1VCTA

Crystal structure of putative potassium channel related protein from pyrococcus horikoshii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
193
structure length
193
Chain Sequence
b'YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH0236
publication title Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 69
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 1vctA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 1vctA02
3RBZA 2IIUA 3L4BC 4J90A 4Q25A 4XTTA 3L39A 1T8BA 1XWMA 1T72A 1LNQA 4J7CA 3KXDA 4EI2A 2OLTA 2BKPA 3JXOA 2BKNA 4L73A 4RO0A 4YS2A 4J9UE 2BKOA 2I0MA 4L74A 2AEFA 2FY8A 1VCTA 1SUMB 4GVLA 2OGUA 4J91A 3RBXA 4J9VA 4L76A 4L75A 2AEMA 4G65A 2AEJA
chains in the Genus database with same CATH superfamily
2B5JB 4GKKF 4ZZCA 3HVWA 4J5OA 1E6YA 2XQ6A 3GMIA 2O5DA 3BH7B 3Q5WA 4JI1J 1X5PA 3ZT5A 1NNDA 1FK9A 3K1SA 3M8PA 1BC6A 3R97A 1TQLA 5BMVE 4P10A 4TXSA 2VQET 2K7JA 3HHLA 1IKVA 3MJXA 2BVZA 3ZKRA 4Z7YA 3VAKA 3A8JA 5ETSA 4IG3A 3TLUA 4X4UA 3PUQA 2PD1A 3GFXA 3M4XA 3QJLA 1RTZA 1PBAA 1RWMB 2ZC4A 4ZJOA 2CQ0A 2G0IA 2LRKA 2FQQB 2LXFA 4YSYA 2V2VA 2VKHA 2AWZA 5JVHQ 4OI2A 4QR1A 4GVBB 4IRDA 5J0ZA 3GZ7A 3AA6B 1AJ3A 2QA4G 2C3MA 1R8CA 1RA7A 4MH8A 4CNZA 4R8UB 2XQ7A 3DLGB 1UKUA 2FJDA 3DCAA 3PW5A 2MQPA 2LM2A 3AE9A 1BWVA 3O1JA 4Y6IA 3P4PA 3RJMB 5DS7A 3EMTA 1W25A 4IDQA 2DI4A 1FCAA 2GMLA 2QSWA 2DRBA 4ANCA 4UOFA 3M2VB 2OPPA 4J9PA 2V68A 4MKYA 5F8MA 3LALA 1FD2A 2A2FX 3RTVA 2XHCA 1CS4A 1FFWB 3LH2S 3UN5A 2R7VA 4NI2A 2FPHX 2RU3A 2BG9B 4ECUA 3TLWA 4OZJA 3FEXB 3HX9A 4YFSA 3H37A 4A5XA 3GP9A 4NLRA 1TL3B 1XNQT 3UULA 4K2JA 4A8FA 2BJDA 4IDZA 3CK6A 4UUXA 4RWXA 5FY7A 4DHVA 2KINB 3QYYA 2J9DA 3FXEB 4X65T 1NWMX 3KJVA 3ZMSB 5L39A 2FUG9 3AA0B 3KG0A 4A56A 5H9FJ 1EP4A 1X4AA 3OFGA 3P6YC 2CXFA 3AEFA 1QY7A 2XTJP 2NPFA 1WR6A 3LGNA 5HEGA 5ABFB 1XN9A 1WKLA 1CG2A 3WX8A 2YPZA 3OPKA 1U4BA 1KKHA 4M5DA 1RAEB 4IH6A 3CB4A 3KG4A 3W8GA 3I5AA 4DOZA 3M1VA 4ZVHA 4JI3J 1IJ5A 4HFCA 3MI7X 2IM3A 4ECVA 4BJNA 5FXXA 4ADZA 1CPZA 1JIHA 3GIRA 4ES2A 4JI1T 5HLFA 3CX7B 1FXDA 4CP5A 5B09A 1JJHA 2AMCB 1H7WA 3P8CD 3ZN1B 5CYMA 3OR1B 4NCGA 1SKUB 5LL6d 2IMWP 2ZVIA 4NYPA 5JUMA 1S1VB 4ISSA 2UXBJ 2LA6A 4AXJA 3TZYA 3A13A 2HZVA 4DV1T 3PCOB 3V4IA 4I50E 2ASYA 3UUBA 2HPJA 5JRCA 3JYTB 1NEKA 5F3TA 1ELOA 4EOZB 1I94F 5EWGA 4RNFA 2F8EX 4QPTA 3KVAA 4E2FB 2HHUA 3OW2R 4CLFA 2Y1LB 4FNHA 3CJ2A 1SH3A 2AZ1A 3G06A 3TR5A 2MYFA 4CXYA 3BR8A 1GK8A 3MDFA 3AE3A 2BJ9A 3RC3A 2HKEA 1OWAA 4IDNA 3Q0AA 3TQ1A 2Y8WA 3WX4A 3LWMA 4DX7A 3NBPA 2D0UA 3KUHA 1MNDA 1WR0A 2I38A 1H74A 3ABVA 4BCAA 3RIFA 1IM4A 4K4UA 3VZHA 5D3GB 5IC4B 3ET6A 3TLTA 2C3OA 5A0YA 4UY85 3J80Y 4UF0A 3SZ2A 4QQBA 2R9LA 3FXDB 2OPSB 3OFHA 4HFIA 5HBMA 3CJ5A 3T1YT 2GNKA 5C3JA 4ILBA 1TKXA 4M1KA 1NU4A 1KHWA 2LHNA 2OLTA 2LT3A 4RW4B 3P96A 4I55E 1OQ3A 2LSGA 2XULA 3NNAA 4OL8A 2GK9A 3AB3B 5KFFA 2QGFB 4YHHT 5ADXL 1IQZA 2JRKA 4O4GB 1SJ4P 3RU0A 2D41A 3PEJA 1BQXA 5K8PA 3ENWA 5EUHA 3H3MA 2X67A 1LKXA 4EFAC 2OP5A 2C5JA 5GONE 4DN9A 2XMAA 2BVMA 4RW6B 2GQ2A 2V6YB 4FF4A 1A0OB 2W0GA 5FD1A 4XPEA 1LV5A 4Z91A 4Q0BA 2P8IA 1OO0B 2HVIA 2Y8YA 5HXSA 3ZZZA 2MKCA 1FEWA 3CMLA 1N36T 3MM6B 4DFKA 3NL0A 2XAQB 4KPCA 3PR5B 1T9UA 4HI1A 3M6WA 2RQMA 1CJKA 3ZZRA 4YN3B 1UEVA 2QTWA 2VKOA 2KMFA 3ZZ0A 2EEYA 1BQNA 2XZDB 1OYDA 4J7CA 3DOLA 4UOGA 3C15A 4TX5A 3RAXA 4TV9E 2XMUA 1D09B 2ZHAA 2E5LJ 3WC0A 2CHNA 5ABGA 2CXEA 1Q5YA 4DV7T 4FYVB 1HG2A 4A8SA 2M2BA 2N82B 2I2YA 3BDPA 2E9RX 4PWDA 1T9XA 5AJ3F 1TL7A 3RPUA 4K0KT 1NUEA 2GS8A 2B51A 1TR0A 1FWKA 4MBQA 2GQQA 2E1CA 1M1GA 2DH7A 3QB5K 3W2WB 3FZMB 2VUGA 1NAQA 3BZQA 3KLEA 5KFSA 2HHXA 3TRGA 5IV3A 3TUIC 2IA0A 2VG6B 3PIOQ 2OAUA 1WFDA 3MMBB 1O6XA 1EJ7L 3DN9A 5DQGA 4O4IE 3PY8A 2GHWA 1SL2A 5DGBA 4WFXA 5I3QA 4KHPT 2FGOA 3QK6A 1T8EA 5A6PA 4N7TA 5FXZA 2DR9A 4KKOB 4ZN1A 1W9RA 1FJCA 4K4WA 1YJ9S 3EXYA 2BS2A 3ZSTA 4OYJA 2JRSA 3WDOA 1N0UA 1F9FA 3M65A 3KLIA 3I0RA 4RPFA 3I31A 3T19A 2D74B 4QJVA 2XNQA 2HPUA 1MU2A 5F8PA 5AQFB 5LJ5Y 1LWCA 4FF2A 4DUZJ 3QO9B 1KRPA 2JC0A 4IE5A 3PW2A 4AISA 2AQ4A 1XIQA 2YNHB 4DX5A 4AUKA 2QYCA 3BN7A 3JQKA 2E5GA 2J8AA 4DV6T 3UU8A 1FRMA 1NZAA 5CD4H 2V8DA 1KHVA 1RT2B 3VWSA 3DRPB 3MR3A 1ZEEA 4DV2F 3UDLA 4HTIA 4DV0J 1JJCB 1SA0E 2RUSA 3ETVA 4BDPA 2E66A 2YX4A 4JYAJ 1IBMF 3QBCA 4Y2IA 3SMZA 5I3UB 1AZSB 2JFKA 2ZH5A 2Y1IA 4TY8B 3V81A 1QAYA 1PIEA 5F8NA 4DR6J 1Y4ZB 4V1Ak 2H7VC 1YG0A 1X4CA 4LVNP 2OEJA 4A47A 4KUMB 5K8OA 2J6UA 1X4BA 5HEHA 1NPRA 1TKDA 3AE6A 4WXWA 2G4BA 4IUFA 4OJGA 3LK42 3OXLA 3CVRA 1XDOA 3HT0A 2E5VA 3Q5DA 4CN4A 1HR0F 1LWFA 1FFGB 2BE2A 1YJ7A 4H4KA 2QE5A 4OYPA 2BW7A 3A3OB 1SQGA 1XMQT 1VJWA 1GNKA 2XPKA 3AA1B 1WHYA 5M4YA 1KS2A 3JC6D 4ID5B 4CO2A 3KFWX 1SUQA 2D3ZA 2YWFA 2V9KA 2HVEA 4YUDA 3L39A 1WKJA 2DH9A 4TU8A 4P2MA 1S9EB 2M9KA 2DNNA 2RIJA 1Y5NB 1C1BA 1RHQB 3GFHA 2QLXA 3PUSA 4FXVA 3B6BA 1YBTA 2D9PA 4LSLB 5JR9A 5IV4A 2HLTA 3SCKE 4I6YA 4ECTA 4YJ3E 3KKFA 5GAGU 2F4VF 3T1HT 2B76A 3CO0P 4ZHRB 1D0EA 4NXMJ 2E5JA 1QD1A 4KV8A 1DU2A 2ZUGA 4IT4A 4UF4A 2F5GA 3M05A 1KNZA 4Q8FA 3CW2C 4PG7A 5L3GB 1WJ9A 5D0HA 2YNIB 2KXNB 1LWEA 2HPLA 4UT4A 4DS4A 1IBKF 4X20E 4ZI3C 3OLAA 1Q1KA 2M88A 5IYZE 4CLPA 4WXOA 2UUCF 2FZGB 5EWEA 4MFRA 1NCLA 3JXOA 3MMCB 2I0XA 2JH3A 4X4PA 2AEFA 4ZCMA 2LOSA 3P45B 2UUBF 4CXXA 2ZEJA 1A9NB 2B9YA 4PABA 1NZ8A 1N5SA 2DHAA 3G9CA 2XAFB 3UE2A 1VQ4S 2ACYA 2FLOA 4ID8A 1UVMA 2GVDB 2XSJA 1DHMA 4DR6T 2Z56B 1YD8G 3A8IA 4XO0A 1VHIA 2XG8A 2XLIA 1CJTA 1OPZA 4J9RA 4PQUA 2NZ4A 3D6HB 1QLBA 5EN1A 1PKUA 2GX8A 4PJMA 1SHZC 2R7RA 3MUTP 3QZ8A 1YVFA 3E22E 3NGKA 1NK9A 1NJWA 1VQSA 4A8KA 3V4MA 3IBWA 3RRKA 4CLSA 5FVKA 2IM0A 2K24A 3CJ0A 2UXXB 3R5AA 4NLXA 1SJQA 3ZNJ1 2M8DB 3PX6A 2JJ4D 1VFJA 4HDGA 3M8QA 4DPOA 3MTKA 4M5JA 2KJVA 3MXHP 2JHEA 3U27A 3D0HE 1ZHCA 2CJKA 1HNZT 3MMAB 2ES0A 2M52A 1D9AA 3QQCD 1MMNA 3B82A 2UXCF 2KTQA 4RR5A 1HYSA 1C4AA 5J2TE 4C3KA 5F3JA 2OO4A 2DXDA 4PYAA 1BLUA 3LSVA 1R0CB 5L4HA 2J9DE 5FDLA 2CWYA 1N34J 4OI3A 1ULRA 2B0GA 1LW2B 1IQTA 4JI4F 3E2EA 3CC4S 5A8KB 1B3TA 2L48A 4IRKA 3SV3A 2ZM6J 4U74A 4DSFA 1JLFB 1FEEA 3BSOA 1FNMA 3KLFA 3N28A 1O8BA 3IG1A 2XYPB 2FVQA 2J76E 1J2VA 3ZEFB 3D7SB 1R43A 5LB7B 3QLHA 3MEEA 3CJQA 5B0EA 4E0DA 5DABA 2W4PA 3KG1A 3SEOA 2LLZA 4C8YA 5IHYA 5KG5A 4JV0A 4O0IA 1IJEB 4LUBA 4ECZA 4KBMB 3SDEB 2W2NP 2XGPA 2IBOA 3MD3A 4YEAA 4ED3A 4DR2J 2H5EA 1OPIA 3PUGA 1WTFA 2IUBA 4EBDA 2CQ1A 4PFOA 1AFJA 4YLHA 4OK0A 1T9TA 1HBNB 1C0UA 3R5GA 5E3PA 1MIVA 4YTNA 2UU9J 2DPJA 2QRXA 3ZTOA 2GAHC 2WMOA 4P09A 3FCWA 1JXEA 3VF0B 3CX8B 4RBUA 2AGOA 5LBMA 3KBTA 3ZTRA 4PG6A 4NMXA 3DI6B 2Z8QA 4G65A 1TK8A 2AIRB 1YJVA 3OUYA 3QC9A 5D4NA 1KFYA 1NJYA 4DUYT 1SC6A 3N9UC 5F0WA 3T6BA 2KVQE 4U7UD 3BB5A 5K8MA 1ZTTA 1RT7B 2X7IA 2HAIA 4YR3A 4X1IE 2P9CA 4F36A 4K4YA 4LR7A 2AEJA 1PCAA 2FGCA 1AYEA 3BGRB 3DM2A 4MFBA 5JQGE 5KFMA 1X5SA 2ZD1A 2ADBA 3I9YA 2YXLA 3GCWP 2IDEA 2Y0SD 4C48A 1TVRB 1YXRA 5LSRA 3UN2A 2J9CA 5L47A 5J2PB 3HHNB 1NJIT 1U2CA 2RUGA 1KWMA 1RACB 5D77A 3W9JA 2MQLA 5A8RB 1RT4B 4O4HE 3IEEA 1VR6A 2DGSA 3PRDA 2W9BB 2P9GA 2QG9B 5L3CB 2HFZA 1XEZA 3DOMB 4IH5A 3KV4A 1ZPVA 2PO4A 3CCJS 1M62A 1FKOB 2YPYA 3LO3A 4ZVGA 3QIDA 4I68A 4LF8J 3SFGA 4CI0B 2Q1LA 1NXIA 1U0HB 2G2YA 2VB6A 1WF2A 2JLGA 1EQMA 3VRBA 3K8PC 4DR3T 1XNRJ 4DCOB 1KEYA 1WG4A 2C2OB 1AROP 2ZH9A 2AT1B 4Q8EA 2H51B 2WSSV 5HVHA 1OEDA 4X64J 2XI3A 4HWCA 1RT6A 2FHJD 2C2NA 2A72A 3UNGC 1SBRA 1HWKA 2XSAA 3ZYLA 5ETOA 4GO5X 2MOZA 1HNXT 2IVYA 1S9GA 4ZLLA 3CC2S 3PDNA 2OIHA 3HFZB 3HHEA 2XS2A 4UTGA 1UZDA 2RHSB 2KG0A 4PJLA 2BJ8A 3O5TB 3GG1A 2WU2A 2FD2A 5HEUA 1R6YA 3CDAA 2DT9A 1FVSA 4WKYA 2NW7A 1K47A 3A3PB 5C2CA 3H5XA 2CJAA 4ZVRB 3UD4P 3LP0A 3QZ7A 3TJ8A 4CWBA 1YBAA 1XWLA 3OXGA 1F2GA 3LP1A 2EC0A 4EGLA 2ZFHA 2VL0A 2I6HA 4ZPCA 1Q78A 3CO9A 4LF7T 2HS4A 1IKXA 1QSSA 2QSFA 4WYLA 1DFDA 1RUSA 3F0NA 2EW9A 3HP6A 5DLFA 4CXWA 1Y3JA 2HIQA 4J9OA 5JTGA 2NTXA 1WDDA 3AE4A 4AFFA 2Q9QB 4WE1B 4CRJA 3KHRA 2V7LA 3EPGA 4K4XA 1PYOB 3ESLA 5DG7A 2DHRA 3QGIA 3MA9A 1RHUB 4NA1A 4OX9T 2W2OP 3SQGA 4LF9J 5A6WA 2DGVA 2WONB 2P9EA 5IQ6A 5CA0E 4ZI2C 1YLXA 3OFEA 5F41A 3CMAS 3MCOA 4U72A 2VKZG 1VOMA 2GIQA 3F57A 2W9CB 2DD8S 4MK9A 1RP5A 3ZLIA 2I6WA 5J1PA 3LP2B 4JB8B 4F0HA 4OX7A 1W0BA 2XQ3A 1LVKA 4GRSA 1UWBB 1CJVB 5HXRA 1O5JA 5IWAJ 4S0MA 2V4JB 5KG2A 2GHPA 2J0QD 1FE0A 3MECB 1HI8A 4LF8T 2EHOD 4P9SA 1N32F 2VD3A 3KVBA 3V6DB 4UVBB 2IJFA 3IBCB 2V8PA 1S0MA 2NXJA 5BYRA 1QLNA 2Y1RI 5ETPA 4KGVB 4X4QA 1J5OB 2DVIA 1ZYQA 5F5WA 2VVSA 3A8EA 5DDPC 4X64T 3ZT6A 3ETMA 2DO4A 4DQIA 2DHXA 2JC1A 4BHQA 1RYRA 2H3RA 5LGNB 1CJUA 4GMKA 2UXDT 3UCGA 2DNHA 5LNKA 3WIVA 4K5RA 4ECSA 2YN6A 3CD6S 1UL3A 1LFWA 5AE1A 2CAJA 4B3RT 1MMLA 2WHOA 3CT9A 3K5PA 1B4SA 3J7YU 1UVLA 1K44A 2QYGA 3L3PA 3QSIA 5T41A 3VAFA 2VFVA 1OWXA 1M1KT 4DI6A 2L8KA 3ZYMA 3LBXA 2WVCA 2ASLA 2GGPA 4FF3A 3B5MA 5HK4A 2DGUA 2W24A 4NCBA 3KUGA 3G6YA 1S9FA 1JLCB 1S1XB 4NLVA 2O3DA 1UCNA 4HHHA 5HI7A 1NHUA 3I5CA 1DAXA 4C91A 3FBFA 4W4MA 4WU2A 2H5JB 2Z57B 3E08A 2OGUA 1D0ZA 4M63A 2VA3A 1WWHA 4F8HA 2QO3A 4TYBA 1ZZFA 3MEKA 3ZPOA 4IDOA 3PEHA 4NZ0A 2V8GA 4UQTA 4JV2A 3B13A 2JL9A 2VG5B 4KC5A 1YZ6A 1Q95G 1CEZA 3NKYA 2BBJA 3LQVA 4HGAA 3KDNA 1U48A 2JEIA 1S1TB 4WFYA 1VLOA 4OZ0A 3H4BA 3PACA 3DGPA 1D1AA 3QT8A 2NUHA 2KM8C 2A3DA 3C4ZA 3OVUA 1NKBA 2BM0A 5CYQB 5KOWA 4DR4J 4AIUA 3N01A 3MM8A 5IWAT 2L3LA 1KOOA 4CTAB 1VQPS 2B9EA 2HBRB 2HGNA 1WOSA 4TWDA 1FMVA 8AT1B 3OD2A 3FHNA 3R5JB 2W7PA 2E7WA 4XPCA 5J2QA 4EU0A 4LF4F 4FXDA 3CTRA 2ZMAA 5HO4A 3HLUA 4YR0A 1XWMA 3TA1A 4JI8T 3RGLA 2DR7A 1U45A 5KTQA 2JZ5A 3V6JA 3CWJA 5ETTA 3NAHA 3FVYA 5HAOA 5LMNT 3C19A 1RWOB 2KDOA 1ZS6A 2KT9A 2CE7A 2YDQA 3QRQA 4B3TJ 4OYAA 4U7CA 1CULA 5HP1A 3OR2A 5CA1E 2FJEA 1HPZB 2B4VA 1ZM9A 2BE7D 2OLWA 4C8NA 2FJWA 4ZIVA 4X66T 2VFUA 1HCIA 2OTLS 4I2PA 3NCQA 4JI0T 3BPDA 3MMJA 2YH0A 5KMGP 3QMQA 3I4PA 5E3CA 2K3IA 4GC6A 2RDIA 5ADZA 4XIUA 2MZSA 1Y7PA 2H1YA 2ZZMA 3NWRA 3WQPA 2HHHT 2Y6XA 2M3DA 5GAHI 3GN5B 3Q8VA 4JI7J 4GOUA 4OI4A 1PSDA 5HROB 5DG8A 4X4NA 1ZOTA 3RRHA 2XMVA 4P75A 5AE3A 2D3UA 1S0VA 2DBBA 3NGSA 2OMOA 4PG5A 5KFQA 1RAJA 1Q81T 2K2PA 1KFDA 3VALA 2B9WA 3IWNC 4CO3A 2CJXB 3AH6A 4L76A 3DRSB 3EGZA 2A3JA 2O66A 2OD6A 1N33J 2HQIA 2PEBA 2OPRA 4DV4J 5GMEA 3RAQA 4G6VB 5JDHA 1KC8T 2OFGX 5KT3A 2N4DA 3N9PA 4H4MB 1CBKA 1VBXA 3A1YG 5KDMC 3MK7C 4A8XA 1VRTB 2HZAA 3EDQB 4ZJLA 4HR2A 1Q53A 1TKZB 5TAOA 5F0UA 2JLEA 3PU8A 4PXEA 3KJQB 4JI6T 4M5IA 2PC6A 3C6TA 1A6LA 4JV5J 2DCUB 1MROA 1VS3A 5GAEI 3KLHB 4AL7A 2D7SA 1X4DA 1W2IA 2HNDA 3THVA 1YJTA 2J9EA 5FKYA 2RD5C 4IREA 3CJKB 3GYNA 5CABA 3GONA 5KG6A 5KG7A 1SV5A 4C0HA 1I1GA 2XMKA 3EE3A 3Q89A 4OMFG 1VDHA 3MFIA 3K59A 3M9MB 3IWLA 2KT2A 4B3MF 1S72S 1XDPA 5B7WA 3DP7A 3IF8B 3CCUS 4F2SA 3EVMA 2DR5A 2OD4A 2FHOB 1HMVB 2EWHA 2MB0B 4HEAA 3NOGA 1RKIA 2BJEA 5A2QY 3GPAA 3E51A 2XUEA 3PKYA 3PW7A 2HHTA 3KHLA 3AEBA 4OHWA 3BJYA 1PYTA 1S4EA 3FEYB 1FJ7A 5AXLA 4WIQA 2AJ0A 4C3MA 4NMLA 3M9NB 1FE4A 1KONA 2D9OA 1E6YB 4EO6A 4DMZA 3FZFB 3Q86A 1MWZA 2C3YA 2EFNA 1J5EJ 1D0YA 2BDEA 1FK9B 1DURA 2BXJA 2GMHA 3M8PB 1PAEX 5GMKa 3HM9A 2HFOA 2F1FA 3BBCA 4DFMA 1RTJA 2A0FB 2V7MA 4TNWA 4DV5F 4BC9A 4P72A 2RQKA 2GW8A 3KLGA 3J81j 1YQHA 4C6AA 1Z2LA 2R7QA 3D4JA 3G82A 5CH7B 2YOEA 3TWZA 4JI5T 2YBVA 2RRAA 1EETA 1PJ7A 3U02A 1R3NA 1JLQA 4X1YE 3MF5A 3TZZA 5BR8F 2M6BA 1U25A 4JEHB 3AAWB 3CJ8A 2V2QA 2C5KT 3NS7B 2YWEA 3UCUP 1D8YA 5F8JA 3PUXF 2VOOA 1IM6A 3PRBA 2OEMA 2ZC3A 2QMXA 3UTKA 2MTLA 4LF5F 1HNIA 2FJDB 1IVZA 2OTJS 4B9MA 2W01A 4XBFB 2EKYA 2WZHA 4DPWA 1RCXB 4USUA 5IT9Y 2ZBRA 5LMUF 2A10A 1M90T 1X8DA 2IAJA 2WVEA 5AE2A 3WIUA 2W1BA 3HKCE 3E01A 1WNEA 3D0IE 1OEDE 4L9IA 4B9SA 4DSKA 1K9MT 5JVGQ 2HQDA 2XQCA 4JV5T 4NI2B 5F8LA 4DU7A 2VIHA 1UX5A 2V67A 3G4SS 2QFIA 2V8VA 5AQVB 3GA8A 4LMZA 3CCSS 3UW1A 5HMYA 4UVCB 2VZ9A 5AXMA 2M6IA 2V5DA 2VURA 1UPPA 4NPOA 2QA2A 2UUAF 2NP9A 3SCIE 5BYSA 4YY3J 2ZE2A 3JTOA 4URSA 2DXEA 1WC3A 5C24B 1G3OA 3HHLD 1YIJS 4FVCA 1EP4B 4KT0C 2IM1A 1B7FA 5DGAA 3OL8A 4NLQA 4ASKA 1WC1A 1KLNA 3UU3A 2NYHA 2BQRA 4JUZA 3LA0A 2KZMA 3AXJA 3W64A 1HNWT 4M5DB 2W2PP 4RUCA 4LBHA 2LQ5A 3M1VB 4IGUA 3R1LA 5ETKA 3EGWB 5HLFB 2PG8A 1Q86T 1G8XA 4U7UK 3FGVA 3HL6A 4USMA 3JAEA 2HEKA 4EO8A 5D0GA 2B56A 2XMWA 2RS8A 2BRKA 4LSZB 3NGTA 5HVFA 1RHRB 2M7SA 4DR7T 2VBWA 4JOUA 3H98A 3F2EA 3DGVA 4M95A 3O2IA 3VV2B 2PSZA 1YX2A 2RSQA 3VGTA 2XM2A 2XSFA 3HD1A 3MGJA 2J47A 2JQKA 1NB2A 2BANA 3PJWA 3DOKB 1RA6A 5AQNB 2Y0BB 4V19J 4DX8H 2DRAA 4IE7A 4USJC 2I9SA 4BS2A 4YB5A 2Y8DA 3DC2A 4ISTA 2W7OA 1WC5A 2DNOA 4LBPA 3QIPA 4ZI7E 3JTNA 2H5IB 1KQSR 2C5IT 1NLKL 2DHGA 1NKCA 1OY9A 3M2UB 1SC4B 2DWKA 3NBPB 2IMLA 1TMMA 2KZZA 1ZA1B 4PXCA 2Z4PA 1RT1A 1RKJA 4O3SA 4ITSA 4R5PB 2LXUA 1ZETA 4HACA 1GTEA 1XQIA 2EPIA 1S7IA 1WRDA 1KLMA 4PQAA 1KVKA 3IGNA 3I9ZA 3W61A 2VONA 4FNIA 1RTIA 3MM5A 5LHHB 5HBMB 4QWCA 1IKYA 5G0RA 1TKXB 3ISZA 2LXIA 1JLEB 3UUXB 1WLXA 4ECQA 2KLQA 2CQPA 2R2UA 1IN0A 4O23A 4AQGA 5FMNA 4B9LA 2NXUA 2ZBCA 4NLUA 1TV6A 1HIYA 2G1DA 1RTHA 2HVHA 4DBRA 1S6UA 4X65F 4RUAA 3BBFA 4U31A 3GJQB 3K2YA 2CNKB 4GKKT 2WY2A 4ZPVR 3ZZUA 1RAAB 2I0MA 5CZXA 2WBRA 1FD8A 4GVLA 3I0QA 4Q0BB 2AGPA 4UEMA 2XS7A 2QN6B 4LFAJ 3R8YA 4UV9B 2QL5B 3BGOP 3M2RA 3DXSX 3EZ5A 3CCQS 1BE4A 2HRUA 1N6QB 4NLSA 4QZVB 3HO1A 4MIBA 3QNUA 4ZJQA 3QJPA 2L9NA 1CJKB 5T14A 3NXZA 1HS7A 3UU5A 3RH3A 1FA0A 3JB9k 2HW3A 4AQFC 5J1EA 1RWVB 1XERA 4ED5A 2XYHB 1UJ6A 3AFGA 5LXYA 4TN7B 4ICLA 4FYDA 2YU2A 4P0AA 2LE8A 5KFWA 3G2XA 2X68A 3W3SA 4IFVA 4X4TA 2AJQA 2F9DA 4HLBA 1HWUA 1TL1A 3OJSA 2DGXA 4KI0F 2LCWA 5M2PA 3RR8A 1TUVA 2XJ7A 3KLEB 3ILLA 3FNNA 5HQLA 2CHOA 4ED4A 2H4WB 3FC9A 3TUJC 4OZ3A 3IFEA 4DR5F 5L3EB 2WVBA 2RF2A 1GXTA 2NW9A 3O9XA 5KT7A 1RCOB 4HFDA 3I9WA 4OZ5A 1B0VA 3ENQA 3DRYA 4ELTA 3BGFA 2IFXA 4Y2CA 5E3RA 1SH0A 3CCVS 3RKOA 2WB5A 3M8SA 4KAIA 2IVFB 1FHTA 2V8HA 1DBDA 4FPIA 3EDVA 4IL4A 1WUUA 2NUUG 4DR1J 3KLIB 2LMIA 1D9DA 2RQ4A 2J0SD 4ES1A 4MK7A 3CKDA 5D4PA 3JS9A 3MPYA 5HEJA 4FJOA 3IP0A 1QAIA 4DFPA 4ANDA 2ROEA 3KK2B 1JQGA 2FUPA 4ZKAA 1V3SA 1R7IA 2L08A 4EYYR 2QLJB 3IR7B 3QPIA 2E5HA 4UZCA 3QT6A 4KR0B 1U26A 4ZOLE 2JVOA 1ZM3A 5DM6Q 4YT0A 4HWFA 3M30A 1K0TA 1AB8A 2EC2A 3T8OA 3MCNA 2R6GF 3E8OA 4RW7A 4YJ2E 3C98B 4ERDA 3TAMA 1DTTB 3GYGA 2G2ZA 3J7ZT 2W2UA 3FZKB 2QFJA 2LVWA 2F4FA 2B5JA 2V0NA 2PFVA 4MIWA 2N4CA 3D1OA 2M4MA 2OMLA 1NM2A 3JC6C 3RI5A 5LP6E 1NPKA 2CZ4A 4JI3F 3ZFVA 2IRUA 3V81B 3C16B 4ZXLA 3BPSP 5HVGA 4LFBJ 2W66A 2WAQD 4CH7A 2LJLA 3HI2A 3GFZA 1Y0HA 2XMMA 5SUHA 3G6XA 2CZVC 3KUEA 2IC6A 1C1CA 3N6LA 3HVTB 5T7LB 4WBFA 2UXBF 1I94T 1FWPA 1LWFB 2BE2B 2R7WA 2XAJB 2CM0A 4ETXA 2H48B 2C2KB 1VQYA 2VJVA 4TNVA 1KTVA 3CEDA 4GVBA 3TA2A 2DIUA 1KNPA 3I32A 4DV3J 1SUQB 3GWCA 4OX8A 4GK0E 2JOQA 3T5LA 5FLXU 2KNDA 3L8RA 3DLGA 1RT5A 3RW7A 2DO0A 1C1BB 3AA7B 5AQJB 1FFSB 2IIUA 2VFSA 4RW8B 5HATA 3M2VA 2G13A 3CCLS 4EV6A 1T72A 5AQKB 3PTWA 1GT8A 3CWZB 4Y3CA 1JXVA 1HLWA 3Q5XA 1B0PA 3CE8A 5M2RA 1VYAA 1QUUA 4KV8B 2BG9A 4QH1A 1DLOA 2WDVA 1IXKA 1TL3A 1HQEA 3OVSA 2GA7A 1UURA 1HBOB 4I64A 1NK8A 4H54A 1LWEB 3BQ0A 1KVJA 4JI2F 2BQUA 2D0TA 2QYWA 1FMWA 5ABFA 1YJUA 4I1TA 3IS9A 3BQ1A 4FN5A 1SKWA 3SFEA 2D9DA 4F2RA 4YSXA 4A8YA 1G4CA 2IC3A 2X1GA 1B0TA 5IXUA 2DRDA 3RQUA 3DLJA 4MLKA 4N5SA 3GIJA 1SB6A 2XSJB 2DPIA 4LF6J 3W9IA 5AQMB 1IZNB 1VQ5S 4ZDNA 2YKNB 5KFXA 2WVDA 5LJ3Y 3OR1A 5EK3A 2HLUA 2LRLA 1I51B 2UZAA 1S1VA 1NENA 2YDRA 5LJNA 3SS1A 4OIXA 4PQUB 3CIRA 1D3WA 1HQUB 4QKNA 5ETNA 2NQPA 4P73A 3JYTA 4QR0A 5L1KA 1AXQA 2KRRA 2VPYB 2E5LF 1FKPB 5DO2A 3TEHB 1NDPA 3P7IA 1VQ9S 3UDVA 5J1GA 3GV8B 2WK4A 4Q44A 4H63H 4L3KA 3VTIA 3HJVA 2JEJA 5MLCV 2ZJRQ 3TA0A 3W2VB 3H8YA 1NKEA 4PW8A 4YFUA 4NASA 1P1LA 1U0SA 2EK1A 2GJIA 5D6GA 5CZVA 1YGYA 5HMZA 3SI8A 4QWBA 1TL4A 4PCQA 2F4VJ 1FDAA 3BS9A 3I1AA 2WS3A 3RBEA 2V1DB 3L7OA 2XY6A 5FP3A 3GU0A 3CJSA 5D3GA 1N8RT 3G8TA 2YQ1A 1RAIB 3LUYA 2OPSA 4OV6A 3A8KA 5LHIB 3KK3B 5CQGA 1R8IA 1WSVA 4H9QC 1V9DA 4B3SJ 1F5BA 2FHMA 1YTYA 1XZYA 3HA4A 3N2OA 5IOLA 2GZOA 3P4SA 1FRXA 4RW4A 2V4QA 3T9NA 3OL9A 4NUVA 5KX5E 4AQYJ 2UUCJ 1IBLF 1PJ5A 2CNLB 2WDRA 4O4GA 3VZIA 4DUZF 1BMQB 3EM1A 4DV2T 5C2TA 1LWXA 4B3OA 3F56A 1UJ5A 3KOAA 4ZPDA 4FS1A 4RW6A 1IBMT 1FX4A 3DNCA 1U5PA 4LFCJ 3EXCX 1TU0B 3PUZF 4YXDA 3OTDA 3H20A 4IFYB 3JSYA 3G8QA 2FJBA 3GE9A 4Y0FA 1HBUB 2W62A 4DV0F 1AUSL 4CI2B 4BAYB 3UUMA 4KGMA 3M3ZB 2EFGA 3S01A 4JYAF 2W63A 3VRAA 2R8GA 3OTEA 1F0XA 5KFRA 1C0UB 4DSEA 3AVRA 7FD1A 3E3XA 1OXZA 1FF2A 4MAKA 2CQ3A 2MTQA 1Z1ZA 2J0WA 4CO0A 4UZBA 3SV4A 3RIAA 2XHEB 2HZCA 2H9ZA 1HR0T 1RAOA 1U8SA 2IMOA 5GVQA 4H9SE 1T98A 2DR6A 3NP5A 4HHUA 3JCFA 5LOQA 1G7CB 3TZXA 1I5OB 4Y34A 2VQEJ 1B64A 2RU9A 3OUYB 2AKWB 3MM7B 2PN6A 4M5LA 2CPFA 3X3UA 5K20B 2CCQA 2R8HA 1FWLA 2P9BA 1R0AB 2MKSA 4O3PA 3CCRS 4CM0A 3OVAA 3DLHA 2ZLYA 4Y2AA 3HKDE 2ZD1B 2HRTA 3G96A 4U95A 3UU6A 4KSEB 1H72C 2UXNB 5LG3A 2BX6A 2VG6A 1FRLA 4QIVA 3LDQB 3PR4A 2DR8A 1MLAA 4EZHA 2F4VT 5HWYA 3PV0F 3O6QA 4PUOB 2G1HA 1YW0A 4WP8A 4H9PC 1NK5A 4KKOA 1RHMB 2Z0GA 2UP1A 5F8GA 3OL6A 3IM9A 2ZWPA 4KMCA 5KG1A 2NW8A 1MIWA 4C98A 4AXIA 2V6AA 3EUHA 4CLZA 5L2LA 1L0VA 3TLSA 2V7JA 2JX2A 3AE7A 4MHCA 2OEKA 1KQKA 2IJNA 4KPYA 4NXMF 2MZRA 1NDKA 4HL9A 3LAMA 1IBKT 3RIUC 2E29A 3QO9A 4LIWA 2UUCT 5F9NA 2QRRA 7AT1B 5KFCA 1UETA 2EBGA 4C8LA 4V1Av 1JJ4A 1VRUA 2QA1A 1WYCA 1IUJA 1R0BG 3LK3B 1QVFR 2CA5A 3FMBA 2UUBT 2M67A 3LOUA 3D68A 4DF8A 2R7XA 1R8HA 1RT6B 1RT2A 2GHVC 2JSXA 3PZPA 2HQGA 3OBIA 1WEYA 3BV8A 3WZ0A 4C8ZA 5ITHA 4LRDA 3ENVA 3P4RA 5LA6E 5KFAA 5K14B 2WOMA 3TJ9A 1R8PA 1F3VA 3CMES 1AZSA 3MXZA 1U1RA 2JPFA 3UFEA 3CCZA 3J7Yq 2ATCB 3CULA 3D6MB 3ZO7A 1JNRA 5AQTB 4RWWA 3CUNA 3PM9A 4WBOA 3BYPA 1H3DA 1U1PA 4CLTA 3TW0A 4Q5VA 4DUTA 1B99A 3LP1B 1EIYB 3OSPA 3FBZA 2CG8A 4TYAA 2BBEA 2YK0A 4HKQA 4DV1J 4P7TA 5L1IA 1SJFA 4L72B 2ZH1A 1LRZA 2J7WA 2CLYC 3AXKA 4ID5A 3EICA 1UW4A 2GCFA 2R8JA 1FRKA 2WWVA 2QC3A 4EYIB 3WAKA 2EHOC 2HWTA 2UXCT 3W15B 3K5OA 1T05A 2LM9A 4QIFA 1S9EA 2CIMA 1S0NA 4OYBA 2CWOA 2AW0A 5GAGI 4CM2A 1G1XA 3U7JA 3SQGB 1N5TA 5KXJA 1ZAXA 4OYZA 1PG5B 3R5CA 3GV5B 3FBBA 4CZZB 3VAJA 1FI4A 4JI4T 2BKNA 2N1GA 1VHFA 5HSPA 1S94A 4ZHRA 2VBXA 4CO4A 2GFFA 5CB4E 4O2BE 5FY1A 1N34F 4N56A 3D1HA 1BGXT 3C8YA 2AJ2A 1RT3B 1NSKL 1T3OA 3V2UC 4LJMA 2OUGA 1S1WA 5J1NA 1N4LA 4KIAA 2KWIB 2Q9QC 1M7KA 3N6MA 2ZM6F 3HXMA 1FDDA 4YDXA 3T1YJ 1NK7A 1X9MA 2BJ3A 2KT5A 5K9FA 3D67A 4U3CA 3KV6A 4AE5A 2B43A 2PMHA 4DPXA 2K9AA 3HSDA 3MMCA 2PEHA 3I0SA 2MYSA 4YHHJ 1VC0A 1UGOA 3OQ2A 1FJGF 1CJUB 4ZZBA 3V6HA 3N5BA 2H54B 1N5YB 3NNCA 3MR2A 5I42B 2GVDA 3SXLA 3K3OA 4GIWA 3Q22A 2C1EB 4DR2F 2ASJA 5IT0A 1BUXA 1GFWB 3GMGA 3I4HX 4TV8E 4HH0A 4N41A 3DJBA 1N36J 2KL8A 1N5VA 3U3IA 2DNYA 2UU9F 2HFSA 2GGPB 1PO6A 1W7WA 3BQ2A 1FT8A 2DHHA 2BUNA 2WW4A 2L3MA 3L95X 1NSAA 2WW8A 1XK8A 3I56S 2ZWOA 3SQOP 3RLFF 2WB4A 2VL8A 2YINA 3AEAA 4A8OA 1TFWA 2UVWA 2AXDS 4UW2A 1WORA 2JEFA 1HBMA 2CUYA 4DV7J 4J9MA 4ED2A 2EBEA 4DLEA 5KT6A 2QJ3A 2XQYA 3SYZA 2QZ8A 2A6MA 4QIWD 4F4YA 3NWIA 4K0KJ 2WSFC 3M8WA 2EFPA 2YTCA 2LHRA 4ELUA 3C51A 2K1RB 2CJQA 2YNGA 2QL9B 4KO0A 2DXFA 2XI2A 3AQPA 3ZMUB 2O67A 3UI3A 4URQU 3DGPB 2IIHA 2EFQA 3PX0A 3H2VE 1AFIA 2PGCA 1T0TV 4NWBA 4KHPJ 1N32J 2LEHA 3AD9C 5A8KA 3CF5Q 3RF1A 3PHEA 2OJ3A 2DNLA 4WTYA 2YH1A 2LU1A 3MM8B 1U1KA 1J27A 3AEGA 3VGSA 1JLFA 3OV7A 1WEZA 4U2ZA 3J7Z5 4GKJF 4OHZA 3HKBE 3R7SB 3N9NA 5E2QA 5KT2A 4RZRA 5KFOA 5DLGA 1QE1A 2UVRA 4ILAA 5H9EK 2A9UA 5I3PA 3KTQA 1XNRF 5D0EA 3OKQA 1JB0C 2R2SA 3CC7S 3SFDA 2N3LA 3JSMB 2CNNB 2XZEA 3HR0A 4ED1A 4XK8C 2ZH7A 2I8EA 5HJXA 1W2BR 2LKGA 3SBMA 4P1NA 5KFLA 2DEIA 4DV6J 1CC7A 2NSBA 1CULB 5HP1B 1F2HA 3OR2B 2FJEB 2V50A 3FZBA 2KFZA 4HTEA 4HI2A 4KYZA 5FL1A 1U24A 2MHEA 3ULHA 1QTNB 4KFBB 3I96A 3IRXB 3PHTA 2HHPA 3AE2A 3FCVA 4F02A 1WD6A 4ZPTR 3IRWP 3QJJA 2Z6EA 3EYZA 2AX1A 2CPXA 3G6VA 3UFGA 5I4MA 4C4WA 2X66A 1URRA 1PAUB 4F4AA 5LSLA 3ZZOA 3GFYA 4J90A 2LQBA 4QPXA 5FJ4A 3TZWA 2GAGC 5IUXA 2Z2MA 5E3AA 2O1PA 1ZV4X 1JLGB 1WG5A 2ATLA 3I87A 5KG3A 3MUVP 2H65B 3OTOF 4MKAA 3GG0A 1U6FA 3JAFA 1HNVB 4H9NC 3PURA 1T7SA 1M5OC 4HWHA 4LRAA 5JJBA 3BK9A 3BGRA 4RNNA 1FX2A 1XMQJ 3ZNUA 2RILA 5GAHU 3AOCA 2CWXA 3RR7A 3W63A 1IR0A 3NRBA 4J9UE 3C14B 1ZZNA 2XY7A 3QATA 2X0YA 3W7BA 3WC2A 3K3NA 2X51A 1JKHA 3EVWA 2POKA 3D0TA 3DRRB 4QYZJ 4OYIA 3RB0A 2QMUB 2OPRB 5ETLA 1HX1B 4CN1A 1HF8A 3QT7A 2F8HA 4B9NA 1VISA 2PT0A 1UA1A 4LF9F 2BKPA 1NAFA 2FC8A 1N52B 1JLBA 2OV9A 3AD8C 2W9BA 3ZCIA 4ELVA 4X2BA 3JAMU 1N32T 1YZ7A 2HGMA 1FKOA 1X31C 3M7VA 5DDOC 4F4KA 2IPOB 3F44A 3CX6B 3TUZC 5A8WB 2PFDA 3T1HJ 1L5UA 1MROB 2RPAA 1U0HA 4DF4A 1VRQC 1B7TA 5JDFA 3OBVE 1RWXB 2C3PA 2KB2A 4L6V3 4URGA 4N77A 2LEBA 4M94A 2HNDB 2AYBA 4C11B 5ETVA 3HHKA 4U67Q 1L3TA 1U7LA 3PIPQ 2MSSA 2ZM0A 3RYLA 4NLOA 2C28A 2V5CA 5DETA 4UY8T 4MTPA 1T03B 1MN9A 4DL7A 3IGVA 4RNMA 2VOPA 2ZOGA 4UELA 2DKOB 1R8BA 2OA5A 4IRCA 5AXKA 5HAXA 2K3KA 4F67A 3UO0A 2UV8G 1IKWA 3AE8A 3MM9A 2F63A 2B6AB 1Z4UA 2V63A 1WHXA 2HMIA 3OXFA 4C8OA 4PKDB 1OJ4A 3H2LA 4QU6A 1IR2A 1N54B 2RP4A 5CAAA 1YHQS 1NBEB 3NY0A 1VQ8S 1WKKA 2RDJA 3Q2TC 1S99A 4QWEA 5AQOB 4O3NA 3O1LA 3OTCA 4RU9A 4BC7A 3RYCE 2RQCA 3P4WA 3OTBA 2R2TA 4RLEA 3RX6A 2Q3PA 4ZITA 1JLQB 3P5BP 2XYGB 4WE1A 2YDSA 2VPXB 1ZM4A 2X1BA 1TAQA 2ERRA 1TK0A 4DZDA 1G73A 5HWXA 3R6NA 1PILA 2NR0A 4KTQA 4WCEQ 5D8HB 3AE1A 5LBQB 1HNIB 5AQRB 3U1NA 4Z37A 3EWGA 1I6JA 4OHXA 3NBXX 3R27A 3F41A 5KFDA 2EG1A 3B8HA 2ROGA 4GC7A 2HNYA 5IC6B 3SFUA 1HNZJ 2KYZA 3HHLC 5IS2A 3EX7B 3MR7A 3FK4A 1NMEB 1QSDA 2BACA 4P2SA 1VQ6S 1NPPA 3CMQA 3IO1A 4KX6A 2HK3A 2IAJB 1UWBA 1HHSA 4O44A 1CJVA 4NEYA 1ZOYA 4B08A 3RHWA 1ZBTA 2PA8D 2V4JA 3FB2A 4LF4T 2HBYB 2EXUA 2YNFA 2DH8A 4IDKA 1H2VZ 4PNIA 4DR4F 4F7VA 3VQTA 2C3UA 3KMQA 1OY8A 2DGOA 2KYXA 1D9FA 5B0FA 3LK2B 3GLJA 1J5OA 4O0NA 2MY7A 1UFLA 4KGKA 2CQIA 4QYRA 3CD7A 2XC9A 4ZI2D 2QEXS 2IJRA 2CRBA 3NZQA 3BQLA 3RB4A 2H4YB 4JV1A 3Q8YA 4OHFA 2J7UA 4WNKA 4TY9A 4WJBA 3FBLA 3D6FB 3J7YI 5B0DA 1BWEA 2PTFA 3TNVA 3D6TB 3TO8A 4OHYA 3FZ2A 4Y28C 5KFZA 1HG5A 3L9ZA 1B70B 1CSJA 3OYXA 4B3TF 2AP6A 4K4ZA 2YKAA 3MCMA 4CQIA 1MMAA 5JH7E 1SXLA 1QUPA 2RMLA 4HFEA 3A4TA 3KJFB 2P6SA 2E7XA 5KOXA 2XO6A 2HWHA 1BY9A 1LXJA 3B54A 4J2CA 3O1IA 2LDYA 5KFKA 3NZPA 3PJAA 3MAAA 4QX8B 1SC1B 4ANJA 3P8BB 5JDNA 3SOLA 1JLCA 1S1XA 3H4DA 1TKTB 4AL5A 1SCJB 4UXNB 2BKOA 2H88A 3HSGA 1DQAA 4CYUA 4U33A 4Z2XA 1UX4A 3S4UA 1YK9A 1UAWA 4FDFA 1Y64B 2XWYA 4JI7F 4LVOP 2XQAA 4DUYJ 3HVAA 2BANB 3N6NA 4IHJE 4PEOA 4H63V 5B0BA 4W92B 2PE8A 3NGRA 4LRCA 1RHKB 3UDCA 4KB7A 3PRVA 4YDDB 4EK2A 1TUWA 2X1FA 3IM8A 2B1EA 2ZOFA 3IWXA 1M5KC 4ZA1A 1C0TB 1N33F 3H40A 3D2WA 4DV4F 2KHCA 2V7KA 3CIZA 1NHKL 2NXEA 4WKRA 3CJTA 4ZPBA 4X4RA 3QUJA 5CYQA 3UR3C 3BQKA 4HACB 3DLBA 3J81U 4CTAA 3PDYA 3HSZA 4CH1A 1WTBA 5EZYE 5E33A 1UJ4A 3P49B 2IRXA 4ZVPB 1U8WA 8RUCA 1IKYB 2JMHA 2WSEC 5IM0A 4TQRA 4P0BA 2L9DA 5G0RB 1NJZA 3C6UB 5HXHA 4DPUA 2RH3A 4CO5A 3VVUA 3FZHB 4B3MT 3Q8SB 1LW0B 2YQ0A 3FZLB 1Y10A 4B9UA 3IBPA 4ZP9A 5E5NA 3OPCA 2LSJA 4DR3J 4FZVA 1RTHB 3DHXA 3ILIA 3QNWB 4IQMA 3HJFA 5DQVA 1REVB 4USIA 4G63A 3EABA 4G2AA 5CA5A 3DHWC 4OJ1A 1KBRA 5JREA 3HKEE 4HN9A 3SCJE 4OX6A 3ZJ2A 2GO9A 3F73A 3GWHA 4DG1A 3S8SA 1HNXJ 1XMOF 1WC4A 2JVRA 5HCMA 1SVDA 5KFEA 5C25A 1MN7A 3MEGA 3M2RB 1WF0A 4DX6A 3ILJA 4LT6A 4DV5T 2LEPA 3RBZA 1U1MA 3NWGA 3TI0A 1J5EF 4LMKA 2YWWA 2SXLA 2X9XA 3S1TA 2OH2A 2VODA 2ACXA 3GN5A 2MLZA 5F8HA 5BR8T 2KH9A 5HROA 2RRNA 1VQLS 3KBUA 1RJJA 3N79A 1GX5A 4USTA 4CO1A 4UOHA 1C2PA 5EHHA 1DJ0A 4LF7J 4IFVB 2K8GA 3T41A 1N0VC 1HTJF 3VQSA 2J6TA 4LF5T 2HURA 1OS5A 2CJBA 1MW7A 2KFNA 2JIWA 1TL1B 2CQCA 2HQCA 3JSRA 2KHDA 2CJ9A 3DLEB 5GADU 1D1BA 1A7GE 4I7FB 3NMAA 5LMUT 2XZWA 2VJUA 4OI6A 4FP9A 4WFNQ 1HARA 3HULA 2MDAA 1W0AA 1TK5A 3NCRA 4OX9J 1TFYA 4K2XA 2ZJQQ 1VRTA 4MKVA 1FJEB 2QA7A 4YR2A 4HFVA 3Q8PB 3ZMVB 1TKZA 2V6XA 1ITPA 2DJWA 4K8RA 4IG0B 4I69A 1L3KA 3Q83A 2EG2A 3UR0A 3K7RA 4TU9A 1HHTP 4PAAA 2UUAT 2RS2A 3BGUA 1HKAA 4WTOB 1U4QA 1BR1A 2R3VA 3PW0A 4EWTA 3NS6A 2ZHOA 1YRUA 4KRWA 4ZCLA 1O51A 2G0CA 4X62F 5FVLA 3AQOA 3ZJ1A 1KN6A 1DTQB 2WRMA 2KRBA 5C42A 1PC5A 4YY3F 3ELHA 4Q45A 2VV5A 2VASA 1YI2S 2OI2A 3ISND 3NLCA 3AJ1A 1UUSA 4NXNF 3GJSB 3RQWA 3C4XA 1M5SA 2RT3A 4MMOA 3AOAA 1NK4A 2HFNA 2UXDJ 3MPVA 2CLYB 3C46A 3K58A 2E9XD 2XM1A 1KK7A 2NPIA 1GX6A 3KNAA 2EHOB 2PIIA 2OPQA 4EZ9A 1I3OB 4I6AA 1U09A 4RL1A 2PI4A 4ATNA 4J9LA 4B3RJ 1H0HB 1S6QB 1RWUA 2COLA 5HMWA 1SJ3P 3H59A 4FYXB 3R1HA 1JXLA 3M32A 3F31A 1C1CB 1M1HA 3TVKA 5KFYA 3UVJB 2BZBA 2YX1A 3FMWA 2XY8B 1F5CA 4OJHA 5CCLA 1RI7A 2ZJPQ 5KFNA 2XQ4A 4DZ6A 3C64A 2C2RA 2HQ3A 4QU7A 3HPOA 2KG1A 3PW4A 5KFTA 2DWGA 2XGQA 3ZTSA 4CI1B 4MIAA 4C90A 4C7QA 3CJRA 4RW9A 4DR5J 4X5TA 4DL5A 3SIPB 1RT5B 4A46A 4Z7CA 1TTHB 3D28A 5LYJE 5B0CA 4KHZF 5J2NA 3ETOA 2XAGB 3J7A1 3CNQP 2ALZA 2BA9A 5CFBA 2LKZA 4GYSA 4R0EA 4F4WA 6AT1B 3O3LA 1S79A 1QDUB 2LKHA 3OHBA 1MNEA 1FTCA 2HWIA 2R8KA 2C0SA 2E1AA 3ZC0A 4H4KC 4A4JA 5KFGA 1TUGB 4DXLA 1DLOB 2XHWA 3G87A 2BRLA 4PG4A 3O4XE 2JMKA 1HQEB 1VLYA 1T7PA 3T3FA 3MURP 3PE0A 1JLAA 1RU1A 4ZVSB 4CQ1A 4QCLA 1RB0A 1TELA 5J2MA 3D1QA 1FRHA 3AXMA 2LQJA 3CCES 5CXTA 2GVZA 2NCKL 3DU6A 5C24A 5HN0A 3R5BA 2N7CA 5THWA 4USHA 3BH6B 4IE4A 1N56A 3GJRB 3B78A 4RUBA 4JI8J 3LWLA 2NSCA 5FXVA 4AKIA 4CDIA 3DRXA 3IS9B 5JR9C 5AXNA 3QGHA 5LMNJ 4EXTA 5EK2A 1KFSA 2IC3B 3W60A 2Y1JA 4AKLA 1EX8A 2I5JA 4PWUA 3NG8A 2X9HA 1S0OA 4BWMA 3R3TA 3DFEA 4YOEA 2R7TA 3PU3A 2J1DG 3LJCA 2IRYA 1P27B 3J7AN 2NLWA 2MPUA 2BDPA 4LFAF 4X66J 2J8SA 4F8RA 4JI0J 4CN6A 5K8NA 3KXDA 5HMXA 1RDRA 4PWWA 2FB0A 2MKYA 4C97A 3M9OB 3DYAA 4NYZA 3WI3A 1SJ1A 4WPAA 3B4MA 5DQWA 3VAGA 1U02A 2HNZB 4QOTA 4ZS3A 5DQHA 2ZNZA 2HHHJ 3DOKA 4NLTA 1R89A 4I4TE 4CCHA 4NLPA 2RKIA 4YSZA 3VU7H 4RUHA 4NA2A 2SPCA 2AV5A 2ZUAA 2B9XA 5EWFA 3LPEA 4DR5T 3BR9A 4J37A 4IOAQ 3Q2SC 3QAEA 4FPRA 4USKA 2IC9A 4ZP6A 2XLJA 4QXHB 1RAFB 3MPDA 5DJBA 5EGYA 4O8SA 3LF0A 4V19X 4BJMA 3M2UA 2GJ2A 2QVAA 3ONJA 2E8IA 1Q0NA 1XMBA 3OHAA 4R5PA 1X5TA 4IH7A 2BOPA 2LP4A 4DJBA 1EZ3A 3FQLA 1SI9A 4XAXB 3N5FA 2YKPA 2MQOA 2U1AA 5KFVA 1QM9A 1ZP0A 1TP7A 3B57A 2V5HG 4YHJA 3K17A 4AYBD 4DR1F 1JLEA 2VA2A 4JI6J 4MALA 1BR4A 4M5HA 1YJNS 4JI2J 3AD7C 1WC0A 4LR8A 2ALYB 3O1HA 1QTMA 2G9OA 5C2GA 4B3OB 3IR5B 1O0PA 1RK8A 4OYXA 4RO0A 2V7IA 2DNGA 5E3QA 1PC4A 1LFPA 2L9QA 4LR9A 2PMZD 4JI3T 3TX0A 2FJBB 3GR0A 1BR2A 1BQMB 4NYOA 3SSRA 1T11A 3C4WA 4ZVQB 1SPBP 2VHGA 1N6QA 3R7BB 4RKUC 4OYKA 3POTB 1LQ9A 4DQRA 2UVUA 4XDCA 4J9SA 4XTTA 4O3QA 1WOOA 1KOHA 2UXBT 2KFYA 1HHQA 2WWUA 4LFBF 5K5MA 4W98A 3NEKA 5A1LA 2R7OA 2MEWA 4A97A 3HFVA 2CNOB 3HSJA 2CRLA 1T95A 1FRIA 3EUNA 4F6RC 3TOQA 4L5GA 4JI5J 1P9YA 4EBCA 1Y01A 1RGVA 1RAHB 1IJ6A 3N9MA 3AY0A 5LXTE 3ITHB 3CCMS 1XR6A 4O3RA 2D5UA 4DV3F 4P2XA 2DGTA 3NNHA 3ZMZB 3CPZA 2BEFA 4RBVA 1E2AA 3QGGA 2AJ4A 3ANWA 4QWAA 4YQWA 3CIMA 2CPTA 3V6KA 4DL2A 1R31A 2YKMB 1VQOS 3H2UB 4Z90A 4KBIA 4AL6A 1HWIA 4UUWA 4LSNA 4TKTA 3P3DA 1S49A 2VPZB 1Y11A 1VBYA 3AJ2A 2HH7A 1KEKA 2NR4A 2V94A 4DSLA 1WC6A 2BQ3A 4B9TA 2GIRA 3ONQA 1KQGB 1IBLJ 3EZOA 2HHVA 4IR1A 1O3XA 2XSBA 4PYDA 3DMJB 3ETUA 4JI2T 3BEGB 3KWMA 2DK2A 3CDUA 2HYIB 5AQPB 3KK2A 2RJZA 2OKQA 2Q6BA 3Q5EA 4HVZA 2C22A 1U6BA 1VRUB 2VQFF 3FRZA 1UVKA 3RW6A 2MSTA 2CPYA 4BLGA 3AVSA 4C8MA 4JEUB 4OI1A 5D15A 4TZ4C 2K5BB 1DTTA 1H7XA 4H4OB 4U8VA 3QB5A 2WOMB 4PR6A 1X0FA 1EB0A 3KK1A 3PXGa 1LEOA 1FERA 4KJIA 1XTZA 2IVMA 4QYZK 1YKWA 1JK9B 2AE9A 2Q6CA 1HNWJ 2R7SA 3ZYKA 3C16A 2E2AA 2LA4A 3EGNA 4FS2A 4C9DA 4LMJA 2DTJA 4NLWA 3NGDA 4AKHA 1JNRB 2Z2LA 4LMLA 1YRTA 2ZDPA 1CVJA 4LF6F 2HS0A 1RLCL 2XBPA 1D0XA 4UQGA 1X4FA 2WBMA 2FJAA 3A12A 3HVTA 5T7LA 1FIOA 3RYFE 2E5LT 1M5HA 3RZAA 3HHLB 3DKDA 1IKVB 1OEDC 1MMGA 4ZLJA 4DMVA 5JMNA 4B6XA 3FJ2A 2X9WA 4DR7J 2CQHA 4DQSA 2MMYA 1UCUA 2H3EB 4IG3B 1WCRA 2YWKA 4Y2KA 4WWSA 2VL1A 4ECXA 4P7VA 2ZKTA 1VGYA 1RWWB 1Z0PA 4OYOA 4NX9A 3DLLQ 4COFA 2GO8A 2PBIA 2KXHA 4LIRA 3MUMP 5JDLA 1M0SA 3THPA 1T05B 2MGZA 2Q79A 4DEZA 4DN0A 5AQGB 2YWHA 2RA1A 3PFOA 3PTRB 5ABEA 2MKIA 1PBUA 4RW8A 1HD0A 4I6WA 3BO3A 3TUPA 1GMVA 5FLXY 2BYCA 2ACZA 4BBYA 1US7B 4KHRA 1GMWD 2WMNA 1VC6A 3TYTA 5FXWA 4O4LE 3W1YC 2QLWA 3ONLC 4I4BA 3I6PA 3CPWR 2OPPB 2ZH6A 4X4OA 3O44A 4M8LA 4WZQA 1CS4B 1IBLT 2LQ8A 2VPWB 3UFCX 1TAUA 3MEDA 1X9WA 1S1WB 3K89A 4DUZT 1S6PA 3H5UA 1HBOA 4B3SF 4Y00A 5M2UA 2NWBA 5E7OB 1LKZA 3ZT7A 3UDEA 5CD4A 2CQ2A 4Q7AA 4AQYF 2BS3A 3TLVA 3FSXA 2QA4S 1EARA 3GIKA 3G6ES 2WB1D 4WK1A 3KJVB 3I0SB 1SL1A 3ZC1A 3OSNA 4DV0T 2P2CB 1NDCA 5AQQB 2XASB 4JYAT 4MJKA 4LFCF 2JWNA 4A48A 4GKKJ 3EDUA 1RZMA 1M5VC 2PA3A 4AT1B 4ED7A 2JJ9A 4ZVEA 3LAKA 3DDKA 3RGIA 2YKNA 3S6EA 3W62A 2ILZA 2ZM8A 4CIOA 3PKMA 2CADA 3KNGA 5HCJA 5DQIA 1V3RA 2FZKB 3H3AA 3D66A 3MOZA 1K1QA 4ZPWR 4J9KA 3DLKA 1HQUA 1NK6A 5CYMB 3UWTA 3H0PA 4C8KA 4PXDA 4NCGB 2X1AA 4E8UA 3CXCR 5LCYA 2QL7B 4PAGA 4LQ3A 1WHVA 3EJMA 1FKPA 2VQEF 2QGSA 2DCFA 3V4IB 4ZP7A 3PX4A 1HBMB 1UVJA 3ZXWA 1D1CA 1RTDA 2XQ5A 5H9EJ 3D54A 5JRCB 1SL0A 3IA0A 2IBKA 4G1QA 1K1SA 2VG7A 3W2VA 2QT7A 2CKWA 3BSAA 4DU8A 1MWYA 3AE5A 4USVA 1GAOA 3CJ3A 1T3NA 4UV8B 1SIWB 3KHHA 4ALZA 1VBKA 2YNGB 1NB7A 2AYGA 2RVJA 4KO0B 3VAHA 1XR7A 1BD6A 2FLLA 3A7MA 3W5YA 4FBUA 4LBIA 4KY3A 3J80U 3MAQA 2DIVA 2ZOMA 2B8PA 3S7RA 4J9NA 1LXNA 2Z30B 4PK6A 2DISA 4KP3C 2NS1B 4NXMT 3K3QC 3NKZA 2E1RA 2R8IA 3CQGB 3TQEA 3VHLA 4U8YA 4HFHA 3QT5A 3KK3A 3FFIA 2CA9A 3OL7A 2X9YA 2QV6A 3ET6B 3GYXB 1LNQA 1V3ZA 5A0YB 1EQ0A 1MMDA 2CBIA 4UF0B 2MZTA 4DIDB 3N2KE 4QWDA 5JVDE 4DQPA 4EGWA 2B4OA 2A18A 3UQSA 1HL6A 1KVIA 4G1IA 6FDRA 2WP9A 1RISA 1QE1B 3L7PA 4QBUA 3VHQA 3GIIA 1RU2A 2AGQA 3LPYA 2CVIA 1FJGJ 2XNRA 2JLFA 4WP9A 1XNQF 1VK8A 2AU0A 4CLKA 4RNOA 4ED6A 4QW9A 1EZZB 2IYIA 4RJVA 3AB2B 3CGIA 4FYYB 4IFYA 3MACA 5L8RC 4ZEYA 5L46A 1KD1T 1H98A 3RRWA 1HW9A 1HBUA 1V9OA 1X79A 2CYYA 4ZPAA 4F4XA 4WFBQ 3AEDA 2MAWA 5H6QB 4AKRB 2ZBPA 3CJ4A 4K4VA 4M5GA 2RAQA 3UUNA 3Q9DA 2AEMA 4TQSA 1E6VA 3X1LB 1WF1A 5L38A 4P71A 2MQQA 1Q8LA 3SCLE 2B4PA 2NZCA 5F8IA 3QAUA 3FUYA 2OSQA 4RNHA 3PG9A 2WZ1A 3HZGA 4J9VA 4HT5A 4JP8A 2XCAA 4F3QA 4JI1F 1UA0A 2R42A 3MM7A 3M6UA 1UVNA 4QR2A 1YKEB 4AXPA 1BQNB 3DOLB 2DB1A 1W09A 3C15B 5ETWA 3TANA 4NLYA 3DDNA 4NLDA 1YQ3A 3AB4B 1I94J 1R0AA 1TL5A 3V5UA 4DV1F 5ETMA 4NPPA 1S1UA 3L4BC 2PDAA 3IR6B 2V2ZA 4PWDB 2E9XA 1TL7B 2XQ9A 3UD3P 4PFPA 2QLFB 1L3UA 2CBJA 1LK5A 1JKHB 1OSCA 1T9VA 4K0UA 3ZZPA 2EVZA 2MY8A 3AODA 1UP1A 3PVXA 4F0MA 4PUOA 1FNXH 3EGVA 4N47A 2WDQA 3CCWA 4GYRA 4OYMA 1FDNA 3K8WA 1C4CA 5LM7E 3EHZA 4IE6A 1S35A 1RBLA 3C50A 1JLBB 3GCXP 1F3FA 1N34T 5KT5A 2MKHA 4D3HA 1FDBA 3CVKA 2LECA 3KINB 4NRTA 1WI8A 1WELA 3NVOA 4GKJJ 2ZM6T 2KU7A 3PO5A 1Q5VA 4ZVOB 5B0AA 1HQ2A 4I2QA 4CT9A 2XTLA 1U2FA 4FBTA 3I0RB 3PNIA 4PK5A 4DLGA 3KLVA 2CPZA 2ZKUA 3MOJB 9RUBA 2ZH4A 1APSA 2XY5A 3N9QA 2AX0A 3VR1A 3MWBA 1YDLA 1MU2B 5FY0A 1VBZA 3MD1A 3FQKA 3PYEA 1FJGT 3HK2A 1LWCB 2N7YA 3N0VA 2H7OA 5KG4A 3T1YF 1GQEA 3KMSA 3BSNA 3WAJA 2FLPA 2G0JA 4EZ4A 1UMJA 4H9OC 1RAGB 1YBUA 5D0RA 2FJVA 2A1BA 1JNZA 3KJNB 2JDJA 3PYFA 4K59A 4ZMMA 2HAFA 4FKXA 3RG6A 4QH5A 5K14A 4DR2T 4YHHF 1IKWB 1SJRA 3IMQJ 4ZIWA 1K0VA 3N9OA 3MM9B 3P4UB 3BBBA 2HMIB 1HFAA 4X84A 1ZM2A 3H5YA 3ZZTA 4ZCKA 1UVIA 4AI6A 2UU9T 2LLYA 2BV3A 1DQ8A 2FBWA 3BGLA 3PJAJ 3H90A 2VICA 2W67A 3NRYA 2RHQB 2LSYA 1IR1A 2KT3A 4YS2A 4I56A 1H2UX 1HWJA 3K5LA 2XMTA 2E7VA 4HEA9 1N36F 4IOCQ 2PMWA 3W5XA 3BQIA 4PPDA 5DDRC 3ZTPA 4WU3A 3IAM9 4P52A 3OTOJ 2MKJA 2DNZA 3HI9A 1GEHA 3KV5A 1V6HA 2WVFA 3T6JA 1AA1B 1WEXA 3MR5A 3K8VA 1S10A 2HFUA 4ERRA 3R7NB 5ABHA 4DDFA 5AJ3J 1NDLA 3N5LA 1Q8KA 1DRZA 2M8HA 1R27B 1RWNB 4DV7F 4ILRA 3OFFA 4L73A 3QWUA 4AKGA 2BABA 4FVMA 2HHWA 2HRYA 1F1BB 2WCAA 4K0KF 3ZMTB 2HS3A 4KGZB 1F6TA 4R8UA 1UWAA 1H2TZ 2RRBA 5FIIA 3P5TL 1Q8BA 2HNYB 4OZNA 1URNA 2L9WA 2NYIA 4ECWA 5LT5A 2BS4A 2NXCA 3OJUA 2IM2A 5JR9B 2QMWA 2AYMA 4O44B 4GKJT 2APOA 3I5BA 4EAHA 3VAIA 2DHSA 1OYEA 1OSDA 1RT3A 4WFAQ 4KHPF 2YNFB 3H7HB 1HX8A 4IDKB 2IYGA 1VJQA 1SE7A 4K4SA 3KV9A 2DLRA 3RB3A 1XNRT 1YJWS 4PZVA 4KGXB 2NREA 2GQCA 5F9LA 4A8WA 3BN4A 1RHJB 4CI3B 3HZEA 4QX7B 1I6ZA 2FZCB 1XBWA 5ETRA 3RBDA 3ICLA 3RB6A 3MZKB 3VAMA 3HCXA 5DRKA 4DV2J 3E0ZA 1N5YA 2BM1A 5I42A 2LSIA 4JLEA 2UUWA 3G71S 2ADCA 4OFZA 1IBMJ 4DV6F 4KH0B 2IY5B 1U6ZA 4WFZA 1X0PA 2J62A 4OHVA 2OFHX 2VF3A 4ENOA 1Q82T 3G8SA 2HN1A 2Q9QD 4YTPA 4PPZA 2F3JA 1NH8A 1JJ2R 2CPEA 1NJXA 3JQJA 2PI5A 1ZH5A 2FDNA 2W7AA 4HT7A 4I0WA 1FTRA 4X4SA 5MAOA 1RXOB 1SQEA 3L7UA 3MAAB 1L3SA 2EI5A 3JQMA 1YITS 4DSIA 4O2AE 3RKGA 1B7YB 3OTOT 2HSEB 2IDLA 4B9VA 3D3CJ 4KH1B 4ZK7M 1HR0J 1CJTB 1HW8A 2J4GA 2JEGA 2FVCA 1D1UA 2AF6A 4CYUB 5BJRA 4CT8A 4K4TA 3MFHA 1KP6A 2XO7A 4HWDA 1S4FA 1UTAA 2C2ZB 2U2FA 3R84B 4EMDA 4LF1A 4TNOA 1GMUA 4IQXA 3IAS9 5H9FK 4FYWB 1OMSA 1MWQA 1UFKA 4XDDA 1N48A 1ZKEA 3UQ4A 3LW5C 1XMQF 2F40A 2CMRA 3HF5A 5DZ6A 4HFBA 2K1RA 4LF9T 1YKHB 2D3OR 3M8QB 3NMRA 4M5KA 2VC0A 1IAPA 2K3WA 3AAAB 2GMJA 5RUBA 3I9V9 2CEAA 3CDEA 1DZ5A 1RQ0A 2Q43A 5D78A 4NUUA 1F5AA 1HYSB 1UK5A 4QW8A 3BKTA 1IBCB 4QIGA 3CDBA 2B3TB 2CQ4A 1JX4A 2YU1A 2CVEA 1NEEA 5LJMA 4DL4A 5FDLB 2VKJA 3PUVF 5L4EA 4GO7X 2DITA 1U1LA 3BKUA 5IM0B 3RYIE 3T1HF 4CLYA 3PV8A 1GXLA 3M8RA 3TVYA 2N2NA 4MYUA 4TLRA 1QSLA 4B02A 1KR4A 1IBKJ 5E0OA 1WI6A 2ODUA 3KLFB 2FIUA 3IG1B 3HDSA 5BXIA 3JSMA 4AQFA 2J5AA 3AHPA 1X9SA 4DO0A 1R8AA 2P5VA 4Q2MA 1P8GA 3BM7A 3QLHB 3MEEB 4WF9Q 2UUBJ 2AJ1A 4MKBA 2ZZNA 3AOBA 5IFMA 2MQNA 1V5IB 3WBZA 4ZCIA 2V6YA 4NL5A 4QXCB 2CDQA 1UFWA 4IR9A 1WDTA 1Q7LB 5C7PA 4KFBA 4DG1B 3IRXA 4ED0A 4IDPA 3I0OA 4WIIA 3D9BA 4EZ6A 1S77D 3MM6A 2CPIA 1EAYC 3U78A 4OLOA 5C25B 3PJXA 3MEGB 3CQCB 4J9QA 3AT1B 1RABB 1RLDA 2FY1A 1NRKA 1VQKS 1VRBA 3NGUA 1P6TA 3A3NB 4ILLA 3AA8A 2FC9A 3MTJA 1VC5A 2KXPB 4DR6F 3UD5A 3M6VA 1JLGA 3T9ZA 3QGPA 4W90B 1F9HA 5AQUB 1RADB 5B08A 2AHOB 1HNVA 3GILA 1UEUA 4N8NA 3FBCA 3BSCA 2ZVSA 4P74A 1Z2ZA 4BA9A 2W4CA 4OZ1A 3AEEA 4QWNB 3IN5A 2HIYA 2F8MA 1VQMS 3C14A 5E41A 3GV7B 5G4DA 2NOXA 3W2WA 5KT4A 3DM2B 3ZN0B 4MFBB 1FEHA 3DRRA 2C2DA 2KXFA 1HD1A 2CXLA 2UXCJ 3QOFA 1V5VA 1VK3A 1MIYA 3MMBA 1ZAWA 2YKOA 2B8QA 3RBXA 1ACMB 1GH8A 2V26A 3ISNC 1UPMB 2E9ZA 3Q8QB 1HNZF 2VKDA 4TVAB 1G2EA 4DR4T 2BE9B 3SSSA 1LK7A 1U1NA 1BXNA 4JI4J 2WSCC 1WSRA 5A8WA 2FHKA 5H6RB 4DCJB 3K5MA 2DY9A 2FY8A 1CC8A 2X3DA 3JTPA 2K7KA 4M1PA 2E9XC 3JAMY 3FBEA 2BBHA 1XR5A 4NIQA 4C11A 2VU5A 4DL3A 4P2FA 3R6LB 3HD2A 4HWIB 4E7ZA 2DNQA 2Y3YA 5C8YE 1NH7A 4LF2A 2YNHA 1T03A 5C42B 3BO2A 2YEVC 1CQMA 4ZHQE 2RDDA 3W66A 5D4LA 5LHGB 4WYWA 4X4VA 3EVOA 4B3TT 1OEDB 3QSYB 1J5WA 4YTMA 1GMWA 1XMOJ 3DRPA 2B6AA 3AA9A 2FYXA 2HFVA 4DSJA 2W9AA 2MQ8A 4PG8A 1S9GB 4DMWA 5I3UA 4PJJA 4P6QA 2OPQB 1YJRA 4TY8A 1T02A 5LOVE 2WTFA 1K8AT 2I59A 4DNDA 4DL6A 1DQ9A 4DWIA 4OQJA 3L09A 4RBTA 5D4OA 2D1CA 3LP0B 3M32B 4E7SA 4KE5A 1FESA 4JI7T 3BDEA 2ODVA 2MHNA 4MT1A 3RUBL 2DNKA 2F65A 2NXNA 1L3VA 1PGZA 2MPKA 2WM9A 3OT9A 4ER8A 2R7UA 4C2MA 3HKWA 1IKXB 1CUNA 2MZQA 3T5JA 5B0GA 3VVTA 2IDOB 2XM3A 4DUYF 4H9RC 4DVDA 1RBOB 4U7YA 2VC1A 5AQSB 4WBNE 1AT1B 1K73T 4RW9B 1N33T 3TAPA 3THTA 4DV4T 5L3DB 4L0RA 5HANA 1FKAF 3PFEA 1QAXA 1RYSA 4NE9C 2XCPA 1S5ZA 5J2NB 2QIFA 4KHMA 2MXYA 3VCDA 4WW0A 4DL0C 2WZIA 1E7PA 4R25A 3FSYA 5DZ7A 1WHWA 4QXBB 4LSLA 4NOHA 2CG4A 4YMEA 1SH2A 4LRBA 1T94A 3MCSA 3CD5A 2F7VA 4J91A 2PFFB 4I43B 4X62J 2RNEA 2YY3A 2V69A 4FKYA 5GMDA 1JLAB 5DM7Q 1H38A 5J2MB 2V34A 3T1AA 2GVZB 3ILOA 4OV1A 4K50A 1VCSA 2GJFA 2YNIA 4EB6E 5HQ8A 4ECRA 2XQ8A 3M8ZA 2HGLA 4NXNJ 2EFOA 3KYLA 1NSQA 3M6XA 5JDGA 1ROFA 4DR3F 2Q66A 1VQNS 1XMOT 4ED8A 1RWPB 1SIZA 2ZHBA 2BOAA 2KN4A 3VKHA 2I5JB 3N2GE 2ZH2A 5HXCA 1YQ4A 4ILCA 3X1DA 3BYRA 1UW9A 1T9WA 1GXUA 3JSBA 1SKSA 2BG9C 2CZ9A 3SSQA 2DL1A 5EX3A 1J5ET 1HNXF 5KAKA 4Z8XA 3RRCA 2ZITA 2GC8A 3CSKA 4U2YA 4IKAA 2LOPA 3JADA 3L3CA 4BWJA 4ZI3D 1TKTA 1QUVA 3PO4A 3Q24A 3VGUA 3H42A 3LBXB 3P50A 3DYAB 2BMBA 5AQIB 1S76D 2Z2ZA 4F3OA 2E1MC 1VIXA 3MHYA 3GR1A 3LGMA 1TZ0A 3SRZA 5LG4A 1NSPA 2W2MP 4WP3A 3TARA 4MK8A 3R6GB 3Q8UA 3I55S 2MLYA 3HVRA 4NZ6A 4LF7F 2RKIB 3CCTA 4B17A 2VBYA 1J1JA 1X5OA 2WU5A 3Q8RB 2FLNA 2ASDA 2M5YA 3NAIA 4OJ3A 1FXRA 3Q23A 1Q79A 4MYTA 2ACMA 4LQ9A 3GQCA 1OY6A 4K7QA 2D69A 1C0TA 3MMAA 4CNYA 2BG9E 2KJWA 1U47A 2VDIA 4OX9F 4UIGA 2VVNA 1D8ZA 3RC8A 4U9RA 2HHQA 2WCXA 3KDSE 1QVGR 1NK0A 3UT5E 2GV1A 3TAQA 7FDRA 3W65A 2WBLA 1LW2A 1IWAA 4K5SA 4Q2LA 4X62T 3C6UA 3C2PA 4ILMA 1S6OA 4YY3T 1LW0A 3J81Y 1FNOA 5ETQA 4TU7A 2W61A 5J2QB 3HFKA 4M5MA 2BVLA 3TVZA 3LFMA 4LF8F 3IC1A 4NXNT 2ZBIA 1RE1B 1X4EA 1M5PC 2AD9A 2CPHA 2RE1A 4OZ2A 4A8QA 2KI2A 1REVA 3LANA 2DNPA 2VFRA 4WK3A 3GJTB 2ZZTA 2K48A 3G86A 2OELA 4X64F 3PYDA 3SWHA 4ANEA 2V9WA 1UZHA 3SDEA 3DXBA 3U1MA 4YB1P 2XZTB 4M5NA 2QX0A 4TWFA 1FRJA 4HH1A 1FXLA 5AT1B 3PUWF 4UVAB 2UXDF 2VFTA 2W2QP 3K0JA 3US5A 2Z2YB 1HBNA 3BREA 1Z8UA 2DNRA 4DQQA 2YX7A 2DY1A 2W00A 5HJYA 1Y3KA 4I2PB 2AJFE 4DFJA 4B3RF 1DY3A 3LG7A 3C66A 5KFHA 2ABYA 2M70A 3MPUB 3R2CJ 2FHJA 1Q4RA 3UNYA 3DI6A 5KFBA 2CFXA 4OZLA 2HG4A 4O4JE 3ZTQA 4QHOA 4U96A 1PYSB 2HN2A 1QSYA 3CQXC 3BF4A 4ECYA 1YSJA 3RYHE 1HI0P 4TWHA 4FI5A 3W5ZA 1HFEL 2UUTA 5GADI 2B7CB 4F3MA 1IJFB 5KFUA 5JDMA 3D3BJ 5CHCB 3IA3A 5J2UE 3UQ7A 5KFJA 1RT7A 5A76A 4YP3A 3MKDA 2Y48B 3RIUA 4OYWA 2IW5B 4AD6A 4ZLNA 3DLEA 2BW2A 4I7FA 4ETZA 1U1OA 2ILYA 4NZ7A 4HYKA 2KO1A 3IHRA 3EZUA 2N3OA 1TVRA 3UPFA 1OIAA 3WHIA 2HVZA 3EI0A 3ANWB 2HVDA 3D0GE 5J2PA 1SQFA 5DG9A 1EKRA 1Y9OA 3P4QA 1LOUA 1QAJA 3DDIA 4EI2A 1KDNA 5A8RA 1RT4A 4IG0A 2G2OA 1H7CA 4LSNB 4QH4A 3HMJG 2YKQA 4L74A 9ATCB 3VR9A 4N76A 1WACA 3DOMA 2M0GB 5JDQA 2HHSA 1DARA 1ZPWX 5L9NA 1E1HB 3C6TB 1HA1A 2J7KA 4LF4J 2VDHA 3K5NA 5IWAF 1DTQA 2DGWA 3ZC4A 5H1SV 4DPYA 1S12A 2C42A 3EPIA 5A2QU 3FEZA 3LTOA 5GAEU 1SV5B 2DYAA 1Y00A 2DNMA 2ROPA 4ZN3A 2PJQA 2KKHA 4JI8F 2BZ2A 3N4WA 2HBZB 3KK1B 3GIMA 4LFAT 4RU2A 5LMNF 2XLKA 4A98A 4F26A 2EHOA 5L3BB 2MJUA 2IA6A 1HWLA 2XWXA 1YRXA 4WYVA 2B7BB 5HEOA 3QWPA 4F04B 1S6QA 2CQDA 3TKLB 4CZCA 3W9HA 1WYBA 4NCAA 5LSOA 4X66F 5AQLB 5JXSA 2MZJA 3FKBA 2FJAB 1YWXA 2V4RA 2ZH8A 3IXQA 2VWAA 3QFHA 4JI0F 3UVJA 5KG0A 1QJHA 2Z58B 4I67A 1RTJB 5BYQA 4HHJA 4PRFA 2CJYB 2DNXA 3KLGB 2YKSA 2B4UA 3I82A 2W8LA 4NLGA 4F0KA 2XMJA 3G82B 5CGMA 1WG1A 3J9X1 3AECA 1EETB 2HHHF 3BO4A 2C2MB 4FXWA 4IL9A 2XB2D 3K57A 3GB0A 2Q9QA 2E5IA 5KFIA 4XZCA 5IT9U 2MGZB 4FF1A 3PYGA 5KFPA 2WQYA 1VQ7S 1WOPA 5EX0A 1CHUA 3FDSA 2A2CA 4IE0A 2CQBA 2QLBB 1X4GA 1G6BA 1GTHA 2VBZA 4X1KE 2LQ9A 5DJQC 5IQQA 1X60A 2WONA 2E44A 4I0UA 1XC9A 3DU5A 1SKRA 2JNJA 4ES3A 2W9CA 1Q16B 2X0HA 2CPJA 2K06A 3R9LA 5IT4A 3ZCJA 4OI0A 1RBAA 1VCTA 3LP2A 4ZS2A 4DR1T 3ADAC 1F9EB 1KQFB 2X3GA 4HKAA 4IO9Q 2W4DA 2E9TA 4USWA 5DDQC 3E01B 2MLXA 1P1TA 4JBCA 2JQQA 2BR0A 3MECA 3MEDB 2VQFJ 2AZ3A 3VGVA 3V6DA 1S6PB 5F3ZA 1Q8IA 3OJAA 2DGQA 3V5RA 4CH0S 2O01C 3HT3A 3TEGA 4JI6F 1VMBA 1RSCA 5EK4A 2BJ7A 2LYVA 3HKZD 2IHR1 4A8MP 4ZOSA 4IO1A 1T8BA 4YB7A 4DCPB 2V2KA 2CPDA 3DTOA 4B3MJ 1S7HA 2ZE2B 4NRUA 5IZHA 2LEAA 2KWHA 4C0BA 3PJ9A 2OHDA 2MZ1A 3T5KA 3N9LA 2KSRA 3MR6A 2J0XA 2MJNA 5EDWA 3TJAA 1JWWA 2C2EA 4PXBA 3NRXA 2R4FA 5U47A 5FNVE 1ZAVA 4OLPA 4KQZA 2E1PA 4EBEA 3AXJB 1S97A 4D3GA 5CCMA 4RX6A 1REGX 1S59A 3BKFA 2FVPA 4ZLPA 5LGUB 5CYJA 2WAUA 4LFBT 1F60B 2RB7A 4GK5E 4Y2MA 1U49A 3CD0A 3MPWA 2FJXA 4Q43A 1PJ6A 5C5JA 4Y65A 3AAIA 4IYQA 1HI1A 4PK4A 4DV5J 3DLKB 2MKKA 5SZTA 2KVIA 2LU2A 4F50A 3LGHA 4F4ZA 3UN3A 2KM8B 2ZH3A 4U7IA 1Y5IB 2HNZA 1R6VA 2A6OA 1XJWB 5BR8J 5LGTB 1RTDB 2W4XA 4DV3T 4F25A 1CLFA 4DPTA 2KZ7B 2Y9HA 2JFDA 1NHVA 4YB6A 4G1QB 4JI5F 2VG7B 4IIJE 1T9YA 4LF5J 3AAEB 2VH7A 1MG7A 3CDWA 4HDHA 1ZTWA 2VG5A 3ONXA 3PUYF 8ATCB 2ZDOA 1N5QA 1H6KX 2CDRB 2DCLA 3U1LA 4EEBA 3QIPB 2HBQB 2VKRA 5LMUJ 3M8YA 1S1TA 3T5HA 2HQFA 4XAKA 1EHWA 3B4DA 3EAMA 4LREA 1X7VA 1BHNA 2MQMA 1RT1B 2FVRA 1KSPA 3FFIB 4EYHB 2N9DA 2CXDA 3UU4A 2W8KA 3H25A 4N78D 1KLMB 1KTQA 2VQFT 3QFWA 2JQ9A 1RTIB 3MM5B 2ZM2A 2UUAJ 2JQHA 3FRYA 3NOCA 4JV5F 2FVSA 2V8SV 2BJ1A 2A2DA 2LDIA 4EUVA 2H89A 4UR9A 4JBWF 4EIWA 4DS5A 5LXRA 4G1PA 2YQ3A 1FO1A 1Y5LB 1TV6B 3ZSSA 4EYUA 1TMJA 3A8YC 1U1QA 3OYZA 1VIOA 3KDOA 1BQMA 1RWKB 4ZVTB 2MBGA 2J6SA 4PJNA 4HE8A 1HPZA 2F9JA 5AFUL 2XAHB 4LF6T 2W25A 3RAMA 4L75A 1E6VB 2NTYA 3POTA 5HQMA 2YWGA 4DBQA 4E98A 4LRFA 1HNWF 3RRGA 5FYMA 2CWKA 3ENAA 4C3LA 1U2RA 4CLUA 3TP2A 1JMTA 3FCHA 2YVSA 2CQGA 4O4RA 4O3OA 4ZS6A 1AUDA 1BR0A 5L9XA 5HXEA 3W8PA 2EKNA 2X0LB 2FTRA 3TX8A 3H5SA 1MSWD 3R2DJ 5HYAA 5J1EB 3ZZYA 3MAHA 3FSIA 1SC3B 1W26A 2HK2A 4L3NA 3IBFB 3UCZP 2LSKA 4CLLA 1IWGA 2D2SA 4ICLB 4JUYA 2LFVA 4DR7F 1S1UB 5L3FB 2DEJA 3R5DA 3EVYA 3ITHA 3QRPA 2E9XB 3VKGA 2R2RA 2EFVA 1EKSA 2ZNYA 4N8OA 4EEDA 4ZVFA 3DRSA 4ZP8A 3OLBA 1H73A 1X4HA 4UOCA 1FVQA 4TUYE 5L1JA 3KHGA 3VR8A 4IOBA 4ILUA 3MZIA 2IAKA 2YKMA 4C0OC 1ICEB 2I1RA 4H4MA 2RF2B 4CLWA 2P6TA 4NA3A 4HTJA 1KNRA 4EEYA 3C3LA 1ZA2B 2EK6A 2XEXA 4Q25A 3PUAA 4TN2A 4ZVUB 1KF6A 2UVVA 4B3ST 1S48A 3GSIA 5AQHB 1AW0A 1CQNA 4I2QB 5CJ5A 3DMJA 4U6PA 1LVFA 4QIEA 1SUMB 3NS5A 2L41A 3KLHA 5L1LA 3GTYX 4AQYT 3O8WA 4WZXA 1OQ6A 5FL0A 1XNQJ 4NEZA 3EDRB 3CJKA 3AJDA 2ZBQA 1VI7A 3A5XA 2VK9A 1Q7YT 3Q2MA 2G0UA 1S57A 4X65J 1P9QC 6FD1A 3NCPA 3QRRA 4G3IA 4LFCT 4R0JA 1JNZB 2D3O1 1N88A 4H4OA 1NO8A 3GSDA 1UEKA 3OVBA 1HMVA 2GIFA 3M30B 2XS5A 2OSRA 3HHDA 4RW7B 4WZMA 2UV8A 3TAMB 2AYEA 3D5MA 1X9BA 5HL7Q 3V5SA 4TLQA
chains in the Genus database with same CATH topology
3RBZA 2IIUA 3L4BC 4J90A 4Q25A 4XTTA 3L39A 1T8BA 1XWMA 1T72A 1LNQA 4J7CA 3KXDA 4EI2A 2OLTA 2BKPA 3JXOA 2BKNA 4L73A 4RO0A 4YS2A 4J9UE 2BKOA 2I0MA 4L74A 2AEFA 2FY8A 1VCTA 1SUMB 4GVLA 2OGUA 4J91A 3RBXA 4J9VA 4L76A 4L75A 2AEMA 4G65A 2AEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBZ A;  2IIU A;  3L4B C;  4J90 A;  4Q25 A;  4XTT A;  3L39 A;  1T8B A;  1XWM A;  1T72 A;  1LNQ A;  4J7C A;  3KXD A;  4EI2 A;  2OLT A;  2BKP A;  3JXO A;  2BKN A;  4L73 A;  4RO0 A;  4YS2 A;  4J9U E;  2BKO A;  2I0M A;  4L74 A;  2AEF A;  2FY8 A;  1VCT A;  1SUM B;  4GVL A;  2OGU A;  4J91 A;  3RBX A;  4J9V A;  4L76 A;  4L75 A;  2AEM A;  4G65 A;  2AEJ A; 
#chains