1G73A

Crystal structure of smac bound to xiap-bir3 domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
157
structure length
157
Chain Sequence
b'AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTDLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES
publication title Structural basis of IAP recognition by Smac/DIABLO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/apoptosis inhibitor
total genus 76
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1g73A00
1EZ3A 2XHEB 4TX5A 1BR0A 2DNXA 4JEHB 1G73A 1FIOA 3C98B 1S94A 1HS7A 3LG7A 4JEUB 5M4YA 1FEWA 5LG4A
chains in the Genus database with same CATH superfamily
4QKNA 1MMDA 4GYRA 3B13A 2YKSA 1WR0A 2V1DB 3SWHA 1HTJF 2Y6XA 5C2TA 5HXRA 3KDSE 4IDQA 4BA9A 1BR1A 3UU5A 1HX8A 1HCIA 3VU7H 4UVAB 4H9NC 2DWKA 2X68A 2V7IA 5FP3A 3KINB 3AE8A 2HPLA 3RC3A 4GKJT 1UGOA 3AA0B 1VCSA 2CEAA 2D0UA 3GN5B 2XQ3A 2XQ7A 2CM0A 5TAOA 3OPCA 3B57A 4EB6E 3N9LA 4CXYA 2ZMAA 3Q5XA 3FBZA 5E0OA 5H6QB 4UVBB 4U72A 2W62A 3JCFA 2KWHA 3KV5A 4BJMA 1YQ4A 3I0QA 3SRZA 4HFIA 2YOEA 2WM9A 5FY7A 1G73A 4UV9B 1OEDA 1UUSA 4DV5T 1IAPA 3KV4A 3N9NA 4AKLA 3UFGA 2OA5A 3KBTA 4AKRB 3I1AA 1OWAA 5JDLA 4JYAT 2GK9A 1JNZA 4ZS2A 4A98A 4JI3T 5JDFA 4AKIA 2N1GA 3KV9A 4O4LE 2WSSV 3TLSA 5FXWA 3TLVA 3GWHA 1WYBA 4G63A 3V5UA 4DMWA 4HN9A 2WQYA 3QNUA 2HN2A 5L3GB 4OK0A 3NBXX 4LF5T 1G8XA 2VKDA 4DUYT 2UUCT 4U3CA 4PK6A 3AVSA 4DV4T 2NTXA 2D9DA 2B76A 1I94T 1IBLT 1MIVA 2E9XD 5LG4A 4B3MT 4JEHB 1GQEA 1W0BA 2WMOA 2V7LA 2WY2A 3CQXC 3OBVE 3RC8A 5IUXA 2DWGA 2CA5A 1KNZA 2KSRA 2I6HA 3OKQA 2D5UA 4ZS3A 2I59A 2LSKA 5ABFA 5L4HA 2Y48B 4YLHA 5JRCA 2MYSA 4EYYR 3NVOA 3UT5E 3FXDB 5C3JA 3RYFE 3PUVF 4L5GA 3P4QA 3RKGA 5JDGA 2V7MA 4DVDA 1O3XA 4QXCB 3MZKB 4QH1A 2K9AA 2CLYC 2E5VA 1QSDA 2XQ6A 3ZYKA 3C4WA 4DBQA 2XPKA 5AQTB 4P09A 4PJJA 4EZHA 3N9QA 4ISSA 4IL4A 2CXFA 4YTNA 2BS4A 4EXTA 1FIOA 1YQ3A 3GMIA 2UXBT 1W0AA 1Y01A 4QWNB 1ZP0A 1MMGA 3NRXA 4QXHB 3VRAA 4U2ZA 4B6XA 2XAJB 5JREA 2UUBT 4HFDA 1D1AA 4MALA 4QH5A 4PW8A 1UCUA 4WW0A 4PK4A 4F6RC 2CHOA 4JI0T 2DL1A 3EVYA 3UU8A 4UIGA 3O4XE 2AE9A 3AAEB 3ZCJA 3G06A 2NP9A 4UF0B 4DR2T 2R6GF 5AQFB 3ONXA 2XUEA 4ILAA 5JR9B 2BS2A 4X1KE 3BK9A 4NUVA 4OYKA 4HFHA 3E0ZA 2VKOA 4CXWA 2MBGA 2V7KA 4KBMB 2VKJA 2LOSA 2JQHA 2X0HA 2VASA 1WLXA 5HEUA 1HNWT 5AQQB 2W00A 4UV8B 5LB7B 1NAFA 3OJAA 3QOFA 1NEKA 1B7TA 3KVAA 2IW5B 3AEBA 3AB3B 3CX8B 3CX6B 4JI5T 2VQFT 3RPUA 4TWHA 2W63A 4DMVA 3MJXA 3K3QC 2X9HA 2RPAA 1ZHCA 2MPKA 2E5LT 2IMLA 4TWFA 5LHIB 3Q9DA 4JI7T 2N2NA 3ZMSB 3ZLIA 3KVBA 2BKNA 4CN4A 1H7CA 3AXJB 3JC6D 4DR6T 3QB5K 2L8KA 1T98A 4KHPT 3ZC1A 3L3PA 1WCRA 3WI3A 1U5PA 4LMLA 2M6IA 4X65T 1HR0T 4IIJE 5AQUB 4K0KT 2EHOA 2M6BA 2YDRA 4IE6A 1HNZT 4TWDA 5FY1A 3ZSSA 4HGAA 2LE8A 3HL6A 3AA7B 4YSZA 2LSIA 4V1Av 4J2CA 3AA1B 2ODUA 5F8PA 5LGNB 4YXDA 2WAUA 4YHJA 4YHHT 2HPJA 1IJ5A 4H9RC 3CWZB 3C51A 3ETUA 1J1JA 3ZN0B 3RIUC 4JI6T 5J2TE 3DJBA 3HKBE 2IAKA 4EZ4A 5FL0A 3LK42 1U4QA 2V5CA 2KMFA 3EAMA 3P4SA 4DV1T 5JDMA 5AQIB 5LMUT 3PUAA 3LBXA 3VRBA 4EGWA 3IHRA 5C8YE 3HA4A 5EK4A 2E8IA 5EK2A 1R8IA 4Z8XA 4HEAA 1KEYA 3UU6A 4CN1A 5LYJE 4QX8B 4DR4T 1XDPA 3ZYLA 3UQ4A 3NZPA 5L3BB 3KBUA 4QXBB 2J62A 1KNRA 4YSXA 1WFDA 4U7YA 3UU3A 1IJ6A 3IA3A 5ABEA 2CWYA 4WZXA 4U33A 1CHUA 1KF6A 2WZIA 4P0AA 3C4ZA 2BG9B 2Z6EA 4HFVA 3W15B 3QC9A 3PU3A 5ABFB 2H89A 4YFSA 5JDNA 4HWHA 1XMOT 2UXDT 1LVKA 2E9XC 4AQGA 3ETVA 1D0YA 3AE3A 1E2AA 5FXXA 4KP3C 4X1YE 5GONE 4AI6A 4M1PA 2XHEB 5JDHA 2VL8A 4AQFC 3RKOA 4EEBA 3PDYA 3HKEE 5J1GA 3J9X1 3U3IA 2UXXB 4WBOA 3FZMB 2XAHB 2DHRA 1LRZA 3RF1A 2XASB 2ZM0A 3UUNA 3SFDA 4XZCA 3F57A 4GK0E 4IE5A 3FZKB 3RRCA 4EAHA 4HWDA 2VL0A 3FB2A 4TNWA 2DI4A 4AISA 3P8CD 4ANJA 2LLYA 3ANWB 3VHLA 3ZT7A 3T8OA 4PJMA 4WYVA 2VURA 3LK3B 4IDPA 2WMNA 4QX7B 3U78A 3RIUA 5HEOA 4CI1B 2D0TA 3P50A 2LM2A 4HE8A 4B3ST 5LGTB 3NZQA 4H63V 1ZKEA 1BR4A 1UK5A 2WBLA 3AAIA 3ABVA 4DR5T 2CXLA 4C91A 5JTGA 3O1IA 4DIDB 4AXPA 5KMGP 1D0XA 4IDOA 4KMCA 1ZV4X 3RLFF 2LHNA 2IDOB 1XMQT 2QRXA 4JI1T 3NKZA 4TX5A 4PJLA 3VKHA 4O2AE 4NUUA 4YJ2E 5LP6E 2OLTA 2KXPB 2P9BA 3L8RA 2LRKA 5HAXA 2FJAA 3ZYMA 1KFYA 3HKCE 4DNDA 2C5JA 4ZXLA 1ZEEA 2D2SA 2PFVA 2F4VT 5FVKA 2X9WA 5AQMB 3ZSTA 1N34T 1J5ET 4ZZBA 1IZNB 3VKGA 2CCQA 2CRBA 2W4XA 1L0VA 3FZLB 5JQGE 3P4RA 3ZT5A 4I4TE 3FXEB 2X66A 2V6YA 1VOMA 2CE7A 1N32T 4ILBA 2FBWA 2ODVA 3J7Yq 1YKEB 2E9XA 2HH7A 4H9PC 2LSYA 2HN1A 2CWOA 3ESLA 2L3LA 2HHHT 3RIFA 2NWBA 4X62T 4X5TA 2VWAA 3BQLA 2EHOB 5LHHB 3AE7A 3PUYF 4CQIA 4AQFA 4CI2B 2XQ8A 2VKHA 2XSBA 2KLQA 4DUZT 1Z8UA 2VK9A 2XQAA 2BZBA 5HCJA 4YTMA 2JQQA 3P4WA 3N9MA 1MNDA 4UXNB 4B3RT 3T1YT 4XAXB 2W2UA 4ISTA 3M3ZB 2XAFB 4ZI3C 2Q9QC 3GN5A 3LSVA 5F3JA 4O4IE 2E2AA 1HNXT 3HI2A 4LF8T 4I50E 2G0UA 4DV2T 3I9WA 4TN7B 5CA0E 4H63H 3AVRA 2BVMA 5AQVB 5AFUL 2X9XA 4H9OC 2KWIB 3OTOT 3CVRA 1IBMT 2WDRA 3JADA 1LKXA 3B5MA 2YEVC 3ZJ1A 1XNRT 1US7B 2JPFA 2XQ4A 1YD8G 3HKDE 2CPTA 4O2BE 1V9DA 3PU8A 2CMRA 5HXCA 4QHOA 1Y64B 1E1HB 2YINA 5JR9C 5CJ5A 3LDQB 2RP4A 2FJDA 3OYZA 3ZT6A 5L3EB 4KI0F 3TLWA 3TKLB 4IE7A 5FXVA 1BR2A 4ZI2D 5HXEA 2SPCA 3D0TA 3RX6A 4DV3T 3ZMVB 3CPZA 3PE0A 3GA8A 2WWUA 2YU2A 3EHZA 2NW7A 2CHNA 2FJBA 3PURA 3WAJA 3SS1A 3UUXB 5CB4E 3K8PC 4O4HE 2JIWA 4ZHQE 3AEAA 1Z0PA 2L9QA 3EABA 4AKGA 2EHOD 1D1CA 1CUNA 4PAGA 1YXRA 2J47A 4DO0A 1MIWA 3R6NA 3AE9A 2W61A 3C50A 1YKHB 3AA6B 2XAGB 3IF8B 3UUMA 3RYCE 1I6ZA 3RIAA 3VR8A 3NWIA 4ILCA 2FJEA 2UU9T 1X79A 4WNKA 1M62A 4IE0A 4NXNT 3CQCB 3FZFB 4DBRA 2XY8B 4TNVA 2A72A 1OEDB 5FY0A 4Z91A 2YU1A 2Q9QA 2J4GA 1S35A 3QB5A 1JNRA 2WU2A 3AEDA 4OFZA 4ASKA 2LOPA 4JUYA 4Q25A 3ONJA 5L47A 5EZYE 3I9YA 3Q2MA 3JAEA 2V7JA 3K1SA 5H6RB 4FJOA 1SE7A 3DP7A 4GKKT 2XSAA 1FEWA 2V26A 5LJMA 2LSGA 4MBQA 3HR0A 2VVNA 3FZHB 2KNDA 5L3CB 3H3AA 3A7MA 5DJQC 1WYCA 3EDVA 5HYAA 2LKHA 5AQKB 5KDMC 4COFA 4ZI7E 3KV6A 3FBLA 2XAQB 3EDUA 3P4PA 5JR9A 2YDSA 2CXDA 4Z90A 2IIUA 3UU4A 4ZZCA 1DU2A 3S4UA 4CN6A 1HS7A 1E7PA 3RGLA 3UQ7A 4JV5T 2LHRA 4HTEA 4DR3T 4TV9E 4O4JE 4EEDA 5HEJA 5HXSA 1OXZA 4JBWF 3UUBA 4LF7T 3OVUA 4DR1T 2BS3A 1BR0A 3Q5WA 2V6YB 4X1IE 1W9RA 4HWCA 5JRCB 4GIWA 3P7IA 2M67A 3O1HA 3E08A 3N5LA 2BG9C 2JMKA 5AQOB 2CBJA 3V5SA 4YT0A 1MNEA 5FKYA 2LKGA 1SHZC 3DTOA 5AQGB 4CI3B 3AXJA 5ABHA 3Q5DA 2H7VC 2QGSA 3C4XA 2DNXA 4ERRA 5CFBA 4H9QC 1MMAA 3CK6A 2PG8A 4K0UA 1EZ3A 2ZLYA 2UUAT 2LT3A 1M7KA 2WS3A 4P1NA 3BQIA 2V6XA 3WAKA 1SUMB 1VRBA 3ZCIA 4HFEA 2N9DA 2NTYA 1OEDE 2XM2A 5FYMA 3QK6A 5L4EA 5AQSB 4TUYE 4B3TT 4YY3T 4GOUA 3N2GE 4H9SE 2LSJA 4JI4T 1WR6A 3AE2A 3LFMA 2I0MA 2WWVA 5KX5E 4DV0T 2ES0A 2JQKA 3FHNA 3A5XA 3AEEA 4EV6A 4AKHA 3UFEA 4C90A 2W0GA 5LMNT 4HFBA 4LFBT 1HX1B 1SA0E 2H88A 2YK0A 3SFEA 2XQYA 4N78D 4E7SA 4U2YA 3PUWF 5LG3A 3AE1A 5FXZA 4IT4A 2OV9A 2KINB 1D0ZA 1HF8A 2UXNB 3E22E 2XJ7A 1ZOYA 2QYWA 4IREA 2A2FX 2ZM6T 3ZJ2A 3UULA 2ZM8A 5FNVE 5LXTE 1QUUA 5JH7E 4MHCA 5HWYA 2WDVA 5IYZE 2BG9E 3ZPOA 2K3WA 1FJGT 3AEGA 4X66T 1N33T 2KT9A 5DQVA 4HFCA 2QA7A 2MOZA 4MFRA 2BBJA 5ABGA 4PJNA 4ZI2C 3ZMTB 4AQYT 5M4YA 2BG9A 4BJNA 5AQPB 2C5KT 2NR4A 4LMJA 3RH3A 2K48A 4BAYB 1T7SA 2XZEA 4HWIB 4DV6T 5ETWA 2CLYB 5AQHB 2NW9A 3ZMUB 3RI5A 1KK7A 1NWMX 4JI2T 4NPPA 3X1DA 3RRWA 4EYUA 3JC6C 2NW8A 2RA1A 5LOVE 3MACA 1UX5A 4UEMA 4L0RA 4IDNA 4GK5E 1MMNA 2EHOC 1FMVA 4OHFA 3EUHA 4IGUA 4YTPA 2XQ5A 4PFPA 4IL9A 2LEHA 4TZ4C 5DABA 4I43B 5J0ZA 2WB5A 2LM9A 2Q9QB 2K5BB 2X0LB 4IDZA 4JLEA 3RHWA 4LF9T 2XTLA 3PJAJ 4LMKA 4F8HA 2V5DA 1FMWA 1NENA 2A9UA 2LJLA 2JJ9A 2KZ7B 1T8BA 2WZHA 2BBHA 1YW0A 2B1EA 2LRLA 3ANWA 5AQJB 2C0SA 4OYJA 1AJ3A 2J1DG 3K3NA 5AQNB 5BMVE 3AECA 4CZZB 3LBXB 2H7OA 5L2LA 2JRKA 2NOXA 2MTQA 5AQRB 2W66A 3MKDA 1W09A 3C64A 3R84B 2IHR1 4IHJE 3BQKA 3T1HT 3N2KE 2CBIA 5LBQB 1IBKT 4U74A 5LGUB 4GYSA 2WCAA 3MXZA 2BKPA 3L39A 2K24A 4QH4A 2IC6A 2H3RA 4A56A 5LBMA 2ACXA 3AE5A 1MIYA 2WDQA 4PNIA 3M65A 1KNPA 3N2OA 3LJCA 5IHYA 3PUZF 5FL1A 2BKOA 2MAWA 5L3DB 1WRDA 4JEUB 2VVSA 3L09A 3TLTA 2UXCT 1LVFA 4DV7T 3ZC0A 4A5XA 3H37A 5LCYA 2FUPA 2PBIA 2BDEA 4P0BA 3ZKRA 4O8SA 2AXDS 1XZYA 3PTRB 4I0UA 3RYHE 1N36T 3LG7A 3CQGB 3RQUA 4A97A 1X9BA 4KUMB 4X20E 4ADZA 5HEHA 2PTFA 2X51A 3NRYA 4XBFB 2PJQA 1HFAA 3CKDA 1VCTA 2JMHA 4DR7T 3K3OA 4KX6A 3F2EA 4JI8T 2DLRA 3PUGA 4ILUA 3N9PA 4LFAT 2IC9A 3OYXA 4OX9T 3MA9A 3VR9A 1HG5A 3UTKA 2VQET 3PUQA 1J5WA 5AQLB 5L3FB 2V8SV 2IUBA 3AAAB 5CGMA 4ZEYA 4ZI3D 2Q9QD 3PUXF 2VB6A 5LA6E 3I0OA 3ZN1B 5LHGB 5LNKA 4IE4A 1XDOA 1HG2A 3O9XA 5KXJA 4ZOLE 3QUJA 4UELA 1S94A 4NXMT 2ACZA 2W67A 3LK2B 5BR8T 4U7IA 2X67A 5DQWA 1OEDC 4G2AA 3PV0F 4WBNE 2YDQA 3N9OA 2X9YA 5FMNA 3ZEFB 1XWMA 3RYIE 5F5WA 3RQWA 2DCFA 4KHZF 2WU5A 4AIUA 2BVLA 3SOLA 4PFOA 2Y8DA 3A8YC 3C98B 3H3MA 5JDQA 3TLUA 5FVLA 3AE6A 4MLKA 4UF0A 3Q5EA 3MK7C 4EOZB 5HXHA 5HEGA 4UVCB 2XM1A 2XQ9A 4UR9A 2ZM2A 4PK5A 1UX4A 5J2UE 2YN6A 2A3DA 3EI0A 4U31A 4CXXA 3AE4A 1UURA 5ADXL 1D1BA 1QLBA 5HCMA 2WP9A 3PUSA 4NIQA 2QVAA 3PJAA 3O1JA 3IBPA 3IEEA 5LJNA 5A1LA 5EK3A 3KFWX 4LFCT 4TV8E 5IWAT 2JQ9A 3CIRA 4X64T 4I55E 5CA1E 4YSYA 4HKAA 3F31A 1T72A 2C5IT 2X0YA 4YJ3E 4HWFA 4E7ZA 3JAFA 3ONLC 2E9XB 5HWXA 3CX7B 3ZMZB 4L9IA 4LF4T 1XNQT 3CMLA 5JVDE 4EIWA 4LF6T 4FI5A 3AEFA
chains in the Genus database with same CATH topology
4J2CA 2KWIB 4QKNA 3AA1B 3CVRA 1MMDA 2A2FX 4GYRA 3B13A 3ZJ2A 3UULA 2ZM8A 1LKXA 2ODUA 5FNVE 5F8PA 2V1DB 5LXTE 1QUUA 5LGNB 2WAUA 3SWHA 5JH7E 1HTJF 4MHCA 5HWYA 2YEVC 4YHJA 3ZJ1A 5IYZE 2HPJA 1US7B 2Y6XA 3ZPOA 5HXRA 1IJ5A 3KDSE 4H9RC 2JPFA 4BA9A 1BR1A 3CWZB 1YD8G 3HKDE 2KT9A 5DQVA 4O2BE 1V9DA 1HX8A 1HCIA 3PU8A 2QA7A 3VU7H 4UVAB 2CMRA 3C51A 4H9NC 5HXCA 2DWKA 1Y64B 2X68A 2MOZA 2V7IA 3ETUA 4QHOA 3KINB 5FP3A 4MFRA 1E1HB 3ZN0B 4PJNA 4ZI2C 3ZMTB 2HPLA 2YINA 3RC3A 5JR9C 3AA0B 2CEAA 5M4YA 5J2TE 3DJBA 3HKBE 2D0UA 2RP4A 2IAKA 4BJNA 3OYZA 5L3EB 4EZ4A 3LK42 3GN5B 1U4QA 2C5KT 3TKLB 4IE7A 5FXVA 2CM0A 3RH3A 5TAOA 1BR2A 3B57A 2K48A 4ZI2D 5HXEA 4BAYB 2KMFA 2SPCA 3D0TA 3N9LA 4EB6E 4CXYA 2ZMAA 5JDMA 3RX6A 3Q5XA 3FBZA 5E0OA 5ETWA 5H6QB 2CLYB 2NW9A 3ZMUB 4UVBB 3ZMVB 4U72A 2W62A 3CPZA 3PE0A 1KK7A 1NWMX 2KWHA 3KV5A 4BJMA 3I0QA 3SRZA 3GA8A 3PUAA 3LBXA 2WWUA 3RRWA 3IHRA 2WM9A 5FY7A 4EYUA 5C8YE 3JC6C 1G73A 2NW8A 2RA1A 3HA4A 4UV9B 5EK4A 2YU2A 2E8IA 5LOVE 3MACA 5EK2A 1UX5A 2NW7A 4Z8XA 3PURA 1IAPA 3KV4A 3N9NA 4L0RA 4UEMA 4HEAA 4AKLA 2OA5A 3WAJA 3SS1A 4GK5E 1MMNA 2EHOC 1FMVA 4OHFA 3UUXB 4QX8B 5CB4E 3EUHA 3K8PC 4IGUA 4O4HE 3KBTA 4ZHQE 4AKRB 4PFPA 2LEHA 3I1AA 1OWAA 3ZYLA 5JDLA 4TZ4C 5DABA 4I43B 3NZPA 2GK9A 1Z0PA 5L3BB 2L9QA 3KBUA 4QXBB 4ZS2A 4AKGA 2LM9A 2Q9QB 2EHOD 2K5BB 2X0LB 4IDZA 1IJ6A 1D1CA 1CUNA 4PAGA 4JLEA 5JDFA 4AKIA 4DO0A 2N1GA 2CWYA 1MIWA 2WSSV 3KV9A 4O4LE 5FXWA 3R6NA 2XTLA 4P0AA 2W61A 3C50A 1YKHB 3AA6B 2XAGB 3C4ZA 3GWHA 3IF8B 3UUMA 1WYBA 4G63A 2Z6EA 4HFVA 3W15B 3QC9A 1FMWA 3RYCE 3PU3A 3V5UA 4DMWA 2LJLA 2JJ9A 4HN9A 2KZ7B 1YW0A 2B1EA 5L3GB 3ANWA 4YFSA 1X79A 4OK0A 5JDNA 2C0SA 4WNKA 4OYJA 3NBXX 1AJ3A 2J1DG 3K3NA 4IE0A 5BMVE 1LVKA 2E9XC 4AQGA 3CQCB 1G8XA 4CZZB 3ETVA 2VKDA 4DBRA 3LBXB 2H7OA 1D0YA 2JRKA 2NOXA 5L2LA 5FXXA 2A72A 4KP3C 4PK6A 4X1YE 5FY0A 2MTQA 5GONE 3AVSA 4AI6A 2YU1A 2Q9QA 3MKDA 2NTXA 4M1PA 3C64A 1S35A 3R84B 4IHJE 3BQKA 1MIVA 2E9XD 5LG4A 2XHEB 4JEHB 5JDHA 3N2KE 2VL8A 4OFZA 4ASKA 4AQFC 2LOPA 4JUYA 5LBQB 3RKOA 2WMOA 3OBVE 2V7LA 3CQXC 4U74A 3PDYA 4GYSA 5LGUB 3RC8A 2DWGA 2CA5A 3MXZA 5EZYE 3HKEE 3I9YA 1KNZA 3Q2MA 5J1GA 3J9X1 3OKQA 2D5UA 3U3IA 2UXXB 4WBOA 5LYJE 2K24A 2V7JA 4ZS3A 5H6RB 2IC6A 2H3RA 4A56A 4FJOA 5LBMA 2I59A 2LSKA 2ACXA 2XAHB 2Y48B 3DP7A 1MIYA 2DHRA 1LRZA 4YLHA 4PNIA 3M65A 5JRCA 2XASB 2ZM0A 2MYSA 4EYYR 1FEWA 3N2OA 3UUNA 3LJCA 2V26A 4XZCA 3UT5E 3FXDB 5IHYA 3F57A 5LJMA 4GK0E 3RYFE 2LSGA 4IE5A 4MBQA 4L5GA 3RRCA 4EAHA 1WRDA 5L3DB 3FB2A 4JEUB 3HR0A 3L09A 5JDGA 2V7MA 4DVDA 1O3XA 2DI4A 4QXCB 3MZKB 3P8CD 4ANJA 3ANWB 3VHLA 1LVFA 2K9AA 3ZC0A 2CLYC 2KNDA 3H37A 5LCYA 5L3CB 3H3AA 1QSDA 5DJQC 3T8OA 4PJMA 3ZYKA 3C4WA 4DBQA 1WYCA 3LK3B 3EDVA 2PBIA 5HYAA 2WMNA 4P09A 2BDEA 4P0BA 4QX7B 3U78A 4ZI7E 5KDMC 3KV6A 3FBLA 2XAQB 3EDUA 4O8SA 4PJJA 5JR9A 3PTRB 4EZHA 4CI1B 2CXDA 3N9QA 3RYHE 3LG7A 2D0TA 3CQGB 3S4UA 4KUMB 4ISSA 4X20E 4ADZA 4HE8A 2X51A 1HS7A 3NRYA 5LGTB 3NZQA 4H63V 2CXFA 1ZKEA 1BR4A 4EXTA 2WBLA 3AAIA 1FIOA 3GMIA 4XBFB 2PJQA 2LHRA 2CXLA 4C91A 4HTEA 1HFAA 3O1IA 4TV9E 3CKDA 4O4JE 4AXPA 4QWNB 2JMHA 5HXSA 1MMGA 3NRXA 1OXZA 4QXHB 4B6XA 3K3OA 2XAJB 1D0XA 5KMGP 5JREA 3F2EA 2DLRA 3PUGA 4ILUA 4KMCA 3N9PA 1ZV4X 2IC9A 3OYXA 2LHNA 3MA9A 3Q5WA 1D1AA 1BR0A 4MALA 1HG5A 3UTKA 4PW8A 1UCUA 4X1IE 3PUQA 4TX5A 5JRCB 4PJLA 3VKHA 4O2AE 4GIWA 4NUUA 3P7IA 4WW0A 4PK4A 5L3FB 4F6RC 4YJ2E 2M67A 3AAAB 3O1HA 5LP6E 3E08A 3N5LA 4ZI3D 2KXPB 2P9BA 2Q9QD 2JMKA 5HAXA 2VB6A 3EVYA 5LA6E 3I0OA 3ZYMA 3ZN1B 3HKCE 5LHGB 5LNKA 4UIGA 3O4XE 4DNDA 3V5SA 1MNEA 2C5JA 4IE4A 1ZEEA 2D2SA 3AAEB 2PFVA 1HG2A 1SHZC 3DTOA 3O9XA 4ZOLE 3ZCJA 3QUJA 2NP9A 4UF0B 2X9WA 4UELA 1S94A 3ONXA 4CI3B 2XUEA 1IZNB 3LK2B 3VKGA 2X67A 5DQWA 2H7VC 5JR9B 2CCQA 2QGSA 3C4XA 4X1KE 3BK9A 4NUVA 2DNXA 4G2AA 4ERRA 5JQGE 4H9QC 4WBNE 1MMAA 4OYKA 3N9OA 2PG8A 3E0ZA 4K0UA 1EZ3A 2ZLYA 2LT3A 2X9YA 5FMNA 2VKOA 4CXWA 2MBGA 2V7KA 4I4TE 3FXEB 4KBMB 2VKJA 2LOSA 2X66A 1VOMA 3ZEFB 3RYIE 3BQIA 2VASA 1WLXA 2CE7A 3WAKA 1VRBA 2ODVA 2DCFA 3ZCIA 3J7Yq 1YKEB 2E9XA 2HH7A 4H9PC 2LSYA 2N9DA 2NTYA 2CWOA 2BVLA 2W00A 3ESLA 5FYMA 4UV8B 2L3LA 3SOLA 2NWBA 3QK6A 1NAFA 3OJAA 4PFOA 1B7TA 2Y8DA 3C98B 5JDQA 4TUYE 2VWAA 3KVAA 2IW5B 3BQLA 4MLKA 4UF0A 3MK7C 4EOZB 2EHOB 5HXHA 3AB3B 4GOUA 5LHHB 3CX8B 3CX6B 4UVCB 3N2GE 4CQIA 4AQFA 3RPUA 4CI2B 2W63A 2ZM2A 4H9SE 4DMVA 2VKHA 3MJXA 4PK5A 1UX4A 3K3QC 5J2UE 2LSJA 1WR6A 2X9HA 2KLQA 2A3DA 1ZHCA 3LFMA 5LHIB 3Q9DA 5KX5E 2N2NA 3ZMSB 3ZLIA 3KVBA 2VK9A 2ES0A 4CXXA 2BZBA 2JQQA 1H7CA 5ADXL 1D1BA 3FHNA 3A5XA 3N9MA 1MNDA 3PUSA 4UXNB 3JC6D 3O1JA 4AKHA 4XAXB 2L8KA 1T98A 3IBPA 3UFEA 3IEEA 4ISTA 3ZC1A 2W0GA 2XAFB 4C90A 4ZI3C 5LJNA 3L3PA 2Q9QC 5A1LA 3GN5A 5EK3A 3KFWX 5F3JA 4TV8E 3WI3A 1U5PA 4O4IE 4I55E 5CA1E 4IIJE 4HKAA 3F31A 1SA0E 3HI2A 2C5IT 2YK0A 4I50E 4YJ3E 2EHOA 2G0UA 3I9WA 2XQYA 4N78D 4TN7B 4E7SA 4IE6A 4E7ZA 2E9XB 5HWXA 3CX7B 5CA0E 4H63H 3ZMZB 4L9IA 5FY1A 4HGAA 3AVRA 2BVMA 3CMLA 2LE8A 5FXZA 5JVDE 5AFUL 3HL6A 2KINB 1D0ZA 3AA7B 1HF8A 4EIWA 2UXNB 2X9XA 3E22E 4H9OC 2LSIA 4FI5A 4V1Av
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZ3 A;  2XHE B;  4TX5 A;  1BR0 A;  2DNX A;  4JEH B;  1G73 A;  1FIO A;  3C98 B;  1S94 A;  1HS7 A;  3LG7 A;  4JEU B;  5M4Y A;  1FEW A;  5LG4 A; 
#chains in the Genus database with same CATH topology
 4QKN A;  1MMD A;  4GYR A;  3B13 A;  2YKS A;  1WR0 A;  2V1D B;  3SWH A;  1HTJ F;  2Y6X A;  5C2T A;  5HXR A;  3KDS E;  4IDQ A;  4BA9 A;  1BR1 A;  3UU5 A;  1HX8 A;  1HCI A;  3VU7 H;  4UVA B;  4H9N C;  2DWK A;  2X68 A;  2V7I A;  5FP3 A;  3KIN B;  3AE8 A;  2HPL A;  3RC3 A;  4GKJ T;  1UGO A;  3AA0 B;  1VCS A;  2CEA A;  2D0U A;  3GN5 B;  2XQ3 A;  2XQ7 A;  2CM0 A;  5TAO A;  3OPC A;  3B57 A;  4EB6 E;  3N9L A;  4CXY A;  2ZMA A;  3Q5X A;  3FBZ A;  5E0O A;  5H6Q B;  4UVB B;  4U72 A;  2W62 A;  3JCF A;  2KWH A;  3KV5 A;  4BJM A;  1YQ4 A;  3I0Q A;  3SRZ A;  4HFI A;  2YOE A;  2WM9 A;  5FY7 A;  1G73 A;  4UV9 B;  1OED A;  1UUS A;  4DV5 T;  1IAP A;  3KV4 A;  3N9N A;  4AKL A;  3UFG A;  2OA5 A;  3KBT A;  4AKR B;  3I1A A;  1OWA A;  5JDL A;  4JYA T;  2GK9 A;  1JNZ A;  4ZS2 A;  4A98 A;  4JI3 T;  5JDF A;  4AKI A;  2N1G A;  3KV9 A;  4O4L E;  2WSS V;  3TLS A;  5FXW A;  3TLV A;  3GWH A;  1WYB A;  4G63 A;  3V5U A;  4DMW A;  4HN9 A;  2WQY A;  3QNU A;  2HN2 A;  5L3G B;  4OK0 A;  3NBX X;  4LF5 T;  1G8X A;  2VKD A;  4DUY T;  2UUC T;  4U3C A;  4PK6 A;  3AVS A;  4DV4 T;  2NTX A;  2D9D A;  2B76 A;  1I94 T;  1IBL T;  1MIV A;  2E9X D;  5LG4 A;  4B3M T;  4JEH B;  1GQE A;  1W0B A;  2WMO A;  2V7L A;  2WY2 A;  3CQX C;  3OBV E;  3RC8 A;  5IUX A;  2DWG A;  2CA5 A;  1KNZ A;  2KSR A;  2I6H A;  3OKQ A;  2D5U A;  4ZS3 A;  2I59 A;  2LSK A;  5ABF A;  5L4H A;  2Y48 B;  4YLH A;  5JRC A;  2MYS A;  4EYY R;  3NVO A;  3UT5 E;  3FXD B;  5C3J A;  3RYF E;  3PUV F;  4L5G A;  3P4Q A;  3RKG A;  5JDG A;  2V7M A;  4DVD A;  1O3X A;  4QXC B;  3MZK B;  4QH1 A;  2K9A A;  2CLY C;  2E5V A;  1QSD A;  2XQ6 A;  3ZYK A;  3C4W A;  4DBQ A;  2XPK A;  5AQT B;  4P09 A;  4PJJ A;  4EZH A;  3N9Q A;  4ISS A;  4IL4 A;  2CXF A;  4YTN A;  2BS4 A;  4EXT A;  1FIO A;  1YQ3 A;  3GMI A;  2UXB T;  1W0A A;  1Y01 A;  4QWN B;  1ZP0 A;  1MMG A;  3NRX A;  4QXH B;  3VRA A;  4U2Z A;  4B6X A;  2XAJ B;  5JRE A;  2UUB T;  4HFD A;  1D1A A;  4MAL A;  4QH5 A;  4PW8 A;  1UCU A;  4WW0 A;  4PK4 A;  4F6R C;  2CHO A;  4JI0 T;  2DL1 A;  3EVY A;  3UU8 A;  4UIG A;  3O4X E;  2AE9 A;  3AAE B;  3ZCJ A;  3G06 A;  2NP9 A;  4UF0 B;  4DR2 T;  2R6G F;  5AQF B;  3ONX A;  2XUE A;  4ILA A;  5JR9 B;  2BS2 A;  4X1K E;  3BK9 A;  4NUV A;  4OYK A;  4HFH A;  3E0Z A;  2VKO A;  4CXW A;  2MBG A;  2V7K A;  4KBM B;  2VKJ A;  2LOS A;  2JQH A;  2X0H A;  2VAS A;  1WLX A;  5HEU A;  1HNW T;  5AQQ B;  2W00 A;  4UV8 B;  5LB7 B;  1NAF A;  3OJA A;  3QOF A;  1NEK A;  1B7T A;  3KVA A;  2IW5 B;  3AEB A;  3AB3 B;  3CX8 B;  3CX6 B;  4JI5 T;  2VQF T;  3RPU A;  4TWH A;  2W63 A;  4DMV A;  3MJX A;  3K3Q C;  2X9H A;  2RPA A;  1ZHC A;  2MPK A;  2E5L T;  2IML A;  4TWF A;  5LHI B;  3Q9D A;  4JI7 T;  2N2N A;  3ZMS B;  3ZLI A;  3KVB A;  2BKN A;  4CN4 A;  1H7C A;  3AXJ B;  3JC6 D;  4DR6 T;  3QB5 K;  2L8K A;  1T98 A;  4KHP T;  3ZC1 A;  3L3P A;  1WCR A;  3WI3 A;  1U5P A;  4LML A;  2M6I A;  4X65 T;  1HR0 T;  4IIJ E;  5AQU B;  4K0K T;  2EHO A;  2M6B A;  2YDR A;  4IE6 A;  1HNZ T;  4TWD A;  5FY1 A;  3ZSS A;  4HGA A;  2LE8 A;  3HL6 A;  3AA7 B;  4YSZ A;  2LSI A;  4V1A v;  4J2C A;  3AA1 B;  2ODU A;  5F8P A;  5LGN B;  4YXD A;  2WAU A;  4YHJ A;  4YHH T;  2HPJ A;  1IJ5 A;  4H9R C;  3CWZ B;  3C51 A;  3ETU A;  1J1J A;  3ZN0 B;  3RIU C;  4JI6 T;  5J2T E;  3DJB A;  3HKB E;  2IAK A;  4EZ4 A;  5FL0 A;  3LK4 2;  1U4Q A;  2V5C A;  2KMF A;  3EAM A;  3P4S A;  4DV1 T;  5JDM A;  5AQI B;  5LMU T;  3PUA A;  3LBX A;  3VRB A;  4EGW A;  3IHR A;  5C8Y E;  3HA4 A;  5EK4 A;  2E8I A;  5EK2 A;  1R8I A;  4Z8X A;  4HEA A;  1KEY A;  3UU6 A;  4CN1 A;  5LYJ E;  4QX8 B;  4DR4 T;  1XDP A;  3ZYL A;  3UQ4 A;  3NZP A;  5L3B B;  3KBU A;  4QXB B;  2J62 A;  1KNR A;  4YSX A;  1WFD A;  4U7Y A;  3UU3 A;  1IJ6 A;  3IA3 A;  5ABE A;  2CWY A;  4WZX A;  4U33 A;  1CHU A;  1KF6 A;  2WZI A;  4P0A A;  3C4Z A;  2BG9 B;  2Z6E A;  4HFV A;  3W15 B;  3QC9 A;  3PU3 A;  5ABF B;  2H89 A;  4YFS A;  5JDN A;  4HWH A;  1XMO T;  2UXD T;  1LVK A;  2E9X C;  4AQG A;  3ETV A;  1D0Y A;  3AE3 A;  1E2A A;  5FXX A;  4KP3 C;  4X1Y E;  5GON E;  4AI6 A;  4M1P A;  2XHE B;  5JDH A;  2VL8 A;  4AQF C;  3RKO A;  4EEB A;  3PDY A;  3HKE E;  5J1G A;  3J9X 1;  3U3I A;  2UXX B;  4WBO A;  3FZM B;  2XAH B;  2DHR A;  1LRZ A;  3RF1 A;  2XAS B;  2ZM0 A;  3UUN A;  3SFD A;  4XZC A;  3F57 A;  4GK0 E;  4IE5 A;  3FZK B;  3RRC A;  4EAH A;  4HWD A;  2VL0 A;  3FB2 A;  4TNW A;  2DI4 A;  4AIS A;  3P8C D;  4ANJ A;  2LLY A;  3ANW B;  3VHL A;  3ZT7 A;  3T8O A;  4PJM A;  4WYV A;  2VUR A;  3LK3 B;  4IDP A;  2WMN A;  4QX7 B;  3U78 A;  3RIU A;  5HEO A;  4CI1 B;  2D0T A;  3P50 A;  2LM2 A;  4HE8 A;  4B3S T;  5LGT B;  3NZQ A;  4H63 V;  1ZKE A;  1BR4 A;  1UK5 A;  2WBL A;  3AAI A;  3ABV A;  4DR5 T;  2CXL A;  4C91 A;  5JTG A;  3O1I A;  4DID B;  4AXP A;  5KMG P;  1D0X A;  4IDO A;  4KMC A;  1ZV4 X;  3RLF F;  2LHN A;  2IDO B;  1XMQ T;  2QRX A;  4JI1 T;  3NKZ A;  4TX5 A;  4PJL A;  3VKH A;  4O2A E;  4NUU A;  4YJ2 E;  5LP6 E;  2OLT A;  2KXP B;  2P9B A;  3L8R A;  2LRK A;  5HAX A;  2FJA A;  3ZYM A;  1KFY A;  3HKC E;  4DND A;  2C5J A;  4ZXL A;  1ZEE A;  2D2S A;  2PFV A;  2F4V T;  5FVK A;  2X9W A;  5AQM B;  3ZST A;  1N34 T;  1J5E T;  4ZZB A;  1IZN B;  3VKG A;  2CCQ A;  2CRB A;  2W4X A;  1L0V A;  3FZL B;  5JQG E;  3P4R A;  3ZT5 A;  4I4T E;  3FXE B;  2X66 A;  2V6Y A;  1VOM A;  2CE7 A;  1N32 T;  4ILB A;  2FBW A;  2ODV A;  3J7Y q;  1YKE B;  2E9X A;  2HH7 A;  4H9P C;  2LSY A;  2HN1 A;  2CWO A;  3ESL A;  2L3L A;  2HHH T;  3RIF A;  2NWB A;  4X62 T;  4X5T A;  2VWA A;  3BQL A;  2EHO B;  5LHH B;  3AE7 A;  3PUY F;  4CQI A;  4AQF A;  4CI2 B;  2XQ8 A;  2VKH A;  2XSB A;  2KLQ A;  4DUZ T;  1Z8U A;  2VK9 A;  2XQA A;  2BZB A;  5HCJ A;  4YTM A;  2JQQ A;  3P4W A;  3N9M A;  1MND A;  4UXN B;  4B3R T;  3T1Y T;  4XAX B;  2W2U A;  4IST A;  3M3Z B;  2XAF B;  4ZI3 C;  2Q9Q C;  3GN5 A;  3LSV A;  5F3J A;  4O4I E;  2E2A A;  1HNX T;  3HI2 A;  4LF8 T;  4I50 E;  2G0U A;  4DV2 T;  3I9W A;  4TN7 B;  5CA0 E;  4H63 H;  3AVR A;  2BVM A;  5AQV B;  5AFU L;  2X9X A;  4H9O C;  2KWI B;  3OTO T;  3CVR A;  1IBM T;  2WDR A;  3JAD A;  1LKX A;  3B5M A;  2YEV C;  3ZJ1 A;  1XNR T;  1US7 B;  2JPF A;  2XQ4 A;  1YD8 G;  3HKD E;  2CPT A;  4O2B E;  1V9D A;  3PU8 A;  2CMR A;  5HXC A;  4QHO A;  1Y64 B;  1E1H B;  2YIN A;  5JR9 C;  5CJ5 A;  3LDQ B;  2RP4 A;  2FJD A;  3OYZ A;  3ZT6 A;  5L3E B;  4KI0 F;  3TLW A;  3TKL B;  4IE7 A;  5FXV A;  1BR2 A;  4ZI2 D;  5HXE A;  2SPC A;  3D0T A;  3RX6 A;  4DV3 T;  3ZMV B;  3CPZ A;  3PE0 A;  3GA8 A;  2WWU A;  2YU2 A;  3EHZ A;  2NW7 A;  2CHN A;  2FJB A;  3PUR A;  3WAJ A;  3SS1 A;  3UUX B;  5CB4 E;  3K8P C;  4O4H E;  2JIW A;  4ZHQ E;  3AEA A;  1Z0P A;  2L9Q A;  3EAB A;  4AKG A;  2EHO D;  1D1C A;  1CUN A;  4PAG A;  1YXR A;  2J47 A;  4DO0 A;  1MIW A;  3R6N A;  3AE9 A;  2W61 A;  3C50 A;  1YKH B;  3AA6 B;  2XAG B;  3IF8 B;  3UUM A;  3RYC E;  1I6Z A;  3RIA A;  3VR8 A;  3NWI A;  4ILC A;  2FJE A;  2UU9 T;  1X79 A;  4WNK A;  1M62 A;  4IE0 A;  4NXN T;  3CQC B;  3FZF B;  4DBR A;  2XY8 B;  4TNV A;  2A72 A;  1OED B;  5FY0 A;  4Z91 A;  2YU1 A;  2Q9Q A;  2J4G A;  1S35 A;  3QB5 A;  1JNR A;  2WU2 A;  3AED A;  4OFZ A;  4ASK A;  2LOP A;  4JUY A;  4Q25 A;  3ONJ A;  5L47 A;  5EZY E;  3I9Y A;  3Q2M A;  3JAE A;  2V7J A;  3K1S A;  5H6R B;  4FJO A;  1SE7 A;  3DP7 A;  4GKK T;  2XSA A;  1FEW A;  2V26 A;  5LJM A;  2LSG A;  4MBQ A;  3HR0 A;  2VVN A;  3FZH B;  2KND A;  5L3C B;  3H3A A;  3A7M A;  5DJQ C;  1WYC A;  3EDV A;  5HYA A;  2LKH A;  5AQK B;  5KDM C;  4COF A;  4ZI7 E;  3KV6 A;  3FBL A;  2XAQ B;  3EDU A;  3P4P A;  5JR9 A;  2YDS A;  2CXD A;  4Z90 A;  2IIU A;  3UU4 A;  4ZZC A;  1DU2 A;  3S4U A;  4CN6 A;  1HS7 A;  1E7P A;  3RGL A;  3UQ7 A;  4JV5 T;  2LHR A;  4HTE A;  4DR3 T;  4TV9 E;  4O4J E;  4EED A;  5HEJ A;  5HXS A;  1OXZ A;  4JBW F;  3UUB A;  4LF7 T;  3OVU A;  4DR1 T;  2BS3 A;  1BR0 A;  3Q5W A;  2V6Y B;  4X1I E;  1W9R A;  4HWC A;  5JRC B;  4GIW A;  3P7I A;  2M67 A;  3O1H A;  3E08 A;  3N5L A;  2BG9 C;  2JMK A;  5AQO B;  2CBJ A;  3V5S A;  4YT0 A;  1MNE A;  5FKY A;  2LKG A;  1SHZ C;  3DTO A;  5AQG B;  4CI3 B;  3AXJ A;  5ABH A;  3Q5D A;  2H7V C;  2QGS A;  3C4X A;  2DNX A;  4ERR A;  5CFB A;  4H9Q C;  1MMA A;  3CK6 A;  2PG8 A;  4K0U A;  1EZ3 A;  2ZLY A;  2UUA T;  2LT3 A;  1M7K A;  2WS3 A;  4P1N A;  3BQI A;  2V6X A;  3WAK A;  1SUM B;  1VRB A;  3ZCI A;  4HFE A;  2N9D A;  2NTY A;  1OED E;  2XM2 A;  5FYM A;  3QK6 A;  5L4E A;  5AQS B;  4TUY E;  4B3T T;  4YY3 T;  4GOU A;  3N2G E;  4H9S E;  2LSJ A;  4JI4 T;  1WR6 A;  3AE2 A;  3LFM A;  2I0M A;  2WWV A;  5KX5 E;  4DV0 T;  2ES0 A;  2JQK A;  3FHN A;  3A5X A;  3AEE A;  4EV6 A;  4AKH A;  3UFE A;  4C90 A;  2W0G A;  5LMN T;  4HFB A;  4LFB T;  1HX1 B;  1SA0 E;  2H88 A;  2YK0 A;  3SFE A;  2XQY A;  4N78 D;  4E7S A;  4U2Y A;  3PUW F;  5LG3 A;  3AE1 A;  5FXZ A;  4IT4 A;  2OV9 A;  2KIN B;  1D0Z A;  1HF8 A;  2UXN B;  3E22 E;  2XJ7 A;  1ZOY A;  2QYW A;  4IRE A;  2A2F X;  2ZM6 T;  3ZJ2 A;  3UUL A;  2ZM8 A;  5FNV E;  5LXT E;  1QUU A;  5JH7 E;  4MHC A;  5HWY A;  2WDV A;  5IYZ E;  2BG9 E;  3ZPO A;  2K3W A;  1FJG T;  3AEG A;  4X66 T;  1N33 T;  2KT9 A;  5DQV A;  4HFC A;  2QA7 A;  2MOZ A;  4MFR A;  2BBJ A;  5ABG A;  4PJN A;  4ZI2 C;  3ZMT B;  4AQY T;  5M4Y A;  2BG9 A;  4BJN A;  5AQP B;  2C5K T;  2NR4 A;  4LMJ A;  3RH3 A;  2K48 A;  4BAY B;  1T7S A;  2XZE A;  4HWI B;  4DV6 T;  5ETW A;  2CLY B;  5AQH B;  2NW9 A;  3ZMU B;  3RI5 A;  1KK7 A;  1NWM X;  4JI2 T;  4NPP A;  3X1D A;  3RRW A;  4EYU A;  3JC6 C;  2NW8 A;  2RA1 A;  5LOV E;  3MAC A;  1UX5 A;  4UEM A;  4L0R A;  4IDN A;  4GK5 E;  1MMN A;  2EHO C;  1FMV A;  4OHF A;  3EUH A;  4IGU A;  4YTP A;  2XQ5 A;  4PFP A;  4IL9 A;  2LEH A;  4TZ4 C;  5DAB A;  4I43 B;  5J0Z A;  2WB5 A;  2LM9 A;  2Q9Q B;  2K5B B;  2X0L B;  4IDZ A;  4JLE A;  3RHW A;  4LF9 T;  2XTL A;  3PJA J;  4LMK A;  4F8H A;  2V5D A;  1FMW A;  1NEN A;  2A9U A;  2LJL A;  2JJ9 A;  2KZ7 B;  1T8B A;  2WZH A;  2BBH A;  1YW0 A;  2B1E A;  2LRL A;  3ANW A;  5AQJ B;  2C0S A;  4OYJ A;  1AJ3 A;  2J1D G;  3K3N A;  5AQN B;  5BMV E;  3AEC A;  4CZZ B;  3LBX B;  2H7O A;  5L2L A;  2JRK A;  2NOX A;  2MTQ A;  5AQR B;  2W66 A;  3MKD A;  1W09 A;  3C64 A;  3R84 B;  2IHR 1;  4IHJ E;  3BQK A;  3T1H T;  3N2K E;  2CBI A;  5LBQ B;  1IBK T;  4U74 A;  5LGU B;  4GYS A;  2WCA A;  3MXZ A;  2BKP A;  3L39 A;  2K24 A;  4QH4 A;  2IC6 A;  2H3R A;  4A56 A;  5LBM A;  2ACX A;  3AE5 A;  1MIY A;  2WDQ A;  4PNI A;  3M65 A;  1KNP A;  3N2O A;  3LJC A;  5IHY A;  3PUZ F;  5FL1 A;  2BKO A;  2MAW A;  5L3D B;  1WRD A;  4JEU B;  2VVS A;  3L09 A;  3TLT A;  2UXC T;  1LVF A;  4DV7 T;  3ZC0 A;  4A5X A;  3H37 A;  5LCY A;  2FUP A;  2PBI A;  2BDE A;  4P0B A;  3ZKR A;  4O8S A;  2AXD S;  1XZY A;  3PTR B;  4I0U A;  3RYH E;  1N36 T;  3LG7 A;  3CQG B;  3RQU A;  4A97 A;  1X9B A;  4KUM B;  4X20 E;  4ADZ A;  5HEH A;  2PTF A;  2X51 A;  3NRY A;  4XBF B;  2PJQ A;  1HFA A;  3CKD A;  1VCT A;  2JMH A;  4DR7 T;  3K3O A;  4KX6 A;  3F2E A;  4JI8 T;  2DLR A;  3PUG A;  4ILU A;  3N9P A;  4LFA T;  2IC9 A;  3OYX A;  4OX9 T;  3MA9 A;  3VR9 A;  1HG5 A;  3UTK A;  2VQE T;  3PUQ A;  1J5W A;  5AQL B;  5L3F B;  2V8S V;  2IUB A;  3AAA B;  5CGM A;  4ZEY A;  4ZI3 D;  2Q9Q D;  3PUX F;  2VB6 A;  5LA6 E;  3I0O A;  3ZN1 B;  5LHG B;  5LNK A;  4IE4 A;  1XDO A;  1HG2 A;  3O9X A;  5KXJ A;  4ZOL E;  3QUJ A;  4UEL A;  1S94 A;  4NXM T;  2ACZ A;  2W67 A;  3LK2 B;  5BR8 T;  4U7I A;  2X67 A;  5DQW A;  1OED C;  4G2A A;  3PV0 F;  4WBN E;  2YDQ A;  3N9O A;  2X9Y A;  5FMN A;  3ZEF B;  1XWM A;  3RYI E;  5F5W A;  3RQW A;  2DCF A;  4KHZ F;  2WU5 A;  4AIU A;  2BVL A;  3SOL A;  4PFO A;  2Y8D A;  3A8Y C;  3C98 B;  3H3M A;  5JDQ A;  3TLU A;  5FVL A;  3AE6 A;  4MLK A;  4UF0 A;  3Q5E A;  3MK7 C;  4EOZ B;  5HXH A;  5HEG A;  4UVC B;  2XM1 A;  2XQ9 A;  4UR9 A;  2ZM2 A;  4PK5 A;  1UX4 A;  5J2U E;  2YN6 A;  2A3D A;  3EI0 A;  4U31 A;  4CXX A;  3AE4 A;  1UUR A;  5ADX L;  1D1B A;  1QLB A;  5HCM A;  2WP9 A;  3PUS A;  4NIQ A;  2QVA A;  3PJA A;  3O1J A;  3IBP A;  3IEE A;  5LJN A;  5A1L A;  5EK3 A;  3KFW X;  4LFC T;  4TV8 E;  5IWA T;  2JQ9 A;  3CIR A;  4X64 T;  4I55 E;  5CA1 E;  4YSY A;  4HKA A;  3F31 A;  1T72 A;  2C5I T;  2X0Y A;  4YJ3 E;  4HWF A;  4E7Z A;  3JAF A;  3ONL C;  2E9X B;  5HWX A;  3CX7 B;  3ZMZ B;  4L9I A;  4LF4 T;  1XNQ T;  3CML A;  5JVD E;  4EIW A;  4LF6 T;  4FI5 A;  3AEF A; 
#chains in the Genus database with same CATH homology
 4J2C A;  2KWI B;  4QKN A;  3AA1 B;  3CVR A;  1MMD A;  2A2F X;  4GYR A;  3B13 A;  3ZJ2 A;  3UUL A;  2ZM8 A;  1LKX A;  2ODU A;  5FNV E;  5F8P A;  2V1D B;  5LXT E;  1QUU A;  5LGN B;  2WAU A;  3SWH A;  5JH7 E;  1HTJ F;  4MHC A;  5HWY A;  2YEV C;  4YHJ A;  3ZJ1 A;  5IYZ E;  2HPJ A;  1US7 B;  2Y6X A;  3ZPO A;  5HXR A;  1IJ5 A;  3KDS E;  4H9R C;  2JPF A;  4BA9 A;  1BR1 A;  3CWZ B;  1YD8 G;  3HKD E;  2KT9 A;  5DQV A;  4O2B E;  1V9D A;  1HX8 A;  1HCI A;  3PU8 A;  2QA7 A;  3VU7 H;  4UVA B;  2CMR A;  3C51 A;  4H9N C;  5HXC A;  2DWK A;  1Y64 B;  2X68 A;  2MOZ A;  2V7I A;  3ETU A;  4QHO A;  3KIN B;  5FP3 A;  4MFR A;  1E1H B;  3ZN0 B;  4PJN A;  4ZI2 C;  3ZMT B;  2HPL A;  2YIN A;  3RC3 A;  5JR9 C;  3AA0 B;  2CEA A;  5M4Y A;  5J2T E;  3DJB A;  3HKB E;  2D0U A;  2RP4 A;  2IAK A;  4BJN A;  3OYZ A;  5L3E B;  4EZ4 A;  3LK4 2;  3GN5 B;  1U4Q A;  2C5K T;  3TKL B;  4IE7 A;  5FXV A;  2CM0 A;  3RH3 A;  5TAO A;  1BR2 A;  3B57 A;  2K48 A;  4ZI2 D;  5HXE A;  4BAY B;  2KMF A;  2SPC A;  3D0T A;  3N9L A;  4EB6 E;  4CXY A;  2ZMA A;  5JDM A;  3RX6 A;  3Q5X A;  3FBZ A;  5E0O A;  5ETW A;  5H6Q B;  2CLY B;  2NW9 A;  3ZMU B;  4UVB B;  3ZMV B;  4U72 A;  2W62 A;  3CPZ A;  3PE0 A;  1KK7 A;  1NWM X;  2KWH A;  3KV5 A;  4BJM A;  3I0Q A;  3SRZ A;  3GA8 A;  3PUA A;  3LBX A;  2WWU A;  3RRW A;  3IHR A;  2WM9 A;  5FY7 A;  4EYU A;  5C8Y E;  3JC6 C;  1G73 A;  2NW8 A;  2RA1 A;  3HA4 A;  4UV9 B;  5EK4 A;  2YU2 A;  2E8I A;  5LOV E;  3MAC A;  5EK2 A;  1UX5 A;  2NW7 A;  4Z8X A;  3PUR A;  1IAP A;  3KV4 A;  3N9N A;  4L0R A;  4UEM A;  4HEA A;  4AKL A;  2OA5 A;  3WAJ A;  3SS1 A;  4GK5 E;  1MMN A;  2EHO C;  1FMV A;  4OHF A;  3UUX B;  4QX8 B;  5CB4 E;  3EUH A;  3K8P C;  4IGU A;  4O4H E;  3KBT A;  4ZHQ E;  4AKR B;  4PFP A;  2LEH A;  3I1A A;  1OWA A;  3ZYL A;  5JDL A;  4TZ4 C;  5DAB A;  4I43 B;  3NZP A;  2GK9 A;  1Z0P A;  5L3B B;  2L9Q A;  3KBU A;  4QXB B;  4ZS2 A;  4AKG A;  2LM9 A;  2Q9Q B;  2EHO D;  2K5B B;  2X0L B;  4IDZ A;  1IJ6 A;  1D1C A;  1CUN A;  4PAG A;  4JLE A;  5JDF A;  4AKI A;  4DO0 A;  2N1G A;  2CWY A;  1MIW A;  2WSS V;  3KV9 A;  4O4L E;  5FXW A;  3R6N A;  2XTL A;  4P0A A;  2W61 A;  3C50 A;  1YKH B;  3AA6 B;  2XAG B;  3C4Z A;  3GWH A;  3IF8 B;  3UUM A;  1WYB A;  4G63 A;  2Z6E A;  4HFV A;  3W15 B;  3QC9 A;  1FMW A;  3RYC E;  3PU3 A;  3V5U A;  4DMW A;  2LJL A;  2JJ9 A;  4HN9 A;  2KZ7 B;  1YW0 A;  2B1E A;  5L3G B;  3ANW A;  4YFS A;  1X79 A;  4OK0 A;  5JDN A;  2C0S A;  4WNK A;  4OYJ A;  3NBX X;  1AJ3 A;  2J1D G;  3K3N A;  4IE0 A;  5BMV E;  1LVK A;  2E9X C;  4AQG A;  3CQC B;  1G8X A;  4CZZ B;  3ETV A;  2VKD A;  4DBR A;  3LBX B;  2H7O A;  1D0Y A;  2JRK A;  2NOX A;  5L2L A;  5FXX A;  2A72 A;  4KP3 C;  4PK6 A;  4X1Y E;  5FY0 A;  2MTQ A;  5GON E;  3AVS A;  4AI6 A;  2YU1 A;  2Q9Q A;  3MKD A;  2NTX A;  4M1P A;  3C64 A;  1S35 A;  3R84 B;  4IHJ E;  3BQK A;  1MIV A;  2E9X D;  5LG4 A;  2XHE B;  4JEH B;  5JDH A;  3N2K E;  2VL8 A;  4OFZ A;  4ASK A;  4AQF C;  2LOP A;  4JUY A;  5LBQ B;  3RKO A;  2WMO A;  3OBV E;  2V7L A;  3CQX C;  4U74 A;  3PDY A;  4GYS A;  5LGU B;  3RC8 A;  2DWG A;  2CA5 A;  3MXZ A;  5EZY E;  3HKE E;  3I9Y A;  1KNZ A;  3Q2M A;  5J1G A;  3J9X 1;  3OKQ A;  2D5U A;  3U3I A;  2UXX B;  4WBO A;  5LYJ E;  2K24 A;  2V7J A;  4ZS3 A;  5H6R B;  2IC6 A;  2H3R A;  4A56 A;  4FJO A;  5LBM A;  2I59 A;  2LSK A;  2ACX A;  2XAH B;  2Y48 B;  3DP7 A;  1MIY A;  2DHR A;  1LRZ A;  4YLH A;  4PNI A;  3M65 A;  5JRC A;  2XAS B;  2ZM0 A;  2MYS A;  4EYY R;  1FEW A;  3N2O A;  3UUN A;  3LJC A;  2V26 A;  4XZC A;  3UT5 E;  3FXD B;  5IHY A;  3F57 A;  5LJM A;  4GK0 E;  3RYF E;  2LSG A;  4IE5 A;  4MBQ A;  4L5G A;  3RRC A;  4EAH A;  1WRD A;  5L3D B;  3FB2 A;  4JEU B;  3HR0 A;  3L09 A;  5JDG A;  2V7M A;  4DVD A;  1O3X A;  2DI4 A;  4QXC B;  3MZK B;  3P8C D;  4ANJ A;  3ANW B;  3VHL A;  1LVF A;  2K9A A;  3ZC0 A;  2CLY C;  2KND A;  3H37 A;  5LCY A;  5L3C B;  3H3A A;  1QSD A;  5DJQ C;  3T8O A;  4PJM A;  3ZYK A;  3C4W A;  4DBQ A;  1WYC A;  3LK3 B;  3EDV A;  2PBI A;  5HYA A;  2WMN A;  4P09 A;  2BDE A;  4P0B A;  4QX7 B;  3U78 A;  4ZI7 E;  5KDM C;  3KV6 A;  3FBL A;  2XAQ B;  3EDU A;  4O8S A;  4PJJ A;  5JR9 A;  3PTR B;  4EZH A;  4CI1 B;  2CXD A;  3N9Q A;  3RYH E;  3LG7 A;  2D0T A;  3CQG B;  3S4U A;  4KUM B;  4ISS A;  4X20 E;  4ADZ A;  4HE8 A;  2X51 A;  1HS7 A;  3NRY A;  5LGT B;  3NZQ A;  4H63 V;  2CXF A;  1ZKE A;  1BR4 A;  4EXT A;  2WBL A;  3AAI A;  1FIO A;  3GMI A;  4XBF B;  2PJQ A;  2LHR A;  2CXL A;  4C91 A;  4HTE A;  1HFA A;  3O1I A;  4TV9 E;  3CKD A;  4O4J E;  4AXP A;  4QWN B;  2JMH A;  5HXS A;  1MMG A;  3NRX A;  1OXZ A;  4QXH B;  4B6X A;  3K3O A;  2XAJ B;  1D0X A;  5KMG P;  5JRE A;  3F2E A;  2DLR A;  3PUG A;  4ILU A;  4KMC A;  3N9P A;  1ZV4 X;  2IC9 A;  3OYX A;  2LHN A;  3MA9 A;  3Q5W A;  1D1A A;  1BR0 A;  4MAL A;  1HG5 A;  3UTK A;  4PW8 A;  1UCU A;  4X1I E;  3PUQ A;  4TX5 A;  5JRC B;  4PJL A;  3VKH A;  4O2A E;  4GIW A;  4NUU A;  3P7I A;  4WW0 A;  4PK4 A;  5L3F B;  4F6R C;  4YJ2 E;  2M67 A;  3AAA B;  3O1H A;  5LP6 E;  3E08 A;  3N5L A;  4ZI3 D;  2KXP B;  2P9B A;  2Q9Q D;  2JMK A;  5HAX A;  2VB6 A;  3EVY A;  5LA6 E;  3I0O A;  3ZYM A;  3ZN1 B;  3HKC E;  5LHG B;  5LNK A;  4UIG A;  3O4X E;  4DND A;  3V5S A;  1MNE A;  2C5J A;  4IE4 A;  1ZEE A;  2D2S A;  3AAE B;  2PFV A;  1HG2 A;  1SHZ C;  3DTO A;  3O9X A;  4ZOL E;  3ZCJ A;  3QUJ A;  2NP9 A;  4UF0 B;  2X9W A;  4UEL A;  1S94 A;  3ONX A;  4CI3 B;  2XUE A;  1IZN B;  3LK2 B;  3VKG A;  2X67 A;  5DQW A;  2H7V C;  5JR9 B;  2CCQ A;  2QGS A;  3C4X A;  4X1K E;  3BK9 A;  4NUV A;  2DNX A;  4G2A A;  4ERR A;  5JQG E;  4H9Q C;  4WBN E;  1MMA A;  4OYK A;  3N9O A;  2PG8 A;  3E0Z A;  4K0U A;  1EZ3 A;  2ZLY A;  2LT3 A;  2X9Y A;  5FMN A;  2VKO A;  4CXW A;  2MBG A;  2V7K A;  4I4T E;  3FXE B;  4KBM B;  2VKJ A;  2LOS A;  2X66 A;  1VOM A;  3ZEF B;  3RYI E;  3BQI A;  2VAS A;  1WLX A;  2CE7 A;  3WAK A;  1VRB A;  2ODV A;  2DCF A;  3ZCI A;  3J7Y q;  1YKE B;  2E9X A;  2HH7 A;  4H9P C;  2LSY A;  2N9D A;  2NTY A;  2CWO A;  2BVL A;  2W00 A;  3ESL A;  5FYM A;  4UV8 B;  2L3L A;  3SOL A;  2NWB A;  3QK6 A;  1NAF A;  3OJA A;  4PFO A;  1B7T A;  2Y8D A;  3C98 B;  5JDQ A;  4TUY E;  2VWA A;  3KVA A;  2IW5 B;  3BQL A;  4MLK A;  4UF0 A;  3MK7 C;  4EOZ B;  2EHO B;  5HXH A;  3AB3 B;  4GOU A;  5LHH B;  3CX8 B;  3CX6 B;  4UVC B;  3N2G E;  4CQI A;  4AQF A;  3RPU A;  4CI2 B;  2W63 A;  2ZM2 A;  4H9S E;  4DMV A;  2VKH A;  3MJX A;  4PK5 A;  1UX4 A;  3K3Q C;  5J2U E;  2LSJ A;  1WR6 A;  2X9H A;  2KLQ A;  2A3D A;  1ZHC A;  3LFM A;  5LHI B;  3Q9D A;  5KX5 E;  2N2N A;  3ZMS B;  3ZLI A;  3KVB A;  2VK9 A;  2ES0 A;  4CXX A;  2BZB A;  2JQQ A;  1H7C A;  5ADX L;  1D1B A;  3FHN A;  3A5X A;  3N9M A;  1MND A;  3PUS A;  4UXN B;  3JC6 D;  3O1J A;  4AKH A;  4XAX B;  2L8K A;  1T98 A;  3IBP A;  3UFE A;  3IEE A;  4IST A;  3ZC1 A;  2W0G A;  2XAF B;  4C90 A;  4ZI3 C;  5LJN A;  3L3P A;  2Q9Q C;  5A1L A;  3GN5 A;  5EK3 A;  3KFW X;  5F3J A;  4TV8 E;  3WI3 A;  1U5P A;  4O4I E;  4I55 E;  5CA1 E;  4IIJ E;  4HKA A;  3F31 A;  1SA0 E;  3HI2 A;  2C5I T;  2YK0 A;  4I50 E;  4YJ3 E;  2EHO A;  2G0U A;  3I9W A;  2XQY A;  4N78 D;  4TN7 B;  4E7S A;  4IE6 A;  4E7Z A;  2E9X B;  5HWX A;  3CX7 B;  5CA0 E;  4H63 H;  3ZMZ B;  4L9I A;  5FY1 A;  4HGA A;  3AVR A;  2BVM A;  3CML A;  2LE8 A;  5FXZ A;  5JVD E;  5AFU L;  3HL6 A;  2KIN B;  1D0Z A;  3AA7 B;  1HF8 A;  4EIW A;  2UXN B;  2X9X A;  3E22 E;  4H9O C;  2LSI A;  4FI5 A;  4V1A v; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...