1VCTA

Crystal structure of putative potassium channel related protein from pyrococcus horikoshii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
193
structure length
193
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH0236
total genus 69
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 1vctA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 1vctA02
4L75A 4Q25A 2BKNA 3L4BC 3RBXA 4J7CA 2AEFA 2OLTA 2BKPA 1T72A 4EI2A 1SUMB 4L73A 3KXDA 4XTTA 4J9UE 1LNQA 4J90A 2BKOA 4G65A 4L74A 4L76A 3RBZA 2I0MA 4GVLA 4J9VA 1VCTA 4YS2A 2AEJA 3L39A 2FY8A 2OGUA 2AEMA 1T8BA 3JXOA 1XWMA 2IIUA 4J91A 4RO0A
chains in the Genus database with same CATH superfamily
4I6AA 3ZPOA 2A3JA 1TKTA 5D0EA 5TAOA 3C16B 2ZH3A 3PRBA 4TUYE 2LSIA 1NZ8A 1R89A 2RDDA 3ZZ0A 2QA4S 1WOPA 1ZA1B 4ELVA 2AZ3A 2XEXA 2CAJA 1TK8A 2AGQA 1C1BA 1VRQC 4DUYT 3KUEA 2MQNA 4QX7B 2YBVA 3PACA 3RI5A 1PGZA 2HFOA 2DRAA 1S59A 3Q24A 2ZFHA 4EWTA 1XR5A 5ETKA 5ETRA 4ES1A 4LF5F 4I50E 1F5AA 4DEZA 3HF5A 2BG9B 3FZKB 3AH6A 2GA7A 3ONLC 4NA1A 1VRUA 5LXYA 2BOPA 2HVZA 3HVWA 1OEDC 1EETA 1H2UX 1QY7A 2HNYB 3D54A 2HFNA 3CMQA 3UN3A 2VA2A 4ITSA 4IE5A 1VC5A 1D9DA 5GAEU 2XWYA 4J9QA 3EX7B 3LP2A 1TQLA 4NX9A 3V5RA 3C50A 4ISTA 2V4RA 3V6HA 3AJ2A 3CJ5A 4WP9A 2AHOB 2XY8B 1HNWJ 2M4MA 4M5DB 4WFNQ 4ZVSB 4ZI2D 3MF5A 4PXBA 2R8JA 4B3MF 1S1XB 1DZ5A 1HNXJ 2LA4A 5G0RB 4CQIA 2G1DA 4IO9Q 4EEBA 3NNAA 3GWCA 2CQ4A 4HKQA 4TNVA 1UCNA 4WIIA 5FVKA 3TZXA 4RBUA 1YW0A 2MKYA 1HMVB 5CZXA 2VFSA 3KKFA 3J7A1 4IDZA 3PUYF 1GK8A 3MCMA 2V0NA 2B43A 4KAIA 2QJ3A 2WCXA 2OFHX 3DRYA 2OD6A 4CLUA 3KJVA 1G73A 1N34T 2PD1A 1OEDB 3SDEA 1VQ4S 3L9ZA 1JMTA 4DR3F 1UWBA 2QZ8A 5LBQB 1C0TA 2FC9A 1U6FA 4C8ZA 4X1IE 2IDEA 4DCJB 2J5AA 3TX0A 4YT0A 1C1CB 3KHLA 4IH7A 2OPPB 4OYWA 2Y1IA 2BJ1A 2D41A 3HHLC 2XC9A 2XYHB 4R0EA 2HHHJ 4K4WA 2G13A 2V8HA 4QIVA 4USTA 4Y28C 4F0KA 2JQ9A 4Q2MA 2EKNA 3PNIA 2GQ2A 2HFZA 3M8ZA 3CK6A 2PIIA 5BXIA 2NSBA 4NA3A 2DIUA 4KB7A 3HFVA 3JADA 3M9OB 4DNDA 5F41A 5KG6A 1IKVB 2DNNA 3MECB 4EYYR 1REVB 7FD1A 5DZ7A 3ENAA 4JV5F 2RUGA 1OQ6A 4NA2A 4J90A 3NZQA 1ZM9A 1GXLA 4RW9A 3J7YI 1S77D 3FFIB 3FRYA 3JXOA 3O3LA 3RRHA 1TVRB 3BR9A 3RAMA 4ECVA 1GX6A 2HK3A 5HVGA 5IHYA 3M2UA 3K5MA 2E1MC 3T8OA 4X64T 1GMWD 1YKWA 3EVWA 4YLHA 3MXZA 1YJRA 2EBEA 5ABHA 4ES3A 2CZ4A 4DQPA 2E5VA 3ELHA 2MKIA 2Y8WA 3HI9A 3HSGA 2RQKA 4DI6A 1RBOB 1WG5A 2G2ZA 4ZVGA 1F0XA 3QATA 3ANWB 2HQCA 1UMJA 5HXEA 1I5OB 3AXJA 1FK9B 3I0QA 4Q7AA 4RWXA 1LVKA 2HVIA 2W01A 1K0TA 4X65J 3T1YF 1CS4B 1RA6A 3GQCA 4LR7A 2G0UA 5CABA 5J2PB 4CYUA 2RVJA 4ID5B 1UAWA 2C2ZB 4DUZF 4JUYA 4Y0FA 3G4SS 4H63V 2AU0A 2JMHA 3RYHE 5J2PA 1MROB 3NLCA 2QGSA 4OHFA 5IM0A 1SUMB 1MROA 2CQ1A 3SCKE 1N36F 4ZVUB 2K3WA 4DMWA 2IM3A 5L47A 2U2FA 4DOZA 3QWUA 1TFYA 5L4EA 3BQLA 2RSQA 3NMRA 2GVZA 2GMHA 2NUUG 1A7GE 1HLWA 3WHIA 4DR3J 4TKTA 1SH2A 3ZTPA 3CCQS 4MAKA 3TKLB 2H9ZA 5LMNJ 4QW8A 2V5DA 2CPHA 4YSXA 2AYMA 3N28A 1NRKA 5F8IA 4Y65A 2CQ0A 2QMWA 1SQEA 2J8AA 4A5XA 2HRYA 1PAUB 2VBXA 4UY8T 2HQFA 3I9YA 2GZOA 5LJ5Y 4KPYA 1TMJA 1J2VA 1XQIA 3MM8A 4ZN1A 2ZH9A 2JJ9A 2IA0A 3ZTSA 2NZ4A 3IAS9 1LRZA 5AQIB 1PJ5A 1DLOA 1RBAA 3QMQA 4B3RJ 4ZHQE 2K2PA 1ROFA 1HW9A 4JV1A 3LPEA 1FEHA 2Y9HA 2HLTA 1EAYC 1IBLF 2AYEA 3ULHA 2GQQA 5LSRA 1IJ5A 1RTHA 4KHPJ 1FEWA 2Y6XA 4H4OB 3D6TB 3CDUA 3O1HA 4XBFB 1REVA 1U02A 1WF2A 1Q7YT 2GVDB 2GFFA 2GO8A 2XQYA 3OTCA 3CCTA 4JV5J 4DCOB 1LWEA 1D0EA 5JDLA 1IJ6A 2Z4PA 2CG4A 4A8WA 3V6DB 1JX4A 2W8KA 4BDPA 1VI7A 4H4MB 1LV5A 1O5JA 1P1LA 1VK8A 2ERRA 2H88A 2AP6A 2X66A 2HS4A 2J0WA 4LIWA 2W63A 4DV0J 2Z2YB 1KOOA 1I3OB 1NJZA 4NPOA 1VJWA 5B0DA 3S8SA 2UUAT 2C22A 2G1HA 2R2RA 4XPCA 3VQTA 4C91A 1U8SA 1VBXA 1WTBA 1U49A 3M6UA 2HW3A 3FBEA 3BGLA 5L3FB 4ILUA 4LBHA 4DR7F 2F8HA 2EKYA 3KLGA 5HYAA 4B9MA 1OEDA 4F8HA 1DTTB 3FDSA 3HMJG 4NEYA 4QH4A 2DR5A 2EI5A 3LWMA 4LF8T 4P2SA 2ZKUA 3CB4A 1R0AB 1K44A 5LHGB 1VFJA 1RTZA 4NLUA 3JAFA 2DVIA 2XS7A 3MAAA 1JNZB 2QYGA 5KT5A 3JYTA 2K1RB 4O3RA 2CJKA 3B82A 5KFRA 4QWAA 2XMWA 1WTFA 5K9FA 2AX1A 3PHEA 2UU9T 3SXLA 4LF1A 4CM0A 3QRPA 3HSZA 3N9NA 2DHXA 2XPKA 2YN6A 4DUTA 3J7Z5 3ESLA 1U8WA 2V6AA 1KD1T 5HO4A 3D0HE 2F3JA 3ZTRA 2V8GA 3F0NA 4LF4J 2VIHA 3P5TL 2WZHA 5D6GA 1LQ9A 4PG8A 3KJFB 3BGUA 4Z91A 2FB0A 3KMQA 3OXLA 1S9GA 4E7ZA 2C3MA 3QIDA 1QDUB 2C2EA 3QB5K 3OUYA 5HL7Q 4NL5A 3SSQA 4LFAF 1S76D 2YNGA 1WHWA 3TYTA 4I0UA 2ZVIA 2DR8A 4ZHRA 4U7CA 3HL6A 2KT5A 2EW9A 4GKJT 3EICA 2VG7A 1P1TA 5A6PA 3FBLA 4C8KA 3VGUA 3MMAA 3RPUA 4O3QA 2ZOMA 1L0VA 2RT3A 4KHPT 2ZJPQ 4QX8B 1RE1B 5CFBA 4ZVPB 2BG9A 2BX6A 2BZ2A 2OSQA 1NSAA 3BGFA 4K4ZA 3F56A 3VKHA 4WU3A 2ADCA 3W8PA 4NLOA 4NYOA 2COLA 2AJ4A 1WC0A 4H63H 3LFMA 3RR8A 5T41A 3J81Y 2UXCT 2R7VA 3GMGA 4PQAA 1WC4A 1UURA 4DPOA 3EPIA 3VR8A 1M7KA 1TL3A 3QB5A 1IKXA 3UD3P 2HURA 2RAQA 4O2BE 2B9YA 3C16A 3ZTOA 4EMDA 3AOAA 2Z6EA 2ZZMA 4B9TA 1WSVA 4CT9A 4JBWF 1URRA 4OYKA 3GFYA 3I6PA 3T1HF 1LWXA 1IBKJ 4Q25A 4CYUB 3R27A 5KFVA 2HFSA 1S5ZA 4DX6A 3DHXA 3G6ES 3B54A 3RKGA 1HKAA 4UF4A 2CPFA 5HEJA 4B3RF 3PCOB 4J2CA 4TQSA 1WRDA 3HD2A 3ISND 1FDDA 2PJQA 5GMEA 3KLVA 4IL4A 3ZJ2A 2LQBA 2HHWA 3OTOJ 3MM6A 2HN1A 2KFZA 4ALZA 1KRPA 1H7XA 4WE1A 2LVWA 5E3QA 3M8PA 3DRSA 3BKUA 3GIKA 2B4UA 1U1LA 5AQVB 3VGTA 5HMWA 4B9SA 3HHLD 2FHKA 4B3SJ 5AJ3J 1JLBB 4YB7A 2DXDA 2H48B 3MXHP 4GRSA 3VAFA 3I87A 3JCFA 5AFUL 5ETSA 3HI2A 4KR0B 3PIOQ 1XC9A 1CJKA 2CA9A 1U47A 2Z2MA 4WYWA 3F44A 2MTQA 1RT7A 1QM9A 2J9CA 2XQ5A 1M5VC 3ETVA 2YPZA 4TY8A 2WMNA 1JLAA 1Q78A 2F65A 4ZLLA 3LANA 3CULA 1XERA 4DR5F 4E7SA 4X4RA 3S4UA 4B9NA 1WEXA 1ZBTA 1HBNA 4RPFA 3TEHB 2OGUA 1IQTA 1X9MA 1X0PA 3UVJA 3UPFA 1XMOT 5L3BB 4UZCA 2DBBA 4LF4F 4ZVQB 2X0HA 4LRFA 4AFFA 2CBIA 1PILA 3SFUA 5JXSA 3SOLA 3AA7B 3G82A 2YNHA 5K8NA 3R5GA 3TOQA 3ZMTB 3BQ0A 3MK7C 1HNXF 1UW9A 4WYLA 5HQLA 3OFEA 6FD1A 3CCSS 2XMMA 3AECA 3ZNJ1 1UKUA 2UXXB 4NWBA 1VC6A 4NYPA 3OR2A 3FZBA 2MY7A 4DQSA 5D4OA 4CH0S 3SSRA 2J7KA 1Y64B 1Q0NA 3TWZA 4GOUA 5F8GA 2Q9QD 4LR8A 3OPCA 2H89A 2QLWA 2KB2A 3MTJA 1W09A 3VTIA 1Q8LA 4UOFA 1WD6A 4USJC 3JQMA 3M8RA 2AE9A 2B56A 1CC7A 2Q9QB 2LSKA 2GVDA 4DPUA 4N47A 1GEHA 1BGXT 1M90T 2CPDA 4K0UA 3FSYA 4AQFA 4CH7A 3VVTA 4USIA 4UVCB 2KINB 3DJBA 4YDXA 4M5DA 1IM4A 1OXZA 1SJFA 2A10A 4I2PA 2MKKA 3D66A 4MFBB 5LGUB 3OSPA 1JLBA 2H5JB 3B13A 3UR0A 2N9DA 2KXPB 1WJ9A 2KRRA 3RR7A 2GC8A 8AT1B 3PKYA 3BO2A 4NXNF 4NXMT 3GFZA 1F2GA 2WVCA 4ED6A 3JAEA 1R8PA 3CSKA 3UUBA 1J1JA 1R27B 5C24B 4WFAQ 1ZPWX 3CJSA 2IMLA 2M6BA 2W25A 4CTAB 4GVLA 4LMZA 2Z0GA 4WE1B 4ZCKA 3MURP 2CXDA 2ZH2A 4P1NA 1FD2A 3N5FA 4RL1A 2QC3A 3P4RA 1D8YA 2V7JA 4Z8XA 3ZMSB 4U9RA 4PEOA 4C3KA 4C98A 3EDQB 2XLJA 3DLGA 3WIVA 2LEBA 1XMOF 1AFJA 1YSJA 1D9FA 2B0GA 4FF2A 4ADZA 3R6NA 2AZ1A 1MMGA 4X66F 1TELA 5C5JA 4P0AA 3U7JA 4U2YA 1NAQA 3DLEA 2YNFB 2IAJB 4RW8A 4F4KA 4ZN3A 2MKJA 4PG4A 2SXLA 4ED5A 5J2UE 3N6LA 3ILIA 4DL2A 3QLHB 5C8YE 3NGKA 3WIUA 1FT8A 3RB6A 4MFRA 3K59A 2FTRA 2OEKA 4O4IE 3OVBA 3NWIA 3MM9A 2LE8A 1EJ7L 3AXJB 1BR2A 2HFVA 1FTRA 1TU0B 2AMCB 4ILLA 1NK8A 2R7TA 3U1MA 2DRDA 2XZDB 8RUCA 2AXDS 4M63A 2R7UA 4QXHB 1BD6A 1VISA 3FXDB 3WZ0A 2R7QA 1RCOB 4WP8A 2HS3A 1QE1B 5J1GA 3M32B 4AKLA 4YHHF 4YFUA 2RA1A 1RK8A 5K8OA 1CJVA 2IRYA 2BG9E 2AJ1A 1LFPA 2HN2A 4M5LA 4GMKA 4DVDA 3T9ZA 1WOSA 2IYIA 2HWTA 3MUTP 4DR6F 3GWHA 2B6AA 1D1AA 2OPRB 1RT5B 1R8AA 1HWKA 4U8VA 2YTCA 3IXQA 3AE1A 2ACZA 4ILBA 2LXFA 4RW9B 3IG1B 1C4CA 4YB6A 2GJ2A 3LTOA 2KG1A 4B3OA 2BVLA 5BR8F 2KJVA 3OL6A 1RYRA 2CWOA 2XSJB 5K8PA 1GX5A 4HTIA 5DDQC 2OTJS 2AYBA 2FHJA 4ZVHA 2C5KT 2IVFB 3CUNA 2LOSA 1AROP 2AT1B 3NAIA 2LXIA 3L4BC 1NCLA 2D69A 4KO0A 1N33J 2D0TA 2XGPA 2V6YB 3E51A 3J7ZT 1K1SA 4HFCA 1NK7A 3FKBA 1H7CA 3N9OA 3CIZA 4KJIA 2XSBA 2WBMA 1NDCA 1HNVB 1LW0B 2Y8DA 5MLCV 3AHPA 4A8SA 3M6WA 3QZ8A 2HGLA 2W9CB 2IJFA 2MEWA 3GMIA 5AQNB 2I8EA 5KG1A 2LEPA 2UVWA 4M94A 1XWLA 2R2UA 3FZ2A 1QD1A 3M65A 5FYMA 4DUZJ 4OYBA 4O3OA 3N9MA 5A8RB 1HWLA 4R5PB 5J2NA 3NVOA 4CM2A 3D6FB 2CJBA 1WC1A 5EHHA 2VKDA 2CHOA 4TXSA 3UUMA 2AGOA 1VQ5S 4O0IA 1WYBA 1R6YA 2Y48B 1FRKA 4I2QA 1Q8IA 5JJBA 4IT4A 4P73A 4IL9A 3Q8PB 1E6VB 4E2FB 3PO5A 4C48A 2HK2A 4DN0A 1LWEB 5IWAF 5C42A 1FNXH 2JDJA 5L38A 5A8KA 2FJEA 2YKMA 2V6YA 2LECA 1YQHA 2FC8A 3DCAA 3UR3C 4H9PC 4HL9A 3ZKRA 2FJEB 2YKMB 3KUHA 1AB8A 3LK42 1UPPA 2VHGA 2LT3A 3N5LA 3K57A 4JI5J 4HR2A 3IGNA 3W61A 3ZO7A 1U1NA 2VICA 5HWYA 4WZMA 3A3OB 4WWSA 4HHUA 2L9DA 2VG5A 4A48A 1WHYA 2HFUA 3T9NA 4O44B 1N5QA 2C5IT 2LA6A 3U3IA 3TUJC 1HBMA 2ILZA 2HIQA 3KK1A 3PRVA 4XZCA 1V6HA 4PYDA 4QXCB 1N6QA 1H7WA 1S1WA 1RT3A 2PA3A 3OYXA 2NOXA 1XDPA 2BBHA 4YQWA 4HWDA 5D4LA 4DR1T 1HI1A 4JI7T 4HVZA 3J7AN 2WW8A 3GONA 4IE6A 4LFAJ 1KK7A 4KI0F 1S7HA 1RTHB 4P74A 4QYZJ 3QO9A 2B9WA 4RUBA 1GH8A 2CEAA 3N9QA 2BA9A 4LQ9A 4B3OB 2ZKTA 2VPWB 4O8SA 4NUVA 3UNGC 4IUFA 3MMCB 1H38A 1S49A 4J37A 2L3MA 3IBFB 3KG0A 4YTMA 3PYDA 3D68A 3H2UB 4C8MA 2BDEA 4CN1A 2CJ9A 4OJGA 4FDFA 1NHVA 2H3EB 4P52A 4DL3A 4Q0BA 1OY6A 4PWDB 5KT3A 1JJCB 4YJ3E 3AA6B 2X0LB 1XZYA 4JV5T 1NZAA 5HN0A 1HYSA 1NHKL 4AKIA 1U7LA 3ET6B 3DLGB 2DXFA 1SUQA 2Z57B 2OLWA 2KMFA 1RHUB 2IRUA 2HPJA 2CQ3A 2KSRA 2MQ8A 5AE1A 3VF0B 4OYMA 4A8YA 4AQYJ 3NG8A 1U09A 3HA4A 1HG5A 3GIMA 1MNEA 4YHHJ 5C24A 1AT1B 1IAPA 3ZZUA 2L48A 3ZZOA 1WELA 3MOZA 1P27B 4ZLPA 3PX4A 1DHMA 2ZJRQ 2FVCA 4DU8A 2CA5A 3D1QA 4DR6J 2DR9A 2NXNA 4TLRA 3CVRA 5JR9A 2RRBA 4DSKA 4PG7A 3V6JA 3T5JA 1HS7A 4R8UA 4I69A 3C4ZA 2WVFA 2IM1A 3VWSA 1JB0C 3TAPA 4B9VA 4USKA 2KG0A 4PXDA 2VJVA 5D78A 4NIQA 3BKFA 3DOMB 3T1YT 4CO0A 4L0RA 2DO4A 1RP5A 4OHYA 4QJVA 5L1JA 2D7SA 3ISZA 2FGCA 2LCWA 3H90A 1SKSA 3BQ2A 4CTAA 3I0OA 2DHAA 1N33F 4IE0A 1Y5LB 1VS3A 2H65B 3ENQA 1RDRA 1U4QA 2H7VC 3HCXA 4JI0F 5AQKB 2P8IA 5HP1B 1EHWA 2O1PA 3V4MA 2IJNA 1SKWA 1B0VA 2IFXA 2RD5C 4F3OA 1T3NA 1HD0A 2J47A 3A7MA 3RLFF 5J2MA 2C28A 2D9DA 2MJNA 3G96A 4RW6B 2ACMA 2C2MB 4PXEA 4JP8A 1KQKA 5LOQA 2M9KA 4OYIA 3PUQA 2OPPA 1KP6A 1R0BG 3FFIA 2JQQA 2NW7A 1HWUA 3OV7A 3DI6A 3RGIA 2BW2A 1K1QA 1NAFA 5LMUT 1UEVA 2B5JA 1MMDA 3H5UA 1Q5YA 3BYPA 4BA9A 1NJYA 4X84A 3LWLA 3J80Y 2NWBA 3A4TA 1HIYA 1HWIA 3BSOA 3EABA 4NRTA 3DRPB 2Y3YA 4ZS6A 1VQPS 2HKEA 2CXEA 2I5JA 2LDIA 4USMA 4KT0C 3W65A 1RHRB 3Q8RB 3HLUA 2XQ8A 1MIYA 1RACB 5CD4A 4DXLA 2RP4A 3EXCX 5G0RA 4M5IA 5C2CA 2ZC3A 3H5SA 3PEHA 1CPZA 3HHNB 4DLGA 1EQMA 2EFVA 3DLHA 3WDOA 5I4MA 3QRRA 1BLUA 1RADB 1YJTA 1U1RA 4L72B 1UWBB 5DG8A 1NEEA 2ZWOA 4WKRA 4I43B 4NYZA 3DRXA 4ECRA 2XHEB 4GK0E 3HT0A 4JYAF 3GJSB 2XAJB 4LQ3A 2R4FA 4IDKB 1X60A 3I5CA 2LM9A 3RRCA 1GMWA 2DWGA 4NMLA 2WVEA 5HROB 4H9RC 4ZJOA 3LAKA 3OXFA 1YBTA 2CADA 2LEAA 3NNCA 5D3GB 2YWKA 2JQHA 1EETB 2XNQA 4DHVA 4L3KA 2VDIA 4ERDA 5JDMA 3RTVA 2MQMA 1LXNA 5J2QA 1Y7PA 1NPRA 1VQSA 5A2QU 4FNHA 5HLFA 2ZD1A 5FL1A 4OJHA 5A76A 3IS9A 2XY7A 5FJ4A 2E66A 4QU6A 1CG2A 4DMVA 2KT2A 3R5BA 1PO6A 1VRTB 2HG4A 1X4EA 4FI5A 2P9GA 2WSEC 3NWRA 4DR5T 1ZH5A 1JLQA 1F9EB 2YNIA 2IC3A 4ZIVA 5C25A 4USVA 2QL5B 2OELA 5LP6E 2YU1A 4YP3A 3ETMA 2NPFA 1FDAA 3MPUB 2BANA 3AE8A 1BQMB 2WU2A 1H72C 2X1FA 4B9LA 1TL7A 5CYJA 1U1MA 5ETPA 4NCAA 1PJ6A 3PW7A 2GGPB 1RWKB 1XMBA 2M52A 3PV0F 4KE5A 3PW2A 1FE0A 2DIVA 1IM6A 4QYZK 4AKHA 5EN1A 1AUSL 3UN2A 1YJVA 1VQOS 1C1BB 1N0VC 4DFKA 3ZYLA 5I3PA 3H4BA 4AL5A 1U6ZA 2EVZA 1HG2A 2DR7A 2CMRA 2CJQA 1N0UA 3ONQA 1KEYA 2ZVSA 4ZA1A 3W15B 2E9TA 3W2VB 3F41A 4YY3T 4ASKA 3M7VA 1DAXA 2X1GA 2AWZA 1M62A 4MK9A 2VOOA 2LQ8A 2PG8A 3RYFE 1YQ3A 2EFPA 1IBMT 3MEEA 4KTQA 3M8SA 2Z2ZA 3R2CJ 3UU6A 2Q3PA 3A8KA 3SIPB 5B0EA 2HNDB 4IRDA 4LIRA 5J1EB 1YKEB 2V2ZA 1EP4A 3JAMY 2JOQA 3P50A 5F0WA 1YJ9S 2MMYA 3CCWA 2F40A 1C4AA 1X79A 2XG8A 5H6RB 3UT5E 1GMUA 3ZN0B 1IVZA 1W0BA 2XQ6A 1TL7B 3D3BJ 3D1OA 5B0BA 1N6QB 4OZLA 2JEFA 2KI2A 1JXEA 1F5CA 1YWXA 3OUYB 2YEVC 1Y10A 2ZM8A 3K5OA 4PYAA 4IKAA 4PW8A 4AQFC 3UU8A 1RAFB 4NXNT 4OI4A 2DH9A 3DDNA 3AJ1A 3FSXA 4NXMJ 4OX7A 5DDRC 1QJHA 4JV0A 2LU1A 4L3NA 4BBYA 5D77A 2DGQA 4LJMA 3IBWA 5BJRA 1T72A 4CZCA 1NMEB 1K73T 5JDFA 3UD4P 5HVFA 3H0PA 3R6LB 4C8NA 3K7RA 1BMQB 2ZE2A 3CTRA 3R7SB 2BUNA 2MXYA 2A9UA 3AODA 3ZTQA 1TKXB 3IBPA 5KFFA 3UN5A 3V6DA 2MKSA 1H74A 4CQ1A 1I94F 2MSTA 2JX2A 2ODVA 4MJKA 2ZNZA 4JEHB 4NZ7A 3PO4A 2D5UA 2ASLA 1DTTA 1UVIA 1E1HB 2E2AA 2HHHT 4Q8FA 3R7BB 2DNOA 5L1LA 5FDLB 2HAFA 3DRPA 2RU9A 2DWKA 5CYMA 1ZEEA 4FPIA 2X51A 3RZAA 1RTIA 5D0RA 2J7UA 4CP5A 4G6VB 3D0GE 1TL1A 1BY9A 4FP9A 4NZ6A 4FKYA 2IA6A 3P4PA 4RW4A 3U02A 1NEKA 4K2JA 4YS2A 1BWVA 2CZVC 5LMUF 4J9OA 3FVYA 1SJ1A 2DL1A 5CJ5A 3BKTA 1B64A 4QIWD 4FXVA 4UR9A 4ZS3A 4U96A 2CVIA 1EZZB 4IG0B 2MZ1A 1WR0A 4X64J 4L74A 2GV1A 2XYPB 5KFOA 3QYYA 4DF4A 3H4DA 4V1Ak 3NGSA 3Q2MA 1UJ4A 2N7CA 1PBUA 1V3SA 5BYQA 3AE4A 3G8QA 3MR6A 4N77A 4C4WA 4XDDA 1VQMS 4H9OC 5JVDE 3BDEA 2G2YA 5KFEA 2OPRA 2LLYA 3PYGA 1IXKA 3EM1A 1U2FA 1WOOA 2LSJA 2W4CA 3TLSA 2VOPA 2UXBF 1U1KA 1L3SA 4K4SA 4KKOA 2E7WA 3RAQA 4YMEA 2QA4G 3O6QA 4RNFA 3M8PB 1WC6A 3C6TB 2DGOA 3BEGB 2D2SA 2E29A 2W2NP 2KXNB 4K5SA 4Y6IA 5DRKA 4FPRA 3FBZA 3ZC4A 3T41A 1M1HA 2R7XA 1SKRA 3L7OA 3W64A 2ZM6F 3EGNA 4ZI3D 1SE7A 2R3VA 3ENVA 4LFCF 3CF5Q 4BHQA 3IFEA 4F3MA 3CCVS 4P0BA 2FVPA 4HDHA 4DUZT 2XMAA 1XBWA 5KFMA 1E7PA 4N8OA 1V5IB 2WK4A 2KFYA 3DHWC 2W8LA 2MTLA 4J9RA 1I51B 1YRXA 3BN4A 3MPYA 3HKBE 1N54B 2JMKA 4CXWA 4ANJA 1S1TB 3K89A 4K50A 3TRGA 3RX6A 1B0PA 2OI2A 5H9EK 3PYFA 2GCFA 3FQLA 2ZBRA 1RT2B 1HX1B 4DV3T 3MEDA 4I64A 1O3XA 1TUWA 3CJ4A 2IDLA 2MZQA 2DNYA 3MZIA 3CO0P 4WJBA 4RW7A 4AL6A 4DV7F 1PYSB 3HHEA 1SC4B 4ZKAA 3IF8B 3HKDE 1MN7A 5DQWA 3JTPA 2KZZA 4PFOA 1WYCA 1RA7A 1XNRJ 2R6GF 3NP5A 1VLOA 2HHQA 3N2KE 2WDQA 3CQGB 2WP9A 1T3OA 1SC6A 2WAUA 2A2DA 2JIWA 1S1WB 2VKZG 1C1CA 1MWZA 2PA8D 2E9XB 1ZAVA 4JI4J 3AE3A 1JJ2R 4DR4T 2V8VA 3B8HA 5T7LA 3KBUA 2I38A 1YVFA 1NHUA 3D0TA 2DCFA 4RBVA 5L9XA 1MIWA 3RBEA 4IH6A 5B08A 2B7BB 5KFGA 4FBTA 1RWNB 2CNKB 4FS1A 3R7NB 2W61A 2NXUA 2VZ9A 3NOCA 3PY8A 2WDRA 4M5JA 1N56A 3QGGA 2LMIA 5CYMB 4KMCA 2N1GA 2JSXA 4FYVB 3MEGA 3C4WA 5FDLA 2EG1A 4CLWA 1IKVA 4Z7YA 2CJAA 3HKWA 4I7FA 4PKDB 3X1LB 4DL6A 5FNVE 2AF6A 4GVBA 1IQZA 4OL8A 2KXFA 3ZYMA 4ZOLE 3V4IA 4Y2MA 2QT7A 4EBCA 3MJXA 3RF1A 4NI2A 3FZFB 2X1AA 2M8HA 3HULA 4J9LA 4PR6A 4I2QB 2BOAA 1XIQA 1ITPA 3P8CD 2XZTB 1UEKA 2VA3A 4DV1J 5IOLA 5H9FK 3ICLA 2JPFA 3RYLA 5LBMA 5AQUB 1V5VA 2KJWA 5L1KA 1M5KC 4AYBD 4OI0A 2AGPA 4J9MA 3EDVA 4LFBJ 4HFDA 1LW0A 5MAOA 1OQ3A 1UJ5A 3SV3A 3EPGA 2CG8A 4NLYA 1KF6A 3AOCA 2XI3A 3ISNC 3I56S 1HI8A 4EFAC 2IMWP 5A8KB 1KFSA 4H9NC 2HVDA 1HBNB 5CCMA 3KNGA 4W90B 3VR1A 4DR7J 2BVZA 1X4AA 1L3VA 1IR2A 4OX9J 1N88A 1HARA 4YUDA 2JEGA 4B3MT 2XSFA 3OJSA 4OZ3A 1HNXT 1AA1B 3THVA 1WG4A 2FD2A 1S94A 4HH0A 2AJFE 2YWWA 4QYRA 4UVBB 1ZV4X 3TAQA 1XNRF 2VURA 2UXBJ 4PG5A 3PUGA 1VCTA 3BO4A 1TUVA 2FYXA 3TUZC 3KDSE 4USUA 1IBLJ 4O3PA 5KTQA 1KFDA 4EBDA 4CLSA 4LF6F 3LA0A 1W26A 5EWGA 3K8WA 2B4PA 2RKIB 4Z37A 3C15B 2O66A 4Q45A 5L3GB 4MH8A 2W2UA 3GR1A 5KFAA 3R1HA 3H42A 2V4QA 4BCAA 2WZ1A 2K3IA 5KXJA 1AZSA 2HHTA 2KL8A 3GN5B 3MM7B 3Q8UA 3CDWA 1H3DA 4HE8A 5LT5A 4C9DA 2BJEA 1SI9A 1FI4A 1B7FA 4L6V3 1T03A 2LRKA 3UE2A 2M8DB 3IWXA 2AEFA 2VQFT 4RU2A 2KVIA 5HK4A 3AA9A 1HR0F 4FN5A 3G9CA 3I96A 5JREA 3DOLA 4DO0A 5D4NA 5HLFB 3Q89A 1WSRA 1R0CB 2JH3A 4OZ5A 3M2RA 1KNPA 2GO9A 4CO5A 1P6TA 2ZDPA 2KYZA 3F57A 2BQRA 2Q6CA 1AUDA 4FNIA 5FKYA 3NCPA 2Z30B 4CLKA 4ZPWR 2WONA 1HPZB 4C11B 1RHJB 1KHVA 4LF7F 5KT4A 1FCAA 2FUPA 1HFEL 2L41A 1CHUA 2ALZA 2WVBA 2I0XA 3K1SA 4JI2F 4OZJA 4B08A 1SQFA 2R8KA 2K8GA 1VQ9S 5ETWA 4M5KA 2O67A 5IQQA 4UV8B 2LDYA 4JI4F 1UPMB 5FY1A 3QFHA 2OD4A 3BJYA 3EI0A 2OPSB 1UK5A 4DCPB 1MSWD 5DLGA 1U24A 3LALA 4U72A 2YVSA 2HSEB 3TUIC 5DJQC 2Q9QC 1B7TA 4I2PB 1HNWF 1AJ3A 2NP9A 5AQRB 3HPOA 3X3UA 2V5HG 3IRXB 4QOTA 3CC7S 2EPIA 1NSQA 4IFVB 1X0FA 4AKRB 5GAHI 4IG3A 3DLLQ 3BQKA 1FRHA 2MGZA 3QT8A 4GYRA 2A18A 1I1GA 2WB4A 4DR5J 2HPLA 3IGVA 5KG5A 2N2NA 2GQCA 3QNUA 2WTFA 1WG1A 2NPIA 3PIPQ 1KQSR 3DRRA 1NENA 4UIGA 1GTHA 1GNKA 1VHFA 5LM7E 2ZUGA 2M88A 2POKA 3AB4B 2DH8A 1N34F 1V9OA 3UO0A 4N41A 1FXRA 4EZHA 3KNAA 4USWA 5J2MB 1XTZA 4DV4F 2E5JA 4GC7A 4IR9A 2B4VA 2ZH5A 1RLCL 3W5ZA 2BBJA 3GSDA 4HACB 2E1AA 1RT4B 3KLEA 1GFWB 2CFXA 1JJHA 3A1YG 1VBKA 3D2WA 3KV6A 2MGZB 1OWXA 2GIQA 4AT1B 4ECXA 1M5HA 2DNGA 2B5JB 4UTGA 3MFIA 3ZN1B 3WI3A 4J9UE 3RKOA 1BQNB 1TK0A 2BQUA 5F3JA 2RJZA 2YWGA 1AXQA 5KFLA 3G8TA 4C0BA 2MSSA 3HD1A 1UW4A 3CJ2A 3CC2S 3AD9C 1MLAA 4HWHA 3UNYA 4PK6A 4ZCIA 3QWPA 4PABA 3RBZA 3W3SA 3IN5A 3ENWA 3G06A 4X4VA 5D15A 1OYDA 4OYAA 2EFGA 5L1IA 1WF1A 1QSDA 1V3RA 1ZAWA 5JMNA 2WSFC 4C7QA 2HWHA 3OPKA 2KT9A 4B3TT 4DR2T 4QZVB 1KFYA 2H7OA 1CULB 1UFKA 3PRDA 2XM3A 2HBYB 2KFNA 2VU5A 4DX8H 3QSYB 4IRCA 3GYGA 1HI0P 2WS3A 2QLBB 1HHTP 4UQTA 1ZOYA 4YN3B 1NM2A 4LSZB 1GMVA 4DS4A 3DGVA 2QYCA 4YDDB 5JR9B 1NDKA 1Z2LA 3F73A 1IR1A 4LF8J 4OHVA 4OYOA 4ED7A 3PJWA 1KBRA 2HHHF 3KLIB 2HPUA 4JI3T 4XAXB 2XLIA 4RNMA 4DV6T 4DPXA 1X5TA 4ZVFA 1U0HB 1RT4A 2CDRB 4IDOA 3IC1A 4DX7A 3ZSSA 3D0IE 3MM7A 2JVRA 2R7OA 2JRKA 2DPJA 1RWOB 2OMOA 4GO5X 4Y3CA 1WFDA 4DFMA 3VHQA 1K8AT 5H9FJ 4GKJF 1XR7A 4O4RA 1PAEX 3GYXB 5KFJA 3BPDA 4I1TA 3KDOA 1NJIT 3PU8A 3LBXA 5M2RA 4ZHRB 4LRCA 3T3FA 3KLFB 3ET6A 4MKBA 4DR6T 1U2CA 2VG7B 3HVTA 2XZWA 4OV6A 4IQMA 3FZHB 3NGTA 4ATNA 2UV8G 2V67A 3OR1A 4MKAA 4P2FA 2R8IA 4ZPAA 2FJAA 3OLBA 2N4CA 2RRAA 2KXHA 3S7RA 4WTOB 4YSYA 3EDUA 3TAMA 2Q66A 4WP3A 5LSOA 4PK4A 2VG6B 1OIAA 1UVNA 1YJNS 1KVKA 1PIEA 3RHWA 2Z58B 3V81B 3PVXA 1JLCB 5JH7E 1JJ4A 1M1KT 3MMAB 2ZDOA 1YG0A 4ZOSA 3I1AA 3DN9A 2Y0BB 2XASB 3B6BA 4IFYB 1CQMA 2IVYA 4PPZA 1BHNA 5DGBA 3D67A 1F3FA 2F63A 5B7WA 5HROA 2G4BA 5JDQA 5CYQB 3DNCA 3KK3A 3L8RA 2L9NA 2IIUA 2CPZA 2N3OA 2WB5A 2KO1A 3VVUA 2NTYA 3HHDA 1ZS6A 2VC1A 1Q81T 3OVSA 4DLEA 4OZ0A 4KX6A 1O51A 3ZT6A 4ECWA 4EEYA 2MYSA 1XNQJ 1NXIA 5C3JA 1OSDA 3KDNA 5BR8J 2W7AA 3BGRB 1N34J 3G6XA 1I6JA 4NI2B 1RAGB 2J6UA 2XMTA 2ZWPA 1FDBA 4OX9T 3MAHA 3CX7B 4CI1B 1WDTA 4DWIA 3HK2A 4NCBA 2K7KA 3FJ2A 2X67A 5AQPB 1E6YA 5SZTA 5AXMA 4OX8A 4U6PA 3Q8VA 3GSIA 1RI7A 4DV1F 1N5VA 5L2LA 2RB7A 3BBFA 3PU3A 3RQUA 4X1YE 4JUZA 3WQPA 4QWEA 4ZI7E 2IRXA 2QA2A 2CBJA 4AE5A 1E6VA 5K8MA 5AQOB 1QAXA 4NLGA 1FERA 2BS2A 5H6QB 5A8RA 1T9VA 3H5YA 1DLOB 1T8EA 4GK5E 5KFXA 3DU5A 1VCSA 3M1VB 3EMTA 3PFEA 2FZKB 3H8YA 5IFMA 2ZHAA 2R42A 3KUGA 2OLTA 1VOMA 5AQGB 1XN9A 2DYAA 2KKHA 2QLFB 1JLGA 5J1PA 1VRUB 4ELUA 3M32A 2X0YA 2YQ0A 1NO8A 4O4LE 5AE2A 4HEAA 3KJQB 5EK4A 4Y2AA 1RAIB 3VU7H 3AVRA 2E9ZA 1FXLA 5HBMA 2HHVA 4HI1A 2RDIA 4UEMA 2FJDB 3TJ9A 5J2TE 2D0UA 4JI1J 4IH5A 4ZP8A 1IJEB 3NNHA 3L09A 3KMSA 3R2DJ 3HZGA 1X4FA 4J91A 2HRUA 1U25A 4B6XA 1WUUA 2FJAB 4MK7A 5AE3A 3OD2A 1F2HA 2C2DA 1TKTB 2QRRA 3OR1B 1ICEB 3PXGa 3ZC1A 3PW5A 2MBGA 3C19A 2I6WA 2XCPA 3N2OA 3U1NA 1N52B 2ZHBA 4OHWA 4Y00A 5KFYA 1M5SA 3TUPA 4L9IA 3OHBA 4Y2CA 3VGSA 3OTDA 4U7IA 3T1AA 1WC3A 4CZZB 1D0XA 2J8SA 4YJ2E 5E41A 1F9HA 1NDPA 3BPSP 1LKZA 5KOWA 4RUAA 3HHKA 4F4XA 4A8MP 1YQ4A 2KM8B 1QE1A 3V6KA 1VQNS 4P72A 5HXSA 1F3VA 1S7IA 3UFCX 4J9SA 1WHXA 2J0XA 1X9WA 3U78A 2LJLA 5A0YB 3OFFA 4I56A 5ETNA 4F0MA 2RF2B 1S1VA 3BH7B 3H98A 1W0AA 5KMGP 3PJAJ 1DFDA 1BR4A 4CH1A 1CULA 1U0HA 1WKJA 3AEEA 4ZXLA 5JVHQ 1PBAA 3A3PB 2RNEA 1S6QB 3C6TA 3RGLA 2EC2A 1FRLA 3KHGA 3CVKA 4K2XA 2ZM2A 4ZVEA 2JJ4D 3R6GB 1U48A 2LQJA 5CB4E 1NKEA 2H4YB 3AA1B 1KQFB 3FGVA 4OI6A 1MN9A 3P8BB 2V7KA 1NNDA 2JQKA 2HRTA 3K2YA 3HDSA 2D74B 4S0MA 3OHAA 1RHQB 3AB3B 3IM8A 3K3QC 5FL0A 1X7VA 2ZM0A 2ODUA 1HQEA 3KG1A 1IBMJ 4GKKJ 1IJFB 4OYJA 2YOEA 2YX4A 3CD7A 4YSZA 2GHWA 2ASYA 4HWFA 4ECYA 4G65A 1F9FA 1C0TB 1GTEA 4YY3F 2IIHA 3CD0A 4JBCA 3FEXB 2MJUA 4DFPA 2CJXB 4P2XA 1R3NA 3MM5B 3G8SA 2Y8YA 5FXXA 3W7BA 3FCHA 4ANEA 2RU3A 1HQUB 4EO8A 1Y9OA 4WZXA 4F0HA 5ABFB 2P6TA 4NXNJ 1VHIA 1NH8A 3KLHA 4J9KA 3IR7B 3TA1A 4WBOA 4HACA 3SCIE 2YK0A 4DSLA 4NCGB 4WFXA 1A6LA 3FZLB 2J0QD 4ETZA 4WFZA 1T9TA 2YWHA 2MLXA 4G3IA 3P4QA 3GP9A 3QQCD 5BR8T 3QBCA 3HKZD 2VKRA 1HR0T 2IW5B 2IAKA 3RC8A 4F6RC 4IR1A 3KHRA 2HEKA 4ZPCA 3CT9A 2F4VT 4URSA 1TV6B 2WZIA 3AVSA 1S12A 2IMOA 2JC0A 1IBKT 2OPSA 4ANCA 1D0ZA 4U7YA 1Q16B 2CHNA 3MD1A 5F8PA 5LHIB 4NLPA 4UOGA 2PFVA 5F3ZA 2WVDA 1RWMB 1ZTTA 5HMYA 3LP2B 1Z8UA 1HBUA 1Q95G 4C8OA 4RZRA 4O23A 1TZ0A 5LG3A 3LOUA 2BW7A 2HHPA 4RKUC 3TVYA 5LXRA 3UCUP 3BO3A 3M8QA 4TYBA 4IQXA 4JI8T 8ATCB 3CIMA 5LG4A 1RT1A 2EK6A 2I9SA 1N4LA 4BC9A 1VLYA 1NKBA 1QUVA 4KO0B 1KLMA 3N5BA 2BYCA 4AQGA 3M2VB 1S0VA 4EOZB 5ETVA 1B0TA 1LEOA 5HXCA 2FDNA 1N36T 3MUMP 2KWIB 1FRJA 1D1CA 4ECUA 4LSNA 4ED3A 2DTJA 2HMIA 1CQNA 1U6BA 1OO0B 3PJXA 3LG7A 3KFWX 4ERRA 1RT5A 2GS8A 3QJLA 3GV5B 1H0HB 2IC9A 2P5VA 5KX5E 4IE4A 4DG1B 4X66T 1RHKB 1IZNB 1QSYA 1CJVB 1R6VA 5IXUA 2E5LJ 2DHGA 3OTBA 3C14A 3JC6C 2C2NA 4K8RA 3UUNA 5GADU 4J9PA 2NZCA 4P9SA 2V4JA 1G1XA 1Y11A 5LA6E 5IV3A 1A9NB 2ADBA 3NS6A 1DURA 2J0SD 1C0UA 2RRNA 4WYVA 3F31A 5LGNB 3MR7A 2GGPA 4KHZF 1PSDA 2KTQA 4TWFA 2WM9A 1YBAA 4N7TA 4ZZBA 4M1KA 4P7TA 3ILOA 1JLQB 1N32T 3SSSA 4RBTA 9ATCB 4GKJJ 3MMCA 2FLNA 3MI7X 1IBMF 1RAHB 3ZZRA 4DV5T 2EBGA 3TX8A 2CNOB 2VBZA 2XAFB 4NPPA 1WI6A 5AQHB 2K24A 2B76A 3DM2A 1GQEA 3GN5A 3MMBA 3OBIA 4O2AE 3GG1A 3AQPA 3HM9A 4WW0A 3IS9B 3ZZPA 4P7VA 3BK9A 2J6SA 3RC3A 3ZT7A 2QG9B 4EYIB 4O4GA 1ZPVA 2XY6A 3NEKA 3VALA 4XAKA 3L3PA 3UCGA 3T1HT 2DGXA 1VBZA 4A8KA 2W2QP 4ISSA 4CXYA 3DXSX 4CT8A 5A2QY 5I3UA 1WORA 4WF9Q 4LF8F 3KOAA 1JK9B 2W24A 2NQPA 2QFIA 2XLKA 5KG2A 3GTYX 2VG5B 3GR0A 1UVMA 3CJ8A 1N48A 4AISA 4H54A 4JB8B 1ZP0A 2AIRB 2K1RA 2V69A 2N82B 2DD8S 3RRGA 1VIOA 2E1RA 3SZ2A 1UX4A 2K48A 3KBTA 2VD3A 4CN6A 4JI4T 3HT3A 3AOBA 2CPYA 4ZDNA 3EHZA 4TV9E 5JQGE 3GFHA 1WKKA 3MR3A 4ED2A 2ROGA 1SC1B 1YJWS 2MPKA 1KHWA 1JXLA 3LP1A 2E7XA 4DV6J 3CQXC 1L3UA 1HBUB 3QUJA 2Q79A 5KFCA 1S79A 2OH2A 4CO4A 3NKZA 1SL1A 3NMAA 2VV5A 1OMSA 5FLXU 2HZVA 4K4XA 1K9MT 1T94A 1KNRA 3C51A 1YD8G 3HXMA 1ZETA 3W9HA 4RW6A 2P6SA 4EI2A 1LWFA 2MLZA 2BRKA 3ZMZB 3R9LA 3PM9A 4TZ4C 2YY3A 3PDYA 2CWYA 2RH3A 4R25A 2A2FX 2K5BB 3ILJA 3AAWB 2YKSA 2YKQA 2L3LA 2KZMA 4O3NA 4RJVA 2VK9A 1RTDB 3GIRA 4B9UA 1B4SA 2DEIA 4R0JA 2PO4A 2QX0A 1I6ZA 3I0RB 1GXUA 2F7VA 2VJUA 4EV6A 5F8JA 5JR9C 3FCWA 1DRZA 4ZEYA 2XM2A 3FB2A 4HWIB 5H1SV 5KT2A 1J5WA 5LMUJ 2QE5A 5IC4B 1NB7A 2QN6B 3QIPA 3UFGA 2J7WA 3QT7A 5LJMA 4WTYA 2PMZD 2B9EA 4R8UB 3PUAA 4NXMF 2AJ0A 4HI2A 4K4TA 2CZ9A 3W5XA 1NKCA 3W9JA 2F4VF 1YXRA 4HTJA 1X31C 5SUHA 5ETLA 4ES2A 2CWXA 1FJGF 4DL0C 4XIUA 2BKPA 3MPVA 2C0SA 1S6QA 5KG0A 3TANA 2UUBJ 3UQ7A 4I4TE 1NH7A 4DPWA 3J80U 4X64F 4MYUA 3TZZA 2W7OA 2FVRA 3N6MA 3W62A 2VPXB 3BSNA 1DQ8A 2YX1A 4HFHA 3BZQA 3HZEA 4DPTA 4F8RA 2KT3A 1WLXA 2EHOB 3ZYKA 5DETA 4JI2J 1WF0A 1WHVA 4KBIA 3VQSA 5DM6Q 3SQGB 2Q43A 3FRZA 1UL3A 2I6HA 4UOCA 2IUBA 3DLKA 4PQUB 3HSDA 2GK9A 4E98A 4PWDA 4YB5A 5EGYA 2GVZB 3N01A 1I94T 1Z2ZA 1SH3A 2PE8A 3PEJA 3DOKA 4IREA 2WWVA 4CI3B 3W66A 3TO8A 1KC8T 3UU3A 3DTOA 4Q8EA 4M95A 4F04B 2F5GA 1T02A 3DDKA 3NGRA 3DLEB 1P8GA 2XHCA 3B4MA 1U1PA 1SB6A 5G4DA 4CXXA 3VAIA 2E9XC 1DJ0A 1HNZT 4TWHA 4DSEA 5GADI 3EGVA 3GZ7A 4GKKT 2D3O1 4HFVA 1FK9A 4ZITA 2L08A 5DQIA 2DT9A 4LSLA 1HL6A 1J5EF 5L4HA 3WC2A 2AYGA 1FNOA 1AZSB 3MECA 4RX6A 4HDGA 1SV5B 5JDGA 4EZ9A 2GAGC 3C3LA 3AXMA 2FJDA 2R9LA 3H3MA 1MU2A 4JI6T 1S6PB 3FMWA 1EB0A 3AJDA 1RT3B 2EHOD 3BR8A 2WDVA 4FYXB 4AXJA 5ABEA 5GVQA 1UUSA 1UEUA 1MMNA 1FMVA 3GA8A 1T9UA 4RR5A 5L3DB 1R43A 4X4TA 1HYSB 3HR0A 2QSFA 2G0IA 3LK2B 3OVAA 4BC7A 4F02A 3LF0A 3K58A 1O8BA 1RABB 4O0NA 1MMAA 3BQ1A 2DGTA 1D1UA 1TVRA 2W62A 1FFSB 4O44A 1JLGB 2DR6A 2HIYA 2YKNB 3CCRS 3ONJA 2VQFF 4O4HE 4DV4J 1N32F 1A0OB 1FA0A 4QPTA 1YI2S 1M5OC 1NK9A 2VUGA 2QTWA 4F4ZA 5LMNT 2EHOC 3AA8A 2KWHA 1N5TA 4ECSA 4HT7A 1FMWA 4DSJA 2FLLA 3H2LA 1URNA 3BS9A 2Q9QA 4B3ST 2EXUA 2FVSA 3Q2SC 4Z2XA 4YY3J 3JSMB 3VRAA 3UUXB 1RYSA 3KLEB 2E9XD 2C42A 2F8EX 5IT0A 3RIAA 3MOJB 3MAAB 4I6WA 3PUVF 3CKDA 2YU2A 1S10A 1SPBP 3DMJA 2JLFA 2KVQE 4NEZA 1IN0A 1GXTA 3HJVA 4HT5A 2MHEA 4OZ2A 4OYXA 4EB6E 3NGDA 4DUYJ 1PCAA 4P71A 2D3UA 3UQSA 2MQOA 3VGVA 3SDEB 1WI8A 2LLZA 4CLLA 4CIOA 2UUTA 2APOA 2OPQA 2XTJP 2XZEA 4E8UA 2C5JA 1G3OA 4WKYA 1NWMX 1W2IA 3LGMA 4JOUA 3CJTA 1R31A 3G82B 4G1IA 4ENOA 4XDCA 3L7UA 4DU7A 4CO2A 2R7RA 1X8DA 3TVKA 4OV1A 3Q23A 3EUNA 2ZH6A 2A3DA 2W9CA 3CNQP 5DQGA 1HMVA 2V1DB 4JLEA 1UETA 3DYAA 4TV8E 2L8KA 1VK3A 1OY8A 1L3KA 4QXBB 4ELTA 4JI6J 3FBCA 3RJMB 2LRLA 3TP2A 2B8PA 2HLUA 2KNDA 4EEDA 2IBKA 1S72S 1YTYA 4U2ZA 3WAKA 1NBEB 3Q8YA 1T11A 3QRQA 2BS4A 3QPIA 2FQQB 3R8YA 4WFYA 3MTKA 3TJ8A 1Q5VA 2VG6A 3PDNA 3IEEA 5E5NA 4HHHA 3I4PA 1RGVA 4PJJA 4QKNA 2CPXA 1X5SA 2HQ3A 2YDQA 3O4XE 4ECZA 5F9NA 5M2PA 2CQHA 1W9RA 1HNVA 3NAHA 4UQGA 2FJVA 3NS7B 1VYAA 4NRUA 4QWCA 3PW4A 4OJ3A 1XEZA 5A1LA 4QQBA 1NK6A 4CCHA 4O3SA 1BC6A 2DY1A 3C6UA 1N32J 5J1EA 3LP0B 2VKHA 1RAAB 2HS0A 2V4JB 1JIHA 2VFVA 4X4QA 3AAEB 3J7Yq 2GW8A 3FMBA 4PWUA 2BR0A 5FMNA 2V63A 3SCJE 4ED8A 3C64A 3Q86A 2DNPA 3RIFA 2WOMB 5J0ZA 2F4FA 3AT1B 4PJNA 1HTJF 2DKOB 1UA1A 3AA0B 2QMXA 4LF5T 1IKWA 3KLIA 5HMZA 1T03B 2C2RA 3QLHA 4FYDA 1FRIA 2X9YA 5HI7A 3PW0A 3O2IA 5DM7Q 4RNOA 5IYZE 2AEJA 3EWGA 5ETOA 1J5OB 3B5MA 2CLYC 3H3AA 3OBVE 1G4CA 3HVTB 4TYAA 4JI7F 2VH7A 4RUHA 3DOKB 3PTWA 4B3TF 3QSIA 2XS5A 2HYIB 4QIFA 4BS2A 4OJ1A 3ZJ1A 4DQRA 3MAQA 4DV2F 3AFGA 4QCLA 2I0MA 5KG3A 3M2VA 5CQGA 1KLMB 1N5YB 3K17A 3JSBA 4RLEA 1SJRA 1BQMA 3CCMS 3ANWA 3MGJA 5LGTB 4DUYF 2XB2D 1RT1B 1YJ7A 3UW1A 1Y0HA 2LM2A 3BBCA 1HCIA 1OJ4A 2CDQA 4NOHA 2MQQA 2RQCA 1BQXA 4ZK7M 3ZMUB 2W9AA 5EX0A 1NJWA 1D0YA 2PFDA 2OJ3A 3QZ7A 5DLFA 4AQYF 2ZMAA 4ER8A 4G1QA 4CLFA 5CHCB 3O1JA 3KHHA 3M4XA 5HWXA 1YITS 4ETXA 4X62T 1TV6A 3QFWA 3I82A 1WWHA 4XO0A 3PUWF 4LMJA 1RLDA 3M8YA 3TQEA 5LB7B 2VWAA 2ZD1B 2BQ3A 4LF6J 3RYCE 1KSPA 2ZBCA 2X9HA 3HKEE 1NDLA 4DV7T 4LF7J 1CJTB 3LJCA 5J2QB 2HNZA 3RB4A 4PG6A 2RHSB 2CQDA 2RMLA 3PKMA 5E33A 1RB0A 2C3UA 3ZNUA 3Q8SB 1ZA2B 4Z90A 3KV4A 3LGNA 1RTDA 3RIUC 4DL7A 1G8XA 4DSFA 1Q7LB 3MFHA 5IT9Y 2N4DA 3UQ4A 1NK5A 1RZMA 3P4WA 4N56A 4Y2IA 4L73A 3VZIA 4LR9A 3RU0A 2WSSV 1N33T 1TAQA 4W4MA 3R84B 3QK6A 4DDFA 4WNKA 3PTRB 5DG7A 2BACA 4W92B 4UZBA 5KDMC 3V4IB 1WKLA 1WACA 2YINA 4TY9A 3O8WA 1TL4A 4FJOA 1RWWB 4I7FB 5M4YA 4QR1A 3GPAA 3CJKB 3K5LA 4KHPF 1PC5A 3K5NA 1HQUA 4H4OA 1VQYA 2LKGA 4B3TJ 4Q5VA 2HGMA 2R2TA 1B3TA 4CI2B 2LSGA 2Q1LA 1DY3A 1SQGA 4C2MA 5AQJB 1CJKB 3NBXX 4PAGA 1S48A 2XMVA 5DS7A 3AEDA 4W98A 3BGOP 3OXGA 1YZ6A 4PCQA 2YKNA 2J9EA 3V5UA 1MW7A 3QAUA 1JKHB 1H98A 1Q82T 1FVSA 4DV2J 2QLXA 3HHLB 2VBYA 3JSYA 3MPWA 1YDLA 3NWGA 2C3OA 2W2OP 3DGPA 3TJAA 4KV8B 1I94J 3V5SA 3BDPA 1P9QC 3U27A 1FEEA 1DQAA 3A8IA 2E5HA 5IWAT 4F3QA 2DXEA 1KNZA 2DB1A 2ZBPA 2JWNA 4IDQA 1FFWB 1SIWB 4DFJA 5JRCA 2ZH4A 3MCNA 2PMHA 1KVJA 1FNMA 3BREA 1WC5A 3EAMA 4LFCJ 1X5OA 4LT6A 2Y1LB 2X9WA 3LUYA 2ZLYA 3MMBB 3AAAB 2J9DA 1T7PA 3P5BP 3MZKB 1RT2A 5CXTA 1Y4ZB 5HQMA 3MKDA 2CUYA 2XMJA 1TMMA 4NZ0A 3AE9A 3MACA 3AEFA 2FHOB 3C46A 2JLGA 1OEDE 3NZPA 1S1UA 3LO3A 1H2TZ 3OL8A 2FY8A 2UU9J 3IMQJ 5KFZA 4F4YA 1XK8A 2WCAA 1IWAA 3H25A 2WOMA 3H2VE 2ZBQA 2UV8A 3MM6B 4AIUA 4MBQA 2KM8C 5KFTA 3M9NB 4OZ1A 2FVQA 2DNRA 2VC0A 3CX8B 2V9KA 2QL9B 2KLQA 1C0UB 3W63A 1BXNA 1ZAXA 3E8OA 3C6UB 2BABA 3QT5A 4YR3A 3R5CA 4HEA9 4KP3C 3CPWR 4DIDB 2OAUA 2CIMA 2K9AA 3OQ2A 4CNZA 2X68A 1CSJA 2J76E 5CZVA 2IC6A 4H4KA 1TKZB 3DOLB 1CJUB 3OT9A 4P09A 4QU7A 1J5OA 4K0KJ 3E01B 1HBMB 3JQKA 4KRWA 3HKCE 2CWKA 1ZKEA 4OI3A 4BJNA 4COFA 3BYRA 3CCES 2P9EA 1S4FA 2MDAA 5L46A 3FQKA 1IKYA 2CVEA 2NREA 5EX3A 2VKOA 2W1BA 4G1PA 2GJFA 4M5MA 4U67Q 1CLFA 3D7SB 2CPEA 1VQKS 2XQ4A 4OX6A 3PE0A 2BXJA 2W4DA 2UUAF 3SFGA 4DR4F 5CCLA 3PX6A 5F0UA 4KC5A 2DH7A 1DTQA 3NBPB 5KG7A 2XYGB 3I0SA 3D3CJ 2VB6A 2FHJD 1U0SA 1HF8A 1KS2A 3H59A 1MNDA 1QVFR 4EYUA 4U33A 4V19X 4TX5A 2SPCA 2WY2A 4EK2A 4U3CA 4DV3J 4MT1A 5D3GA 3GU0A 2XJ7A 1G6BA 1FD8A 5HQ8A 3BQIA 1KQGB 3M1VA 2CYYA 2G0CA 3MD3A 5KG4A 3K0JA 3QGIA 5CAAA 4GYSA 3P6YC 1B70B 2NUHA 2KHCA 4XPEA 2ROPA 4F2SA 1TL1B 1NLKL 3TEGA 1S6OA 1KOHA 3QAEA 2Z56B 3WBZA 4A8QA 2BS3A 4FBUA 2LHRA 5CGMA 3E2EA 4MIBA 1UVLA 3CMAS 4JI5T 2IBOA 3E0ZA 5IT9U 1FWPA 2GHVC 1SJ4P 3Q0AA 2VONA 4L5GA 2CQPA 2CE7A 3G71S 3VZHA 2CJYB 2XUEA 2L9WA 1FX4A 4NLXA 5EDWA 4YXDA 4ZCLA 1D3WA 3F2EA 2Q6BA 4Y2KA 3CXCR 4ZVTB 3AD8C 3U1LA 4I4BA 5AXNA 3T6BA 1L5UA 2BMBA 5C42B 3JSRA 2ZE2B 5LJNA 2XAGB 1JNRB 2E7VA 3EXYA 3KLGB 4AXPA 3M6XA 2ACYA 1SL0A 2XTLA 5J2NB 2MKCA 3JAMU 3EGWB 4LF9T 1Q79A 1LNQA 2O01C 4CLZA 3E3XA 3Q2TC 1Q4RA 1X4BA 1UZHA 1B99A 4NASA 4DV0T 1Q8KA 4UF0A 4K4UA 4JI6F 3VRBA 3D28A 2PEHA 4U8YA 2IJRA 4F7VA 1CC8A 4OQJA 2EFQA 4K0KF 2UXCF 1HR0J 5DDOC 2WW4A 2V8SV 3N2GE 3BH6B 1JLCA 4C6AA 4K5RA 2E5IA 4GVBB 1FRMA 2FIUA 5D4PA 3ZMVB 2LU2A 4CO3A 4IFYA 3SCLE 3D1HA 3GG0A 3M05A 2UUCJ 2VBWA 5BYRA 3N9LA 3A13A 2XQAA 3IR6B 5F8HA 3JTNA 3I0SB 2DRBA 4BLGA 3MUVP 2F1FA 1XR6A 5LHHB 5F8LA 5LMNF 4I55E 1YGYA 3HVRA 2V50A 4TQRA 2PSZA 1SA0E 3BF4A 4RW7B 5T7LB 4LREA 1NUEA 2FJXA 1T9XA 1XMQJ 3B4DA 1TK5A 4C8YA 1SJ3P 1MMLA 1JXVA 4ICLB 5A8WA 1QTNB 2WWUA 2NW8A 1FVQA 1X9SA 3Q8QB 1TR0A 2CQCA 4Q2LA 2M5YA 1ZM2A 2W00A 3O5TB 3LW5C 4F4AA 3SQOP 5IV4A 4V1Av 5AQTB 1J27A 4NLVA 4OX9F 1CS4A 2EWHA 2WAQD 4IIJE 1Z4UA 2MLYA 1SV5A 4LUBA 3POTA 1FJGT 3TA0A 1RCXB 5AT1B 4DR4J 5JDHA 3AAIA 4X65F 3T1YJ 5AJ3F 2V2QA 3NL0A 4B3RT 3ZC0A 5L3CB 2D9PA 4DZ6A 4M5HA 4OIXA 3FBFA 2AQ4A 2XS2A 2E1PA 2A1BA 2OEJA 5C25B 2YNFA 1AFIA 2BE2A 2HZCA 3M2UB 2O3DA 1OPIA 4X1KE 1XMOJ 3WC0A 3THPA 4IHJE 1NPKA 4U74A 4JI3F 3PJ9A 2DNMA 1GAOA 4X4OA 4G2AA 1VGYA 2LYVA 3QIPB 4NLSA 3CCUS 2GMJA 1QSLA 3DP7A 1R8CA 2NXJA 1LFWA 1TAUA 2J1DG 1KVIA 3SQGA 4DV6F 3BSAA 2DJWA 1FHTA 4DQQA 1O0PA 4O4JE 4JI1F 1N8RT 5CA5A 2DGVA 1RWPB 2JHEA 3IHRA 5DZ6A 4P10A 2QGFB 3TR5A 1NB2A 4OMFG 1J5ET 2YQ3A 4PJMA 2CXFA 4DR3T 2DLRA 4X4UA 2XGQA 3Q5EA 1OPZA 3SS1A 1WEYA 3ZZYA 5DABA 4N76A 2UUCF 4ZPBA 3ADAC 3EDRB 3NKYA 2RQMA 3AE5A 1O6XA 5RUBA 3T5LA 4F25A 2OUGA 4ED0A 1RKIA 2VQET 1JNRA 5B0FA 2P2CB 4MKVA 3H5XA 3S6EA 2HQGA 3TNVA 1QAIA 3A5XA 1UGOA 3AE2A 5E0OA 3DKDA 3ABVA 2GIFA 4NLDA 4DV4T 4DSIA 3M8WA 1HNIA 2EK1A 4P2MA 2VASA 1ZTWA 2UXBT 4MIWA 5K20B 4N78D 3AE7A 2DISA 2RHQB 2Y0SD 5K14B 1FJGJ 2OIHA 4A8OA 5HMXA 1LK7A 2KN4A 4C3MA 2W67A 2EC0A 4QW9A 2ASDA 1ZZFA 4TU9A 4M1PA 5HAXA 5HCJA 3CJ3A 5HSPA 2M3DA 4LBPA 1EIYB 3OKQA 3DRRB 1SBRA 5CD4H 5FXVA 2I1RA 4DN9A 4E0DA 1KLNA 4OLOA 4HFIA 3H7HB 1JWWA 4JYAT 5I3UB 2YNHB 2BVMA 3KV9A 3HFKA 4DPYA 3GV7B 4LFBF 1Y5NB 4JI3J 2CQIA 2YDRA 1ZOTA 1F60B 1SJQA 2VF3A 4GO7X 1EP4B 3BB5A 4DV1T 3W2WB 5KFQA 1EZ3A 5LYJE 4TY8B 3TZYA 1CJTA 5IC6B 2F9JA 4WU2A 2AJQA 4HFEA 3M30B 3PG9A 3RQWA 2XSJA 4A8XA 2BZBA 2M6IA 3GLJA 4TN2A 2W9BB 2GMLA 2CCQA 1SH0A 4KBMB 4G1QB 4WBFA 1RT7B 4X62J 2CNLB 1S4EA 3LSVA 3OTOF 2V8DA 1J5EJ 5BMVE 3PUXF 4URGA 2IYGA 4AKGA 4ZCMA 1T9YA 5I3QA 2JFDA 2HNYA 4WIQA 4DV0F 4YHHT 2WONB 3MR5A 1TUGB 2J6TA 3L39A 3ITHB 3CIRA 3IWNC 4K0KT 3QJPA 2WBRA 3HJFA 3KLFA 2H51B 1YZ7A 1LOUA 4J5OA 3ZLIA 3KXDA 3G87A 4RNHA 2QMUB 1N5YA 5E2QA 1FDNA 5CA1E 3BN7A 2RKIA 3J81U 3C4XA 3E08A 4AUKA 3SWHA 2J9DE 2KYXA 1D8ZA 2WHOA 3ETUA 4HKAA 4P75A 2JLEA 2ZH8A 4WBNE 5A8WB 4CI0B 1IBLT 4K4YA 1W7WA 2CQBA 4ID8A 2NR0A 4NLQA 2YNIB 2A6OA 3CJRA 3IA0A 2KZ7B 3Q22A 1MWYA 2M2BA 4ED4A 4P6QA 5GAEI 1YBUA 2AKWB 3N9UC 3CCJS 2XAHB 3T1HJ 1YJUA 4QPXA 2UXDJ 3G6VA 4ILRA 3A8YC 1U5PA 1HBOA 1C2PA 2KH9A 4YTNA 2ATLA 4ECQA 4LSNB 1P9YA 4KUMB 3SFEA 5B0AA 3CMES 2QO3A 4G63A 5GONE 3NOGA 4LMLA 1VJQA 4UY85 2W4PA 4U95A 3W8GA 3JYTB 2PI5A 1MG7A 2LKHA 3TZWA 2DCUB 2AW0A 4Q43A 4Q44A 1R0AA 2Z2LA 3ZSTA 3ZCIA 2BV3A 5AQQB 2MZRA 3UWTA 1MWQA 3MA9A 4F4WA 3CDBA 2MPUA 2QLJB 4K59A 2N3LA 1YX2A 4DV2T 1W2BR 1TKDA 4IDKA 2HZAA 2XQCA 1Q1KA 1VRTA 4WCEQ 4HN9A 2QFJA 3K3NA 3HFZB 4DBQA 2LQ5A 1RWVB 1V9DA 3GCXP 4C0HA 4A47A 2JVOA 3K5PA 4LF4T 3AY0A 4JI2T 4OI1A 2HHXA 5FP3A 1BWEA 2XY5A 3KTQA 5JDNA 3SBMA 2H5EA 1QVGR 3UULA 4UVAB 3I5BA 4X4SA 3DYAB 1HNIB 4FYYB 4NLTA 4I0WA 2V7MA 2XQ7A 4KGVB 1LK5A 4YHJA 2DHHA 4IOAQ 4AXIA 4X62F 4NLWA 3O1IA 3GCWP 1T05A 3MM5A 1SC3B 5KT7A 4MYTA 2BJ7A 3FEYB 5ABFA 1FF2A 3SFDA 4HTEA 3J7YU 4C3LA 4H9SE 3Q83A 4YOEA 1G2EA 2IPOB 4QH5A 4R5PA 3LGHA 5HANA 2V8PA 5E3PA 2KRBA 2IM2A 2NYHA 3DI6B 2P9BA 1Q8BA 2UUCT 3WX4A 3MCOA 5HXHA 3I5AA 4ANDA 1X4GA 5K14A 5KFNA 4ZVOB 3GJRB 1GT8A 3PR5B 4DBRA 2HHSA 2RQ4A 3SV4A 1RKJA 2D3OR 3FHNA 2FHMA 1RWXB 3TLUA 4B3SF 4A98A 2I2YA 4H4MA 2N7YA 4V19J 1KONA 3V81A 2ZC4A 1UA0A 1KTVA 4NLRA 1G7CB 2PI4A 3KK2A 1YRUA 4PZVA 1XNQF 3MPDA 4J7CA 4OHZA 3ZT5A 1ELOA 4NUUA 2E44A 1KWMA 2WQYA 1F6TA 1JLAB 1S0NA 4CNYA 2IDOB 5AXLA 1PC4A 1RTJA 2XO7A 4KYZA 2PFFB 4ILAA 2HQIA 1RAJA 1U2RA 3K3OA 4PRFA 2NXCA 2C2OB 2BE2B 2QIFA 1S1TA 3EVOA 3IP0A 1VIXA 4LRAA 1N5SA 1QUUA 3W9IA 4DJBA 1TKZA 4LRDA 1S0MA 1M0SA 4URQU 4EIWA 1JLFB 5FY7A 5FIIA 5HP1A 1TP7A 1H2VZ 1S1VB 2A72A 2NCKL 3QGHA 4LFCT 4JI8F 1HPZA 4C11A 6AT1B 4ZPTR 4ZPVR 2CPTA 1HHSA 1RXOB 1HX8A 3D9BA 1S6PA 2GX8A 5IUXA 3VHLA 1FRXA 2DNZA 2XQ9A 2I59A 1S99A 3DOMA 2DNXA 3UFEA 2RIJA 2JEJA 1US7B 4YFSA 3RAXA 2LQ9A 5H9EJ 2FJBA 4HFBA 2NTXA 4KFBB 4QWDA 2PTFA 3SI8A 1XNRT 1WCRA 4F50A 2PN6A 3HVAA 4I68A 1RT6B 1QAYA 2LP4A 2MYFA 2J4GA 3ZFVA 4M5GA 2UXDF 1RTJB 5M2UA 1EARA 4ILMA 4ID5A 4PUOB 5F5WA 4ZP7A 3T5HA 1FE4A 3C66A 4GIWA 4WPAA 1UJ6A 3DLKB 5F8NA 3AEGA 5LCYA 4RUCA 1SUQB 1S9EB 3IAM9 4KQZA 1SIZA 3C15A 5GAGU 2ACXA 2VL1A 3SEOA 2PDAA 3FUYA 3MDFA 4KV8A 1Y5IB 2XMUA 1U45A 1FJEB 4IDPA 2ROEA 3DC2A 3N4WA 3I55S 3HHLA 1OS5A 3P96A 1MIVA 3EVMA 4HWCA 2LOPA 5ETMA 5GMKa 1UVJA 3AB2B 4FF4A 4YR0A 3UU5A 4UF0B 4CLTA 2HBZB 4LBIA 5LJ3Y 4QIEA 4PXCA 4MIAA 2V6XA 3QGPA 2OA5A 5KFWA 1DQ9A 2OMLA 5KFUA 2MOZA 3AEAA 1EX8A 4IDNA 4NE9C 2RUSA 2QV6A 4PFPA 2ES0A 2B4OA 2JC1A 4WZQA 2V26A 3S1TA 4M8LA 2UVUA 3ZZTA 1FTCA 3P49B 2B8QA 2C1EB 3FNNA 5U47A 3CCZA 2ZH1A 2FBWA 1R8IA 4DV5J 2OO4A 2F8MA 1FWKA 3I0RA 1LXJA 3EJMA 2BDPA 2R2SA 5FXWA 5DJBA 1SKUB 1W25A 4LF5J 2DHSA 1OY9A 3OFHA 4DF8A 3OR2B 2JNJA 3BBBA 2CQGA 5AQFB 5THWA 4RW4B 3PJAA 2NW9A 3W60A 1Y3JA 4YB1P 2UVVA 5HEHA 5IT4A 1NU4A 4ZIWA 7FDRA 5ADXL 1RTIB 5LSLA 3FC9A 2NSCA 3C8YA 1X4HA 2OP5A 1ULRA 1T05B 4I6YA 2ASJA 2V5CA 4QIGA 4IG3B 4KSEB 4GKKF 5GMDA 2XSAA 3ILLA 4O4GB 3R1LA 2E5LF 4LRBA 1E6YB 2ZM6T 5JVGQ 4CO1A 2C3YA 5L9NA 4IYQA 5L39A 2X3GA 3EZ5A 1WDDA 3MWBA 1X4DA 3WX8A 3O1LA 3PFOA 1SCJB 5HVHA 3CWZB 3GYNA 4J9VA 4WXWA 5KFHA 3BSCA 2UU9F 1EKRA 4BJMA 2GAHC 1DTQB 3NBPA 3CEDA 2QRXA 1NSKL 4DR1J 5HJXA 2A6MA 3RH3A 2ZNYA 4EO6A 4KHRA 2X1BA 4DZDA 1VMBA 4AI6A 3G2XA 2R7SA 4L76A 3D4JA 2E9XA 3R5DA 3RIUA 2KHDA 3CCLS 1YIJS 2MY8A 5IWAJ 5CYQA 3KK3B 5EZYE 1LW2A 2OTLS 4OYPA 4DX5A 2RS2A 3LBXB 1X4CA 4KH1B 5HJYA 4NMXA 5BYSA 2XNRA 1CJUA 3J9X1 4PPDA 1HW8A 2R8HA 5HCMA 2ZZNA 2HNDA 1FIOA 2XO6A 1Q53A 1HBOB 2ZEJA 3K8PC 3R3TA 2YKPA 2IY5B 1ZM4A 2DCLA 3P4UB 2R7WA 3DM2B 2Y1JA 3CD6S 2BANB 3MM9B 5EWEA 2WSCC 3TLTA 1F5BA 3UCZP 1FWLA 1FKOB 1S1UB 2ZUAA 3PZPA 3RB3A 5KT6A 2FLPA 5CA0E 3PUZF 3SRZA 3GB0A 1JQGA 5IM0B 1FKOA 3OYZA 2JL9A 3P45B 4EGLA 2VQEJ 2E5GA 4KFBA 2HMIB 2QVAA 5HEUA 4TNWA 1R8BA 2QA7A 2VFRA 4FF3A 5IQ6A 3KVAA 3M30A 4DV5F 3I9ZA 3IWLA 4BAYB 4WK1A 1FKPA 3VKGA 5KAKA 3TI0A 4PQUA 1SVDA 3RRWA 4J9NA 4TU8A 3P3DA 1EKSA 3ZXWA 2DHRA 2VFTA 5D8HB 4A56A 2EHOA 1KN6A 3MMJA 5FXZA 2ZM6J 2DNLA 2YNGB 3C14B 4F36A 5E3RA 3UTKA 3PV8A 3FZMB 4LFBT 1VQ8S 1LVFA 1L3TA 4LF7T 1CBKA 2BRLA 2V68A 3TA2A 1RQ0A 4XK8C 2ZOFA 1WNEA 3CX6B 2RS8A 3OFGA 2ZHOA 4AL7A 2J62A 1S97A 3KV5A 3HO1A 3NCQA 2CNNB 1RSCA 2IC3B 3IBCB 3OJAA 2QA1A 4D3GA 3RBDA 3VAJA 2M70A 3FK4A 2MZJA 1K0VA 2HBQB 5D0GA 2V34A 5EWFA 2WMOA 3RUBL 3CDAA 2B51A 3FCVA 3KJNB 2W9BA 2DGSA 3HSJA 1SXLA 3EVYA 3I32A 2QEXS 3DLJA 4LF2A 4N5SA 2B1EA 5JRCB 5KFSA 1N36J 3N6NA 3A3NB 3JTOA 1Q86T 4ECTA 3CO9A 2H4WB 1T95A 3AQOA 1HNZF 2CKWA 2BJ3A 5B0GA 2CRLA 4IGUA 2F9DA 1JLEA 4OZNA 2MZTA 1RISA 3N9PA 2U1AA 6FDRA 3ZCJA 5KFKA 2FZCB 4I67A 2QYWA 2BJ9A 4X66J 4MALA 1PKUA 5EK2A 1Z0PA 2MB0B 2AD9A 3I31A 2UZAA 1HA1A 1LWFB 2NYIA 1D1BA 3EYZA 3FSIA 3IR5B 5IZHA 2F4VJ 4JI1T 4QBUA 4DR1F 4JI7J 4LFAT 3D6HB 1CEZA 2FLOA 5L8RC 1PYTA 1JLEB 4ZLNA 2XMKA 4NCGA 3CE8A 3L3CA 2G0JA 3I9WA 5KFIA 3LP1B 3LAMA 2HAIA 1OWAA 3A12A 3EGZA 5I42B 3KLHB 1T8BA 3LQVA 1UFWA 2ZITA 3JSMA 2LSYA 3CMLA 3IRXA 1HWJA 2W4XA 1QLBA 2V2KA 2NXEA 4MKYA 3B57A 1YHQS 1BR1A 1E2AA 4MK8A 2B9XA 4CDIA 1XJWB 1T7SA 1HHQA 4A46A 5KFBA 1U1QA 3NY0A 1FX2A 4UELA 2DGUA 3NRBA 5AQMB 4YEAA 4X20E 5C2TA 2MHNA 3UU4A 2PT0A 2A2CA 3MCSA 3GILA 3WAJA 1M1GA 3DU6A 2V94A 2V7LA 1HQ2A 4KY3A 4JYAJ 1S6UA 2Z8QA 3LDQB 2VPYB 4QWNB 1IWGA 4RO0A 5HXRA 3Q5DA 1HQEB 2K7JA 3KVBA 3A8JA 2DO0A 4U7UD 3KG4A 4TN7B 1KEKA 3VAKA 3ZZZA 1NJXA 2P9CA 3CJQA 2FUG9 2BG9C 5F9LA 3DRSB 1FJ7A 4LF9J 3A8EA 2VQFJ 4K7QA 1MU2B 1SL2A 5A0YA 3R5AA 2AJ2A 4OFZA 4EZ6A 1U1OA 1AW0A 1WR6A 3IA3A 2OFGX 3ZEFB 4XTTA 3UDEA 3D5MA 5LXTE 4F67A 1LWCB 1RAEB 3VAGA 4C97A 2AEMA 1ZYQA 3CGIA 4ZI2C 4FVCA 5L3EB 5FD1A 3M9MB 3G6YA 4DR2J 2CM0A 1F1BB 4DL4A 4JI8J 3I9V9 4FZVA 3BM7A 2FPHX 4HHJA 4C8LA 1R7IA 2FJBB 5HAOA 1IKXB 2PBIA 4MTPA 2DNQA 2WRMA 1D09B 4ZJLA 3DLBA 1FKAF 2C3PA 3SMZA 1FO1A 4LVOP 2V7IA 2DNKA 2RF2A 4JI0T 1QUPA 3POTB 2GJIA 3NCRA 4A4JA 3QO9B 3QOFA 2VFUA 2BBEA 2MAWA 3RG6A 1Y00A 1IBCB 1OSCA 4LVNP 2AV5A 2YWFA 4DS5A 2AX0A 3LK3B 2PEBA 2BE9B 4EYHB 1D9AA 3RB0A 3EZUA 3M2RB 2HWIA 4EU0A 3VCDA 3R5JB 4OI2A 1LKXA 2H5IB 4YTPA 1LW2B 2QL7B 2WB1D 1S9FA 4QR0A 2YKOA 4OLPA 3G86A 4KKOB 2W2PP 3TVZA 3AD7C 5DQVA 3KK1B 1WEZA 2OV9A 2MZSA 3NGUA 1S9GB 3O9XA 1AYEA 1BE4A 3OLAA 1VQLS 5F8MA 2ILYA 4KGXB 1PG5B 2D9OA 2CXLA 5IS2A 1QTMA 5B0CA 4H9QC 3W5YA 2EFOA 1B7YB 5FLXY 1QLNA 2MQPA 3VV2B 1ACMB 1RHMB 3T5KA 4X5TA 3ONXA 1R8HA 4UUXA 2LXUA 3I4HX 4TU7A 1XNQT 4ZI3C 3GFXA 3J81j 1VC0A 3CW2C 2PC6A 2A0FB 2MKHA 1UCUA 1TL5A 2DGWA 4IG0A 4EBEA 3KWMA 1HNZJ 5HBMB 1T9WA 2VVNA 2YDSA 2FZGB 3Q5XA 5KFPA 2R8GA 3PUSA 4EXTA 3M8QB 2K3KA 1XWMA 3AXKA 2XWXA 4HYKA 2BKNA 3NS5A 5J1NA 4C0OC 3MEKA 3K8VA 5JTGA 2VKJA 5FY0A 1DARA 2OPQB 4KH0B 4JI5F 1TFWA 5HEOA 2EEYA 2UXNB 2ABYA 3BGRA 1REGX 4AQYT 3L95X 2YKAA 3S01A 2UUAJ 5ETTA 3PHTA 1YKHB 2FGOA 5JUMA 1FJCA 2KU7A 4HH1A 3DMJB 1VRBA 3SYZA 5KOXA 4CRJA 3QNWB 4FVMA 4DR2F 2M0GB 4EUVA 1U4BA 2X3DA 1BR0A 2JZ5A 1DBDA 2I5JB 3CC4S 3UDVA 2JFKA 2XQ3A 1JNZA 4USHA 2YXLA 2VODA 4C90A 2B3TB 2ZZTA 1Y3KA 4UT4A 5LOVE 3DXBA 1RAOA 2HQDA 3T19A 2ZOGA 3UDCA 4IOBA 1HNWT 4LF9F 2VL0A 3JB9k 4LF6T 4ZZCA 3MEGB 2XCAA 3OTEA 1UFLA 1PYOB 4QR2A 1H73A 2BM0A 4CN4A 2YQ1A 2BJDA 3RW6A 4D3HA 2VVSA 3TLWA 1UZDA 1UX5A 2YH0A 1K47A 4F2RA 2EFNA 2VDHA 2BJ8A 5AQSB 2JEIA 1NK0A 3EUHA 4CWBA 4OHXA 1YK9A 2FY1A 1HD1A 3MM8B 2NS1B 5DQHA 4ZPDA 3UDLA 3CQCB 2PGCA 4ZJQA 5LL6d 3PURA 2UP1A 3OW2R 4FKXA 2ALYB 3Q5WA 2HHUA 4ZP6A 2LKZA 1TTHB 2BKOA 1QAJA 4FYWB 2H1YA 4QH1A 5ETQA 4PUOA 2G2OA 3CJ0A 3IG1A 4PAAA 2EG2A 4U31A 3US5A 2XHWA 3AE6A 1Z1ZA 3MEDB 1X5PA 3MR2A 3GJTB 1NSPA 4TNOA 5B09A 4OYZA 2QSWA 3Q9DA 2W66A 4LSLB 1XDOA 1VQ7S 3DDIA 2JRSA 2DY9A 3HP6A 4KPCA 4QHOA 3T6JA 2UXCJ 3RRKA 2LFVA 5KFDA 1VQ6S 4MLKA 2MQLA 3GE9A 5GAGI 4EAHA 4DQIA 7AT1B 3E01A 3UI3A 3DFEA 1VBYA 3C98B 3NRXA 1IR0A 2W0GA 2UUBF 2BE7D 2HH7A 4PWWA 2DK2A 1S9EA 3O44A 4TVAB 1XMQF 3CPZA 4X65T 2RILA 4AD6A 4PK5A 1ZM3A 3P7IA 4RWWA 4MHCA 2GHPA 2DNHA 2E1CA 2G9OA 2PMWA 3QT6A 1KDNA 4LMKA 4KHMA 2E5LT 4DR7T 2M67A 4DG1A 4Y34A 4QWBA 3KYLA 4JI0J 4Q0BB 4GC6A 1RT6A 1X9BA 3OTOT 1RUSA 4RU9A 1RU2A 2ZJQQ 4ZS2A 1YLXA 3TW0A 9RUBA 1JKHA 4B17A 3M6VA 2KDOA 3NRYA 3JC6D 1FFGB 1UTAA 3CD5A 4FF1A 3EE3A 4MFBA 5CH7B 4RW8B 2IAJA 1LWCA 3ETOA 4HLBA 2DI4A 1SHZC 5D0HA 3KK2B 3AEBA 3W2WA 2X9XA 4F26A 4L75A 5LNKA 2HBRB 3GIIA 1RBLA 2W2MP 1Y01A 4YR2A 4OK0A 3GJQB 4N8NA 2ZBIA 3PR4A 3CJKA 2V9WA 4IOCQ 4CLPA 2W7PA 4A8FA 5E7OB 2YH1A 3DGPB 2X7IA 4X4PA 5I42A 2K06A 3VR9A 3NXZA 2GNKA 2FJWA 3VAHA 2CPJA 2UXDT 4PNIA 1JLFA 5E3CA 2UVRA 3C2PA 3TQ1A 3GV8B 3OJUA 3B78A 3PYEA 4WFBQ 2DITA 2WU5A 2B7CB 4ZLJA 2XI2A 1NPPA 4KGKA 4TLQA 3D6MB 3TLVA 1ZZNA 3OSNA 1S57A 2O5DA 2VQEF 3H37A 2OEMA 1BQNA 4UXNB 3IRWP 4TWDA 5FVLA 1RWUA 1VR6A 2V2VA 4JV2A 1UP1A 4KGZB 1QSSA 4DMZA 2IHR1 3L7PA 1T0TV 1NK4A 1CVJA 2XBPA 3KINB 2RPAA 1S0OA 5F3TA 5EUHA 2M7SA 1KTQA 2UUBT 4IFVA 3H20A 3OL9A 1S1XA 5AQLB 3X1DA 3GIJA 5DGAA 1XMQT 4FS2A 3N0VA 1RU1A 4H4KC 3IM9A 2OHDA 4K4VA 1TKXA 3P4SA 1ZHCA 4DV7J 5GAHU 2C2KB 2ZH7A 2CRBA 3THTA 4IRKA 3MHYA 2LEHA 2ATCB 4CLYA 1IUJA 3H40A 2WBLA 2VPZB 1APSA 1V3ZA 4B3MJ 4WK3A 3W1YC 5HATA 2HGNA 3JQJA 1VDHA 2Y1RI 3FEZA 2RE1A 3KJVB 1PJ7A 1IBKF 1HFAA 1KR4A 4KIAA 4PJLA 3EZOA 3M3ZB 3PX0A 4IO1A 1UWAA 5A6WA 4ED1A 3JS9A 3TARA 3UVJB 1EQ0A 2HNZB 2H3RA 5HEGA 4UOHA 5DG9A 5C7PA 2DPIA 2NR4A 4MMOA 2XM1A 3LPYA 2RDJA 2UUWA 2YPYA 1BUXA 1RJJA 4ILCA 3R97A 4Z7CA 3CDEA 3FBBA 2D3ZA 1KKHA 4UUWA 4RNNA 1FKPB 1YRTA 2NLWA 1FESA 3E22E 5T14A 2GIRA 2CPIA 3OL7A 2BM1A 2CQ2A 2CLYB 5E3AA 4EGWA 4ZP9A 4BWJA 3TAMB 4KGMA 4U7UK 4X4NA 1H6KX 1IKYB 3W2VA 1U26A 2DEJA 2IM0A 4IE7A 2B6AB 4ZMMA 3RBXA 4DV3F 4UV9B 4X2BA 1FXDA 3QC9A 4B02A 4UW2A 2BEFA 2HVHA 1TL3B 2E9RX 2YX7A 1CUNA 2VL8A 4FXWA 4ZVRB 3HX9A 4HGAA 3OVUA 2E8IA 1UVKA 3LH2S 2IVMA 3IO1A 1M5PC 5DDPC 2L9QA 5ADZA 3N79A 5EK3A 2D1CA 4EZ4A 2LHNA 4DL5A 5C2GA 4M5NA 3LP0A 4JEUB 3RW7A 5K5MA 5AXKA 4A97A 3FXEB 2XAQB 3UD5A 5ABGA 5ITHA 3ITHA 2OKQA 2XULA 3VAMA 4FXDA 2YWEA 3V2UC 3BV8A 3MEEB 1T98A 1DU2A 4ICLA 3QJJA 1OYEA 3RYIE 1IKWB 5DO2A 2OSRA 2H54B 1S35A 4WXOA 2HVEA 4BWMA 3CWJA
chains in the Genus database with same CATH topology
4L75A 4Q25A 2BKNA 3L4BC 3RBXA 4J7CA 2AEFA 2OLTA 2BKPA 1T72A 4EI2A 1SUMB 4L73A 3KXDA 4XTTA 4J9UE 1LNQA 4J90A 2BKOA 4G65A 4L74A 4L76A 3RBZA 2I0MA 4GVLA 4J9VA 1VCTA 4YS2A 2AEJA 3L39A 2FY8A 2OGUA 2AEMA 1T8BA 3JXOA 1XWMA 2IIUA 4J91A 4RO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L75 A;  4Q25 A;  2BKN A;  3L4B C;  3RBX A;  4J7C A;  2AEF A;  2OLT A;  2BKP A;  1T72 A;  4EI2 A;  1SUM B;  4L73 A;  3KXD A;  4XTT A;  4J9U E;  1LNQ A;  4J90 A;  2BKO A;  4G65 A;  4L74 A;  4L76 A;  3RBZ A;  2I0M A;  4GVL A;  4J9V A;  1VCT A;  4YS2 A;  2AEJ A;  3L39 A;  2FY8 A;  2OGU A;  2AEM A;  1T8B A;  3JXO A;  1XWM A;  2IIU A;  4J91 A;  4RO0 A; 
#chains in the Genus database with same CATH top