T41A 3C16B 3D66A 1CJUA 3CC2S 4I6YA 3QT7A 4QCLA 1RA7A 1SBRA 2IJFA 1Y5LB 4DV2T 2CLYB 3C64A 1CJUB 3MFHA 2AJQA 3AXJB 4ZITA 2W4CA 5DDPC 2COLA 4RBVA 1YJ9S 1SPBP 1S9EA 3H2VE 2V4JA 2DGSA 4QIVA 3HF5A 3PG9A 2RJZA 1FF2A 4U8YA 4DV6J 1B3TA 4B9SA 2JZ5A 5BXIA 2YX1A 4NI2B 3UU6A 3CD6S 2VFUA 3A3OB 2QLFB 2JEFA 3CJ5A 4CT9A 2JEJA 4DCPB 3LWMA 4Y3CA 2KT3A 2G0IA 4TWDA 4I0WA 3AAAB 3C19A 1S72S 2VWAA 2R8GA 3BGLA 4JI2F 3DNCA 2XQ8A 1FK9A 3FQLA 1UJ6A 2IA6A 3J80Y 1HNWJ 4PWDA 3Q23A 1S7IA 3O44A 5A6WA 4ZCMA 1C1CB 1Q86T 1FFGB 3EDRB 1X5TA 3L8RA 1MNDA 3T1HT 4UY8T 5KFIA 3LP0A 2G9OA 1JXLA 3PCOB 4OI0A 1CHUA 3QRQA 1UPMB 2V9WA 2XI2A 1B70B 2CJAA 2K8GA 4YXDA 1OXZA 1EQMA 3DLGA 2XY6A 3PY8A 4DUZT 3MR2A 4OZ5A 4KPCA 1RAFB 5JQGE 3QFHA 2WCAA 2R2UA 4ECQA 4P10A 2PFFB 1RTDA 2E8IA 2L9NA 2ILYA 2EK6A 2V1DB 1VQ7S 3QNUA 4R5PA 2NXCA 5BMVE 1YBAA 4WK3A 5ETSA 2DXDA 2YNGA 2B9WA 3PX6A 2VOOA 1AROP 4ZZBA 1G6BA 2YKMB 3UQ4A 4AQYF 3H5SA 4PG8A 1M5OC 4PUOB 2HFSA 1WJ9A 2V2ZA 4KJIA 2V6AA 3HJVA 1Q7LB 1WTFA 2AD9A 4EO8A 1Z2ZA 1CULA 5BYSA 4FYYB 2KNDA 3T19A 2HWHA 5JDLA 2QYGA 5JDGA 5JDHA 2Z2ZA 2CM0A 4I7FB 1KFDA 4HFEA 3HJFA 2GMLA 4NLPA 1TL1B 2IBKA 3G6VA 1D9FA 5H9FJ 3MKDA 1EKRA 4QX7B 1U7LA 4X1YE 2OTLS 2RDDA 1X60A 5IT9Y 2DCUB 1SC1B 2VF3A 1D09B 4JBWF 3UE2A 4TU7A 4DHVA 3HMJG 2V8VA 1FJGF 3ZMSB 1YG0A 4L3NA 4X20E 3UT5E 3BBFA 3LAMA 1RWWB 3QLHB 4QIGA 1QAXA 5IOLA 2ZH5A 1FKPB 2ZITA 2B51A 2BQUA 2HHPA 2BBJA 4HACA 5LOQA 3CVRA 3WIVA 2O1PA 2HHHF 2R2RA 2BG9E 4ZJLA 4O3PA 4KHMA 1IVZA 3HSJA 1ZA1B 4F67A 1QSLA 4H4MA 4O8SA 3H98A 3JADA 3KKFA 2WM9A 4AI6A 3MXZA 2WZ1A 3NGTA 1R8BA 4X4VA 5BR8T 4TXSA 1K0VA 2MQNA 4H9OC 3KK2A 2IW5B 1CJKA 3JQKA 4TN7B 4F7VA 3A5XA 2C2ZB 2Y9HA 1T9YA 2GQQA 1RT2A 4O4IE 1DQAA 2OELA 4JEUB 3ZJ2A 2ZE2A 1S49A 3OV7A 3B82A 2K3WA 2GIQA 1UAWA 4IE0A 1P1LA 1RUSA 3KHLA 4WE1A 1N32F 3R6LB 4DFKA 3Q0AA 3UTKA 2LU1A 2VFSA 2FJDB 4P2MA 5LMUF 4CLSA 5HXRA 1WI8A 3KDNA 4OJ3A 3UR3C 1T3NA 1RT1B 4DSJA 4XDCA 2K5BB 3UFCX 1TVRB 3M7VA 2BVMA 1NENA 5IM0A 1U2FA 2HKEA 1RT6A 2WVFA 4DMVA 1UJ4A 1O5JA 4DL2A 3QB5A 1NEKA 3M1VB 5FXWA 2FJVA 2GC8A 5DDQC 2LECA 1NHVA 1W7WA 1S6PA 2KH9A 3ZZPA 1BC6A 4L73A 5JRCB 2IIHA 2KZMA 2EKNA 2I6WA 4X5TA 1PJ7A 1T9WA 2RQ4A 2HHXA 4JOUA 2RMLA 4UXNB 9ATCB 2XO6A 2M6IA 1DARA 5GMDA 3Q5EA 4DL3A 3HKBE 3B5MA 1M62A 1OQ3A 2LQJA 3PHTA 2H4WB 4ILAA 1RZMA 1WSVA 2JLFA 3NGKA 1XR5A 4LF1A 2WSEC 3KG4A 1ZETA 4W92B 3GMIA 2FUG9 3O4XE 1FD8A 4EGLA 2XQ6A 5I4MA 4C4WA 1N88A 2Q9QB 2E44A 3K2YA 3HHNB 3CWJA 2AEFA 1HBOA 1V5VA 2R7VA 1FDNA 4M5MA 1WG4A 4ANCA 2FJAA 3KK3B 1KTQA 2MYSA 1HQUA 2WP9A 2DGTA 2KTQA 5GAGI 2DNLA 1NO8A 2IAJB 4ILMA 1G8XA 3O2IA 2J9EA 3NBPB 4IOCQ 2NS1B 1Y3JA 2JRKA 3L95X 2XLJA 3G96A 5HROA 2HQIA 5AQOB 3TLSA 3VGUA 3BYRA 4XK8C 3L9ZA 4DR2T 4ED7A 3H5UA 4MIAA 2CXEA 4P71A 2VDIA 4TY9A 4IH5A 2B43A 3NNAA 5T41A 1IKWB 4BCAA 2W0GA 2RRNA 2LM9A 2ZHOA 4KRWA 4XO0A 3ZMTB 3E3XA 3Q89A 1HMVA 4XAXB 2XJ7A 4YJ3E 4PYDA 4X66T 2YWFA 4WP8A 5L38A 3I9WA 4GOUA 1KD1T 2K7KA 2XEXA 3OTDA 4CYUB 1MIYA 4ICLB 1JNRB 3B78A 2ZOMA 1C4CA 4Q2LA 1PG5B 3ETOA 3BSOA 3WIUA 3I9YA 2X1AA 3WZ0A 3HHLC 4EAHA 2KRRA 5L47A 2VQEJ 2EEYA 2AYMA 4X64J 5KFWA 3QATA 2R4FA 5SZTA 1S1TA 2W2PP 2C2MB 4HWFA 2Q1LA 1R43A 1RADB 3KNAA 1KC8T 3G8QA 5F3ZA 4KFBB 4LF4T 1FRJA 1RDRA 4MH8A 1Q7YT 3I96A 4DG1A 3KLHB 5FJ4A 2UXDF 2XQ9A 4EU0A 2FZGB 2MLZA 1S6UA 2AZ1A 2HZVA 3LK42 2YU1A 3O8WA 3FSIA 4LF8F 1S1XB 2BV3A 3D2WA 2AJ2A 4ZI2D 2XTLA 2JC1A 4WE1B 3EGVA 5HROB 2GMJA 4EEDA 2NYIA 5A2QU 2AGQA 1N33J 4N8OA 1I94J 3V81B 2DO4A 5DQHA 1XC9A 2XCPA 1G73A 2KRBA 2PA8D 3FXEB 2EFOA 1VYAA 2VL8A 3ANWA 1FNOA 1UX4A 4DV6F 3I0SB 5LYJE 1SQFA 1NSKL 3K8WA 2V8GA 3SOLA 2CQCA 4JV0A 4NWBA 3ZSSA 3RLFF 4K2XA 4IYQA 4OYOA 5D0HA 2N3OA 3P5TL 5KFBA 4CO0A 5KG6A 3K8PC 1U49A 4Z8XA 1UVKA 2GHVC 1TU0B 2DR7A 2CPJA 5HP1A 4QR0A 3RQUA 2V8PA 4R25A 4J91A 1WI6A 4IDOA 2RF2A 1B99A 2B9EA 2NQPA 2HS3A 4QZVB 2VU5A 3KK1B 2VFRA 2GJFA 3FKBA 2LSGA 4WFNQ 3LP0B 2XAJB 4B9LA 3FDSA 3Q8VA 2C5JA 1U02A 5JVHQ 9RUBA 4AFFA 3BGFA 3AE2A 2X0LB 2HHUA 3BV8A 4PQUA 3MZIA 1NLKL 2V7IA 3G6ES 3TARA 3MEKA 3K5LA 3K3OA 2MTQA 2N82B 4NPPA 2HURA 2HNDA 1RBAA 3AOCA 2F40A 3TZYA 2OPRA 2QJ3A 4HKQA 3DLBA 2IDOB 5CZVA 3MDFA 3KLEB 3VHQA 4ZLPA 5LJNA 3NCPA 2A2FX 3W5YA 3VAKA 2BANB 4ZK7M 4WYVA 2B9XA 1S12A 2KINB 2K1RB 3IG1A 4Y0FA 3JAEA 4HL9A 2QL5B 3H5XA 3KLVA 1R0CB 4UQTA 2K3KA 1F5CA 4QWEA 1MG7A 1XN9A 3E51A 4AD6A 1WKLA 5H9FK 2EKYA 2V69A 1UZDA 3EMTA 4JI4J 4KMCA 2WOMA 3P4WA 1NUEA 2HG4A 2HGLA 4A5XA 4HACB 4U72A 5E3PA 4J9RA 2VKDA 4FVMA 1HF8A 4Y2CA 3EDQB 4X64T 2IMWP 4RNFA 3PUQA 5J2UE 4ECSA 4FXVA
chains in the Genus database with same CATH topology
2BKOA 3RBZA 2AEJA 1SUMB 2OGUA 2BKPA 2AEMA 2FY8A 4J91A 3KXDA 4J90A 4J9VA 2IIUA 4YS2A 4XTTA 1VCTA 4GVLA 4G65A 3JXOA 1LNQA 4L75A 3L39A 3RBXA 2AEFA 2BKNA 1T72A 4L74A 3L4BC 4L76A 2OLTA 4L73A 4J9UE 4J7CA 1XWMA 4RO0A 4Q25A 2I0MA 1T8BA 4EI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKO A;  3RBZ A;  2AEJ A;  1SUM B;  2OGU A;  2BKP A;  2AEM A;  2FY8 A;  4J91 A;  3KXD A;  4J90 A;  4J9V A;  2IIU A;  4YS2 A;  4XTT A;  1VCT A;  4GVL A;  4G65 A;  3JXO A;  1LNQ A;  4L75 A;  3L39 A;  3RBX A;  2AEF A;  2BKN A;  1T72 A;  4L74 A;  3L4B C;  4L76 A;  2OLT A;  4L73 A;  4J9U E;  4J7C A;  1XWM A;  4RO0 A;  4Q25 A;  2I0M A;  1T8B A;  4EI2 A; 
#chains in the Genus database with same CATH top