1G73A

Crystal structure of smac bound to xiap-bir3 domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
157
structure length
157
Chain Sequence
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTDLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis/apoptosis inhibitor
molecule keywords SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES
publication title Structural basis of IAP recognition by Smac/DIABLO.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1g73A00
5LG4A 3LG7A 1S94A 1FEWA 2XHEB 4TX5A 1EZ3A 1FIOA 3C98B 4JEUB 2DNXA 4JEHB 1BR0A 5M4YA 1G73A 1HS7A
chains in the Genus database with same CATH superfamily
3ZSTA 3FB2A 4IDQA 2LKGA 3L8RA 3H37A 3I1AA 3HI2A 4XZCA 2JMHA 2WY2A 3LG7A 2XSBA 3NBXX 2CHNA 2Q9QC 2W67A 3ZSSA 4X62T 2YOEA 3QC9A 1HS7A 4LF7T 1J1JA 3OYXA 3HR0A 3ABVA 4AQGA 3H3MA 4YTPA 4A97A 3N2OA 4YFSA 4Z91A 3RC8A 4I4TE 2M6IA 1J5WA 2JQKA 3PUYF 4QXBB 3AAAB 1BR2A 2MTQA 2HHHT 4PJJA 4PK5A 5AQQB 3VR8A 2V7MA 4YSYA 5KMGP 3P7IA 3P8CD 3LFMA 2JJ9A 1MMGA 4GYSA 4TZ4C 4IL9A 3RKOA 4HFHA 1D1CA 2VURA 3M3ZB 1SHZC 1XZYA 4IDOA 4MBQA 2XSAA 4IE5A 4BA9A 1ZOYA 1S35A 1E7PA 4JI3T 5HXRA 5H6QB 4AKGA 2IDOB 3VR9A 5LYJE 4AQFC 4ISTA 4X20E 2H3RA 2VL0A 5L3FB 4OHFA 5LGNB 5LA6E 3UQ7A 4EOZB 4O4JE 5ADXL 2UUAT 3RYCE 4AIUA 2ZM2A 2OLTA 1SA0E 3OYZA 4ZS2A 2KT9A 4E7ZA 5A1LA 2C5IT 4H9NC 4GKJT 2XZEA 1T98A 3KVAA 3PURA 3AEEA 4P09A 2NOXA 4QX8B 2YK0A 4LF6T 2DWGA 4DMVA 2WS3A 2V6YB 3LDQB 3JC6D 4AKIA 3CPZA 3ONJA 1E1HB 3QNUA 1NENA 2E9XB 4OFZA 2BG9E 2MYSA 3AECA 1MNDA 4YJ3E 3AE9A 1IJ5A 5HCMA 2CE7A 2LOPA 3AE5A 2A3DA 3QB5A 3TLWA 4DVDA 2ZM6T 4B3RT 3C98B 5HWYA 2DNXA 5HXHA 5AQKB 2FJDA 1LVFA 3ETUA 3K3NA 4LF9T 3B13A 4QWNB 5AQRB 2PJQA 2VKJA 5IWAT 4BJMA 2G0UA 3ZYLA 5JR9B 3MACA 5HAXA 3KVBA 4A56A 4DO0A 4EGWA 4UF0B 2QRXA 2BVLA 4EZ4A 4EV6A 1CUNA 2XAQB 3ZJ2A 1JNZA 5DQWA 4LMJA 1YD8G 4IREA 5AQSB 2I0MA 2KWIB 5LMNT 3C4ZA 1Y01A 4ILCA 4L5GA 1XWMA 3RRWA 3CX7B 1EZ3A 3EABA 2L3LA 4TV9E 2PBIA 1SUMB 3AE7A 3PUQA 4B3MT 3EHZA 2FBWA 3T1YT 1OWAA 4UELA 2UXCT 4HFCA 3AA7B 2K48A 4YJ2E 2Q9QD 3IEEA 4M1PA 2W0GA 5FY0A 3ANWB 2XAHB 1T72A 3FBZA 3FZKB 3PUZF 5IUXA 4LMKA 4JEUB 3UU4A 1VRBA 3AVSA 2WMNA 3ONXA 3PJAA 3AAEB 5C2TA 2X66A 5JRCB 5FXWA 4DBQA 4DV4T 2PTFA 1VCTA 2XM2A 3RYHE 4TWHA 4YLHA 5LHGB 3F2EA 5CFBA 3EI0A 2XQ8A 2ODVA 1LKXA 3KDSE 3FXEB 3ZT7A 4ILBA 4TNVA 3KBTA 3ZCIA 3RRCA 2CXFA 4PJLA 2R6GF 5JDQA 2FJBA 3PUXF 4YHJA 4B3TT 2D2SA 4L0RA 5JDNA 2UUBT 1KFYA 3Q5EA 3LSVA 2NWBA 2X9YA 2OA5A 2WSSV 4ZXLA 5AQLB 2MOZA 2V7IA 2EHOB 4PJNA 1KNPA 4A5XA 2W00A 5FL1A 3D0TA 3AE8A 2KINB 3K3OA 4OK0A 4U2YA 5LGUB 1YKHB 3LK42 4JI7T 2XQAA 4NUVA 4AXPA 3OJAA 3Q5XA 5LBMA 5J2TE 1HX8A 2KMFA 5HCJA 4HKAA 2WM9A 1WLXA 2X0HA 2N2NA 2D0TA 4IE0A 4EIWA 4H63H 5ABEA 2W4XA 1R8IA 1YW0A 4X1IE 2KZ7B 2WCAA 3C51A 4MALA 4X65T 2MBGA 3GN5B 2BG9C 2CWOA 4NXNT 4PJMA 2XAGB 2LSGA 3ZLIA 2IC9A 1LRZA 1YQ4A 2H89A 2VQFT 3FZFB 1O3XA 4OYKA 3LK2B 1ZV4X 3LBXB 2YU1A 3RI5A 3JAFA 4EYUA 4HWIB 1WFDA 2IHR1 3P4SA 2IC6A 1IBKT 2L8KA 4UV8B 4QXHB 4I43B 4DMWA 3C4WA 4O4LE 3SWHA 3ETVA 3P4QA 2J62A 1FMWA 3SRZA 3RPUA 2X67A 3HKDE 4O4IE 3AE1A 4JV5T 3K1SA 3QK6A 4MLKA 5BMVE 3N2KE 3N9NA 5ABFB 3N9LA 1WRDA 5LB7B 4EZHA 3OPCA 5JDGA 5LHIB 5DABA 2ZM8A 4N78D 3ZYMA 2HPJA 4HFBA 3H3AA 1IJ6A 5JVDE 2Q9QA 3VKHA 3ZC0A 5LG4A 2CBIA 3RC3A 3PUWF 4ILUA 1ZP0A 5FYMA 1AJ3A 3IF8B 3GWHA 2Z6EA 2BKOA 3RYIE 4AQYT 2WU2A 3AAIA 4O4HE 3UQ4A 2CCQA 4OYJA 3Q5WA 5AQHB 5L3GB 4DR2T 4I50E 5L47A 2AXDS 4BAYB 4U3CA 2VVSA 4TNWA 3SOLA 3AVRA 1M7KA 4HFIA 4AKHA 2E9XC 3K3QC 4CXWA 4EEBA 5JDLA 5JDMA 5F8PA 4NPPA 5L3DB 3I0QA 3IBPA 3MJXA 4HTEA 3RIUC 4LFCT 2BG9B 2NW8A 1D1BA 2C5JA 3UULA 2YKSA 1Z8UA 1M62A 1Z0PA 1QUUA 2KXPB 1OEDB 3C4XA 4QXCB 3UUXB 1YXRA 5DQVA 5TAOA 2K9AA 5FL0A 4ZHQE 5HXEA 5FKYA 3PV0F 3ZN1B 1LVKA 2YDRA 2CMRA 4AI6A 1U5PA 4AQFA 5JR9C 1MIYA 2H7OA 2NP9A 3FXDB 2BS4A 4PW8A 3FZHB 1QLBA 4IL4A 4DV2T 4KHZF 1WYCA 4JEHB 3U78A 2LRKA 2DWKA 4WZXA 3RLFF 5EZYE 4YSZA 4YTMA 3R6NA 4H9PC 2LT3A 3DP7A 3MK7C 4HN9A 1NAFA 3CQCB 4GIWA 2L9QA 3PUGA 1G73A 2XY8B 4JBWF 4ISSA 4FJOA 5JQGE 2ZLYA 3FHNA 4DR5T 1HG2A 4G63A 2W62A 1W0AA 1QSDA 2B1EA 1D1AA 3B57A 2LLYA 4CI3B 4IE7A 3KINB 4DIDB 2XQ7A 5AQIB 5GONE 4GK5E 2ACZA 4DV6T 1KNRA 3UU6A 4C91A 3PUVF 2P9BA 4DV0T 5FMNA 1H7CA 2CXDA 5C3JA 4YSXA 3UT5E 3K8PC 3UUBA 3C50A 3ESLA 3M65A 2XQ5A 1UUSA 2DL1A 3A8YC 3MXZA 5FNVE 2D5UA 2M6BA 2XAFB 4QH4A 2WDRA 4X1KE 3CQXC 3QUJA 3PTRB 4NIQA 1XMQT 3B5MA 1OEDE 5LP6E 3F31A 5LCYA 2LKHA 2UUCT 2VQET 1G8XA 1KNZA 4X64T 2LJLA 1ZEEA 2RPAA 5ETWA 2HH7A 5AQNB 4Z90A 3ZMVB 4U7IA 1KEYA 4PAGA 4BJNA 3AXJB 4YTNA 3NZQA 2LOSA 2FJAA 5C8YE 2NTXA 2EHOC 1SE7A 3VU7H 3VRBA 4YHHT 5AQJB 5J1GA 3C64A 4UVAB 2V5CA 4H63V 5JREA 5FXZA 2IMLA 4G2AA 4EYYR 3FZLB 2LRLA 5F3JA 1V9DA 1XDOA 4C90A 2WQYA 4ADZA 2XQ4A 2X9HA 1OXZA 2C0SA 1CHUA 3LK3B 5LGTB 3E0ZA 1N34T 3PUSA 5HXSA 1HF8A 4B3ST 2B76A 2E2AA 4U33A 1VOMA 2XM1A 5ABHA 1WYBA 4Q25A 3JCFA 2E8IA 3L39A 2PFVA 4MFRA 4DUZT 3P4RA 1XNQT 4KBMB 2E9XD 4DNDA 1Y64B 4XBFB 4A98A 3AB3B 4U72A 5EK2A 2Y6XA 4I55E 3MKDA 5LMUT 2DCFA 2WMOA 4ZI3C 3N2GE 3RQUA 2V6XA 2VK9A 3CVRA 3UUMA 1I94T 1W0BA 2DI4A 5KX5E 3A7MA 4NUUA 3SFEA 3RIFA 3A5XA 4QHOA 2DLRA 4KI0F 3HKBE 2ZM0A 3CX8B 2VKHA 2X0YA 4IHJE 4ASKA 3JADA 1HCIA 3MA9A 2V5DA 3ONLC 2V7KA 2K3WA 3UFEA 4IIJE 5JTGA 4IE6A 1FEWA 4JYAT 2QVAA 3AE3A 5LHHB 3AA0B 5LBQB 4IDNA 4HE8A 4QH1A 3AEAA 4IDZA 3UFGA 2M67A 2HPLA 2LSJA 3ZJ1A 3I0OA 4P0AA 3ZC1A 2BG9A 2LSYA 4CN6A 3EUHA 5CJ5A 3J7Yq 3EAMA 3L09A 3ZYKA 2GK9A 4O2BE 3U3IA 2QGSA 3KV4A 4KHPT 1N32T 3KBUA 1IBMT 3PDYA 4O8SA 4XAXB 4CI2B 3ZCJA 3RIAA 4O2AE 2XHEB 4UEMA 2FUPA 1D0ZA 1XNRT 4TN7B 3S4UA 3FZMB 3FBLA 3AE6A 4QKNA 4EXTA 4IE4A 3AA1B 3N9QA 2WAUA 5HWXA 4UV9B 3Q5DA 4UVCB 5L4EA 3ZPOA 4ERRA 1N36T 4AKLA 1OEDC 2DHRA 2OV9A 1IAPA 1NEKA 4GKKT 4JI6T 2I59A 2CWYA 2CM0A 3OKQA 4KUMB 2JIWA 2K5BB 3VKGA 2W2UA 2LSKA 4HFEA 4P0BA 4DR4T 4X1YE 2Y8DA 3EVYA 3BQLA 4CQIA 2D0UA 2W63A 5LOVE 4JI4T 3PJAJ 4KX6A 1MMNA 3P4PA 2JQHA 3L3PA 3TLTA 2IW5B 1ZKEA 4EEDA 2WU5A 3DJBA 3PUAA 5AQUB 2XUEA 3AA6B 2EHOD 4QX7B 5L2LA 4MHCA 2W61A 5AQVB 2V6YA 3RX6A 2RA1A 2WWVA 2ES0A 3NVOA 4IT4A 5AQOB 4Z8XA 3EDVA 3HKCE 2E9XA 4CXXA 3N9OA 4EAHA 5HEUA 4DV7T 4IDPA 2MAWA 2CBJA 4LF8T 4WYVA 3ZMSB 4HWHA 4ZI2C 2BS3A 4ILAA 1MIWA 4DR1T 4JI8T 3OBVE 4HFDA 5LNKA 4WNKA 1NWMX 2JMKA 4JLEA 4QH5A 5KDMC 2A9UA 2JQQA 2QYWA 4U2ZA 3DTOA 2RP4A 4HWCA 4B6XA 2X68A 3P4WA 2XQ6A 2WZHA 5JR9A 4V1Av 1FJGT 1W09A 4UF0A 1HR0T 2LEHA 3LJCA 4F6RC 1ZHCA 3ZEFB 4ZI3D 3BQKA 1YQ3A 4WBOA 3Q2MA 2V7LA 3NWIA 3TLSA 2VASA 3HL6A 4ZEYA 2JPFA 2X0LB 5JDHA 3CX6B 2YDSA 4U74A 4HEAA 3CKDA 5HEGA 2LHRA 2J47A 4WBNE 1BR4A 1HNXT 4J2CA 4CN4A 2VL8A 2BBHA 2WB5A 4L9IA 2A2FX 4H9OC 2IIUA 4JUYA 3UTKA 4DV5T 4UXNB 4ZS3A 2UU9T 5M4YA 1WR0A 3KFWX 1X9BA 3AE4A 3ANWA 2XASB 3NRYA 4PFOA 3T1HT 3PU8A 5ABGA 4PNIA 3G06A 2XQYA 1JNRA 2XTLA 2AE9A 1S94A 2VWAA 4X5TA 5DJQC 2ODUA 3KV5A 4HWFA 5L3CB 2CHOA 5JRCA 5HEJA 2V1DB 3QOFA 2H88A 2LSIA 3WI3A 4PFPA 3F57A 5L3BB 4ZOLE 4IGUA 3E08A 4YXDA 3IHRA 5EK4A 2XJ7A 3UUNA 3CWZB 3AE2A 5JH7E 2YDQA 4I0UA 1HX1B 4AKRB 3CMLA 2BBJA 4EB6E 1FIOA 4LMLA 2LHNA 3Q9DA 2NTYA 2K24A 2LE8A 4LF4T 4AISA 2CA5A 2KNDA 2CLYB 2VKDA 3V5UA 5IHYA 2EHOA 2V7JA 4DV3T 1US7B 4JI0T 1MNEA 2WZIA 3PE0A 3N9PA 3W15B 3CIRA 2XQ3A 3SS1A 4DR7T 1UCUA 3BK9A 5H6RB 4JI2T 2WP9A 2HN2A 2MPKA 2Q9QB 3AEDA 2X9WA 4FI5A 3ZKRA 5E0OA 3UU8A 5LJMA 3RYFE 2VB6A 3BQIA 4LFAT 2H7VC 5HEHA 5J0ZA 5AQGB 2BKNA 3RKGA 2XAJB 4JI1T 3GN5A 5LJNA 3J9X1 5L4HA 2BZBA 2SPCA 3PU3A 1UK5A 2ZMAA 2HN1A 4ZZCA 4TWFA 2CXLA 5KXJA 4HWDA 2I6HA 1U4QA 1B7TA 2XPKA 4U31A 3ZT6A 2IAKA 3NKZA 5BR8T 1HFAA 3LBXA 4GOUA 4LF5T 4HGAA 4K0UA 4PK4A 3ZN0B 2X51A 4ZI7E 2J4GA 2V26A 2WWUA 1YKEB 1MIVA 4ZI2D 3N9MA 5AQMB 5FXXA 2CRBA 3O1IA 4DUYT 5HXCA 4GK0E 4JI5T 5HEOA 2VVNA 3AEGA 2YU2A 5CA1E 4CI1B 3RQWA 2LM2A 4NXMT 3O4XE 4COFA 5ABFA 2ACXA 1XMOT 4H9SE 3WAKA 3NZPA 1KF6A 4UR9A 3HKEE 4UIGA 4TX5A 3T8OA 1D0XA 3TKLB 2CEAA 3RGLA 3WAJA 4DR3T 1GQEA 1BR0A 2BKPA 2V8SV 1XDPA 3KV9A 5AQFB 2FJEA 5FVKA 1WR6A 2KWHA 3OTOT 2JRKA 1KK7A 2UXXB 4TUYE 2UXDT 5CB4E 2W66A 4TV8E 1UX5A 3P50A 2KLQA 5EK3A 1I6ZA 5AFUL 2NW7A 3TLUA 4HFVA 2VKOA 1HNWT 4ANJA 3O1JA 4CXYA 3N5LA 3NRXA 3RHWA 2WDQA 3RF1A 4YT0A 2BS2A 3KV6A 2BDEA 2JQ9A 2NW9A 3E22E 3HA4A 4DBRA 4OX9T 1OEDA 1E2AA 2C5KT 2XQ9A 2Y48B 2D9DA 4KP3C 1VCSA 1J5ET 3I9WA 4YY3T 3TLVA 4X66T 3EDUA 4WW0A 2X9XA 2YEVC 3QB5K 2PG8A 3IA3A 2NR4A 1HNZT 4LFBT 5CGMA 2N1GA 4P1NA 2E5VA 1WCRA 3VHLA 1D0YA 1L0VA 3CQGB 2BVMA 5L3EB 1IBLT 2YINA 4H9RC 2QA7A 5FVLA 4TWDA 5LG3A 4K0KT 3ZT5A 3JC6C 1BR1A 3X1DA 1N33T 3OVUA 4F8HA 5HYAA 5IYZE 4DR6T 1MMDA 3V5SA 1UX4A 2WBLA 2A72A 3UU3A 2E5LT 1X79A 5FP3A 5J2UE 5LXTE 1FMVA 3O9XA 2UXBT 2YN6A 2F4VT 3VRAA 1UGOA 5FY7A 1MMAA 1T8BA 1UURA 1HG5A 4PK6A 5FY1A 2WDVA 4E7SA 4UVBB 3GMIA 1DU2A 4DV1T 5AQTB 3SFDA 3ZMTB 2CPTA 4CN1A 5JDFA 5CA0E 4U7YA 3O1HA 4ZZBA 3RIUA 1IZNB 3RH3A 2KSRA 5FXVA 3AEFA 2UXNB 1HTJF 3UU5A 3CK6A 3JAEA 4CZZB 2N9DA 5AQPB 2IUBA 3AXJA 3GA8A 4KMCA 2J1DG 2LM9A 3AEBA 3ZMZB 1W9RA 4H9QC 3I9YA 3ZMUB 4GYRA 2CLYC 3R84B 3MZKB 5F5WA 1T7SA
chains in the Genus database with same CATH topology
2PFVA 4H63H 1FIOA 2LHNA 4MFRA 1YW0A 4X1IE 2KZ7B 2E9XD 3FB2A 1Y64B 3Q9DA 4KBMB 4DNDA 2NTYA 3C51A 4MALA 3ZLIA 4XBFB 2K24A 3H37A 3I1AA 2MBGA 3GN5B 2CWOA 3HI2A 2LE8A 4PJMA 3AB3B 4U72A 5EK2A 2CA5A 2Y6XA 2XAGB 4I55E 4XZCA 3MKDA 2JMHA 2KNDA 2LSGA 2CLYB 2VKDA 2IC9A 1LRZA 2DCFA 2WMOA 3LG7A 4ZI3C 3V5UA 3N2GE 3NBXX 5IHYA 2EHOA 2V7JA 2VK9A 3CVRA 1US7B 1O3XA 2Q9QC 3UUMA 2DI4A 5KX5E 3QC9A 4OYKA 1MNEA 3LK2B 1ZV4X 3PE0A 4NUUA 1HS7A 3N9PA 3W15B 3A5XA 3SS1A 3LBXB 2YU1A 3OYXA 1UCUA 4QHOA 4EYUA 3BK9A 3HR0A 5H6RB 2DLRA 3HKBE 2ZM0A 3CX8B 4AQGA 2VKHA 3N2OA 4YFSA 3RC8A 4IHJE 4ASKA 4I4TE 2Q9QB 1HCIA 2IC6A 2X9WA 2L8KA 3MA9A 4FI5A 5E0OA 4QXBB 3AAAB 5LJMA 3RYFE 1BR2A 4UV8B 2VB6A 3BQIA 2V7KA 3UFEA 2MTQA 4QXHB 4I43B 2H7VC 4IIJE 3C4WA 4O4LE 3SWHA 4DMWA 4PJJA 4PK5A 4IE6A 1FEWA 3ETVA 2V7MA 5KMGP 1FMWA 2XAJB 3SRZA 3RPUA 2X67A 3GN5A 3P7IA 3HKDE 5LHHB 3P8CD 5LJNA 3J9X1 3LFMA 2JJ9A 4O4IE 2BZBA 2SPCA 1MMGA 4GYSA 3AA0B 3PU3A 2ZMAA 4TZ4C 5LBQB 3QK6A 3RKOA 4HE8A 2CXLA 4MLKA 5BMVE 3N2KE 1D1CA 3N9NA 4IDZA 1U4QA 3N9LA 1WRDA 1B7TA 2M67A 2HPLA 2LSJA 3ZJ1A 4EZHA 5JDGA 5LHIB 1SHZC 2IAKA 3I0OA 4P0AA 5DABA 3ZC1A 1HFAA 3LBXA 4GOUA 4HGAA 2ZM8A 4K0UA 4PK4A 2LSYA 3ZN0B 4MBQA 2X51A 3EUHA 4IE5A 4BA9A 4N78D 3ZYMA 2HPJA 4ZI7E 2V26A 2WWUA 1S35A 3H3AA 3J7Yq 1IJ6A 1YKEB 5JVDE 1MIVA 2Q9QA 5HXRA 3VKHA 3ZC0A 3L09A 5LG4A 5H6QB 4ZI2D 3N9MA 3ZYKA 4AKGA 3RC3A 4ILUA 5FXXA 3O1IA 5FYMA 5HXCA 2GK9A 4O2BE 4GK0E 3U3IA 3IF8B 5LYJE 2QGSA 1AJ3A 3GWHA 4AQFC 4ISTA 2Z6EA 3KV4A 3RYIE 3KBUA 3PDYA 4O8SA 4X20E 2H3RA 3AAIA 4XAXB 4O4HE 2YU2A 4OHFA 3ZCJA 4CI2B 5LA6E 5L3FB 5LGNB 2CCQA 4EOZB 4O2AE 5CA1E 4O4JE 4OYJA 3Q5WA 5ADXL 4CI1B 3RYCE 2XHEB 5L3GB 2ZM2A 4I50E 1SA0E 3OYZA 4UEMA 1D0ZA 4TN7B 3S4UA 4BAYB 3O4XE 4ZS2A 2ACXA 3FBLA 2KT9A 4H9SE 4QKNA 3WAKA 4EXTA 4E7ZA 3NZPA 5A1LA 3HKEE 4UIGA 4TX5A 3SOLA 4IE4A 2C5IT 3AA1B 3AVRA 3N9QA 4H9NC 4AKHA 2WAUA 1D0XA 3T8OA 3TKLB 2CEAA 2E9XC 5HWXA 3K3QC 3WAJA 4UV9B 1T98A 3KVAA 4UVCB 4CXWA 3ZPOA 4ERRA 1BR0A 4AKLA 5JDLA 5JDMA 2DHRA 5F8PA 3PURA 5L3DB 1IAPA 4P09A 2NOXA 2I59A 3I0QA 4QX8B 2YK0A 2CWYA 3IBPA 2DWGA 3MJXA 3KV9A 4HTEA 4DMVA 3JC6D 4AKIA 3CPZA 2CM0A 2NW8A 1E1HB 1D1BA 2C5JA 3OKQA 3UULA 4KUMB 2K5BB 1WR6A 3VKGA 2KWHA 2E9XB 1Z0PA 2JRKA 1KK7A 2UXXB 4TUYE 2LSKA 4OFZA 4P0BA 1QUUA 2KXPB 2MYSA 1MNDA 5CB4E 4YJ3E 3C4XA 4X1YE 1IJ5A 2Y8DA 4QXCB 3UUXB 3EVYA 2CE7A 2LOPA 3BQLA 5DQVA 5TAOA 4CQIA 2K9AA 4TV8E 1UX5A 4ZHQE 2D0UA 2W63A 2A3DA 5HXEA 2KLQA 5LOVE 4DVDA 5EK3A 1MMNA 3C98B 3ZN1B 1LVKA 5AFUL 2CMRA 4AI6A 3L3PA 5HWYA 2DNXA 2NW7A 1ZKEA 2IW5B 1U5PA 4HFVA 5HXHA 4AQFA 5JR9C 2VKOA 1MIYA 2H7OA 2NP9A 3FXDB 3DJBA 3PUAA 4PW8A 3O1JA 4ANJA 2XUEA 1LVFA 4CXYA 3N5LA 3NRXA 3ETUA 3AA6B 3K3NA 1WYCA 4JEHB 3U78A 2EHOD 3B13A 2DWKA 4QX7B 5EZYE 5L2LA 4MHCA 4QWNB 3R6NA 4H9PC 2LT3A 2PJQA 3DP7A 2VKJA 3MK7C 4HN9A 1NAFA 3CQCB 2W61A 3RX6A 2RA1A 3KV6A 4BJMA 2G0UA 2ES0A 4GIWA 2L9QA 3ZYLA 5JR9B 3MACA 2BDEA 5HAXA 3KVBA 3PUGA 4Z8XA 4A56A 4DO0A 2NW9A 3EDVA 3HKCE 2E9XA 3E22E 1G73A 3HA4A 4UF0B 4DBRA 4ISSA 4CXXA 3N9OA 4FJOA 4EAHA 5JQGE 2BVLA 2ZLYA 3FHNA 4EZ4A 1HG2A 4G63A 2C5KT 1CUNA 2W62A 2Y48B 1QSDA 2XAQB 3ZJ2A 2B1EA 1D1AA 3B57A 4KP3C 4CI3B 4IE7A 5DQWA 3ZMSB 3KINB 4ZI2C 1YD8G 1MIWA 3I9WA 3OBVE 5GONE 4GK5E 5LNKA 4WNKA 3EDUA 2KWIB 1NWMX 2JMKA 4JLEA 4WW0A 2X9XA 5KDMC 3C4ZA 2JQQA 4C91A 2YEVC 2P9BA 2PG8A 5FMNA 3DTOA 4L5GA 2RP4A 3RRWA 1H7CA 2CXDA 3CX7B 1EZ3A 4B6XA 3UT5E 2X68A 3K8PC 2N1GA 3C50A 3ESLA 2L3LA 4TV9E 2PBIA 3M65A 3VHLA 1D0YA 5JR9A 3PUQA 4V1Av 3CQGB 2BVMA 1OWAA 4UELA 4UF0A 5L3EB 2LEHA 3AA7B 3LJCA 4F6RC 1ZHCA 3ZEFB 2K48A 4ZI3D 3BQKA 4WBOA 3Q2MA 4YJ2E 3MXZA 2V7LA 2Q9QD 3IEEA 2YINA 4H9RC 2QA7A 4M1PA 2W0GA 5FY0A 2VASA 5FNVE 2D5UA 3HL6A 3ANWB 2JPFA 2XAHB 3FBZA 2X0LB 5JDHA 3CX6B 2XAFB 4JEUB 3JC6C 4U74A 4HEAA 1BR1A 4X1KE 3CKDA 2LHRA 4WBNE 3CQXC 1BR4A 3QUJA 5HYAA 3PTRB 5IYZE 1VRBA 1MMDA 4J2CA 3AVSA 5LP6E 2WMNA 3ONXA 3F31A 2VL8A 3AAEB 3V5SA 2X66A 5LCYA 1UX4A 2WBLA 5JRCB 1G8XA 5FXWA 1KNZA 4L9IA 4DBQA 2LJLA 2A72A 1ZEEA 2A2FX 4H9OC 3RYHE 4JUYA 5ETWA 3UTKA 1X79A 4YLHA 4UXNB 2HH7A 5FP3A 5LHGB 3F2EA 5J2UE 5LXTE 3ZMVB 4ZS3A 1FMVA 2ODVA 4PAGA 4BJNA 1LKXA 5M4YA 3O9XA 3KDSE 3FXEB 3KFWX 5FY7A 1MMAA 3NZQA 2LOSA 3KBTA 1HG5A 4PK6A 5C8YE 2NTXA 3ZCIA 5FY1A 3RRCA 2CXFA 2EHOC 4PJLA 4E7SA 5JDQA 4YHJA 3ANWA 4UVBB 2D2SA 3GMIA 3VU7H 2XASB 3NRYA 4PFOA 3PU8A 3ZMTB 5J1GA 4L0RA 5JDNA 4PNIA 3C64A 4UVAB 2XQYA 2XTLA 1S94A 2VWAA 2NWBA 4H63V 5JREA 5DJQC 2X9YA 5JDFA 2OA5A 5CA0E 5FXZA 2ODUA 2WSSV 3O1HA 4G2AA 2MOZA 3KV5A 4EYYR 2V7IA 5L3CB 2EHOB 4PJNA 1IZNB 3RH3A 5JRCA 2V1DB 5FXVA 2LSIA 3WI3A 2UXNB 2W00A 4PFPA 5F3JA 1HTJF 1V9DA 3D0TA 4C90A 3F57A 2KINB 5L3BB 3K3OA 4ADZA 4OK0A 4CZZB 2X9HA 5LGUB 1OXZA 1YKHB 2C0SA 2N9DA 4ZOLE 4IGUA 3E08A 3LK3B 3LK42 3E0ZA 5LGTB 3PUSA 3IHRA 1HF8A 5HXSA 4NUVA 5EK4A 4AXPA 3OJAA 3Q5XA 5LBMA 3GA8A 4KMCA 5J2TE 3UUNA 1VOMA 2J1DG 1HX8A 2KMFA 4HKAA 2LM9A 2WM9A 1WLXA 3CWZB 3ZMZB 4H9QC 3I9YA 3ZMUB 5JH7E 4GYRA 2CLYC 2N2NA 2D0TA 1WYBA 3MZKB 3R84B 4AKRB 2E8IA 3CMLA 4IE0A 4EB6E 4EIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG4 A;  3LG7 A;  1S94 A;  1FEW A;  2XHE B;  4TX5 A;  1EZ3 A;  1FIO A;  3C98 B;  4JEU B;  2DNX A;  4JEH B;  1BR0 A;  5M4Y A;  1G73 A;  1HS7 A; 
#chains in the Genus database with same CATH topology
 3ZST A;  3FB2 A;  4IDQ A;  2LKG A;  3L8R A;  3H37 A;  3I1A A;  3HI2 A;  4XZC A;  2JMH A;  2WY2 A;  3LG7 A;  2XSB A;  3NBX X;  2CHN A;  2Q9Q C;  2W67 A;  3ZSS A;  4X62 T;  2YOE A;  3QC9 A;  1HS7 A;  4LF7 T;  1J1J A;  3OYX A;  3HR0 A;  3ABV A;  4AQG A;  3H3M A;  4YTP A;  4A97 A;  3N2O A;  4YFS A;  4Z91 A;  3RC8 A;  4I4T E;  2M6I A;  1J5W A;  2JQK A;  3PUY F;  4QXB B;  3AAA B;  1BR2 A;  2MTQ A;  2HHH T;  4PJJ A;  4PK5 A;  5AQQ B;  3VR8 A;  2V7M A;  4YSY A;  5KMG P;  3P7I A;  3P8C D;  3LFM A;  2JJ9 A;  1MMG A;  4GYS A;  4TZ4 C;  4IL9 A;  3RKO A;  4HFH A;  1D1C A;  2VUR A;  3M3Z B;  1SHZ C;  1XZY A;  4IDO A;  4MBQ A;  2XSA A;  4IE5 A;  4BA9 A;  1ZOY A;  1S35 A;  1E7P A;  4JI3 T;  5HXR A;  5H6Q B;  4AKG A;  2IDO B;  3VR9 A;  5LYJ E;  4AQF C;  4IST A;  4X20 E;  2H3R A;  2VL0 A;  5L3F B;  4OHF A;  5LGN B;  5LA6 E;  3UQ7 A;  4EOZ B;  4O4J E;  5ADX L;  2UUA T;  3RYC E;  4AIU A;  2ZM2 A;  2OLT A;  1SA0 E;  3OYZ A;  4ZS2 A;  2KT9 A;  4E7Z A;  5A1L A;  2C5I T;  4H9N C;  4GKJ T;  2XZE A;  1T98 A;  3KVA A;  3PUR A;  3AEE A;  4P09 A;  2NOX A;  4QX8 B;  2YK0 A;  4LF6 T;  2DWG A;  4DMV A;  2WS3 A;  2V6Y B;  3LDQ B;  3JC6 D;  4AKI A;  3CPZ A;  3ONJ A;  1E1H B;  3QNU A;  1NEN A;  2E9X B;  4OFZ A;  2BG9 E;  2MYS A;  3AEC A;  1MND A;  4YJ3 E;  3AE9 A;  1IJ5 A;  5HCM A;  2CE7 A;  2LOP A;  3AE5 A;  2A3D A;  3QB5 A;  3TLW A;  4DVD A;  2ZM6 T;  4B3R T;  3C98 B;  5HWY A;  2DNX A;  5HXH A;  5AQK B;  2FJD A;  1LVF A;  3ETU A;  3K3N A;  4LF9 T;  3B13 A;  4QWN B;  5AQR B;  2PJQ A;  2VKJ A;  5IWA T;  4BJM A;  2G0U A;  3ZYL A;  5JR9 B;  3MAC A;  5HAX A;  3KVB A;  4A56 A;  4DO0 A;  4EGW A;  4UF0 B;  2QRX A;  2BVL A;  4EZ4 A;  4EV6 A;  1CUN A;  2XAQ B;  3ZJ2 A;  1JNZ A;  5DQW A;  4LMJ A;  1YD8 G;  4IRE A;  5AQS B;  2I0M A;  2KWI B;  5LMN T;  3C4Z A;  1Y01 A;  4ILC A;  4L5G A;  1XWM A;  3RRW A;  3CX7 B;  1EZ3 A;  3EAB A;  2L3L A;  4TV9 E;  2PBI A;  1SUM B;  3AE7 A;  3PUQ A;  4B3M T;  3EHZ A;  2FBW A;  3T1Y T;  1OWA A;  4UEL A;  2UXC T;  4HFC A;  3AA7 B;  2K48 A;  4YJ2 E;  2Q9Q D;  3IEE A;  4M1P A;  2W0G A;  5FY0 A;  3ANW B;  2XAH B;  1T72 A;  3FBZ A;  3FZK B;  3PUZ F;  5IUX A;  4LMK A;  4JEU B;  3UU4 A;  1VRB A;  3AVS A;  2WMN A;  3ONX A;  3PJA A;  3AAE B;  5C2T A;  2X66 A;  5JRC B;  5FXW A;  4DBQ A;  4DV4 T;  2PTF A;  1VCT A;  2XM2 A;  3RYH E;  4TWH A;  4YLH A;  5LHG B;  3F2E A;  5CFB A;  3EI0 A;  2XQ8 A;  2ODV A;  1LKX A;  3KDS E;  3FXE B;  3ZT7 A;  4ILB A;  4TNV A;  3KBT A;  3ZCI A;  3RRC A;  2CXF A;  4PJL A;  2R6G F;  5JDQ A;  2FJB A;  3PUX F;  4YHJ A;  4B3T T;  2D2S A;  4L0R A;  5JDN A;  2UUB T;  1KFY A;  3Q5E A;  3LSV A;  2NWB A;  2X9Y A;  2OA5 A;  2WSS V;  4ZXL A;  5AQL B;  2MOZ A;  2V7I A;  2EHO B;  4PJN A;  1KNP A;  4A5X A;  2W00 A;  5FL1 A;  3D0T A;  3AE8 A;  2KIN B;  3K3O A;  4OK0 A;  4U2Y A;  5LGU B;  1YKH B;  3LK4 2;  4JI7 T;  2XQA A;  4NUV A;  4AXP A;  3OJA A;  3Q5X A;  5LBM A;  5J2T E;  1HX8 A;  2KMF A;  5HCJ A;  4HKA A;  2WM9 A;  1WLX A;  2X0H A;  2N2N A;  2D0T A;  4IE0 A;  4EIW A;  4H63 H;  5ABE A;  2W4X A;  1R8I A;  1YW0 A;  4X1I E;  2KZ7 B;  2WCA A;  3C51 A;  4MAL A;  4X65 T;  2MBG A;  3GN5 B;  2BG9 C;  2CWO A;  4NXN T;  4PJM A;  2XAG B;  2LSG A;  3ZLI A;  2IC9 A;  1LRZ A;  1YQ4 A;  2H89 A;  2VQF T;  3FZF B;  1O3X A;  4OYK A;  3LK2 B;  1ZV4 X;  3LBX B;  2YU1 A;  3RI5 A;  3JAF A;  4EYU A;  4HWI B;  1WFD A;  2IHR 1;  3P4S A;  2IC6 A;  1IBK T;  2L8K A;  4UV8 B;  4QXH B;  4I43 B;  4DMW A;  3C4W A;  4O4L E;  3SWH A;  3ETV A;  3P4Q A;  2J62 A;  1FMW A;  3SRZ A;  3RPU A;  2X67 A;  3HKD E;  4O4I E;  3AE1 A;  4JV5 T;  3K1S A;  3QK6 A;  4MLK A;  5BMV E;  3N2K E;  3N9N A;  5ABF B;  3N9L A;  1WRD A;  5LB7 B;  4EZH A;  3OPC A;  5JDG A;  5LHI B;  5DAB A;  2ZM8 A;  4N78 D;  3ZYM A;  2HPJ A;  4HFB A;  3H3A A;  1IJ6 A;  5JVD E;  2Q9Q A;  3VKH A;  3ZC0 A;  5LG4 A;  2CBI A;  3RC3 A;  3PUW F;  4ILU A;  1ZP0 A;  5FYM A;  1AJ3 A;  3IF8 B;  3GWH A;  2Z6E A;  2BKO A;  3RYI E;  4AQY T;  2WU2 A;  3AAI A;  4O4H E;  3UQ4 A;  2CCQ A;  4OYJ A;  3Q5W A;  5AQH B;  5L3G B;  4DR2 T;  4I50 E;  5L47 A;  2AXD S;  4BAY B;  4U3C A;  2VVS A;  4TNW A;  3SOL A;  3AVR A;  1M7K A;  4HFI A;  4AKH A;  2E9X C;  3K3Q C;  4CXW A;  4EEB A;  5JDL A;  5JDM A;  5F8P A;  4NPP A;  5L3D B;  3I0Q A;  3IBP A;  3MJX A;  4HTE A;  3RIU C;  4LFC T;  2BG9 B;  2NW8 A;  1D1B A;  2C5J A;  3UUL A;  2YKS A;  1Z8U A;  1M62 A;  1Z0P A;  1QUU A;  2KXP B;  1OED B;  3C4X A;  4QXC B;  3UUX B;  1YXR A;  5DQV A;  5TAO A;  2K9A A;  5FL0 A;  4ZHQ E;  5HXE A;  5FKY A;  3PV0 F;  3ZN1 B;  1LVK A;  2YDR A;  2CMR A;  4AI6 A;  1U5P A;  4AQF A;  5JR9 C;  1MIY A;  2H7O A;  2NP9 A;  3FXD B;  2BS4 A;  4PW8 A;  3FZH B;  1QLB A;  4IL4 A;  4DV2 T;  4KHZ F;  1WYC A;  4JEH B;  3U78 A;  2LRK A;  2DWK A;  4WZX A;  3RLF F;  5EZY E;  4YSZ A;  4YTM A;  3R6N A;  4H9P C;  2LT3 A;  3DP7 A;  3MK7 C;  4HN9 A;  1NAF A;  3CQC B;  4GIW A;  2L9Q A;  3PUG A;  1G73 A;  2XY8 B;  4JBW F;  4ISS A;  4FJO A;  5JQG E;  2ZLY A;  3FHN A;  4DR5 T;  1HG2 A;  4G63 A;  2W62 A;  1W0A A;  1QSD A;  2B1E A;  1D1A A;  3B57 A;  2LLY A;  4CI3 B;  4IE7 A;  3KIN B;  4DID B;  2XQ7 A;  5AQI B;  5GON E;  4GK5 E;  2ACZ A;  4DV6 T;  1KNR A;  3UU6 A;  4C91 A;  3PUV F;  2P9B A;  4DV0 T;  5FMN A;  1H7C A;  2CXD A;  5C3J A;  4YSX A;  3UT5 E;  3K8P C;  3UUB A;  3C50 A;  3ESL A;  3M65 A;  2XQ5 A;  1UUS A;  2DL1 A;  3A8Y C;  3MXZ A;  5FNV E;  2D5U A;  2M6B A;  2XAF B;  4QH4 A;  2WDR A;  4X1K E;  3CQX C;  3QUJ A;  3PTR B;  4NIQ A;  1XMQ T;  3B5M A;  1OED E;  5LP6 E;  3F31 A;  5LCY A;  2LKH A;  2UUC T;  2VQE T;  1G8X A;  1KNZ A;  4X64 T;  2LJL A;  1ZEE A;  2RPA A;  5ETW A;  2HH7 A;  5AQN B;  4Z90 A;  3ZMV B;  4U7I A;  1KEY A;  4PAG A;  4BJN A;  3AXJ B;  4YTN A;  3NZQ A;  2LOS A;  2FJA A;  5C8Y E;  2NTX A;  2EHO C;  1SE7 A;  3VU7 H;  3VRB A;  4YHH T;  5AQJ B;  5J1G A;  3C64 A;  4UVA B;  2V5C A;  4H63 V;  5JRE A;  5FXZ A;  2IML A;  4G2A A;  4EYY R;  3FZL B;  2LRL A;  5F3J A;  1V9D A;  1XDO A;  4C90 A;  2WQY A;  4ADZ A;  2XQ4 A;  2X9H A;  1OXZ A;  2C0S A;  1CHU A;  3LK3 B;  5LGT B;  3E0Z A;  1N34 T;  3PUS A;  5HXS A;  1HF8 A;  4B3S T;  2B76 A;  2E2A A;  4U33 A;  1VOM A;  2XM1 A;  5ABH A;  1WYB A;  4Q25 A;  3JCF A;  2E8I A;  3L39 A;  2PFV A;  4MFR A;  4DUZ T;  3P4R A;  1XNQ T;  4KBM B;  2E9X D;  4DND A;  1Y64 B;  4XBF B;  4A98 A;  3AB3 B;  4U72 A;  5EK2 A;  2Y6X A;  4I55 E;  3MKD A;  5LMU T;  2DCF A;  2WMO A;  4ZI3 C;  3N2G E;  3RQU A;  2V6X A;  2VK9 A;  3CVR A;  3UUM A;  1I94 T;  1W0B A;  2DI4 A;  5KX5 E;  3A7M A;  4NUU A;  3SFE A;  3RIF A;  3A5X A;  4QHO A;  2DLR A;  4KI0 F;  3HKB E;  2ZM0 A;  3CX8 B;  2VKH A;  2X0Y A;  4IHJ E;  4ASK A;  3JAD A;  1HCI A;  3MA9 A;  2V5D A;  3ONL C;  2V7K A;  2K3W A;  3UFE A;  4IIJ E;  5JTG A;  4IE6 A;  1FEW A;  4JYA T;  2QVA A;  3AE3 A;  5LHH B;  3AA0 B;  5LBQ B;  4IDN A;  4HE8 A;  4QH1 A;  3AEA A;  4IDZ A;  3UFG A;  2M67 A;  2HPL A;  2LSJ A;  3ZJ1 A;  3I0O A;  4P0A A;  3ZC1 A;  2BG9 A;  2LSY A;  4CN6 A;  3EUH A;  5CJ5 A;  3J7Y q;  3EAM A;  3L09 A;  3ZYK A;  2GK9 A;  4O2B E;  3U3I A;  2QGS A;  3KV4 A;  4KHP T;  1N32 T;  3KBU A;  1IBM T;  3PDY A;  4O8S A;  4XAX B;  4CI2 B;  3ZCJ A;  3RIA A;  4O2A E;  2XHE B;  4UEM A;  2FUP A;  1D0Z A;  1XNR T;  4TN7 B;  3S4U A;  3FZM B;  3FBL A;  3AE6 A;  4QKN A;  4EXT A;  4IE4 A;  3AA1 B;  3N9Q A;  2WAU A;  5HWX A;  4UV9 B;  3Q5D A;  4UVC B;  5L4E A;  3ZPO A;  4ERR A;  1N36 T;  4AKL A;  1OED C;  2DHR A;  2OV9 A;  1IAP A;  1NEK A;  4GKK T;  4JI6 T;  2I59 A;  2CWY A;  2CM0 A;  3OKQ A;  4KUM B;  2JIW A;  2K5B B;  3VKG A;  2W2U A;  2LSK A;  4HFE A;  4P0B A;  4DR4 T;  4X1Y E;  2Y8D A;  3EVY A;  3BQL A;  4CQI A;  2D0U A;  2W63 A;  5LOV E;  4JI4 T;  3PJA J;  4KX6 A;  1MMN A;  3P4P A;  2JQH A;  3L3P A;  3TLT A;  2IW5 B;  1ZKE A;  4EED A;  2WU5 A;  3DJB A;  3PUA A;  5AQU B;  2XUE A;  3AA6 B;  2EHO D;  4QX7 B;  5L2L A;  4MHC A;  2W61 A;  5AQV B;  2V6Y A;  3RX6 A;  2RA1 A;  2WWV A;  2ES0 A;  3NVO A;  4IT4 A;  5AQO B;  4Z8X A;  3EDV A;  3HKC E;  2E9X A;  4CXX A;  3N9O A;  4EAH A;  5HEU A;  4DV7 T;  4IDP A;  2MAW A;  2CBJ A;  4LF8 T;  4WYV A;  3ZMS B;  4HWH A;  4ZI2 C;  2BS3 A;  4ILA A;  1MIW A;  4DR1 T;  4JI8 T;  3OBV E;  4HFD A;  5LNK A;  4WNK A;  1NWM X;  2JMK A;  4JLE A;  4QH5 A;  5KDM C;  2A9U A;  2JQQ A;  2QYW A;  4U2Z A;  3DTO A;  2RP4 A;  4HWC A;  4B6X A;  2X68 A;  3P4W A;  2XQ6 A;  2WZH A;  5JR9 A;  4V1A v;  1FJG T;  1W09 A;  4UF0 A;  1HR0 T;  2LEH A;  3LJC A;  4F6R C;  1ZHC A;  3ZEF B;  4ZI3 D;  3BQK A;  1YQ3 A;  4WBO A;  3Q2M A;  2V7L A;  3NWI A;  3TLS A;  2VAS A;  3HL6 A;  4ZEY A;  2JPF A;  2X0L B;  5JDH A;  3CX6 B;  2YDS A;  4U74 A;  4HEA A;  3CKD A;  5HEG A;  2LHR A;  2J47 A;  4WBN E;  1BR4 A;  1HNX T;  4J2C A;  4CN4 A;  2VL8 A;  2BBH A;  2WB5 A;  4L9I A;  2A2F X;  4H9O C;  2IIU A;  4JUY A;  3UTK A;  4DV5 T;  4UXN B;  4ZS3 A;  2UU9 T;  5M4Y A;  1WR0 A;  3KFW X;  1X9B A;  3AE4 A;  3ANW A;  2XAS B;  3NRY A;  4PFO A;  3T1H T;  3PU8 A;  5ABG A;  4PNI A;  3G06 A;  2XQY A;  1JNR A;  2XTL A;  2AE9 A;  1S94 A;  2VWA A;  4X5T A;  5DJQ C;  2ODU A;  3KV5 A;  4HWF A;  5L3C B;  2CHO A;  5JRC A;  5HEJ A;  2V1D B;  3QOF A;  2H88 A;  2LSI A;  3WI3 A;  4PFP A;  3F57 A;  5L3B B;  4ZOL E;  4IGU A;  3E08 A;  4YXD A;  3IHR A;  5EK4 A;  2XJ7 A;  3UUN A;  3CWZ B;  3AE2 A;  5JH7 E;  2YDQ A;  4I0U A;  1HX1 B;  4AKR B;  3CML A;  2BBJ A;  4EB6 E;  1FIO A;  4LML A;  2LHN A;  3Q9D A;  2NTY A;  2K24 A;  2LE8 A;  4LF4 T;  4AIS A;  2CA5 A;  2KND A;  2CLY B;  2VKD A;  3V5U A;  5IHY A;  2EHO A;  2V7J A;  4DV3 T;  1US7 B;  4JI0 T;  1MNE A;  2WZI A;  3PE0 A;  3N9P A;  3W15 B;  3CIR A;  2XQ3 A;  3SS1 A;  4DR7 T;  1UCU A;  3BK9 A;  5H6R B;  4JI2 T;  2WP9 A;  2HN2 A;  2MPK A;  2Q9Q B;  3AED A;  2X9W A;  4FI5 A;  3ZKR A;  5E0O A;  3UU8 A;  5LJM A;  3RYF E;  2VB6 A;  3BQI A;  4LFA T;  2H7V C;  5HEH A;  5J0Z A;  5AQG B;  2BKN A;  3RKG A;  2XAJ B;  4JI1 T;  3GN5 A;  5LJN A;  3J9X 1;  5L4H A;  2BZB A;  2SPC A;  3PU3 A;  1UK5 A;  2ZMA A;  2HN1 A;  4ZZC A;  4TWF A;  2CXL A;  5KXJ A;  4HWD A;  2I6H A;  1U4Q A;  1B7T A;  2XPK A;  4U31 A;  3ZT6 A;  2IAK A;  3NKZ A;  5BR8 T;  1HFA A;  3LBX A;  4GOU A;  4LF5 T;  4HGA A;  4K0U A;  4PK4 A;  3ZN0 B;  2X51 A;  4ZI7 E;  2J4G A;  2V26 A;  2WWU A;  1YKE B;  1MIV A;  4ZI2 D;  3N9M A;  5AQM B;  5FXX A;  2CRB A;  3O1I A;  4DUY T;  5HXC A;  4GK0 E;  4JI5 T;  5HEO A;  2VVN A;  3AEG A;  2YU2 A;  5CA1 E;  4CI1 B;  3RQW A;  2LM2 A;  4NXM T;  3O4X E;  4COF A;  5ABF A;  2ACX A;  1XMO T;  4H9S E;  3WAK A;  3NZP A;  1KF6 A;  4UR9 A;  3HKE E;  4UIG A;  4TX5 A;  3T8O A;  1D0X A;  3TKL B;  2CEA A;  3RGL A;  3WAJ A;  4DR3 T;  1GQE A;  1BR0 A;  2BKP A;  2V8S V;  1XDP A;  3KV9 A;  5AQF B;  2FJE A;  5FVK A;  1WR6 A;  2KWH A;  3OTO T;  2JRK A;  1KK7 A;  2UXX B;  4TUY E;  2UXD T;  5CB4 E;  2W66 A;  4TV8 E;  1UX5 A;  3P50 A;  2KLQ A;  5EK3 A;  1I6Z A;  5AFU L;  2NW7 A;  3TLU A;  4HFV A;  2VKO A;  1HNW T;  4ANJ A;  3O1J A;  4CXY A;  3N5L A;  3NRX A;  3RHW A;  2WDQ A;  3RF1 A;  4YT0 A;  2BS2 A;  3KV6 A;  2BDE A;  2JQ9 A;  2NW9 A;  3E22 E;  3HA4 A;  4DBR A;  4OX9 T;  1OED A;  1E2A A;  2C5K T;  2XQ9 A;  2Y48 B;  2D9D A;  4KP3 C;  1VCS A;  1J5E T;  3I9W A;  4YY3 T;  3TLV A;  4X66 T;  3EDU A;  4WW0 A;  2X9X A;  2YEV C;  3QB5 K;  2PG8 A;  3IA3 A;  2NR4 A;  1HNZ T;  4LFB T;  5CGM A;  2N1G A;  4P1N A;  2E5V A;  1WCR A;  3VHL A;  1D0Y A;  1L0V A;  3CQG B;  2BVM A;  5L3E B;  1IBL T;  2YIN A;  4H9R C;  2QA7 A;  5FVL A;  4TWD A;  5LG3 A;  4K0K T;  3ZT5 A;  3JC6 C;  1BR1 A;  3X1D A;  1N33 T;  3OVU A;  4F8H A;  5HYA A;  5IYZ E;  4DR6 T;  1MMD A;  3V5S A;  1UX4 A;  2WBL A;  2A72 A;  3UU3 A;  2E5L T;  1X79 A;  5FP3 A;  5J2U E;  5LXT E;  1FMV A;  3O9X A;  2UXB T;  2YN6 A;  2F4V T;  3VRA A;  1UGO A;  5FY7 A;  1MMA A;  1T8B A;  1UUR A;  1HG5 A;  4PK6 A;  5FY1 A;  2WDV A;  4E7S A;  4UVB B;  3GMI A;  1DU2 A;  4DV1 T;  5AQT B;  3SFD A;  3ZMT B;  2CPT A;  4CN1 A;  5JDF A;  5CA0 E;  4U7Y A;  3O1H A;  4ZZB A;  3RIU A;  1IZN B;  3RH3 A;  2KSR A;  5FXV A;  3AEF A;  2UXN B;  1HTJ F;  3UU5 A;  3CK6 A;  3JAE A;  4CZZ B;  2N9D A;  5AQP B;  2IUB A;  3AXJ A;  3GA8 A;  4KMC A;  2J1D G;  2LM9 A;  3AEB A;  3ZMZ B;  1W9R A;  4H9Q C;  3I9Y A;  3ZMU B;  4GYR A;  2CLY C;  3R84 B;  3MZK B;  5F5W A;  1T7S A; 
#chains in the Genus database with same CATH homology
 2PFV A;  4H63 H;  1FIO A;  2LHN A;  4MFR A;  1YW0 A;  4X1I E;  2KZ7 B;  2E9X D;  3FB2 A;  1Y64 B;  3Q9D A;  4KBM B;  4DND A;  2NTY A;  3C51 A;  4MAL A;  3ZLI A;  4XBF B;  2K24 A;  3H37 A;  3I1A A;  2MBG A;  3GN5 B;  2CWO A;  3HI2 A;  2LE8 A;  4PJM A;  3AB3 B;  4U72 A;  5EK2 A;  2CA5 A;  2Y6X A;  2XAG B;  4I55 E;  4XZC A;  3MKD A;  2JMH A;  2KND A;  2LSG A;  2CLY B;  2VKD A;  2IC9 A;  1LRZ A;  2DCF A;  2WMO A;  3LG7 A;  4ZI3 C;  3V5U A;  3N2G E;  3NBX X;  5IHY A;  2EHO A;  2V7J A;  2VK9 A;  3CVR A;  1US7 B;  1O3X A;  2Q9Q C;  3UUM A;  2DI4 A;  5KX5 E;  3QC9 A;  4OYK A;  1MNE A;  3LK2 B;  1ZV4 X;  3PE0 A;  4NUU A;  1HS7 A;  3N9P A;  3W15 B;  3A5X A;  3SS1 A;  3LBX B;  2YU1 A;  3OYX A;  1UCU A;  4QHO A;  4EYU A;  3BK9 A;  3HR0 A;  5H6R B;  2DLR A;  3HKB E;  2ZM0 A;  3CX8 B;  4AQG A;  2VKH A;  3N2O A;  4YFS A;  3RC8 A;  4IHJ E;  4ASK A;  4I4T E;  2Q9Q B;  1HCI A;  2IC6 A;  2X9W A;  2L8K A;  3MA9 A;  4FI5 A;  5E0O A;  4QXB B;  3AAA B;  5LJM A;  3RYF E;  1BR2 A;  4UV8 B;  2VB6 A;  3BQI A;  2V7K A;  3UFE A;  2MTQ A;  4QXH B;  4I43 B;  2H7V C;  4IIJ E;  3C4W A;  4O4L E;  3SWH A;  4DMW A;  4PJJ A;  4PK5 A;  4IE6 A;  1FEW A;  3ETV A;  2V7M A;  5KMG P;  1FMW A;  2XAJ B;  3SRZ A;  3RPU A;  2X67 A;  3GN5 A;  3P7I A;  3HKD E;  5LHH B;  3P8C D;  5LJN A;  3J9X 1;  3LFM A;  2JJ9 A;  4O4I E;  2BZB A;  2SPC A;  1MMG A;  4GYS A;  3AA0 B;  3PU3 A;  2ZMA A;  4TZ4 C;  5LBQ B;  3QK6 A;  3RKO A;  4HE8 A;  2CXL A;  4MLK A;  5BMV E;  3N2K E;  1D1C A;  3N9N A;  4IDZ A;  1U4Q A;  3N9L A;  1WRD A;  1B7T A;  2M67 A;  2HPL A;  2LSJ A;  3ZJ1 A;  4EZH A;  5JDG A;  5LHI B;  1SHZ C;  2IAK A;  3I0O A;  4P0A A;  5DAB A;  3ZC1 A;  1HFA A;  3LBX A;  4GOU A;  4HGA A;  2ZM8 A;  4K0U A;  4PK4 A;  2LSY A;  3ZN0 B;  4MBQ A;  2X51 A;  3EUH A;  4IE5 A;  4BA9 A;  4N78 D;  3ZYM A;  2HPJ A;  4ZI7 E;  2V26 A;  2WWU A;  1S35 A;  3H3A A;  3J7Y q;  1IJ6 A;  1YKE B;  5JVD E;  1MIV A;  2Q9Q A;  5HXR A;  3VKH A;  3ZC0 A;  3L09 A;  5LG4 A;  5H6Q B;  4ZI2 D;  3N9M A;  3ZYK A;  4AKG A;  3RC3 A;  4ILU A;  5FXX A;  3O1I A;  5FYM A;  5HXC A;  2GK9 A;  4O2B E;  4GK0 E;  3U3I A;  3IF8 B;  5LYJ E;  2QGS A;  1AJ3 A;  3GWH A;  4AQF C;  4IST A;  2Z6E A;  3KV4 A;  3RYI E;  3KBU A;  3PDY A;  4O8S A;  4X20 E;  2H3R A;  3AAI A;  4XAX B;  4O4H E;  2YU2 A;  4OHF A;  3ZCJ A;  4CI2 B;  5LA6 E;  5L3F B;  5LGN B;  2CCQ A;  4EOZ B;  4O2A E;  5CA1 E;  4O4J E;  4OYJ A;  3Q5W A;  5ADX L;  4CI1 B;  3RYC E;  2XHE B;  5L3G B;  2ZM2 A;  4I50 E;  1SA0 E;  3OYZ A;  4UEM A;  1D0Z A;  4TN7 B;  3S4U A;  4BAY B;  3O4X E;  4ZS2 A;  2ACX A;  3FBL A;  2KT9 A;  4H9S E;  4QKN A;  3WAK A;  4EXT A;  4E7Z A;  3NZP A;  5A1L A;  3HKE E;  4UIG A;  4TX5 A;  3SOL A;  4IE4 A;  2C5I T;  3AA1 B;  3AVR A;  3N9Q A;  4H9N C;  4AKH A;  2WAU A;  1D0X A;  3T8O A;  3TKL B;  2CEA A;  2E9X C;  5HWX A;  3K3Q C;  3WAJ A;  4UV9 B;  1T98 A;  3KVA A;  4UVC B;  4CXW A;  3ZPO A;  4ERR A;  1BR0 A;  4AKL A;  5JDL A;  5JDM A;  2DHR A;  5F8P A;  3PUR A;  5L3D B;  1IAP A;  4P09 A;  2NOX A;  2I59 A;  3I0Q A;  4QX8 B;  2YK0 A;  2CWY A;  3IBP A;  2DWG A;  3MJX A;  3KV9 A;  4HTE A;  4DMV A;  3JC6 D;  4AKI A;  3CPZ A;  2CM0 A;  2NW8 A;  1E1H B;  1D1B A;  2C5J A;  3OKQ A;  3UUL A;  4KUM B;  2K5B B;  1WR6 A;  3VKG A;  2KWH A;  2E9X B;  1Z0P A;  2JRK A;  1KK7 A;  2UXX B;  4TUY E;  2LSK A;  4OFZ A;  4P0B A;  1QUU A;  2KXP B;  2MYS A;  1MND A;  5CB4 E;  4YJ3 E;  3C4X A;  4X1Y E;  1IJ5 A;  2Y8D A;  4QXC B;  3UUX B;  3EVY A;  2CE7 A;  2LOP A;  3BQL A;  5DQV A;  5TAO A;  4CQI A;  2K9A A;  4TV8 E;  1UX5 A;  4ZHQ E;  2D0U A;  2W63 A;  2A3D A;  5HXE A;  2KLQ A;  5LOV E;  4DVD A;  5EK3 A;  1MMN A;  3C98 B;  3ZN1 B;  1LVK A;  5AFU L;  2CMR A;  4AI6 A;  3L3P A;  5HWY A;  2DNX A;  2NW7 A;  1ZKE A;  2IW5 B;  1U5P A;  4HFV A;  5HXH A;  4AQF A;  5JR9 C;  2VKO A;  1MIY A;  2H7O A;  2NP9 A;  3FXD B;  3DJB A;  3PUA A;  4PW8 A;  3O1J A;  4ANJ A;  2XUE A;  1LVF A;  4CXY A;  3N5L A;  3NRX A;  3ETU A;  3AA6 B;  3K3N A;  1WYC A;  4JEH B;  3U78 A;  2EHO D;  3B13 A;  2DWK A;  4QX7 B;  5EZY E;  5L2L A;  4MHC A;  4QWN B;  3R6N A;  4H9P C;  2LT3 A;  2PJQ A;  3DP7 A;  2VKJ A;  3MK7 C;  4HN9 A;  1NAF A;  3CQC B;  2W61 A;  3RX6 A;  2RA1 A;  3KV6 A;  4BJM A;  2G0U A;  2ES0 A;  4GIW A;  2L9Q A;  3ZYL A;  5JR9 B;  3MAC A;  2BDE A;  5HAX A;  3KVB A;  3PUG A;  4Z8X A;  4A56 A;  4DO0 A;  2NW9 A;  3EDV A;  3HKC E;  2E9X A;  3E22 E;  1G73 A;  3HA4 A;  4UF0 B;  4DBR A;  4ISS A;  4CXX A;  3N9O A;  4FJO A;  4EAH A;  5JQG E;  2BVL A;  2ZLY A;  3FHN A;  4EZ4 A;  1HG2 A;  4G63 A;  2C5K T;  1CUN A;  2W62 A;  2Y48 B;  1QSD A;  2XAQ B;  3ZJ2 A;  2B1E A;  1D1A A;  3B57 A;  4KP3 C;  4CI3 B;  4IE7 A;  5DQW A;  3ZMS B;  3KIN B;  4ZI2 C;  1YD8 G;  1MIW A;  3I9W A;  3OBV E;  5GON E;  4GK5 E;  5LNK A;  4WNK A;  3EDU A;  2KWI B;  1NWM X;  2JMK A;  4JLE A;  4WW0 A;  2X9X A;  5KDM C;  3C4Z A;  2JQQ A;  4C91 A;  2YEV C;  2P9B A;  2PG8 A;  5FMN A;  3DTO A;  4L5G A;  2RP4 A;  3RRW A;  1H7C A;  2CXD A;  3CX7 B;  1EZ3 A;  4B6X A;  3UT5 E;  2X68 A;  3K8P C;  2N1G A;  3C50 A;  3ESL A;  2L3L A;  4TV9 E;  2PBI A;  3M65 A;  3VHL A;  1D0Y A;  5JR9 A;  3PUQ A;  4V1A v;  3CQG B;  2BVM A;  1OWA A;  4UEL A;  4UF0 A;  5L3E B;  2LEH A;  3AA7 B;  3LJC A;  4F6R C;  1ZHC A;  3ZEF B;  2K48 A;  4ZI3 D;  3BQK A;  4WBO A;  3Q2M A;  4YJ2 E;  3MXZ A;  2V7L A;  2Q9Q D;  3IEE A;  2YIN A;  4H9R C;  2QA7 A;  4M1P A;  2W0G A;  5FY0 A;  2VAS A;  5FNV E;  2D5U A;  3HL6 A;  3ANW B;  2JPF A;  2XAH B;  3FBZ A;  2X0L B;  5JDH A;  3CX6 B;  2XAF B;  4JEU B;  3JC6 C;  4U74 A;  4HEA A;  1BR1 A;  4X1K E;  3CKD A;  2LHR A;  4WBN E;  3CQX C;  1BR4 A;  3QUJ A;  5HYA A;  3PTR B;  5IYZ E;  1VRB A;  1MMD A;  4J2C A;  3AVS A;  5LP6 E;  2WMN A;  3ONX A;  3F31 A;  2VL8 A;  3AAE B;  3V5S A;  2X66 A;  5LCY A;  1UX4 A;  2WBL A;  5JRC B;  1G8X A;  5FXW A;  1KNZ A;  4L9I A;  4DBQ A;  2LJL A;  2A72 A;  1ZEE A;  2A2F X;  4H9O C;  3RYH E;  4JUY A;  5ETW A;  3UTK A;  1X79 A;  4YLH A;  4UXN B;  2HH7 A;  5FP3 A;  5LHG B;  3F2E A;  5J2U E;  5LXT E;  3ZMV B;  4ZS3 A;  1FMV A;  2ODV A;  4PAG A;  4BJN A;  1LKX A;  5M4Y A;  3O9X A;  3KDS E;  3FXE B;  3KFW X;  5FY7 A;  1MMA A;  3NZQ A;  2LOS A;  3KBT A;  1HG5 A;  4PK6 A;  5C8Y E;  2NTX A;  3ZCI A;  5FY1 A;  3RRC A;  2CXF A;  2EHO C;  4PJL A;  4E7S A;  5JDQ A;  4YHJ A;  3ANW A;  4UVB B;  2D2S A;  3GMI A;  3VU7 H;  2XAS B;  3NRY A;  4PFO A;  3PU8 A;  3ZMT B;  5J1G A;  4L0R A;  5JDN A;  4PNI A;  3C64 A;  4UVA B;  2XQY A;  2XTL A;  1S94 A;  2VWA A;  2NWB A;  4H63 V;  5JRE A;  5DJQ C;  2X9Y A;  5JDF A;  2OA5 A;  5CA0 E;  5FXZ A;  2ODU A;  2WSS V;  3O1H A;  4G2A A;  2MOZ A;  3KV5 A;  4EYY R;  2V7I A;  5L3C B;  2EHO B;  4PJN A;  1IZN B;  3RH3 A;  5JRC A;  2V1D B;  5FXV A;  2LSI A;  3WI3 A;  2UXN B;  2W00 A;  4PFP A;  5F3J A;  1HTJ F;  1V9D A;  3D0T A;  4C90 A;  3F57 A;  2KIN B;  5L3B B;  3K3O A;  4ADZ A;  4OK0 A;  4CZZ B;  2X9H A;  5LGU B;  1OXZ A;  1YKH B;  2C0S A;  2N9D A;  4ZOL E;  4IGU A;  3E08 A;  3LK3 B;  3LK4 2;  3E0Z A;  5LGT B;  3PUS A;  3IHR A;  1HF8 A;  5HXS A;  4NUV A;  5EK4 A;  4AXP A;  3OJA A;  3Q5X A;  5LBM A;  3GA8 A;  4KMC A;  5J2T E;  3UUN A;  1VOM A;  2J1D G;  1HX8 A;  2KMF A;  4HKA A;  2LM9 A;  2WM9 A;  1WLX A;  3CWZ B;  3ZMZ B;  4H9Q C;  3I9Y A;  3ZMU B;  5JH7 E;  4GYR A;  2CLY C;  2N2N A;  2D0T A;  1WYB A;  3MZK B;  3R84 B;  4AKR B;  2E8I A;  3CML A;  4IE0 A;  4EB6 E;  4EIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...