1VCTA

Crystal structure of putative potassium channel related protein from pyrococcus horikoshii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH0236
publication title Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
total genus 69
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 1vctA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 1vctA02
2I0MA 4J91A 1LNQA 2AEMA 2BKPA 4RO0A 2AEJA 1VCTA 3JXOA 4EI2A 2OGUA 4L73A 2OLTA 4L74A 4GVLA 4J9VA 3KXDA 4G65A 3RBXA 4YS2A 4XTTA 2BKNA 1SUMB 2IIUA 1T8BA 4J90A 3L4BC 2FY8A 2AEFA 4Q25A 2BKOA 4J7CA 1T72A 1XWMA 3RBZA 4L75A 4J9UE 4L76A 3L39A
chains in the Genus database with same CATH superfamily
2G2ZA 5D0EA 4KGMA 4BHQA 2HN2A 4JEUB 3CCQS 1RTIA 3WC0A 3BKUA 4BA9A 4DJBA 1A9NB 2ZH2A 1WORA 4BWMA 4FS1A 5KOWA 3P4RA 3NS6A 2YDSA 1N4LA 5G4DA 1FK9A 3NOCA 1VBXA 4L76A 4X84A 2ZOFA 3GV7B 2RUGA 2C3OA 5A8WA 1YK9A 4MMOA 1YLXA 3SV4A 1U2CA 2KKHA 2A6MA 1RTIB 4R0JA 3RIUC 3M4XA 4USVA 2ZM6F 2HAIA 3HVRA 3GILA 3L8RA 1ZYQA 2DK2A 3N2GE 2DNKA 2ROEA 1FK9B 2KYXA 3DGVA 2WVDA 3G87A 5ETMA 4X2BA 1TQLA 4RU2A 2IHR1 1L3UA 5AXMA 2XQAA 4DMZA 5H9EJ 4B3RJ 1N32J 4JI5T 2BRKA 3GIMA 3MD3A 3T1HT 4O4HE 2XMAA 3P8BB 3BO4A 1B3TA 3DDNA 2U2FA 5AQMB 3TQEA 2MXYA 1FRXA 4NCAA 3NBPA 4J90A 3BQIA 2JVRA 3FB2A 3GIKA 1GK8A 3ZKRA 2LU1A 4M5JA 2YDRA 1IXKA 4WTYA 3AOBA 3P8CD 4RZRA 3B13A 1I51B 4UOHA 5GAHU 3VRBA 1H2TZ 2X0LB 1YX2A 2YY3A 3C98B 1H73A 2UUAT 4KHPT 5KFAA 1KVKA 3ZSSA 1RB0A 3UW1A 2F4VF 2XNRA 3PUYF 2VH7A 3BBCA 4HE8A 4LFAF 5A2QY 3TLVA 1UVMA 2KG1A 3AQPA 1IKYB 2UXBF 3DOKA 1NCLA 2M4MA 2R8GA 2KZMA 2YK0A 5H1SV 2HQ3A 2CNLB 3J7ZT 2EKNA 4MIAA 3AJDA 3IF8B 2FY8A 1L3TA 4WBOA 2LM9A 4K5RA 2DPIA 4DV4F 1KTQA 3MPWA 2BJDA 2HLUA 3DOKB 2BXJA 2CDRB 2D3UA 3UDCA 3PX4A 2ZUGA 1T03A 2DGWA 2Z58B 1BGXT 1OPZA 2QLWA 3H4BA 3EHZA 1QLNA 4QYZJ 3CCJS 3R8YA 2AJQA 5BR8T 3OW2R 1YJ9S 4OHVA 4EYIB 5FY7A 5HANA 3GSDA 3DKDA 4QHOA 1RAFB 2A72A 3MEKA 4HHJA 2UUAJ 2HHXA 2BE7D 2DRDA 1N34F 3F44A 4KHPJ 3UUBA 4HWFA 3MEEA 2P9GA 4IREA 4ALZA 3QSYB 1ZH5A 2QLJB 3VKHA 2LEBA 3AE3A 5AJ3J 3HT3A 2LQBA 1YQ3A 4QW9A 2ES0A 2Z8QA 5HQLA 3BN4A 4GYRA 1R8PA 3J81j 3AOCA 2B1EA 4MK8A 4YY3T 2CADA 2CBIA 2RDIA 4F4AA 3PJAJ 2W24A 4MT1A 5KG2A 2M9KA 4ZN3A 2J9DA 2Z2ZA 5KG7A 3BQLA 3WX8A 5KFLA 3SWHA 2C1EB 2NREA 4IG3A 2CDQA 3ZNJ1 2CHNA 5BR8J 5EUHA 4LF1A 3UN2A 5AQHB 5CYMA 1AZSB 1TKZB 2FGCA 1WC4A 4NLOA 3PEJA 4J9MA 2WS3A 4IFVA 2JFKA 1X5SA 2NPFA 5JDHA 2ZZTA 4NOHA 4IG3B 4DUZF 2GHPA 2ZKTA 1CS4A 1HD0A 1RLDA 4EK2A 1B70B 1XZYA 5CYMB 1RT6A 4L9IA 4CYUB 3PZPA 5JXSA 5HP1A 1G3OA 1VK3A 3Q83A 4IFVB 4YY3J 1OY8A 3JAMY 3O1JA 4HT5A 4ZI2C 5J2UE 1TL7A 4U33A 4ICLA 2ZJQQ 2JZ5A 5ETNA 1CS4B 1GXLA 3TI0A 4WP3A 4IL4A 1HWJA 3EVOA 1QUPA 5IWAF 3HHLA 4HT7A 4KR0B 3UTKA 2W66A 3L3PA 2YEVC 4HI2A 2I5JB 2ILZA 1JJHA 1HBNA 3UU4A 4A46A 4K4TA 3HHEA 1RCXB 4I56A 4ICLB 5L46A 4QU7A 1IR0A 2IIUA 3N5BA 4I1TA 3J80Y 3LDQB 3CCES 5A1LA 3JTNA 3CVKA 4C48A 2I1RA 4KP3C 5AE3A 3B57A 2HS4A 1Y11A 4A98A 5HBMA 5C24A 1X79A 1CJUB 1HBNB 3DGPA 2BKNA 4G6VB 1W09A 1ROFA 4X65T 2BVMA 5F41A 3CDAA 3QLHA 2DL1A 4N56A 2XQYA 3VAMA 3VR1A 2WAUA 1NO8A 1SH0A 3CE8A 1XDPA 1REVA 4QXBB 1S1WB 3EM1A 5C24B 1YWXA 2EFGA 1X8DA 2JNJA 4OYWA 1Q5YA 2KM8B 2RQMA 3MM9B 1K47A 3GJQB 3AA7B 3OD2A 4A8QA 2YINA 4OMFG 1SJ4P 5KT7A 3I9ZA 3HHDA 5H6QB 5JVDE 1Y4ZB 3I6PA 3N2KE 4PW8A 2XSJB 3C6UA 2KFNA 2KL8A 3ZYKA 4OYPA 1SA0E 4X4TA 4JI7T 4DPUA 1CBKA 4MYTA 3DLJA 3KHRA 2JEIA 5HXCA 4DR7F 5HI7A 1H38A 2YX7A 1UWBA 3IRWP 2GJFA 4JI2T 4QH5A 4EYYR 1WG5A 2VKOA 4KGXB 3HF5A 5LL6d 3PFOA 2V4RA 4RPFA 3EYZA 2G2OA 1FJEB 1PYOB 2EFQA 4LRCA 5HMYA 2V8VA 3V4IB 5LJNA 4AQYF 4X65J 1WTFA 4XZCA 4IE4A 2Q79A 4A4JA 4ED1A 3AEGA 3E2EA 4MKAA 2RE1A 4KRWA 4MKVA 1S6OA 3P96A 1B0TA 2XS7A 8ATCB 2EBEA 1S9GA 1VBZA 3E08A 1SC6A 3HFZB 4RX6A 2NXNA 1QTNB 2NUHA 1F1BB 3ETMA 2V9WA 1WTBA 2E5LF 1UUSA 7AT1B 1R6VA 2AMCB 5AQIB 3BQ1A 1HI8A 4LMKA 4JI7J 5KT2A 2X1BA 2VOOA 3OVAA 3VRAA 3F57A 1S9GB 2I0MA 4IT4A 4JI2J 1EQ0A 4UIGA 1RTZA 3MF5A 1F3VA 2WDVA 4IOAQ 1XQIA 2W2MP 1NEKA 2VQET 1CJVA 5KFGA 3R5AA 5EDWA 2DLRA 2XMTA 5ABHA 2P9EA 2Y9HA 2XMKA 5L3DB 3MXZA 3CMLA 5IV3A 1UZDA 3KDNA 4BJMA 5FY1A 3A8YC 3OLAA 2MBGA 4O44A 1R89A 4F0HA 2PMZD 1WC1A 1Y3KA 3QC9A 3KV4A 2QA4S 2HN1A 3VAFA 1CJVB 4OHWA 4CZCA 3HHKA 2EXUA 4I4BA 3ICLA 1XR7A 4HKQA 1WC0A 3CDEA 4KO0A 1X5TA 1S35A 4UVBB 5LNKA 2XM3A 4ZLNA 4NLWA 3OVSA 1D3WA 2WHOA 4A8OA 5JDMA 1EAYC 4HTIA 2UUWA 5KFKA 2MKCA 3CO0P 1EQMA 3GYNA 3ZNUA 3O5TB 2VUGA 2LEHA 5A8KB 2M6IA 5L2LA 2VQEJ 1IM6A 3OQ2A 4GRSA 4Q25A 2YKPA 3OT9A 1JQGA 3U02A 3EXYA 4PJJA 3PV8A 1SXLA 3KLFA 1F0XA 2GQQA 5KG6A 4ZP7A 3S6EA 1HR0T 3G86A 3FXDB 3GMIA 3FBFA 4AXIA 4DR2T 5FKYA 4JI4F 1T72A 1I94T 1R8CA 3C64A 4ZKAA 3H90A 1YJRA 2ODUA 3CCMS 3H98A 4BBYA 1IKVA 2C2MB 3D0HE 5J2PA 5ABEA 4DN0A 2E5IA 4Z7YA 4C8YA 2DPJA 2CPTA 1SCJB 5AT1B 2NXJA 4LIRA 1RWKB 2M5YA 1HNVA 3DDKA 4ZVOB 2UU9T 3W2VB 4ZLLA 4B9VA 1W26A 2HSEB 1DTTA 4N76A 2XM1A 4P9SA 3TAPA 4LFBT 2IAJA 2VF3A 1F5BA 4YTNA 1U25A 5ETVA 3TJ9A 4F4WA 3K5NA 1RT7B 2KFYA 1RT2B 4TVAB 2XHWA 2VA2A 4V19X 3PV0F 3MFHA 3SV3A 4USWA 5J1GA 1KS2A 4JV5F 3PR4A 4AL7A 4FPIA 3TP2A 2UV8G 3G96A 2E9XC 2LA4A 4JI8F 4WU3A 3K0JA 2OFHX 1AXQA 4DR2J 3T1YT 2R7OA 3K58A 5HEUA 1I94J 3ZLIA 1I5OB 5L1LA 3LBXA 5HYAA 3CWZB 1WG1A 4KPCA 3LP0B 3HI9A 1YRTA 3KK2A 3CCRS 1U26A 1Z2LA 2VKZG 3JSRA 2AEFA 3MHYA 3W63A 3F2EA 4LVOP 1T9TA 2MZSA 2BQUA 3SSRA 2UU9J 3P45B 5CXTA 2CVEA 3HVAA 4OLOA 4IRDA 2HAFA 3K1SA 2DCFA 5F9LA 3M2RA 4LFBJ 5GMEA 2P9CA 3WDOA 2OPQA 3KK2B 3H5SA 1NM2A 2IMLA 2YNGB 2OSQA 1HPZB 3GZ7A 3CDBA 2A2CA 2AEJA 2WAQD 4NLUA 3DN9A 4LBHA 3OTEA 4E98A 1PAEX 4DCJB 5KOXA 1ITPA 5T14A 3AAIA 2LHNA 5IM0A 3M2RB 2E8IA 3RIUA 3PO5A 2VQFF 2OPQB 4NZ6A 5FMNA 3VALA 3ZTSA 4U7UD 4A8WA 3DRPA 1UW4A 4YXDA 3UNGC 4ECTA 3T1YJ 3JC6C 2RNEA 3PU8A 5L3CB 3NBXX 2AT1B 1TFYA 3CJ3A 2AYGA 3GSIA 3BKTA 1YBUA 2IM0A 4DFMA 3I56S 1HKAA 3CJTA 1M5OC 5THWA 3LTOA 2RRNA 4EUVA 3IHRA 4NLGA 2RB7A 2XCAA 3HZGA 2J7WA 2N7YA 3DRPB 4Q7AA 3T5HA 2DIUA 2XMWA 4BJNA 4YN3B 1JX4A 1DTQA 4Y34A 2MYSA 1TMJA 5KFMA 4X20E 4PQUB 1EKSA 4I6WA 2EPIA 3IS9B 3E0ZA 2C28A 1HNZF 1RAAB 5CYQA 4L6V3 5B0GA 4FP9A 3QGPA 2FJWA 2J62A 5DG7A 3HK2A 2LXFA 1UCUA 1RHMB 3PW0A 1FVSA 6FD1A 4QH4A 3HCXA 2WZHA 5KFYA 2ACZA 3AE1A 3RBZA 4CXXA 2BACA 2R9LA 2KJVA 4OI0A 3HVWA 4USUA 1FNMA 4YDXA 1OEDA 1VQLS 2DGUA 2RRBA 5FVKA 2AZ3A 4OYAA 2F4VT 1S9FA 5DZ7A 1ZA2B 3MEGA 4HEA9 5FVLA 2MQNA 2FUPA 3VAIA 4ZPTR 4AXJA 4WF9Q 2SPCA 1DLOA 5AXNA 4QQBA 1SQFA 3G6YA 4JI6F 1OEDB 4IO1A 5U47A 1NPKA 4RUBA 4MLKA 2JEJA 1R27B 3E01B 4GO5X 5KT4A 1NZAA 3C46A 1K0VA 4ELUA 1BWEA 1JJ2R 1PIEA 3KKFA 1LEOA 5A6PA 4CLPA 1U6BA 1WYBA 4OHYA 1DLOB 2KTQA 4LJMA 2RF2A 4PUOB 2CRLA 1HCIA 3CC4S 2W2OP 3EE3A 2LDYA 4CO2A 2XSBA 4L75A 2L3LA 2A10A 2ZM2A 4G3IA 4LF4F 2UXDT 2CBJA 1HBOA 1D9DA 1UZHA 3M7VA 1HNIA 2X9YA 4H9SE 3HSJA 1N34T 3BQ2A 5FL0A 1KSPA 4K0KJ 1M5HA 2RF2B 2FVPA 1SQGA 3R7BB 3UDVA 3AD7C 4N8NA 4DV3J 4YQWA 3D0GE 3RAMA 5L39A 4FF3A 4MK7A 3UE2A 3J7YI 3HKEE 1EJ7L 3MEDA 4X4PA 3VCDA 4YR3A 3AE6A 1HNIB 4I7FA 3LA0A 2FVSA 2JIWA 3IBFB 1WCRA 4PG8A 2IC9A 1G7CB 3BEGB 5IT9U 4JYAT 1GX6A 4ADZA 2PFFB 3ILIA 4JI0J 2B76A 1Z1ZA 4K0UA 2HRUA 4GVBA 2YX1A 4K2JA 4CM0A 3HKDE 2QYGA 1IJ5A 2W7OA 4N77A 3GMGA 2H7VC 4C98A 1G2EA 5LHGB 3TUJC 5M4YA 3R27A 4I7FB 3AEEA 1BY9A 1HWUA 3EVWA 2D2SA 1IR2A 2UXDJ 3W60A 3DOMA 2XHCA 5D4NA 1WF0A 3NEKA 2W2UA 1RTDA 4HFIA 1ACMB 4GVBB 2DNQA 2N3LA 1RAOA 2ZH8A 2V2KA 1OWAA 4KC5A 1HNWF 2OJ3A 1S94A 2D5UA 4ZPCA 1YJUA 4ZPAA 3EGNA 4DUZT 1S79A 3H3AA 5GVQA 1WNEA 2V69A 3DOMB 4YJ3E 1RTDB 1Y00A 3MM8B 1U48A 3CX8B 2YWGA 2VFSA 2HHVA 2D9OA 4IOCQ 2BX6A 3Q8UA 4OV1A 3T9NA 4JYAJ 4TWDA 2DNXA 4OIXA 4PXCA 1S49A 2N82B 4LR8A 1G6BA 3CK6A 3N6NA 3S8SA 3UVJA 3OTOF 4DU8A 1PC5A 4DS4A 1ZM3A 1UURA 1YVFA 2P5VA 3GJTB 1PO6A 1CVJA 1XMOF 4A97A 3M32A 4YS2A 2MKJA 5KFXA 3MECB 1XR5A 4UY8T 2P9BA 3D3BJ 4B3TF 4X64J 3R97A 3PR5B 1TL1A 2BZBA 3DMJA 3BYRA 2GK9A 5DLGA 2CXLA 2LU2A 5KFQA 3BGLA 2ZH6A 1E7PA 3MMBA 4IO9Q 2M2BA 2M7SA 4DUYT 4EU0A 4QBUA 3MPVA 3M32B 4QJVA 2CPYA 4PJMA 4PYAA 4ZI3C 1SKWA 1HTJF 1RCOB 3EXCX 1B64A 2VKHA 4F7VA 4XAKA 1BLUA 2QA2A 4Y2CA 1H2VZ 2MKHA 5B0BA 1R6YA 3MMBB 1L5UA 1N52B 3EGVA 1UPMB 3OTCA 1RYRA 3OHAA 4KHZF 3FHNA 2B7CB 4LF9J 2IRYA 4Z2XA 1Q1KA 3OYXA 3FBZA 1JLCB 3VAHA 1W2BR 3QYYA 3HXMA 4AKGA 4U67Q 3CCSS 1TV6B 3M2UB 3I0SA 1R43A 5F3JA 2PI4A 5DRKA 3VVUA 2ZH1A 1E6VA 3RR8A 4IDQA 5HSPA 4RO0A 2AYMA 3MAAB 3T5JA 5F8JA 4HH0A 4AUKA 4AKHA 1RT5B 1ZV4X 3R2CJ 1FHTA 4DUYJ 1KK7A 3QRQA 4YLHA 4X4UA 2MQLA 3NG8A 3D6TB 1E6VB 5KFJA 3U27A 4AQYT 3WQPA 3KNAA 4CDIA 5SUHA 1EP4B 3M8WA 3QIDA 5K8NA 4QX7B 2L3MA 1CQMA 4OJ3A 4DR6J 1NDKA 5L9NA 2MSSA 2RQKA 4TXSA 4YR2A 4DR1F 1CJTA 1LRZA 2OUGA 2D0TA 4E8UA 2Y1JA 5DABA 1YBAA 3W8PA 1SH3A 2GIFA 1UFKA 1PG5B 2VV5A 1TZ0A 2WB1D 4QW8A 2V8HA 4WKRA 3B5MA 3ZZUA 4UF0A 3HPOA 2W7PA 4DL6A 1LQ9A 1QTMA 3KDSE 1WUUA 2OLTA 3RYCE 1CJTB 3H59A 4YHJA 2BE2A 3TX0A 2FZKB 1O8BA 1WEZA 1GX5A 4QX8B 2QJ3A 4ZN1A 1L3VA 2BVLA 1X9BA 2R8KA 3A1YG 3RZAA 1NDCA 3TUIC 4RW9B 1U2FA 4AQGA 2UXXB 4UF0B 3GG0A 3W5XA 4TQRA 4AQYJ 5F8PA 4ZXLA 4M94A 1CJKB 1O0PA 1VRTA 2K1RA 4FXVA 4MJKA 3MCSA 1Q8KA 2ZDOA 1YRXA 3I5AA 4DU7A 4NCBA 4FF1A 3JB9k 1TK0A 3W1YC 2E44A 5DDPC 3OFFA 2FJVA 1IWAA 1R0AA 5F3ZA 1FMWA 4YFSA 4FVCA 1VRTB 2J0XA 2K1RB 3TNVA 3Q89A 4FBUA 5HWXA 3SYZA 4J9VA 2YKMB 4Y2KA 5DZ6A 5CCLA 2J5AA 4KKOA 4DR3F 2LSYA 1N6QA 3J81U 1W9RA 1XDOA 3JAFA 7FDRA 4U9RA 5I42B 3A8KA 1HLWA 2DH7A 3PX6A 3X1LB 1OIAA 3QNUA 3G6XA 4DL5A 3WAKA 2AGQA 1FD8A 4Q2MA 1WRDA 4F50A 5FJ4A 4NA3A 4KKOB 3QWUA 1N6QB 1W25A 1UA0A 4CI2B 1ZA1B 4CM2A 1DAXA 4OV6A 4IDOA 3Q8YA 3BGRA 5LCYA 4WXWA 1S72S 4ELTA 4CCHA 3EDQB 4EYUA 2CQ2A 2JMKA 1NUEA 2BG9E 3NS5A 2L9DA 1FFWB 3RYLA 3GIIA 2LMIA 5EWFA 4LMJA 2AQ4A 1KQFB 1B7TA 5DG9A 3C51A 4DX8H 1IQTA 1ZM2A 2HS0A 2D3OR 5LM7E 3NWRA 3MM7A 5KFOA 2RP4A 4DV0F 3BGRB 2ZZNA 2PIIA 2J47A 3TO8A 3AJ1A 3W9JA 5AE2A 4GK5E 4MKBA 2CPFA 3BR9A 5HJXA 2CQIA 2CWOA 4JV5T 2E9XA 1A6LA 2MAWA 5CB4E 3MM6A 4JI8T 2UXCT 4ZDNA 2FZCB 2BDEA 2RPAA 4KX6A 2DNZA 4PAGA 3PURA 5KFHA 1PKUA 2UV8A 1QD1A 3GR0A 3PJAA 1S6UA 1MWQA 3IN5A 3J7YU 4H4MB 2GIRA 3CT9A 1IKXA 1FX4A 2E9XB 1WSVA 3HO1A 3MM6B 5IT4A 2A0FB 2FJBB 3HT0A 2AE9A 4ZZCA 4IE0A 4JUYA 1WC3A 1GXTA 5KT5A 1RKJA 2KMFA 2E29A 4OFZA 2W25A 1Z4UA 1F5AA 3KLIB 2XULA 4EZ6A 2QMWA 2QSFA 1IKXB 1GFWB 3ABVA 4CXWA 3ISND 2ZM0A 1N5VA 2CFXA 2WK4A 2XAJB 2ZFHA 1RAGB 3M2VA 4F4KA 1FKOA 1K1QA 4OHXA 2O01C 4DS5A 2VB6A 1DARA 2UXCJ 5A8RA 4U6PA 4AQFC 3PXGa 2YWFA 3ZT5A 4OX6A 3D1QA 4QIEA 3J7Z5 5D15A 4OHZA 1AYEA 3QZ8A 5JVHQ 3ETUA 2HKEA 3QT8A 1KP6A 2C2KB 3PJWA 2GHWA 3M2VB 1FKOB 3FBCA 4UW2A 4COFA 3T3FA 2FGOA 4NCGA 4TN7B 1X4GA 1U6FA 3H5XA 2ALZA 3CGIA 3HLUA 2B6AA 1AFJA 2ZMAA 3QRPA 1H3DA 4USJC 3NL0A 3SFDA 2C3PA 4PWDA 1EARA 3GV5B 1R8HA 3IM9A 1S1VA 4ATNA 4IRCA 2RH3A 1WELA 1FDDA 2CNNB 4NCGB 2BE9B 3LFMA 1LK7A 2OPRA 1O6XA 2Y8YA 1IN0A 2B6AB 3GQCA 3IO1A 3WX4A 2XYHB 3ZCJA 2XEXA 2VPYB 2CWKA 4UTGA 1VOMA 4H63V 4DV7F 4PWDB 4PXEA 1XERA 1X7VA 1CEZA 1MLAA 2IMOA 5DQVA 3HR0A 1MMDA 2MZJA 4DSKA 5LSLA 2O67A 4YB1P 3C19A 3OPKA 2VIHA 2ZHOA 2CLYC 1YJTA 3HI2A 2CZ4A 4DV1T 1I6JA 4TNOA 4W90B 2EG2A 5HEOA 2W0GA 1V5IB 2PC6A 2EFNA 4LF8F 1TELA 4M1KA 3EAMA 2QLXA 4PKDB 5DG8A 3QB5A 5D4OA 3NY0A 2CJ9A 2PEBA 3DDIA 4ELVA 1TFWA 1KLNA 1D0ZA 1MIVA 3PIOQ 2IDEA 3QRRA 1TR0A 2KB2A 3N5LA 3V4MA 1RI7A 4WP8A 2C2OB 2Y8DA 2BM0A 2KT3A 1OWXA 1Y64B 3C50A 2MDAA 3CQCB 4IDZA 4U72A 1QUVA 1XNQT 3SS1A 2CQ1A 2PTFA 1FWPA 4HACA 5HXEA 2XY5A 2I38A 4C8KA 4YTMA 1ZOTA 4FKYA 1NEEA 4NL5A 1FJGF 1T02A 1NAFA 2QYWA 2D41A 3DRYA 3I0QA 3Q22A 1OMSA 4DV1J 3D0TA 2YDQA 4RW6A 2M6BA 4V1Av 2LSJA 4KPYA 2CQ3A 3NRXA 3OJAA 2QMUB 4WU2A 5ABFA 2G0IA 2ROGA 3SDEA 3T8OA 4ID8A 1NXIA 4RL1A 1U2RA 2HVHA 2HK2A 1ZZNA 1WWHA 2QL5B 3BKFA 4RW6B 5C5JA 4OI2A 3UULA 4ZIWA 3GV8B 1Q7LB 4FKXA 1NU4A 3NZQA 3SDEB 3SI8A 3WZ0A 5LA6E 4K4YA 3NCQA 4PCQA 1XNQJ 5CD4H 3AFGA 1F9HA 2IVMA 3U1MA 4J9SA 3AE7A 1M5KC 1VRQC 4B9UA 2RRAA 3UPFA 2UXNB 3M6VA 4Y28C 1MIYA 3A5XA 3S01A 5DGBA 4JLEA 2VBXA 3SXLA 4J91A 2MHEA 5LXYA 2Y48B 1FTRA 4OYKA 4LSLA 3R5CA 3TEHB 4ECQA 4X66J 1U1QA 3KLEA 1HIYA 4BC9A 3M9OB 4WNKA 1Q4RA 3D6MB 1XTZA 2CJAA 2CPEA 1T95A 1TTHB 2HBRB 2B43A 1TUWA 1FRKA 4EZHA 1VHIA 1M5SA 2J8SA 6AT1B 3M8PA 3S7RA 1LNQA 1QM9A 3PX0A 5ABGA 3OTOT 2H89A 4OI3A 5ETKA 3PTRB 1HQEA 4LSLB 4NRTA 1UP1A 2MJNA 3N0VA 2QZ8A 3KLEB 2BZ2A 2WDQA 2OPPB 1XMOT 2XY6A 4DQIA 2XBPA 4X4QA 1MMGA 2RSQA 4USHA 4IRKA 2N1GA 3W9HA 1RAEB 3PG9A 2WCAA 2YKAA 3RR7A 3GONA 3BO3A 1HQEB 1QSSA 1RBAA 3KLGA 4UQGA 3NGRA 3P5TL 2CMRA 2JEGA 1FXLA 4XPEA 2K24A 3HSZA 4O2BE 2XTJP 1R8AA 3JQMA 4PG7A 3ONQA 1MN7A 1K8AT 3OXLA 1JLBA 4PK5A 1C0TA 3B6BA 4DPYA 2PGCA 2MQQA 1NENA 4L72B 3AXJA 2G2YA 1Y3JA 1HBUA 2WW4A 5KFRA 1C0UB 1E6YA 4H4OA 1LVKA 2EFOA 1S99A 1AB8A 3W2WB 3K8VA 4OJHA 4GC7A 5T7LA 3KUHA 5KFZA 5ETQA 4RW8B 4G65A 2NPIA 1NK0A 1HQUA 2E7WA 2ZOGA 4UUXA 1JLBB 1C0TB 2VKRA 4Z91A 3QFWA 4YB5A 3AXJB 1XNRF 3D67A 3PUQA 4IDNA 4CLTA 4DF8A 1U02A 5LP6E 1OJ4A 2X1FA 1T9VA 5B0AA 1ZHCA 2ADBA 2B3TB 2IM3A 2DR6A 4WE1A 3PW2A 3JADA 3BGUA 4CI0B 4OZNA 5L47A 2LEPA 1QUUA 1X5PA 1FJ7A 3POTB 3EWGA 1JLFA 1YZ6A 4IE6A 3TYTA 4WCEQ 2O5DA 3EDRB 2MGZA 2HVDA 4DMVA 4WE1B 4Y6IA 2EFPA 3CCVS 4NXNT 2VD3A 1AT1B 2XAFB 5LSOA 1G1XA 3C4ZA 4PABA 3UCGA 3CJRA 2JHEA 1Z8UA 2GZOA 4FI5A 2HG4A 2MGZB 3ISZA 2OMLA 1D0XA 4M95A 1WC5A 4DFPA 1HI0P 2H9ZA 3RB0A 2C22A 4L3KA 3OTDA 3RJMB 1OY9A 3R7NB 1U0HA 2LP4A 1UEVA 4XK8C 3RLFF 1CG2A 4U95A 2WBMA 2D1CA 3D6FB 4ZPBA 2YU2A 4C97A 4LF7F 2VL8A 2FHOB 5L1JA 3BYPA 3BGFA 2HHHJ 4UUWA 1RE1B 2DHGA 1J5EF 4LFCF 2IM2A 2L9WA 2CNOB 4DV5F 2CPDA 3OTBA 2ACXA 3GPAA 2OD6A 2DH8A 4USTA 2X0HA 4F26A 4NXNJ 1RHQB 2FDNA 2IJNA 2HPLA 4DEZA 2KH9A 3EMTA 4U8YA 2X9WA 2B7BB 4QU6A 2V9KA 5AQVB 2KZ7B 1Q16B 5KXJA 2RVJA 4ZITA 1MMAA 1Q8LA 4ZEYA 3C16A 3UFGA 2R2SA 2XAQB 4DR5F 3EDUA 4Y0FA 1X4FA 2OD4A 3RGIA 3UN5A 5H6RB 2XWYA 3CCUS 4F2SA 4C7QA 2YQ0A 3SIPB 1VC0A 1RAHB 4ED0A 1FNOA 4HDHA 3R84B 2BMBA 5I4MA 2H5IB 3C16B 3EX7B 4LIWA 4KB7A 4X1KE 3EZUA 4O4IE 4DCPB 1LV5A 2X7IA 3MKDA 3RUBL 5BMVE 3H2LA 2C2DA 2PMWA 2FJEA 1AFIA 4YEAA 2H54B 2KXNB 1T3NA 3TKLB 2VASA 3CJ4A 2DO0A 4IGUA 2BKOA 2WM9A 3RYIE 3T5LA 3FEXB 3E8OA 4JP8A 2CJQA 2WBLA 2WVCA 3KHLA 2KINB 2DWKA 2XGPA 2FJEB 2ZJRQ 1FDNA 1VQ5S 1V3ZA 1RT4A 5A0YA 3BSOA 1JNRA 1UK5A 2V67A 1KFDA 1ZAXA 3QOFA 3FJ2A 5LMUF 2AX0A 4GKKF 2IPOB 3BO2A 3ANWB 4F25A 3BDPA 5A76A 1RAJA 1KQGB 5BYSA 4HFEA 2UUBT 1WSRA 4OI6A 4ED7A 4ZCIA 1H7CA 3CXCR 2E66A 5A0YB 2FJXA 5BYQA 1JNRB 1CSJA 1IKWA 2QL7B 3RHWA 2RJZA 3ZJ2A 3IGVA 4LQ9A 2NW9A 5ETTA 4DPTA 3DCAA 3B54A 3Q8SB 2L9NA 4ZP8A 4WWSA 2V2ZA 5HVGA 4M5MA 2W9BB 1XMQF 2D7SA 2JL9A 4QH1A 4AKLA 2EHOD 4ILAA 2OPSB 3PTWA 5B0FA 3THTA 2VHGA 5CQGA 3HHLC 1IKWB 3BBBA 4B3MT 3ILJA 1TAUA 2XI2A 2OTJS 2N7CA 3P49B 2WOMB 1ZBTA 5CA0E 3DLLQ 2NXEA 3K3NA 1KEYA 4FYYB 2ODVA 2C42A 2K06A 1X31C 1F6TA 2C3MA 1S4FA 2NW7A 2H51B 4FXDA 5LGNB 3ELHA 4TYAA 5IT0A 1UEKA 5LMNF 4EEYA 1IWGA 3WIVA 5IYZE 3Q5EA 1S4EA 5B7WA 2VURA 2XQ9A 1HYSB 4R8UB 2UUBJ 2YNFA 3D0IE 4X4VA 4TWHA 3T9ZA 4OYJA 3CO9A 3MURP 3N9PA 2IA0A 3D54A 1X4CA 1VC5A 3MK7C 4IG0A 2BJ7A 3I87A 2HEKA 3KK3A 4ED6A 5D8HB 3CW2C 2YNFB 4JI3F 1S1UA 2GIQA 3TZYA 3FZLB 2E9TA 2NR0A 3MM5B 5ETWA 4NYOA 2IY5B 4B3MJ 1MMLA 2VG5B 4C9DA 2FLLA 5D3GA 2DYAA 4OX8A 4IG0B 5C2CA 3CJ5A 5C2TA 1CPZA 3P4PA 2A18A 2DH9A 1YBTA 4X62F 5LB7B 4DQSA 3TJAA 2GHVC 2VG6A 1DJ0A 1JLAA 1TMMA 3Q5DA 4DR4F 3D3CJ 3M9MB 3M8QA 5D3GB 2XB2D 4I67A 5E0OA 5KDMC 4MIBA 2KRRA 4EO8A 2DITA 2GVZA 1GXUA 3W61A 2HZAA 2C3YA 5DQHA 5E33A 3AXMA 2VG6B 1JLAB 5AQPB 1HBMB 3NCPA 1KVIA 3D6HB 1XBWA 4J9OA 3TLWA 3M8QB 2VU5A 2B8PA 2VBZA 4JI1J 4CH7A 4CLLA 1U1RA 4WW0A 5JUMA 3UD4P 3BM7A 3BPDA 1HQ2A 5JRCA 3RGLA 2GVZB 2LYVA 5DS7A 2FUG9 2KNDA 2XHEB 3QO9B 4TLQA 5HEHA 1F60B 4QR1A 1X60A 5CD4A 4NLTA 2HW3A 3QT5A 4QCLA 2W00A 4Z90A 2CLYB 1Y10A 3AY0A 3AOAA 5AQUB 4L3NA 2MZTA 2OGUA 2CRBA 1LW2A 1HHSA 2F65A 4L5GA 1VQ9S 2AKWB 2WSEC 3SFGA 2CQGA 1VQKS 4DSIA 5EK4A 3NKYA 5KFSA 2DEJA 2W9CB 5C8YE 1YI2S 1HW9A 3KK1A 1S76D 3AE4A 4AISA 2VKJA 3T6JA 4WK3A 5ETRA 1PBUA 4XDDA 5IXUA 3JCFA 1OS5A 2F7VA 3AT1B 2AV5A 1FJGT 1LKZA 4ZCLA 2AGPA 3S4UA 1Q95G 3BSNA 3DYAA 2EC2A 3AXKA 3AEAA 3KK1B 2IBOA 4MHCA 4UY85 1TP7A 3UCUP 2POKA 2IVYA 1RBLA 2V6AA 2DGSA 2R7SA 5C2GA 1WD6A 3FSIA 2B56A 4U74A 2J6TA 2ADCA 1IBLF 4GC6A 4C91A 4ILRA 4WBFA 5MAOA 2WBRA 1Y01A 2HIYA 4Q8EA 4DV6F 1C1BB 4GO7X 4P72A 4A8SA 4GKJJ 2ZITA 1SL0A 2V94A 2OTLS 4K4VA 2KRBA 2R2RA 3IWXA 4QKNA 4ZHRA 4Y00A 2MPKA 2VJVA 1FE0A 4CTAA 1GAOA 3BDEA 4ZS2A 3H0PA 3K2YA 3RKOA 2DHSA 4ECYA 1SV5A 4P2XA 3QT6A 4IE7A 1KLMB 1HG2A 4LRAA 2YKNA 2RQCA 4K7QA 4AT1B 2MB0B 4RBUA 2KT5A 4C0HA 2KVIA 5DQIA 2VFUA 3AB4B 2GMJA 2F8HA 4ZHRB 4KFBB 4ZIVA 1U1OA 4NXMF 3U1LA 4NLDA 1T05B 2LKZA 4F6RC 2HHWA 3RG6A 1BC6A 2DCUB 2UZAA 2DR9A 1SV5B 1VQ8S 1RISA 1XR6A 4J2CA 2JDJA 4LRBA 2KJWA 2ZVIA 3W15B 1ZZFA 4URSA 4ECRA 2MPUA 4I4TE 4NLPA 1LFPA 3L09A 1FE4A 4ES3A 4QWDA 3P7IA 4M8LA 2Q9QD 1NKCA 4HFCA 2HFNA 3DLHA 2QTWA 1M1HA 3D1HA 4DWIA 3R1LA 1N8RT 2XQCA 3TAMA 2DHXA 1TKTA 2XMJA 4PG5A 2ACMA 3UU5A 3TA0A 2NLWA 4AKRB 3UDEA 2N4CA 5I3PA 4YB7A 3I1AA 4DV2F 4RW4A 4RBVA 1RA6A 3DTOA 4F0KA 2A3DA 2CAJA 1HFEL 3DFEA 1NPPA 4XO0A 1S9EA 5LSRA 2C2ZB 3TVZA 3NGSA 4ILCA 3THPA 1TKTB 1FFSB 2A3JA 4A8XA 2YKOA 5FXVA 2UUCJ 2QV6A 3AE2A 1ZPVA 1SC1B 5K8MA 4F2RA 2IC6A 2J9EA 2NZCA 1XN9A 3PYDA 1VCSA 3ZTOA 1T9YA 3KJVB 1S9EB 2R7RA 2CXEA 4JV2A 2PO4A 3RU0A 4JEHB 3FUYA 2V26A 3QUJA 4DIDB 3QZ7A 2ZH3A 1IBKF 4EGLA 3FQLA 1NSPA 4DMWA 1C2PA 2WP9A 3I9WA 3OHBA 4PNIA 2V2QA 4OJ1A 4I6YA 4I69A 4EMDA 4HHHA 3D1OA 2RS2A 3OL8A 1N33T 2IYGA 3A8JA 3FCVA 5E41A 3ZZZA 3A3NB 3ZZPA 4DBQA 4OZJA 1ZAWA 3THVA 3D4JA 1FA0A 5EWGA 1ZKEA 4TU8A 3I5CA 3TEGA 5A8WB 3UUXB 3AD9C 1N36F 1TKXA 1NDPA 2ZLYA 4ECXA 4NZ0A 4PWWA 3VGTA 1BR2A 1D1UA 1GTHA 1IAPA 1VBKA 2HNZA 4CT8A 1FEHA 1XWLA 1FTCA 1SKRA 4IYQA 2ZBPA 1T11A 1DQ8A 2XZDB 2HHPA 1TKXB 2W01A 4BC7A 2DWGA 5IOLA 3K5PA 3U3IA 4QYRA 4NLVA 1I1GA 3KLHA 3LSVA 1FO1A 1IM4A 2CA9A 5HLFA 2RILA 2MKIA 3NBPB 2R7VA 4YB6A 2WTFA 1HI1A 1OEDC 2ATLA 3N6MA 1N33J 3TVYA 2JVOA 4ANJA 3DU6A 4RU9A 3KBUA 4KYZA 2EWHA 2DNYA 3X1DA 3ZPOA 4FVMA 2YNIA 4J9LA 4HWCA 1B0PA 3KLHB 1M1GA 5FXZA 3IEEA 4JI5J 4LF7T 3FSYA 1OQ3A 3T1HJ 2QLBB 3UU3A 4J9RA 3PRVA 1FRIA 5FD1A 1ZS6A 4K8RA 3WAJA 1Q0NA 4DV5T 4C8ZA 2YNIB 3CX6B 2CXFA 4IOBA 5CYJA 2D0UA 1X5OA 3A13A 4ILUA 2PFVA 3FEYB 1GMWD 3KVBA 4K59A 3V81A 1AA1B 3MTKA 2COLA 1E1HB 4DR5T 1PYTA 4QWBA 5AFUL 2AYBA 2LSKA 2SXLA 2FLOA 2UVRA 3KV5A 1T03B 3KTQA 5DM7Q 4QZVB 5EX3A 4ANDA 3CQXC 3MA9A 3V81B 4H9OC 2DNMA 4N5SA 3WI3A 2X67A 4MH8A 2CCQA 2B0GA 2NW8A 3IGNA 3CD6S 2QA4G 2B9XA 2D9PA 4B02A 5RUBA 3MEEB 3B4MA 5HROA 2IJFA 5E3CA 4IKAA 3Q5WA 5KG5A 4TV8E 4AFFA 3EZOA 1XEZA 5JDFA 5LBMA 4HGAA 4NWBA 3PW7A 3N9UC 2N3OA 1LK5A 3O9XA 2R8IA 3DU5A 4DFJA 1RBOB 2GMLA 4KBMB 5F9NA 1JNZA 2WONA 3LANA 5HROB 3M8RA 4NA1A 1SH2A 1DRZA 3H42A 2LCWA 4B3RF 2YNHA 1N32F 2DB1A 2E5GA 3KUEA 1EHWA 4NEYA 2NWBA 4CIOA 2R8HA 1YXRA 1M5PC 3AE5A 2QVAA 3LP2A 1R3NA 1LW0A 3O2IA 2DY9A 5KG1A 1VK8A 2VJUA 1JNZB 4N41A 2I9SA 2WONB 5J2NA 2GJIA 1SVDA 4P0AA 4IDKA 3RQUA 4BCAA 2EK6A 3TUPA 2H48B 4K50A 2RD5C 2YNHB 2PSZA 3ZCIA 1KNPA 2LHRA 3LP2B 2EG1A 4DFKA 4M5KA 3X3UA 1WFDA 2UUTA 4IR9A 2HFSA 5J2NB 2H5EA 4IDKB 3HP6A 3NKZA 1XMQT 2EKYA 2DGVA 4F3QA 2Z0GA 1I6ZA 1RT6B 1YIJS 3TA1A 5KFFA 3LK42 5HP1B 3C4WA 2W63A 2VC0A 3W9IA 3CJKA 3D9BA 1TL7B 2KHDA 2C5KT 4PQAA 2YH0A 5G0RA 1HARA 2CA5A 4CRJA 4AKIA 4OYOA 4PPDA 2HQCA 2FHJA 4DQRA 1X4DA 4LREA 4ZOSA 3GWCA 2YU1A 3HHLB 4LUBA 2ZHBA 4ISSA 3U78A 2AJ0A 2XNQA 2J0QD 1Q5VA 3DI6A 3NXZA 2EK1A 2JPFA 3PUVF 3MR6A 1NWMX 5HJYA 1V3SA 3EICA 2JC0A 1UEUA 2XPKA 5L3EB 3DHXA 5KT6A 3IA3A 4RKUC 5I3UA 4ECVA 1RAIB 3TRGA 3W64A 4B9LA 2KYZA 4M5GA 4OX9T 5D0HA 2ZUAA 2W4DA 3F56A 5HBMB 9RUBA 4PEOA 2UUAF 4P2MA 4KHPF 1XMQJ 1NSKL 4CH1A 2HFVA 1VIXA 3DGPB 5GMDA 2DHHA 3DNCA 3LK3B 5IS2A 2LLYA 3Q86A 1Y5NB 3QLHB 3CB4A 5AJ3F 4OI1A 1YKEB 3ILLA 2PD1A 3Q2MA 5EN1A 5KFEA 1REVB 1SKSA 1RWUA 5JREA 2Y0SD 2B4PA 1D8ZA 5JMNA 1X9WA 5FL1A 2QT7A 2V8DA 1VJQA 4DR4T 1KQKA 3PRDA 3C6UB 2HZCA 4B9TA 1UVLA 2LSGA 1HNXT 3TQ1A 1KVJA 4ZPDA 4B3ST 1GNKA 4DQPA 1D0YA 4WTOB 4B9MA 1UWBB 3UCZP 2WW8A 4PFOA 2XQ6A 1H74A 4TUYE 3MACA 5BR8F 3JSYA 5F8IA 4HWHA 3FBLA 4XAXB 2ZHAA 1N5YA 4OX9J 3ZN1B 5L9XA 4DG1A 3NGUA 4FPRA 3RYFE 4ZZBA 1YJ7A 2NUUG 3OJSA 4WYVA 3CD7A 3UFCX 2ZH7A 4DI6A 3SOLA 1T94A 1RT3A 4L73A 4F02A 1UW9A 4F8RA 3NNAA 4ZVGA 4UVCB 1G4CA 2DGQA 1N5YB 1AJ3A 1S0MA 3EUHA 4NIQA 3VU7H 3FKBA 1UKUA 4YY3F 3JYTA 2I8EA 3UNYA 2V6YA 4TQSA 3OL7A 4CO3A 5D4LA 4O4GA 5FY0A 1WLXA 1RT3B 3AE9A 3PUSA 2OKQA 3P50A 3PVXA 4LR7A 1HNXJ 3DM2A 1UETA 4B3SJ 1O5JA 3TLTA 1MWZA 3G4SS 5DGAA 3JYTB 3CULA 4D3HA 1YJWS 2V6YB 3IR7B 4F0MA 2XMUA 4USKA 2CEAA 3AB2B 1IBMF 1FESA 2DISA 3R6LB 3MWBA 1OY6A 2A1BA 1OSDA 3AA8A 3C15A 1VS3A 1WOPA 5F0UA 4O44B 4YHHT 3CCLS 3LJCA 2LKGA 4OK0A 4IQMA 2MQPA 4X4SA 2OELA 3BH6B 3KJFB 2QYCA 3OXFA 1U1LA 2ZM8A 3TOQA 5HATA 2XMVA 4P7VA 2DT9A 3VV2B 1LWEA 3C15B 4KO0B 3RW7A 3VHQA 3VTIA 4CH0S 5L1KA 3OVUA 3PCOB 3GCXP 2ZZMA 3P3DA 3SZ2A 4WFAQ 3Q2TC 1K9MT 1TU0B 4RW7A 3ZC0A 4NLSA 2HH7A 1OXZA 2W7AA 4B3OA 3ENQA 2XG8A 3JAEA 4G1PA 1O3XA 2XI3A 5ETSA 3Q0AA 1UTAA 1FMVA 2MLZA 3EGWB 1RHUB 4USMA 2FY1A 1FNXH 3OFGA 4NPPA 2VVSA 4NMLA 3KLFB 4RW7B 1TL3A 1ZAVA 4RJVA 1W0BA 3ZC1A 4YHHJ 2G0UA 5MLCV 4ETXA 4DBRA 3ZC4A 2LEAA 4IH7A 3HJFA 5HVFA 3AJ2A 4LF5F 1LWXA 3HVTA 5F8NA 4MFBA 1RDRA 1S0VA 1JMTA 1S57A 1BR4A 4X65F 2XQ3A 4NXMT 1IKVB 3EVYA 5J2PB 3K5LA 5K8PA 1TL3B 1EIYB 5C7PA 5L1IA 2F1FA 1E2AA 1P9QC 3LAKA 3HX9A 4A5XA 5AQRB 1RK8A 1UWAA 1HNVB 3D2WA 2L8KA 4PK4A 1SIZA 2QX0A 5EWEA 4O3QA 2I0XA 4HFHA 1UCNA 3LK2B 1DTTB 3FRZA 1HR0J 3SCIE 2IAJB 5JDGA 3G71S 2HHTA 2J8AA 2KWIB 3RAXA 4H4KC 3HL6A 5FP3A 1LOUA 2PN6A 3QT7A 3HFKA 2MEWA 1S1TA 3LH2S 3UUNA 4JI7F 3C8YA 4DZ6A 4ZVPB 1RJJA 2QGFB 1JLGA 1V9OA 1Q8IA 4JI2F 1FIOA 4G1QA 4CLUA 4DV2T 3LP1A 3QJJA 1Z0PA 3PW5A 1VIOA 4F4YA 3IBCB 4NE9C 2GX8A 1ZM9A 2JLEA 1Y5IB 1AW0A 2C5JA 1S1TB 4OYBA 3Q9DA 2ASLA 4HFDA 1BQMA 2K7JA 5B0EA 4YT0A 3FRYA 1IBCB 3LBXB 3EUNA 4G1QB 3LP1B 2L48A 3MZKB 3PUZF 5KFUA 1WC6A 3P4QA 4N47A 1VGYA 5L3FB 4YOEA 1M7KA 1DY3A 4MALA 4UV9B 1BQMB 2Q3PA 1R8IA 3BR8A 4ZJLA 4DXLA 1KOHA 2OEJA 1IBKT 2CZVC 1X4EA 3T1AA 1JLQA 2ZM6T 2LXIA 4DSLA 1QAXA 4A8MP 1HWLA 1QE1A 4A47A 2FB0A 1YKWA 3LGNA 2H5JB 3HHNB 1NDLA 4A56A 3C3LA 2VQEF 2CQDA 2AHOB 5IM0B 3IP0A 4OLPA 3RB4A 4LMZA 2QRRA 3K59A 4NRUA 2C2NA 3GFXA 2HPJA 3FZ2A 2LXUA 2W8KA 5IT9Y 1QE1B 5LGTB 4QIFA 1FJCA 2MSTA 1WDTA 5TAOA 3EJMA 5GAEI 4Y3CA 5HO4A 2HBYB 2M70A 4TWFA 3DLBA 3QWPA 1T0TV 2BKPA 2MLXA 5KFWA 3IA0A 2CPXA 3RRGA 2IA6A 1DTQB 4DSJA 5IUXA 2DI4A 3AQOA 2V4QA 1BQNA 3NGTA 2NOXA 2V5CA 3VHLA 4EOZB 2F9DA 2WB4A 4U3CA 2R7XA 4Y2AA 1PSDA 5CYQB 2ZM6J 4OI4A 2MQMA 2IFXA 1SUQA 2E5HA 2K7KA 3W65A 4N8OA 3I55S 1MN9A 4LFAT 4P6QA 2AU0A 4HN9A 5B08A 1TUVA 3Q8VA 1UVJA 2V7MA 4UOFA 2UXBT 1X4AA 4KGKA 3RRCA 4MAKA 3GCWP 1WJ9A 2WVEA 3G8TA 2W2QP 3IR5B 1Q79A 4PXDA 4Y65A 1T7SA 2QGSA 3FEZA 1KDNA 3ZT6A 3GIRA 1X9MA 3MEGB 4ETZA 4WZQA 3QGHA 1FKAF 1MG7A 2FJAA 4QOTA 1JK9B 4W92B 4J5OA 1JIHA 4DR2F 2WSFC 3R5GA 2L08A 4DV4T 3PFEA 2ZC3A 4X4RA 1I94F 2WMOA 3SCJE 5LT5A 2XS5A 1BE4A 3QAUA 3MOJB 2WVBA 1VQSA 4OZLA 3D66A 4ZVRB 1TUGB 3PM9A 1KHVA 4P74A 4A8FA 2AGOA 4Q0BA 4RNFA 2UU9F 2FJAB 1IVZA 3TA2A 4WKYA 4KGZB 5B09A 2WRMA 2XASB 2ASDA 2OEKA 4LFBF 2F4VJ 4B6XA 1KQSR 2XAHB 2KO1A 4LFAJ 2BJ8A 2K2PA 3C66A 4U2ZA 3N9OA 4Y2MA 2UXBJ 4ZJQA 2Z2LA 3LQVA 3VAKA 2HQFA 3MAQA 4AL5A 1HBOB 3CCZA 2Z2MA 3F31A 2OA5A 2XLKA 2GNKA 1JKHA 1GMWA 2J6SA 1QVGR 2R7TA 3V6DA 2I2YA 5IC4B 2XO6A 5ADXL 3K3OA 3ET6A 3VR8A 4K5SA 3T1YF 2CM0A 4DV4J 1P9YA 3PHTA 1IR1A 3RB3A 3VF0B 3MEDB 1X0FA 4DL4A 3ZXWA 1JKHB 3IMQJ 4F4ZA 3PY8A 4P2FA 1KNRA 2XZTB 3V6DB 3N9LA 4LVNP 3AA6B 3ZTPA 3CEDA 3AAAB 1S7IA 1RADB 1N32T 4RNOA 2XQ8A 5M2PA 2PE8A 3ET6B 1R8BA 3FBBA 3A4TA 1N34J 2D69A 3ULHA 2V7JA 1FWLA 1DBDA 5GMKa 3M6WA 2WZIA 3GFHA 3N28A 2OAUA 1FXRA 2CWXA 2HGMA 3CD0A 2BBJA 1C4AA 5JQGE 2MKSA 3TX8A 1D1CA 2YX4A 1N0UA 4F3MA 3HDSA 4LQ3A 3VQTA 3MTJA 3CSKA 3CMQA 4Q43A 1KNZA 2WU2A 1BXNA 3GB0A 4ZVHA 3G8SA 3FSXA 2BW7A 2DR7A 2C5IT 3QATA 2JOQA 3D5MA 5KFPA 3IAM9 2G1DA 2BM1A 3TZZA 4NUUA 4EAHA 5IWAT 1JXLA 2ROPA 2APOA 4U31A 3I32A 1U1KA 1OQ6A 3TVKA 4DQQA 1S6PA 4QPTA 3GJRB 3PO4A 3GG1A 1PBAA 4M5NA 5J1NA 4MK9A 2X68A 4DF4A 3RQWA 3W5YA 3UVJB 2LJLA 1SL2A 2CUYA 4R25A 3N6LA 1T8EA 4U96A 4ITSA 2W2NP 4DUZJ 5AQJB 3IWNC 1S6PB 2G9OA 1FDBA 1NPRA 1UGOA 1U1PA 4ED5A 1P1LA 1SJ1A 3ENVA 2XC9A 2HFUA 3ETVA 1TL1B 3CDWA 2V50A 1SJFA 3KJQB 3DMJB 2V7KA 3DLKA 3P4UB 4CXYA 4NLYA 4ZCKA 4CQIA 1IKYA 3I4PA 4ED3A 2GMHA 2I59A 1NMEB 2MQOA 1NNDA 1KR4A 2JC1A 1NK6A 4K0KF 3RTVA 2WZ1A 5ETOA 5IWAJ 1ICEB 5FIIA 4DV3F 1VLYA 2OI2A 3V2UC 1VISA 4OHFA 3M8YA 1TK8A 3K7RA 1IJFB 3RPUA 3DLKB 3OBIA 2QA7A 2V4JA 3KG4A 2R7WA 1JJCB 1YQHA 2XQ7A 4DR7T 2W62A 3J81Y 3PKYA 3ENAA 5JDLA 4WXOA 1SJRA 3O6QA 3RAQA 3Q8PB 2ZC4A 4KH1B 4E7ZA 4HTEA 3R1HA 2XS2A 2HURA 5F5WA 3K3QC 3GP9A 1HG5A 4JI0F 1GMUA 2K3IA 4Q2LA 3VAGA 4TV9E 3I0SB 2V4JB 3L39A 2BS3A 2JQHA 3Q23A 3O1LA 4X1YE 1KTVA 1VQ6S 3PW4A 4EV6A 5HAOA 1WOOA 2UXDF 4WFXA 1TVRA 2KWHA 4LT6A 4HVZA 2HWTA 3CTRA 1VYAA 2IM1A 5K9FA 2R42A 3A8IA 3W62A 2XJ7A 3CJ0A 5HEGA 2DGXA 2E5LT 1B0VA 1KHWA 1RYSA 5KFDA 1TVRB 2ZKUA 2GGPA 1OYDA 1VFJA 2ZBCA 2ACYA 4DR7J 2MKYA 2HIQA 3DC2A 2V1DB 4CP5A 2H3EB 3ZT7A 2QC3A 1BD6A 4JYAF 2VFTA 2IDLA 1AZSA 1TKZA 2R3VA 4CT9A 1X9SA 1HD1A 4OYIA 2J76E 2RKIA 2E1AA 1Q86T 1VDHA 4CLFA 3CC7S 2GGPB 1RACB 2F4FA 1D0EA 5AQNB 4ZI2D 2ASYA 2QEXS 4I43B 2HLTA 4ZVSB 1N5QA 2BDPA 3BQKA 5J2QA 2BE2B 1RKIA 3E51A 1J27A 5KFVA 2BQRA 1IBMT 3L3CA 4O3PA 1DURA 4CYUA 4X64F 1SHZC 2R8JA 1Q8BA 3O1IA 1UX4A 4V19J 1VBYA 1HHQA 2RKIB 2J6UA 3KUGA 2J0SD 5HXRA 4DOZA 1D9AA 3N79A 3CDUA 2HFZA 5GAEU 4RNMA 2W4PA 2E5LJ 4OYXA 5A2QU 4ZOLE 5J2QB 4MKYA 3KV9A 4CLZA 2NYIA 2BYCA 3EVMA 2V7LA 4WFNQ 2F8MA 4C11A 4FF2A 4AXPA 1T9UA 3V6JA 3FZHB 1JLEA 4ASKA 2RDDA 2I5JA 3ILOA 4LBIA 5LOQA 3NGDA 1ZOYA 3BGOP 1R0AB 2X3DA 3VKGA 4Q5VA 1MMNA 1D9FA 5E2QA 2BRLA 1EB0A 1A0OB 4LF9F 4C0BA 1RWVB 1NLKL 5F3TA 2MOZA 1YQ4A 4C11B 2L41A 3JSBA 1JLEB 4YSZA 4LRFA 3JQJA 1CJUA 1YKHB 4JI4T 3E22E 4F67A 4NLRA 1IBMJ 4HEAA 4KV8A 3Q8QB 3RC8A 2CPJA 3QSIA 4FBTA 1VI7A 4ZHQE 5JDQA 1A7GE 2OH2A 2YWEA 3AB3B 4XPCA 1XK8A 3M6XA 1FDAA 5D78A 1S1WA 2RQ4A 4DUYF 3MCOA 3KVAA 2F63A 3UU8A 5AQKB 1S97A 2VPXB 1FT8A 2HGNA 2OEMA 3MM9A 4LF5T 4KV8B 4H9RC 3MJXA 1K0TA 1UJ4A 3O3LA 4ANCA 4C8LA 1RP5A 1VRBA 4CI3B 4DUTA 5IQ6A 4YR0A 2XSJA 1WKLA 5J2TE 1U09A 8RUCA 1OO0B 4DR6F 1GH8A 2U1AA 3NS7B 3MM7B 3HD1A 3MR5A 4EBDA 2MY7A 3CC2S 4H4KA 3QBCA 3QGIA 2BBHA 2BABA 2Y1RI 4LBPA 1HW8A 3DXBA 4JI4J 2MYFA 3ZSTA 3DRSA 3V4IA 4NUVA 1J2VA 3HSDA 3ZTQA 1NH8A 3MFIA 5LJMA 2E5JA 1NK7A 2VC1A 2VONA 4JBWF 1NK8A 1F2GA 4C8MA 4WZXA 2BBEA 2OHDA 3AA0B 3OR1A 4I2QA 3RF1A 2E7XA 4LF5J 3DRSB 2CQBA 5E3PA 3ETOA 2HQIA 2RDJA 3S1TA 5GONE 1JXEA 2M8HA 2DKOB 5BJRA 2V8SV 4DPXA 3JAMU 3ZMVB 3ITHA 2VOPA 4HWIB 4FYDA 3BREA 4JV5J 4XBFB 3HA4A 2RUSA 1VQOS 3OR1B 4I2QB 2DIVA 2QFIA 3MPDA 4KSEB 2OLWA 4JI8J 2RA1A 1UVNA 1DHMA 4H54A 2VQFT 1R7IA 3BSAA 3R9LA 3I0OA 2VFRA 3FZKB 1FI4A 2AJ1A 3GU0A 1NJXA 3CWJA 4NASA 1W0AA 3ZTRA 4O4JE 4BAYB 3ITHB 4EEBA 2HVZA 4P09A 5HMZA 2DXFA 4ZS3A 3J80U 3FCHA 1M1KT 2E1RA 1RT1A 1EETA 5A8RB 5F8LA 2KDOA 4CLKA 2F8EX 2GQ2A 3ISNC 1KKHA 3NNHA 4WFYA 2ZH4A 2DNGA 4UV8B 2X51A 3GR1A 4KTQA 5IFMA 3H3MA 2P8IA 4JUZA 2K9AA 1OYEA 4CLSA 1HNZT 2W9AA 2IW5B 3IXQA 1RT1B 4BWJA 1EETB 2B9YA 3LAMA 2M67A 1U1NA 3GIJA 5LG3A 5A8KA 4ER8A 3VVTA 2VQFJ 1B4SA 3PJ9A 1XMBA 3N9QA 2LT3A 1S1VB 1YJVA 2DHAA 3UI3A 3UU6A 2QFJA 3I4HX 1IUJA 5HMXA 1LVFA 4O3NA 4P52A 2OPRB 4I0WA 5F0WA 4IH5A 2ZEJA 2DD8S 2VDIA 1T98A 3C2PA 4ZCMA 4HFBA 3MR2A 4A8YA 1FRHA 2GFFA 3WC2A 4JI6T 3M6UA 1KFYA 2LECA 2OSRA 2K8GA 3ZMZB 3ZMUB 2LFVA 5KG3A 1VCTA 2ABYA 2X0YA 2OIHA 2AJ2A 3OV7A 2LRLA 4XTTA 1HFAA 1HNZJ 3HKCE 2DBBA 4CN6A 3PU3A 3W2VA 1QY7A 2QSWA 1YTYA 2ALYB 4RWXA 4ED4A 3VZHA 1FVQA 2HNDA 2I6WA 3RB6A 2E9XD 3MCNA 1WG4A 2ZH5A 1DFDA 2C2RA 2HK3A 1YDLA 1RT7A 1RT2A 1B7YB 1RHJB 4XIUA 2PG8A 5KFBA 4LF4T 2JQQA 3L4BC 2VWAA 3AEBA 1NKBA 5HVHA 4JOUA 3QIPA 1S77D 5L4EA 1U4BA 4U7YA 4O8SA 4L74A 3PUXF 2HNDB 3UT5E 1T9XA 3I9V9 1S48A 3D7SB 1PYSB 3M65A 3BV8A 2QE5A 4U7IA 3LGMA 4JI6J 1PAUB 3LP0A 4HACB 1Z2ZA 2VK9A 3QIPB 4DX7A 4DVDA 3N4WA 1U49A 3C14A 4OX7A 2NXUA 2W2PP 2UXCF 4LR9A 2Q6BA 1FCAA 2HRYA 4DNDA 3GFZA 3RRKA 1BR0A 1N5TA 2A2DA 2ERRA 4EZ9A 2VA3A 5LHHB 3G6VA 3PYGA 5ABFB 2BS4A 3C14B 2YNGA 4LF4J 1HPZA 4QIVA 3JC6D 1KN6A 4TN2A 4ZVFA 2R2UA 3T41A 3RW6A 4DO0A 3KFWX 2KXHA 4UELA 1CC8A 1HNWT 3ZZYA 4G63A 1HWIA 1SC3B 3B4DA 3O1HA 1ULRA 1YITS 3KMSA 4R0EA 2PA3A 1AUDA 1FRMA 2FHKA 2GC8A 4JV1A 4OZ1A 2ZE2A 1WR0A 2AIRB 5JJBA 3QK6A 2P6TA 3GLJA 3EGZA 1NB7A 1URNA 1B7FA 4ISTA 4O4LE 1S10A 3L95X 4N78D 3PDNA 4PQUA 4USIA 2FVRA 2UP1A 5H9FK 3MMAA 5CHCB 3IS9A 3J7AN 2IJRA 3ZJ1A 2ZE2B 1EKRA 2I6HA 4B3TT 4WFBQ 4ES1A 2DNLA 3MMCA 2GA7A 2IC3A 4A8KA 3M8PB 2JX2A 3RBXA 2NSCA 1BR1A 1YSJA 1CHUA 4LSNA 2BJ1A 2P6SA 1BHNA 2XZEA 1HNWJ 3GA8A 2YPZA 4F8HA 3MMAB 3MR3A 1PJ5A 4UQTA 4FZVA 5LBQB 2QIFA 5BYRA 3NAIA 4PAAA 1T7PA 2XM2A 3MGJA 5AQOB 4TX5A 1ZP0A 4DL0C 1I3OB 4CI1B 3PRBA 4P1NA 3MMCB 2IC3B 1S1XA 3ZO7A 3NMRA 5DJBA 4EB6E 1NJIT 2GCFA 2H4WB 2H1YA 4DPWA 2W8LA 2CJXB 2XY8B 1EZZB 3LPYA 4WIIA 4LSNB 3WBZA 2PDAA 1FF2A 3KLGB 2X66A 2QA1A 1RU1A 2BW2A 3M9NB 1FRLA 4Q45A 4OZ5A 2J9DE 4YMEA 3OTOJ 3T19A 2G0JA 1RGVA 2VL0A 2DRBA 1U6ZA 4K0KT 3E01A 5LOVE 5D4PA 5IV4A 1WHXA 4CLYA 1S1XB 4DV3T 1HBUB 4PFPA 1XMOJ 4WYWA 4CQ1A 1E6YB 2KHCA 3U7JA 4H4OB 3MI7X 4ES2A 5L38A 4DV1F 4B3TJ 4PUOA 5D6GA 3AH6A 5T7LB 2PBIA 5CA5A 1HQUB 4Q8FA 4ZJOA 1KWMA 1D1BA 4DL7A 5F8HA 3AD8C 4L0RA 4JBCA 1TL4A 5CABA 4JI0T 1RHKB 4PJNA 3BB5A 2QG9B 2WQYA 3CIRA 4H63H 3H2VE 3KLVA 2NSBA 3M30A 3AECA 1HMVA 3CUNA 3NP5A 2XMMA 4QR2A 2YQ3A 2BOAA 4H9NC 3N5FA 4KAIA 3W66A 1KC8T 4UF4A 2A6OA 4TZ4C 4OQJA 3UQ7A 4LF6F 1NBEB 1XNQF 3MUTP 4DR1T 3NAHA 4QWAA 1JLFB 2CJYB 1N88A 2MTQA 4FF4A 7FD1A 3UR0A 3F41A 4JB8B 1M5VC 2RIJA 3M30B 1KF6A 3BJYA 4RBTA 1HMVB 4MTPA 4HWDA 3SSSA 1SBRA 3MUVP 1VJWA 4DPOA 3CJSA 4AE5A 3IM8A 2OMOA 1RQ0A 3MOZA 3L7PA 1DQ9A 3HMJG 4X66F 3MMJA 2MJUA 2DR8A 2VBYA 5F8MA 1GMVA 2N2NA 1SI9A 2JQKA 1PC4A 3BN7A 3H8YA 3HM9A 3KNGA 1KEKA 2IBKA 4DL3A 4ZI7E 5LXTE 3P4WA 2F5GA 2E2AA 3BQ0A 3OKQA 4J37A 2YPYA 3R5JB 4WPAA 3OLBA 1ZETA 5EK3A 1SJQA 3ZZOA 2VFVA 1C1CA 1U0HB 2GV1A 1J5WA 3OVBA 2VICA 2D3ZA 3R6NA 2FPHX 3K8PC 2CYYA 5KG4A 3TWZA 3LOUA 2LKHA 1SL1A 2ZBIA 4H9PC 4RNHA 2CNKB 3G2XA 4X64T 3BZQA 3MM8A 1FFGB 2CWYA 4HFVA 4DR1J 2HHUA 4ERRA 2NTYA 2ASJA 4PG4A 5IHYA 2JH3A 4KH0B 1MWYA 1APSA 3C6TA 5DDQC 1C1CB 1QSYA 4ZP6A 2M8DB 2DNHA 2Y1LB 1TAQA 3TW0A 2UVUA 2FYXA 3U1NA 4P0BA 1UJ6A 4I55E 3OFHA 1UAWA 5CH7B 4W98A 4JV0A 1VQ7S 3V5UA 4DR3T 4B17A 1Y7PA 3MECA 1UFWA 2BVZA 2XO7A 3KWMA 3C6TB 4DLGA 3EPGA 4DX5A 3IG1A 3A7MA 1FXDA 3VWSA 5BXIA 2CPIA 3ZEFB 2ZBRA 4KBIA 3RH3A 4ZI3D 2DY1A 1JXVA 4LF9T 3M05A 3K57A 5L3BB 4DX6A 2HQDA 2DNRA 5HQ8A 2M0GB 1RWPB 1KD1T 1GEHA 1DU2A 1KBRA 1DQAA 3OR2A 3OYZA 4F4XA 3FK4A 1XC9A 1WKKA 1NKEA 1OSCA 3JSMA 2WDRA 1BUXA 1TKDA 1YZ7A 4O4RA 1G73A 2AYEA 2G1HA 4B9SA 3IG1B 4HL9A 4C0OC 1MSWD 2MY8A 4F36A 2VPWB 5AXKA 3JTPA 2EFVA 4DDFA 2KI2A 1V5VA 4K4UA 2HFOA 4IFYA 3OR2B 3SBMA 3D68A 4DV0T 3JSMB 5KFTA 3JTOA 4PPZA 2ZJPQ 2B9EA 4P75A 4X4OA 1JLCA 5LXRA 1LWFA 1QDUB 3MXHP 4DR3J 1TV6A 2XY7A 3M2UA 4Y2IA 4C8NA 3FFIA 4KQZA 4A48A 1F3FA 4DR6T 2HMIA 1GT8A 3EZ5A 1KONA 1RT4B 1ZPWX 3MAAA 4IFYB 5DQGA 4FN5A 5C42A 3WHIA 3F0NA 1RT5A 1R0CB 4YTPA 2LE8A 2XZWA 1LWFB 3SFEA 1ZTTA 5AQTB 4OZ3A 1ZEEA 3TLUA 3FFIB 4WZMA 3G06A 5EGYA 2DVIA 3FZBA 2RU9A 2BS2A 5DDRC 2HMIB 5C42B 4OYMA 1EP4A 2Q1LA 2MHNA 3R5BA 1FKPA 3OSPA 3P5BP 1SB6A 4DV0J 2BR0A 2HHHF 3JS9A 3G9CA 4ZS6A 3SMZA 4IDPA 4AD6A 2Q6CA 2LQ5A 5LHIB 4NXNF 1PJ6A 1FKPB 4AI6A 4CO1A 3AA9A 2GAHC 1U1MA 4QIWD 2B4VA 3UD5A 2EHOC 2PI5A 4ED8A 4GMKA 1WI6A 4WBNE 3BK9A 4G2AA 2LA6A 2LDIA 1LWCA 3UD3P 4ILBA 1V9DA 3BSCA 2W1BA 5GADI 4X4NA 4RW9A 2M52A 2H7OA 1O51A 2DXEA 2E1PA 1TK5A 5K20B 1CJKA 2J0WA 6FDRA 1T8BA 1BMQB 2IIHA 3OPCA 4J7CA 1X4HA 1SE7A 2HZVA 2AW0A 5IQQA 1LWCB 4E7SA 3ZYMA 2XSFA 5LJ5Y 4QWNB 1FERA 4TY9A 5KG0A 2CPHA 5C25A 3KK3B 2LQ8A 2D74B 2DNOA 3GTYX 5H9EK 2EBGA 1PCAA 1S1UB 2HBQB 5E7OB 3ESLA 2GO8A 5HCJA 3MPYA 5E3AA 3WIUA 1NK5A 3ZMSB 3PYFA 1OPIA 1U24A 2GQCA 3V6HA 1K44A 2YKMA 3L9ZA 1YD8G 4P7TA 1VQMS 1YG0A 3ZMTB 2CQ4A 4E0DA 2BV3A 5JH7E 5C25B 3H2UB 4M63A 4KHRA 1RZMA 5FNVE 1NH7A 5DO2A 4Z37A 3AAEB 4AL6A 2OP5A 5I42A 4DV7T 3GYGA 1RTJA 3PEHA 2NZ4A 2YBVA 1U8SA 1M90T 4QWCA 2H65B 2X9XA 1R31A 3SFUA 4I2PA 2BQ3A 2Z57B 2JWNA 3QJPA 2EVZA 2G0CA 2HVEA 4QXHB 5DJQC 2K5BB 2PEHA 3H5UA 3ZZTA 4C3LA 3PKMA 5J1EA 2ZH9A 1M62A 1RTJB 3RYHE 4DCOB 2X1GA 1US7B 4KIAA 1JWWA 4I2PB 2GAGC 4M1PA 1U7LA 3DRRA 4LF8T 3GWHA 2N4DA 4ZVEA 2CXDA 1RABB 4WK1A 2NCKL 1TL5A 2VG7A 3F73A 2E7VA 2H88A 2EI5A 3CCTA 5JRCB 1URRA 1K73T 3JQKA 1JJ4A 3OFEA 4HR2A 1H7XA 5J1EB 1QAYA 3SRZA 4ZLJA 2K3KA 3CNQP 4X5TA 2H4YB 3UR3C 2KFZA 3DRRB 2JSXA 4EBEA 1C4CA 4ECSA 2HVIA 2YN6A 4DV7J 2VG7B 5CFBA 4QYZK 3P4SA 2AD9A 2DRAA 4XDCA 1SPBP 2OO4A 1ZM4A 1FD2A 2RHSB 5KFIA 1LW2B 2JFDA 3EABA 2ATCB 4K4ZA 2KT9A 2R4FA 2GS8A 5KFCA 1VQYA 3KHGA 4M5DA 3P6YC 1M0SA 2UUBF 2E9RX 5EZYE 3RIAA 2B5JA 4ZK7M 4Z7CA 4H4MA 4M5HA 3UQ4A 2NYHA 2B4UA 2V68A 3QJLA 4RUCA 1IJEB 4LF8J 3LWLA 3IAS9 2BOPA 2QL9B 2FJBA 2B9WA 3MAHA 1QSLA 3LO3A 2R7UA 1U47A 2JLFA 2IRXA 2MZ1A 2AX1A 3Q5XA 4KGVB 4V1Ak 1FRJA 3RIFA 4I50E 1S5ZA 4J9PA 4M5DB 4OJGA 4O3OA 3DYAB 1KRPA 2B5JB 4O2AE 3KLIA 4DHVA 3OUYA 4U2YA 3ZYLA 1U4QA 5SZTA 1G8XA 3FVYA 3VR9A 5AQFB 4B3MF 3T6BA 3NNCA 1OEDE 2NXCA 1FWKA 2JJ9A 4C90A 3VGVA 2XYGB 1HL6A 2CPZA 3D28A 4P2SA 1SJ3P 2ZDPA 4MIWA 3KG0A 1CLFA 2V7IA 3I5BA 2BJ9A 4TY8A 3NRYA 3NMAA 2KXPB 2FHMA 4CLWA 3OUYB 1FJGJ 1P8GA 4KHMA 4CWBA 3KYLA 3MR7A 1WHWA 4WFZA 5JR9C 1YHQS 1L0VA 1RHRB 1Q81T 1WYCA 5J1PA 4EO6A 1LXNA 3GJSB 5HL7Q 4O0IA 4CTAB 2ZNZA 4J9UE 5ADZA 4UT4A 1UPPA 3Q2SC 3QMQA 4EIWA 4TY8B 4QR0A 1H2UX 2YKNB 4KI0F 3VGSA 1RWNB 2W67A 3MD1A 3PUWF 1MW7A 2A9UA 2E1MC 4JI1F 4J9NA 2ZD1A 2XAGB 2FLPA 2X9HA 2Q66A 1B99A 2O3DA 4WJBA 4MFRA 2LRKA 4X1IE 2AXDS 2DTJA 3G82A 3I31A 5AQSB 1XWMA 4H9QC 4CN1A 1Y9OA 4CNYA 2RMLA 5FLXY 2ZD1B 2KT2A 1SKUB 2P2CB 1RUSA 3OBVE 3DJBA 4FJOA 2HRTA 3TAMB 1BQXA 4U7UK 3E3XA 2FC9A 1WACA 3G82B 4Z8XA 3HFVA 2QLFB 3JXOA 4RW4B 1MNDA 2Q9QC 5HK4A 4I6AA 4ZVQB 3US5A 4EWTA 3PIPQ 5KT3A 1WDDA 3MCMA 2K3WA 2YH1A 1RSCA 1RWWB 4Q44A 1HWKA 1H7WA 1N5SA 4IL9A 3J9X1 4NMXA 2BG9C 1XNRT 1NJZA 2CG8A 4LF2A 3KBTA 4KUMB 1QAJA 1QVFR 2Y0BB 2CIMA 3C4XA 2HHSA 3SSQA 4UVAB 3NWIA 4YJ2E 3OJUA 2NP9A 3PJXA 4PK6A 4QIGA 4RNNA 4WP9A 2RS8A 1L3KA 2MZQA 3QB5K 2YXLA 4O3RA 5D0GA 3CPWR 2BJEA 4ID5A 1P1TA 3ONLC 1U8WA 2R6GF 3VGUA 4GKJF 5IC6B 2HBZB 2AJFE 5B0DA 3W3SA 4LF6T 3W8GA 5DQWA 3SCKE 3RBDA 4NZ7A 5LG4A 5A6WA 3BH7B 2DNPA 3IRXA 3O44A 4ID5B 3A8EA 4J9QA 4KMCA 4PYDA 3FMWA 3ADAC 2LOPA 3AE8A 3UDLA 1XNRJ 2HNZB 1DZ5A 1NB2A 2XGQA 2HQGA 1S7HA 2ZWOA 3PUAA 4RR5A 4WYLA 1QJHA 1PJ7A 3H37A 2D3O1 2WVFA 4KT0C 2VODA 4X66T 1RLCL 1UVKA 4CO0A 3CQGB 4B9NA 2J7UA 5DDOC 2VBWA 3O8WA 3KMQA 3IRXB 3I96A 4MYUA 4EBCA 1S6QA 4CZZB 5HLFB 1P6TA 5GADU 5FLXU 4GIWA 1IQZA 1QSDA 5JVGQ 1UFLA 1H72C 1V3RA 4UR9A 2J1DG 2HPUA 1J5ET 4LFCT 1FX2A 3ONJA 2RAQA 4NLQA 4HDGA 4C3KA 3M8ZA 3UN3A 2WU5A 2IRUA 3DLEA 3I0RA 1S6QB 4LF6J 1D09B 3M8SA 5M2UA 5L4HA 2FBWA 4DL2A 2XQ4A 4G1IA 3CKDA 3QNWB 2VDHA 2JRKA 2LLZA 3IBWA 2G13A 2DJWA 4NEZA 3TR5A 3I82A 3QQCD 2NQPA 3DLEB 3FMBA 3I0RB 2UUCF 5E5NA 1Q7YT 1CULA 4IR1A 2YWKA 2J7KA 2OPPA 1WHYA 4HH1A 4KE5A 3NOGA 3ZN0B 2MZRA 2CQCA 2XYPB 1N56A 1WOSA 1SIWB 4PJLA 4LF7J 1GQEA 2VVNA 5CZVA 1RWOB 4TNVA 2FIUA 5L3GB 3RKGA 5T41A 3QFHA 4YFUA 1CULB 4OZ0A 1J5EJ 4LFCJ 5FDLA 3DOLA 4DV5J 3J7Yq 3DRXA 2F9JA 4KY3A 3NZPA 3CMAS 1WEYA 3DXSX 1ELOA 3FZMB 5CGMA 3B82A 4EZ4A 1F9EB 2GO9A 1C0UA 1NJWA 4ZA1A 2AF6A 3W2WA 3MPUB 4LMLA 2FZGB 2CQHA 5FDLB 3DOLB 3SQGA 3CJ2A 1YRUA 1QLBA 3J7A1 1H6KX 4DR5J 5HMWA 4TNWA 4RW8A 2DGOA 3TLSA 1YJNS 1RWMB 3H20A 5LMUT 3SQOP 4GKKT 1P27B 3AHPA 3CJQA 4RUAA 4GYSA 2AJ4A 4EYHB 1QAIA 1XJWB 2E5VA 5CZXA 4E2FB 3R5DA 5HWYA 4FNHA 2LOSA 4QPXA 2NS1B 1HHTP 2C3UA 1KOOA 3LGHA 1HF8A 3SQGB 1U5PA 5HEJA 3KOAA 3QPIA 2C0SA 4C8OA 4NYZA 2BJ3A 1LW0B 2XUEA 5F8GA 4C4WA 3POTA 2ZOMA 2IDOB 4B08A 5D77A 3LPEA 4FDFA 3PDYA 3PUGA 2X3GA 3SCLE 1YW0A 3HKZD 5KX5E 1N33F 3N01A 4MBQA 3NVOA 2H3RA 3H40A 1REGX 2KSRA 2HWIA 3CIZA 4ZMMA 3G8QA 3K5MA 5KAKA 3GE9A 2JJ4D 2YWWA 4JI5F 2DO4A 9ATCB 4P10A 2JLGA 3T1HF 4P71A 2VL1A 2OV9A 2HHHT 3CIMA 5LMUJ 4GKKJ 2V0NA 2DEIA 2YQ1A 4OL8A 4FNIA 5IZHA 5LMNT 3CJKB 4ZPVR 3IFEA 4UXNB 3B78A 1D8YA 1LKXA 4AIUA 4TYBA 2EHOA 2KVQE 5G0RB 2ZBQA 4EXTA 1PGZA 4F3OA 4S0MA 5GAGI 3Q8RB 2WMNA 1NRKA 2GW8A 4NA2A 4LSZB 1W2IA 3KJNB 4URQU 3DI6B 2FVCA 1VR6A 2M3DA 2HS3A 2FLNA 5DLFA 4ZP9A 3VZIA 3RC3A 5L8RC 4JI3T 2C2EA 2EHOB 1S0NA 3PNIA 5LGUB 3N9MA 3IC1A 3FDSA 1WF2A 4CO4A 2W4XA 1FEWA 1WF1A 1VHFA 2MQ8A 5ETPA 5I3UB 2KU7A 3TAQA 4K4SA 5B0CA 5KMGP 1SQEA 4K2XA 4U7CA 2CE7A 2BEFA 3GN5A 4X62T 2YKSA 2XLIA 4BDPA 5LMNJ 4I68A 2PT0A 3ONXA 1RXOB 3ZZRA 3CF5Q 3R3TA 4M5LA 2CVIA 1H98A 2WY2A 2RT3A 2MKKA 1NK4A 2XQ5A 2ZVSA 4EI2A 3GN5B 4EFAC 4K4WA 1NSQA 3W7BA 4YSXA 3N9NA 2WWUA 5FYMA 4C3MA 1RA7A 3TUZC 1NJYA 4HYKA 2CQ0A 2QN6B 4JI3J 1LXJA 1NK9A 4YSYA 3IR6B 2A2FX 2DR5A 2DNNA 3H5YA 2HNYA 2PMHA 2UVWA 2R2TA 1MU2A 4DG1B 3AVSA 2AP6A 2XWXA 4J9KA 4NLXA 4CO5A 2BANA 2BUNA 4X62J 5EX0A 2O66A 5KFNA 4KJIA 1RTHA 3NGKA 1AROP 2V8GA 4DR4J 1ZTWA 2HNYB 4I64A 4PRFA 2KZZA 4IE5A 3NRBA 1MU2B 2X1AA 2V6XA 5AQGB 3AA1B 3ANWA 4DN9A 5AXLA 3FGVA 3V5RA 3OL6A 2V34A 2BANB 4HKAA 1MNEA 4CN4A 1IZNB 2DXDA 2F40A 5CA1E 2Z56B 4HHUA 1RTHB 4O4GB 4GOUA 4RLEA 1HX1B 2YOEA 1X0PA 2YWHA 2YVSA 1RWXB 2B51A 4FS2A 4QWEA 3DM2B 4TU7A 1HS7A 2E9ZA 3HHLD 4URGA 5HQMA 3M3ZB 2IUBA 4PG6A 1MIWA 2Z6EA 2LQ9A 2W9BA 3CCWA 4WIQA 1AUSL 4ENOA 5AQQB 2KLQA 2NR4A 2OPSA 2W61A 8AT1B 1F9FA 1WHVA 3HSGA 2CG4A 2B8QA 3FXEB 2EEYA 4OZ2A 5E3QA 1Y0HA 1W7WA 1D1AA 2FHJD 4CNZA 5LJ3Y 5ITHA 2PFDA 4GK0E 2PJQA 2WOMA 3EI0A 1V6HA 5H9FJ 1IBLT 1VQNS 2XSAA 1NAQA 1MROA 3AAWB 5HN0A 2JEFA 5CCMA 2V2VA 3RI5A 1N0VC 2AZ1A 4HTJA 2MTLA 4DV6T 2M88A 1UJ5A 1LWEB 4YUDA 3AEDA 4EEDA 1HYSA 4R8UA 5J2MA 1KFSA 3CMES 3LWMA 5JTGA 4OYZA 5AE1A 2YTCA 2AEMA 2WCXA 3CJ8A 3RX6A 3NLCA 5GAHI 5K8OA 1MROB 4F04B 2WSCC 1NZ8A 4PWUA 1J5OA 4B3OB 2QMXA 5JR9A 2VPZB 3CVRA 4ZVUB 2V63A 4NPOA 3EPIA 3K89A 3LW5C 3H25A 1JB0C 3L7UA 2JRSA 3A3PB 5J2MB 3M1VA 1UL3A 4BLGA 2F3JA 3BBFA 2KN4A 3QAEA 2Y3YA 2KM8C 3MM5A 3H4DA 3RRHA 4O3SA 4AQFA 1T9WA 4N7TA 2VG5A 2WSSV 3KINB 4M5IA 1BWVA 3RBEA 1J5OB 3FC9A 3EDVA 3LF0A 5JR9B 4OX9F 3L7OA 2RU3A 1IBLJ 1NHVA 1WR6A 1VQ4S 5ETLA 4K4XA 4FYWB 3M1VB 3HVTB 4MFBB 4JI1T 4D3GA 5HXSA 3CPZA 1T3OA 3LALA 3TZXA 4TKTA 2LM2A 4DV6J 3TJ8A 3CX7B 2DCLA 4ZVTB 3O4XE 3B8HA 4PZVA 3DP7A 3FCWA 3HULA 1S0OA 3TANA 4IH6A 2Y1IA 5HXHA 3TZWA 1CQNA 4UZBA 4RUHA 3I9YA 2EW9A 3V6KA 3UWTA 1SC4B 3AEFA 2HWHA 3CD5A 1Q82T 2IVFB 3VAJA 1HBMA 4DLEA 2W4CA 4HI1A 3NCRA 4EGWA 2LSIA 3T5KA 4ZPWR 3ZZ0A 4AYBD 2HYIB 4PR6A 1HNXF 5EK2A 3BPSP 3HKWA 1GTEA 4B3SF 5D0RA 4NXMJ 3HZEA 1S59A 2Q9QA 4ECZA 1JLGB 3OL9A 1H0HB 4ECUA 1VLOA 3TARA 1VMBA 2PA8D 2J4GA 1N54B 3HJVA 3OXGA 2HGLA 3FBEA 3QO9A 3FNNA 1HA1A 5C3JA 3GYXB 3UFEA 3W5ZA 2BG9A 5DETA 4ERDA 2FC8A 1XIQA 2CJBA 4FYXB 2Q9QB 2FD2A 2ILYA 5M2RA 1WEXA 3VQSA 4QXCB 4FXWA 5KTQA 2OFGX 2V5DA 3KV6A 2CQPA 3K17A 3HKBE 4DZDA 3R7SB 3UO0A 5K14A 2Z4PA 4TLRA 2QO3A 4IIJE 5CJ5A 3PYEA 4DV2J 1LFWA 1FEEA 1S12A 3IWLA 2BG9B 2W9CA 4UOGA 2Q43A 2IMWP 3KHHA 2QRXA 1N36T 3PHEA 2EC0A 1JLQB 2KXFA 2IYIA 1CUNA 5E3RA 1F5CA 3R6GB 5K14B 2GVDA 3LG7A 4U8VA 1U0SA 2ZNYA 4GKJT 4LRDA 4R5PA 4ED2A 2L9QA 1PILA 1CC7A 5LYJE 3FQKA 1SUMB 4ECWA 5HCMA 3PE0A 4I0UA 1K1SA 5EHHA 1IBKJ 3Q24A 4YHHF 2GVDB 2XCPA 2D9DA 5HAXA 4YDDB 1YGYA 5I3QA 2CZ9A 4HLBA 2FVQA 2YKQA 4R5PB 4UEMA 1NHUA 4P73A 2FQQB 4NI2A 1Q78A 5GAGU 3IBPA 1C1BA 2RHQB 3NWGA 2G4BA 2CKWA 4NX9A 2JQ9A 2NTXA 4TU9A 1BQNB 3DLGA 3GFYA 4ILLA 2IAKA 2JMHA 1N36J 1Q53A 3RRWA 1X4BA 2K48A 3UUMA 1WI8A 1F2HA 5J0ZA 4C2MA 3MUMP 3MZIA 1U45A 2WB5A 1HR0F 1SUQB 2LVWA 3BF4A 4NI2B 1KLMA 5DM6Q 2MMYA 1J1JA 1EX8A 3A12A 3DHWC 3MDFA 2GJ2A 3DLGB 4UOCA 1UX5A 3V5SA 4ZLPA 4KFBA 1T05A 4ILMA 1VC6A 1VRUA 3KDOA 3KG1A 4IHJE 2VZ9A 4IQXA 2CJKA 3OSNA 2VKDA 3R2DJ 3BS9A 4UZCA 4O23A 3KXDA 1HX8A 5FXXA 2DGTA 4RWWA 2R7QA 1WKJA 2FJDA 2BA9A 2UUCT 2N9DA 3LUYA 1VRUB 3FZFB 4DSFA 1EZ3A 5FXWA 2LQJA 1NHKL 3K8WA 4Q0BB 3UQSA 2B4OA 3SEOA 5K5MA 4O0NA 1R0BG 1VQPS 4IUFA 2AWZA 1IJ6A 2V5HG 2Y6XA 4YP3A 4ANEA 2FJDB 2V8PA 4PXBA 3AODA 3H7HB 2O1PA 4C6AA 1N48A 5AQLB 2DHRA 4GVLA 3G6ES 4DSEA 2CHOA 1Y5LB 2Z30B 3N2OA 2FTRA 3K5OA 2UVVA 5JDNA 2Y8WA 2XTLA 1UMJA 3A3OB 4BS2A 3AVRA 1L3SA 2HHQA 2J9CA 2ZWPA 1NSAA 2E1CA 2MLYA 1RU2A 4W4MA 3HD2A 2Z2YB 3ENWA 3ZFVA 2KG0A 2XLJA 3KJVA 4B3RT 3QGGA 1UA1A 3PACA 4NYPA 2WWVA 4FYVB 5CAAA 1UVIA
chains in the Genus database with same CATH topology
2I0MA 4J91A 1LNQA 2AEMA 2BKPA 4RO0A 2AEJA 1VCTA 3JXOA 4EI2A 2OGUA 4L73A 2OLTA 4L74A 4GVLA 4J9VA 3KXDA 4G65A 3RBXA 4YS2A 4XTTA 2BKNA 1SUMB 2IIUA 1T8BA 4J90A 3L4BC 2FY8A 2AEFA 4Q25A 2BKOA 4J7CA 1T72A 1XWMA 3RBZA 4L75A 4J9UE 4L76A 3L39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0M A;  4J91 A;  1LNQ A;  2AEM A;  2BKP A;  4RO0 A;  2AEJ A;  1VCT A;  3JXO A;  4EI2 A;  2OGU A;  4L73 A;  2OLT A;  4L74 A;  4GVL A;  4J9V A;  3KXD A;  4G65 A;  3RBX A;  4YS2 A;  4XTT A;  2BKN A;  1SUM B;  2IIU A;  1T8B A;  4J90 A;  3L4B C;  2FY8 A;  2AEF A;  4Q25 A;  2BKO A;  4J7C A;  1T72 A;  1XWM A;  3RBZ A;  4L75 A;  4J9U E;  4L76 A;  3L39 A;