3K3OA

Crystal structure of the catalytic core domain of human phf8 complexed with alpha-ketoglutarate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
355
structure length
350
Chain Sequence
LRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords PHD finger protein 8
total genus 96
structure length 350
sequence length 355
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3oA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3oA01
4IGOA 4DIQA 3U78A 5FUPA 3PU3A 4AI9A 3KVBA 2XDVA 5FXZA 5K4LA 5FZ7A 3ZLIA 4UF0B 4XDOA 5A3PA 5FYVA 5FZ6A 5ISLA 5FZ8A 2YBPA 3AVRA 3PUSA 2OQ6A 5A7NA 2PXJA 5FPVA 5FZ0A 5FZDA 3PUAA 3ZPOA 4EYUA 5FBJA 5IVYA 3UYJA 5FUNA 5E6HA 5FPLA 5A80A 3OPTA 4LXLA 3N9OA 5F2SA 4QX7A 3AL5A 4EZ4A 4Y4RA 5A7WB 5F3IA 5F5CA 4Y3OA 5FXVA 3PTRB 5FP9A 5F3CA 3DXTA 4HOOA 3LDBA 3K2OA 5FP4A 5FZFA 5FYCA 5A1LA 5FP3A 4GJYA 3N9LA 2OX0A 5F32A 2GP3A 3KV5A 5FZOA 5KR7A 4UF0A 5A7WA 2YBSA 5ANQA 2VD7A 5F2WA 4QXHA 4NUBA 4CUGA 5FZAA 2YBKA 4TN7A 3K3NA 4GAZA 2WWJA 5FZ4A 5FJKA 5FPAA 5FP7A 3KV4A 2P5BA 4CCLA 4D6QA 5FZCA 5FZ3A 5IVCA 4IGPA 5LY2A 3PU8A 5FY0A 3KVAA 4LIVA 3PURA 2Q8DA 4XDPA 5FZKA 3U4SA 4D6SA 1VRBA 5FWEA 5FY7A 4CCJA 3N9NA 4BXFA 3K3OA 4QX8A 5FXWA 3PDQA 3N9PA 2XMLA 5FY1A 4BU2A 5LY1A 3OPWA 5A3TA 5A7OA 3PUQA 5FYYA 4LIUA 5FYMA 5FZBA 4CCKA 5IVVA 2YU2A 3KV6A 5F5IA 2Q8EA 4C8DA 5A7SA 5F39A 4DO0A 2WWUA 5FV3A 5LW9A 4E4HA 4Y33A 5FY8A 5A7QA 5FP8A 5FWJA 5CEHA 5A1FA 5FYZA 5IVJA 5FZMA 3KV9A 2YPDA 5FZ1A 5FYTA 5FY9A 4QU1A 5FYSA 3N9QA 3N9MA 2XUEA 4V2WA 4HONA 5FY4A 5F3GA 3DXUA 4GD4A 4BISA 2YU1A 5A3NA 4IGQA 5FYHA 5A3WA 5FYUA 5FXXA 5IVBA 5IVEA 4CCOA 5FYIA 4CCMA 5IW0A 4GJZA 4ASKA 2OQ7A 2OT7A 2XXZA 4AAPA 5IWFA 2W2IA 3LD8A 5FPBA 5FZ9A 5F37A 5A7PA 4V2VA 5IVFA 4QXBA 3AL6A 4CSWA 3NJYA 5FZIA 3RVHA 2OS2A 4CCNA 4QWNA 2GP5A 5FYBA 4LITA 4EZHA 5FPUA 5F5AA 5FZLA 4D6RA 5FJHA 5FY5A 5FZHA 5FZEA 2Q8CA 5F3EA 5FZGA 5FZOB 5LWBA 4QXCA 3AVSA 4URAA
chains in the Genus database with same CATH superfamily
5L3BB 4GULA 5DABA 4JHTA 4S2DA 1NY71 3MW3A 1BR2A 5FXZA 4AGGA 4P9YA 4DB5A 2IC9A 4Z2AA 4XDOA 3NRUA 2LALA 3QH7A 2VB6A 1F35A 2QQOA 2LRKA 4HWDA 1H9WA 2A73B 5FL1A 3PVEA 2XTLA 4KQ7A 2ZM0A 4LLOA 1S0CA 4UT5A 1OLMA 4XQ4A 4PJYA 2Q1MA 1X9TA 4X62T 4NROA 2WDVA 5DJQC 3I3EA 4P9JA 5DXDA 5BR8T 1O3RA 3FLTA 5C8WA 1OFNA 4MGZE 1NZCA 2DUQA 2GNMA 4P9GA 1KRIA 4H14A 5GZFA 3UUBA 3VBUA 2NTYA 2EXHA 1YFWA 4FJOA 2WZPP 4AVTA 1X33A 1GQEA 3AJYA 2JENA 4DXRA 4JYAT 1IS5A 1YCIA 2ZGTA 3P4QA 2ZGKA 5FREA 4ET7A 1F4HA 4WBBA 2CU5A 2LRLA 1PGW2 4YWAA 4Y3OA 3TLWA 2V6XA 1LGBA 1W8OA 3ETQA 3JD71 1WBLA 4IESA 4HKOA 4EWEA 1UWWA 3LDQB 1LECA 3EYPA 1VPHA 2R071 1H7CA 3M3CA 2D0TA 1TNFA 3N9LA 5JSRA 2MHFA 3CWZB 2GP3A 4RYDA 3PUVF 1NA1B 2V4AA 3KV5A 1MZ5A 4NVPA 3RH3A 5HXRA 4JLEA 2AREA 2DCYA 4P1NA 1Y9MA 4FTBA 4XUOA 2JDAA 3MYXA 2WT0A 2J1TA 1Q8VA 3EAMA 4CUGA 4K20A 4FAGA 1KS5A 4ZI7E 2X51A 4M4RA 2ZGMA 1HLCA 4IQPA 3T2PA 3KM5A 1UY3A 4IL4A 4SLIA 5J98B 4X6RB 1WMXA 4LLFA 4QU2A 1MQTA 4TX5A 4AKIA 4HSLA 1CR7A 2FHRA 3T0BA 1BR0A 2VL0A 4E4DX 4XTPA 4E2SA 1U5YA 1Y9GA 1WCDJ 2YDEA 5FZKA 5L19A 4QXCB 4CEYB 2ZHKA 3BQKA 2XPJA 2HYXA 4AFBA 3GNEA 3KT1A 1LHOA 2WT2A 3ST7A 2ZM6T 4JRAA 2KR2A 2CEAA 3K48A 2YPJA 5EZWA 5JTGA 2ZBJA 2XVKA 4IV1A 4QAWA 1W6QB 5C3SA 3LFMA 3MK7C 4UV8B 5J2TE 1CPMA 5AVAA 5C8CA 3KLSA 1H6XA 5DQVA 1HNZT 2DWRA 2YC2A 1PMJX 1OVPA 2D5HA 3POYA 3D0SA 3A5XA 4DUXA 2FUPA 2VMIA 4N53C 4S2GA 4URTA 3VD9A 5F5IA 2L3LA 1EAH1 3VDDC 2V5CA 1PNGA 3AYAA 3D0TA 1PNFA 1VR3A 3I2JA 5HCBA 2NQYA 2VC9A 3PUZF 3SKVA 3RYIE 2AH2A 3WF3A 2VZTA 4YSZA 3EABA 1FI2A 2HKXA 3MHZA 1R083 3VZKA 3WF4A 3E5UA 4KNCA 4KMQA 5FZ1A 1WA6X 4EN9B 5JXGA 1WYCA 4DV1T 1AL21 4COZA 5L3CB 1GZTA 3RMXA 4OHZA 5LEJA 2D40A 3UU3A 2RR12 3O12A 2RS11 1WGPA 2D7FA 1MMDA 2W4XA 3HWJA 1ULDA 2HWE1 3KZ4C 4Q8KA 2ZJCA 4FOQA 2ATFA 3L09A 3AP9A 5I8YA 4BK4A 4LBJA 4GJZA 3MEPA 3AE5A 3VUOA 2XXZA 1G7YA 1YI7A 3RS6A 5FZ9A 1RUC3 1B35A 1DHKB 1IGOA 4NRPA 2IHR1 2F4PA 4X1IE 1KDKA 4JC1A 1CN1A 2G19A 3E1F1 3WP5A 5CA0E 5IK5A 3BU0A 3G06A 1QJY2 2WAOA 3OD0A 4QHOA 5CFDB 1JUIA 1O5UA 2GP5A 3BK9A 2LKGA 4DV3T 4I3GA 2Y8KA 1UMHA 4P9LA 1KQRA 4PNIA 3VBRC 3T4HB 3HN1A 2Z2SB 5JDLA 4CCEA 5JREA 3CX8B 5EFUA 1DYOA 2OA5A 2FBEA 3MIBA 1JZ5A 4GWIA 3E97A 3IM0A 1I9RA 2XDVA 4CUAA 3GF6A 2ZKNA 4Q0UA 2ES0A 4UF0B 2YMZA 5ACA1 4Q2FA 1XU2A 4AOCA 3RQWA 4TV8E 3E6DA 3ESLA 5IWAT 4ISTA 1CJPA 2UUBT 2BOIA 2W94A 5D8AB 4DFSA 5C9AC 1BYHA 2VGDA 3WF1A 5A6YA 1CPNA 3HKCE 1APNA 4GIWA 1ZZ7A 5BNOB 2WBKA 2MEV3 5AC92 3A22A 3I7DA 4YW7A 5FZ0A 5H9QA 2CGNA 5JDBA 3K51A 3GCWA 5A33A 1W6MA 3ZPOA 3N4MA 4JI6T 2LOSA 3ONJA 3LA2A 3MIHA 3U07A 4LUKA 1AR81 3WLUA 3WW4A 5C33A 4QKNA 5I8TA 2GN7A 2D44A 3ZFFC 3LF7A 2ADEA 4FT8A 1KNZA 2Z6EA 4JDNA 4XFAA 2YDSA 4YM3A 2WA3A 5AQJB 4O4IE 2JD4A 2PAEA 2ZGQA 1YFXA 5H6RB 3OB8A 5CU1A 5DZGA 4AGRA 4F7ZA 5FYCA 1RUH1 1JODA 3GBWA 1ZZ8A 3RDIA 4AI0A 2VOXA 4BWOA 1G9BA 1S0DA 5FBZA 2J1SA 2V73A 4FOYA 3H7YA 4TYSA 3O1HA 2VMGA 1VOMA 2J1DG 3J8F1 3W21A 5M0TA 1VBD3 3TLUA 4GYSA 1UPIA 3GBFA 2CAVA 4MGKE 4NUBA 4PDWC 2FD8A 4XFIA 1S0GA 2B5HA 5J1XA 3IDAA 1ZNPA 3ILNA 3K46A 4LOTA 4NRQA 5AVPA 1J1JA 3EHKA 1W28A 1YI9A 1D4M1 4TZDA 3R4SA 1GZWB 1VAVA 3ZN5A 1MEC3 4RR3A 4X20E 1V70A 1GNYA 3HQUA 3OEAA 5C3QA 3ILFA 1NY72 3PU8A 1PIV1 2AEYA 4Q0SA 4J25A 2WLQA 2D98A 2E31A 2FCVA 2VKJA 4I3PA 4DV7T 2P37A 4NIAA 4RHV1 4TUYE 4BB3A 1VRBA 2DL1A 3FXEB 4KUMB 3AZZA 1IKQA 1COV1 1PMIA 4BXFA 5LG3A 4NUVA 3PJQA 3RI8A 2M6IA 1MEC1 3ES4A 1VE0A 1UMZA 4XMIA 3B3QE 5J3UA 1PK6A 2E9XA 1VBC2 1EAH3 2V7MA 1H2MA 1KGYA 1R8IA 3V0BA 3VKLA 3G6JB 5IT6A 1FMWA 2HWC3 4IW3A 4PW8A 1S0FA 3WVJA 3C4XA 2C6SA 3GZAA 3VZOA 2D43A 3ZN1B 1KDMA 1RMU1 2ZEWA 4AVVA 4BMEA 5FV3A 4QWNB 4KGQA 1QKQA 1O7FA 1KNPA 1UCXA 2PHLA 3QCWA 5DUUA 4AE2A 3AEBA 2GK9A 2WO7A 2O0OA 1QJFA 3P1IA 3QACA 4MALA 3B5LB 3H1MA 4COWA 1COV2 1N32T 3F31A 3ZCJA 3S7IA 2UUAT 4P5YA 4W8JA 3RQ0A 1G9DA 5FY4A 5IK7A 1JU4A 2ZHNA 3ME2A 4K21A 5ANNA 4XE9A 3UGHA 2J1AA 4M3CB 2V09A 1CAWA 1EAH2 2YINA 2RM21 4UR9A 2R1BA 3AFGA 1OD3A 3SCHA 4DIDB 1XNKA 3H42B 1RUOA 2W62A 3ZN6B 5F7UA 2V7LA 5C9AB 5BNNA 1UN1A 2BV4A 2QQKA 1AR83 1TNRA 1VRH3 2B46X 2VBPA 1PGL2 1CD3G 2Q1ZB 1DDLA 1W6QA 1YW0A 2OV9A 2AEZA 4P9XA 2W2IA 1GQHA 4YM0A 4AHWA 1Q3EA 1E2AA 4MGQA 3RYKA 4HFCA 4LE4A 3GA8A 4QGLA 1ZRCA 1V6MA 1NLRA 4LKSA 4LHLA 1ASJ2 4CDQB 5C4WC 1BVVA 3O1IA 5ACA3 2JDHA 1J3RA 2RE9A 2DVAA 3HA4A 4LMLA 1IS4A 1OA4A 1WLCA 1PGSA 4ZY9A 5JMCA 4F6RC 3AYCA 3JQXA 5CJ5A 2G9FA 3UQ7A 1NAFA 3O1JA 1PZ8A 4L2NA 3U10A 3F57A 1QY4A 4CI2B 1LEDA 4AZZA 5JQGE 1H4HA 1Q5OA 2ARAA 3PHMA 1M62A 2BG9C 2Q9QD 5JDHA 1RJ8A 2WS91 1KD7A 2WCAA 1YJKA 4PQQA 5FPZA 4YFSA 5G04L 1OF3A 5FZ7A 3ZXAC 2CTVA 2VJXA 5EYYA 2BTVC 4V1PA 2FDHA 2X8KA 4GK5E 4I43B 3CDZB 5C9AA 1PO12 2Y60A 1WWYA 4X5TA 1CAXB 2VY0A 3AVRA 3FZFB 4LO5B 5IFPA 5AQUB 5HXCA 2B45X 3CZJA 3LKJA 4UXAA 4XMAA 5JCTA 5LRSA 1AX1A 1JZ6A 3KBUA 3PUAA 1URXA 2Y6LA 4DV0T 4XFBA 5LG4A 3K8PC 1MS5A 1F8VA 3UULA 1YD8G 4S2FA 2Q9QA 3PJAJ 1OOPB 4H9NC 3TLSA 1KNRA 1POQA 2RS12 4A2UA 2ZLYA 3VKMA 2GNBA 4TV9E 1TME2 1GFF2 2QCSB 4IE0A 4FP3A 1CAUA 1GYKA 5FTTC 2WWSA 5I0UA 3CX7B 1ZHCA 3FN9A 5C2TA 2Q5TA 3ACFA 4K6BA 2ZACA 4LHSA 4QQLA 3WOGA 2BKOA 2DLRA 1LOFC 5FP3A 2DWKA 1Q56A 4GJYA 4N43A 3RYRA 2PELA 3WP3A 1IBMT 2FDJA 1SMVA 1I3HA 4JI2T 1W8HA 2E51A 3ZN4A 4KX6A 1U12A 1UOBA 1H4GA 2W3JA 3LDRA 1JYWA 1RUH2 4LBOA 1TME3 3ZMUB 4NJ4A 3KWVA 2DUOA 3RGBA 1W99A 2XLGA 2RS13 4G9SB 4O9EA 3THDA 1TG7A 1N1YA 3KINB 1OVSA 1OT5A 2XGXA 2Y26A 2B7YA 4DV2T 2C0SA 2BEOA 2VZSA 1UOFA 3PL0A 5CFCA 4IEQA 3QK6A 3TEZA 4OQ8A 4JV5T 3AA0B 1VRH1 4OI2A 2HWE2 5I0RA 3N7KA 1WMFA 2ILMA 4KWLA 3CJIA 1IQDC 5AQKB 1MZ6A 3R6NA 3NV1A 2VTXJ 4LUMA 4TWTA 3MACA 4LFBT 1HQNA 5H6QB 1W90A 2WRAA 3A0NA 4XIOA 4MGYE 5DAXA 4NIIA 4OI1A 4Z92B 3DGTA 2VL8A 3RZJA 4FTSA 1D1CA 3N5LA 3H8OA 1X82A 2HEYF 2TEPA 3FWEA 2WQZC 3GGLA 4K1YA 1MZEA 2E53A 3ZXEA 4BYYA 3K3OA 4RR3B 5LA0A 1QJU2 4QX8A 4XUQA 2DF7A 1WRDA 3ITQA 2XMLA 3MLJA 4OUMA 4YVSA 1SFPA 3AEAA 4MBQA 2XHKA 2XJQA 3ZT7A 4I09A 3NRXA 1C4RA 2HPLA 2XM2A 1DGWX 1RMU3 1VRH2 2QQUA 5ABEA 1DG6A 1XNDA 3NL1A 1LAJA 4UFLA 2HH7A 3RI5A 5G05L 5F5QA 3HPNA 3PUXF 5L3GB 2KD7A 5LASA 4OHFA 4HG6B 3ES1A 3VDDA 4E7ZA 1GLHA 1FXZA 1FOD1 1Q8QA 2VOWA 3DPRC 3NW4A 1UOGA 5FP8A 2Z79A 5IHYA 2PG8A 5BNNB 2WSSV 4UVAB 4CI1B 5IVJA 1QXRA 1VALA 1YQ6A 2VQUA 4Y1XA 3WP4A 4A44A 2CSGA 5BNPC 4DR2T 3NMBA 2LJLA 4OI4A 2Z69A 4RGGA 4XF3A 5AQFB 1SDWA 4BISA 4C0BA 1WYBA 2GALA 2OVUA 1D0GA 3VKGA 1XZYA 2F4LA 2WO3A 4FFGA 4CU6A 5A3WA 1VIWB 3P5BA 4RGKA 1ULCA 3JXSA 3TNQA 4KWJA 4PK6A 4LBQB 4COYA 1HV1A 2ERFA 4GKXA 4LOSA 2MBGA 5LZ6A 2H7OA 3KGZA 4BQ1A 1GOFA 1XDPA 3B93A 2ZX4A 3H37A 2BNOA 3LBXB 1UL9A 4LMKA 2IUBA 2VZOA 4Z07A 4Y4YA 3VKFC 2YK0A 5HXSA 1XPWA 1G9FA 1YEWA 4Y1ZA 4M3CF 2RG4A 2PHWA 3I2KA 2RHPA 2Y33A 2JB8A 3C7HA 1DYPA 1ZBA2 2D6LX 4L0PA 5T5JA 4QWNA 1HJFA 1XBFA 3DUIA 4UBHA 4YARA 3EHZA 5A6ZA 4D6RA 4ZU7A 4NN0A 4BOWA 5FKCA 2BGOA 2VW2A 2QQNA 2WLPA 5FZEA 2ZM2A 5LBCA 1E5HA 3T30A 4IDQA 4TN7A 1QUUA 1CAVA 2VAUA 1HX8A 3ZVXA 4X1YE 5BYNA 3AKTA 1ULGA 2E26A 4IGOA 4Q4Y3 5HV4A 5ABFB 1NXD1 3KVBA 3CKDA 1IAPA 2WC2A 2E5LT 4YZ1A 4L0RA 2YFZA 3LPFA 4NXNT 3I2HA 1Q43A 3HKBE 2R042 3NAPA 1BBT2 2NMOA 1CIWA 1YHFA 1UURA 3SFDA 1LOCA 1W6NB 2VW0A 4ZXEA 1OKQA 4GKJT 5HV0A 2FDGA 2WAUA 3AECA 2XJPA 3GBGA 4FPJA 4AI3A 2BBVA 2AGSA 4E4SA 5HCAA 2NMNA 2LROA 1FEWA 2DCZA 3JB4C 3CU7A 1T7SA 1DLCA 2BGPA 1DGWA 4L11A 4FPEA 1IKPA 2Q4SA 4NAMA 5E6HA 3ZSKA 5A3LA 4ERRA 2D2SA 2EXJA 2RS31 2WNVA 5F2SA 2CLYC 1YQ2A 5CA6A 4EZ4A 2XQ4A 3AK0A 4QQOA 5JDFA 3VV1A 3Q5XA 2MAWA 1HR0T 1S0BA 2KSRA 3BGAA 3SXWA 5JOZA 4ZZCA 3LB9A 4JKKA 1EUUA 4PLNA 3N3HA 4HPKA 5GLVA 2LSYA 4PFOA 2FDFA 2BW8A 4QHZA 1F5JA 1W9YA 1L3JA 3KQRA 5JI9A 3LOBA 4JDOA 1N47A 3F95A 2WA4A 1BCXA 4XUPA 3MJXA 5F32A 1ND2B 1CESA 3L3PA 4Q1PA 1AR61 3FX3A 1UZYA 4ZPIA 4XQDA 2B4KA 2XR4A 3DYPA 3NNFA 5A7WA 2I07B 2CM0A 3WDVA 3WW3A 1ND3A 4QKDA 4Z8XA 4JI8T 4KHPT 2V72A 2YBKA 4XC9A 4AVBA 4FOWA 1QJX3 3AE2A 2V5YA 1P8JA 5FZ4A 1UKRA 2UXNB 1ZA4A 4YRDA 3NZQA 3WNKA 3AEFA 5FZCA 1IJ6A 4A6OA 4XZCA 1RUF2 1UX4A 3ZXKA 2X66A 1OC1A 1H8VA 3MIFA 4NE9A 4Y5TA 2BG9E 4YG3A 2JQQA 3OOXA 4OYUA 1O8PA 3OD4A 3VZLA 3BTZA 3UUXB 1HB4A 2RJLA 3RSJA 3T1HT 2W87A 3MLLA 3AYEA 1VBC1 2PHXA 1O3TA 1SHWB 3QOPA 4MLOA 4XYXA 1Q8OA 1YWKA 1TMF2 2PQSA 5GLWA 4LF6T 4AFMA 3WG3A 1D1BA 3FXDB 4AF9A 5HYAA 5FYYA 5GLUA 3WSOA 4KI0F 1L7LA 3C4WA 3L2YA 3KV6A 2DYCA 1YC61 4RHV3 3VBHC 4W65A 3TN91 2QKDA 3VD3A 2VOTA 1H1AA 4WM8A 4WZCA 5A1FA 5JR9A 4XJZA 5CEHA 3UU6A 5LJMA 2WINB 2EICA 5L7OB 3I59B 3ANWB 3NJVA 3NNMA 4K40A 4ZI3C 2JDNA 2X9WA 3H9AA 1MS9A 4Q4W1 3M3EA 2A3XA 3THPA 1O8SA 1QJX2 2HWB3 4LPLA 5L36A 5FXXA 1NWMX 3HJRA 2XSBA 2QZ2A 2ZX2A 1LOEA 1YYNA 1ND3C 2XAHB 3MDPA 2W66A 2ZCWA 2XONA 5F6LB 3U14A 4K8FA 4H2AA 4AI6A 2XAGB 2IIUA 4U33A 1MZFA 4DV5T 3Q8EA 2OLTA 3IKWA 2WN2A 2X5IA 4XAEA 1O3SA 4CA9A 3ZEFB 4B3TT 2WMNA 4LO7A 4MGTA 4D8MA 2WZEA 4ZHQE 2B9UA 3BOWA 5JIUA 2IFWA 5FMNA 4E8DA 3AE3A 1C3HA 5DPNA 1QJZA 3DYMA 2P3JA 2R0HA 3ECQA 4FVVA 4IV3B 3T1YT 4XJWA 5CG8A 5F3EA 4YGEA 4DR4T 2VMEA 1MQTC 2LSJA 4B3ST 2JDMA 4IGUA 1HXS1 2JJ6A 3DKWA 4O65A 4A7YA 3U37A 2VTFA 3OBRA 4UOJA 4EE2A 1QH7A 5FUPA 2BZDA 3UKTA 4CDXC 3ZKYA 2RS51 1O91A 1DLLA 3P4PA 2WNUC 3A23A 4HK9A 2GC1A 2WS92 4IDOA 4JQTA 3FBMA 2OW4A 5IUXA 1OPMA 2YC0A 2CWOA 1CAVB 1K5MC 1WW5A 5GKAC 5KHHA 2ZMAA 4RS5A 5C3JA 4NIQA 2YBPA 3I9WA 1Q8PA 1UY4A 4LR4A 2UXCT 3ZMVB 3ZYGA 2XASB 2I45A 3POIA 3OGSA 3VBFC 2UWBA 2ZHMA 2WIIB 4CEWA 3E6BA 1LHUA 5EK4A 4AI8A 1HG2A 5D2AA 5CFBA 5KDMC 3K77A 3T0AA 3PUGA 3VGIA 3C51A 1BR1A 3RIAA 5FPLA 2LSGA 4LXLA 2NN8A 2OXBA 2VASA 4M0HA 3AJZA 3SHRA 1ULOA 4CDWA 3IMNA 5BNOC 5JR9C 1TQ5A 5C3OA 3X29B 1QNWA 3AKQA 4PLMA 5LGUB 2KXPB 5K0UC 1VLNA 3C7GA 1FPN2 4U72A 5AQRB 1DQ4A 1GWLA 2FQPA 3POFA 4JDMA 5FP4A 3JZVA 3I2FA 3NNLA 2HEVF 2YC4A 3OBVE 2P2KA 3RIFA 2K24A 1WA4A 4N53B 2XHEB 4XJAA 1EY2A 1RUD2 2J47A 1S0JA 1ZKEA 4HN1A 4HGAA 3VBUC 1W6PB 1DP0A 1SLAA 2WZR1 3NVCA 5LA6E 3IHRA 3CX6B 3J9X1 3P8CD 4AIUA 3FMGA 2WWJA 4RS5B 4KG0A 4OYKA 5AQIB 2MTQA 2D6OX 2QGSA 4W4ZA 4CZSA 1H1MA 4OULA 3SOLA 1UY1A 3HEIA 3VRBA 2YY1A 3IDEA 1RUG2 5FMBA 2QUOA 4JKMA 4GB32 3ZFEB 5IVCA 3VDBA 2I59A 2QRXA 1GANA 1MQTB 2OA2A 4U7IA 3ZYHA 4MYEA 3EVYA 3CNAA 1OEDC 3H3MA 3WNXA 4EROA 3ZT5A 3ZYMA 2D5UA 4PJMA 5FVKA 1Y9QA 2PYTA 3OY8B 5BUVA 4HVOA 1RUE2 5FO9B 1ZRIA 5ERLA 5J48A 3AEEA 2GDFA 1R1ZA 2WSVA 2W39A 3O4XE 5GZDA 3DF0A 4A45A 4BZ4A 1HQLA 4ZOLE 4H7MA 2A75A 4PDWA 1LTEA 1N3OA 4CCDA 3PTYA 2W92A 1RGSA 1RUF3 1OH4A 2R062 1DF0A 2VUJA 4WVMB 4Q25A 3ZDVA 5C4WB 4KWKA 4NIGA 2B76A 4NPRA 5LA9A 5I93A 2PJQA 4BMBA 4BJMA 2BBAA 3JB8A 2H3RA 5F39A 2GMEA 3AE6A 2BG9A 1CZTA 2RDRA 4BQ5A 1HB3A 3QBQA 1LGCA 2RDNA 5JH7E 1DQ6A 2VZRA 4P9WA 5FZMA 4QX1A 3JCIA 3KV9A 3R6SA 3SH5A 1SBDA 3HIFA 4FTEA 5L47A 2JQKA 3FBLA 1FNYA 3N9MA 1A8DA 4PJNA 1O5LA 2GH2A 1HXS2 5CKMA 3T4VA 4OZXA 3I2GA 5F3GA 3DXUA 2QQMA 4S2HA 2CNAA 3UT0A 2R16A 4KHZF 3WW2A 2XPKA 4CVUA 1OFSA 2VL4A 3ZJ1A 3N35A 4Y22A 1HRI1 1XNTA 1J3QA 5FUIA 2JICA 2JKXA 4E27A 4QKFA 2P1BA 1H0BA 2BP6A 2Q0AA 2Y38A 3SH4A 2SPCA 1BEV2 3V5UA 3IF8B 1W0AA 1ZBE3 4DR1T 2OT7A 1U0AA 3VBFB 1XDOA 1RUI2 3JAEA 1X9PA 4O9GA 4PF1A 2LHRA 5JI7A 3SISA 4HWIB 3VZNA 2VNVA 2JG9B 5CISA 5ABJC 3MF6A 2XAJB 1A3KA 2OS2A 4UVBB 3PDYA 5TSWA 3PV0F 2UU8A 1DU3D 1W0PA 3ZC0A 5B2GB 3TEXA 5JPMB 4BQ2A 2XQAA 3I2DA 4XJ8A 3VBRA 4AVSA 4C0HA 3UFEA 2EA7A 3LOIA 1OF4A 1ENQA 4LHNA 3U78A 4HSJA 4YGCA 1Y43B 2XJTA 2VULA 3POWA 4TLGA 5A32B 1VAMA 5ABGA 2E33A 2P34A 5AQQB 1PM7A 3C7OA 4MADA 5CKQA 1CX4A 4AQ6A 3WUDA 2Y6XA 1SUMB 3O0XA 4YZ3A 3IPVB 3TN92 3RWNA 4PBOA 5DDJ2 5FK7A 1IJ5A 4LEJA 2A6ZA 4JTOA 2OQ6A 2W0GA 2QJVA 3HR0A 2QQVA 1LCLA 4PJJA 2R043 1HDKA 2UY8A 2VCAA 2MPKA 5FPVA 3ZO0B 4XIKA 1FMD3 4IL9A 2C5DA 3WEZA 2GNTA 4GA9A 2JG9A 4GWMA 4HKWA 2WT1A 4I30A 4AKLA 3M2MA 3H1YA 4HZFA 1D4M2 4CDWC 4QX7A 4N78D 4KBBA 1IZ3A 5ACA2 5FPXA 5LK7B 3RGLA 2R32A 3D8CA 2B39A 4Z8BA 5BNQA 1OXZA 5F5CA 2JMHA 3C64A 1VBB2 2ZEYA 1WW6A 2V7JA 1SLBA 2DCKA 2X09A 1NXMA 4Y1VA 5F3CA 4BHPA 1ZBA3 2XHNA 2YROA 3CJXA 3FB2A 3UQ4A 3RLFF 3KQ4B 4H63V 3H0OA 3IAPA 2H0VA 1CQ9A 2VBBA 1JYIA 2ET7A 4OHVA 2C0ZA 4HL0A 4GKKT 4GAZA 4Q4W3 3LA7A 4Y24A 2CMRA 2X67A 4E7SA 4HFBA 2RJ2A 1BXHA 4OUSA 5JLVA 4PAGA 4JI0T 4HK8A 1AF9A 2K46A 2XBO1 3RRWA 2AE9A 2Y8DA 1E57A 1SPPB 3RPUA 1BKZA 2NYYA 3CJIC 4LIVA 4A42A 1WMDA 1YQ3A 1JOBA 5CB4E 4GMP3 4Q0PA 4QX3A 4LF8T 2E6VA 3JU9A 2V7IA 2RR11 1Z0PA 3J7HA 1E5SA 3H3UA 4LE3A 4RQPB 3DKQA 1PIV3 2WNEA 4ZKTB 4HFSA 1BMV1 1D0XA 3DP7A 3Q9DA 2WO1A 5ABJB 2RJKA 4ARXA 5LY1A 4O4HE 2XJVA 4XF9A 4ZZBA 5DZFA 3HQXA 1UCUA 2C1FA 2I74A 4QPIC 3LBXA 2D6MA 1JW6A 4Q4V3 2LM9A 4FOVA 3UJOA 3FZ3A 1BBT1 4RGAA 5LW9A 1ND2C 1H9PA 2HWD3 2JE9A 4JGZA 5LHHB 2RMU3 2HH9A 3H50A 4HLTA 1FYUA 3MV01 2H89A 1KJLA 1XYOA 3OUJA 1AYM1 1ZRDA 1W2TA 3KD4A 2A9UA 2UXXB 2XKOA 2IAKA 4YTPA 5FYTA 1QQP2 2OPKA 4WM7B 1RC6A 5LGTB 1F15A 2A1XA 5A6XA 3WG2A 4FPLA 3GCXA 4W6XA 3TBDA 2X0YA 4YM2A 1POV1 1GICA 3WDWA 3ZYKA 2FJDA 4EV6A 2P9BA 2VVSA 5JIAA 3UNPA 3JAFA 1W09A 5C8YE 1YFUA 4Y20B 2VXRA 3NNGA 4GIQA 3TOJA 4WV8A 4ASKA 1K5JA 1YQ5A 4XF0A 1GQGA 3LFIA 4IEPA 3LSVA 4M0NA 1RUH3 2HHHT 4HFVA 3JC6D 4UFHA 3CIHA 5FIXA 4I0WB 3FBZA 2NTXA 4O2AE 4JQRA 3WX5A 3ZIXA 4AEKA 2CWYA 1W0BA 4CDXB 2L9QA 2RPAA 4H9QC 2A71A 2DFCA 2DI4A 3EMRA 4XBLA 2BERA 3T09A 3WF0A 5F9TA 5FPUA 5FY5A 1CGPA 1DZRA 3M3QA 2Q8CA 3UGFA 3U0ZA 5J1GA 1XSRA 2XQ7A 4YM1A 5JVVA 2JIGA 3FZLB 3MW4A 1KXGA 3N7MA 5FJKA 4G2AA 5H9RA 2R041 3MIGA 4TZ4C 4ZHNA 3AMPA 4BJ0A 3RZLA 1UYZA 4WBNE 3RMYA 2R1DA 3ZLIA 1BLZA 2VCCA 2LLYA 5C70A 4PK4A 4ADZA 4X66T 4ZEYA 1HX6A 3OF1A 3I2OA 2YUEA 3HAGA 2CLYB 2H7VC 3J7LA 5SV5A 4BCUA 1PM4A 3NO8A 4JGZC 4Q4Y1 4YVSC 1JZ2A 4DMWA 4DR3T 3GMIA 1C1LA 1W39A 2GMPA 3OJBA 5A7NA 3FL7A 5LCWL 1IBLT 1AUYA 2R49A 3TEYA 1MIYA 2NOXA 1ZBA1 3AZWA 3M8LA 3EB7A 4LK6A 1GP4A 4X6QB 4YSYA 4L9BA 1WLXA 1NCQC 2VURA 4OX9T 3SEEA 3EUHA 3WXPA 3DCQA 4Y4RA 2XQ8A 5FXVA 2QA7A 2R072 4XBFB 1W06A 3I2IA 4AVCA 4LA2A 3QD6A 2BS2A 3L39A 4MHRA 2FMYA 4FPGA 4XUTA 4AI2A 5FRAA 2D97A 3AZYA 2LM2A 3ZMZB 4AFDA 1TEIA 5IFTA 2YFUA 3JBG1 3JADA 2VKOA 1FPN3 3F2EA 4NHKA 5KR7A 4UXNB 2YBSA 4NHMA 3BU7A 1MNDA 2WDRA 1IPJA 3O1UA 2IW5B 3K3NA 1W6OA 1XE7A 2VVFA 4DOUA 1Y3TA 2RR13 4RFRB 4G3YC 1NUKA 1HX1B 2B8MA 4ILBA 1EV13 3WDUA 4PDWB 5IAXA 4ANJA 1X9BA 4IV1B 1PZ9A 2W9XA 2VQET 2JMKA 3I3BA 4MG2A 5EP9A 1X8EA 4WVMA 5AFEA 2JPFA 3I97A 4G63A 2V6YA 1RUJ1 1XXNA 1LJ7A 4QH1A 2Y34A 5CADA 1VBE3 1YIPA 5H9SA 4QXBB 1XE8A 2IMLA 4HFHA 1H2KA 4OK0A 5F5WA 2UYAA 3S7EA 3O1RA 5HEHA 1R091 5A3TA 1I6XA 3I8TA 3I3MA 3ZXLA 1W04A 4YTMA 4YJ3E 5C8CC 1ZZCA 3P4SA 1W6PA 3VL8A 4X65T 5F6KA 5A7SA 1NENA 3UUNA 2XB6C 4BAYB 2WWUA 2BPA2 5T3NA 4E4HA 4NR1A 2EXIA 5FLJA 3P50A 2FZ1A 3IBPA 4WM8C 4Y20A 3MBWA 2DUPA 4D7TA 2CXDA 4YHJA 3POSA 4AAXA 5T50A 4EN8B 5FQ0A 2M6BA 5LYJE 4ITCA 1ZRFA 3X1DA 4LBNA 2HWF1 2E9QA 4Q1RA 1T6BX 4XHXA 3WQ1A 2FJAA 3C50A 4CN1A 5A70A 4AXPA 1W9FA 4IGQA 3S6PA 3VHPA 4TNWA 1DQ2A 2NW7A 3MKDA 1U4QA 1G73A 1QHDA 3VD5A 4YSXA 5C6CA 5L2LA 4ZS3A 2VCBA 4MO3M 4YHHT 1IPKA 2LUWA 4XABA 2H6CA 2YV8A 2L9LA 2DVDA 1YQCA 3MI8A 3B69A 1CWPA 3RRCA 2GC0A 4PJLA 4DEQA 1YUDA 4B6XA 2X10A 3UK9A 5F37A 4YLHA 4AQTA 3W20A 5IVFA 2CV6A 3KF5A 3MW2A 5L9RA 4JRLA 2I0MA 1S1AA 4KBMB 4LO6B 3SEPA 5AC93 4O2BE 1UF2C 3EDVA 3L2HA 4IV1C 2CBIA 3RJRA 3M70A 1PGL1 1LODA 4U36A 1RTVA 4L5GA 3B00A 3K75B 2Y48B 1IG0A 1ZYBA 2BJSA 4K9SA 1V6JA 4UYBA 5K8SA 1NA1A 1V6NA 1LESA 3ZJ2A 1OLRA 1PK6B 4HT1T 4URAA 3V0BB 3ZPYA 4XZUG 5FMCA 2C26A 4ZI3D 2PA7A 1RITA 1LNSA 2B42B 1I5PA 4XW3A 3KS7A 5CKNA 4NHXA 2K0GA 4AQ2A 4YG6A 4BIOA 3OBAA 4XVHA 3WDXA 4DRVA 3GWHA 2WZ8A 1UX5A 1BZWA 1FIOA 4IL7A 3T08A 5JXHA 4NHLA 3SRZA 2UU9T 4XCAA 3PUWF 5CNAA 1SHZC 1NLSA 5LHIB 1W9TA 3C98B 1EUTA 2DDUA 2VQAA 1GZWA 1GSLA 3TAYA 1N33T 1S2BA 2D3RA 4GWNA 2E7TA 2GAUA 2XJRA 4NPLA 2NP9A 1VB4A 2P3YA 4WBOA 3IDBB 3KF3A 5GZCA 1WLDA 1MMAA 4HWCA 4MVTA 5A80A 4EN6B 1FMD1 1I1EA 3GN5B 4XACA 4IUGA 2ZHLA 4IT4A 1B35C 3HI2A 3SWHA 1EPWA 2VZVA 4H55A 4OYJA 3UL2A 3ZFFB 5FOJB 2YGLA 4X8NA 4ES8A 4FQ4A 1GP5A 3B9IA 3NAPC 1AR93 1UU6A 2K9AA 3DXTA 4YLZA 1HRV2 2VZUA 5A1LA 4FFHA 4GMP0 3U4XA 4JGYB 2IUWA 5EJZB 3O1TA 3PLQA 4FAHA 3KGLA 1UX7A 3I4IA 4Q4X3 5FLIA 3U75A 1OURA 4Y5Z0 1XJAA 2KA3A 2VD7A 3H1WA 1PMHX 3F2ZA 2KXLA 4XEZA 4XXPA 5F2WA 1GR3A 2VUDA 2BFUS 4FPOB 3W58A 3ZFGB 4A6SA 3VR8A 3J8F2 3T0DA 2K9ZA 1OKOA 3MF9A 3PIJA 1W2NA 5KX5E 2WFF2 4AHZA 1XNRT 4EN0A 2A6YA 1NCRB 4N9IA 1QNYA 4XZPA 5E8AA 2E5VA 4NPPA 1US2A 2CDPA 3CL1A 3KHBA 2WB5A 2W47A 2X29A 2EHOB 4HVQA 2GN3A 3AP7A 1E1HB 4TWHA 4XXAA 3KDSE 4COFA 4IEWA 1AYN3 4YXDA 1LOAA 3RNSA 2BVLA 4F8AA 4ASMB 2C4XA 3CVRA 3AEGA 4MHCA 1X7NA 4XFFA 2XH6A 1OHFA 4LBMA 2D9DA 1RXGA 3DECA 4IERA 2V6YB 2ZAAA 1NOVA 5A7OA 2OUHA 5LB6A 4D69A 1PO22 3S30A 3SKJE 3VBOB 1R64A 1NKGA 4BQWA 3SMHA 5A33B 2IFRA 2VQ0A 2FDKA 3O9XA 2XKPA 3N2OA 2KWHA 2W67A 2XVGA 1ZVFA 1M7KA 2F6BA 4MZUA 4PIYA 5DDJ1 5CBLA 2DURA 4LBLA 4TLFA 1PVC1 4U31A 2KT9A 5JAXA 5C5TA 5FY9A 3AZXA 5FYSA 1U5ZA 1CAWB 4IREA 2XUEA 1QOSA 1WCUA 2EIEA 3NQHA 1UYXA 3ZSTA 4KL1A 3RHWA 5A3UA 4YVWA 4HWFA 4Q4Y2 4CDUA 2LW8A 2IXCA 2Z42A 5FO8B 2RS33 1QEXA 4P5HA 3RJ2X 1JS9A 2RMU1 3BPSA 2OKXA 4BLIA 4CCOA 1JH5A 1PIV2 1UQXA 2WP9A 2Y6FA 2RDSA 2BBHA 1HIXA 1UOJA 3K4ZA 1MS8A 3Q8CA 3IMMA 3SH3A 3ZFFA 1ULPA 4XFGA 4MGIE 3IB3A 1C1FA 1WBFA 4V2VA 1C28A 4GALA 1FATA 2YB7A 3AL6A 4QXBA 1HB1A 4WNKA 4N7IA 5JSPA 2W61A 4IHJE 1R1A1 1VBA1 3ZYLA 2BNNA 3RVHA 1DQ5A 2VZQA 2Y6HA 4AEDA 1OEDA 5ABJA 4FPKA 5LEKA 2WU5A 1LKNA 4I50E 3VR9A 3QC9A 2XWBB 2R073 2D6NA 4Q4W2 5FZOB 1SLCA 3BQIA 1T98A 1DFQA 5KMGP 1B09A 4LK7A 1STMA 1GMMA 2A2FX 1W2AX 1J5ET 4N43B 1FNZA 4YPJA 3GZTB 3TNPB 4ILCA 3FHIB 1HW5A 1TE1B 4ARYA 4BQXA 3RZHA 4DMVA 5I0DA 4KU8A 2KZ7B 1NEKA 5LXTE 1L7RA 5FYVA 4I4TE 4CE8A 2V1DB 2Q9QB 3O14A 2PTFA 3BODA 4TN7B 3M3ZB 1G6NA 2J1EA 1OEDE 2IC6A 1SEFA 3OGVA 3USUB 1D0YA 3OBZA 1KEYA 3SQOA 3RRDA 2R0FA 2UXBT 3ZIWA 3ZR6A 3T3YA 4AK3A 2JDPA 1DU2A 2PLV3 2HLEA 4HBNA 4B7KA 5EXOA 1N1TA 1JUHA 1RVF3 4E9KA 5A7WB 3O5SA 3LWCA 3URFA 1ZP0A 2K2SA 1K45A 3TN93 3VZMA 1CZVA 1KS4A 2E63A 4N90A 5A3MA 3POGA 1UY0A 2ADDA 4H9SE 3IEEA 1UIJA 2IVJA 3FZMB 1BVP1 4U2YA 1W9WA 2XQ6A 3P3NA 1S0IA 3ZOIA 4GOUA 3R4UA 4Q5OA 3PUHA 4QHBA 4HEAA 1D4VB 3ZYBA 3ILRA 4META 4UW5A 4E8CA 2D6PA 1UMIA 3WUCA 2CA5A 1J1LA 4BPZA 3BIEA 3WG4A 2WZIA 3ZN0B 4LFCT 4LFAT 1OWAA 1QXPA 3ASIA 2E9XD 1W8UA 4JGZB 4QQPA 1LULA 1RHI3 2VNOA 4Z2WA 1CUNA 1DIWA 3USUA 4YFZA 4QX8B 3SFEA 3E5XA 1WKYA 3VHRA 4IGPA 1R081 3WNLA 1UU4A 2P4EA 3AAIA 4XUNA 5EHDA 2Q8DA 4PHZA 3ZM8A 3DEMA 2XAQB 1FX5A 3AKRA 3A8YC 5EK2A 5ADXL 1ZZ9A 5FWEA 2CRBA 2LSIA 2FMDA 3RFRA 5GZGA 3S57A 1NZIA 5KWRA 3C4ZA 5FXWA 4UIGA 4ONUA 1X36A 5IATA 1HNWT 1UZWA 2OZ6A 1UO9A 1DCSA 2CWMA 2LE8A 2N1GA 4Q4V2 3VU7H 3FC0A 4XPVA 2EAKA 3AAAB 4C8DA 4D7SA 2W00A 4CU9A 1RUE3 4I01A 3ZSMA 4DXSA 4ISQA 3GM8A 3LG7A 1QU0A 4L8QA 4U3CA 1JU3A 1MS3A 1RXFA 2M67A 1HG5A 4IDNA 2CGOA 4L97A 2WN3A 1EPZA 4Z90A 4QT6A 1SLIA 1OI6A 4M01A 1XYNA 1RVF2 4BA6A 3MICA 4ASLA 2R063 3UETA 3BVCA 3MO4A 4NMIA 2HN1A 2E9XC 5FYHA 4TTGA 2GH8A 3VLBB 4RQPA 5CFCC 5AQHB 3GDBA 5FYUA 5K0UA 4LF7T 2NWBA 3QLQA 2BU9A 3UGGA 4Q29A 1PVC2 3VBSC 1LRZA 3ACLA 2WNVC 5DUVA 2VMDA 2C9AA 3WAJA 1ZA7A 1U5PA 1F5FA 2LTNA 3FUQA 3MGUA 4QPGC 5D1IA 5EJ3A 2EIGA 3KBTA 1OOPA 1YLLA 1HTJF 2DTYA 4CSWA 4IE4A 4A4AA 1AJ3A 5FMOL 1BJQA 3BTXA 4AKGA 3NJZA 4J6GA 2CYFA 2A6WA 3CEWA 3OUHA 2WWVA 1ALYA 4MH0E 4EZHA 3K4DA 3VHNA 2JDZA 4FFFA 2XQ3A 4OMDA 3HNBM 1VBE1 2A6XA 4CXXA 5F3JA 2QQJA 4CQIA 4XILA 2DNXA 3CZUA 1VBA2 1YXWA 3TLTA 2VQFT 4WW0A 2VVNA 2A3DA 2LOPA 3E5QA 3NKGA 3RWKX 1CONA 5SV8A 3MLKA 2ETEA 3NNJA 5D8AA 3LSEA 2VKHA 4AI9A 4B8EA 3AMNA 3DN7A 3FFQA 1HN0A 1RHI1 1WUVA 3HD8B 2DCJA 4MX3A 4O61A 5DG1A 5IUQA 5A3PA 3ON7A 1ZZBA 2X05A 5DZEA 5JOWA 3J7MA 4LF4T 4EWAA 3V64A 1LVKA 3J26N 3RYPA 2HN2A 4YVWB 3N7LA 1AJOA 3FJSA 2ARCA 1VBB3 2SBAA 2EHOD 1UZ0A 4BIFA 2HPJA 1RUG1 5IVYA 3VL9A 1K12A 2RS32 2WY2A 4QH4A 5C3RA 5JUVA 1GP6A 3OPTA 3T2OA 3HL6A 3CPZA 2XUMA 3VB9A 2UWAA 4EV0A 3VBUB 4LF9T 1NYWA 1NCQA 3Q8AA 3C8XA 2BFUL 3UESA 1H8TC 3VHLA 4EIWA 3MIEA 1LENA 1RUE1 1Q8SA 2EF6A 1T2XA 4W50A 4CPBD 3WQ7A 3HOBA 3THCA 1RJ7A 4WVWA 4YZ5A 4SBVA 5K7PA 4Y22B 4QB2A 2A7AA 2YGMA 1ST8A 1MVEA 1IOAA 1W9RA 4P02B 4R8HA 4A3XA 4YSFA 4ISSA 5AQNB 1XNQT 2EHOA 2RP4A 1C57A 1MEC2 3UU4A 1KFXL 1ZRRA 5AC91 1N1SA 2SLIA 1QLBA 3DTOA 2ZOEB 3I3DA 3O0WA 4INDA 4NAOA 4OUEA 4ZU5A 3QOFA 1JZ4A 5D8AC 3MZHA 3CHXA 3Q5DA 1POV3 4HN0A 5J37A 5CGMA 3HMYA 2PFVA 4CCCA 1Y4WA 4QM9A 2R6GF 2D0UA 1FJGT 2ZAHA 1UU5A 1KJRA 5JRCB 4JEHB 1SCRA 4LKDA 3HBKA 4LKFA 2BZBA 3U11A 3WCRA 1AL0G 1T72A 3OJAA 1RUD1 1SQ4A 3ZSJA 1MVQA 1JYTA 2NW8A 2CXFA 2JXAA 3KVAA 1J5WA 3PURA 4N43C 1KFYA 4R9CA 2RV9A 4EEBA 2TUNA 4QB1A 2EHOC 1GOHA 4RN5A 3PVBB 1FV2A 5KC6A 3VKNA 3Q5EA 4CXWA 2K48A 2KWIB 1U5IA 4AQGA 4M1PA 2D93A 3RIUA 3OTOT 1DZQA 1ZBE2 1FV3A 1W9SA 1TMF3 2ZM8A 2ZTNA 4O7XA 1WD4A 2F4VT 4YNIA 1XYPA 2W63A 5LP6E 2XY8B 4C90A 2FJBA 4HKAA 5DQ0A 2DHRA 2E7QA 2KINB 4UAPA 5BY5A 5IVVA 1AYN1 5HXEA 3VBHA 2MEV2 4GYRA 4R9AA 4RD7A 1HN1A 1N3PA 2C5JA 3FHNA 1GZCA 2A5ZA 4LBQD 3VD4A 3RPQA 5EK3A 4GWJA 4K7JA 4F3JA 1YQ4A 1H2LA 4JI7T 4ZI2D 1L7QA 2E9XB 5APAA 5FMOS 2XLFA 1FOD3 1PX3A 2JG8A 3N9QA 2XWJB 4QU1A 4B29A 5HWYA 3RIUC 5T55A 5HAXA 3K4AA 5HWXA 1AYM3 4A7ZA 3U3IA 3ZYJB 2H88A 2IDOB 3J4UH 1MNEA 2VNRA 1S0EA 4I0AA 4IEVA 5DG2A 3AE4A 5LA1A 1L0VA 5IW0A 2PLV2 4EJRA 5JVDE 2H6BA 3TRSB 5IWFA 5L9VA 2X53S 4B1LA 5BV6A 3AMQA 1NQJA 3OCPA 1SE7A 1O4YA 2CHOA 5L3FB 5M4YA 1NT0A 4JI1T 5J09A 4AYUA 1OMIA 2LSKA 4AQYT 4ATEA 3KMHA 1RUC2 5LBBA 4RA0A 1W3VA 2MNGA 4O4JE 3ZSSA 1IS3A 1R1A2 1W0OA 4XCBA 3VBHB 2UY9A 5FZHA 3BPZA 2JDUA 5FFOC 4CEYC 1GKBA 2ORXA 5IK8A 4HTEA 3B5MA 3VRAA 2FCTA 2QNKA 3ENRA 1ZM1A 3IPVA 2AR6A 3OGRA 4JGYC 3RI9A 2D5FA 3FHAA 3FBYA 1WCKA 2XBO3 1IG3A 4QB6A 1US7B 1S2EA 2VBDA 3VDCA 3WNNA 4CU8A 5JZGA 3RZKA 1GNZA 4HFEA 1NAEA 3JBG3 4MXWB 3LZZA 3AB0A 4PLOA 2WFPA 4P0AA 5L3EB 3QUJA 4B3RT 3ONLC 1MS4A 2V4VA 3A0KA 3GJBA 5FZ6A 4R4XA 5I0TA 4COVA 2CHNA 4N8MA 3OYWB 1CZSA 3DJBA 1MS1A 3MFCA 2OYZA 3WNPA 1LHWA 1I6ZA 2PXJA 3M65A 4JBWF 1AR63 4IXLA 4LHKA 4YZ2A 3DL3A 4XJUA 4H9OC 3RZZA 3D5OA 1US3A 4DVDA 3BIWE 2VCMA 3OTFA 1PZ7A 2WU2A 1JNZA 2HJIA 4KBZA 3N9OA 4XHBA 2DVBA 3CIRA 3APBA 3NSTA 1XWMA 2RS53 2ES3A 2XLAA 1D1AA 4IDPA 1HRI2 1VCTA 3FFZA 4YZ4A 2DWGA 2R061 2IC1A 2IZWA 1BBT3 3K1SA 1ULFA 1AR62 4AISA 3ACIA 4QX5A 1YKEB 4DNDA 3DYOA 3ZFGC 2OX0A 2ODUA 4V1Av 2ZKLA 4G4FA 2TBVA 5FZOA 4XTMA 1DQ0A 1H6YA 2AYHA 3RQUA 1YIFA 1IQAA 3AA1B 2VE1A 2WS93 2ZMLA 5GJ6A 3SCFA 2Q8OA 3CMLA 4U7YA 1HRI3 4QXHA 3MA9A 1GBGA 3P6BA 4PQ9A 1SBEA 5HXMA 4UFMA 2BBJA 5CZKA 3KHCA 2MYSA 1G86A 2B9VA 1RINA 1U5XA 4UEMA 3U1XA 3P4RA 1JZ7A 2OPWA 4FQZA 4A3ZA 4UW6A 1J59A 2X9HA 3PIGA 5FKBA 5KC5A 1S55A 1O59A 2BRTA 2HWB2 3HR9A 3HKEE 1DGRN 4JVAA 2WL1A 4QPWA 4OZOA 4ZXLA 5EV7A 2X0HA 4XDPA 1LGNA 3D82A 1QIQA 3AKSA 4R9DA 1YJLA 1H30A 3W59A 4DY5A 1W8TA 1JYCA 3UU8A 2VWAA 4UELA 5AQLB 2AENA 5A32A 1VP6A 1QDCA 3POBA 1EV12 4YW6A 5E88A 3OPZA 2X0LB 5LBMA 1DGLA 4GH4A 1H2NA 3RZMA 1J58A 1AHSA 5JOXA 2VO5A 1JTZX 3QNUA 1EP0A 1BHGA 2DBNA 4QGMA 4X8PA 2FBWA 3BI3A 5DAVA 4WM8B 4H7LA 3Q9OA 4QX2A 4XAAA 2YDRA 4CDXA 1D2QA 4E4ZA 1N36T 3SC7X 4UVCB 2IXJA 2C9KA 1O4ZA 1XB9A 1G9AA 4L9IA 3KT7A 1IHMA 4EGWA 3J9SA 4HKLA 5DDJ3 4MV2A 2ZMKA 1S2KA 2QTWB 1HB2A 3GJAA 4WYVA 3M3OA 2W1WA 1ND3B 3WY6A 2G9GA 2WUHA 3LGRA 4YYOA 4GMP1 3TLVA 4CRQA 4EWDA 3AB3B 3AE1A 2O8QA 1UYYA 1OH3A 2B1EA 1RMU2 3IIIA 1AR92 2GMMA 1T8BA 1C5IA 3VKHA 2J1VA 2BOJA 2P3IA 1KF6A 3AA6B 3AZVA 1ZREA 4DV6T 4K0UA 1E5IA 3B7MA 2PHTA 4FP2A 3ZXDA 4BXSV 1AYM2 1FPN1 2ZMNA 4FI5A 4AAPA 1UAIA 4F83A 1QDOA 3ABZA 4GZ9A 3EQEA 2QVAA 2ET1A 1FOD2 2RM22 1WR6A 4W6WA 3I0OA 1XQNA 2AACA 4K3UA 3W15B 5C3PA 2XAFB 4I0UA 4QQ2A 1I94T 3LAGA 4U2AA 3WNMA 4EOZB 3B94A 2N9DA 1PK6C 4FPYA 1WFDA 3ETPA 3AE8A 2IXLA 1C8M2 4OHXA 4KP3C 4RL7A 3WHTA 4PIZA 5J36A 1NE6A 3I1AA 2GC2A 2Z4FA 1SLLA 3D0JA 4N53A 3AE9A 1UXZA 4OVEA 3AXEA 3PE0A 3NV4A 4CP9B 2C24A 1LU1A 2BGCA 2ZGOA 3GYDA 4KWUA 5DUXA 2V26A 1UNBA 4A97A 5LB7B 1YNAA 2ARXA 2DTWA 4OMCA 5K4LA 5IJRA 3WDTA 1QQP3 3BUCA 1D0ZA 2P3KA 2Z5WA 3B01A 4UV9B 1C5HA 1JBCA 1HKDA 1X8MA 3ZXJA 5LOVE 1UW8A 1LKXA 4XFHA 3S0MA 1GWKA 2P6CA 4Q0VA 2P17A 1C8M1 2DVGA 5HCMA 3C7EA 2MOZA 4UWDA 5KXDA 4EAHA 2QQLA 1QQP1 3ATGA 1AXZA 3Q2MA 3IIAA 4XF4A 5EQUA 2GZWA 2I6HA 4YGDA 4NWWA 3AX4A 4E2GA 2VK9A 4ISRA 3RKOA 3NAPB 3PUIA 4YW5A 3O1SA 5KHKA 2XJ7A 5BPXA 3LE0A 1RUJ2 3D4KA 1ASJ3 4LF5T 1PO13 2C5KT 4QPIA 4OFZA 4TWDA 3ALQA 3LEIA 2WM9A 3PTRB 4BJNA 5C4WA 4MOAA 4UFJA 1WW7A 3LA3A 3B13A 2PHUA 1UUSA 2K5BB 1DZTA 2HWD2 3GALA 4CEWC 4ORFA 4I55E 2BG9B 1YXRA 4MXWA 4D0QA 5C8CB 2V7KA 5ANQA 3ZX7A 3ROUA 1XNCA 4DXZA 3P7IA 2N2NA 3LK42 3BB6A 4Y1YA 1V9U2 2VVEA 1Y64B 4WZXA 4FXGB 2BDRA 3RG0A 5FPAA 1BEV1 3UKNA 3WINE 2LT3A 4CUCA 2IXKA 5DMYA 5HEJA 2AUYA 3LPGA 4MUVA 5A6QA 2JRKA 5LJNA 5FZ3A 1GV9A 3T2QA 1EYBA 3NZPA 1COV3 1QJY1 3IN9A 4XBNA 5ABHA 1V6OA 1MIWA 1AL23 4FFIA 4P9IA 4PI0A 4Y1UA 1D7PM 1F31A 4CU7A 1ODMA 4PK5A 1W8ZA 1VBE2 3OGJA 5HEUA 2XG3A 3I54A 3USSA 4CCJA 4DS0A 1O6UA 2HWC2 4BK5A 4A98A 3IDCB 1QGLA 3PVOA 2W95A 2G0UA 1NLQA 4JZRA 3E0ZA 3WQBA 4D94A 5L7OA 4H9RC 2VZ3A 3CLPA 2VTXA 1S35A 4LIUA 4JAAA 5I91A 1QJX1 4KGGA 2YU2A 3UT5E 4HVRA 4K0KT 3UJQA 4IE6A 2JQ9A 4DMIA 1GQPA 5KXEA 2MPFA 3JD73 4DEVA 1LOFA 1RUF1 1GNHA 3NWIA 1AL22 1ND2A 5CG9A 2ODVA 3RKGA 4K1ZA 1QJEA 5FYZA 2VM9A 4R4ZA 1LU2A 3MV11 3V0AA 2E32A 2VMFA 3PUYF 4H9PC 4F8HA 1LHVA 1OUXA 3JQWA 4QXHB 3IZOA 5A3NA 3WP6A 1RUJ3 1WW4A 2JG8C 4LJHA 3BCWA 1A78A 2ZABA 4HN9A 2JKBA 2WNUB 5GLZA 1ZOYA 1PVC3 4AKHA 2EIDA 1V9U3 2WR9A 1DGRA 4AQFC 4FCAA 4QXKA 5DN2A 4CDUB 1ODNA 3ACGA 1OA2A 3R05A 2W52A 2BUKA 2YOEA 1PVXA 5FLHA 2E8IA 2ORZA 1ULEA 3J7NA 4TXWA 3ZDSA 3CQXC 1B7TA 1JN2P 5DUWA 5J7MA 1AR91 1ZEEA 2XJSA 3NV3A 5J96B 5K9YA 3CO2A 2C5IT 5HCFA 2ZA9A 5IHRA 4CCNA 3VKOA 2WABA 5FCCA 5CAZA 3CF6E 2JJ9A 4J1XA 2NP0A 2QDRA 4ILAA 1OEDB 5AQMB 2D6KA 2JEMA 4DRRA 4Q26A 3ZXFA 1HQWA 1RHI2 4LO4B 4BA9A 2CCQA 1AXYA 4QXCA 2FZ2A 5T5OA 4OHYA 4UI9L 5CIRA 3SNMA 3B9CA 3O1VA 4KH9A 2W91A 5KHGA 3RYFE 4CN4A 3CQGB 3AFKA 3IBMA 1J84A 1SFNA 1SG3A 4NWVA 5ABFA 1D2SA 1HRV3 4YG0A 3MPBA 5EYXA 2JG8B 4D6QA 4IDZA 5FDBA 2VUAA 4C91A 1WLWA 4LO8A 1G8WA 2VVDA 2J1UA 5GZEA 4JUYA 2XL9A 1A34A 1H8TB 2WQ8A 2JE8A 3ETVA 2WQ4A 2GU9A 3AKPA 5HCJA 3WI3A 1AZDA 1ZZ6A 3I3QA 1IZNB 1W2UA 4M4PA 2VKDA 3N7JA 3OBTA 3AC0A 1W8WA 5KHJA 4EYUA 2IWGB 5GLTA 5BXXA 4MFRA 2RA1A 1N34T 2PTMA 3DPRB 1MMGA 1POV0 2AC1A 3QH6A 3MXZA 3LQCA 2IXHA 3GXUA 1HXS3 4QDSA 1UPSA 5KXCA 2PHRA 5KXBA 1NCQB 2WAAA 2BKPA 1BK0A 1G9CA 2WSUA 1AX0A 3V0AB 3POJA 5GALA 4CP9A 1LOBA 2HWC1 3DPRA 4FPHA 5GONE 1UY2A 1VCSA 4CI3B 1JNRA 2WDBA 1OOPC 3CMGA 4K8RB 5LATA 3SLIA 1REDA 4MHUA 5CVRA 5AQSB 1SPPA 1X50A 4GB33 4X64T 2J22A 1K5MB 3INAA 4YT0A 1NE4A 2OIIA 3M1HA 3W5MA 2BWAA 2K3WA 4HFIA 1WMEA 2BYVE 1F2NA 2KLQA 1SZBA 1REFA 2CWSA 3KV4A 3PJYA 4IE5A 1JYVA 3I49A 3NBXX 4CCLA 4QPGA 5LMNT 3KCCA 1QJY3 4DXTA 4QQHA 2EVXA 4QDRA 1RUD3 5IYYA 5LY2A 3AXDA 5FY0A 5L9BA 3ZXGA 3WT3A 2YKSA 3EBRA 4OQ9A 2CPTA 4IV3C 2PQQA 3HT2A 3HNMA 2WNOA 2CY6A 1OQDA 3DV8A 4GQ7A 3N2GE 3QB5K 2O8OA 4I02A 2WBLA 3AMMA 3ZFEC 1QWRA 3OGGA 4CYDA 5A1AA 4GKYA 1J83A 1A6CA 4DV4T 4XDQA 4Q4X1 3MFAA 1XMOT 4AI1A 1KITA 3OPWA 1BK1A 1UYPA 4GH4C 4AGVA 5I0SA 4N9HA 5FQ0B 4FPCA 2XVLA 2EAAA 1W3XA 3PUQA 5FZBA 1NA1C 2UYBA 2VQTA 4UW4A 4FXKB 4TNVA 4EQVA 1AVBA 3FUOA 4DO0A 3WG1A 1TMF1 4XAXB 2LS6A 3ZMOA 3OYXA 5JZGC 5A7QA 4GK0E 1HS7A 1X79A 4X1KE 2KNDA 1WCRA 1H8TA 5CB7A 3ZYRA 5IK4A 3AE7A 1E7PA 4CN6A 2HBTA 5AFBA 5BNPA 1GOGA 2X9YA 5H9PA 4V2WA 4Q8LA 5L3DB 2DV9A 2QQWA 1V0AA 2R6QA 2YHJA 2W46A 4PFPA 4GD4A 3RZGA 2Q30A 3I59A 5JDGA 4DUVA 5T54A 4CUBA 1TME1 2NZ9A 1V6IA 2UURA 2ZPXA 3CBNA 3FLPA 1DYKA 1D4M3 5LBQB 3NKZA 1VBC3 1VMJA 4NHYA 2RVAA 5FKYA 3O1MA 1DQ1A 4WZFA 2OQ7A 1OSGA 2TNFA 3ORJA 3ZSLA 3GZEA 3LD8A 4L99A 1VBD1 2NLRA 3CK6A 3EO6A 2A3WA 2HBUA 4IEUA 1AYN2 4P14A 4YW4A 5FZIA 4JEUB 4XJ9A 1D0HA 5LRRA 2PHFA 2EXKA 3JUUA 1QOTA 3BTYA 3VDDB 4LITA 4FSJA 1H1IA 3AA7B 4CEYA 1PO23 4ZI2C 1PGW1 4IEXA 5LBFA 3V65A 4EEDA 4DNYA 2G1MA 1W05A 1YQ8A 2QVSB 2VMCA 2ZS6B 3PU3A 3OUIA 1SACA 2GC3A 5LBEA 4JI5T 5HEOA 3Q8BA 3IAQA 2WFF1 2G9ZA 4M3CE 2CDOA 3W5NA 4DBRA 5ISLA 1NX9A 2JIWA 3PNAA 1G8XA 3O7OA 4LBQA 5JR7B 3FHQA 4YW3A 2CGPA 4LQRA 3WCSA 2FCUA 4H3WA 1TVGA 1FT9A 2ZGNA 1O4TA 2A72A 2BVBA 1NCRA 4KI5M 1BMV2 4P08A 3AEDA 2CE7A 3LEKA 2BWCA 1XRUA 5DQWA 2J4GA 1OLQA 2WFF3 1LOGA 3P3PA 2WS3A 1UK5A 4UFKA 3WW1A 4XBQA 4HANA 2XSAA 4DQAA 1R1A3 3WHUA 2V8SV 1OXCA 3AL5A 1WCSA 5JSOA 4PI2A 1F9KA 3MUZ1 2DCTA 1C8M3 3UV9A 4AFCA 5C71A 1YRZA 4CDWB 4RR3C 1JYXA 4HWHA 2QBXA 1Z7S2 3ZN6A 2VECA 1E5RA 1ONAA 3A7QA 3HN3A 1WCQA 1F4AA 1QH6A 2QZ3A 4HPKB 4XOGA 3ZSEA 1XMQT 1T6GC 3LEGA 4OLLA 4UF0A 3A7MA 2WMOA 4AKRB 2Y0OA 2VZPA 3BOPA 3MPPG 2KM2A 3PMSA 2GNDA 4QPYA 1V9U1 3ACHA 3AXJB 3AP4A 4RHV2 3VHOA 4DY3A 1ENRA 3NVOA 2Y6KA 4EYYR 5JDMA 4R9BA 3TB0A 3EJKA 4ZU4A 4OCTA 1J1TA 2JDKA 3NJXA 4YVWC 2P5BA 4NO4A 2JE7A 3M7AA 1LRHA 3FZHB 2W0XA 2ACZA 3OYWA 3ZCIA 5JWPA 4HFDA 1IBKT 4KU7A 4BQYA 2ZX1A 1VMHA 2WZR2 1S94A 4ILUA 1SDDB 1Z7S3 1BQPA 1Z7S1 2NM1A 4PT6A 4O8SA 4W6YA 1R082 3B02A 3ZYPA 2J42A 2JX9A 5HCHA 1ACCA 1O3QA 3EDUA 4AEDC 3FE5A 3BYWA 3IT8A 5EPAA 5FY1A 1YFYA 1ZV4X 3LIHA 4JKLA 3D3AA 1XE0A 4QMAA 3H3AA 2ZEXA 4JCKA 5FL0A 5FYMA 3AYDA 2ZXQA 3VZJA 5T5LA 4CP0A 2Q8EA 3ZKUA 2CBJA 1AX2A 1GZ9A 1R093 2OUJA 3ONXA 4ZZ8A 4CEWB 1K42A 2UUCT 1J3PA 3VBSB 1MIVA 2HWB1 2QQIA 5JR9B 3RYHE 3LDKA 1K5MA 2YZ4A 1V6LA 4FPFA 4P00B 5IAVA 1CAUB 2XQXA 3WR0A 2WYSA 3JCFA 3ANWA 2WJSA 1MS0A 4KMCA 2D3PA 3POEA 4J1WA 3K3QC 1YO8A 2W1UA 4LTAA 5FVLA 5J0ZA 4UFIA 4ES9A 3ZR5A 5IVEA 5JXIA 4AVAA 1QJU1 4LA3A 1EZ3A 1MR5A 1VAKA 1N3QA 2ZZQA 2RDQA 1W2OA 4Q0QA 1C8NA 3VN4A 5HEGA 2ZGPA 3H8XA 2I2SA 2N7GA 4ZXKA 4QX7B 5A7PA 5BNOA 1WLTA 4RSUA 3ELNA 5JPNB 4AL9A 2YG0A 4AEDB 2A70A 2WO2A 1SCSA 2BS3A 4XURA 1W03A 5AFUL 1XNBA 4UBGA 4NIHA 4LBKA 4NUUA 2VMHA 5FYBA 3P4WA 3AXJA 1OUSA 4YW1A 5F5AA 5FZLA 3OVUA 3VBOC 4Z1VA 1KK7A 4YFWA 5FZGA 3SCGA 3N36A 2H0BA 1YKHB 3RX6A 1VBA3 2W68A 3KFWX 2RS52 2JG9C 2W2UA 2WYFA 2LM3A 2Y6GA 4DIQA 4XFCA 3ZFGA 2WNUA 2UXDT 3HNYM 5L4EA 2ZEZA 2PHDA 4PF5A 4B4RA 4LULA 4B1MA 4QH5A 1UX6A 2ZX0A 5L73A 3RC8A 4P09A 5B4NA 4RS5C 3B57A 5LNKA 5C7GA 5FZ8A 4P0BA 3UFGA 2L8KA 4LKEA 5KHIA 2BKNA 3BALA 2AZ5A 1AR72 1B35B 3HVDA 3PUSA 2DFBA 1GU3A 1NCRC 3AP6A 4CDUC 1GWMA 1MMNA 5JRCA 5FZDA 2UWCA 3JBG2 4JV4A 2W08A 4DR5T 2ZGRA 2ZGUA 1NQDA 1CIYA 4CXYA 2ENRA 3KB5A 4JGYA 5FUNA 3UYJA 3ZYIB 1JZ3A 1OQ1A 3OPCA 5LHGB 1OLME 2XBO2 4BE3A 1M06G 3H3LA 3TKLB 2X5IC 5E16A 4C1WA 5FO7B 3H8UA 4M3CA 5AQOB 2OZJA 2QFEA 4TWFA 5F3IA 2XJUA 1UGOA 2CAUA 3NRYA 5FP9A 4NXMT 2YDQA 1ENSA 3PMEA 4HETA 4XF1A 4YJ2E 5HXHA 4QM8A 3ZC1A 3RF1A 4AHXA 1FMVA 4GH4B 4KG8A 4MGSA 3GZUC 3SS1A 2JQHA 2HWE3 3CKHA 5T52A 2XL7A 4CP1A 2HEWF 5E0OA 4QDQA 5FZAA 3WAKA 1SFYA 2Y6JA 2Q1FA 1W6NA 3TWIA 1OA3A 2X68A 3W9AA 2XM1A 1W6MB 1JI6A 2HWF3 1QJU3 1V00A 1CHUA 2WQYA 2F17A 2Y64A 3PJAA 4QGNA 4YY3T 5DAWA 4BQ3A 4JTNA 3ZT6A 5C5UA 3T2TA 2BVMA 1LVFA 2JIJA 3ZKRA 2VZ1A 4HE8A 5CYYA 1OD5A 5E89A 4JI3T 1PO21 1TZOA 1W8NA 5DAQA 4DUZT 4B7EA 4OI0A 1BEV3 1KEXA 1M4WA 1Z78A 3N9NA 5F8PA 4DR6T 3PVNA 5T5PA 2ZGLA 2VOVA 4J2CA 2YYOA 4AG4A 3KSCA 3N9PA 1JHJA 1ZX5A 2PAMA 5IYZE 5FAXA 5BNPB 3UU5A 4NOTA 1AXKA 5B4XA 1I5ZA 2AXDS 3VD7A 1XC6A 4A41A 1HCIA 4CCKA 2ZZJA 3I0QA 1PHMA 4HXCA 3IA3A 3MIDA 2O14A 5BMVE 1JXNA 2J1RA 2PN5A 2P6HA 1RL3A 3HBZA 3LEMA 5FY8A 1AJKA 3THTA 1Y01A 2VU9A 2YXSA 1QF3A 2DU0A 2PFWA 5L4HA 4E2QA 1JZ8A 1GUIA 4B4PA 4GXLA 4LORA 5F1RA 5KBFA 1HV0A 1MACA 1RIRA 4BDVB 5JDQA 1EV11 3OEBA 2RMU2 2QQPA 3LCPA 3NWKA 4I0BA 4NIDA 1NG0A 2Q9QC 2W1QA 4DUYT 3D6EA 4Q27A 3SITA 5L7OC 4YGBA 5AQTB 1LB2A 1RUNA 1CAXA 2WZHA 2VG9A 3HT1A 4D3WA 5HPOA 1V6KA 2PBIA 3Q8FA 4GB31 5HI0A 5IVBA 2EALA 3S5AA 2XQYA 4CTEA 2VXJA 3LSDA 3R4DB 4NRMA 5FWJA 5FPBA 2YN6A 1VJ2A 3O1PA 2NW9A 3AM2A 3OKQA 5CFDC 5DAPA 3ZMTB 3NJYA 2ZX3A 3LJCA 1SBFA 2BVVA 1K3IA 1UXXX 4A56A 2G4IA 2JWPA 4DR7T 1FAYA 1Z0HA 3CJIB 4EB6E 2VOKA 3QB5A 4YTNA 1JOPA 3L8RA 4TSVA 5GM0A 1QXJA 1REEA 4AQSA 4DINB 2R30A 3V5SA 1O3XA 1ASJ1 2JDYA 2IVIB 5LWBA 5AQVB 3AVSA 1WR0A 4U74A 4COUA 3O0VA 1QOOA 4M00A 3VDAA 2LHNA 4JX0A 1W8FA 2E7AA 5JDNA 2VR4A 3WD5A 3WNOA 2QE3A 2JD9A 4PIXA 3ZMSB 5CFDA 3BQLA 1HRV1 1PX4A 5FK8A 3VBRB 3WQ0A 3ETUA 2EIBA 3OY8A 4IEOA 3EI0A 2MEV1 4ATFA 2YEVC 2WDQA 5J2UE 1A8MA 2XQRA 1UD1A 4D7YA 2ACXA 4AFAA 2VH9A 3FZKB 2X5IB 3JD72 3H8RA 3IWZA 4WVZA 3HQRA 4QKBA 1AR82 4QPGB 3BKZA 3A4UA 3OG2A 5FBJA 5K0UB 2WNVB 4UW3A 4ZS2A 3ZYFA 2VUCA 4B4QA 1BR4A 5LK5A 4WM7C 3LK2B 2WKKA 3KCYA 3C3VA 2A3YA 1LHNA 3M3IA 4NPMA 4MLKA 4BQ4A 1AR73 1VBB1 5FMDA 4XQWA 4YVSB 2QYWA 4AQFA 1OBNA 4MSVA 3V56A 2PMWB 4Y5SA 4BM8A 4Y26A 2CHHA 3G7DA 4AEMA 2LEHA 2LRPA 2PLV1 4HOOA 4AEJA 1VB2A 3ABVA 2BQPA 3K2OA 3LDBA 4Z82A 1JOJA 5FZFA 4PBPA 4AW7A 3TEWA 1SLTA 1RB8G 1XNAA 3WF2A 3WZ1A 5JR2A 5D21A 4C1XA 4JI4T 2D3SA 4CP2A 3UUMA 3Q5WA 2JECA 1UZVA 2DBIA 4OHWA 5A3OA 3S5QA 4AHYA 1OQEA 3I9YA 1WD3A 3E08A 2GSYA 4EXTA 2J62A 1RUC1 2ZGSA 3BTAA 3M4FA 2DCFA 3J7Yq 4AR2A 2A6VA 3LK3B 3E6CC 5FNVE 4CDQC 2KMFA 5FP7A 1UZZA 1RYYA 2NR4A 5TAOA 3A21A 4RQPC 1VBD2 1HJGA 1Z8UA 5AQGB 1MPXA 1FMD2 1V9DA 1W6OB 2ID4A 5EZYE 4U2ZA 2CL2A 5LMUT 2NPIA 1N1VA 5CA1E 3C7FA 4O4LE 3CQOA 3KCXA 4LMFA 4MXVA 3E22E 2XZEA 4IIJE 1ENXA 2HWD1 3EXUA 4OFGA 5LA2A 2XQ5A 2FJEA 3R84B 1IS6A 4JHZA 3U4SA 2DU1A 3NKTA 4D6SA 2LKHA 5EWSA 4BLJA 5AQPB 3RC3A 3NV2A 1JMUB 5JXJA 5FY7A 5LCYA 2W5FA 1ZBE1 3VBSA 4Q4V1 3ZFEA 1Y7BA 2O1QA 3ZMNA 4QD2A 4YW2A 2BDEA 2XQ9A 3PDQA 5HXVA 3KT4A 4BU2A 4CDQA 4RFT0 1JHNA 1VMFA 1XU1A 4DUWA 3R0RA 2VNGA 3O1OA 2J7MA 2PAKA 3L9JT 1XOYA 1SA0E 1HFAA 5EJ1B 1XSQA 2QDNA 1IPSA 1UKGA 1W0NA 4QX0A 4BH9A 1HF8A 5LGNB 2CXLA 2V5DA 1WZXA 2VPVA 3AP5A 4N7UA 4XETA 1DBNA 4FI9A 2FDIA 4Y33A 4AWDA 5CFCB 1CJDA 3T8OA 3OSDA 3FLRA 4WVVA 3CQCB 5HBAA 3T1MA 5EIYB 4IEYA 1R092 5FOBB 2YPDA 2RM23 3UTKA 3GHNA 3H3ZA 4EN7B 1RUI3 1RUI1 2VW1A 2Y0IA 4HONA 4QPIB 3T1LA 4IE7A 1PO11 4WM7A 1CX1A 2YU1A 3MUY1 2E2AA 1AR71 4I2OA 3J8F3 5FR3A 3AAEB 4LT5A 5BNNC 1CVNA 2HWF2 3S4UA 2BS4A 3HKDE 4LMJA 3MZKB 5FYIA 4CCMA 1UIKA 4A5XA 2ARBA 3GHMA 4IETA 4IEZA 4Q4X2 3AMHA 4FO9A 1S4CA 2IXIA 5I8SA 4Z91A 3TYJA 2HYKA 4L92A 1LEMA 2W1SA 4HMZA 3GN5A 3OYZA 2WZR3 2JB4A 4CPBA 3N2KE 3LIGA 1JYNA 5ETWA 5E1RA 2R7EB 2DVFA 4A7KA 1OPOA 3H7JA 4CZZB 3UKVA 5JMOA 4LNVA 3JC6C 3RYCE 3WV6A 1HNXT 4H63H 4IV3A 4DBQA 4DPNA 5JOYA 4ZONA 3VBFA 4AXOA 3BN6A 4B3NA 4B3MT 1KFUL 1QMJA 5FJHA 3C2UA 3VBOA 5KXJA 3WDYA 1LR5A 4ZZ5A 5JZGB 2BNMA 1RUG3 2X9XA 4R52A 4DZGA 4FBFA 1QSDA 1RVF1 4PCRA 2XOMA
chains in the Genus database with same CATH topology
5L3BB 5DABA 5FUPA 3RYFE 1BR2A 4DMVA 3CQGB 5FXZA 2IC9A 2KZ7B 5LXTE 4XDOA 4IDZA 2VB6A 5FYVA 4I4TE 4C91A 2CWOA 2V1DB 2Q9QB 2XTLA 2ZMAA 2ZM0A 4JUYA 2YBPA 3I9WA 4TN7B 3ZMVB 3ETVA 2XASB 5DJQC 2IC6A 3WI3A 1IZNB 1D0YA 2VKDA 5EK4A 1HG2A 4EYUA 5KMGP 5KDMC 3PUGA 2NTYA 3C51A 2RA1A 1BR1A 4FJOA 4MFRA 5FPLA 1MMGA 2LSGA 4LXLA 2VASA 3MXZA 5JR9C 5A7WB 4Y3OA 5LGUB 2KXPB 4U72A 5FP4A 1H7CA 2D0TA 3N9LA 4H9SE 3IEEA 3OBVE 5GONE 3CWZB 2K24A 4CI3B 2GP3A 2XHEB 3KV5A 3RH3A 5HXRA 4JLEA 1ZKEA 4HGAA 4GOUA 4HEAA 4CUGA 5LA6E 3IHRA 3CX6B 3J9X1 2X51A 3P8CD 4ZI7E 2WWJA 4TN7A 2CA5A 4OYKA 2KLQA 2MTQA 2QGSA 3KV4A 3ZN0B 4IE5A 1OWAA 3NBXX 2E9XD 3SOLA 4CCLA 1CUNA 4TX5A 4AKIA 4QX8B 1BR0A 5IVCA 2I59A 4IGPA 5LY2A 5FY0A 3EVYA 3AAIA 2Q8DA 5FZKA 4QXCB 3ZYMA 2D5UA 2XAQB 3BQKA 4PJMA 5EK2A 5ADXL 5FWEA 2LSIA 3N2GE 2WBLA 2CEAA 3O4XE 3C4ZA 4ZOLE 4UIGA 5FXWA 3LFMA 3MK7C 4UV8B 5J2TE 3OPWA 5DQVA 2LE8A 2N1GA 3A5XA 3PUQA 3VU7H 5FZBA 3AAAB 5F5IA 2L3LA 4C8DA 2PJQA 2W00A 4BJMA 5F39A 2H3RA 4DO0A 3D0TA 4XAXB 3LG7A 3OYXA 5A7QA 4GK0E 3RYIE 1HS7A 1X79A 2M67A 2KNDA 1HG5A 4X1KE 5JH7E 5FZMA 3KV9A 5FZ1A 1WYCA 2X9YA 3FBLA 4V2WA 3N9MA 5L3DB 4PJNA 5L3CB 5F3GA 4PFPA 3DXUA 4GD4A 2E9XC 5FYHA 5JDGA 1MMDA 5FYUA 3ZJ1A 2NWBA 3L09A 5LBQB 1LRZA 4GJZA 2SPCA 3V5UA 3IF8B 2OQ7A 2OT7A 3WAJA 2XXZA 1U5PA 3LD8A 5FZ9A 2LHRA 3KBTA 4X1IE 1HTJF 4CSWA 4IE4A 5FZIA 1AJ3A 4JEUB 5CA0E 4AKGA 2XAJB 2OS2A 4QHOA 4UVBB 2GP5A 3PDYA 3BK9A 4LITA 4EZHA 3ZC0A 3AA7B 4PNIA 4CXXA 4CQIA 5F3JA 2DNXA 3UFEA 5JDLA 4ZI2C 4WW0A 5JREA 2A3DA 3CX8B 2LOPA 2OA5A 3U78A 3PU3A 2VKHA 4AI9A 2XDVA 2ES0A 4UF0B 5A3PA 2Y6XA 4DBRA 4TV8E 5ISLA 3ESLA 1G8XA 4ISTA 1LVKA 1IJ5A 3HKCE 4GIWA 2OQ6A 2W0GA 2A72A 3HR0A 4PJJA 5FPVA 5FZ0A 2CE7A 3ZPOA 2EHOD 5DQWA 2HPJA 5IVYA 2LOSA 4QKNA 4AKLA 3OPTA 3HL6A 3CPZA 1KNZA 4QX7A 4N78D 2Z6EA 3AL5A 1OXZA 3VHLA 5F5CA 2JMHA 3C64A 4O4IE 4EIWA 5F3CA 2V7JA 5H6RB 5FYCA 3FB2A 4ISSA 4UF0A 2EHOA 2RP4A 2WMOA 4H63V 4AKRB 3O1HA 1VOMA 2J1DG 3DTOA 4NUBA 4GYSA 4GAZA 4EYYR 5JDMA 2CMRA 2X67A 2PFVA 4E7SA 2P5BA 2D0UA 5JRCB 4JEHB 4PAGA 2BZBA 4X20E 3OJAA 3RRWA 2Y8DA 3ZCIA 2NW8A 2CXFA 3PU8A 3KVAA 3RPUA 3PURA 4LIVA 2VKJA 5CB4E 1S94A 4ILUA 4TUYE 1VRBA 2EHOC 2V7IA 1Z0PA 3FXEB 4KUMB 4O8SA 4CXWA 2K48A 2KWIB 4BXFA 4AQGA 3EDUA 4NUVA 4M1PA 1D0XA 3DP7A 3Q9DA 5FY1A 1ZV4X 5LY1A 4O4HE 2E9XA 2ZM8A 2V7MA 3H3AA 2W63A 5LP6E 1UCUA 1FMWA 4C90A 4HKAA 4PW8A 3LBXA 2DHRA 5FYMA 3C4XA 2KINB 5IVVA 2Q8EA 2LM9A 3ZN1B 5HXEA 4GYRA 4QWNB 5FV3A 3ONXA 5LW9A 2C5JA 2GK9A 3FHNA 5LHHB 4MALA 5EK3A 1MIVA 3F31A 3ZCJA 4ZI2D 3RYHE 2E9XB 2UXXB 5JR9B 2IAKA 4QU1A 5FYTA 3N9QA 5FY4A 5LGTB 5HWYA 3ANWA 5HAXA 2YINA 4KMCA 5A3NA 5HWXA 3K3QC 3U3IA 3ZYKA 2P9BA 5IVEA 2W62A 5C8YE 2V7LA 1MNEA 1EZ3A 5IW0A 5JVDE 4ASKA 1YW0A 5IWFA 2W2IA 4QX7B 5A7PA 4HFVA 3JC6D 3GA8A 5L3FB 5M4YA 3FBZA 2LSKA 2NTXA 4O2AE 5AFUL 2CWYA 3O1IA 4NUUA 2L9QA 4H9QC 4O4JE 5FYBA 2DI4A 5FPUA 3HA4A 5F5AA 5FZLA 5FZHA 5FY5A 1KK7A 4F6RC 2Q8CA 5FZGA 5J1GA 1NAFA 1YKHB 3O1JA 4HTEA 3RX6A 3F57A 3KFWX 4CI2B 5JQGE 4G2AA 4DIQA 4TZ4C 1US7B 2Q9QD 5JDHA 4WBNE 5FZ7A 4YFSA 3ZLIA 4PK4A 4ADZA 4P0AA 5L3EB 3QUJA 5FZ6A 3RC8A 2CLYB 2H7VC 4GK5E 4P09A 4I43B 3B57A 5LNKA 5FZ8A 4P0BA 2L8KA 3AVRA 5HXCA 3DJBA 4DMWA 3PUSA 5A7NA 3GMIA 2PXJA 3M65A 1MMNA 5JRCA 3KBUA 5FZDA 3PUAA 4H9OC 1MIYA 2NOXA 3K8PC 5LG4A 4CXYA 5FUNA 3UYJA 4DVDA 3UULA 1YD8G 5LHGB 2Q9QA 1WLXA 3N9OA 4H9NC 2ZLYA 3EUHA 3TKLB 1D1AA 4TV9E 4Y4RA 4IE0A 5FXVA 5F3IA 2DWGA 2QA7A 4XBFB 3CX7B 1ZHCA 3NRYA 5FP9A 2DLRA 1YKEB 4YJ2E 5FP3A 2DWKA 3ZC1A 4DNDA 5HXHA 3ZMZB 2ODUA 4V1Av 2OX0A 1FMVA 4GJYA 5FZOA 5KR7A 2VKOA 3F2EA 3SS1A 4UXNB 2YBSA 3AA1B 1MNDA 3CMLA 5E0OA 3ZMUB 4QXHA 3MA9A 5FZAA 3WAKA 2IW5B 3K3NA 2MYSA 3KINB 5FJKA 2X68A 4UEMA 2C0SA 3QK6A 2X9HA 3AA0B 4ANJA 3HKEE 2JMKA 3R6NA 2BVMA 1LVFA 3MACA 5H6QB 2JPFA 4HE8A 4XDPA 4G63A 2VL8A 1D1CA 3N5LA 4QXBB 2VWAA 4UELA 3N9NA 5F8PA 3K3OA 4QX8A 4OK0A 4J2CA 1WRDA 3N9PA 2XMLA 2X0LB 4MBQA 5IYZE 5LBMA 5A3TA 3NRXA 2HPLA 4YJ3E 2HH7A 1HCIA 4CCKA 3I0QA 5L3GB 5A7SA 3UUNA 4QXCA 4OHFA 2WWUA 4BAYB 4E7ZA 5BMVE 4E4HA 4UVCB 5FY8A 5FP8A 3IBPA 5IHYA 2PG8A 4L9IA 2WSSV 4UVAB 2CXDA 4YHJA 4CI1B 5IVJA 5LYJE 5JDQA 2LJLA 3AB3B 3C50A 2B1EA 4BISA 1WYBA 2Q9QC 4AXPA 3VKGA 4IGQA 3VKHA 2NW7A 3MKDA 5A3WA 1U4QA 5IVBA 2PBIA 1G73A 3AA6B 4PK6A 5L2LA 4ZS3A 4K0UA 2XQYA 2MBGA 2H7OA 3RRCA 4FI5A 4PJLA 4AAPA 5FWJA 4B6XA 5FPBA 5F37A 4YLHA 3H37A 2NW9A 3LBXB 5IVFA 3OKQA 3ZMTB 1WR6A 2YK0A 3NJYA 3I0OA 3LJCA 4KBMB 5HXSA 4O2BE 3W15B 3EDVA 4A56A 2XAFB 4QWNA 4EOZB 4EB6E 4L5GA 2N9DA 2Y48B 4D6RA