1VCTA

Crystal structure of putative potassium channel related protein from pyrococcus horikoshii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH0236
total genus 69
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 1vctA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 1vctA02
3KXDA 3L4BC 2AEFA 4J9VA 2OLTA 3RBXA 4J9UE 4G65A 4EI2A 1SUMB 2IIUA 1VCTA 4L76A 1LNQA 1T72A 3JXOA 3L39A 2OGUA 4J90A 2BKNA 4L74A 4Q25A 4L73A 4XTTA 4YS2A 2AEJA 2BKPA 4RO0A 1T8BA 3RBZA 1XWMA 2BKOA 2AEMA 4J91A 2I0MA 4L75A 4J7CA 2FY8A 4GVLA
chains in the Genus database with same CATH superfamily
3CJ4A 2C2RA 2QRRA 3MJXA 5FLXY 3D54A 4NLUA 4DR2J 3HSZA 4AKIA 3OYXA 1G7CB 3AAAB 3OTDA 1N6QA 2V8DA 1AROP 2YX7A 2JEFA 1U4BA 5M2UA 2BKPA 4IO1A 4AD6A 3WHIA 1BQMB 3ZTOA 1NHUA 1RE1B 4YXDA 4RNFA 4P2FA 2C3OA 1VBYA 1SUMB 2FVPA 2X3DA 2AZ1A 5BXIA 3PUZF 4CP5A 3LPEA 2KRRA 3B82A 3CCLS 2DNXA 3L8RA 4YSZA 3M2UA 2KINB 1XR7A 2XO7A 2AYBA 4O3QA 5DLFA 3TJAA 5ETPA 3MEGB 5G4DA 1RHRB 1UFWA 2FVCA 2B9EA 5C24A 1BGXT 4F04B 3S1TA 3V81A 4IOAQ 4A8YA 3W8PA 2LFVA 4LRAA 4IO9Q 3LANA 3T1HT 3W66A 2DLRA 4TU8A 3UD5A 5JQGE 2IAJA 3MR5A 3NGTA 2NCKL 1RHUB 4IG3B 2XM2A 2V7LA 5AQSB 2XAJB 2A6MA 4JI7T 4G2AA 2ZUGA 2PGCA 1NJWA 3L7UA 3ZCIA 4ERRA 1ZOTA 2RHQB 1R8BA 3OFFA 5D6GA 4WZMA 4C9DA 3J80Y 2WCAA 3IWNC 3UU5A 5E33A 2WSCC 2KXHA 5SUHA 3KK1A 3CWJA 2XS2A 2A18A 2BE2B 3K58A 1P9QC 3P6YC 2V2ZA 3RYCE 1Z8UA 4DV0T 4CI0B 3RIFA 4OZ0A 2AGOA 3HVAA 3TLTA 4LMZA 4C98A 5HXSA 4OL8A 2X51A 4UQGA 2VQET 3FSIA 2J0XA 2DGXA 4YTPA 2D9DA 5CYQB 3O6QA 1BE4A 1PCAA 1M7KA 1FRIA 3LALA 3W8GA 1YJ7A 4Y34A 4B08A 2KTQA 4CNZA 1WSVA 3FBFA 5AJ3J 2XI2A 1M0SA 1RA6A 4X66J 3THVA 3DRSA 1UMJA 1N33J 4EYIB 4ZP6A 3L7PA 2MDAA 1VQSA 3AXKA 4ETZA 4ZVQB 1T9UA 1R0CB 4PCQA 2C3PA 3HLUA 1JB0C 3HULA 3AVSA 4PXBA 2XLKA 3ZKRA 5JRCB 1IVZA 3QC9A 4QU7A 1YSJA 1AYEA 3M4XA 2MKJA 2JFKA 1S12A 3KK3A 2POKA 3OTBA 5B7WA 2YKOA 2KI2A 4YR0A 4A8MP 3DOKA 2OMOA 3SCJE 1S6QB 3JAEA 5KFBA 1IJFB 1V6HA 2E5LF 3VRAA 4FN5A 1KR4A 2CPFA 3QQCD 4ISSA 2WP9A 3G8QA 5HMZA 4DR4T 2KJVA 3RR7A 3IO1A 3MCMA 2HHUA 2D0TA 2DR5A 2CZVC 2DHHA 4NLOA 5L9NA 4WTOB 3KUHA 1F9FA 2H65B 4AQYJ 3PX6A 4CDIA 1JLCB 1VLOA 5JVGQ 3IAM9 3R1HA 4DN9A 1AFJA 2ZH2A 2OD4A 1FESA 2VC1A 1KOHA 3DYAA 4WBFA 2XB2D 2UXDF 1P6TA 4LQ9A 3MMCB 4ANDA 1BY9A 2DNYA 1JNRA 5F8MA 4LF6J 3RAXA 4LRCA 2QJ3A 3P4PA 4IQXA 3M8QA 2AMCB 2CXDA 3NRBA 4FKYA 4DHVA 5KG5A 2D3O1 5F0WA 2JPFA 3LGNA 3PX4A 1S49A 5KFCA 3RRGA 3N6MA 1F3VA 3FVYA 2JVOA 3ONLC 4ECVA 3VQTA 1RWWB 5SZTA 3Q83A 1HARA 3S6EA 2MKYA 2V6XA 5H9FK 2CNLB 3HZGA 4P0AA 1KHWA 4U96A 1NZ8A 2V67A 4DSKA 4TY8B 1MU2A 4DUZF 5FJ4A 1KN6A 3FEZA 4CLLA 4ED3A 4YJ3E 3G96A 3ZNJ1 4WKYA 4U67Q 3QAEA 1VQ8S 4DLGA 1XZYA 2N82B 3AEAA 2HFSA 3ANWB 1N56A 1Z2ZA 5IQ6A 3I6PA 3PIOQ 1IBLF 3MR7A 2FZGB 4BS2A 5BJRA 2WVDA 3UQ7A 3CDWA 1FTCA 2CXEA 3HFKA 2OAUA 5CABA 3IG1B 5E3CA 4OJ1A 1RADB 3NBPB 4ECYA 5ETNA 4HT7A 2AX0A 3VGTA 1RT7B 3AA1B 4YT0A 5L3BB 2BS2A 1L3KA 2F9JA 4ILUA 4KFBB 4CT8A 2IVMA 3VRBA 2PJQA 1ZAWA 3AAEB 2WCXA 3NZQA 2ACZA 1LFPA 2VOOA 3TVYA 4WU3A 2OH2A 4B6XA 4DFJA 3OV7A 3K5NA 1RWNB 3O1LA 2BQRA 1H3DA 1XK8A 3V4IB 4KSEB 4WIQA 3NNAA 5FXXA 2VG6A 3MI7X 3OVAA 5MAOA 2WVBA 3EUNA 4CQ1A 2M6IA 2N2NA 4OI4A 2AQ4A 3PTWA 1UL3A 1M1GA 3QIDA 3NKZA 1HWKA 4M1PA 2LLZA 1Q1KA 3TZWA 4LF8J 4ZHRA 2XAFB 4Q8EA 4OI3A 2H5JB 3DFEA 5LL6d 5DJQC 6FDRA 3I96A 5B0CA 1TKXA 1QJHA 1JXEA 1N32F 4DSEA 4OYPA 2QA4G 3PW5A 4AQYT 5CFBA 2HK2A 3MUTP 2MLZA 2PDAA 1N36F 5E3QA 1UFKA 5LP6E 2Q9QB 3C3LA 4LF5F 1CBKA 4I1TA 3K3QC 1HPZB 4KC5A 2P6TA 4JI6F 3J7AN 1HBUB 5LT5A 3J7ZT 2C28A 2BZ2A 1CJTA 1T9YA 1ZM4A 1H7XA 5J2MB 2YKMA 1RWXB 4EZHA 4KTQA 3MECB 4W92B 4XIUA 2I6HA 1S5ZA 4FS1A 1WG4A 1ZA1B 3OKQA 1Q8IA 4KBMB 4KPYA 2CBJA 3RRWA 3K1SA 1E6YA 3T1AA 3ZZZA 2FJBB 1C0TB 1WRDA 2C2NA 1WCRA 5AQKB 4BHQA 2V7JA 2L9DA 3U02A 2GHWA 1CJTB 4ANEA 3BPDA 3HL6A 3R97A 1N34T 4P09A 4YQWA 1BD6A 1UP1A 2MB0B 1WYCA 4AL6A 3M32B 2N1GA 4FXDA 1OY6A 1LW2A 1R8HA 4LFAF 1OJ4A 1HW9A 2HAIA 2E1MC 2J0QD 3A3PB 2W2NP 3UUNA 4UW2A 3W2WA 4EEDA 3CEDA 1SL1A 3R8YA 3CW2C 4UF0B 4TU9A 4UVBB 4DV5T 5HEGA 1ZTTA 3TUPA 1M1KT 3BN4A 3POTA 4EUVA 4M95A 3T5HA 1Q8KA 4YDDB 1Z4UA 4OLOA 4Y28C 3K0JA 3KDNA 1US7B 1GH8A 1SXLA 3CDEA 2H4YB 1FVQA 2RS8A 3DRXA 2DTJA 1V3SA 2XO6A 2KFYA 5JRCA 5L4EA 1SHZC 1RLDA 2H7OA 1VQOS 3D1HA 3P4SA 4NEZA 2YH0A 2J5AA 1EQ0A 5EUHA 2Q9QC 2AEFA 2KO1A 2P9CA 3AA9A 4HWHA 4C2MA 3SI8A 3MZIA 3KTQA 3BPSP 5AQUB 2V6YB 3W61A 2ZOMA 5JDGA 2XY6A 4A46A 2BMBA 1CUNA 2V8SV 4YS2A 4NA1A 3SV3A 2DWKA 1K1SA 3O9XA 3HXMA 4R0EA 2APOA 2F8MA 2CLYC 4YB5A 3VZIA 2RU9A 3BDEA 3B5MA 1XWLA 3M6VA 4QWDA 1GMWD 4O3NA 3V5UA 4GRSA 2HPLA 4UOFA 4F0MA 1FD8A 3Q8UA 3PYGA 2UXXB 4ZJQA 3NZPA 2ZM0A 2NOXA 3F0NA 3GIMA 3KK1B 2LU2A 2ADCA 4K59A 1YD8G 3MAHA 1VBZA 4YMEA 4FYXB 5CZXA 1LK5A 2GAHC 3CQGB 3PHTA 3ZYMA 4FYWB 4ED8A 3VGVA 1GT8A 5LSRA 2LHRA 3GZ7A 1NKEA 2AZ3A 3Q23A 4IIJE 1PYTA 2H54B 4AL5A 2LHNA 2JQKA 3BQ2A 4WF9Q 1WDTA 1H7WA 2HQCA 5AQRB 4BJNA 1M5SA 4HI2A 2UVUA 4H9RC 4DUYF 4KI0F 2DO4A 4ZK7M 2CQ3A 3LTOA 1RWPB 4AUKA 3UT5E 3PURA 3MM5B 5F8NA 2HFUA 3R7SB 3UWTA 4CCHA 4U7CA 3DOLA 1FE4A 4Z7CA 3MEGA 2UXCF 5I42B 3ETMA 4KY3A 3KK2B 1HBNB 4Z8XA 2F40A 3MEKA 4JV5F 4UT4A 3A8YC 3KLIA 3N4WA 5AQPB 3PYEA 2HNZB 1KNPA 4OYBA 4HWCA 1FT8A 4FS2A 5I3QA 3QWPA 2Y48B 2E9TA 3PEHA 1FE0A 4DU7A 1XERA 3RAMA 1YITS 1R0AA 5HBMB 5E7OB 5IS2A 3MFHA 2HGNA 2PTFA 2F4VF 2MKIA 3OR2A 2DR8A 4ED1A 3LH2S 2DNNA 2MOZA 4N56A 2I0MA 4DG1B 2QVAA 3DLGA 4GOUA 2XWXA 3OW2R 2HLUA 3NMAA 3A7MA 2VG5B 4DR6T 2CJKA 3MM8A 2CIMA 3GJSB 3IAS9 4OQJA 2R7OA 2YNGA 2O67A 5FP3A 4DN0A 3I0RA 4CH0S 3PACA 3M8SA 4YY3T 2WBLA 3EJMA 5IM0A 5EWEA 1ZPWX 3MWBA 1BMQB 3FRYA 3QNUA 4ITSA 4ECRA 4HI1A 3Q89A 5G0RA 1VIOA 4N78D 2RPAA 3JQMA 3N0VA 6AT1B 1Y0HA 1I6JA 3LJCA 2FHKA 4P6QA 4LMLA 3BO4A 2W24A 1WEZA 3V6KA 2ABYA 4YB1P 1FWPA 3WBZA 2ZZTA 4YSXA 1R0BG 2DGUA 5CYJA 2V5DA 2KKHA 3M6WA 1I51B 3GQCA 4TYAA 4ES2A 4A8WA 5D15A 5HWYA 3X1DA 2FJEA 1RT7A 4DL0C 5KG0A 2LU1A 3KBTA 3A3OB 2D7SA 3MHYA 3G8SA 2X3GA 4DNDA 3UDLA 1NH8A 1FTRA 2CPIA 1SJ4P 3DGVA 3RI5A 3HT0A 3IBPA 1XTZA 3MEDA 1C4CA 5CXTA 1TL1A 2EXUA 2LEBA 2O3DA 4USTA 2NXEA 5HXHA 1RJJA 3QJPA 2CPXA 2ZBRA 2OPQB 2BOAA 2IW5B 4WE1A 3UNGC 5HP1B 4RWWA 4X64F 1IBLT 3AAWB 3M8WA 3CXCR 1B70B 1UETA 3FFIB 3E0ZA 2COLA 3CJTA 4IRCA 3EXYA 1I94F 3MCOA 2VUGA 2MYSA 4L76A 3ZTPA 3BGRB 3I0SB 2RU3A 4O4IE 1WUUA 4DR7F 4ATNA 2H7VC 3OXLA 5GADI 3NL0A 2CQIA 1HD1A 4QIVA 3ZTRA 2V34A 1VDHA 3AOAA 4WKRA 2Y0SD 2H5EA 2RVJA 4K4UA 1GQEA 3IBWA 4JI4T 2BABA 4RNNA 2XM3A 2G13A 2EEYA 4O4RA 3K17A 3M9OB 4X4TA 3DLLQ 3OJSA 2EFPA 3BGUA 2MJUA 1ZBTA 1LWEA 2Z30B 1FX4A 1VIXA 3K2YA 2GIRA 3M8PA 2LDYA 4DOZA 4MFBB 2GMHA 2L41A 3JAFA 1U1NA 5L47A 3DLEA 1KRPA 5HROA 1ZS6A 3O4XE 4LF9T 3HSGA 4ZCIA 3P7IA 4OHXA 2FJDB 2GX8A 2WVEA 5HATA 5JDLA 4IL4A 2E5JA 2WW4A 2V5CA 2XMWA 1QSLA 1SI9A 2YBVA 1PAEX 1U1KA 1HI1A 4EK2A 4G1QA 3DLKA 2FY1A 1IKVA 3CD5A 3T6JA 5K14B 1NJZA 3JQKA 4UF4A 3VAIA 2MHEA 2XBPA 2PA3A 1ZETA 1VBXA 3TVKA 2MSTA 2DNLA 4MYUA 5F9NA 4DV5J 4J9KA 2XTJP 3F57A 2VG7A 3HHEA 4U9RA 4KO0A 3ILLA 3FUYA 2ZC3A 5HQLA 2HWHA 2RUGA 4Z90A 2V6AA 1RGVA 5AE2A 3RBEA 3RU0A 5KFPA 3G6XA 2EHOD 2DGTA 4JV2A 3HM9A 3A4TA 4C3KA 5D78A 2VBXA 3NS5A 1TR0A 4NLXA 1TU0B 2D74B 3TEGA 5HN0A 3ZC1A 2RRNA 1HWIA 3I4HX 2HHWA 2IFXA 3RPUA 3KV9A 3PDYA 1WHYA 3NG8A 5H9EJ 3TQ1A 1SIWB 1B7TA 2QLXA 3TAMB 3MM6B 3GSIA 3TLSA 1X4HA 2OD6A 3GCWP 3TA0A 2W66A 3KHLA 2E9RX 1MLAA 1WOSA 2J9DE 2R2UA 5JTGA 5AQMB 3KG0A 1GFWB 2Y8WA 2K3KA 5DJBA 3RRKA 4U3CA 4KHRA 4JI3T 4X65F 1M90T 5JR9A 4DDFA 1Y10A 5K20B 5HEUA 1Y01A 1VC5A 1OEDA 4GKKF 1CJUB 2O66A 2IJRA 3CJ5A 3MM7A 4NUVA 3HZEA 3BO2A 3SFEA 4UOCA 1QLNA 1O3XA 4M8LA 4MKAA 2K3WA 3JS9A 4L5GA 2C2ZB 1JLBA 4NLPA 3EE3A 3N9PA 3M9MB 1UTAA 4QYRA 5I4MA 4FF3A 3UE2A 2YKNB 4DX7A 4LF7J 3DLHA 1FJCA 4NL5A 4ZS6A 3PW0A 5KG7A 4YP3A 2CPEA 5ETOA 3KFWX 2QEXS 3NNHA 5AE3A 1M5VC 4ED4A 5CZVA 2UXBT 5JUMA 3CX8B 2QA2A 2OJ3A 1RT3A 1NM2A 2GAGC 1S94A 3C2PA 2Z2ZA 2XQ9A 3CULA 2RSQA 2UV8A 3KUGA 1MIVA 4K50A 1EP4A 3ENQA 3BJYA 1U4QA 2Y8DA 4L9IA 4UVAB 4FVMA 4NLSA 2XNRA 1QTMA 1D1BA 4CXYA 4P2XA 5LMUJ 3PJAJ 1RT3B 1TUVA 2Z8QA 1YQ4A 1TL4A 3FDSA 1KLMA 1NK8A 1N5VA 1U1QA 4G65A 1P1TA 1VHFA 4JEUB 1VQMS 2MHNA 1D1UA 1K1QA 1MMLA 1NKCA 2GQCA 4GVBA 4OHVA 2UUCT 2R7VA 2E29A 1H73A 2OA5A 5HMYA 3BO3A 4PWDB 4EEBA 3F56A 5JDHA 4LFCT 4O8SA 3HKWA 5F8IA 1OSDA 1ITPA 3ZYKA 1RTZA 4OIXA 3TAMA 3PUWF 4PJLA 2CPHA 3CNQP 3KJVB 2RILA 2ZWOA 3OLBA 2A10A 2I8EA 1T9XA 4OYWA 3C14A 3QIPB 2AHOB 2I5JA 2J8AA 2F4VJ 2LOSA 4F2RA 1HG5A 4UY8T 3MEEB 3SIPB 4DV0F 4EGWA 2OP5A 1H98A 5D4LA 4HHUA 5HJYA 5ADXL 4G1PA 5K8PA 3C50A 1ZAVA 1LQ9A 4CI2B 4KO0B 1Y00A 2MBGA 1G8XA 2F63A 1S77D 2Q6CA 3QWUA 4QWBA 2LKZA 1J5WA 2BJ9A 2YPZA 1RQ0A 3C19A 5DDRC 5C7PA 4GKKJ 3DP7A 2B9WA 1VJQA 3C15B 3HSDA 4NMLA 3DLKB 3ZLIA 4ILCA 4WCEQ 4DV5F 3J81U 3PU3A 1NH7A 3BREA 3KNGA 4ZOSA 1N36J 4LSLB 1YRXA 1KD1T 4XZCA 4R8UA 1URRA 3C66A 3QO9A 4O4HE 1J27A 2PI4A 3OYZA 1NAQA 3HFVA 5KOWA 2D3OR 4DZ6A 1QLBA 4CLTA 2WS3A 3DHXA 3KOAA 3IA0A 3NGDA 1L3VA 1UVKA 1X9MA 4K2JA 4LF8F 2ZM8A 2IIHA 1NJIT 1NSQA 3HVRA 2CXLA 4DV1J 1WEXA 2VONA 2HVDA 2AJQA 1UA0A 1QD1A 2BZBA 3R7BB 2U2FA 1R8AA 3DRRA 5DS7A 3S7RA 4YHHJ 4B9VA 1OSCA 2FHOB 2WK4A 3CIRA 5L39A 1YJRA 5IV4A 5HSPA 2MKSA 1H38A 4MK7A 4IFYB 3Q2SC 1LOUA 1A7GE 3N9MA 1WHVA 2BS4A 4KGVB 1RAHB 2GHVC 1HIYA 2FD2A 3KUEA 4ER8A 1CJVA 3P4QA 3LAKA 3UDEA 4JI6J 3RC8A 3JC6D 4DXLA 1CS4B 3UR0A 4EV6A 1JIHA 4OHZA 3T1HJ 5LNKA 2QSWA 1U8WA 2PG8A 2FLLA 5IWAF 5DZ6A 4NUUA 4ICLB 2J9DA 1VI7A 3NMRA 4MH8A 3BF4A 3I31A 2CJQA 2ILZA 5KFUA 2CE7A 4WBNE 4B3MF 1NRKA 1U48A 4H54A 1VJWA 4ZP8A 3NOCA 3AXJA 2BW2A 3H25A 3KMSA 3Q8PB 4RBUA 2C2MB 4AIUA 2OPPA 4TNVA 1KVIA 5KXJA 3HSJA 2CQDA 2H1YA 4I7FB 3ONQA 1I6ZA 4ECWA 3QUJA 3T19A 4H9QC 2UUTA 4X2BA 4CXWA 1OY8A 2MYFA 1LVFA 3D28A 2GZOA 5ABGA 1YWXA 4S0MA 3BBCA 3AB4B 4I56A 4OJGA 7AT1B 3CJ0A 2B9XA 5HP1A 4YB7A 3J7Z5 3BDPA 2YWHA 1VRBA 2KNDA 4HWDA 2XWYA 5AE1A 4O4JE 4L6V3 5MLCV 2UUCF 2FJXA 2CUYA 1JQGA 1XDPA 2DH8A 1ZKEA 2W01A 4ZI2C 2E7WA 2A3JA 4CLKA 3DDKA 3SV4A 1HR0T 3QGPA 5GAHU 1YJTA 1QAJA 4ETXA 4JI3J 2Y1RI 2W8LA 4QPTA 5J1NA 3QGGA 1KONA 3KVAA 5KT5A 4TY9A 2HWIA 4RUAA 5D77A 4YFSA 1OEDE 4MKVA 2FJEB 4OV1A 4QIGA 1BR2A 1YKHB 2J47A 1XNRT 2XY7A 2HVEA 2R6GF 1SE7A 3NCQA 2V8GA 3QBCA 1NUEA 5DG8A 1EB0A 1TKTB 5HANA 4I67A 4ALZA 2J9CA 1LWCA 4R25A 5A8WB 3Q8RB 1HHTP 3P45B 4H4MA 4RBVA 2W8KA 4CM0A 2MY8A 5HBMA 3MMAB 3L3PA 2AJ4A 4K5RA 3KDSE 4XAXB 4I50E 1OXZA 1JXVA 1RYRA 1S0MA 4PW8A 1YKWA 5KOXA 1S1UA 3ENAA 3L3CA 3EABA 1HNZT 5FL1A 1T8EA 4LF9F 3UI3A 4OYAA 4QIEA 4F7VA 4NCGB 1WWHA 3FBEA 4Q5VA 4YHJA 3OT9A 2A6OA 4OX7A 2CQ0A 2KLQA 3P5TL 3P8BB 4FF4A 4YLHA 1RKIA 3GSDA 3MM9A 4ILLA 5ETKA 5CD4H 1U1LA 4N47A 2B4UA 1RBLA 3DHWC 1RT4B 3O44A 2HH7A 2EPIA 5J2PB 4WP9A 2NYHA 4H9NC 3UCZP 3TA1A 1KEKA 4JI5F 2BW7A 4USIA 1KLMB 1MNDA 1EZZB 4Q2MA 1EETA 1EX8A 4NZ0A 2UXBF 4ZN3A 3ZXWA 1DFDA 2GC8A 1FMVA 3ETVA 1APSA 4K4WA 4DX8H 1TKDA 2HGMA 4YN3B 3D4JA 4A8QA 1T98A 4JI5J 4F0KA 3QATA 4ZVOB 3W64A 1NHVA 3O5TB 2O5DA 4QYZJ 3RW6A 2M7SA 2XC9A 2A2CA 3O1JA 3AFGA 2O01C 1UVJA 3GONA 2RP4A 5E5NA 4DR3J 4ZZBA 2KT5A 5HK4A 4CO2A 3RLFF 1XNQT 3JCFA 2K3IA 4TXSA 3RYLA 3SSQA 1NSKL 4JI3F 2VPYB 1JLBB 2ADBA 2KZMA 1IBCB 2ZKTA 4JV1A 1AUSL 4Q45A 4AQFC 3JTPA 3V4MA 4IDPA 4ED0A 3T9ZA 2XZWA 4DUZT 3AEFA 4FJOA 2DBBA 2YWWA 5RUBA 2QLWA 3QMQA 5ETVA 5L3CB 1YXRA 4B3SF 7FD1A 2DGWA 2RRAA 3OHBA 2NW9A 2ZM6F 1UJ6A 1IKYA 1CLFA 3V6DA 5AQHB 5IT9U 1FI4A 2RAQA 4IOBA 2R7UA 1HTJF 2CWXA 4Z7YA 4HLBA 3MOJB 3KYLA 3PRBA 2CWOA 3FZMB 4P72A 4HFCA 3I4PA 4OZ1A 3D6TB 3VAFA 5A0YA 1S57A 4IH6A 4F02A 3N9UC 5L38A 3HK2A 3K8PC 2IMLA 3IR7B 3U27A 5KFLA 2ZE2A 3F41A 3L9ZA 2W9AA 2M9KA 4MIWA 3DRPB 3I0OA 2BV3A 3PUYF 1QUPA 3R84B 3O1HA 1GXLA 3M30B 3MAAB 5L1JA 1U09A 2QGFB 5HJXA 5DDPC 1CEZA 1D8YA 2UUAJ 1S4FA 4M5LA 1IKVB 2D41A 3C98B 4G1QB 1H2TZ 4ES3A 1U5PA 3T5KA 2RRBA 4F50A 3TEHB 3I5CA 2V4QA 1HQUB 3EICA 1YHQS 4BWJA 1FRLA 2YX4A 2ZD1A 4Y2MA 1UJ5A 2F3JA 2IY5B 5IWAJ 1RT6A 4RR5A 1OMSA 2YWEA 4X1KE 4FXVA 1XMQF 3W2WB 5AQIB 4CZZB 4GVLA 4ENOA 5IV3A 2PBIA 3HFZB 4RWXA 1JXLA 5KT2A 5HLFB 1KFDA 3I9V9 2W9CA 4V1Av 3GYGA 1W0AA 1B7FA 2JRSA 2WTFA 2QLBB 3QJLA 3ET6A 4V19J 2RDJA 1S9EB 1FXLA 3T3FA 3PFOA 3K89A 3HI2A 3SDEB 3PDNA 4H63H 5F3ZA 1RISA 1J5EF 1KLNA 3UCUP 5DDQC 2FJBA 1QM9A 4C8MA 1R8IA 3CT9A 3RBDA 2AEMA 2UV8G 4LF7F 4D3GA 1TP7A 3VVTA 3OSNA 2CCQA 2AX1A 3MECA 1U6ZA 1W9RA 2VPXB 5LG4A 4OZNA 3W9IA 1FHTA 3IMQJ 2P2CB 2CNNB 2YKMB 5J2MA 2FVRA 3NBXX 1IQZA 3AE1A 3CQXC 4IQMA 4HVZA 4RNMA 4DX6A 4I64A 4DR3F 1YJUA 5D0RA 1WACA 4NYOA 1LWEB 1IBKT 4E2FB 1IBMJ 3RZAA 3I87A 4F8HA 2IVYA 4X4SA 2DGOA 2J6TA 1R43A 4AKHA 2RT3A 4ZVFA 4DSJA 2ZFHA 1PIEA 1UZDA 3IS9B 1GAOA 2P5VA 1ICEB 1J1JA 2PFDA 2BVMA 4O0NA 3ISND 1U45A 3MR6A 3CCVS 4GO5X 4EZ9A 2KH9A 4ANCA 3D3BJ 2JH3A 1PJ6A 1NDCA 1J5EJ 2FBWA 1QSSA 2HIQA 1SUQB 4AI6A 2QV6A 2ODUA 1F3FA 2HZAA 2CDQA 4CLFA 5F8HA 2IUBA 1FDNA 2M4MA 3QAUA 2G4BA 1IJEB 2HBZB 5DGAA 1JJ2R 3KV4A 4XPEA 5BYRA 5J2TE 3AE3A 2VG6B 1RTHA 2X1GA 2PA8D 5IT0A 4NRTA 4EOZB 2LA4A 4LRDA 1FKAF 2QLFB 3B6BA 2MZTA 5I3UA 3N5LA 2XMAA 3AAIA 2OSRA 2MQPA 2D9PA 3NS6A 3CCMS 4USMA 3MEDB 1FNXH 4LR7A 4OYMA 1U2FA 1UVLA 3C46A 5LJ5Y 3LPYA 1RSCA 4HH1A 5LXYA 3M7VA 4NLVA 5J1PA 2R2TA 3AH6A 4ZMMA 2F9DA 5LB7B 4LRBA 4NLRA 4FDFA 3NBPA 4ZP7A 4DEZA 5F3JA 2QYWA 4P52A 4RU2A 2RQMA 1IKWA 4ZPDA 5DQWA 4X4PA 1FO1A 1UA1A 1N5TA 4P7VA 3TJ9A 3V4IA 1S1WA 1X0PA 2IM3A 4QX7B 1Q86T 2OGUA 4NXNT 1FRKA 5G0RB 2GVDB 4CNYA 4DR6F 2WWUA 1NDKA 3GIIA 2ZBPA 1FIOA 4NYPA 2H4WB 3MR2A 1WELA 1MSWD 2E5GA 1RKJA 3JAMU 5LXRA 4Y6IA 2YNIB 2CG4A 3UDVA 4X4RA 1S48A 2AIRB 4IUFA 3UFEA 2C5KT 2J76E 2OTJS 4EYYR 1D9FA 3KLIB 1RLCL 4DL3A 4UUWA 5KFDA 1G1XA 4C11A 2XUEA 5KFAA 2JLFA 2Q43A 4KKOA 3M8YA 4ZDNA 1JKHB 2W25A 4KGZB 1ZYQA 1TMJA 2K06A 3BSCA 1SVDA 4LF6F 2EHOC 4PUOA 3CVRA 2FUG9 4O44B 1YK9A 4FNIA 1NBEB 4IFVB 5H6QB 3BS9A 1VS3A 4ZIVA 4DR1F 4B9TA 1QUUA 3M8QB 2CMRA 1R0AB 3BBBA 1JLEA 2CHOA 4MK8A 2RQCA 4F25A 3Q24A 2IRXA 4LF8T 2W7AA 4I2PB 2XMJA 2XS7A 4B9LA 3CO0P 3D3CJ 4IG0B 3QLHB 2EG2A 2JFDA 4RL1A 5CCLA 2B5JA 4MIAA 2HPUA 3M8ZA 1ZZNA 4NXNJ 3PJXA 3QK6A 4QR0A 1UK5A 3BSOA 1JJHA 3TI0A 4HN9A 3VU7H 4J9SA 2BYCA 2XSAA 3ZC0A 4WYVA 1LKXA 3K5PA 2C3YA 2NREA 3OXFA 2RKIB 2DNGA 4KBIA 1MW7A 4MBQA 2AW0A 3UN2A 3QB5A 4YJ2E 1MNEA 3P4UB 1SJFA 3CCRS 4GIWA 5KG3A 2P6SA 1RHQB 5LJNA 3UR3C 9RUBA 2LECA 4IFVA 4LMKA 2BDEA 3BQIA 4PFPA 3VTIA 2FHMA 1IAPA 1U0HB 4HKAA 2YH1A 1JNZB 3VR9A 2HHXA 1BR4A 4WPAA 3PUQA 1S1XA 3B57A 1I1GA 4C11B 2MTLA 4EU0A 1HHSA 3VHQA 2RUSA 1T9TA 3GV8B 2HYIB 1NJXA 3KWMA 3N5FA 2YNIA 5THWA 3CC4S 2HVIA 3MPDA 2ZOFA 5JH7E 3BM7A 1JLAA 5H6RB 1VYAA 5CA1E 1SPBP 2QL7B 2NW7A 1SC4B 1IWGA 1RACB 2DKOB 5HMXA 1XMOF 2EHOB 3GN5B 5ETMA 4L3NA 4J90A 2XAGB 3E01B 4J9LA 1E7PA 2Z57B 5FY7A 1RZMA 1Q53A 3GTYX 1U2RA 1XDOA 3GG1A 4ILAA 2G1HA 2V68A 5AXNA 4YUDA 4FZVA 5H9FJ 3TAPA 5A0YB 3TANA 2RH3A 3KHHA 1TV6B 3PU8A 3CD0A 1S99A 1JLQA 2CVIA 3H3MA 4KMCA 4E0DA 3C6TA 4DL4A 4B9NA 1KFSA 2VOPA 1LXJA 5B0DA 3TRGA 2JQHA 5GADU 3PW7A 1Y7PA 2EW9A 1NPPA 5EN1A 3ZYLA 2EFQA 3CX7B 4CLWA 4DI6A 2IJFA 2Z2LA 3UUXB 3AE8A 3H5SA 2JL9A 5LYJE 1NPRA 4J91A 4AFFA 4HWFA 2JJ9A 2VKOA 3X1LB 3ZSTA 3W2VA 4DPWA 3UW1A 4LF1A 1PJ5A 1WOOA 2KHCA 1TVRB 2XLIA 1UWBB 1RU1A 4RW7B 1WF0A 3IWXA 1M62A 1Y5NB 3HKCE 3RBZA 2CPYA 1WD6A 3TA2A 3AY0A 4AQFA 1X4AA 5KFJA 4HTJA 2RA1A 5GAHI 2A72A 1MN7A 4UF0A 4DU8A 1QAYA 5A8RA 2FVSA 2E5HA 2NPFA 3AECA 3M2UB 3W60A 2RNEA 4OYOA 2UXDJ 4NXMT 2D3ZA 2RQ4A 4RUBA 3OTEA 2DH7A 1LWXA 1C2PA 4X66F 2NZCA 1JLGA 2IM1A 4OYIA 4DV7T 4CTAA 4PK6A 2MQ8A 2ZEJA 1H0HB 4N5SA 2V5HG 2B6AB 4IG0A 1HBUA 2W62A 1S59A 3Q2TC 2ODVA 2XCPA 4CTAB 2FLPA 1HX8A 4PRFA 2KYZA 1FVSA 3MXZA 2ZC4A 2XY8B 2N4DA 3GU0A 2FY8A 1B7YB 5KT4A 4EO8A 3M6UA 4ZCLA 1FD2A 3GJTB 5L2LA 1WC4A 3S01A 2WZHA 4F4AA 2W4PA 4DPYA 3IGNA 2BE9B 2GVZA 1LK7A 3NCRA 4WFYA 3PCOB 2CXFA 2JMKA 1HQEB 2HRTA 4MKYA 2KJWA 4KKOB 1YBAA 2GK9A 1FFGB 2ZHOA 4IDOA 3SDEA 1UWBA 2KVQE 1IWAA 2JIWA 2CQGA 2J8SA 4U7YA 3BKFA 1DQ8A 3HP6A 2HHVA 2RD5C 4PWWA 2DXFA 3HVTB 3PUAA 5A76A 5GMKa 2R8GA 1GK8A 2PEBA 3VGUA 5E41A 1I94T 2RB7A 1N33F 1T03B 5CYMA 2AKWB 2IDLA 1RT6B 4DFMA 4WK3A 1AW0A 3CCWA 1S1WB 1GMUA 5AJ3F 3ILJA 6FD1A 3HX9A 2V7MA 2QGSA 4PABA 1H6KX 3GFXA 1D0EA 4YSYA 1VCSA 5KG2A 2VK9A 2QRXA 5K8MA 3EX7B 3T5JA 4Y2CA 1X4DA 1AA1B 3IBCB 2VL1A 1SKSA 1Q8BA 1WKJA 4Y65A 4B3OA 1HX1B 3K5OA 2WSEC 4JBCA 4N7TA 4YTMA 2LYVA 4UQTA 4O2BE 4LF7T 4QIWD 3E2EA 4JUYA 4Z37A 3HHLA 3PKMA 4J2CA 4DUYJ 1YZ6A 4KJIA 3JYTB 3PV8A 1VQ6S 4J7CA 1HQ2A 4H9SE 4P7TA 3ITHA 2CLYB 5L1LA 3PRDA 4IH7A 2KG1A 3DC2A 4I4BA 1TK8A 3V6DB 4PAAA 2R3VA 3DU6A 2F8EX 3C4XA 2QO3A 2NZ4A 1I3OB 4EWTA 1XNQJ 2JJ4D 3B8HA 2BQ3A 1VQKS 1GEHA 3GG0A 2HW3A 3KINB 1SIZA 1Y11A 4RNHA 1B4SA 3TJ8A 2CA5A 2BG9B 1S97A 3BQ0A 1UW4A 4UUXA 3PUVF 3GE9A 1RWOB 2AXDS 2XQ5A 2GGPA 3NCPA 2WONA 3TLUA 3PUXF 4KT0C 4NPPA 2B4VA 4LJMA 1VQLS 4A48A 2QIFA 5DGBA 2GS8A 1T7SA 1JK9B 2WWVA 4K0KJ 4JV5J 1TUGB 1F0XA 1HBMB 2MPUA 3DLBA 4Y2AA 2ACXA 2GJIA 1IQTA 3RF1A 4PPDA 3UU8A 1F5CA 3UQSA 4TY8A 1BXNA 3PE0A 1DAXA 2C1EB 2UZAA 1EJ7L 4DF8A 4ANJA 2WY2A 3IHRA 4DCJB 4RW9A 3CJSA 2PT0A 2KL8A 5L4HA 2KT2A 3T6BA 2FLNA 4L0RA 1R8CA 4CO3A 1W0BA 2KM8C 2W4DA 1Z1ZA 4IYQA 3IR6B 3G6ES 4DV2T 3WIVA 1G6BA 3WDOA 2YY3A 3BGFA 4F3MA 1P8GA 1Y9OA 1FJGJ 3OUYB 3CJKA 2WZIA 3OBVE 2ZH6A 2HZVA 4Y0FA 4G1IA 4BDPA 3G2XA 2MZSA 3KBUA 2I2YA 3NLCA 2AD9A 3NWRA 1F1BB 3OVUA 2KM8B 4N41A 4K4ZA 1NEKA 2ZWPA 4C90A 3KLGA 3OTOF 2KXFA 2ROGA 3TZXA 4BC9A 1YDLA 4J9MA 5BYQA 1WC1A 1X5SA 1Q4RA 3H37A 3QT7A 1Y3JA 1J5OB 1BQNB 1ZP0A 2BKOA 4C0HA 1DLOB 3ZZOA 3UQ4A 2AJFE 3NGUA 4Q2LA 2GVDA 3TWZA 3RQWA 4Z2XA 4DR7T 1WG1A 1N52B 1PC4A 3OUYA 2GMJA 4O2AE 4ZVGA 4GKJJ 5DQHA 4OJHA 2R7SA 2LJLA 4C8NA 2G9OA 2G2ZA 4GKKT 5E0OA 2ZE2B 1S1TB 2JC0A 1YBUA 4LSNA 4A4JA 2K7JA 1HNWJ 4DPUA 1VQYA 1V9OA 2VJUA 3AA7B 3W15B 2BS3A 1BWEA 3GCXP 3E51A 2DJWA 1DTTA 2HHTA 2FPHX 3WAJA 3PUGA 4LR9A 1RAGB 2VODA 4WFNQ 1XWMA 3EAMA 1S0VA 2CNOB 4O4GA 2AGQA 2M67A 3B4DA 2EKYA 2WOMB 2BVLA 4O0IA 3LFMA 1RAJA 1N48A 1BC6A 1UEUA 2AYGA 4LFBF 3BSNA 2MMYA 2H3EB 4J37A 3M65A 3KJQB 2NW8A 4IH5A 2D69A 1TKZA 1RT1A 3CMQA 2HN2A 3VHLA 3FNNA 3FZ2A 4NXNF 3EM1A 2XHCA 4ILBA 1E1HB 1LRZA 2AP6A 2K48A 3LF0A 1WEYA 3J80U 4DQSA 4OI6A 4OI2A 5C8YE 3W65A 3FRZA 2A2FX 2UUAT 3UCGA 3ZN0B 3BGOP 3SCIE 3EUHA 2E1PA 1IBMT 1KQFB 1KKHA 3FBCA 2Y9HA 1IBMF 2WW8A 2IVFB 3K57A 2G0JA 3EDVA 2HNYA 3MMBB 3O3LA 3T1HF 2LE8A 4NCAA 3G4SS 3ICLA 4J9PA 1P1LA 2DNMA 5AQGB 2YN6A 2CKWA 2P8IA 1R27B 2XHEB 3EZUA 2LSGA 3BGLA 5J2NB 4JI1T 2M70A 2N3OA 1GMWA 1WORA 3NWGA 2FDNA 4G3IA 1KP6A 1R31A 1RWMB 1Q7LB 2VQFF 5LBMA 5J2PA 1AT1B 1XR6A 1RT4A 2HRUA 4U7IA 3PZPA 1HG2A 3NXZA 3ONXA 3V81B 4QWNB 3MDFA 4M5MA 2QYCA 2LT3A 4MFRA 3RIUA 4U7UD 2XGPA 4C7QA 3KLFB 4KH1B 3SYZA 2QT7A 2X0YA 1KVJA 3R5BA 4HEAA 5L3GB 2BRLA 2CWKA 2YQ0A 4TN7B 2VIHA 4C48A 3N2OA 4UIGA 2JLEA 1CVJA 4X1YE 4DR1T 4B3TF 4H9OC 1WOPA 4ZLNA 1V5IB 5KFYA 3MM7B 2X0LB 3I9WA 2YU2A 4ED6A 5HO4A 2B4OA 3D1QA 3DCAA 4O3OA 2VF3A 2NXNA 3AB3B 4OHYA 2CPDA 3MTJA 3CJRA 2YINA 2W2PP 3OBIA 3P49B 4L74A 3LQVA 5IYZE 3FQKA 4A98A 3CMLA 2XG8A 3I9YA 2ZOGA 3H59A 1S1VA 2GHPA 5JREA 2IIUA 1I94J 1LWCB 4FVCA 5A8WA 4PKDB 3AD7C 2KN4A 4PR6A 4LF4F 2JWNA 5FDLB 1S9GB 3KLFA 1FA0A 5HEJA 1L5UA 2VV5A 2GVZB 3GA8A 3RTVA 1ZV4X 5LG3A 1RHMB 4USJC 5IZHA 4DBRA 1W25A 4QJVA 1VQNS 4MLKA 2LMIA 3N01A 4H4OB 2JHEA 1QUVA 4PJMA 1HNIB 2I0XA 4WXOA 1WNEA 3CCES 2ES0A 4I0WA 3HCXA 3G6VA 3FQLA 4CXXA 2VURA 3HMJG 4RU9A 1Y3KA 2VG7B 3MUVP 3AJ1A 2K1RB 2IPOB 3DN9A 1MMDA 2DHRA 3A8JA 3MEEA 4DR5F 1YX2A 4E7SA 2NUUG 1CC8A 1AUDA 5HQMA 3KLEB 4HL9A 2RS2A 2XMVA 5KT7A 4IGUA 3HJFA 1IBLJ 4HWIB 1DURA 2V9KA 3OFGA 1TFWA 4RO0A 2VH7A 2R9LA 3CE8A 4L3KA 4USWA 4W90B 2CQHA 3I1AA 2XMMA 2ACYA 4HFBA 4UOGA 2VKJA 5F8PA 1TKZB 1WKKA 2I38A 5IWAT 2CZ4A 1KVKA 3T1YJ 9ATCB 1VC6A 3FZKB 3R5DA 1XR5A 3Q8QB 5HWXA 1EKRA 5HVFA 2KZZA 3GPAA 2IHR1 4QW8A 4HFIA 5EK2A 3GR1A 2PD1A 4CN1A 1G73A 2E2AA 1YW0A 2RDDA 2VFTA 4UZBA 1VQ5S 5FY1A 1WFDA 4CLUA 1FCAA 3FC9A 3C6TB 4TV9E 3PYFA 2HFVA 3FMBA 3N6LA 1MIYA 5DG9A 4C91A 2IC9A 1Q78A 4NYZA 4PPZA 2HMIA 4CLSA 4JLEA 2H51B 2QSFA 2HHPA 3AE7A 1CS4A 4BWMA 1WR0A 4A47A 4ZVUB 2DIVA 2KWHA 4FBUA 1PSDA 4PQUA 3CCUS 4Z91A 3EWGA 3CC7S 2QFIA 1QE1A 1X79A 3GN5A 2EHOA 3HR0A 3L95X 1T11A 2FJAA 3A13A 4DR7J 3QPIA 5IUXA 3FSXA 3EDRB 2H5IB 4TYBA 5DDOC 4QH1A 4WZXA 2CPZA 2NQPA 2DXDA 2ZDOA 1O5JA 1RWVB 2IMWP 3FHNA 2DL1A 4P74A 3PW4A 2WOMA 4XBFB 3QFHA 4X64J 2OO4A 1FEHA 2BX6A 2DR7A 1TFYA 3IRXA 3D6FB 3HF5A 2VBWA 1TK5A 1GX5A 2HAFA 3GJQB 3CJ3A 3Q5XA 4OYKA 2G0UA 4LQ3A 5CAAA 3MMJA 3OPKA 1X31C 5K9FA 3P50A 3D9BA 3WC2A 2LSIA 5BR8T 4ADZA 1X5PA 1C1CB 1FJGT 1WTBA 2CDRB 3CCZA 4LSNB 4A8KA 1N33T 1VRTB 4M5GA 4M5KA 2ZH4A 2PC6A 2RKIA 2E5LJ 1T0TV 5KFRA 1N8RT 1MMAA 3M6XA 2KT9A 3R27A 2Z0GA 3ZZYA 2YQ1A 1NJYA 4FF1A 4A8OA 2CHNA 3T8OA 1H72C 4B3RF 2ZVIA 3G86A 3L4BC 1DARA 3RG6A 1JMTA 3QSYB 4ERDA 1U8SA 4HR2A 4F6RC 2B4PA 4ID5B 4DR5J 4CN6A 4OYJA 2AEJA 2QMXA 1BQNA 2E9ZA 1SH0A 1HS7A 1RDRA 3JADA 3SS1A 4ZIWA 3QLHA 4F4WA 3FGVA 1FKOB 1K44A 3LA0A 2YNGB 2ZMAA 4PYAA 2YDRA 1V9DA 1N34J 4DQRA 3WIUA 3SFUA 2YDSA 4DL7A 3EGNA 2PMZD 1YJVA 4UR9A 3GP9A 1NK5A 3Q8SB 5HYAA 4QWCA 2D9OA 3OR2B 3MPUB 4F8RA 3CJQA 3DGPA 4ZITA 4IOCQ 3MPVA 2WONB 3I5BA 4Y3CA 2KWIB 1HWJA 3N9OA 5M2PA 4OLPA 2UU9J 3RGIA 4OZ2A 4ZPTR 2PMWA 3RKGA 1X4GA 1XN9A 2BG9C 3LOUA 1H2VZ 4MTPA 3ZT6A 4X4VA 2ZBQA 2HEKA 2ZHAA 3GIJA 2HNZA 5DZ7A 4OI0A 2F4FA 3WX8A 5FXZA 2NS1B 5HROB 3TX0A 4KPCA 5LMNJ 3DNCA 3DOMA 3IBFB 5AQLB 4LF5J 2VKZG 2WSSV 2IYGA 4ILMA 5LGUB 3ADAC 3KXDA 2RF2A 2N3LA 1L0VA 2MPKA 4DO0A 2HQGA 3W3SA 3PR4A 4FF2A 1NB2A 5IFMA 3AE4A 1ZAXA 3MM5A 4D3HA 4KGMA 5GONE 2XQ3A 1S0OA 5HQ8A 3NAHA 2VFSA 2WHOA 5EHHA 5KT3A 2R7XA 2VZ9A 3WAKA 3SSSA 1UPPA 1HNVB 1HNWT 1UAWA 4YR2A 4F3QA 3KMQA 5IHYA 1WF2A 2LM2A 3EZOA 1WTFA 2J1DG 2LSYA 1BUXA 2WMNA 2MQMA 3JC6C 3PX0A 3QOFA 2BM1A 2PMHA 4B3ST 4ZJLA 1F5BA 1A0OB 4RZRA 4IE7A 5KFXA 2DH9A 3QRRA 4QXBB 2C0SA 5KFEA 1FFWB 4IDQA 5F5WA 2CFXA 2YWGA 2BBHA 1F9HA 5HMWA 3MURP 3CPZA 5L3FB 4HACA 3C16B 4R8UB 2UXNB 1MG7A 1HQEA 3FBLA 1OWXA 1C1BB 4K4VA 1HL6A 3H2VE 4K0KT 1KOOA 1SJRA 2YWFA 4I2QB 1XC9A 2HS4A 1OYEA 5D4PA 4X62F 3LO3A 2KT3A 2V50A 1UW9A 2MTQA 3IS9A 5JXSA 1N32J 4KB7A 2IDEA 4OMFG 2G2OA 3JQJA 2QC3A 4U72A 1R8PA 1SH2A 4GC6A 1KTQA 1EZ3A 1TAUA 1V3ZA 2HWTA 3AB2B 1MMGA 4NLTA 4RW8B 1FEEA 1UEVA 3AT1B 3IFEA 2QMWA 5CA0E 3HHDA 2BQUA 4DV3T 3ULHA 3RC3A 5KT6A 4W98A 4PG7A 4B3MJ 2YVSA 4X64T 3M3ZB 4LFBT 4RKUC 2HN1A 2IDOB 3Q8VA 4UVCB 3KKFA 4NLGA 2HRYA 2B8QA 1VRUA 1IM4A 4J9QA 1CQMA 4DJBA 4QBUA 5FVLA 4E7ZA 4HFVA 1KQKA 2XPKA 4RW4A 4X4OA 2BUNA 2E1RA 3DDIA 4NI2B 2UXCT 4V1Ak 3BQ1A 2XQ6A 2HNDA 1WSRA 3ET6B 4IE4A 5T14A 2UUBF 1YIJS 4EAHA 1RWUA 2E7VA 5HLFA 2VL0A 2ROPA 4YB6A 2FHJD 2GNKA 1ZM3A 2XHWA 1RWKB 2LRLA 2YNHB 1URNA 3NRXA 1UVIA 2OPSB 2HVZA 3DLEB 1UCUA 4KUMB 2FGCA 4JB8B 1YI2S 3IC1A 3UVJB 4E8UA 3DDNA 4OZJA 3H7HB 3LAMA 5ABHA 4FYVB 3QRPA 3ZJ2A 2AYMA 1LXNA 3KK2A 3ZMSB 3ZTSA 3ZC4A 1AZSB 2A1BA 3FCVA 4L75A 1D8ZA 5A8RB 4C97A 1NDLA 5HEOA 1C1BA 4IR9A 4LUBA 2WMOA 1UJ4A 3A3NB 1NK0A 5B09A 5DQVA 2CEAA 4LF5T 2E5IA 4HACB 5I3PA 3Q22A 1TL7B 2JRKA 3Q5DA 2YX1A 5CCMA 4ZJOA 4DMZA 2KFNA 2Z2YB 1PKUA 1XNRJ 4EXTA 2X1BA 1RT1B 1YBTA 2QFJA 4DFPA 4EFAC 3R5CA 2VA2A 1VOMA 5L3DB 3NRYA 4LR8A 3NP5A 4ZLPA 4U31A 3R5JB 4DV4T 3ZZ0A 1IR0A 3TX8A 2ZHBA 3Q2MA 2VKHA 3ETUA 1RT5B 4CO5A 2L9NA 2JX2A 4ZVTB 1GTHA 2MEWA 4BC7A 3DXSX 1S1XB 4ZS2A 5B08A 2WBRA 1JNZA 3LP2A 1TV6A 2JLGA 2UVWA 2AU0A 2ROEA 3AEEA 2BBEA 4QIFA 3OJAA 4OYXA 3J7Yq 1TL7A 3W5ZA 3AE5A 4ZPVR 4F4YA 2YKPA 3U1LA 2MGZB 3C4WA 2E5VA 3RIUC 1UVNA 4J9VA 1F2GA 1G3OA 2W4CA 3MOZA 1JJ4A 2IM0A 1BHNA 4WBOA 1HHQA 1L3SA 1UWAA 5LCYA 2R7RA 2NYIA 1KEYA 1DHMA 3R9LA 1NDPA 1DLOA 4OFZA 5CHCB 2Y1IA 3T41A 4PG5A 4X65J 3OFEA 2QA7A 3UVJA 2H89A 1T9VA 3BKTA 2QG9B 1NEEA 1HLWA 3R6LB 2ZH7A 1FK9A 2ASLA 2UUWA 3N9NA 2LSJA 5ETRA 3QT8A 2B8PA 3EZ5A 4OYZA 1X0FA 4MAKA 3HPOA 4O23A 5GAGU 2MKCA 1N34F 3B78A 2LXFA 4K2XA 2XJ7A 1SJ1A 4N8NA 3ZNUA 4EBDA 4LBHA 1OPIA 1MWZA 2DY1A 2XMTA 3DI6B 1VFJA 2B76A 2A2DA 2M8HA 2MZRA 1FK9B 3CC2S 5A8KB 2BDPA 3CF5Q 4NCGA 2FJDA 4JYAT 1RTIA 4LFBJ 2F7VA 4R0JA 4JI0J 1VK3A 3MUMP 4H63V 4M63A 1RABB 4HT5A 1UX4A 4NXMJ 1KQGB 1HWUA 4KHZF 1T05B 2F1FA 2EK1A 3AD9C 4W4MA 2MZJA 3RKOA 4H4MB 4BLGA 1QSYA 2B56A 2HK3A 1WLXA 4IREA 2OUGA 2W9BB 1TKTA 1VQ4S 4YY3J 2KYXA 3V2UC 1FDAA 2MGZA 2UXCJ 1N36T 2W61A 3UD3P 5DQGA 1VRTA 2NPIA 5L1KA 5A2QY 2W2QP 2JOQA 4ZI2D 3MMCA 4DQQA 2EWHA 5B0BA 3TAQA 4EEYA 5F3TA 1D9DA 2E66A 2J0SD 3OXGA 4I2QA 5ITHA 2AF6A 3IM9A 1F2HA 4USVA 2G0CA 1PBAA 3UFGA 4DZDA 2CJXB 1JLFB 5DABA 4GKJT 1UCNA 2LXUA 1HFEL 4TKTA 1RT5A 4TLQA 2ZBIA 3KLHB 3P8CD 2R8JA 1X5TA 3T1YT 5GAEI 4QXCB 2GQ2A 5AQVB 4BJMA 1Q79A 1GMVA 2YKAA 3GMGA 2HVHA 1ULRA 1W7WA 2LVWA 3HKBE 3GYNA 2IYIA 4NOHA 1RTHB 3ZT7A 4WE1B 2ZM2A 2K7KA 5KAKA 3K5MA 1S6QA 2QMUB 4X4UA 3MACA 4ZS3A 5HI7A 4M5NA 3ZJ1A 2BVZA 2QN6B 2OSQA 3UU6A 1NPKA 3KLHA 3H8YA 2ZH3A 2WU5A 1YG0A 3KK3B 2EC0A 2V26A 3UULA 1Q81T 2AYEA 3GILA 4MYTA 1GXTA 3U1NA 1ACMB 3PG9A 1ZHCA 5K5MA 1X5OA 4ILRA 4EZ6A 3TZYA 2X9HA 2AJ1A 2DIUA 2OPPB 1HKAA 1HNVA 2N9DA 1HYSB 4OX9J 4ELTA 2JEGA 4ZVEA 3AXJB 3ZPOA 1RAEB 4CZCA 3LK3B 2DPIA 2E7XA 2W63A 4ZVRB 4EBEA 3TUZC 5L9XA 2ILYA 5CGMA 2DEIA 1RB0A 2MQOA 5LMUF 4G6VB 3Q5EA 2OEMA 2X1AA 1SKUB 2DR6A 5CYMB 2AGPA 2HBYB 5EWGA 1T05A 3RW7A 2Q3PA 4DPOA 1X60A 3BBFA 2DI4A 2K9AA 2HQDA 2ZKUA 4B3RT 4NLQA 4GK5E 1EQMA 3UU3A 1CJVB 2V7IA 2W7PA 2BXJA 3UUBA 4ZLLA 4ZOLE 1OQ3A 2BE2A 3QB5K 1XMOJ 2JNJA 3F31A 2R2RA 3DLGB 2KXNB 2B7BB 4CN4A 4TNOA 4QWAA 2JDJA 5F0UA 2X67A 1PYOB 5GMEA 3EMTA 3G8TA 3KLEA 2UP1A 4DV2J 1MMNA 3AQOA 3B4MA 1HBOA 3ZT5A 3CIMA 1YGYA 2IA6A 4RBTA 4WFZA 4DPXA 4JI8J 2CPJA 3M32A 2G1DA 4WFAQ 1IJ5A 2NXJA 4RW8A 5LOQA 5ETQA 5LBQB 4IE5A 4DV7F 3AJ2A 1O8BA 3ZZTA 3V6HA 2VFUA 3NWIA 1JLGB 4OJ3A 4IRKA 2SPCA 4PK5A 3ILIA 4H4OA 1HQUA 2AJ0A 2QX0A 3BH7B 3VCDA 4AXIA 3C51A 3KHGA 2K5BB 2CQ2A 2R8HA 4KGKA 4A8XA 1PGZA 3C15A 5H9EK 5FVKA 1HI8A 2B1EA 1P9YA 4K7QA 3DRPA 4JP8A 4ZCKA 3C16A 4B9SA 2OKQA 2A3DA 1BWVA 4FBTA 3ABVA 5A6PA 2X1FA 1RT2B 4OI1A 4L73A 2HFZA 3VAMA 1X4CA 4LT6A 2E8IA 3VALA 4CH1A 3NGKA 5C42A 3ZCJA 3LP2B 2VICA 3GWHA 3EVOA 2XEXA 3EVYA 2EFNA 1UEKA 1S10A 1IKYB 2GIFA 2QZ8A 1FKPA 2L3LA 4ZHQE 3H3AA 1X9WA 3IRWP 4JI8T 2RQKA 4IDZA 3JB9k 1FEWA 1OO0B 3EXCX 3HKZD 2N7CA 3RB4A 4LSZB 4U6PA 3J81Y 2VBYA 4AISA 1U6FA 2V2VA 4YOEA 1N0VC 1S35A 3VVUA 4FNHA 2DPJA 4X84A 1RAIB 3CK6A 2XASB 4NLDA 8RUCA 1CQNA 1V3RA 1IUJA 4TNWA 2HZCA 4TQSA 3RB6A 4YFUA 1O6XA 4GO7X 3RYHE 2ZNYA 5GAGI 4K5SA 1EKSA 4PQUB 2DNPA 2MQLA 3A5XA 4NLWA 3FCWA 3ZFVA 3FZHB 3ONJA 4QQBA 2VQEJ 2SXLA 4KRWA 1FDDA 4IE6A 3IM8A 3VWSA 3DMJA 4CYUB 2WDVA 3ENWA 4H4KA 5DO2A 1Q5YA 3A12A 1LW0A 2H48B 2IA0A 3F73A 4F2SA 1ZM2A 3NOGA 2XZEA 3RAQA 4K4YA 4GYSA 1IM6A 1S76D 2WU2A 3Q8YA 3JXOA 5JDNA 3G87A 4U8VA 2YNHA 2R7TA 2BOPA 1XMBA 2IBOA 4WP8A 1Y64B 1NXIA 3E3XA 5KFIA 2QL5B 2CAJA 2GFFA 2OIHA 1BQXA 1IZNB 4DSIA 2KRBA 3O8WA 5LHGB 3FEYB 5J0ZA 3PYDA 5D3GB 1REVA 4LVOP 5HL7Q 2BM0A 3N79A 3R2DJ 2IC6A 1MROB 4GC7A 3DKDA 3M2RA 3POTB 2R2SA 3I9ZA 4C3LA 2V2KA 4QXHB 4F4KA 4HEA9 3H90A 2CYYA 2ALZA 4BA9A 3I55S 1KDNA 4X4QA 3QZ7A 2HQIA 5D8HB 5LMNF 5KFWA 4A8SA 3FBZA 5KFOA 4HDHA 4R5PB 2L9WA 3BN7A 4DR2T 3IP0A 1NENA 4V19X 5EWFA 1CULB 2BE7D 4DSLA 4WXWA 1F5AA 1NMEB 2PE8A 4CI1B 1XEZA 4EGLA 3ZZPA 2CPTA 2EC2A 4I2PA 1W2BR 4DV2F 3UD4P 5AQFB 1VGYA 1UKUA 2I1RA 3QNWB 2HQ3A 1C1CA 4I0UA 3K3OA 4JI8F 4DL5A 2XQAA 3L39A 5ETSA 3MM9B 1E2AA 5B0AA 2CQ1A 4DQIA 3NVOA 2HFOA 2J0WA 2XGQA 4DS5A 1HNXF 3K8WA 2YTCA 1VQ9S 3HHLD 1S4EA 2VC0A 1NO8A 1JLCA 4CH7A 5M4YA 2WQYA 1S1VB 1R3NA 3QT6A 3AA0B 3LW5C 4MK9A 3QRQA 1N6QB 2D5UA 2Q9QA 3RRCA 2GQQA 3HHNB 1NKBA 4KH0B 3AA6B 1RUSA 3MMAA 2EI5A 4DX5A 4KAIA 4WZQA 2ERRA 1NK4A 2KXPB 2W0GA 2VKRA 4AYBD 8ATCB 4DR6J 4P0BA 1PO6A 2AV5A 4I7FA 2NLWA 1VK8A 4ZPCA 5HCMA 2M52A 1N5YB 2VFVA 4TQRA 4ZPAA 3EGZA 1TL3A 5EK4A 3HVWA 4DL6A 1X4BA 2XQ8A 4EYHB 3DRSB 3Q86A 1AJ3A 4USHA 3FB2A 2Q6BA 2I9SA 4DV6J 2W7OA 1S6UA 3IGVA 1VLYA 4DV3F 4PZVA 1UZHA 1C4AA 1E6VB 4B3SJ 2CJBA 4M1KA 4WIIA 1U1RA 1XMQT 1HBMA 2CADA 2XAQB 3C6UB 4OX9F 1QAXA 3PJWA 4NZ6A 4ECSA 1RK8A 4K4XA 1UUSA 4KFBA 4NZ7A 4C8KA 2E5LT 5FYMA 2GIQA 3RQUA 3CIZA 3H5YA 3S8SA 3AA8A 3TW0A 4Y2KA 1MN9A 3ISZA 2XCAA 5HXCA 1FXRA 1ZZFA 2UXBJ 2LEAA 1ZTWA 1SUQA 3H98A 2JZ5A 5JDMA 3I0SA 3VV2B 2H9ZA 4YHHT 3D2WA 4DL2A 3DU5A 5C5JA 1QTNB 3ANWA 3DGPB 1VHIA 4CM2A 2HBQB 4J5OA 2DD8S 1YJ9S 2LEPA 5F8LA 1FJGF 3DM2B 3AEGA 3K59A 2OPQA 5LSLA 3ZZRA 5C2CA 2ACMA 3PM9A 3M9NB 4DR4J 4U95A 3C6UA 1YJNS 1KHVA 1TL1B 4HYKA 4NMXA 5C2GA 4EBCA 2JEIA 3N28A 2HHHF 1MU2B 1FKOA 2ZJRQ 5L1IA 2IAJB 2NR4A 3AE9A 1HW8A 4BCAA 2V8HA 5JVHQ 1K9MT 4KHPF 4AT1B 2BA9A 1NK9A 1QVGR 4JI4J 2ZVSA 4C6AA 3R5AA 2P9EA 2DGQA 3C8YA 3CD7A 4M94A 1SJ3P 3NY0A 1PYSB 3OL8A 1M5HA 4ZPBA 2C5IT 2DNZA 1SQEA 3GMIA 1PC5A 1NK6A 4IFYA 2MY7A 4C0BA 3W9HA 3TP2A 4Y00A 3PO5A 3MD3A 4ECXA 3NGSA 2UXDT 5IT9Y 2B0GA 3CB4A 1T3OA 5DRKA 1S9EA 1HCIA 4DCOB 3BQLA 1HFAA 1T03A 3SOLA 3FK4A 5KFFA 1BQMA 3BYRA 1OEDC 2WM9A 3U3IA 1PBUA 4RUHA 3N9QA 1RHKB 4OX8A 4DV1F 2Y3YA 1YLXA 2C3UA 4X62J 5ADZA 3TZZA 2I6WA 1LNQA 1TTHB 3IRXB 3MM8B 3RUBL 4K0UA 4EB6E 4CO4A 4PFOA 3GJRB 4LF4T 2V63A 3I5AA 1N32T 3PV0F 1WKLA 3PY8A 3DOKB 1O51A 2FC8A 3C4ZA 1PAUB 4PWDA 4XO0A 2UUCJ 3CCTA 2DEJA 4X20E 2L8KA 2YQ3A 2PN6A 2UUBT 4QOTA 4GVBB 1U47A 1VBKA 1LEOA 2MQQA 3EGVA 4PG6A 2R42A 1YJWS 3SFDA 1Y5IB 3MR3A 5D4OA 3LK42 2PO4A 4LFCF 4ED5A 2OFHX 5E3AA 3AEDA 1W2IA 3AXMA 3E8OA 4TLRA 2XZTB 4JOUA 3WX4A 5HAXA 1SCJB 3CO9A 2GA7A 2KSRA 2C22A 4JBWF 3MMBA 2W4XA 5I42A 4ECZA 1X7VA 3N9LA 4JI2F 3SQGB 2VQEF 4UEMA 3M2VA 5CJ5A 1MROA 1YQHA 2MQNA 3CJ2A 1K8AT 2FZCB 4NWBA 2R7QA 1TVRA 3NEKA 1WR6A 1NWMX 2LSKA 2ZJPQ 4K4SA 1SBRA 2DHXA 3N2GE 2N7YA 1RTDB 1Z2LA 4KHPJ 4RNOA 1N0UA 2VQFJ 2Z6EA 3D6HB 2BG9A 4R5PA 3C64A 4HKQA 2UU9T 4MIBA 1N4LA 3W5XA 4NIQA 5LJMA 4KHMA 3FJ2A 1B3TA 2NUHA 3SQGA 1VRQC 3OTOT 1OEDB 3Q0AA 2EFOA 3DMJB 2HHQA 5FKYA 5LHIB 4KR0B 4LFAJ 2XQCA 1U1MA 4WYLA 5ETWA 2XMKA 3AE6A 4I6WA 2V94A 2K1RA 3ITHB 1ZH5A 5FXVA 1RTDA 4Q25A 4Q0BB 3TVZA 4F36A 2LOPA 3RJMB 2D3UA 5KFGA 3TKLB 1N88A 4JI0F 3MM6A 2NP9A 1U24A 4LVNP 2VDHA 4PQAA 3P96A 5C24B 2YU1A 1LW0B 3BQKA 1MWQA 2ASDA 3D66A 2ZJQQ 4TV8E 2CJAA 3HT3A 3UTKA 4IRDA 5ETLA 2NXUA 3ILOA 1IR1A 1J5OA 1FXDA 4AQGA 3BKUA 4KV8B 2WAQD 2W67A 2FIUA 1K73T 2DVIA 3ZN1B 1HNZF 3R1LA 1N5QA 2OMLA 3I0QA 4QR1A 4CQIA 1CJUA 4WTYA 4FPRA 4BAYB 3BK9A 2DXEA 3KLGB 4DFKA 3RIAA 1W09A 4NASA 4ZXLA 4DPTA 2QL9B 3L09A 2BJ1A 2C2KB 3SCLE 3FZFB 3ZSSA 4CLPA 2MLXA 1RTJB 4PAGA 4A8FA 2K8GA 4LREA 1SA0E 3J7YU 5TAOA 5JJBA 5GMDA 3PJ9A 1VMBA 4MT1A 3BH6B 2FYXA 2X0HA 3UUMA 4JI7J 4PXCA 2LLYA 2Y1LB 5LA6E 3QZ8A 3K3NA 4JI2T 4RPFA 4ZI3D 4FI5A 4OZLA 1NSPA 2WDQA 4U8YA 5IT4A 2YKSA 2C2DA 1FNOA 4HE8A 2MKKA 1FRMA 3RRHA 1FNMA 2C2EA 2HHSA 3MAQA 4DR2F 2E9XA 5J2NA 2CRBA 3BSAA 1XMOT 1YQ3A 4FPIA 1EHWA 1J5ET 5AXKA 2MXYA 5FNVE 1D1CA 4CLYA 1E6YB 3P3DA 3H40A 1ZA2B 3V5RA 2UUBJ 4DV3J 2VD3A 2CVEA 1G2EA 2LM9A 5KFQA 4PG8A 4PUOB 5FMNA 4COFA 1A9NB 1U0SA 2A0FB 3GLJA 4ZI3C 1U49A 3CJ8A 4LF6T 5AQJB 1Q7YT 2KVIA 2Z56B 3ESLA 4TN2A 3PRVA 2MKHA 1RHJB 2FQQB 4DV6T 3FFIA 2YEVC 1AXQA 3SWHA 2ZDPA 4CLZA 3TARA 3AE2A 1HPZA 1WC0A 3I56S 4ZZCA 2EFGA 2GO8A 4F67A 2CBIA 1SH3A 1JWWA 4UV9B 4O4GB 2OFGX 2Z2MA 2PI5A 2Q79A 1CPZA 1KFYA 3QGHA 1CG2A 3PR5B 1DTTB 1O0PA 4NEYA 4ECQA 1TZ0A 1IKXB 4ZVPB 1MWYA 1Q16B 5K8OA 3JSMA 3P5BP 1IN0A 1IKWB 3CDUA 2IC3A 2EFVA 2E9XC 2R7WA 5HXEA 5GVQA 3OTCA 4F3OA 2P9GA 3E08A 1TL3B 2J4GA 2KZ7B 1DQ9A 4C0OC 2R8IA 2XSJB 4C4WA 1S1TA 3AOCA 4QW9A 5DETA 5LHHB 2W2OP 2J6SA 4HH0A 3E01A 2MAWA 5KFZA 2BANB 2B43A 3A1YG 3HI9A 1Y5LB 4TUYE 2RJZA 2VBZA 3CKDA 4X66T 2H3RA 5E2QA 1R6YA 2J9EA 3PFEA 4UXNB 4LFAT 2JQ9A 3OL7A 3CUNA 2BJEA 2YPYA 2YNFA 1B64A 2JC1A 5LM7E 4GK0E 1Y4ZB 5D0EA 5ABEA 2WVFA 2AT1B 5J2QA 2DNHA 3ZMVB 2D1CA 2M6BA 4RX6A 3ZMUB 4OK0A 5EK3A 3GFYA 2L08A 3QO9B 1SL2A 1OQ6A 1IJ6A 2BR0A 1OIAA 4AXJA 1CHUA 4TWDA 1UPMB 3OL9A 3VR1A 3F2EA 3IR5B 2B51A 4IL9A 2ZH8A 4F0HA 4C8OA 2XYGB 4P73A 3T1YF 4ELUA 1NCLA 2LDIA 4ZA1A 4JV0A 3LWMA 2QA4S 5AQTB 2A9UA 2DGSA 3KLVA 4RW6A 3GV5B 1KS2A 1OS5A 1KBRA 3L7OA 5CB4E 5JR9C 3BB5A 3VF0B 2W9BA 2F4VT 2RIJA 3VKGA 1CULA 2VA3A 2V4JA 2KDOA 1M5KC 2G2YA 3OHAA 4E98A 5HEHA 1QDUB 1FRJA 1HBNA 3A8EA 4IE0A 3TUJC 5IM0B 4I6AA 3U1MA 4AKGA 3KJFB 1T3NA 1CC7A 2IAKA 3RHWA 1FWLA 1RTIB 3LP1B 4LFCJ 4DR1J 5L8RC 2MLYA 3AODA 1FJ7A 2K24A 2GW8A 4ZKAA 1Z0PA 4DG1A 4RW7A 2ATCB 1JLEB 3PIPQ 3THTA 3KJNB 3B54A 4QH4A 5U47A 3D6MB 3HO1A 3W2VB 1LWFA 4O44A 1SQGA 4TWFA 2GGPB 4I4TE 1HA1A 2V0NA 1KWMA 4DV4J 2EVZA 1SC3B 2GJFA 5KFSA 2DRBA 3K7RA 3UO0A 2ASYA 1V5VA 1HWLA 2HURA 2CJ9A 3MPWA 2FTRA 1S6OA 1ZEEA 2J7KA 4ZP9A 5B0EA 4YR3A 4YEAA 4I55E 3AD8C 5B0GA 3ZTQA 2LQJA 4HTEA 1B99A 2XQYA 2PIIA 2ZD1B 3M2RB 4DIDB 1JLQB 3RR8A 3N2KE 2P9BA 1SB6A 2Y1JA 3DI6A 1REVB 5FY0A 4LMJA 3V5SA 3CMES 3OPCA 3M1VB 3UPFA 2MZQA 3D7SB 5IC6B 2R8KA 3G06A 3DOLB 3OR1B 3FSYA 5BR8F 2DHSA 1K0TA 1IR2A 5L46A 3VAHA 3B13A 3CSKA 3RX6A 5KFKA 3OL6A 1QSDA 2PSZA 1K47A 3W62A 2OEJA 4B17A 1RP5A 3QT5A 1UVMA 1JLAB 1SKRA 2XULA 3DLJA 2KMFA 2VHGA 3TQEA 1OYDA 2WZ1A 4O3RA 3CCJS 1F60B 5LOVE 3EYZA 5AXLA 3ELHA 2CA9A 4DR3T 2X66A 3RH3A 1WF1A 4JI2J 3O1IA 2VFRA 1T02A 2IRYA 4JEHB 2CRLA 3OVSA 1R89A 2B3TB 4P75A 4DR5T 4EMDA 4QR2A 4URQU 5ETTA 1CJKA 2RHSB 1L3UA 2NSBA 5C42B 3GWCA 1U0HA 3HVTA 4NRUA 4WFBQ 4RJVA 2CQBA 4KIAA 3JSRA 5J1EA 1HNWF 4PK4A 1AB8A 3ZZUA 5IQQA 4B02A 4QZVB 1RAAB 3CPWR 3SSRA 4Q44A 2J6UA 3SEOA 5GAEU 3SMZA 2RE1A 4HDGA 1S9FA 5JMNA 1FKPB 2FC9A 3SRZA 1AZSA 2FGOA 1M5PC 2IJNA 3H4BA 1S7IA 1PG5B 3G6YA 2AWZA 4QYZK 1FF2A 2NWBA 2I59A 5A2QU 3IA3A 4P10A 5DLGA 1RU2A 4P1NA 4IG3A 2B6AA 4JI7F 1RT2A 3EVWA 3VKHA 1H74A 4YDXA 1DU2A 1FRHA 2WSFC 4LIRA 4JI5T 3H20A 4LRFA 1RI7A 2V2QA 3JSYA 4M5DA 3EHZA 4KP3C 1SC1B 4X62T 5CA5A 1C0TA 2HKEA 5HVGA 4HGAA 3OR1A 3OVBA 3HKEE 2XM1A 5KG1A 2HNDB 2QLJB 4LF9J 2XSFA 4JV5T 2V8PA 3ISNC 3TR5A 3DJBA 3HKDE 1WC5A 1UURA 2VU5A 3M05A 1S72S 5A6WA 2CQPA 2DCLA 3R2CJ 3P4RA 4X1IE 3IXQA 2HS3A 3KVBA 5FXWA 3UU4A 5FD1A 4U7UK 1NU4A 1WHWA 2ZM6J 1KTVA 3CX6B 2DISA 1DQAA 3VAJA 4PJNA 5C25A 5C25B 1HBOB 2DB1A 2B9YA 3PO4A 1LW2B 4GMKA 3JTNA 1TELA 3GFZA 5LSOA 4LIWA 1QVFR 3OD2A 2HHHJ 5IOLA 4QH5A 4Q43A 3ETOA 3TNVA 1KQSR 4IDNA 4ZLJA 1U7LA 3N5BA 3H4DA 3X3UA 2V9WA 2BACA 3HJVA 4CI3B 5EZYE 1BLUA 3LP1A 2MSSA 1DRZA 1HYSA 2CM0A 2QA1A 2XTLA 3Q9DA 4O4LE 1WG5A 2HS0A 1S0NA 4C8ZA 5K8NA 1PJ7A 4M5DB 1WC3A 2YXLA 3HHLC 1RCOB 1IBKF 4IT4A 3CQCB 3SFGA 3IN5A 5AQQB 3SXLA 3R6NA 2HIYA 1HNZJ 3W63A 5I3UB 2LP4A 2OLTA 4AKLA 3G82A 2YKQA 1QY7A 1T95A 2ZH1A 3N6NA 5C2TA 2XAHB 1GXUA 4B9UA 1REGX 2RMLA 2ZITA 4ZVSB 3VAGA 4TU7A 4X4NA 1KF6A 4NX9A 5EX0A 3LG7A 1TKXB 3AEBA 3RB3A 4X5TA 2XY5A 2OTLS 5EDWA 1Q82T 2NTXA 1D0ZA 2E44A 3IG1A 1JLFA 2BKNA 2UVRA 5DM6Q 2YK0A 3MF5A 4JI4F 3FEXB 4ZHRB 3H2UB 4P2MA 2XMUA 3E22E 5J1EB 2DR9A 1YVFA 4EI2A 5LJ3Y 1RCXB 2M0GB 3CGIA 2Y8YA 4DLEA 4DV4F 1F9EB 1WJ9A 2HG4A 2CJYB 4J9OA 5M2RA 1KSPA 2HBRB 1WYBA 2W2MP 4DR4F 4O3SA 4A56A 5FLXU 4C8YA 1XNQF 3LBXB 3ZMZB 2E1CA 2HGLA 1I5OB 2BANA 2MJNA 5KG4A 1YRTA 1WI8A 2B5JB 5T7LA 2UU9F 2ZZNA 1KC8T 1EAYC 1SJQA 1T7PA 3D0HE 3D0TA 1RA7A 2DITA 2ZLYA 1HD0A 4FKXA 2DNQA 5A8KA 2IC3B 3US5A 2M88A 2BJ3A 4A5XA 1B0TA 4LF4J 1JNRB 2Q66A 1IKXA 1HMVA 1EARA 3SZ2A 5DM7Q 1XIQA 5B0FA 3MK7C 2OPRA 3TO8A 2W9CB 4OV6A 1LFWA 3D5MA 3BZQA 1M1HA 4ECUA 4X65T 1JKHA 3UFCX 2OI2A 3DOMB 3TLVA 3GV7B 2OELA 4F4ZA 1S79A 4FP9A 3WZ0A 3CVKA 1LVKA 4U2YA 3PEJA 3DXBA 4XDCA 5KFNA 4NXMF 5LMNT 1S7HA 3GYXB 2ZBCA 3PW2A 4AL7A 2JQQA 3KV5A 3S4UA 3MFIA 1R7IA 3LSVA 3SQOP 5C3JA 1FJEB 5F8JA 1W26A 2DRAA 5JVDE 4N8OA 2FB0A 3MAAA 3M30A 3IF8B 2NR0A 4P71A 2MZ1A 2DNOA 1ELOA 3MD1A 4LBPA 1KK7A 1RBAA 3NKYA 4JYAJ 4HFDA 2J62A 2BJ8A 2F65A 4P2SA 2E9XB 4NA2A 1KNZA 3MPYA 3DYAB 1XMQJ 3FMWA 2YOEA 1WC6A 5LXTE 1U26A 1VR6A 3D0IE 3UN5A 3MCSA 3J7YI 1IBKJ 2Y0BB 4ID8A 4Q7AA 3DTOA 3MTKA 2DGVA 4I6YA 1TMMA 4WNKA 2GCFA 3LBXA 4WFXA 4CRJA 3ZO7A 1NAFA 4YHHF 2E1AA 3ENVA 4WK1A 5CH7B 3MZKB 3FKBA 3GIKA 3OFHA 1HI0P 3QYYA 4PEOA 4TWHA 2C5JA 2QTWA 2BRKA 3T9NA 3OTOJ 3HDSA 2JVRA 4M5JA 1HR0F 3KV6A 1VQ7S 4AXPA 3JAMY 5JDFA 2ZH9A 3V6JA 3NAIA 1D0XA 4PYDA 4DWIA 1KNRA 3IWLA 3K8VA 4JYAF 3CDAA 3WI3A 5CD4A 4KHPT 2FJVA 3PNIA 1C0UB 2IRUA 5IXUA 4ZI7E 3EPIA 2X7IA 4B3RJ 2M8DB 4MALA 1RXOB 2GV1A 4KV8A 4UOHA 2D0UA 1U25A 2ZUAA 2X68A 2YNFB 2KG0A 1D3WA 2FVQA 1K0VA 2PEHA 1SV5B 4JI0T 2XZDB 4FXWA 1UFLA 1EETB 4J9RA 3PJAA 4ICLA 2N4CA 4PNIA 3RBXA 5AT1B 1X9BA 2C42A 3H5UA 2FJAB 1PILA 3QGIA 2VKDA 3W9JA 4DMVA 5AQOB 2KB2A 4NCBA 4QKNA 4JI6T 2WB1D 4DUZJ 1HR0J 2Q1LA 1NLKL 1D9AA 2DCUB 4OZ3A 2IM2A 3CTRA 4LF2A 4Q0BA 2B7CB 1WDDA 3P4WA 1UGOA 3M1VA 2XI3A 3MGJA 3SBMA 4NI2A 5KFHA 3H42A 4CO0A 2HMIB 3OJUA 4RW4B 1F6TA 4C3MA 1H7CA 7FDRA 3JSMB 4G63A 3D68A 1WHXA 3EGWB 1FX2A 4F4XA 4AKRB 2M5YA 4K8RA 4DV1T 4J9UE 5D0GA 4PG4A 2F8HA 2RDIA 1S1UB 1ZM9A 5E3PA 2KHDA 2OPSA 1SL0A 3OQ2A 2DO0A 1B0PA 3SCKE 3QSIA 3ZMTB 2W1BA 3FXEB 2NXCA 3MKDA 3THPA 2IBKA 4PXDA 1NHKL 3M8RA 4DF4A 8AT1B 3PHEA 5HAOA 3AHPA 4C8LA 4H4KC 4XAKA 2KU7A 3CDBA 2HHHT 2V69A 1JJCB 1RBOB 4HHHA 1TQLA 4N77A 4YTNA 4PXEA 5D0HA 5F9LA 4DQPA 1FFSB 3CD6S 1XBWA 4NPOA 4MJKA 1VRUB 5F8GA 5ABFB 1GX6A 1RAFB 3FCHA 1GNKA 3J81j 2HLTA 2ASJA 2DHGA 4DMWA 1T8BA 4URGA 5KMGP 1VQPS 3LUYA 2KFZA 4ELVA 3A8KA 3R6GB 3J9X1 2FZKB 3EPGA 4JI1F 2EK6A 2XQ4A 4QPXA 4MHCA 1NSAA 3CMAS 3RYIE 4WW0A 2EKNA 2Z4PA 2ZNZA 2M2BA 4ZN1A 2OLWA 4ED7A 1HNIA 4ISTA 5DQIA 2W2UA 2V8VA 5KFTA 2LQ9A 1FRXA 5KFVA 2DHAA 2BEFA 5K14A 5ABFA 1HNXT 3VQSA 1Q8LA 2CG8A 4B3TJ 2C2OB 2HSEB 5FIIA 2M3DA 4I43B 2VVNA 2K2PA 2QYGA 2LQ5A 1U2CA 2VVSA 3VZHA 1DY3A 5DG7A 1S9GA 1YTYA 4CWBA 4P9SA 2VASA 4AE5A 5FDLA 1P27B 3T5LA 1T72A 1M5OC 3GFHA 3F44A 5T41A 4TX5A 3W1YC 2XQ7A 4CIOA 3CCQS 2JEJA 2DYAA 5J2QB 4OHFA 2L48A 3A8IA 2QE5A 4H9PC 2U1AA 1TL5A 2HQFA 1X4EA 2VPWB 4OX9T 3RYFE 3BEGB 1CJKB 2PFFB 1X9SA 3OLAA 4MFBA 4L72B 3BR9A 1NNDA 2OEKA 3MXHP 4EIWA 4DS4A 5LGNB 4USKA 3U7JA 1SKWA 2RF2B 1DTQB 4CT9A 4IDKA 1Q5VA 4BBYA 1ROFA 4NLYA 5HXRA 1EP4B 4LBIA 2VB6A 4UY85 4M5IA 3VAKA 4K4TA 4DUYT 4QHOA 3MCNA 4AQYF 2V7KA 3JSBA 4USUA 1CSJA 4WP3A 2Z58B 3PTRB 3R5GA 3G71S 4N76A 3BGRA 3W5YA 5AQNB 2DY9A 1FMWA 4M5HA 2WB4A 2G0IA 1XJWB 2VPZB 2YKNA 3DRRB 1TUWA 1SV5A 3LGMA 1RAOA 4KQZA 2BJ7A 3GB0A 5LMUT 4J9NA 2ZH5A 5KX5E 3Q5WA 1L3TA 3LGHA 4WWSA 1YRUA 3UNYA 4NE9C 4U2ZA 1NZAA 3D67A 3EI0A 1U6BA 3DM2A 4K0KF 1EIYB 4MKBA 2HNYB 2V1DB 5AFUL 5EGYA 3OSPA 3VR8A 4UTGA 2HPJA 3QJJA 1QAIA 1C0UA 1X8DA 2ZM6T 3QFWA 5JR9B 4ZVHA 4KGXB 2DNRA 2X9WA 1HF8A 3CCSS 4JI1J 2JMHA 3LK2B 2WB5A 4XPCA 4ZEYA 1LWFB 1Q0NA 3AOBA 4RUCA 2XLJA 1DZ5A 3J7A1 1U1OA 5BR8J 5J1GA 3RB0A 1Q95G 1S6PA 3PXGa 4Y2IA 2BBJA 4OZ5A 2LA6A 2LKGA 1U1PA 3KDOA 4KE5A 2EBGA 1BR1A 4MMOA 3M2VB 4OX6A 3U78A 2VDIA 2W00A 2XNQA 3H2LA 2LEHA 5LGTB 1E6VA 1VC0A 1OY9A 5F41A 2XSBA 2D2SA 1HNXJ 3D1OA 2DRDA 2YWKA 1D09B 4ID5A 4OHWA 1JX4A 4NA3A 4U74A 4GKJF 4O3PA 1AFIA 2VL8A 2I5JB 1XNRF 2OV9A 4KX6A 3LP0B 2V4JB 4FYDA 3TLWA 4ES1A 1U02A 5HVHA 2IMOA 1N5YA 1RYSA 1GTEA 3KJVA 4DV6F 3D0GE 2VG5A 2L3MA 1OWAA 4XK8C 4PJJA 3GR0A 2WBMA 5D4NA 2GMLA 2CZ9A 1S6PB 1T9WA 4RW6B 3LWLA 1FERA 4IR1A 3IEEA 4DCPB 3NS7B 1SQFA 2DWGA 3AJDA 2EBEA 1FWKA 4CO1A 2CQ4A 5CQGA 2JSXA 3CJKB 4QU6A 5H1SV 5BMVE 2LCWA 3HHKA 1QE1B 4UZCA 1BR0A 3EVMA 1H2UX 5KG6A 1TAQA 3NNCA 2CWYA 2CQCA 3FZBA 3WQPA 4DV7J 5AXMA 3LP0A 4HTIA 3WC0A 3AQPA 5KTQA 1YKEB 2FHJA 3KG4A 4HFEA 1J2VA 4EYUA 1WI6A 2J7UA 2NTYA 2WAUA 3I32A 2OPRB 3M8PB 3HA4A 4WU2A 2ZZMA 5EX3A 5J2UE 1HMVB 5CYQA 4ZPWR 2VJVA 3TOQA 4HFHA 3VGSA 4DVDA 2XS5A 2FJWA 4ED2A 2VQFT 5JDQA 1NK7A 3ZEFB 3EDQB 3JTOA 1VCTA 1B0VA 3HD1A 3R7NB 3FZLB 2XSJA 4KYZA 2Q9QD 3TYTA 2LKHA 5KFMA 2R4FA 3GIRA 5T7LB 2AE9A 4RW9B 4ZCMA 2WDRA 3TUIC 1X4FA 4IDKB 4PWUA 2ATLA 3BR8A 1DTQA 2O1PA 2CNKB 4U33A 3UDCA 1D1AA 2BG9E 1T94A 5L3EB 5IC4B 2DK2A 2OHDA 1DJ0A 4URSA 2PFVA 2LQBA 4TVAB 1A6LA 4YY3F 3G9CA 2E9XD 2L9QA 2UVVA 2V4RA 1OPZA 4EZ4A 2EG1A 4EO6A 1R6VA 2J7WA 5D3GA 2Y6XA 4IHJE 3JYTA 2WVCA 2YDQA 5E3RA 3RGLA 4WJBA 2LRKA 3H0PA 3NGRA 1VISA 3BV8A 2H88A 1NB7A 4UV8B 2VWAA 3FBBA 4JUZA 3K5LA 4QWEA 3HD2A 4LSLA 2FUPA 3CWZB 2LQ8A 4B3TT 2DT9A 4WYWA 1N5SA 4XDDA 2DCFA 4XTTA 1LV5A 3BYPA 3KNAA 2FLOA 4TZ4C 4B9MA 4QCLA 5HCJA 3I82A 4CYUA 3R3TA 2BJDA 4GYRA 4DUTA 2V6YA 4DV0J 3G82B 2LXIA 5KDMC 1IXKA 5FL0A 2ALYB 3LDQB 1DBDA 3KHRA 4A97A 4F26A 4IKAA 3AVRA 5A1LA 1MIWA 3HHLB 1ZOYA 4FYYB 2X9XA 4ECTA 2GO9A 2NSCA 1SC6A 3PVXA 3FXDB 1D0YA 1G4CA 2GJ2A 1N54B 4I69A 4RLEA 3UN3A 3KG1A 1UX5A 4Q8FA 4I68A 3DRYA 1XQIA 3I0RB 4DSFA 1YZ7A 2XYHB 2HFNA 4B3OB 3W7BA 4B3MT 3EDUA 3QIPA 3PUSA 4UELA 4HHJA 3C14B 1TK0A 5BYSA 2DNKA 1FDBA 4DBQA 3O2IA 3MA9A 2X9YA 3H5XA 4QX8B 2WRMA 3PKYA 2XYPB 2F5GA 2C3MA 1ZPVA 2UUAF 4ASKA 1LKZA 2AJ2A 1RTJA
chains in the Genus database with same CATH topology
3KXDA 3L4BC 2AEFA 4J9VA 2OLTA 3RBXA 4J9UE 4G65A 4EI2A 1SUMB 2IIUA 1VCTA 4L76A 1LNQA 1T72A 3JXOA 3L39A 2OGUA 4J90A 2BKNA 4L74A 4Q25A 4L73A 4XTTA 4YS2A 2AEJA 2BKPA 4RO0A 1T8BA 3RBZA 1XWMA 2BKOA 2AEMA 4J91A 2I0MA 4L75A 4J7CA 2FY8A 4GVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXD A;  3L4B C;  2AEF A;  4J9V A;  2OLT A;  3RBX A;  4J9U E;  4G65 A;  4EI2 A;  1SUM B;  2IIU A;  1VCT A;  4L76 A;  1LNQ A;  1T72 A;  3JXO A;  3L39 A;  2OGU A;  4J90 A;  2BKN A;  4L74 A;  4Q25 A;  4L73 A;  4XTT A;  4YS2 A;  2AEJ A;  2BKP A;  4RO0 A;  1T8B A;  3RBZ A;  1XWM A;  2BKO A;  2AEM A;  4J91 A;  2I0M A;  4L75 A;  4J7C A;  2FY8 A;  4GVL A; 
#chains in the Genus database with same CATH top