1G73A

Crystal structure of smac bound to xiap-bir3 domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
157
structure length
157
Chain Sequence
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTDLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES
publication title Structural basis of IAP recognition by Smac/DIABLO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/apoptosis inhibitor
total genus 76
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1g73A00
1HS7A 2XHEB 1EZ3A 1FEWA 1G73A 2DNXA 3C98B 4JEUB 4JEHB 4TX5A 3LG7A 5M4YA 1BR0A 1S94A 5LG4A 1FIOA
chains in the Genus database with same CATH superfamily
3AA1B 4HE8A 3AVRA 2E9XD 5L4EA 5ABFB 5FNVE 3PJAA 1XDPA 5AQPB 5AQQB 4F8HA 4YJ3E 2I59A 4AQYT 2N1GA 4EB6E 2UU9T 4QXCB 3SFDA 3OTOT 1IBMT 3P4PA 3C51A 5A1LA 2JMKA 2X68A 1D1BA 4TV8E 4UVBB 2YDRA 2F4VT 3BK9A 4ISTA 1YQ3A 4UEMA 4YTMA 5FXVA 5J2TE 4PJMA 2L8KA 1UCUA 4IREA 5GONE 3O1IA 4IT4A 4X5TA 1IZNB 1HG2A 5L3CB 1VCSA 2FJAA 1CHUA 2V1DB 5KX5E 2PBIA 4HGAA 4UXNB 4TZ4C 5IWAT 3KFWX 4H63H 4LF5T 1LVFA 2MOZA 5L2LA 3LJCA 4Z8XA 4IGUA 4XBFB 2V6YB 2NOXA 1MMNA 4AQGA 1UX5A 3EVYA 3KV5A 2WWUA 3ZSTA 5JDMA 2B1EA 5HXHA 5TAOA 4E7SA 3AEBA 3ZMTB 1KNZA 1AJ3A 4HFVA 2H3RA 2KSRA 5AQGB 1WR0A 3OVUA 5JR9C 4DV0T 3W15B 2OV9A 3LK2B 4LF6T 1ZOYA 4N78D 4NUVA 4P0AA 3WAJA 4PFPA 4ILAA 4GOUA 1T98A 4IDPA 5KDMC 3UFGA 3PJAJ 2VKOA 4NXMT 3AECA 4DMVA 3HKDE 2ODUA 3I1AA 3IHRA 4HWHA 4B6XA 1NWMX 4HFEA 1WRDA 2CA5A 3AE7A 3RHWA 4F6RC 1KK7A 5IUXA 2VL0A 2X0LB 3ABVA 3CQCB 1I94T 5JREA 2YINA 2K24A 3JAFA 2V7IA 2SPCA 2KXPB 2KMFA 3RKGA 4QXBB 1IBKT 2K3WA 4LFAT 2NTXA 4KI0F 4EOZB 2ODVA 3EDUA 3N2GE 3OJAA 3PU3A 2XQAA 4GK0E 4DR2T 2YU1A 3KV6A 5JDQA 2FUPA 2WP9A 2XQ3A 4G2AA 3HKCE 2FJDA 5CGMA 1KNRA 3QK6A 4PJNA 3CKDA 5FXWA 5CJ5A 2XZEA 4IIJE 2EHOB 3TLVA 3K8PC 2FBWA 2BG9E 5BMVE 1M62A 3JADA 4PAGA 3GN5B 4HWIB 3J7Yq 3UUBA 2LSJA 1FEWA 3ONXA 2ZM6T 4AKLA 2W4XA 2EHOD 3CVRA 1OEDE 4MALA 3ZJ2A 5L3FB 2V26A 2W2UA 5JRCB 2W67A 4JUYA 3FHNA 5LJMA 2WM9A 5AQOB 2LEHA 2V5CA 3P8CD 3M3ZB 2I0MA 1IAPA 2LRKA 3N9NA 2CHNA 3RLFF 4EYUA 3B5MA 5LGUB 4BJNA 2WB5A 2DCFA 2C5IT 2MYSA 2QGSA 4BA9A 3P4WA 3AA7B 1SE7A 4DR3T 4M1PA 1BR0A 1US7B 5FP3A 5J0ZA 2WY2A 5HEGA 4PJJA 5L3DB 1HFAA 3AEFA 3ZC0A 2HH7A 3T8OA 3LG7A 3VKHA 1BR4A 1WCRA 4QWNB 4IDZA 2LSIA 5HWXA 3F57A 5DQVA 4DV3T 2M6BA 5FVKA 1N34T 4CN6A 2LSKA 2NP9A 3MKDA 2OA5A 3OYXA 1Y64B 3V5SA 4GK5E 5EK4A 5FMNA 5HXRA 2L3LA 3ZLIA 4O4JE 3OPCA 5JR9A 1W09A 2HPLA 4CI3B 3KDSE 3L39A 2MBGA 4ZHQE 2K5BB 3JAEA 2IIUA 5HAXA 4DV6T 5JDNA 4LF9T 2UXBT 4ZI3D 3MJXA 5FL1A 4ZI2C 4OYKA 4AKIA 3ZYLA 3KV9A 4TX5A 2DLRA 2H89A 4IE0A 4DR6T 3V5UA 3CK6A 3ETVA 4TWHA 4U31A 1XWMA 5DJQC 1ZHCA 1QLBA 1WYBA 2H88A 3BQKA 4U7IA 3FZFB 5LGTB 5LBMA 4DMWA 4U7YA 4AKHA 4JI0T 4PFOA 3UTKA 2K9AA 5F8PA 1O3XA 4YHJA 4IL9A 3SOLA 4DV2T 1D0YA 3PUXF 4QX8B 1N33T 2IMLA 4UELA 4CZZB 4JI3T 3AAAB 4JI4T 5AQVB 4A56A 5LJNA 2MAWA 2XHEB 3Q5XA 2YDQA 3NBXX 1YQ4A 4IE5A 1ZEEA 1BR1A 4Q25A 4UF0A 2V5DA 3EHZA 4UIGA 2BBHA 2XAJB 3NWIA 1Z0PA 1IBLT 1UX4A 3VR9A 5ABEA 2J4GA 4LF4T 4JYAT 3Q5WA 1GQEA 1HG5A 1T7SA 3RYCE 4J2CA 2ZM0A 2X67A 1B7TA 2UXNB 3PUVF 5CA1E 1QUUA 2CXFA 3IEEA 2X0HA 4TNVA 1HNZT 2BKOA 1HTJF 5ABHA 4ISSA 3L09A 2V7JA 3AEAA 3N9MA 5AQRB 5LXTE 4PK5A 1Z8UA 5ABGA 2CMRA 4U33A 5L3GB 1YKEB 2JQQA 5CB4E 3AVSA 3O1HA 5CFBA 4U3CA 2X66A 3NKZA 3F31A 1YD8G 2WSSV 4Z91A 5LHGB 2X9WA 3QB5A 5HEUA 1XNQT 5LB7B 4LFBT 4ERRA 4U2ZA 4HN9A 2VQET 2UUBT 1WYCA 3C4WA 4QHOA 2D2SA 5EK3A 2OLTA 3VR8A 3LK3B 5AQHB 3CMLA 2W0GA 4QX7B 4HFDA 3NRXA 4H9NC 3ZMUB 1N36T 2WU2A 4P1NA 4PJLA 3HKBE 4ADZA 1S94A 4LF8T 3TKLB 4V1Av 4EEDA 3HA4A 2LM2A 3LFMA 2QYWA 3N9OA 2BDEA 3M65A 4QH1A 2NR4A 3AA6B 4TUYE 2UXDT 3S4UA 4UVAB 2GK9A 3VRAA 5HXEA 2CEAA 4YSYA 2XQ6A 4IDOA 2NWBA 3CQXC 2JIWA 3T1YT 2WZIA 4LFCT 4I4TE 5AQUB 4AXPA 2HN1A 5EK2A 2LHRA 2CPTA 5AQJB 3QNUA 3VKGA 5AQTB 2D0UA 2VKHA 1UUSA 2NW8A 4DBQA 2KT9A 3Q2MA 3C64A 4C90A 3AEEA 1FJGT 1HF8A 2BBJA 3I0QA 3AXJA 5LP6E 3IBPA 5AQSB 3FXEB 3FZMB 3HI2A 3JC6C 4JEHB 4QH4A 2CBJA 5C2TA 1T8BA 4EYYR 3MXZA 4YLHA 2G0UA 3K3OA 2KINB 5IHYA 2LKGA 5CA0E 4ZEYA 4AQFC 2DL1A 5ADXL 3ZSSA 3D0TA 3C4XA 3HL6A 5FVLA 3WI3A 1V9DA 5JR9B 3DTOA 2XPKA 4HFHA 3KV4A 3TLUA 4ASKA 2WMOA 5AQMB 1Y01A 3RYIE 2NW9A 4IL4A 1XDOA 1NENA 3QUJA 4JI1T 3BQLA 2RPAA 4EV6A 3O9XA 5C8YE 3CQGB 2XAFB 1L0VA 3FXDB 4YY3T 4OX9T 5AQFB 4DNDA 2LRLA 3LDQB 3LK42 4JI6T 2BVMA 2CBIA 2PFVA 3I9WA 3KBTA 1UK5A 4OFZA 4JI5T 4B3TT 1W0BA 3UUNA 2W62A 4P09A 3N9LA 2X51A 2IAKA 2E5LT 4KX6A 1ZP0A 1OWAA 3AE6A 4DV4T 4I0UA 5F3JA 5AQIB 2FJBA 5HEHA 3UUMA 4ZZCA 3RQWA 1JNRA 2YK0A 3RGLA 5E0OA 2VASA 2WCAA 1IJ5A 2YDSA 4O2AE 4UF0B 4PK4A 1LKXA 2WBLA 4H9OC 2LE8A 3N2OA 4HFCA 3ZCIA 3A7MA 2CLYC 3KBUA 2CLYB 3SWHA 3ANWB 3AE4A 3B13A 3FBLA 4PK6A 3PDYA 4GKKT 3H3AA 4K0KT 4ZOLE 5H6RB 3PE0A 4IHJE 2HN2A 4TN7B 5L3BB 2D0TA 4KHPT 1SUMB 2NTYA 4HWDA 4WBOA 1LVKA 4DR7T 4AI6A 2IW5B 3ZN0B 3PUQA 4YTNA 2CWOA 3EI0A 4DVDA 3MA9A 4O2BE 2JQHA 3RX6A 4AISA 3R6NA 4LF7T 4ANJA 1EZ3A 2E5VA 4WYVA 3RRCA 2C5JA 3UFEA 5HCJA 4LMJA 1HX8A 4DUZT 4CXXA 5LA6E 1YXRA 4ILCA 3ESLA 3AE3A 3I0OA 3C98B 2V7MA 4AQFA 2YKSA 3UU6A 2QVAA 4DIDB 2YOEA 3SRZA 3FZKB 2V7KA 1YKHB 4CI2B 4WZXA 2H7OA 3C50A 2JQ9A 5FY7A 4JEUB 3ZYMA 4X20E 3PUWF 4AIUA 3TLTA 4HWCA 4XZCA 1X9BA 4TV9E 4EZ4A 3F2EA 3ZCJA 4B3ST 3N5LA 5HEJA 4ZI2D 1FIOA 3A8YC 2LT3A 3ETUA 5L3EB 5LMNT 3E08A 2A2FX 2IDOB 4ZS2A 3P4RA 4EXTA 1VCTA 2XSAA 2A72A 4CXYA 2LOPA 2N9DA 4DO0A 5AQLB 5HEOA 4O4HE 4KUMB 3PU8A 4X1IE 3HR0A 4JI2T 3AXJB 4TWFA 4OHFA 3AEGA 1HX1B 4LMLA 4O4IE 2A9UA 2WWVA 3GMIA 2IUBA 2VKJA 3UU8A 4NUUA 4I50E 1XMQT 5LG4A 5DABA 4X1KE 3UULA 2UUCT 3H37A 2UUAT 4DR1T 2BVLA 3VRBA 1UURA 4ZXLA 2DWKA 3ANWA 1G73A 5LMUT 4PW8A 4WNKA 5LOVE 3L8RA 3KVBA 3ZEFB 2PG8A 4YSZA 3UU5A 4DV7T 1N32T 3NZQA 2DWGA 2XQ5A 3CX7B 4X66T 2WDQA 4GKJT 3EABA 1S35A 2WMNA 2XSBA 4GYRA 4A5XA 3UU4A 1KF6A 4TNWA 3N9PA 5JVDE 3UQ7A 1OXZA 3NRYA 2XAHB 3ZJ1A 4BAYB 1CUNA 2XJ7A 5FYMA 4KP3C 5FXXA 4X1YE 2CE7A 3OYZA 2XAQB 1DU2A 3LSVA 4EGWA 2FJEA 2CRBA 5JTGA 5LNKA 2CCQA 4MFRA 4YJ2E 4A98A 4IE7A 4MLKA 4CXWA 2WU5A 1D0ZA 4UV8B 2W66A 3AE1A 3H3MA 4O8SA 2E9XC 4Z90A 3ZMVB 1H7CA 4FJOA 2A3DA 2JQKA 4WW0A 2CHOA 2RA1A 3PURA 1U5PA 3PV0F 3PUAA 4BJMA 3O1JA 5AFUL 4B3MT 2BS3A 4FI5A 4IE4A 3AE9A 2LOSA 1MNDA 3ZT7A 3U78A 3Q5DA 4YHHT 3IF8B 2HHHT 1SHZC 2BS4A 3P4QA 1T72A 4NPPA 2HPJA 3K3QC 3FZHB 2M6IA 5LHIB 2H7VC 2KLQA 1HNWT 2UXCT 3A5XA 1NEKA 1D0XA 4NIQA 3RIUA 2ACXA 3GA8A 2CM0A 3RYFE 2XAGB 3PUZF 2VURA 3HKEE 3QC9A 4DR4T 5HXSA 5LHHB 3C4ZA 2X9XA 4KBMB 4EIWA 5JDGA 1HCIA 3RYHE 3P7IA 4IE6A 3ZT5A 3P50A 3SFEA 4QXHB 3LBXA 2X9YA 2PTFA 1VRBA 3GWHA 2K48A 3JC6D 1MIVA 4ILUA 2M67A 2LLYA 4AKGA 3N2KE 1E1HB 5IYZE 1G8XA 3ZMSB 1ZKEA 2Y6XA 2L9QA 2V7LA 2JRKA 4DUYT 3Q9DA 4COFA 3R84B 3ZPOA 3RIAA 4AKRB 1HNXT 2Q9QA 2N2NA 5ETWA 4H9QC 4MHCA 3RQUA 2YU2A 4ILBA 2BG9C 2VB6A 2BG9B 4L5GA 1MIYA 5FKYA 3RRWA 4ZS3A 1W9RA 3ZMZB 1HR0T 4H9RC 1R8IA 2WS3A 1OEDC 1OEDB 3NZPA 2B76A 4WBNE 1D1AA 3PUYF 2AE9A 3UQ4A 2AXDS 2MPKA 4JV5T 3RPUA 2D5UA 2X0YA 2LSYA 5DQWA 3MK7C 5EZYE 5M4YA 2XTLA 1U4QA 5LYJE 2W00A 2VK9A 1XMOT 4OK0A 2Y8DA 3KVAA 1J5ET 2XM1A 4GIWA 3AE2A 4EEBA 1KEYA 2V8SV 4OYJA 4U2YA 5FL0A 4HFIA 4ZZBA 3NVOA 1E7PA 4I43B 2WAUA 3PUGA 3QOFA 2E9XA 2BKPA 3WAKA 3RH3A 2JMHA 2CWYA 4KMCA 1XZYA 2IHR1 4H9SE 2ES0A 4UV9B 1E2AA 4QH5A 3ZC1A 2QA7A 2IC9A 5ABFA 2UXXB 2ZMAA 5FY0A 1LRZA 4HFBA 4X62T 2YEVC 4A97A 2IC6A 2E2AA 3O4XE 2EHOC 4YSXA 1MMDA 3DJBA 5AQKB 1M7KA 4JI7T 3UUXB 3E22E 4U72A 2VVNA 4IDNA 1X79A 2XY8B 5JQGE 3J9X1 1MMGA 5LCYA 2ZM2A 5J2UE 4YTPA 5HWYA 5JH7E 3G06A 2LJLA 4QKNA 4GYSA 2WDRA 4DV5T 2XQYA 3VU7H 1JNZA 1I6ZA 1KNPA 5C3JA 4MBQA 5H6QB 3PUSA 4L0RA 4DV1T 3MACA 3AAIA 4UVCB 4CQIA 4X65T 4O4LE 2RP4A 3RKOA 4JLEA 2XUEA 3OBVE 2BZBA 2Y48B 2VVSA 2VKDA 4X64T 2R6GF 2V6YA 3K3NA 2KZ7B 3TLWA 1J5WA 2C0SA 3TLSA 4EAHA 1YW0A 3AE8A 3ZKRA 2VL8A 5LG3A 4C91A 3EDVA 3BQIA 3RI5A 3Q5EA 2LHNA 4H63V 1MIWA 1VOMA 2J47A 2BG9A 3CX6B 2BS2A 5HYAA 5JDLA 3MZKB 3K1SA 4LMKA 2J1DG 4ZI3C 3KINB 4H9PC 1SA0E 3RIFA 2WDVA 4K0UA 1OEDA 2QRXA 3T1HT 3PTRB 1XNRT 5FXZA 5L4HA 3CX8B 1WFDA 4XAXB 2D9DA 2DI4A 5HCMA 1BR2A 2Z6EA 1KFYA 2XQ4A 5L47A 2KWHA 2XM2A 1IJ6A 4TWDA 3RIUC 1MNEA 3UT5E 2ACZA 4CN4A 3AAEB 3AB3B 4HEAA 3CPZA 4ZI7E 5JDFA 3IA3A 4YXDA 2ZM8A 2YN6A 4U74A 3LBXB 3ZYKA 2BKNA 3DP7A 3JCFA 5LGNB 1ZV4X 1WR6A 2JPFA 2C5KT 2J62A 3RC3A 4UR9A 4PNIA 1UGOA 3I9YA 3L3PA 3AA0B 3FB2A 5FY1A 2KNDA 3OKQA 2XASB 3U3IA 2EHOA 2Q9QC 2Q9QB 2DNXA 5JDHA 3QB5K 2LM9A 1HS7A 1MMAA 3GN5A 2VQFT 3ZT6A 2KWIB 4E7ZA 3ONJA 5J1GA 3ONLC 2Q9QD 2WZHA 2JJ9A 4DBRA 4EZHA 1QSDA 3VHLA 5F5WA 2LKHA 4JBWF 2V6XA 1NAFA 5HXCA 2XQ9A 3N9QA 2W63A 5JRCA 2LSGA 4G63A 3RC8A 1D1CA 2I6HA 2NW7A 4CN1A 4P0BA 3EUHA 5AQNB 4HKAA 3AEDA 2MTQA 1W0AA 4HTEA 4IDQA 4HWFA 2P9BA 1FMVA 4L9IA 2W61A 4YFSA 3EAMA 3AE5A 4I55E 2CXDA 1FMWA 4KHZF 2XQ8A 2ZLYA 5KMGP 3FBZA 3SS1A 3ZN1B 3X1DA 3CIRA 3E0ZA 3CWZB 2CXLA 2X9HA 3P4SA 5BR8T 4B3RT 5LBQB 4CI1B 2XQ7A 3B57A 1WLXA 4DR5T 4JI8T 3RF1A 4YT0A 2E8IA 2E9XB 3FZLB 2VWAA 3UU3A 2WQYA 5KXJA 4NXNT 2DHRA 1J1JA 2PJQA
chains in the Genus database with same CATH topology
3AA1B 4H9RC 4AI6A 4HE8A 2IW5B 3ZN0B 4YHJA 3AVRA 3PUQA 2CWOA 2E9XD 4DVDA 3SOLA 5FNVE 1D0YA 3MA9A 4QX8B 3NZPA 4O2BE 4UELA 4WBNE 4CZZB 3RX6A 1D1AA 3R6NA 3AAAB 4ANJA 1EZ3A 4YJ3E 2I59A 3RRCA 2C5JA 4A56A 3UFEA 3RPUA 2D5UA 5LJNA 1HX8A 2N1GA 2XHEB 3Q5XA 2LSYA 4EB6E 5DQWA 3MK7C 3NBXX 5EZYE 5M4YA 2XTLA 1U4QA 4IE5A 4CXXA 1ZEEA 5LA6E 5LYJE 1BR1A 4UF0A 2W00A 2VK9A 3ESLA 4QXCB 4OK0A 4UIGA 2Y8DA 3I0OA 3C51A 2XAJB 3C98B 3KVAA 5A1LA 2V7MA 1Z0PA 2JMKA 4AQFA 2X68A 1UX4A 1D1BA 4TV8E 3Q5WA 1HG5A 4GIWA 3RYCE 4J2CA 2ZM0A 4UVBB 2X67A 1B7TA 2UXNB 3SRZA 5CA1E 2V7KA 1QUUA 4OYJA 3BK9A 4ISTA 4UEMA 1YKHB 2CXFA 5FXVA 5J2TE 3IEEA 4PJMA 4I43B 1UCUA 1HTJF 2L8KA 2WAUA 3PUGA 4ISSA 4CI2B 5GONE 3O1IA 2H7OA 1IZNB 3C50A 5FY7A 4JEUB 3L09A 2V7JA 1HG2A 2E9XA 3N9MA 5L3CB 5LXTE 3ZYMA 4PK5A 3WAKA 2V1DB 3RH3A 5KX5E 2JMHA 2PBIA 2CMRA 2CWYA 4KMCA 4HGAA 4X20E 5L3GB 4UXNB 1YKEB 2JQQA 4H9SE 5CB4E 2ES0A 4TZ4C 3AVSA 4UV9B 3O1HA 3ZC1A 3KFWX 2QA7A 4H63H 4XZCA 2IC9A 4TV9E 2X66A 1LVFA 4EZ4A 2UXXB 3F31A 2MOZA 5L2LA 1YD8G 3F2EA 3LJCA 3ZCJA 4Z8XA 3N5LA 2ZMAA 4IGUA 5FY0A 2WSSV 1LRZA 4XBFB 2YEVC 4ZI2D 2IC6A 5LHGB 2X9WA 3O4XE 1FIOA 2EHOC 2LT3A 2NOXA 1MMNA 1MMDA 3ETUA 3DJBA 4AQGA 5L3EB 3E08A 2A2FX 1UX5A 3UUXB 3EVYA 3KV5A 4ERRA 4ZS2A 4HN9A 2WWUA 3E22E 4U72A 4EXTA 1WYCA 3C4WA 4QHOA 5JDMA 1X79A 2B1EA 2D2SA 5EK3A 5HXHA 5TAOA 4E7SA 2A72A 5JQGE 3J9X1 3LK3B 1MMGA 3CMLA 5LCYA 3ZMTB 2W0GA 1KNZA 4CXYA 1AJ3A 2ZM2A 2LOPA 5J2UE 2N9DA 4DO0A 4QX7B 4HFVA 2H3RA 3NRXA 4H9NC 4O4HE 5HWYA 5JH7E 4KUMB 5JR9C 3PU8A 4X1IE 3W15B 3ZMUB 2LJLA 3LK2B 4QKNA 4N78D 4NUVA 3HR0A 4GYSA 4PJLA 3HKBE 4P0AA 4ADZA 3WAJA 1S94A 4PFPA 3TKLB 4OHFA 4V1Av 4GOUA 1T98A 5KDMC 3HA4A 2VKOA 4O4IE 2XQYA 3VU7H 3LFMA 4DMVA 3HKDE 2ODUA 3I1AA 3IHRA 4MBQA 5H6QB 3PUSA 3N9OA 4L0RA 4B6XA 1NWMX 3MACA 3AAIA 2BDEA 3GMIA 3M65A 1WRDA 4UVCB 2CA5A 4CQIA 2VKJA 4O4LE 2RP4A 3AA6B 4F6RC 1KK7A 3RKOA 4NUUA 4JLEA 4TUYE 4I50E 2XUEA 3OBVE 2X0LB 2BZBA 3S4UA 5LG4A 4UVAB 5DABA 2GK9A 2Y48B 3CQCB 4X1KE 3UULA 4WBOA 2CEAA 5HXEA 3H37A 5JREA 2BVLA 2VKDA 2YINA 2K24A 2NWBA 2V7IA 3CQXC 2SPCA 2KXPB 2KMFA 3K3NA 2DWKA 3ANWA 2KZ7B 4QXBB 1G73A 4PW8A 4WNKA 5LOVE 2C0SA 4I4TE 4AXPA 1YW0A 4EAHA 2NTXA 5EK2A 3KVBA 2LHRA 3ZEFB 2VL8A 4EOZB 2PG8A 2ODVA 3VKGA 4C91A 3EDVA 3BQIA 3EDUA 3N2GE 2D0UA 3OJAA 3PU3A 3NZQA 4GK0E 2LHNA 2VKHA 2DWGA 4H63V 1MIWA 3CX7B 2NW8A 4DBQA 1VOMA 2KT9A 2YU1A 3CX6B 3KV6A 1S35A 2WMNA 5HYAA 5JDQA 5JDLA 3Q2MA 3MZKB 3C64A 4GYRA 4C90A 4G2AA 3HKCE 2J1DG 4ZI3C 3KINB 1HF8A 3CKDA 3QK6A 3I0QA 4PJNA 3N9PA 5JVDE 5FXWA 4H9PC 5LP6E 1SA0E 3IBPA 4K0UA 3FXEB 1OXZA 3HI2A 3JC6C 4JEHB 4IIJE 3NRYA 2XAHB 3ZJ1A 4BAYB 2EHOB 3PTRB 3K8PC 4EYYR 3MXZA 5BMVE 4YLHA 1CUNA 2G0UA 3K3OA 4PAGA 5FYMA 2KINB 3GN5B 4KP3C 3CX8B 5FXXA 5FXZA 3J7Yq 4X1YE 2CE7A 3OYZA 2LSJA 2XAQB 5IHYA 4XAXB 1FEWA 2DI4A 3ONXA 5CA0E 4AQFC 4AKLA 2EHOD 1BR2A 2Z6EA 2KWHA 3CVRA 5ADXL 1IJ6A 3D0TA 5LNKA 4MALA 3C4XA 1MNEA 2CCQA 3HL6A 4MFRA 3WI3A 4YJ2E 3ZJ2A 5L3FB 2V26A 1V9DA 4IE7A 5JR9B 4MLKA 5JRCB 3DTOA 4CXWA 4JUYA 3FHNA 5LJMA 3UT5E 2WM9A 1D0ZA 3KV4A 2LEHA 3AAEB 4ASKA 3P8CD 2WMOA 3AB3B 4UV8B 4O8SA 2E9XC 4HEAA 3CPZA 3RYIE 5JDFA 4ZI7E 1IAPA 2NW9A 3N9NA 3ZMVB 1H7CA 4FJOA 3QUJA 2ZM8A 2A3DA 3BQLA 4U74A 4EYUA 3LBXB 3ZYKA 5LGUB 3O9XA 4BJNA 4WW0A 5C8YE 2DCFA 2C5IT 2RA1A 3DP7A 3ZMZB 3PURA 3CQGB 1U5PA 2MYSA 2QGSA 4BA9A 5LGNB 2XAFB 1ZV4X 3PUAA 3AA7B 4BJMA 1WR6A 2JPFA 3O1JA 2C5KT 5AFUL 4M1PA 3FXDB 1BR0A 3RC3A 1US7B 5FP3A 4PNIA 4FI5A 4IE4A 4PJJA 3I9YA 2LOSA 3L3PA 1MNDA 5L3DB 1HFAA 3AA0B 4DNDA 3U78A 3ZC0A 3IF8B 3FB2A 2HH7A 1SHZC 3T8OA 5FY1A 3LG7A 2KNDA 3LK42 3VKHA 1BR4A 4QWNB 3OKQA 2XASB 3U3IA 2EHOA 2Q9QC 4IDZA 2BVMA 2LSIA 2Q9QB 5HWXA 2DNXA 5JDHA 3F57A 5DQVA 2PFVA 3I9WA 3KBTA 2LM9A 1HS7A 4OFZA 2HPJA 1MMAA 3GN5A 3K3QC 2LSKA 5LHIB 3UUNA 2H7VC 2W62A 2NP9A 2KWIB 3MKDA 2KLQA 2OA5A 4P09A 4E7ZA 5J1GA 2Q9QD 4DBRA 2JJ9A 4EZHA 3A5XA 3OYXA 3N9LA 1QSDA 1Y64B 2X51A 3V5SA 4GK5E 2IAKA 3VHLA 5EK4A 5FMNA 1D0XA 2ACXA 5HXRA 3GA8A 2L3LA 1NAFA 3ZLIA 5HXCA 2CM0A 1OWAA 4O4JE 3N9QA 3RYFE 2W63A 2XAGB 5JR9A 2HPLA 4CI3B 5JRCA 3KDSE 2LSGA 5F3JA 4G63A 2MBGA 3RC8A 3HKEE 3QC9A 4ZHQE 1D1CA 5HXSA 5LHHB 2K5BB 2NW7A 5HAXA 4P0BA 3EUHA 3UUMA 3C4ZA 2X9XA 4KBMB 4HKAA 2MTQA 4HTEA 5JDNA 2YK0A 4EIWA 1HCIA 3RYHE 5JDGA 5E0OA 3P7IA 2P9BA 1FMVA 2VASA 2W61A 4IE6A 4L9IA 4ZI3D 3MJXA 1IJ5A 4QXHB 4YFSA 3LBXA 2X9YA 4ZI2C 4O2AE 1VRBA 4UF0B 3GWHA 4PK4A 2K48A 4I55E 2CXDA 3JC6D 1MIVA 4OYKA 3ZYLA 1LKXA 4AKIA 2WBLA 1FMWA 4H9OC 2M67A 4ILUA 3KV9A 2LE8A 4TX5A 4AKGA 2ZLYA 3N2KE 3N2OA 5KMGP 3FBZA 2DLRA 4IE0A 1E1HB 5IYZE 3SS1A 3ZN1B 3ZCIA 3E0ZA 1G8XA 3V5UA 3ZMSB 1ZKEA 2CLYC 3ETVA 3KBUA 2CLYB 3SWHA 3CWZB 3ANWB 2CXLA 2X9HA 2Y6XA 2L9QA 2V7LA 3B13A 2JRKA 5LBQB 5DJQC 4CI1B 3FBLA 3Q9DA 1ZHCA 4PK6A 3R84B 1WYBA 3B57A 3BQKA 3PDYA 3ZPOA 4AKRB 2Q9QA 1WLXA 3H3AA 2N2NA 5LGTB 5LBMA 5ETWA 4ZOLE 5H6RB 3PE0A 4H9QC 4IHJE 2E8IA 4MHCA 4DMWA 2E9XB 2YU2A 2VB6A 2VWAA 4AKHA 4L5GA 4TN7B 1MIYA 4PFOA 3UTKA 2D0TA 2K9AA 5L3BB 2DHRA 2NTYA 5F8PA 3RRWA 4ZS3A 1LVKA 2PJQA 1O3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HS7 A;  2XHE B;  1EZ3 A;  1FEW A;  1G73 A;  2DNX A;  3C98 B;  4JEU B;  4JEH B;  4TX5 A;  3LG7 A;  5M4Y A;  1BR0 A;  1S94 A;  5LG4 A;  1FIO A; 
#chains in the Genus database with same CATH topology
 3AA1 B;  4HE8 A;  3AVR A;  2E9X D;  5L4E A;  5ABF B;  5FNV E;  3PJA A;  1XDP A;  5AQP B;  5AQQ B;  4F8H A;  4YJ3 E;  2I59 A;  4AQY T;  2N1G A;  4EB6 E;  2UU9 T;  4QXC B;  3SFD A;  3OTO T;  1IBM T;  3P4P A;  3C51 A;  5A1L A;  2JMK A;  2X68 A;  1D1B A;  4TV8 E;  4UVB B;  2YDR A;  2F4V T;  3BK9 A;  4IST A;  1YQ3 A;  4UEM A;  4YTM A;  5FXV A;  5J2T E;  4PJM A;  2L8K A;  1UCU A;  4IRE A;  5GON E;  3O1I A;  4IT4 A;  4X5T A;  1IZN B;  1HG2 A;  5L3C B;  1VCS A;  2FJA A;  1CHU A;  2V1D B;  5KX5 E;  2PBI A;  4HGA A;  4UXN B;  4TZ4 C;  5IWA T;  3KFW X;  4H63 H;  4LF5 T;  1LVF A;  2MOZ A;  5L2L A;  3LJC A;  4Z8X A;  4IGU A;  4XBF B;  2V6Y B;  2NOX A;  1MMN A;  4AQG A;  1UX5 A;  3EVY A;  3KV5 A;  2WWU A;  3ZST A;  5JDM A;  2B1E A;  5HXH A;  5TAO A;  4E7S A;  3AEB A;  3ZMT B;  1KNZ A;  1AJ3 A;  4HFV A;  2H3R A;  2KSR A;  5AQG B;  1WR0 A;  3OVU A;  5JR9 C;  4DV0 T;  3W15 B;  2OV9 A;  3LK2 B;  4LF6 T;  1ZOY A;  4N78 D;  4NUV A;  4P0A A;  3WAJ A;  4PFP A;  4ILA A;  4GOU A;  1T98 A;  4IDP A;  5KDM C;  3UFG A;  3PJA J;  2VKO A;  4NXM T;  3AEC A;  4DMV A;  3HKD E;  2ODU A;  3I1A A;  3IHR A;  4HWH A;  4B6X A;  1NWM X;  4HFE A;  1WRD A;  2CA5 A;  3AE7 A;  3RHW A;  4F6R C;  1KK7 A;  5IUX A;  2VL0 A;  2X0L B;  3ABV A;  3CQC B;  1I94 T;  5JRE A;  2YIN A;  2K24 A;  3JAF A;  2V7I A;  2SPC A;  2KXP B;  2KMF A;  3RKG A;  4QXB B;  1IBK T;  2K3W A;  4LFA T;  2NTX A;  4KI0 F;  4EOZ B;  2ODV A;  3EDU A;  3N2G E;  3OJA A;  3PU3 A;  2XQA A;  4GK0 E;  4DR2 T;  2YU1 A;  3KV6 A;  5JDQ A;  2FUP A;  2WP9 A;  2XQ3 A;  4G2A A;  3HKC E;  2FJD A;  5CGM A;  1KNR A;  3QK6 A;  4PJN A;  3CKD A;  5FXW A;  5CJ5 A;  2XZE A;  4IIJ E;  2EHO B;  3TLV A;  3K8P C;  2FBW A;  2BG9 E;  5BMV E;  1M62 A;  3JAD A;  4PAG A;  3GN5 B;  4HWI B;  3J7Y q;  3UUB A;  2LSJ A;  1FEW A;  3ONX A;  2ZM6 T;  4AKL A;  2W4X A;  2EHO D;  3CVR A;  1OED E;  4MAL A;  3ZJ2 A;  5L3F B;  2V26 A;  2W2U A;  5JRC B;  2W67 A;  4JUY A;  3FHN A;  5LJM A;  2WM9 A;  5AQO B;  2LEH A;  2V5C A;  3P8C D;  3M3Z B;  2I0M A;  1IAP A;  2LRK A;  3N9N A;  2CHN A;  3RLF F;  4EYU A;  3B5M A;  5LGU B;  4BJN A;  2WB5 A;  2DCF A;  2C5I T;  2MYS A;  2QGS A;  4BA9 A;  3P4W A;  3AA7 B;  1SE7 A;  4DR3 T;  4M1P A;  1BR0 A;  1US7 B;  5FP3 A;  5J0Z A;  2WY2 A;  5HEG A;  4PJJ A;  5L3D B;  1HFA A;  3AEF A;  3ZC0 A;  2HH7 A;  3T8O A;  3LG7 A;  3VKH A;  1BR4 A;  1WCR A;  4QWN B;  4IDZ A;  2LSI A;  5HWX A;  3F57 A;  5DQV A;  4DV3 T;  2M6B A;  5FVK A;  1N34 T;  4CN6 A;  2LSK A;  2NP9 A;  3MKD A;  2OA5 A;  3OYX A;  1Y64 B;  3V5S A;  4GK5 E;  5EK4 A;  5FMN A;  5HXR A;  2L3L A;  3ZLI A;  4O4J E;  3OPC A;  5JR9 A;  1W09 A;  2HPL A;  4CI3 B;  3KDS E;  3L39 A;  2MBG A;  4ZHQ E;  2K5B B;  3JAE A;  2IIU A;  5HAX A;  4DV6 T;  5JDN A;  4LF9 T;  2UXB T;  4ZI3 D;  3MJX A;  5FL1 A;  4ZI2 C;  4OYK A;  4AKI A;  3ZYL A;  3KV9 A;  4TX5 A;  2DLR A;  2H89 A;  4IE0 A;  4DR6 T;  3V5U A;  3CK6 A;  3ETV A;  4TWH A;  4U31 A;  1XWM A;  5DJQ C;  1ZHC A;  1QLB A;  1WYB A;  2H88 A;  3BQK A;  4U7I A;  3FZF B;  5LGT B;  5LBM A;  4DMW A;  4U7Y A;  4AKH A;  4JI0 T;  4PFO A;  3UTK A;  2K9A A;  5F8P A;  1O3X A;  4YHJ A;  4IL9 A;  3SOL A;  4DV2 T;  1D0Y A;  3PUX F;  4QX8 B;  1N33 T;  2IML A;  4UEL A;  4CZZ B;  4JI3 T;  3AAA B;  4JI4 T;  5AQV B;  4A56 A;  5LJN A;  2MAW A;  2XHE B;  3Q5X A;  2YDQ A;  3NBX X;  1YQ4 A;  4IE5 A;  1ZEE A;  1BR1 A;  4Q25 A;  4UF0 A;  2V5D A;  3EHZ A;  4UIG A;  2BBH A;  2XAJ B;  3NWI A;  1Z0P A;  1IBL T;  1UX4 A;  3VR9 A;  5ABE A;  2J4G A;  4LF4 T;  4JYA T;  3Q5W A;  1GQE A;  1HG5 A;  1T7S A;  3RYC E;  4J2C A;  2ZM0 A;  2X67 A;  1B7T A;  2UXN B;  3PUV F;  5CA1 E;  1QUU A;  2CXF A;  3IEE A;  2X0H A;  4TNV A;  1HNZ T;  2BKO A;  1HTJ F;  5ABH A;  4ISS A;  3L09 A;  2V7J A;  3AEA A;  3N9M A;  5AQR B;  5LXT E;  4PK5 A;  1Z8U A;  5ABG A;  2CMR A;  4U33 A;  5L3G B;  1YKE B;  2JQQ A;  5CB4 E;  3AVS A;  3O1H A;  5CFB A;  4U3C A;  2X66 A;  3NKZ A;  3F31 A;  1YD8 G;  2WSS V;  4Z91 A;  5LHG B;  2X9W A;  3QB5 A;  5HEU A;  1XNQ T;  5LB7 B;  4LFB T;  4ERR A;  4U2Z A;  4HN9 A;  2VQE T;  2UUB T;  1WYC A;  3C4W A;  4QHO A;  2D2S A;  5EK3 A;  2OLT A;  3VR8 A;  3LK3 B;  5AQH B;  3CML A;  2W0G A;  4QX7 B;  4HFD A;  3NRX A;  4H9N C;  3ZMU B;  1N36 T;  2WU2 A;  4P1N A;  4PJL A;  3HKB E;  4ADZ A;  1S94 A;  4LF8 T;  3TKL B;  4V1A v;  4EED A;  3HA4 A;  2LM2 A;  3LFM A;  2QYW A;  3N9O A;  2BDE A;  3M65 A;  4QH1 A;  2NR4 A;  3AA6 B;  4TUY E;  2UXD T;  3S4U A;  4UVA B;  2GK9 A;  3VRA A;  5HXE A;  2CEA A;  4YSY A;  2XQ6 A;  4IDO A;  2NWB A;  3CQX C;  2JIW A;  3T1Y T;  2WZI A;  4LFC T;  4I4T E;  5AQU B;  4AXP A;  2HN1 A;  5EK2 A;  2LHR A;  2CPT A;  5AQJ B;  3QNU A;  3VKG A;  5AQT B;  2D0U A;  2VKH A;  1UUS A;  2NW8 A;  4DBQ A;  2KT9 A;  3Q2M A;  3C64 A;  4C90 A;  3AEE A;  1FJG T;  1HF8 A;  2BBJ A;  3I0Q A;  3AXJ A;  5LP6 E;  3IBP A;  5AQS B;  3FXE B;  3FZM B;  3HI2 A;  3JC6 C;  4JEH B;  4QH4 A;  2CBJ A;  5C2T A;  1T8B A;  4EYY R;  3MXZ A;  4YLH A;  2G0U A;  3K3O A;  2KIN B;  5IHY A;  2LKG A;  5CA0 E;  4ZEY A;  4AQF C;  2DL1 A;  5ADX L;  3ZSS A;  3D0T A;  3C4X A;  3HL6 A;  5FVL A;  3WI3 A;  1V9D A;  5JR9 B;  3DTO A;  2XPK A;  4HFH A;  3KV4 A;  3TLU A;  4ASK A;  2WMO A;  5AQM B;  1Y01 A;  3RYI E;  2NW9 A;  4IL4 A;  1XDO A;  1NEN A;  3QUJ A;  4JI1 T;  3BQL A;  2RPA A;  4EV6 A;  3O9X A;  5C8Y E;  3CQG B;  2XAF B;  1L0V A;  3FXD B;  4YY3 T;  4OX9 T;  5AQF B;  4DND A;  2LRL A;  3LDQ B;  3LK4 2;  4JI6 T;  2BVM A;  2CBI A;  2PFV A;  3I9W A;  3KBT A;  1UK5 A;  4OFZ A;  4JI5 T;  4B3T T;  1W0B A;  3UUN A;  2W62 A;  4P09 A;  3N9L A;  2X51 A;  2IAK A;  2E5L T;  4KX6 A;  1ZP0 A;  1OWA A;  3AE6 A;  4DV4 T;  4I0U A;  5F3J A;  5AQI B;  2FJB A;  5HEH A;  3UUM A;  4ZZC A;  3RQW A;  1JNR A;  2YK0 A;  3RGL A;  5E0O A;  2VAS A;  2WCA A;  1IJ5 A;  2YDS A;  4O2A E;  4UF0 B;  4PK4 A;  1LKX A;  2WBL A;  4H9O C;  2LE8 A;  3N2O A;  4HFC A;  3ZCI A;  3A7M A;  2CLY C;  3KBU A;  2CLY B;  3SWH A;  3ANW B;  3AE4 A;  3B13 A;  3FBL A;  4PK6 A;  3PDY A;  4GKK T;  3H3A A;  4K0K T;  4ZOL E;  5H6R B;  3PE0 A;  4IHJ E;  2HN2 A;  4TN7 B;  5L3B B;  2D0T A;  4KHP T;  1SUM B;  2NTY A;  4HWD A;  4WBO A;  1LVK A;  4DR7 T;  4AI6 A;  2IW5 B;  3ZN0 B;  3PUQ A;  4YTN A;  2CWO A;  3EI0 A;  4DVD A;  3MA9 A;  4O2B E;  2JQH A;  3RX6 A;  4AIS A;  3R6N A;  4LF7 T;  4ANJ A;  1EZ3 A;  2E5V A;  4WYV A;  3RRC A;  2C5J A;  3UFE A;  5HCJ A;  4LMJ A;  1HX8 A;  4DUZ T;  4CXX A;  5LA6 E;  1YXR A;  4ILC A;  3ESL A;  3AE3 A;  3I0O A;  3C98 B;  2V7M A;  4AQF A;  2YKS A;  3UU6 A;  2QVA A;  4DID B;  2YOE A;  3SRZ A;  3FZK B;  2V7K A;  1YKH B;  4CI2 B;  4WZX A;  2H7O A;  3C50 A;  2JQ9 A;  5FY7 A;  4JEU B;  3ZYM A;  4X20 E;  3PUW F;  4AIU A;  3TLT A;  4HWC A;  4XZC A;  1X9B A;  4TV9 E;  4EZ4 A;  3F2E A;  3ZCJ A;  4B3S T;  3N5L A;  5HEJ A;  4ZI2 D;  1FIO A;  3A8Y C;  2LT3 A;  3ETU A;  5L3E B;  5LMN T;  3E08 A;  2A2F X;  2IDO B;  4ZS2 A;  3P4R A;  4EXT A;  1VCT A;  2XSA A;  2A72 A;  4CXY A;  2LOP A;  2N9D A;  4DO0 A;  5AQL B;  5HEO A;  4O4H E;  4KUM B;  3PU8 A;  4X1I E;  3HR0 A;  4JI2 T;  3AXJ B;  4TWF A;  4OHF A;  3AEG A;  1HX1 B;  4LML A;  4O4I E;  2A9U A;  2WWV A;  3GMI A;  2IUB A;  2VKJ A;  3UU8 A;  4NUU A;  4I50 E;  1XMQ T;  5LG4 A;  5DAB A;  4X1K E;  3UUL A;  2UUC T;  3H37 A;  2UUA T;  4DR1 T;  2BVL A;  3VRB A;  1UUR A;  4ZXL A;  2DWK A;  3ANW A;  1G73 A;  5LMU T;  4PW8 A;  4WNK A;  5LOV E;  3L8R A;  3KVB A;  3ZEF B;  2PG8 A;  4YSZ A;  3UU5 A;  4DV7 T;  1N32 T;  3NZQ A;  2DWG A;  2XQ5 A;  3CX7 B;  4X66 T;  2WDQ A;  4GKJ T;  3EAB A;  1S35 A;  2WMN A;  2XSB A;  4GYR A;  4A5X A;  3UU4 A;  1KF6 A;  4TNW A;  3N9P A;  5JVD E;  3UQ7 A;  1OXZ A;  3NRY A;  2XAH B;  3ZJ1 A;  4BAY B;  1CUN A;  2XJ7 A;  5FYM A;  4KP3 C;  5FXX A;  4X1Y E;  2CE7 A;  3OYZ A;  2XAQ B;  1DU2 A;  3LSV A;  4EGW A;  2FJE A;  2CRB A;  5JTG A;  5LNK A;  2CCQ A;  4MFR A;  4YJ2 E;  4A98 A;  4IE7 A;  4MLK A;  4CXW A;  2WU5 A;  1D0Z A;  4UV8 B;  2W66 A;  3AE1 A;  3H3M A;  4O8S A;  2E9X C;  4Z90 A;  3ZMV B;  1H7C A;  4FJO A;  2A3D A;  2JQK A;  4WW0 A;  2CHO A;  2RA1 A;  3PUR A;  1U5P A;  3PV0 F;  3PUA A;  4BJM A;  3O1J A;  5AFU L;  4B3M T;  2BS3 A;  4FI5 A;  4IE4 A;  3AE9 A;  2LOS A;  1MND A;  3ZT7 A;  3U78 A;  3Q5D A;  4YHH T;  3IF8 B;  2HHH T;  1SHZ C;  2BS4 A;  3P4Q A;  1T72 A;  4NPP A;  2HPJ A;  3K3Q C;  3FZH B;  2M6I A;  5LHI B;  2H7V C;  2KLQ A;  1HNW T;  2UXC T;  3A5X A;  1NEK A;  1D0X A;  4NIQ A;  3RIU A;  2ACX A;  3GA8 A;  2CM0 A;  3RYF E;  2XAG B;  3PUZ F;  2VUR A;  3HKE E;  3QC9 A;  4DR4 T;  5HXS A;  5LHH B;  3C4Z A;  2X9X A;  4KBM B;  4EIW A;  5JDG A;  1HCI A;  3RYH E;  3P7I A;  4IE6 A;  3ZT5 A;  3P50 A;  3SFE A;  4QXH B;  3LBX A;  2X9Y A;  2PTF A;  1VRB A;  3GWH A;  2K48 A;  3JC6 D;  1MIV A;  4ILU A;  2M67 A;  2LLY A;  4AKG A;  3N2K E;  1E1H B;  5IYZ E;  1G8X A;  3ZMS B;  1ZKE A;  2Y6X A;  2L9Q A;  2V7L A;  2JRK A;  4DUY T;  3Q9D A;  4COF A;  3R84 B;  3ZPO A;  3RIA A;  4AKR B;  1HNX T;  2Q9Q A;  2N2N A;  5ETW A;  4H9Q C;  4MHC A;  3RQU A;  2YU2 A;  4ILB A;  2BG9 C;  2VB6 A;  2BG9 B;  4L5G A;  1MIY A;  5FKY A;  3RRW A;  4ZS3 A;  1W9R A;  3ZMZ B;  1HR0 T;  4H9R C;  1R8I A;  2WS3 A;  1OED C;  1OED B;  3NZP A;  2B76 A;  4WBN E;  1D1A A;  3PUY F;  2AE9 A;  3UQ4 A;  2AXD S;  2MPK A;  4JV5 T;  3RPU A;  2D5U A;  2X0Y A;  2LSY A;  5DQW A;  3MK7 C;  5EZY E;  5M4Y A;  2XTL A;  1U4Q A;  5LYJ E;  2W00 A;  2VK9 A;  1XMO T;  4OK0 A;  2Y8D A;  3KVA A;  1J5E T;  2XM1 A;  4GIW A;  3AE2 A;  4EEB A;  1KEY A;  2V8S V;  4OYJ A;  4U2Y A;  5FL0 A;  4HFI A;  4ZZB A;  3NVO A;  1E7P A;  4I43 B;  2WAU A;  3PUG A;  3QOF A;  2E9X A;  2BKP A;  3WAK A;  3RH3 A;  2JMH A;  2CWY A;  4KMC A;  1XZY A;  2IHR 1;  4H9S E;  2ES0 A;  4UV9 B;  1E2A A;  4QH5 A;  3ZC1 A;  2QA7 A;  2IC9 A;  5ABF A;  2UXX B;  2ZMA A;  5FY0 A;  1LRZ A;  4HFB A;  4X62 T;  2YEV C;  4A97 A;  2IC6 A;  2E2A A;  3O4X E;  2EHO C;  4YSX A;  1MMD A;  3DJB A;  5AQK B;  1M7K A;  4JI7 T;  3UUX B;  3E22 E;  4U72 A;  2VVN A;  4IDN A;  1X79 A;  2XY8 B;  5JQG E;  3J9X 1;  1MMG A;  5LCY A;  2ZM2 A;  5J2U E;  4YTP A;  5HWY A;  5JH7 E;  3G06 A;  2LJL A;  4QKN A;  4GYS A;  2WDR A;  4DV5 T;  2XQY A;  3VU7 H;  1JNZ A;  1I6Z A;  1KNP A;  5C3J A;  4MBQ A;  5H6Q B;  3PUS A;  4L0R A;  4DV1 T;  3MAC A;  3AAI A;  4UVC B;  4CQI A;  4X65 T;  4O4L E;  2RP4 A;  3RKO A;  4JLE A;  2XUE A;  3OBV E;  2BZB A;  2Y48 B;  2VVS A;  2VKD A;  4X64 T;  2R6G F;  2V6Y A;  3K3N A;  2KZ7 B;  3TLW A;  1J5W A;  2C0S A;  3TLS A;  4EAH A;  1YW0 A;  3AE8 A;  3ZKR A;  2VL8 A;  5LG3 A;  4C91 A;  3EDV A;  3BQI A;  3RI5 A;  3Q5E A;  2LHN A;  4H63 V;  1MIW A;  1VOM A;  2J47 A;  2BG9 A;  3CX6 B;  2BS2 A;  5HYA A;  5JDL A;  3MZK B;  3K1S A;  4LMK A;  2J1D G;  4ZI3 C;  3KIN B;  4H9P C;  1SA0 E;  3RIF A;  2WDV A;  4K0U A;  1OED A;  2QRX A;  3T1H T;  3PTR B;  1XNR T;  5FXZ A;  5L4H A;  3CX8 B;  1WFD A;  4XAX B;  2D9D A;  2DI4 A;  5HCM A;  1BR2 A;  2Z6E A;  1KFY A;  2XQ4 A;  5L47 A;  2KWH A;  2XM2 A;  1IJ6 A;  4TWD A;  3RIU C;  1MNE A;  3UT5 E;  2ACZ A;  4CN4 A;  3AAE B;  3AB3 B;  4HEA A;  3CPZ A;  4ZI7 E;  5JDF A;  3IA3 A;  4YXD A;  2ZM8 A;  2YN6 A;  4U74 A;  3LBX B;  3ZYK A;  2BKN A;  3DP7 A;  3JCF A;  5LGN B;  1ZV4 X;  1WR6 A;  2JPF A;  2C5K T;  2J62 A;  3RC3 A;  4UR9 A;  4PNI A;  1UGO A;  3I9Y A;  3L3P A;  3AA0 B;  3FB2 A;  5FY1 A;  2KND A;  3OKQ A;  2XAS B;  3U3I A;  2EHO A;  2Q9Q C;  2Q9Q B;  2DNX A;  5JDH A;  3QB5 K;  2LM9 A;  1HS7 A;  1MMA A;  3GN5 A;  2VQF T;  3ZT6 A;  2KWI B;  4E7Z A;  3ONJ A;  5J1G A;  3ONL C;  2Q9Q D;  2WZH A;  2JJ9 A;  4DBR A;  4EZH A;  1QSD A;  3VHL A;  5F5W A;  2LKH A;  4JBW F;  2V6X A;  1NAF A;  5HXC A;  2XQ9 A;  3N9Q A;  2W63 A;  5JRC A;  2LSG A;  4G63 A;  3RC8 A;  1D1C A;  2I6H A;  2NW7 A;  4CN1 A;  4P0B A;  3EUH A;  5AQN B;  4HKA A;  3AED A;  2MTQ A;  1W0A A;  4HTE A;  4IDQ A;  4HWF A;  2P9B A;  1FMV A;  4L9I A;  2W61 A;  4YFS A;  3EAM A;  3AE5 A;  4I55 E;  2CXD A;  1FMW A;  4KHZ F;  2XQ8 A;  2ZLY A;  5KMG P;  3FBZ A;  3SS1 A;  3ZN1 B;  3X1D A;  3CIR A;  3E0Z A;  3CWZ B;  2CXL A;  2X9H A;  3P4S A;  5BR8 T;  4B3R T;  5LBQ B;  4CI1 B;  2XQ7 A;  3B57 A;  1WLX A;  4DR5 T;  4JI8 T;  3RF1 A;  4YT0 A;  2E8I A;  2E9X B;  3FZL B;  2VWA A;  3UU3 A;  2WQY A;  5KXJ A;  4NXN T;  2DHR A;  1J1J A;  2PJQ A; 
#chains in the Genus database with same CATH homology
 3AA1 B;  4H9R C;  4AI6 A;  4HE8 A;  2IW5 B;  3ZN0 B;  4YHJ A;  3AVR A;  3PUQ A;  2CWO A;  2E9X D;  4DVD A;  3SOL A;  5FNV E;  1D0Y A;  3MA9 A;  4QX8 B;  3NZP A;  4O2B E;  4UEL A;  4WBN E;  4CZZ B;  3RX6 A;  1D1A A;  3R6N A;  3AAA B;  4ANJ A;  1EZ3 A;  4YJ3 E;  2I59 A;  3RRC A;  2C5J A;  4A56 A;  3UFE A;  3RPU A;  2D5U A;  5LJN A;  1HX8 A;  2N1G A;  2XHE B;  3Q5X A;  2LSY A;  4EB6 E;  5DQW A;  3MK7 C;  3NBX X;  5EZY E;  5M4Y A;  2XTL A;  1U4Q A;  4IE5 A;  4CXX A;  1ZEE A;  5LA6 E;  5LYJ E;  1BR1 A;  4UF0 A;  2W00 A;  2VK9 A;  3ESL A;  4QXC B;  4OK0 A;  4UIG A;  2Y8D A;  3I0O A;  3C51 A;  2XAJ B;  3C98 B;  3KVA A;  5A1L A;  2V7M A;  1Z0P A;  2JMK A;  4AQF A;  2X68 A;  1UX4 A;  1D1B A;  4TV8 E;  3Q5W A;  1HG5 A;  4GIW A;  3RYC E;  4J2C A;  2ZM0 A;  4UVB B;  2X67 A;  1B7T A;  2UXN B;  3SRZ A;  5CA1 E;  2V7K A;  1QUU A;  4OYJ A;  3BK9 A;  4IST A;  4UEM A;  1YKH B;  2CXF A;  5FXV A;  5J2T E;  3IEE A;  4PJM A;  4I43 B;  1UCU A;  1HTJ F;  2L8K A;  2WAU A;  3PUG A;  4ISS A;  4CI2 B;  5GON E;  3O1I A;  2H7O A;  1IZN B;  3C50 A;  5FY7 A;  4JEU B;  3L09 A;  2V7J A;  1HG2 A;  2E9X A;  3N9M A;  5L3C B;  5LXT E;  3ZYM A;  4PK5 A;  3WAK A;  2V1D B;  3RH3 A;  5KX5 E;  2JMH A;  2PBI A;  2CMR A;  2CWY A;  4KMC A;  4HGA A;  4X20 E;  5L3G B;  4UXN B;  1YKE B;  2JQQ A;  4H9S E;  5CB4 E;  2ES0 A;  4TZ4 C;  3AVS A;  4UV9 B;  3O1H A;  3ZC1 A;  3KFW X;  2QA7 A;  4H63 H;  4XZC A;  2IC9 A;  4TV9 E;  2X66 A;  1LVF A;  4EZ4 A;  2UXX B;  3F31 A;  2MOZ A;  5L2L A;  1YD8 G;  3F2E A;  3LJC A;  3ZCJ A;  4Z8X A;  3N5L A;  2ZMA A;  4IGU A;  5FY0 A;  2WSS V;  1LRZ A;  4XBF B;  2YEV C;  4ZI2 D;  2IC6 A;  5LHG B;  2X9W A;  3O4X E;  1FIO A;  2EHO C;  2LT3 A;  2NOX A;  1MMN A;  1MMD A;  3ETU A;  3DJB A;  4AQG A;  5L3E B;  3E08 A;  2A2F X;  1UX5 A;  3UUX B;  3EVY A;  3KV5 A;  4ERR A;  4ZS2 A;  4HN9 A;  2WWU A;  3E22 E;  4U72 A;  4EXT A;  1WYC A;  3C4W A;  4QHO A;  5JDM A;  1X79 A;  2B1E A;  2D2S A;  5EK3 A;  5HXH A;  5TAO A;  4E7S A;  2A72 A;  5JQG E;  3J9X 1;  3LK3 B;  1MMG A;  3CML A;  5LCY A;  3ZMT B;  2W0G A;  1KNZ A;  4CXY A;  1AJ3 A;  2ZM2 A;  2LOP A;  5J2U E;  2N9D A;  4DO0 A;  4QX7 B;  4HFV A;  2H3R A;  3NRX A;  4H9N C;  4O4H E;  5HWY A;  5JH7 E;  4KUM B;  5JR9 C;  3PU8 A;  4X1I E;  3W15 B;  3ZMU B;  2LJL A;  3LK2 B;  4QKN A;  4N78 D;  4NUV A;  3HR0 A;  4GYS A;  4PJL A;  3HKB E;  4P0A A;  4ADZ A;  3WAJ A;  1S94 A;  4PFP A;  3TKL B;  4OHF A;  4V1A v;  4GOU A;  1T98 A;  5KDM C;  3HA4 A;  2VKO A;  4O4I E;  2XQY A;  3VU7 H;  3LFM A;  4DMV A;  3HKD E;  2ODU A;  3I1A A;  3IHR A;  4MBQ A;  5H6Q B;  3PUS A;  3N9O A;  4L0R A;  4B6X A;  1NWM X;  3MAC A;  3AAI A;  2BDE A;  3GMI A;  3M65 A;  1WRD A;  4UVC B;  2CA5 A;  4CQI A;  2VKJ A;  4O4L E;  2RP4 A;  3AA6 B;  4F6R C;  1KK7 A;  3RKO A;  4NUU A;  4JLE A;  4TUY E;  4I50 E;  2XUE A;  3OBV E;  2X0L B;  2BZB A;  3S4U A;  5LG4 A;  4UVA B;  5DAB A;  2GK9 A;  2Y48 B;  3CQC B;  4X1K E;  3UUL A;  4WBO A;  2CEA A;  5HXE A;  3H37 A;  5JRE A;  2BVL A;  2VKD A;  2YIN A;  2K24 A;  2NWB A;  2V7I A;  3CQX C;  2SPC A;  2KXP B;  2KMF A;  3K3N A;  2DWK A;  3ANW A;  2KZ7 B;  4QXB B;  1G73 A;  4PW8 A;  4WNK A;  5LOV E;  2C0S A;  4I4T E;  4AXP A;  1YW0 A;  4EAH A;  2NTX A;  5EK2 A;  3KVB A;  2LHR A;  3ZEF B;  2VL8 A;  4EOZ B;  2PG8 A;  2ODV A;  3VKG A;  4C91 A;  3EDV A;  3BQI A;  3EDU A;  3N2G E;  2D0U A;  3OJA A;  3PU3 A;  3NZQ A;  4GK0 E;  2LHN A;  2VKH A;  2DWG A;  4H63 V;  1MIW A;  3CX7 B;  2NW8 A;  4DBQ A;  1VOM A;  2KT9 A;  2YU1 A;  3CX6 B;  3KV6 A;  1S35 A;  2WMN A;  5HYA A;  5JDQ A;  5JDL A;  3Q2M A;  3MZK B;  3C64 A;  4GYR A;  4C90 A;  4G2A A;  3HKC E;  2J1D G;  4ZI3 C;  3KIN B;  1HF8 A;  3CKD A;  3QK6 A;  3I0Q A;  4PJN A;  3N9P A;  5JVD E;  5FXW A;  4H9P C;  5LP6 E;  1SA0 E;  3IBP A;  4K0U A;  3FXE B;  1OXZ A;  3HI2 A;  3JC6 C;  4JEH B;  4IIJ E;  3NRY A;  2XAH B;  3ZJ1 A;  4BAY B;  2EHO B;  3PTR B;  3K8P C;  4EYY R;  3MXZ A;  5BMV E;  4YLH A;  1CUN A;  2G0U A;  3K3O A;  4PAG A;  5FYM A;  2KIN B;  3GN5 B;  4KP3 C;  3CX8 B;  5FXX A;  5FXZ A;  3J7Y q;  4X1Y E;  2CE7 A;  3OYZ A;  2LSJ A;  2XAQ B;  5IHY A;  4XAX B;  1FEW A;  2DI4 A;  3ONX A;  5CA0 E;  4AQF C;  4AKL A;  2EHO D;  1BR2 A;  2Z6E A;  2KWH A;  3CVR A;  5ADX L;  1IJ6 A;  3D0T A;  5LNK A;  4MAL A;  3C4X A;  1MNE A;  2CCQ A;  3HL6 A;  4MFR A;  3WI3 A;  4YJ2 E;  3ZJ2 A;  5L3F B;  2V26 A;  1V9D A;  4IE7 A;  5JR9 B;  4MLK A;  5JRC B;  3DTO A;  4CXW A;  4JUY A;  3FHN A;  5LJM A;  3UT5 E;  2WM9 A;  1D0Z A;  3KV4 A;  2LEH A;  3AAE B;  4ASK A;  3P8C D;  2WMO A;  3AB3 B;  4UV8 B;  4O8S A;  2E9X C;  4HEA A;  3CPZ A;  3RYI E;  5JDF A;  4ZI7 E;  1IAP A;  2NW9 A;  3N9N A;  3ZMV B;  1H7C A;  4FJO A;  3QUJ A;  2ZM8 A;  2A3D A;  3BQL A;  4U74 A;  4EYU A;  3LBX B;  3ZYK A;  5LGU B;  3O9X A;  4BJN A;  4WW0 A;  5C8Y E;  2DCF A;  2C5I T;  2RA1 A;  3DP7 A;  3ZMZ B;  3PUR A;  3CQG B;  1U5P A;  2MYS A;  2QGS A;  4BA9 A;  5LGN B;  2XAF B;  1ZV4 X;  3PUA A;  3AA7 B;  4BJM A;  1WR6 A;  2JPF A;  3O1J A;  2C5K T;  5AFU L;  4M1P A;  3FXD B;  1BR0 A;  3RC3 A;  1US7 B;  5FP3 A;  4PNI A;  4FI5 A;  4IE4 A;  4PJJ A;  3I9Y A;  2LOS A;  3L3P A;  1MND A;  5L3D B;  1HFA A;  3AA0 B;  4DND A;  3U78 A;  3ZC0 A;  3IF8 B;  3FB2 A;  2HH7 A;  1SHZ C;  3T8O A;  5FY1 A;  3LG7 A;  2KND A;  3LK4 2;  3VKH A;  1BR4 A;  4QWN B;  3OKQ A;  2XAS B;  3U3I A;  2EHO A;  2Q9Q C;  4IDZ A;  2BVM A;  2LSI A;  2Q9Q B;  5HWX A;  2DNX A;  5JDH A;  3F57 A;  5DQV A;  2PFV A;  3I9W A;  3KBT A;  2LM9 A;  1HS7 A;  4OFZ A;  2HPJ A;  1MMA A;  3GN5 A;  3K3Q C;  2LSK A;  5LHI B;  3UUN A;  2H7V C;  2W62 A;  2NP9 A;  2KWI B;  3MKD A;  2KLQ A;  2OA5 A;  4P09 A;  4E7Z A;  5J1G A;  2Q9Q D;  4DBR A;  2JJ9 A;  4EZH A;  3A5X A;  3OYX A;  3N9L A;  1QSD A;  1Y64 B;  2X51 A;  3V5S A;  4GK5 E;  2IAK A;  3VHL A;  5EK4 A;  5FMN A;  1D0X A;  2ACX A;  5HXR A;  3GA8 A;  2L3L A;  1NAF A;  3ZLI A;  5HXC A;  2CM0 A;  1OWA A;  4O4J E;  3N9Q A;  3RYF E;  2W63 A;  2XAG B;  5JR9 A;  2HPL A;  4CI3 B;  5JRC A;  3KDS E;  2LSG A;  5F3J A;  4G63 A;  2MBG A;  3RC8 A;  3HKE E;  3QC9 A;  4ZHQ E;  1D1C A;  5HXS A;  5LHH B;  2K5B B;  2NW7 A;  5HAX A;  4P0B A;  3EUH A;  3UUM A;  3C4Z A;  2X9X A;  4KBM B;  4HKA A;  2MTQ A;  4HTE A;  5JDN A;  2YK0 A;  4EIW A;  1HCI A;  3RYH E;  5JDG A;  5E0O A;  3P7I A;  2P9B A;  1FMV A;  2VAS A;  2W61 A;  4IE6 A;  4L9I A;  4ZI3 D;  3MJX A;  1IJ5 A;  4QXH B;  4YFS A;  3LBX A;  2X9Y A;  4ZI2 C;  4O2A E;  1VRB A;  4UF0 B;  3GWH A;  4PK4 A;  2K48 A;  4I55 E;  2CXD A;  3JC6 D;  1MIV A;  4OYK A;  3ZYL A;  1LKX A;  4AKI A;  2WBL A;  1FMW A;  4H9O C;  2M67 A;  4ILU A;  3KV9 A;  2LE8 A;  4TX5 A;  4AKG A;  2ZLY A;  3N2K E;  3N2O A;  5KMG P;  3FBZ A;  2DLR A;  4IE0 A;  1E1H B;  5IYZ E;  3SS1 A;  3ZN1 B;  3ZCI A;  3E0Z A;  1G8X A;  3V5U A;  3ZMS B;  1ZKE A;  2CLY C;  3ETV A;  3KBU A;  2CLY B;  3SWH A;  3CWZ B;  3ANW B;  2CXL A;  2X9H A;  2Y6X A;  2L9Q A;  2V7L A;  3B13 A;  2JRK A;  5LBQ B;  5DJQ C;  4CI1 B;  3FBL A;  3Q9D A;  1ZHC A;  4PK6 A;  3R84 B;  1WYB A;  3B57 A;  3BQK A;  3PDY A;  3ZPO A;  4AKR B;  2Q9Q A;  1WLX A;  3H3A A;  2N2N A;  5LGT B;  5LBM A;  5ETW A;  4ZOL E;  5H6R B;  3PE0 A;  4H9Q C;  4IHJ E;  2E8I A;  4MHC A;  4DMW A;  2E9X B;  2YU2 A;  2VB6 A;  2VWA A;  4AKH A;  4L5G A;  4TN7 B;  1MIY A;  4PFO A;  3UTK A;  2D0T A;  2K9A A;  5L3B B;  2DHR A;  2NTY A;  5F8P A;  3RRW A;  4ZS3 A;  1LVK A;  2PJQ A;  1O3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...