3K3OA

Crystal structure of the catalytic core domain of human phf8 complexed with alpha-ketoglutarate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
355
structure length
350
Chain Sequence
LRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 8
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 96
structure length 350
sequence length 355
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3oA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3oA01
2YBKA 2WWJA 4URAA 5FWJA 3N9OA 3N9QA 5KR7A 2WWUA 4DIQA 3PURA 5F39A 3LDBA 5FV3A 5FZ8A 5A3NA 4XDPA 4QWNA 2OX0A 5FYVA 2GP3A 3KV4A 4V2VA 2YU2A 4TN7A 3OPWA 5FP8A 4QU1A 3PUSA 5FZAA 5LY2A 5IVEA 3KVBA 5A7WA 5FZGA 5FYSA 2OT7A 5FY8A 5FYIA 5F5AA 5F37A 3PUAA 5FBJA 5FZDA 5FZ3A 2YBPA 5FY9A 5E6HA 2PXJA 5FYHA 3ZLIA 2YU1A 5FYYA 5FJKA 4CCLA 5A7QA 3AL6A 4CCMA 4CCOA 3UYJA 5FZ7A 4Y33A 5FPLA 4QXHA 2YPDA 3DXTA 3NJYA 2YBSA 5FXZA 2Q8EA 4EYUA 5F3IA 5IW0A 3U4SA 4QXCA 5FUNA 4DO0A 5IVYA 5FY7A 5ANQA 4CUGA 3K3OA 2VD7A 5F3GA 4QX8A 5F32A 5A1LA 2P5BA 5LY1A 3PUQA 4CCNA 5IVJA 4IGPA 5FZCA 4UF0A 5FP3A 3KVAA 4AAPA 3AVRA 5FZKA 5A7WB 5FPBA 3ZPOA 5FWEA 2OQ6A 2Q8DA 2XMLA 3PTRB 4D6RA 4C8DA 4GJZA 5FYTA 5F2SA 5FPUA 3DXUA 4QX7A 5F5IA 5FZIA 5A3WA 5A7PA 5FZBA 5FYCA 2XUEA 5A80A 5FPAA 3PU3A 4GD4A 4ASKA 2W2IA 5FXXA 4D6QA 4BU2A 4NUBA 5A3TA 5A7OA 5CEHA 2XXZA 4HONA 3N9MA 3K3NA 5A3PA 5F3EA 5FZ0A 5FY1A 5F2WA 2OS2A 4GJYA 4E4HA 3AVSA 5FYBA 5FZHA 5ISLA 5FPVA 5FXWA 5FZOA 3N9LA 4LIVA 5K4LA 4HOOA 5FY4A 5A1FA 4V2WA 5FZ4A 4UF0B 4CCKA 3KV6A 2XDVA 4AI9A 1VRBA 4CCJA 4LIUA 4D6SA 4BISA 5FZOB 4IGOA 3PU8A 5FZFA 5IVFA 3N9NA 5LW9A 4EZ4A 3K2OA 5FZEA 4XDOA 5FP7A 2Q8CA 3RVHA 5IWFA 5LWBA 4QXBA 5FP9A 4Y3OA 3LD8A 5FYMA 5FZLA 5F3CA 4LXLA 3PDQA 5F5CA 5FZ1A 5FY0A 5FUPA 2GP5A 4IGQA 5FZMA 4GAZA 5IVBA 3AL5A 4CSWA 4BXFA 5A7NA 3KV5A 4Y4RA 3KV9A 5FJHA 2OQ7A 5IVCA 3OPTA 5FZ6A 5FP4A 5FZ9A 5FY5A 5FYUA 3N9PA 5IVVA 4EZHA 3U78A 5FYZA 5A7SA 4LITA 5FXVA
chains in the Genus database with same CATH superfamily
4GH4A 4LA3A 4DR1T 2WDQA 2OYZA 1ZRRA 3SFDA 1XDOA 1QNYA 2BKNA 1U12A 4YFWA 2WMNA 4LF4T 4HTEA 4AVVA 3ZFFA 1ND3A 4YLHA 5A3OA 1AR62 3DYOA 5H9PA 1ZRDA 3LEIA 5FJKA 3T8OA 2WNVA 3AL6A 4YVSB 2IXIA 4PJJA 4Q1PA 2IXCA 4OQ8A 4OUMA 3SEPA 3WP4A 4KWJA 5ANQA 1BKZA 1PVXA 1G9CA 4QH1A 1J3QA 2W3JA 1W8OA 3ON7A 3CKDA 3AXJB 2Q1FA 1Y64B 5C4WB 3T1YT 2BV4A 1HN1A 2XL7A 1K5JA 1IBMT 1LHNA 2ZZQA 4CP9A 1D4M1 1KXGA 2VTXJ 4AXOA 1LEMA 2R16A 5ABJB 1CONA 1YC61 1QH7A 4JHZA 4AVSA 4N8MA 5AQGB 3TLSA 3MIFA 1NYWA 4XXPA 1XPWA 2VQUA 5FZ6A 3WDTA 2GNDA 4AI2A 4P1NA 4E4DX 2ZEYA 3O1RA 1X36A 1V70A 5FZ8A 2GP3A 2RJ2A 1VRH3 5C9AC 4YW4A 3ZFGB 1JN2P 2AYHA 1URXA 3MXZA 1GZCA 3ZXLA 1U5XA 4QX3A 5F5WA 3J7NA 2NW9A 5IWAT 1SPPB 1HDKA 2WKKA 4FPCA 2NQYA 1D1CA 4Y1VA 3NVCA 4LKSA 3V5SA 5HEUA 4H9OC 4YSZA 1L7QA 4LMKA 3H3AA 3QC9A 1V6IA 1NAFA 2MEV2 2X9XA 4XEZA 1H6YA 1H2KA 4XUPA 2VVNA 1IZNB 1G9AA 3T2PA 5T50A 3JBG3 5HXVA 4NVPA 3WDUA 2W1WA 4QAWA 1H8TB 1X9TA 4WBNE 2W1SA 3TN93 2UYAA 4PQ9A 2WM9A 4PBPA 1GZTA 1AR92 5A70A 5IYZE 1XMQT 1SFNA 2V5YA 4AI9A 1FMD3 2JPFA 3VBHC 5LJMA 4CA9A 4EZ4A 4XPVA 2YROA 4HBNA 3RDIA 4QPGB 3BUCA 5FMNA 2P9BA 1GMMA 3K8PC 3PHMA 1WMEA 5CISA 2ZX3A 3I8TA 3QBQA 1TNRA 4PLOA 4HWFA 1VRH1 4AQ6A 2CHOA 5FWJA 2V6YA 3LPFA 4GXLA 1MMAA 4GH4B 5CFDA 1BVP1 4BWOA 5CKQA 4CDUC 5JIUA 1LULA 2HPJA 2PA7A 5E6HA 1ND3B 3RSJA 4DY3A 4AISA 1O3RA 5BMVE 3WUCA 2GNTA 2RS53 4Q25A 3U1XA 4ARXA 1MVQA 2X10A 3BPSA 3ZN4A 1E5HA 2AH2A 4OYJA 4JUYA 3FZKB 4HZFA 3JBG1 2DI4A 2UY9A 2AR6A 4IEWA 1J59A 1GNZA 4X65T 1ZZCA 2GC1A 4FSJA 3TN91 2PHWA 4RYDA 4XFCA 3AECA 3LA3A 4NUUA 4QXHB 1EUUA 2WS93 1FMD1 4PK5A 1N36T 3Q8FA 4CP9B 1FT9A 2ZGNA 2XAQB 4E4HA 4AKIA 5B2GB 2WBLA 5E1RA 3JQWA 3OBRA 4XFIA 1GANA 4XZPA 4D94A 3PU8A 2X8KA 2PHFA 2WO3A 4Z07A 4DPNA 3MF9A 1TME2 4CDXA 3T1HT 2GH8A 1G6NA 1K5MA 4E4SA 1W9TA 2BUKA 3I54A 3MGUA 4Y1XA 2GSYA 2PAEA 4UFLA 2R6GF 5JUVA 5LBEA 3BK9A 4UT5A 3LWCA 3ONXA 1ENXA 3I0OA 3CO2A 1IG0A 3VBUC 4QX2A 1D1AA 1KNZA 2RS51 4AG4A 4CXWA 3B01A 4DZGA 2CLYC 2JDNA 2R0FA 1BZWA 3AFGA 2K2SA 2YEVC 1NZIA 4RGGA 1PVC2 3RQ0A 3KDSE 4JI1T 4LHSA 3CZJA 4DY5A 4W65A 4KHPT 2XPJA 3EJKA 4BLJA 2JIWA 4UW5A 5LBQB 4AQ2A 4OK0A 4IIJE 2Y6KA 2D3RA 2ZPXA 1AYM2 2XTLA 4AVAA 3TEYA 3E5UA 3VBRC 1WZXA 2WS91 1JH5A 3KZ4C 1WD4A 1C4RA 4XMIA 2FJEA 2BVLA 3VD3A 5LK7B 5JDMA 5E89A 4DR5T 1UGOA 1AXYA 1WA4A 5DQ0A 5BR8T 2EIBA 5T55A 2P34A 3CF6E 2XSAA 3OSDA 4O4HE 5DZGA 4M3CA 5JR9C 5L19A 1W06A 3NWKA 5EK4A 4JKKA 1UYYA 1PGSA 2HYXA 1BK0A 5L47A 1UIJA 3VZJA 3AEFA 2Y6FA 1WKYA 3IDEA 2L9LA 3H3MA 3C8XA 3ZKRA 1STMA 4D69A 4M1PA 3MPBA 3WDYA 2Z2SB 3A7MA 3WDXA 4JEHB 3N7LA 2ORZA 2VB6A 3UU6A 4ZPIA 4JEUB 4RGKA 2PYTA 4AWDA 5EP9A 2EF6A 2L9QA 4FTSA 2ZGQA 5LB7B 5CG8A 1QJY3 4YNIA 1EPWA 1DGWA 3BIWE 3J8F3 3OJBA 3NV2A 1UKRA 1BBT2 4R9DA 1XNCA 1DDLA 4AEKA 2XVLA 2BWAA 2J1SA 3SMHA 1LB2A 4AGVA 2Y0OA 1ZVFA 3FFQA 2IIUA 2ZMAA 1OF3A 4J1XA 3N9LA 3CQOA 1BR2A 4CTEA 2I74A 2BG9C 4H63H 4XURA 4OFZA 1ZKEA 5FUPA 4CDXB 4Z92B 1WW4A 2XKOA 5A7NA 3B5MA 2C5KT 3AK0A 2B1EA 4QDQA 4XMAA 2A72A 4YGDA 3ENRA 1US3A 5I0RA 1PHMA 4OQ9A 1RUJ3 3FBLA 3PVOA 4UEMA 2Q8OA 2BDEA 3P5BA 1UYPA 1QJY1 4LOSA 1LHUA 1NENA 1PGL2 1UURA 3DXTA 1NY72 3WNXA 4FAHA 1CX1A 1UY3A 4HWCA 3J8F1 2LSKA 1CJDA 3K4ZA 3ME2A 5ADXL 4Q4W1 3RIUA 4O9GA 4EEBA 4CUCA 3H3LA 5E16A 1AYN3 4LF6T 4Q0UA 3O0XA 3WXPA 3AA7B 2BEOA 4AQFA 4PK4A 4PF5A 2NZ9A 1VMJA 3HWJA 5K0UB 5CG9A 3IT8A 2WNUA 3WAJA 2A3XA 3AP9A 1OA3A 5FK8A 3UNPA 2RDNA 3FXDB 1AL22 1RUJ1 3PVNA 2Y26A 4RS5B 5F8PA 3HKEE 3D5OA 3WDWA 5A3NA 1OKQA 1N1TA 4QHOA 2CWMA 2P2KA 4DV3T 1GWLA 4NPMA 4IE7A 1COV2 2YDSA 2HBUA 4CVUA 5FL1A 4CUAA 2LUWA 3RQWA 2FCVA 2ID4A 1LECA 4YW7A 3T1MA 2PFWA 4C0BA 3PLQA 3EDVA 3CJIC 2QQVA 3VZMA 2LOSA 5JR2A 5A1LA 2ZBJA 4YGBA 2V26A 1AR82 3VKMA 3ALQA 1FI2A 2A3WA 3WOGA 5HAXA 2DU1A 3N36A 1NA1A 1CX4A 4ASLA 2KWHA 4CU7A 3RJRA 2A1XA 1Z7S3 1LGBA 2JKXA 1A3KA 2XPKA 2EXKA 1VCSA 2CA5A 1LU1A 3SXWA 5EV7A 3NJVA 2JG8C 2CHNA 2W52A 4EAHA 5FBZA 3SFEA 5IVBA 1TVGA 1CHUA 4MUVA 5GLVA 2NMNA 2FJBA 2VZ1A 3GJBA 2H6BA 1Z0PA 2VZVA 4AVBA 1JOJA 4JDOA 5FZDA 2MTQA 2ETEA 4XAXB 1QUUA 4CDQB 5JDLA 2G1MA 2W08A 1CVNA 5J36A 3WP6A 4CU9A 2B7YA 2ZGRA 4TWDA 2A6VA 2ERFA 1KEXA 1SCSA 2JG9B 1MEC3 4JKMA 3PUQA 2I6HA 5LYJE 2E9XC 3WLUA 4AEDA 1GNYA 4Q4Y2 5LRRA 5C2TA 3IAQA 1QSDA 1R8IA 2UXXB 1Z7S1 2ZHMA 5A3WA 2ZMKA 5JSPA 1GSLA 5JRCA 1G7YA 5A7OA 3VHNA 1MR5A 5JDBA 1KJRA 2ZTNA 2WA4A 1ULPA 1S0GA 4FPOB 3HR9A 4WNKA 2ZZJA 3FHQA 5K9YA 3ZSMA 4IGOA 1OFNA 1IPSA 3QNUA 4HFCA 1RUI3 2RM22 2PHTA 5KC5A 2LS6A 4H9SE 5F3JA 4N43C 4IV3A 5FZ9A 2DTWA 2MPFA 3CX6B 3N7JA 4E8CA 4WYVA 2JB4A 3MV01 2RE9A 2JQQA 2XZEA 5IK8A 1QHDA 2D5UA 1HNXT 3KV4A 1TEIA 5JZGC 3IB3A 4IEOA 4IE5A 4KI0F 4CDWC 4KBBA 4LJHA 2VW2A 1MEC1 4I0BA 3MKDA 2QQWA 4DO0A 4L9IA 1CD3G 3OTFA 2WZ8A 3K3OA 4I0WB 3THCA 1JZ3A 2X53S 5CB4E 2VMEA 2DCFA 2X29A 4H7MA 4NWWA 2VQAA 3JB8A 3AC0A 1HFAA 3IA3A 2QA7A 3E08A 4BM8A 1X8MA 1RUI1 4QH4A 4FP3A 1HN0A 4F83A 4NRQA 1X9BA 4PDWC 3KS7A 2JRKA 3JCFA 4NHLA 2OQ7A 4UR9A 1DZQA 2XOMA 5FP4A 5C5UA 3I2HA 1Y43B 3LJCA 2J1UA 1VB2A 2Y38A 4DXZA 2OXBA 4CCEA 5FY8A 4D8MA 3KCXA 1J5ET 5LXTE 1BHGA 2JMKA 2R063 1V6NA 5LEKA 1Z0HA 2YV8A 3SEEA 3UUBA 4AQGA 3FE5A 3JB4C 3A0KA 3BIEA 1V6LA 4QB6A 2ODUA 5F3GA 1DYOA 1O8PA 3PV0F 4IGPA 5FVKA 4UFHA 3WD5A 4YHJA 4AEDB 3H3ZA 3MO4A 4F7ZA 4CEWC 2HWF2 1IPKA 3VR9A 4IV1A 5HCMA 5CA6A 4B4QA 1CZSA 1NG0A 4H2AA 1S2KA 3I3DA 1DIWA 3SRZA 1YYNA 3CIRA 2QQUA 1VRBA 4AKRB 4JGZC 3IIIA 1YQCA 2EHOC 5I0TA 3CNAA 3JAFA 5IJRA 3HT1A 4M3CF 4MSVA 1OQEA 2XJQA 1MZEA 3AKPA 4PBOA 5IVVA 2X0LB 1LENA 5JWPA 4DFSA 5G04L 3E0ZA 1SLTA 2VMGA 2V09A 4XDPA 1Q56A 4FFHA 2R061 1KQRA 1PO23 3IBMA 4YARA 3VBOA 1S0FA 1C28A 2ZHLA 3KCCA 2VTXA 3ZXFA 4L2NA 2VZ3A 4ILAA 2KZ7B 5LBBA 1LOEA 3QK6A 3H9AA 3HL6A 4EN8B 4JI6T 2XAHB 5KBFA 2BVBA 5HV0A 2MNGA 2QNKA 3ZXAC 1IKPA 1OMIA 5GM0A 3ZSEA 2FUPA 5LEJA 1HRI3 3THDA 2TBVA 4QXCB 3CIHA 5HV4A 4GB32 4GA9A 5APAA 1OLRA 1NOVA 4H7LA 3C7EA 2Y6JA 5FP9A 3EYPA 2FDJA 1LVFA 5AQUB 2A6YA 5C8YE 1PO21 2VUJA 2YB7A 2DVBA 5A7SA 4UI9L 3AAEB 3CX8B 1H6XA 1JNRA 4BB3A 1OQ1A 4P5HA 1PX3A 4JZRA 4U2YA 1GZWA 4C91A 3N7MA 3WW4A 4DNYA 1WFDA 3SKVA 4D7TA 1ND2C 2X5IB 1BCXA 1UPSA 2J1DG 1CPMA 2BVVA 2JIJA 4FPFA 4XFFA 5LA1A 2A7AA 2XJRA 5DXDA 2WO1A 5FTTC 2G0UA 1O6UA 1LGCA 3ZN1B 4WM7A 1RHI3 1ZZ9A 1W3XA 2QFEA 4B4PA 4FPGA 4ZI2D 3F57A 3AE5A 5AQFB 3SWHA 5FY4A 1EAH3 1SZBA 1EV13 4FI5A 4KNCA 4JQRA 4U33A 2VVDA 1QLBA 2C24A 3K3QC 5ERLA 2W4XA 3A4UA 5KHIA 2VVSA 1X82A 1DGRA 4YG3A 3U75A 4GIQA 4BZ4A 1JHJA 2KMFA 3T4VA 3LK2B 1E5IA 1PZ7A 1PGW1 3TYJA 1JXNA 2V6XA 3RC3A 2OT7A 5LASA 1VCTA 1PK6A 1CIYA 4YVWC 5GZDA 3EBRA 5DDJ2 2XQYA 3VRAA 4XIKA 4DUXA 1US7B 4KMCA 3ZMTB 1UNBA 1FPN2 3MEPA 1M62A 4FPKA 4JDNA 4P9WA 1Y9QA 2Q8DA 5C4WC 5LGTB 2WUHA 3U11A 2WQ4A 1J5WA 4RFRB 1J83A 5C8WA 1EAH1 4EQVA 3X29B 1R1A3 1EV11 1RUF2 5HXCA 5ABJC 3T0DA 3H8RA 4FFIA 4BISA 4DUZT 3ZMVB 4OHZA 5LCYA 1QXJA 4DUVA 3MI8A 4RQPC 3KF3A 4Y24A 3DEMA 1OLMA 1V0AA 5J2TE 2OPWA 3DUIA 1XNAA 4AI1A 3X1DA 5M0TA 2V7JA 3ASIA 3RFRA 2ZAHA 1KEYA 1S0JA 2W9XA 4Z82A 3EVYA 3PURA 2YPJA 3HNMA 3O1HA 3ZMNA 4AYUA 4MXWB 5C3PA 1UKGA 2ENRA 3H8OA 1AR63 2E5LT 2J42A 4MBQA 3PUAA 3QB5K 1O8SA 1S0EA 4LBQB 2HJIA 3D3AA 2E53A 3ZYJB 1GZWB 3UQ7A 3FZHB 2XJ7A 5FPLA 2QTWB 4XACA 1Z78A 2D6KA 3OPCA 4L11A 2AXDS 3V0AA 4AEMA 1UY0A 1RUC2 5T5LA 1JOBA 3OCPA 4XILA 4YRDA 4DOUA 3RH3A 3TLTA 3EI0A 1R1A1 1V9DA 2IAKA 4W50A 2Z4FA 3AMHA 3WDVA 4IDQA 3ZXJA 3PE0A 5BNNC 1YWKA 4LE4A 4JDMA 5BY5A 1PM7A 2HWD3 4E8DA 1H0BA 3AE6A 3RYIE 4I3PA 4TWTA 3KHCA 1Y9MA 3AKQA 2WL1A 4KQ7A 4QXBA 4CCDA 3ETQA 1NCRB 1KDMA 3S6PA 3SC7X 3PDYA 3VDDC 5B4XA 1AR61 2HWC2 4CP1A 4DV2T 4HKAA 3PTYA 2P3JA 3ETUA 3N9OA 2PAKA 4CI2B 2BGOA 4QWNA 2A73B 4N53B 2CDPA 3VZKA 4E9KA 4IW3A 3RI5A 4RFT0 1QU0A 3T1LA 4BJ0A 4IE4A 3MLKA 2QQMA 2V4AA 4GMP0 1GBGA 4P02B 3RF1A 2VZSA 4IERA 2WNOA 4YW3A 3A22A 4YT0A 1PK6B 4EWEA 4DS0A 3NJXA 1MIYA 4BIFA 5CGMA 4I3GA 3RHWA 4YYOA 2JECA 2ES0A 2NTYA 3IAPA 1F4AA 3WHTA 1JYNA 2MEV3 2DF7A 3VBHA 4ZY9A 4FBFA 4JI7T 1ZREA 4TXWA 3ETVA 4JTOA 3HQRA 3AE1A 3KFWX 3WF2A 1QNWA 4A98A 1TE1B 2W1UA 2WAAA 1AR93 3OD0A 1LTEA 3H0OA 1R082 4EN0A 2X66A 1ZA7A 4LF7T 1UX6A 3GA8A 3DPRA 4GWMA 4JX0A 4CDUA 5LWBA 4QQ2A 3WT3A 4JI0T 1MS0A 3OF1A 2CGOA 3VBFA 2FZ2A 3TAYA 1OQDA 2RS12 3ZSLA 1VAMA 1D7PM 2E33A 2W66A 3LPGA 1OH4A 2CBJA 5FPXA 1DQ0A 3AKSA 2K48A 2JWPA 2E6VA 4YJ2E 1SFPA 4IDNA 1NLRA 1OF4A 5JSRA 4BQ1A 5H6QB 4WM8A 4UWDA 3ESLA 4AXPA 4AVCA 3LK42 2SPCA 3PUGA 2GNMA 2PFVA 1XNKA 4CXYA 4WZFA 1XQNA 1H7CA 4HFSA 4QDSA 1GWKA 2OIIA 2MEV1 4X1YE 2O8OA 2M6BA 2LSIA 2XQ5A 2WP9A 4PQQA 1AR91 2BDRA 1AX2A 3OEBA 2ZGSA 4CEYC 1G73A 2QGSA 3PIJA 5FQ0B 3NQHA 3OBAA 1O3XA 3MK7C 3MHZA 1CAWB 5FYBA 2B8MA 4E7SA 4CU8A 2K9AA 2D6PA 5CZKA 3VV1A 2HPLA 1TME3 3FMGA 5J96B 3KGZA 3AMMA 1XE7A 2VZQA 3EB7A 2VASA 3MIGA 5C9AB 3S7IA 3RYKA 1MNEA 3S7EA 3IDBB 5DAXA 1REFA 4EIWA 1YJKA 4QXKA 4BIOA 3QH6A 3IDAA 4LBKA 3WR0A 5HI0A 2O14A 4YY3T 4KX6A 1RINA 2LE8A 4NPPA 2YFUA 1N34T 3ONJA 3AYAA 1CAXA 3RZMA 2RV9A 4HWIB 4JAAA 4L8QA 3G7DA 3QOPA 3M3OA 3A7QA 4YG6A 2AEYA 5L3BB 2Q4SA 1AYM3 1JZ2A 5JR9A 3QH7A 4P9GA 3ACFA 5FOJB 1ZRFA 2VVFA 3AB3B 5L3DB 1G8WA 4QPIA 3AP6A 3V64A 5AVAA 4K9SA 1TME1 3IBPA 3HKDE 5JDFA 3RZHA 5KWRA 3EABA 3CX7B 5FPVA 4HKWA 2OA5A 3U37A 1IGOA 1XU1A 1RJ7A 4Z1VA 4BQ5A 5D8AB 1QXRA 1S1AA 1SG3A 4CDUB 1OUSA 3AE7A 3VUOA 4PAGA 3KV5A 4MGIE 5IHYA 3MACA 4NIDA 3PJAJ 3ZMZB 3N9PA 2YG0A 4PJNA 3VD5A 5JOZA 5GZFA 1VBD2 1O4ZA 1PVC1 5F6KA 3O1SA 2EHOD 3ITQA 2HEYF 1NEKA 2F4VT 2FJAA 1I5PA 2VW1A 3ZDSA 1AYM1 2GN3A 4CPBD 3TLWA 4NAMA 4HSLA 3S5AA 2BS2A 2D3PA 2ZJCA 1OI6A 2E7TA 1J84A 5LCWL 3THPA 2W67A 1BBT3 1YFYA 2ZM6T 2Q9QC 4ILBA 4HFEA 4OHYA 5ABHA 2UU9T 2O1QA 4Y22B 2WWVA 1AJKA 4UF0B 5L2LA 3J9SA 1JU4A 3OG2A 4TYSA 2WWSA 2NP0A 1K3IA 4DNDA 3VBUB 5KXEA 1OC1A 1JODA 3FLPA 5JCTA 3ST7A 2XQ8A 4FOYA 1WW6A 4B8EA 4RS5C 3OY8A 3A21A 3PUYF 1IG3A 1LVKA 1LJ7A 4JI4T 1AR72 2IUWA 4H14A 4OHWA 1OH3A 2BNMA 2WLQA 5CKNA 2GC0A 4AGRA 3ZM8A 5AQPB 1W8HA 1I1EA 3P4QA 2PTMA 3VBRB 4CCMA 5EQUA 4HG6B 3RRCA 4ADZA 4RHV2 3LDKA 1YRZA 1JZ4A 1VB4A 5HBAA 3L3PA 1BBT1 2RHPA 3HNYM 3P4WA 3HJRA 2WU2A 3LG7A 1KFXL 2P17A 3GM8A 5ABFA 2OZJA 1OOPA 3SCHA 3BPZA 5JR9B 1S2BA 5FPUA 4O4IE 2UYBA 5I8YA 5A7PA 1ZZ8A 4X1IE 1RUD2 4Q4V2 3OUJA 1IS5A 1UL9A 1H2LA 3POYA 3MFAA 2DCZA 3C50A 2VBDA 4B7EA 5FMOS 3H7YA 1IS3A 2ES3A 2CGNA 4AAXA 4AE2A 1YW0A 4AR2A 4OUSA 4DEQA 3BVCA 1LOBA 4XBQA 3ZIWA 3BOPA 4AQSA 1ZEEA 3VBSC 3W5MA 2W46A 3P4RA 4LHKA 2GDFA 4MV2A 1COV3 1PGL1 1YHFA 3AZVA 1NY71 3GZUC 5FZGA 3HI2A 2CNAA 3CLPA 5FBJA 3NVOA 1BXHA 3KHBA 4AHZA 1AXZA 4CDQC 1AYN2 4LTAA 2ZM2A 2B39A 4BXSV 2JG9C 1AR83 3MIEA 1B35C 2VOXA 3MICA 3TNQA 4ARYA 1CAVB 4Y5TA 3P4PA 2JG8A 3LGRA 2BG9B 3CPZA 1W6NB 4XQWA 4P08A 4S2FA 3JXSA 3Q2MA 1HX6A 4QH5A 2J7MA 4O65A 4LIUA 1F35A 1NAEA 3POWA 4XDOA 1AL21 3J7Yq 5FO7B 5FY0A 4AQTA 3OYZA 2VCCA 1ULFA 4Z2AA 1COV1 1IS6A 5IATA 2C5DA 1D2QA 5FYZA 3OD4A 5IUQA 2KR2A 1KF6A 1M4WA 1WLXA 4QU1A 2E9XA 5KC6A 4YZ1A 4M4RA 1L0VA 5FMOL 4CN4A 3W21A 1MQTA 5FYHA 2JMHA 1BMV2 2BKOA 2DFBA 1AR81 2YXSA 4CXXA 3OGJA 3GHNA 2GU9A 4AI8A 1DU2A 2FDGA 1MS8A 4FO9A 4ZOLE 4Q4Y3 2FDIA 5LGNB 1N3PA 3IPVB 5EWSA 2OUJA 1SLCA 1LHOA 4RN5A 2AC1A 2NOXA 5LB6A 3ELNA 4JBWF 3VKNA 2YUEA 1PNGA 4OUEA 4N43A 2BS4A 3AEDA 4QT6A 4TV8E 5FY1A 4GJYA 3VDCA 3URFA 3VHOA 3IHRA 3OVUA 1V6JA 2KXPB 5JZGA 2Y6GA 4K20A 2VUDA 4GKYA 4CDWA 1AJOA 1ZBA2 3WP3A 4EE2A 3FWEA 1DQ6A 2LTNA 4DEVA 3UFGA 2XJTA 3CJIB 5LY2A 3U10A 2VOKA 2EIGA 5DG2A 4R8HA 2FDFA 2BRTA 4NHYA 2CXLA 3RZGA 1CAUB 3RMXA 3CDZB 3WAKA 4Q4Y1 4LBMA 3I49A 4XBFB 4LHLA 2WQZC 3HVDA 4XCAA 5HCHA 4UBHA 2DBNA 2QQIA 3SKJE 3I2KA 5FREA 2C5JA 4XTMA 2YN6A 3MLLA 2E63A 2BBVA 2VNRA 2BYVE 2FHRA 2Y33A 2JG8B 4PDWA 5L4HA 2HEVF 4N7IA 5L7OA 1OBNA 2WYSA 4BU2A 2NN8A 4BH9A 2X68A 2D97A 2XQ6A 3CJXA 1LU2A 5HWYA 4BMEA 2RM21 3LEKA 1US2A 4AI0A 5IK5A 1FATA 2W2UA 4QM9A 4HN1A 1FV3A 1CR7A 1UO9A 2R1BA 3Q5WA 4Y3OA 3MV11 1OPMA 3DGTA 3P4SA 3GZTB 1DLCA 2ZLYA 3LOBA 2QQOA 2YDRA 3E5QA 4UYBA 1TG7A 3JADA 4NJ4A 4JI3T 4EN7B 2BNOA 2PHLA 3HEIA 4COUA 3LDRA 3BOWA 1POV0 3WHUA 3ZXGA 1O3QA 4ZU4A 2IXLA 3NMBA 1G9BA 1PX4A 3D6EA 4ZONA 2HH9A 2EXJA 4R9AA 4DR3T 2VNVA 5FK7A 4ET7A 5EJZB 3KBUA 2GMEA 4BPZA 2NP9A 2HWF3 4KWLA 3S0MA 3ACHA 5D21A 4JGZA 1SHZC 4V1PA 4OULA 2EHOA 4A3XA 2H0VA 5AQMB 2VUAA 3I1AA 2YC0A 1IPJA 2CCQA 1WBLA 5EYXA 1KNPA 1Q43A 3ZSSA 3MIDA 1GP4A 4N43B 2J1EA 4V2WA 5KMGP 2ZXQA 2A6WA 1XSRA 1MNDA 3IN9A 5J48A 1E5RA 2W47A 2IHR1 1Y4WA 3AZYA 3ZMSB 3UESA 3RWNA 5C3JA 2AUYA 4CDWB 3GNEA 3ZT5A 4JGYC 3KT7A 1NQJA 2X05A 4HFDA 1BK1A 4AKGA 3J26N 4DIDB 1DP0A 3I9YA 2OA2A 5FZ3A 3JCIA 4NHKA 1UU5A 1WCKA 3N2KE 2VULA 1T98A 2XAJB 1S94A 3UQ4A 3WNMA 2HWF1 3SH3A 3K4AA 5C8CA 1W05A 2XM2A 3D4KA 5A7WB 4MFRA 5CKMA 1Z8UA 2WSVA 2VUCA 1Q8QA 3ONLC 1WGPA 4FPEA 2VQTA 3SNMA 2C0SA 4LFCT 2Y48B 2XQAA 1HQNA 4CN1A 5DZEA 2RVAA 2BBAA 4GB33 4B29A 4RD7A 4BJNA 3GYDA 1NT0A 3AEGA 2JDZA 3ZVXA 2A2FX 4WV8A 3TEWA 3O9XA 4MH0E 3SCGA 5AQOB 5L3FB 2HBTA 5BNOC 3ABZA 4K1YA 2RPAA 4I2OA 2Y34A 1RIRA 2DCKA 4XBLA 3ECQA 3VKOA 2Y6XA 1CGPA 2XY8B 4URAA 2ODVA 1ND2A 1VR3A 5LHHB 5DMYA 3FBMA 4ZZBA 3ACIA 1W6QA 3JZVA 4K6BA 1WR0A 3TLUA 3OJAA 2QQNA 2D6OX 5LBMA 3IEEA 1UPIA 4U7YA 4AFAA 5JOXA 3AJZA 4ATEA 4W4ZA 3ZFEC 1W6PB 4CEWB 2OW4A 1E5SA 1HRI2 4AIUA 2Z79A 3UL2A 2P6HA 1QJX2 1NUKA 2BBJA 4P9XA 4C8DA 3SS1A 4XJUA 4GB31 3SLIA 3OGRA 2W0XA 3B5LB 5A3TA 3MUY1 2W0GA 3WF4A 5JDQA 3WCRA 3AEEA 2Q9QD 4O7XA 4LT5A 5IWFA 4YSFA 4HFIA 3NRUA 2B9UA 5FZMA 3T4HB 3RYHE 5H9SA 2I2SA 4H9QC 3KCYA 4YVWA 4PHZA 5FYUA 2PJQA 2YYOA 1HV0A 4HLTA 4QMAA 1KJLA 4C1XA 1JZ6A 2XL9A 2D7FA 3NV3A 5FPZA 1PZ9A 2H6CA 1XNBA 3AXJA 2RJLA 5DUWA 5C4WA 1RYYA 5DDJ3 5CFCB 4ES9A 1APNA 1JYWA 3RKOA 3LEMA 3HAGA 1FPN3 3OKQA 2XWJB 4AKHA 3MBWA 3O1UA 3NAPB 2DCJA 2MHFA 3C2UA 5LY1A 4XJ9A 1RHI2 5ABJA 3O7OA 3K77A 4NROA 3ZN5A 4KP3C 3GWHA 2NW8A 2CBIA 3VKLA 1MIWA 4YLZA 4JV5T 2PQQA 2VO5A 1EV12 4HL0A 1JUHA 2DU0A 1RUF3 4NWVA 2CSGA 2UXBT 5A3PA 2ACXA 2I59A 1QXPA 4L99A 4A7ZA 3KWVA 1J3RA 1MS4A 1Q8SA 2JKBA 4XFBA 1MS9A 4K40A 1ENQA 2ARBA 4Q0SA 3ZFGA 1JZ7A 5FCCA 5BV6A 4XJ8A 1FIOA 3MZKB 3S5QA 5JXHA 2ZGOA 4BA9A 4LBLA 4QPWA 4DRRA 5AQRB 1YLLA 1EZ3A 3AAIA 4GKJT 5DDJ1 4B3RT 4YWAA 3Q8CA 4XFGA 5K7PA 1FPN1 4BCUA 4RA0A 4YPJA 3CEWA 2VC9A 2LJLA 5LBFA 1QQP2 3I59B 3AYDA 2C6SA 3RGBA 2YINA 3D0TA 4I4TE 4TWHA 4YW1A 2Q8EA 1H8TA 4XQDA 5BUVA 1HB4A 4FPJA 4QHBA 4OHFA 4HXCA 3VD4A 1RUC3 4GIWA 4N78D 3PJAA 3RZLA 1O3TA 5IFPA 5FZKA 3HNBM 5I0DA 4FXGB 4NRPA 2X0YA 2XMLA 3QLQA 5HPOA 1RUF1 3M2MA 4QPGA 2FMDA 3TB0A 4META 2DWRA 1MZFA 2D0TA 3RKGA 4K3UA 3SHRA 5CFDC 4QPYA 2P3KA 1R092 4DV0T 3AVSA 4XHBA 3ETPA 3M3CA 5HYAA 4KL1A 4ISSA 1N47A 1U5IA 4A56A 4XUOA 3NZQA 4CCCA 1JMUB 2Z6EA 1XJAA 5IUXA 1PMJX 3FHAA 2EA7A 3S57A 2HWC3 3FX3A 4AKLA 2RS32 4YVWB 1YQ3A 4O61A 3WX5A 4YZ5A 4NO4A 4A3ZA 1PMHX 4XAEA 2LM2A 4PJLA 3E22E 3OBVE 4I55E 1LRZA 3C3VA 2LHRA 3VKHA 2QQPA 1RUC1 4QXHA 3Q8AA 1F9KA 2XQ7A 4P14A 5FLJA 1RITA 4H9PC 1K5MC 2ZMNA 1WMXA 4A42A 3MA9A 2HWD2 2WQYA 2R1DA 3CBNA 1JUIA 5IYYA 2BG9E 5KXJA 2XQ4A 3FLRA 4RQPB 2LOPA 1R083 2OS2A 5AQHB 3DCQA 3P50A 1MZ5A 4YZ4A 4NHXA 3BN6A 4D6SA 2LHNA 1HJGA 1X50A 3WINE 4FQ4A 3POEA 2HWC1 4HPKB 2RS13 2HN2A 3AL5A 1IBLT 1XSQA 4QX0A 1TZOA 4UXNB 1QF3A 3SCFA 2XONA 4QKFA 1WD3A 4LMJA 4AQYT 3L09A 1C3HA 1KRIA 4BOWA 2VBPA 4BK4A 1OXCA 5F5AA 5LHIB 4MGQA 1XOYA 2PBIA 2VCMA 3JUUA 4AI3A 4UFMA 1RUG2 5CJ5A 2ARXA 5HCAA 4J25A 5JDNA 4DR7T 5C70A 4XF3A 1MMDA 2J1AA 1UX5A 5BNNB 1OUXA 5JVDE 3VZNA 2BJSA 4AEJA 2ZKNA 4GKKT 4G63A 4FAGA 2LROA 4A4AA 5A3MA 2KD7A 1R081 4PCRA 4Q4X2 2GN7A 2W2IA 2HEWF 5I93A 3VN4A 5LHGB 4XUQA 5CEHA 3AE2A 3H8XA 3KINB 4EWAA 2XWBB 2CE7A 2ZX1A 2GK9A 2RS11 2ZGTA 4DXRA 4GZ9A 3VDDB 3WZ1A 5D8AC 1W9FA 3OBTA 4OZOA 5G05L 1OT5A 4Q0QA 3B57A 4M4PA 1R64A 1WLDA 4K0UA 1LOAA 5BNPC 4E2SA 4S2DA 3VKGA 3DN7A 3KSCA 5IAXA 3MW2A 1YEWA 3NSTA 3VD7A 2EAAA 2X09A 1RGSA 2BQPA 3ZYRA 4TZDA 3ZXEA 1JS9A 3B00A 1PM4A 2YZ4A 3EDUA 4EB6E 2XVKA 1SACA 1W6OA 3ILRA 1CESA 5I8TA 4Y33A 1VPHA 2VNOA 2YBSA 4EYUA 3NKTA 5AQIB 5FFOC 4CUGA 1C1LA 5KDMC 5DUVA 1DGWX 1LHWA 2QQLA 3LOIA 1AUYA 2WQ8A 4F6RC 1X79A 2QCSB 2PHXA 2IC9A 1WYCA 4NUBA 5H9QA 5CB7A 1V00A 2IXHA 2J1VA 2VWAA 2YY1A 5LK5A 3ZYMA 5IT6A 2JDPA 3LCPA 5F2WA 2LRPA 2PHDA 4IEUA 4NIHA 3C7FA 3DECA 2D6NA 1D1BA 4IQPA 2WFF2 5FZFA 2C5IT 3RVHA 2V73A 4JV4A 1IJ6A 5CYYA 3LSDA 4BDVB 2XQXA 5JXIA 3PUHA 1RXGA 2YGLA 3GBFA 4DB5A 1VBD3 3ZO0B 5JLVA 3BTYA 2M6IA 5J0ZA 2VNGA 4F8AA 4Q29A 3BB6A 5ABEA 4JRAA 4XAAA 4P9IA 2BS3A 1IOAA 2VAUA 4QGLA 2W61A 3AMNA 2P3IA 3AKRA 3MF6A 2Q9QA 5A7QA 5DPNA 2XLGA 5E88A 3H42B 1RUOA 1GNHA 4CEYB 4O8SA 4JI5T 5L4EA 2WNUC 2PELA 2A71A 3WEZA 2WYFA 2E26A 5K0UA 1O4TA 1T6GC 2H89A 1UK5A 5GZEA 3I4IA 3PL0A 5A80A 3ZPYA 1GYKA 4ZXLA 2XUMA 4AW7A 2XLAA 1IKQA 2QZ2A 2P1BA 1V9U2 3EAMA 5DQWA 3AE4A 2W94A 1LEDA 3ZYLA 5DAQA 5FZOA 1DCSA 4OCTA 4LIVA 4RS5A 4L5GA 1YO8A 1GUIA 2VR4A 1RUNA 1VBD1 1POQA 1SLIA 4RR3C 5L36A 3BQLA 3ZSJA 2IVIB 3ZX7A 4MALA 2GC2A 2Q1ZB 4EOZB 1OD3A 2D40A 2FJDA 3GZEA 3T0BA 1AR73 4HKLA 3FL7A 2CU5A 1NA1C 2LKHA 3BYWA 1V6KA 4ZI2C 2VTFA 1XE8A 3FZFB 4XF0A 4WZXA 4XF1A 2K9ZA 1RUH2 1BR0A 4RHV3 4DVDA 1W6OB 4UVAB 3NJYA 4I01A 1F15A 3UFEA 1O7FA 3AE8A 4PFPA 4TN7B 3USUB 1VBC2 5GLUA 4A97A 2B4KA 4OLLA 5AQNB 5FWEA 4EJRA 3VHLA 1FMWA 3WQBA 1RUD3 4Q4V3 3KM5A 1H9PA 4HVQA 4GWNA 4FOWA 3DYMA 4GALA 1ALYA 3QOFA 3FFZA 1JW6A 2F17A 3INAA 4LLFA 5F9TA 1J1JA 4LK6A 5C5TA 5A6ZA 2VE1A 4CP2A 4QU2A 1Y3TA 3POGA 4HK9A 3RC8A 4IDZA 1AR71 1WMFA 1J58A 4CDQA 4DMVA 2ADDA 1YI9A 3OYXA 3GCWA 4QGMA 5JTGA 5IK4A 2QVAA 3GN5B 1H4HA 2JG9A 2V7KA 4IHJE 4YM0A 4QGNA 4RHV1 1LNSA 3DV8A 2ZX2A 4QDRA 1DFQA 3IM0A 3ZXDA 2Q9QB 4JLEA 3RLFF 2IMLA 1W6MA 4OMCA 1ULOA 3J7MA 1RUD1 4Q4V1 4WVVA 3R6SA 1W04A 4LBQD 2KA3A 4YZ3A 2H7OA 3IF8B 1IJ5A 2DCTA 3I3BA 4PT6A 1FEWA 1VBA2 4D6RA 1UU4A 5KXBA 4LR4A 4ISQA 1O3SA 2XUEA 1W2NA 4XUTA 1W0AA 2DHRA 1BEV2 3QUJA 1O5LA 3RRWA 3GHMA 5FZOB 2DCYA 3E6BA 3IZOA 4X66T 4XOGA 1ZHCA 4RSUA 2XJSA 2DUPA 3WNLA 1XRUA 2EIDA 1ZBE2 2DVDA 3I3QA 3I7DA 1N1SA 2WO2A 3M3EA 1XE0A 2RMU2 2V7IA 2PAMA 3T3YA 3A8YC 5LA2A 2UURA 4UVCB 1AYN1 2UXDT 3TEXA 5FP8A 4Y1ZA 3SH4A 5TSWA 2W62A 4H55A 4MYEA 4TX5A 1RC6A 5ETWA 1Q8PA 2I45A 1CPNA 3ZCIA 3AP5A 2J22A 3LZZA 4IDPA 4AFDA 4ORFA 2D6MA 1OEDB 4HE8A 4I43B 5EXOA 1ZV4X 1VBE2 1IZ3A 1ONAA 5EK2A 1W2TA 3BODA 3SITA 2TUNA 2WABA 1QH6A 5J1XA 2AREA 2UWBA 5CIRA 3RZKA 1WR6A 1NCQC 3KB5A 3VBSB 4UBGA 5FZEA 1W09A 2JD9A 4QX7B 1W8UA 5J7MA 1QOTA 1ZBA3 2OKXA 4BYYA 2VXJA 5EZYE 1JYVA 1EYBA 3ZC1A 1HCIA 5IFTA 2WN3A 5SV5A 3U3IA 4P0BA 1BMV1 3TBDA 4IV1C 4XTPA 5A3LA 1B35B 2X67A 2CMRA 1QY4A 1SCRA 5GKAC 2R072 2ZX0A 1N3OA 5FZ7A 3M3IA 1Y9GA 4SLIA 3CQGB 4UXAA 1GOFA 1W0OA 4HFBA 3AZXA 2WY2A 1W6MB 1GP5A 4FPHA 1ACCA 3ZJ2A 1UWWA 1UY2A 2OQ6A 1JZ5A 2VKHA 2UWCA 2UWAA 4CI3B 3H1YA 5FXXA 2WT2A 5JXGA 3K1SA 5A33A 3VBOC 1HB2A 2A9UA 1H1IA 2UXCT 2DL1A 2OUHA 2JQKA 3VR8A 3Q5XA 1S2EA 1ZBA1 5GALA 1P8JA 4O4JE 3OOXA 2DFCA 2FZ1A 4A6SA 2CGPA 3ZSKA 4IL9A 5FLIA 2BP6A 3TOJA 3HQUA 1KD7A 5JMCA 1QGLA 3Q8BA 4YTNA 3V65A 2ZEWA 1YKEB 1SQ4A 5L9VA 3E1F1 4RGAA 3LEGA 5FV3A 3B3QE 4M0NA 4H63V 2EAKA 3E97A 1AZDA 4LFAT 5JSOA 3HQXA 3OUIA 5SV8A 2NWBA 4YTPA 5FYYA 3NJZA 3UKVA 3NO8A 3UU4A 3AA6B 4Q1RA 2C0ZA 4QXCA 4M00A 4X62T 3FUOA 1Q8OA 4CCNA 5LA6E 4WZCA 4TNWA 2CY6A 2D43A 3ZN6B 1NXMA 2JENA 2A6ZA 4D6QA 2KM2A 2X51A 2XAFB 4COVA 4FOVA 1BJQA 1WCSA 1JYTA 1FOD3 4YM3A 2WS3A 5FVLA 3EMRA 1UN1A 3SH5A 2FBEA 1AF9A 3BTXA 3RPQA 2BKPA 1H2NA 2WZR2 1HB3A 3RZJA 1ULGA 1VMFA 2C26A 4DV7T 3VL9A 5IK7A 4CN6A 4Y4RA 1GV9A 1UQXA 3H1WA 3O5SA 3PUXF 2X5IA 3MW3A 3VHRA 4IESA 5TAOA 3MLJA 3H8UA 5LOVE 5FRAA 4XFHA 2YDQA 5FYIA 4WM7C 1SUMB 3EO6A 4QQLA 3I2OA 1WLWA 4OI2A 2QRXA 1A8MA 3C4XA 4TUYE 1YJLA 2VW0A 5FUNA 5J09A 1A6CA 4NRMA 2CAUA 5FZCA 1KS4A 2WCAA 2IFRA 2VMHA 3J7LA 3NNJA 4MGKE 4ASMB 4KH9A 1NLSA 3MYXA 4YHHT 3CQXC 2ACZA 3NBXX 3OBZA 5A33B 4LO7A 1D4VB 5EIYB 4Z2WA 2B9VA 1N33T 2LALA 5C3QA 1QDOA 4CCKA 5HCBA 4HK8A 3VHPA 2XKPA 2XQ9A 5C33A 4LXLA 3NV1A 3V0BA 5HEJA 5A32B 5C6CA 5H6RB 1T7SA 3C51A 2R0HA 2VPVA 1KITA 3ZFEA 1FYUA 3KT1A 3WNPA 4FFGA 1OA4A 1W0NA 1DG6A 2G9ZA 3PUSA 4UFIA 2RA1A 2FD8A 2CDOA 1WMDA 5FY9A 4BQ4A 5C71A 3A0NA 5CFCC 3N4MA 4Y5SA 2GC3A 2LEHA 4XQ4A 1W9YA 5JREA 1OVPA 3VLBB 1XNDA 3POBA 5L3GB 4P5YA 3NAPC 2D6LX 1O59A 1VP6A 4EV0A 1QJX3 2RG4A 5FPBA 1W8WA 3HIFA 5DZFA 4ZXKA 2CPTA 3T08A 4OMDA 1E2AA 3WG1A 2Y60A 1E1HB 4E2GA 3B93A 1VJ2A 2CXDA 5F5QA 3R4SA 2I07B 1NLQA 1UXXX 4UIGA 3O1MA 4MXWA 1NE4A 4JGYB 3AM2A 5FP7A 3UU3A 4LBQA 3E6CC 4K0KT 3ZR5A 1VBB2 5FMCA 4ONUA 4QD2A 5FR3A 3D0SA 2NLRA 1GOHA 5KR7A 3SOLA 1D0YA 4TNVA 1PIV2 2K0GA 3OPWA 4KG8A 3T2TA 2D3SA 5FO8B 2B45X 1HRI1 5FKCA 1F31A 3ZR6A 1M7KA 1QJX1 3I3MA 1K42A 4YJ3E 1F5FA 4LUMA 2XQRA 3AE9A 1GQGA 2XHNA 2DDUA 3RX6A 1B7TA 4AGGA 1OA2A 4DBRA 4CI1B 4I50E 2XLFA 2J47A 1CUNA 2WIIB 5F5IA 1NCRA 5FPAA 1UY4A 1ZX5A 3O4XE 5I0UA 3PUZF 2K46A 5BNOB 3KGLA 2A70A 2BVMA 3POIA 2K3WA 3WF3A 4N53A 5IVFA 4P0AA 4NXMT 5FZLA 1GP6A 4R4XA 3WNOA 3FBZA 4QKNA 4IGQA 4FT8A 4HT1T 3V0BB 4IT4A 2IXKA 2BPA2 4Q0VA 2W68A 3ZFEB 2CL2A 5HXMA 4MHUA 2E9QA 2SLIA 2YGMA 2BBHA 4JVAA 2OPKA 2UUBT 1QQP3 1EUTA 5F37A 4E27A 2QDNA 3CZUA 1RHI1 3VDBA 2R30A 5HXEA 2YPDA 2LKGA 1SBFA 2PHRA 3DPRC 3VD9A 1E57A 3AZZA 1WWYA 1DF0A 5JOYA 3VBFC 1I5ZA 3Q9OA 4UV8B 3GGLA 2HWE2 5GZCA 5JDHA 4Q8KA 4MG2A 3ZFFB 3R84B 2XVGA 1YD8G 2Q0AA 5DAVA 2F4PA 2WNVB 2GH2A 1R093 2JDKA 4BJMA 4WM8C 2UY8A 1G9DA 4XXAA 5ISLA 1VE0A 2B46X 2ZCWA 3AMQA 3UT5E 3QD6A 5F7UA 5LW9A 3FZLB 1I6XA 1OWAA 4ZKTB 1QWRA 4CU6A 3LD8A 2WRAA 2MOZA 3OYWA 3W59A 4U74A 2RS33 4LNVA 1OVSA 1SDWA 3LIHA 3EHZA 3U78A 4QQHA 3ZYIB 1QQP1 3VU7H 2EALA 2WWUA 5T5PA 4OHXA 3ZYFA 4UAPA 2VOVA 3NNLA 5BPXA 2KSRA 1XNQT 4B4RA 2EVXA 4IL4A 2CWYA 4DMWA 5JQGE 5L73A 4LQRA 2YU1A 2A6XA 5LP6E 5FKBA 5HCFA 3WSOA 4YW2A 5FQ0A 1ZM1A 3UTKA 5FLHA 5IW0A 4ZZ8A 3F2EA 1QJFA 5AQJB 1UX4A 3O14A 5GJ6A 3ZC0A 1CAWA 5DABA 4FOQA 3A5XA 4LPLA 4DR6T 4WBOA 2YDEA 5L9BA 1R091 1XB9A 4NR1A 2PLV3 4SBVA 2HWB2 3C7HA 4B6XA 2PHUA 4D0QA 5C9AA 3SQOA 5IHRA 3WW3A 4Q2FA 5DJQC 3A23A 3QACA 1ASJ2 3I2DA 4DXTA 3UULA 4HANA 4ATFA 1GKBA 4LKEA 4JCKA 3UUMA 3EHKA 3N2OA 2W5FA 3SISA 2PTFA 1RVF2 2RS31 4CQIA 4KBMB 4NIGA 4DV5T 4IL7A 3TNPB 4N9IA 2VH9A 3PNAA 3KQ4B 3JC6C 1W0PA 1T2XA 2VL4A 3PUWF 4TZ4C 2QQJA 4OFGA 2C1FA 3WY6A 3IMNA 1JYCA 5CNAA 2DVAA 1HV1A 2JXAA 4GYSA 4QPIC 1UD1A 4C0HA 1G86A 4EWDA 5BYNA 1KS5A 1RUE2 2FQPA 1GLHA 1RUG3 3LE0A 1W9SA 4E4ZA 2HWD1 4QQOA 4YGEA 4BQXA 3N2GE 1OEDE 1FXZA 2V6YB 5AQKB 5CFDB 2PLV1 2YKSA 4AAPA 3LDQB 3BKZA 4IEXA 2G9GA 1VALA 3THTA 3PTRB 1UOGA 5D8AA 4Q4X3 3J7HA 5FYCA 3KLSA 4V1Av 1HXS2 5BNPA 2XXZA 3UJOA 2R042 3IDCB 4HETA 4MGZE 4HVRA 3M1HA 2VL0A 2XAGB 4Y1YA 1FJGT 4Q4W3 4M01A 2WB5A 4FI9A 4ERRA 2LM3A 2P3YA 4WVWA 5LMNT 3RRDA 2ZGLA 4R52A 5J2UE 3OPTA 3OYWB 3C64A 4COYA 1NWMX 3C98B 3R6NA 5FYVA 2F4LA 5DG1A 1RUG1 2FMYA 4QKDA 4NUVA 3U14A 1CJPA 5FYSA 3M7AA 2RDRA 1K5MB 1YQ6A 3T09A 4CZSA 4Q5OA 1YFXA 4Q0PA 3ZXKA 2KWIB 4FCAA 2NM1A 4Y22A 3NKZA 1DHKB 3BQKA 3O12A 3HN3A 2VCBA 4Q4X1 3L2HA 4UF0A 3T2QA 2A3DA 4D3WA 4QX5A 1W90A 4IEVA 2BU9A 2WBKA 2VKJA 5FZIA 4X64T 3VBUA 2JJ6A 4DUYT 2ZGPA 5LMUT 1UCXA 4G9SB 4XVHA 4DQAA 4DBQA 3GALA 2ZM8A 4XABA 3ES1A 4Z8XA 2WFF3 4ZZ5A 2Q8CA 3K46A 1UIKA 2WDRA 1REDA 1YQ8A 1X33A 1XYPA 2HLEA 2VL8A 1ZYBA 3VBRA 4NOTA 5DQVA 4EZHA 1OOPC 1OURA 3POFA 4M3CB 3N9QA 2PG8A 1KFYA 2R7EB 5T54A 3UUNA 1H1AA 3KQRA 2XSBA 3OUHA 3H37A 4HKOA 4B3NA 2FDKA 3LAGA 4COWA 3CWZB 5T5OA 4NE9A 1LOCA 1FV2A 3I2FA 2JE9A 1DU3D 5CA0E 4JRLA 3I2IA 3UKNA 3BI3A 1HRV2 4R9CA 4D7SA 1GU3A 1BYHA 5BXXA 4IUGA 4NHMA 2NTXA 2BOJA 3N3HA 5FZBA 1N3QA 3ZT7A 4RR3A 2KNDA 1V9U3 2WFF1 4PIXA 2VURA 2WZHA 3M70A 5BNPB 4E2QA 1W2UA 4MX3A 3BTZA 1S0CA 1C5IA 4INDA 2NW7A 3G6JB 1KNRA 5ACA2 1RMU2 3WP5A 4UVBB 3H3UA 5F5CA 4OI1A 1AL0G 2GMPA 4BA6A 2FCUA 3WG4A 1D2SA 4ES8A 2ZEXA 4U3CA 2D98A 2BZBA 3OGGA 3J9X1 1WLTA 2YU2A 3W9AA 4LFBT 4XYXA 4IREA 4PLMA 2BNNA 2O0OA 4W6XA 3U4XA 1CAVA 4P00B 1RUH3 1D0XA 3WF0A 2BG9A 3DYPA 1ZOYA 1YKHB 1W6NA 2F6BA 4UW3A 3ZOIA 1XNRT 1RL3A 5JDGA 1S35A 4AZZA 3NNFA 2LSGA 3AEAA 1VBC3 2QQKA 4XUNA 2XJUA 1V9U1 4B3MT 2G4IA 2NMOA 1C8M2 1S55A 4NIAA 3ZMUB 4ASKA 2V72A 2N7GA 3Q8EA 1R1ZA 2A3YA 4N7UA 1DQ1A 1C8NA 1MQTC 5AQQB 1S4CA 4GK5E 5FYMA 2WC2A 2IC6A 2IXJA 3B02A 2W87A 2V8SV 3N7KA 5FJHA 2YC2A 4GWJA 4HN9A 4YSXA 3E5XA 5I8SA 2MAWA 4LITA 4FPLA 3VGIA 2V4VA 2GAUA 5A3UA 1RUH1 2IZWA 5LG4A 4NIIA 3IPVA 1HQLA 4G2AA 3W5NA 2WNUB 3ZYGA 4OHVA 3ZLIA 2CTVA 4LEJA 1CZTA 4ZI7E 1VBC1 5C3RA 3FHIB 3FLTA 2BGPA 1OEDC 1WCUA 2BWCA 1MACA 2JEMA 4EV6A 5T52A 1ZNPA 3CVRA 5LNKA 1VBA3 2VCAA 2VY0A 4GWIA 3ZDVA 2CXFA 4LBNA 5I0SA 2H88A 4L0RA 3O1OA 4DRVA 4LORA 1BEV3 5EFUA 2WNEA 4RR3B 5JPNB 3N9MA 1MS1A 3M8LA 4TWFA 3G06A 4MVTA 3RI8A 1WW7A 1MS5A 3U0ZA 4XDQA 1BR4A 1TMF2 1SMVA 3CJIA 5J1GA 1NXD1 3TRSB 1ZBE3 1UMHA 4BMBA 2RR12 3WF1A 3HMYA 1NA1B 3UU8A 3ORJA 2RMU3 1ZRCA 1CAUA 1V6OA 3C4WA 4Z90A 3FUQA 5FXVA 4IETA 4QM8A 4LBJA 4COZA 2TNFA 2WSSV 2OZ6A 3MUZ1 3LQCA 4L0PA 5L7OC 1WCQA 3DP7A 1QMJA 1PO12 3GZAA 3K51A 1DZRA 1QJU2 2WU5A 1VBA1 4HEAA 5IVYA 1VBE3 1JYIA 1ULEA 1YIPA 3KVAA 1NCQA 3Q5EA 1JTZX 4MHCA 1BEV1 2YC4A 4XC9A 4H9NC 4MLOA 5CVRA 3DXUA 1D0ZA 3IKWA 1UZWA 3WUDA 1XDPA 2VZTA 3RGLA 2X9HA 5FUIA 3C4ZA 4IEPA 2AEZA 4EYYR 4Q26A 1ZBE1 1Q3EA 4CRQA 1VOMA 3PJYA 1NX9A 5GONE 2RMU1 1X7NA 2JICA 5I91A 2CEAA 2JE8A 2IW5B 3PMEA 2B76A 2ZM0A 5CA1E 5JRCB 5IVCA 3CKHA 4L97A 4F3JA 2QVSB 3M3QA 3HN1A 3ES4A 4PJMA 5F39A 4AFCA 1SDDB 5HEGA 3ZSTA 4KGGA 5GLWA 5M4YA 4CE8A 3NRYA 1WRDA 3LA2A 2R073 2J1RA 1VBE1 4ANJA 4IV3B 1QJEA 4PI2A 4CP0A 5CBLA 4DMIA 2KLQA 4JI8T 4WVMA 3KMHA 1UYZA 1J1TA 1S0IA 2YFZA 1W8FA 1UZ0A 4J6GA 4DR4T 3F2ZA 4GJZA 5FYTA 3WVJA 4XETA 5AC92 2WO7A 1GWMA 4A5XA 1AX1A 1F5JA 5HXSA 2ZACA 1B09A 4XZUG 3NL1A 3AEBA 2XDVA 2XM1A 4WW0A 3IIAA 5AVPA 2B5HA 1F8VA 3RIFA 5KHJA 4ILCA 3ZEFB 1LOFC 3AB0A 3OPZA 3D82A 1MIVA 2ARCA 1QOOA 1LGNA 5DAWA 3HOBA 1YQ4A 2XHKA 1FMVA 4EGWA 3RQUA 5C8CC 4LO8A 2QUOA 3MDPA 2JIGA 4GKXA 5KX5E 3WNNA 2XHEB 1UOJA 4JKLA 3RS6A 2R071 1I6ZA 5A7WA 2ZAAA 3PMSA 5FL0A 3JC6D 3PUVF 2R49A 1GQEA 2JQHA 4COFA 2LT3A 1GR3A 4TLFA 1DQ4A 1XU2A 5DUXA 4LLOA 4ZHNA 1LR5A 2P5BA 1SLBA 1G8XA 4ZZCA 2VQFT 5AQTB 3I3EA 1SBDA 1NCQB 2XBO2 4EXTA 1XMOT 4ZI3C 1RXFA 2P37A 3GJAA 3UGFA 1PMIA 4KMQA 4W6YA 1HF8A 2VMCA 1EY2A 5K4LA 3HA4A 4LK7A 2VU9A 2WZR3 1A34A 4KWKA 3AX4A 1UOBA 2YK0A 5KHKA 4AHXA 3N35A 1T6BX 1ZA4A 4IV1B 1WBFA 1W6PA 4CEWA 2I0MA 4DIQA 4AFBA 4IXLA 3WQ0A 1HLCA 1J3PA 4U2AA 1JHNA 4K7JA 4BQYA 2AENA 1VMHA 3U4SA 4C90A 5DUUA 4QHZA 5FY7A 1RJ8A 4WVMB 4HFHA 3VBOB 3U07A 2D5FA 1HB1A 2VK9A 4CPBA 1FOD2 4J2CA 4YVSC 3WW1A 2ATFA 1A78A 4ZXEA 1QDCA 1YQ5A 4FTBA 3FZ3A 2DUOA 4PLNA 2WZR1 1UF2C 4TV9E 3GBGA 5GLZA 2DV9A 1WCRA 5FXWA 1OPOA 4AFMA 1ULDA 1W28A 3HKBE 1DYPA 1JNZA 1DQ5A 3FHNA 4NXNT 1AHSA 5ABGA 2R32A 5HXRA 3H50A 4K8RB 4EN6B 4O2BE 3ROUA 2LRKA 4OX9T 5CFCA 1H2MA 2Z42A 2D93A 5EHDA 4KGQA 2BW8A 3NAPA 5CADA 3TLVA 4A7KA 4A45A 1DZTA 1FNZA 3JD72 5JIAA 2P6CA 3VKFC 3TEZA 1H9WA 3LFMA 3VB9A 4LMFA 4YM1A 3V5UA 2N2NA 4E7ZA 5LA9A 4DXSA 3APBA 2HYKA 3ANWA 2X9WA 3ZFGC 3DJBA 1C5HA 2DVFA 1W0BA 4Y1UA 3M3ZB 3LK3B 4MLKA 2IC1A 2WFPA 4LO4B 3EQEA 1XNTA 1WCDJ 1HTJF 3FN9A 4NMIA 4MGTA 2E7AA 2PMWB 4JQTA 4HONA 1CZVA 2CRBA 3AFKA 2CHHA 1SE7A 2DWKA 3GF6A 2D2SA 1QJZA 3T30A 1D4M2 2VQET 1YUDA 1H8TC 3RMYA 3EXUA 1VBB3 2WT0A 2LSJA 3I59A 3P1IA 4WM7B 4KBZA 3ZN0B 4LO6B 4YG0A 3NWIA 3ILNA 1PIV3 3MIBA 4M3CE 5LA0A 2P4EA 4QPGC 1UMZA 3RG0A 3GBWA 4HMZA 4LE3A 3C7GA 4A7YA 4KU8A 5C3SA 3PJQA 1ZRIA 3RYRA 5D1IA 3PIGA 4GH4C 2NYYA 5H9RA 3IWZA 1NE6A 1HR0T 2JDYA 2TEPA 1N1YA 2Q5TA 4BLIA 3ZFFC 1ND3C 1CN1A 4JYAT 2J1TA 4QB1A 1JOPA 4HFVA 2WNVC 4ITCA 5CAZA 4EEDA 4P9LA 3EUHA 4GYRA 5J37A 2JDUA 4PIYA 5C7GA 2A75A 4FTEA 2X0HA 2PQSA 2VG9A 1LHVA 3AA1B 5LZ6A 1JBCA 4UOJA 4NN0A 2ZHKA 3CMGA 1L3JA 3BU0A 1VBB1 1MPXA 4XF4A 4LBOA 2EIEA 3ABVA 1YI7A 2WT1A 4YTMA 1PIV1 2E9XD 3C7OA 3NKGA 2G19A 4MZUA 5JMOA 2OV9A 1N32T 2WZIA 2J62A 3B9IA 4YW5A 4HWHA 3IMMA 4FXKB 4KI5M 3DTOA 1HX1B 1WYBA 1YXRA 4LKDA 3KVBA 2EICA 1VRH2 3WNKA 4FP2A 5JI9A 3VDAA 4CCOA 2AGSA 4YXDA 4IEYA 4OYUA 4RQPA 3NZPA 2HWE3 2ZHNA 4XF9A 2CWOA 1VAKA 4LHNA 5D2AA 2YOEA 3ANWB 2ZX4A 3R4UA 1H1MA 3OGSA 4NAOA 5FOBB 4HPKA 5F2SA 4LMLA 2W39A 2V1DB 1ODNA 4PI0A 1GOGA 1PNFA 4B1LA 1LOGA 1GQHA 4X8PA 3JBG2 2EXIA 5KXCA 1UW8A 3UK9A 4X20E 4Z8BA 4Y4YA 3V0AB 3TN92 1W8NA 4YW6A 2X9YA 2HN1A 1KFUL 1FMD2 2XG3A 1HNWT 3F95A 2UUCT 2WZEA 2WMOA 3H7JA 3O1VA 3AA0B 3AAAB 3L2YA 3R05A 2Q1MA 3D8CA 4YSYA 2WWJA 3RNSA 5BNNA 3BALA 3O1JA 2GALA 5FIXA 1UAIA 4I0UA 4QXBB 2Y8KA 5FAXA 4OI4A 2K24A 1YFUA 1V6MA 3ZIXA 2HWE1 3KD4A 3WG3A 1UOFA 2ZS6B 4KHZF 2NPIA 3JU9A 3VRBA 1HG5A 3ZJ1A 2RS52 1FX5A 4FJOA 2VD7A 4QWNB 1L7LA 2DURA 4ZEYA 4OVEA 3VDDA 1PVC3 5L3EB 1YCIA 2SBAA 4CUBA 2HWB3 2Q30A 2DWGA 4BQ3A 3FBYA 4Z91A 2W95A 1T8BA 4MHRA 5JVVA 1M06G 3VL8A 3RWKX 4ZU5A 1ASJ3 2WS92 2E32A 3LA7A 4L9BA 2VMFA 4Q8LA 5FZ4A 5JH7E 1RVF3 1U0AA 1K45A 3VBHB 2J4GA 2HH7A 3RPUA 3R4DB 3H1MA 2UUAT 1ENSA 3P3NA 3WCSA 1Y01A 4BK5A 2AZ5A 4A6OA 5L3CB 2C9KA 5E8AA 3ACLA 1KGYA 3M65A 2W63A 2QDRA 4X8NA 2VVEA 1IQDC 4D7YA 1W2AX 1W9RA 1GFF2 3DPRB 4YGCA 4CDXC 3CL1A 5FZAA 5J98B 4J1WA 3RJ2X 1UX7A 1RUE3 1DGRN 2V7LA 3VBFB 2YBPA 3HR0A 4GMP3 5A6QA 4ILUA 1MVEA 1BLZA 4LULA 1CQ9A 1Y7BA 3ATGA 4U31A 4LF5T 1QEXA 5KHGA 2PLV2 5DN2A 2ZABA 2JX9A 2HWB1 1IBKT 4WM8B 3UKTA 4O4LE 1ASJ1 1QOSA 1HXS3 4I02A 2R043 4YZ2A 2DVGA 3TWIA 4MADA 1RVF1 2AACA 3AYEA 4B1MA 1O5UA 4H3WA 1W9WA 4FQZA 1GICA 1UZVA 2L3LA 3AYCA 4JTNA 3KV6A 2N9DA 2Y0IA 4B3TT 3W58A 1ZZ6A 2IWGB 1AJ3A 4AHWA 4XJAA 4N90A 4G4FA 2VZOA 2VMDA 2VGDA 4CSWA 4UELA 1H8VA 4AHYA 1BVVA 3WQ1A 5FY5A 5B4NA 4PJYA 3KF5A 3NRXA 1DBNA 4CEYA 1RUE1 5K0UC 2CWSA 5LRSA 4I09A 2VECA 4GMP1 3AP4A 5LG3A 2KXLA 2YMZA 5HCJA 3PUIA 2ET7A 2WAOA 3AJYA 2CLYB 5FKYA 3ZYBA 4AOCA 2LLYA 2D0UA 4IGUA 1F2NA 2FDHA 1K12A 2ZEZA 1W39A 3GDBA 3K4DA 3B94A 2ILMA 1QJY2 4I30A 5IVJA 1HXS1 1DYKA 2ZMLA 1OD5A 2R041 3I2JA 1WLCA 3B7MA 1CAXB 3J8F2 1NZCA 3I9WA 3LSVA 4Q4W2 1XXNA 4L92A 3DL3A 5AFBA 2GNBA 3RYCE 4I0AA 2XASB 4URTA 1ENRA 1I94T 4XJZA 4CCJA 4FPYA 1DQ2A 2LM9A 4ZI3D 3I97A 1UMIA 1JU3A 3LSEA 3UGHA 2E51A 2BERA 5HWXA 3PDQA 1W8ZA 2VZUA 5KXDA 4QPIB 3UUXB 1L7RA 5JOWA 4PFOA 2YBKA 5EPAA 1Q5OA 4Y20A 1A8DA 2Z5WA 1PZ8A 3FC0A 1O91A 4TN7A 3USUA 5IVEA 5F6LB 4MGSA 3LIGA 5FMBA 5AFUL 1RUJ2 4TLGA 2OLTA 1AL23 1ULCA 2VBBA 1IS4A 2ZGUA 3UYJA 3MIHA 4JC1A 3JAEA 1SLLA 5JR7B 1HRV3 3HD8B 4BQWA 4QX8A 1SHWB 4AL9A 2H3RA 3LBXA 2H7VC 1H4GA 2CV6A 3T0AA 3PU3A 2VXRA 4K8FA 2JE7A 4XE9A 4PIZA 4IE0A 2O8QA 3OTOT 1S0BA 1BR1A 5LATA 3AZWA 3RIUC 3BQIA 1JYXA 5ACA3 4GQ7A 1RMU3 3GN5A 5HEHA 1EPZA 4XBNA 2JQ9A 3NNMA 1IAPA 5GLTA 1W3VA 1DGLA 4ISTA 1LRHA 2R6QA 3MJXA 4AQFC 3HPNA 1GQPA 4M0HA 3CQCB 3ZKYA 3O0WA 4R9BA 3HKCE 4R4ZA 1XYNA 2WN2A 4P9JA 2MBGA 1LKNA 5JI7A 2FBWA 1HRV1 1I3HA 3P3PA 1GZ9A 4QX1A 1UU6A 4PK6A 4O2AE 4LKFA 3ZCJA 3OY8B 1YFWA 4QKBA 1XYOA 4K21A 3MPPG 1C8M3 3M4FA 1REEA 1RB8G 2RDQA 1OSGA 1NKGA 1ST8A 4XFAA 2WLPA 5EYYA 1SBEA 1DLLA 3AKTA 2XGXA 5ACA1 1RMU1 2ZOEB 2Y6HA 4X6RB 1Z7S2 3FZMB 2VM9A 5F1RA 2UXNB 2RP4A 3RI9A 1C1FA 5ABFB 4X6QB 1OOPB 1D0HA 3N9NA 3MZHA 1OLQA 2BFUS 4IEQA 2H0BA 5C3OA 2GP5A 2XJPA 3L8RA 1ODMA 2ZA9A 4DV1T 1U5YA 4H9RC 2ORXA 3BU7A 3QCWA 1OEDA 4DV4T 1C57A 4GOUA 2OVUA 4DR2T 2E5VA 2RM23 4Y20B 2IUBA 2XB6C 1AX0A 1SA0E 3GXUA 3AP7A 4MO3M 1UZZA 1HS7A 4TTGA 4NPLA 4X1KE 4QQPA 3S4UA 4UW6A 2WA3A 2V7MA 1C8M1 2WINB 1QIQA 1F4HA 4IE6A 1W99A 4U36A 1UXZA 4QX8B 2ZGMA 3VBSA 1MEC2 3HBKA 3CMLA 2GZWA 3LBXB 2QZ3A 4HN0A 1ZZBA 4QX7A 3N5LA 2DLRA 4GD4A 5AFEA 2PN5A 1HX8A 2DBIA 3HBZA 4IEZA 4U7IA 4DV6T 1WUVA 2VZPA 4AEDC 4A44A 2JJ9A 1LCLA 1TMF3 1OHFA 3TKLB 1YIFA 2E31A 2RR13 5FNVE 3UV9A 2BGCA 3UT0A 3NNGA 1RUI2 2WDVA 1B35A 4GAZA 2Z69A 2AE9A 1HG2A 5EJ1B 2V5CA 4ZS3A 4G3YC 3DF0A 3B13A 1UUSA 2E7QA 5LJNA 3RYFE 3MW4A 2XQ3A 1PO13 2C9AA 3Q9DA 4XIOA 1SLAA 4NPRA 1JI6A 4IV3C 1QJU3 5J3UA 2IDOB 4XW3A 3PVBB 4F8HA 4B3ST 2ARAA 2QYWA 3WQ7A 5EK3A 1HIXA 2BFUL 4JI2T 2D44A 4DINB 1HJFA 3ZMOA 3POJA 5AQLB 5F32A 4BE3A 2W92A 3W20A 4AI6A 2E9XB 2FCTA 4A41A 1MQTB 1VLNA 2EXHA 5FDBA 3ILFA 1TMF1 1JZ8A 5F3EA 1XZYA 2RR11 3GMIA 3RIAA 1MMGA 1J1LA 4HOOA 5JAXA 1OXZA 2B42B 1AVBA 3D0JA 3ZT6A 2BTVC 1NQDA 3E6DA 4S2HA 3L9JT 1U5ZA 2QBXA 3PVEA 5FZ1A 3I2GA 4MXVA 3FB2A 4KG0A 3KV9A 1X8EA 5LGUB 2WJSA 3UJQA 3O1IA 2W00A 4TSVA 3ZKUA 1HW5A 1IQAA 1PO11 2VOWA 3ZYPA 3LDBA 1W8TA 4HGAA 1QJU1 2A5ZA 2OX0A 2VQ0A 5BNQA 3BCWA 2D5HA 4P9YA 1XBFA 4AK3A 3P7IA 5JZGB 2QE3A 4AF9A 4UFKA 3ZN6A 5IAVA 2R062 4LF9T 1OLME 4PF1A 5E0OA 4BHPA 4RL7A 5FXZA 3AXDA 3NV4A 2Y8DA 1SFYA 3WG2A 5HEOA 3AVRA 1AXKA 3K48A 5HXHA 4YFSA 5AC93 2MYSA 2BOIA 1YQ2A 2W91A 4QB2A 3RYPA 2BZDA 1LOFA 3L39A 2X5IC 1LODA 1MS3A 2DYCA 1U5PA 1VIWB 2MPKA 3LB9A 5FZ0A 2LW8A 4OYKA 4C1WA 4PNIA 4HSJA 3WW2A 1YNAA 4LA2A 5A1FA 4OI0A 3K2OA 2RDSA 4W8JA 2CM0A 4ZS2A 4PDWB 5EZWA 5L7OB 4BXFA 3O1TA 5DAPA 4KUMB 2K5BB 4HWDA 3POSA 4CYDA 3ZYKA 2VJXA 2LRLA 4DUWA 3JQXA 2VMIA 1W2OA 4V2VA 3LF7A 5LBCA 4XZCA 4XHXA 1PO22 1S0DA 5T3NA 1UCUA 2QJVA 1ZZ7A 2XH6A 1HNZT 4MGYE 5AQSB 4X5TA 4ISRA 1KDKA 1EP0A 5GZGA 2ZGKA 5F3IA 4A2UA 2G9FA 2M67A 5AC91 4P09A 2IVJA 4FFFA 4GULA 5FP3A 2ADEA 4LUKA 1HKDA 4O9EA 2XBO3 4Q27A 1I9RA 4W6WA 3O0VA 1MMNA 5L9RA 3CHXA 1CIWA 4EROA 1X9PA 2XR4A 5A32A 3Q5DA 2JDHA 4PW8A 1MZ6A 3QB5A 1OKOA 2WSUA 2WDBA 2YHJA 2ET1A 3W15B 3FXEB 5FZHA 1SEFA 3AE3A 1ZP0A 3CU7A 2Y64A 4JGZB 2JD4A 1YXWA 5JPMB 2EHOB 1G9FA 3VZOA 3AMPA 3UETA 1QKQA 1UYXA 3P8CD 1HQWA 2RJKA 3UU5A 4ZHQE 1Q8VA 4KWUA 1E7PA 1W03A 2JB8A 4XJWA 3S30A 3B69A 2XJVA 2PXJA 4YVSA 1WA6X 2VKDA 1POV3 4CCLA 1PGW2 2Y6LA 4WVZA 2LSYA 2XBO1 1IHMA 4S2GA 3HT2A 2VZRA 3OB8A 3FJSA 4NIQA 1BQPA 4GK0E 3OEAA 3ZPOA 4JGYA 2HKXA 2VKOA 1H30A 4MOAA 2CAVA 1FAYA 4B7KA 3OGVA 2DUQA 1OFSA 3LKJA 3K3NA 3DKQA 2DNXA 1O4YA 1TQ5A 2C4XA 4ZU7A 5EJ3A 5C8CB 1N1VA 4UV9B 3BGAA 3NW4A 4Y5Z0 1EAH2 3VZLA 3CK6A 4IDOA 3RZZA 4OZXA 3KT4A 3MFCA 2GMMA 3R0RA 3ZYHA 1FNYA 1XWMA 3DKWA 5AQVB 2E2AA 2W1QA 4YFZA 3T2OA 3P6BA 5FO9B 3V56A 1TNFA 5T5JA 1VAVA 3F31A 4AVTA 1LKXA 2CYFA 4K1ZA 3K75B 3JD73 1POV1 2E8IA 1NCRC 5KHHA 2JDMA 4HVOA 4KU7A 1U4QA 5A6YA 2IFWA 2DTYA 4Y26A 5K8SA 3GCXA 2HHHT 2JDAA 2UU8A 2V5DA 3UGGA 1LESA 2D9DA 1SPPA 3J4UH 4WBBA 4FVVA 5BNOA 1UY1A 3AXEA 1FOD1 5JXJA 5ANNA 4N53C 4CZZB 1ND2B 2QKDA 1WW5A 1W6QB 2WZPP 4JHTA 3KBTA 4XCBA 2L8KA 1PK6C 3WV6A 3LFIA 3ACGA 2VOTA 3USSA 4N9HA 3WI3A 5CU1A 1XC6A 1D0GA 1LAJA 2N1GA 1R1A2 2KINB 1T72A 4U2ZA 1D4M3 5A6XA 2NR4A 1CWPA 1UZYA 2WR9A 4LO5B 4BQ2A 4EN9B 4U72A 4YM2A 4LF8T 2KT9A 3BTAA 5F3CA 2WAUA 4BAYB 3I0QA 4UFJA 2ZKLA 5FMDA 5CFBA 1KK7A 4LOTA 3JD71 3O1PA 3B9CA 5A1AA 1RTVA 4UW4A
chains in the Genus database with same CATH topology
2YBKA 2XHEB 3LK2B 4URAA 2ODVA 2JQQA 3L09A 3VU7H 5LHHB 2D5UA 2WWUA 5TAOA 3LDBA 3DTOA 4HGAA 2OX0A 3KV4A 3GN5B 5LOVE 2YU2A 3RC3A 1WYBA 1WLXA 3OJAA 2V7KA 4TN7A 4IHJE 4QU1A 4M1PA 5IVEA 2WMNA 3KVBA 5A7WA 2E9XA 4HTEA 3P7IA 2OT7A 2CWYA 4IE5A 5AFUL 5F5AA 2LE8A 4YLHA 5FYIA 5LBMA 3JC6D 5LHIB 4DMWA 5JQGE 4JEHB 5FYHA 1D0XA 2JMHA 3IEEA 2YU1A 2VB6A 2PBIA 5FJKA 3T8OA 4JEUB 5LP6E 3AL6A 4CCOA 1YKHB 3UYJA 4CXXA 5E0OA 2Q9QB 2XQYA 2L9QA 4JLEA 4PJJA 2LT3A 5FXZA 3UTKA 3C4XA 5JDNA 3MKDA 5IW0A 4TUYE 3F2EA 1US7B 4KMCA 1UX4A 1S35A 3ZMTB 5JDGA 4DO0A 2Y8DA 4L9IA 5FUNA 2LSGA 2KMFA 5L3BB 5ANQA 3ZC0A 1MMDA 3K3OA 1UX5A 3NZPA 5DABA 4QX8A 5JVDE 4ZOLE 2P5BA 5LGNB 2H3RA 3A5XA 5FZCA 1G8XA 2CWOA 2H7OA 5CB4E 3IF8B 1IJ5A 3AVRA 2H7VC 3LBXA 5JR9A 3ANWB 4WBOA 4G63A 2DCFA 5HXHA 3CKDA 2NOXA 4YFSA 2Q8DA 1FEWA 2MYSA 4EXTA 4C8DA 4D6RA 4ZI3C 5LGTB 1Y64B 3SS1A 5F2SA 3AB3B 2V1DB 5L3DB 2XUEA 5FYZA 3PU3A 3ZMUB 1HFAA 4ASKA 2W2IA 4B6XA 3CQXC 5A3TA 5LHGB 2DHRA 4IE0A 5CEHA 3NBXX 1U5PA 2W0GA 3QUJA 3KINB 2QA7A 3E08A 3IBPA 3HKDE 4TV8E 5JDQA 4OYKA 5FY1A 1HF8A 5JDFA 5FZ0A 2CE7A 4GJYA 1BR1A 4PNIA 4X20E 2GK9A 5DJQC 3CX7B 2ZMAA 5FPVA 5HXCA 5IVJA 3N9LA 3UULA 3BQIA 5K4LA 5A1FA 3HA4A 3RRWA 4CCKA 2OA5A 4BISA 2X9YA 5FZOB 3GN5A 3UUMA 1BR2A 2Q9QD 3IHRA 3N2OA 2YK0A 4H63H 1ZHCA 3K2OA 3ZMVB 5LCYA 4CQIA 4GK5E 2KXPB 5IWFA 1IAPA 4KBMB 2CM0A 4OFZA 4ZS2A 2IC6A 5FYMA 3B57A 4LXLA 1ZKEA 4ISTA 5FUPA 4K0UA 5FZMA 2JRKA 2WMOA 3RYHE 3MJXA 4H9QC 5H6RB 4BXFA 4PAGA 3VKGA 3KV5A 5FJHA 3JC6C 5A7NA 4KUMB 2OQ7A 3C51A 2C5KT 4HN9A 3AA0B 3MACA 3AAAB 5IHYA 5J2TE 2K5BB 5FP4A 5FZ6A 3ZMZB 2B1EA 4AQFC 3N9PA 5FYUA 2PJQA 3ZYKA 4PJNA 4TZ4C 2V7IA 2V7JA 2A72A 3LJCA 4LITA 2WWJA 3EVYA 4DIQA 3PURA 3CQCB 5FZ8A 3O1JA 2GP3A 4UVCB 4V2VA 3O1HA 5LG4A 2EHOD 4GYSA 4XZCA 5FP8A 3HKCE 3PUSA 5LY2A 2W62A 4G2AA 3FBLA 4QXBB 4TX5A 2RA1A 5FY8A 1UCUA 4MBQA 3PUAA 4UEMA 5LXTE 3EDUA 5ETWA 2BDEA 2MBGA 4EB6E 5FY9A 2K24A 2JMKA 3ZCIA 3ZLIA 3MXZA 2CXLA 4ZI7E 2LEHA 3RKOA 3WAKA 4Y33A 5FPLA 4XBFB 3N2GE 3DXTA 2YBSA 4AQGA 2NW9A 5JREA 4EYUA 4PK6A 5F3IA 4O2AE 3U4SA 5L3GB 4HE8A 3OKQA 1HG5A 4I43B 3ZJ1A 4C90A 3ZCJA 2M67A 4AKHA 5FY7A 4P09A 1D1CA 4CUGA 4FJOA 2VD7A 2ODUA 2LSKA 4QWNB 5F3GA 1ZV4X 3CVRA 5LY1A 3V5SA 5ADXL 5KDMC 5FP3A 5LNKA 4IGPA 4AAPA 5EK2A 4H9OC 5L3EB 5FPBA 2VK9A 4KP3C 1MMNA 3GWHA 3H3AA 4J2CA 2C5JA 2NW8A 3QC9A 3PTRB 4YHJA 1NAFA 3RH3A 2CXFA 2Q9QC 2X9XA 1V9DA 1MIWA 2IAKA 4F6RC 2DWGA 4L0RA 5FYCA 1IZNB 1X79A 2IC9A 4V1Av 1WYCA 4BU2A 1E1HB 4NUBA 4PW8A 3PE0A 2XXZA 3AA7B 2X68A 4WBNE 3N9MA 2VWAA 4TV9E 3ZYMA 5A3PA 2CXDA 2ACXA 5F2WA 5HWYA 3W15B 3FXEB 2WM9A 4PK4A 4AQFA 5FZHA 1WR6A 2I59A 3RYIE 5FXWA 3HKBE 3SRZA 5FZ4A 4UF0B 2UXNB 5IYZE 5L2LA 4AI9A 1VRBA 5JH7E 2RP4A 2JPFA 4UIGA 4AKRB 1BR4A 2XAGB 1D1BA 5LJMA 5FZFA 3N9NA 3FHNA 5J1GA 4EZ4A 5FZEA 5FP7A 2HH7A 2C5IT 3RPUA 3RVHA 4QXBA 3Q5WA 4Y3OA 2EHOC 4QX7B 1IJ6A 5HXRA 3WAJA 4ERRA 5FMNA 2P9BA 3K8PC 2EHOB 4O2BE 4DNDA 2GP5A 5J2UE 2ZLYA 1FIOA 3MZKB 3C4WA 3OPTA 3PDYA 5EZYE 5L3CB 3C64A 5IVVA 4BA9A 2X0LB 3FXDB 3P8CD 4H9RC 3ZC1A 1NWMX 3M65A 4HKAA 5FXVA 1HCIA 3C98B 3R6NA 2W63A 3ETUA 3N9OA 4GOUA 5FWJA 3E0ZA 4ZHQE 5KR7A 3U3IA 5F8PA 3HKEE 4CI2B 1MMAA 4P0BA 3SOLA 5A3NA 1EZ3A 2WSSV 1D0YA 4QWNA 3AAIA 4XDPA 4QHOA 5FYVA 1LVKA 3OPWA 4IE7A 5FZAA 4NUVA 5FYSA 2HPJA 1SA0E 2W61A 4IE4A 2V7LA 3DP7A 2YBPA 1HS7A 2X67A 3HR0A 2PXJA 5E6HA 2LJLA 2CMRA 4ILUA 2VKDA 2KZ7B 2Q9QA 4X1KE 4CCLA 5A7QA 4CCMA 3S4UA 5BMVE 5FZ7A 2YINA 2LSYA 3QK6A 3HL6A 2KWIB 3D0TA 3LFMA 4I4TE 4YJ3E 2V7MA 3RRCA 4ADZA 2Q8EA 1MIYA 3CQGB 2XAHB 4HEAA 4O8SA 3EDVA 3BQKA 5IVYA 3L3PA 4OHFA 4IE6A 3V5UA 4OYJA 2N2NA 4E7ZA 2ES0A 4JUYA 2LOSA 4GIWA 5A1LA 2NTYA 3ANWA 4N78D 3RX6A 3ZJ2A 1B7TA 2X9WA 4UF0A 3DJBA 3KVAA 2V26A 2DI4A 3KBUA 4O4LE 3LG7A 4MHCA 4QX8B 4GK0E 3LK3B 4DBRA 3ZPOA 4CI1B 4MLKA 4I50E 2OQ6A 2NP9A 3CMLA 2A3DA 2XMLA 3LBXB 5JR9B 4H9NC 2VKHA 1CUNA 1SHZC 5HAXA 5FPUA 3DXUA 4QX7A 1HTJF 2DLRA 2VKJA 3N5LA 4O4IE 2VKOA 5F5IA 5FZIA 5A7PA 5A80A 4X1IE 1D0ZA 2EHOA 3ETVA 4GD4A 5FPAA 4CI3B 2D0TA 3I1AA 3O4XE 5FXXA 1HX8A 4NUUA 2KWHA 4QXHB 3KFWX 2CCQA 4HONA 4PK5A 2X9HA 3K3NA 3C4ZA 4QXCB 2DNXA 3C50A 2XAQB 2DWKA 5DQWA 4DBQA 3AVSA 4EYYR 3ZYLA 4E4HA 2BVMA 4AKIA 2ZM8A 2D2SA 5FZOA 2WBLA 4Z8XA 4LIVA 2L3LA 2JJ9A 2CA5A 2X66A 3Q5XA 4V2WA 3KV6A 1VOMA 2N9DA 4UV9B 5HYAA 5KMGP 3TKLB 4L5GA 3PU8A 4ISSA 4O4JE 5GONE 3GA8A 5IVFA 2Q8CA 5FNVE 5LWBA 1AJ3A 5FP9A 1YW0A 4P0AA 4EAHA 4A56A 1MNDA 2CEAA 5FZLA 3NZQA 3BQLA 3FBZA 2IW5B 4QKNA 4IGQA 4GAZA 5IVBA 4CSWA 2Z6EA 2ZM0A 4UELA 2VL8A 1LVFA 2LSJA 5CA1E