3K3OA

Crystal structure of the catalytic core domain of human phf8 complexed with alpha-ketoglutarate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
355
structure length
350
Chain Sequence
LRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PHD finger protein 8
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 350
sequence length 355
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3oA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3oA01
2XMLA 5FXXA 5FP8A 4D6RA 3KV9A 2P5BA 5FZAA 4UF0B 5FYZA 4BU2A 5FZGA 5FZIA 3PUQA 3OPTA 4LITA 5F32A 4DO0A 5FXWA 5FZOB 5A3PA 3N9NA 4C8DA 5FYCA 2YPDA 5FZMA 2W2IA 5E6HA 5FJHA 2YBSA 4QXCA 4V2VA 4Y4RA 5FZ1A 5FZ7A 3PU3A 3LDBA 5FZBA 4EZHA 3UYJA 5A3TA 5F37A 5FV3A 5FZ8A 4GAZA 4BISA 5FZFA 5A7QA 3AVRA 5FY7A 4CSWA 5FPBA 3K3NA 5A7WB 5FP4A 5FPLA 5FYIA 3OPWA 5FPAA 2Q8EA 4CCOA 5FZ9A 5A1FA 2XXZA 3N9QA 5IWFA 5FY0A 5KR7A 3PTRB 5FUNA 4LIUA 3AVSA 3K3OA 3PUSA 5FYTA 5FY5A 3KVAA 4UF0A 5F3GA 2YBPA 4CCLA 5LY1A 5FZCA 2Q8CA 4CCJA 5FBJA 5IVVA 5CEHA 5FZOA 3PU8A 2YU2A 5FZ6A 5IVBA 4QXBA 5FZLA 5F39A 4QX8A 5IVFA 5LY2A 4Y3OA 2YBKA 4IGOA 4XDOA 5A3NA 5FZ3A 5FYHA 4HOOA 3AL5A 4GJYA 5FY8A 2OS2A 4BXFA 4V2WA 5FZKA 3N9PA 5A80A 5FJKA 5FP9A 3N9LA 4QU1A 5FYBA 3PDQA 4QX7A 5A7PA 5FYSA 5A7WA 4DIQA 4QWNA 3KV4A 5FWEA 5A7OA 5FPUA 5F5CA 5FY9A 2XUEA 5FZEA 5F2WA 2WWJA 4GJZA 5F3IA 3AL6A 2GP3A 3DXTA 5F3CA 3N9OA 3RVHA 5FWJA 4TN7A 5FXVA 4D6SA 3ZLIA 5FYVA 1VRBA 5ISLA 2PXJA 4AAPA 4E4HA 4CCKA 5F5IA 5LWBA 3KV6A 5K4LA 5FYYA 2OX0A 5ANQA 4GD4A 2OT7A 3U4SA 3DXUA 3PUAA 5FP3A 2XDVA 4Y33A 5F5AA 2WWUA 4LXLA 4NUBA 4XDPA 2OQ6A 5A1LA 5FYMA 3N9MA 4EZ4A 2GP5A 5F3EA 3PURA 4QXHA 5IVJA 5A7SA 4D6QA 5FXZA 5IVCA 5F2SA 5FY4A 5FPVA 5FZHA 4IGQA 2VD7A 5A7NA 4CUGA 2YU1A 5IVEA 4HONA 4EYUA 3U78A 2OQ7A 5FY1A 5IW0A 3KVBA 3K2OA 4AI9A 4LIVA 5FZ0A 5LW9A 3KV5A 4IGPA 5FZDA 5FYUA 3NJYA 4CCNA 3ZPOA 5FP7A 5IVYA 4CCMA 3LD8A 4URAA 5FUPA 5A3WA 2Q8DA 4ASKA 5FZ4A
chains in the Genus database with same CATH superfamily
2E26A 1IPJA 5ABFA 1ZBA3 4ZS2A 4NMIA 1IG3A 5C2TA 1LESA 3C4WA 1OLMA 3A7MA 1QJX2 2WZR2 2ZZJA 2AXDS 5LG4A 2CGNA 1MACA 2WDQA 1VMFA 1MVEA 3ZYLA 4LUKA 4C91A 4KHZF 3DECA 4YG3A 1FI2A 1ZBE1 4RQPC 1PGW2 3H8RA 4UBHA 2XOMA 4UEMA 5JDBA 3N7KA 4DR3T 2ETEA 5DDJ2 2W46A 1ZNPA 3QCWA 2CEAA 1HXS2 5ANQA 4YSZA 3TLTA 3DF0A 1AL22 2E7AA 2HH7A 2GP5A 4QXKA 5LGTB 1X79A 2IZWA 4CDWC 3AA0B 4TWHA 4A41A 5K9YA 4QX5A 4RR3C 3O1VA 2FBEA 1D1BA 3AJYA 2ZLYA 2KXLA 3PIGA 5J7MA 4TV9E 4BK5A 2F17A 2P2KA 1RUI3 1OPOA 3KV9A 3RC3A 3AFGA 5GLWA 4XUOA 2A6VA 5E16A 5KC5A 1WD3A 1ASJ3 1W6MA 4XF1A 4AR2A 5KXBA 4PFPA 5JWPA 4OMCA 4QXHB 3OUIA 3D82A 4MVTA 3LDKA 5KXCA 3FHAA 5F3GA 4MBQA 5DG1A 3CPZA 1QJFA 3LPGA 4JGZA 3KZ4C 3RFRA 3HNMA 1DDLA 3P6BA 3VZLA 1CD3G 3C7FA 4JEHB 3V56A 5CG9A 2E9XD 4LMFA 1TMF1 2VZTA 1BYHA 3RVHA 1H6YA 1LOAA 4PIZA 3ZFFC 4AXPA 4IEZA 5FOBB 3KGLA 5LWBA 1D0GA 2W91A 4MALA 4Y5SA 2DCFA 4YGEA 3HKEE 4DXTA 4JV4A 2HWE2 3OBZA 5JIUA 4H2AA 1GR3A 4H9OC 1D4M2 5EJZB 4LF6T 1VBA1 4QKBA 3IBMA 2VMIA 1XNRT 3RYKA 2XH6A 5IW0A 3MBWA 5FYUA 4BZ4A 1XNQT 1CVNA 2E5LT 1C8NA 2VCBA 4Z90A 1UOFA 4OI0A 1ZV4X 2MPKA 5FYCA 3FXDB 4BLJA 4YM1A 3KS7A 1MNDA 1AX0A 1G9BA 4BMBA 4WYVA 4N9HA 4B29A 5FPAA 2CGPA 4AI1A 2IXIA 1JZ8A 5FVKA 5C9AB 4E4SA 3GA8A 3AA7B 4O2AE 2HBTA 4CI1B 2KD7A 4GKXA 4NIIA 1OURA 1J84A 2QDNA 3AL5A 5F1RA 2Z4FA 4BQ4A 3I3QA 4J1XA 2YGLA 3UTKA 4FVVA 2P17A 2WNOA 5JR9A 3B69A 1U5ZA 3T8OA 1ZRIA 1FNYA 3RIUC 1NXD1 2HWC1 3RWKX 4Y33A 4ZZ8A 4AIUA 4XFBA 1GWKA 2OQ6A 5CAZA 1SLAA 1YQ8A 4AQSA 1RMU1 3D8CA 3ONJA 2W87A 1UX7A 4IGQA 4P09A 3U78A 2PFWA 1J1TA 4TLGA 3HT1A 1TMF3 3LEKA 4CZZB 5FZAA 3GALA 4P5HA 3AZXA 2D5HA 3D0JA 2V7JA 3I9YA 4R4ZA 4HGAA 2PHUA 4BM8A 2A7AA 4C90A 4M3CE 1UF2C 3ZSJA 1IQAA 3GN5B 3UESA 1VBA3 4BIFA 3O1RA 1U5YA 3M7AA 3KGZA 3CIRA 4GK5E 1JZ4A 3HT2A 4UT5A 2DUPA 2JECA 4HFHA 4A98A 1H8TB 3PLQA 1BEV3 4XJZA 1UY4A 2YG0A 1LHNA 3LK3B 2ZGOA 2LALA 4XUNA 4JI7T 3A7QA 2IVJA 3J9X1 2TNFA 3O1HA 1CZTA 1YJKA 4U2YA 2LLYA 2V5CA 4AOCA 3AMHA 2ZM6T 2WWUA 4R9DA 4R52A 2VUDA 4A6SA 1WBFA 4QB1A 5I8SA 1KDKA 2AGSA 1RVF2 1S55A 3GJBA 1I94T 5FPVA 4ZI2D 4BQ1A 4YT0A 3E5QA 2Y60A 1MEC2 2GMMA 1WUVA 3CWZB 2BP6A 4KBBA 1JU4A 3NZPA 1H2MA 3TWIA 1G7YA 4U31A 5EJ1B 1XNAA 1RUJ2 4B4QA 2QQWA 1LCLA 3UV9A 4UV8B 2B45X 1PGL2 1RMU3 3WF2A 2R30A 2WDRA 5FYTA 5DQWA 2WP9A 1ZA4A 2KA3A 1CZSA 1JU3A 1BR0A 1QJY3 5FMOS 2Z69A 1DQ0A 4HWHA 2PLV3 1A8DA 1E1HB 4Q4X2 1W28A 3KV6A 5H9QA 4IHJE 2E9XC 1QHDA 2YHJA 4GZ9A 2XSAA 3AE5A 3KCYA 2I0MA 1LOEA 4XAAA 2ACXA 3W5NA 5LGNB 2OPKA 3FLPA 5DUXA 1T8BA 1VBB3 1MS0A 2ZX4A 4AEDB 2VVFA 1VAVA 1OFNA 2CWSA 2DCKA 1PVC1 2XZEA 4JI8T 4IGPA 3A8YC 2JDYA 3VHOA 1EPZA 1G9FA 4XFAA 5AQFB 2J1UA 3SKJE 2XASB 2WZIA 3VD7A 1ENQA 1ND3B 3VZMA 3ZYBA 1UIKA 4QWNB 3P7IA 1FX5A 4BCUA 5EK4A 4UELA 3N4MA 1BR4A 3OSDA 1BLZA 3ZYPA 4N43B 3ATGA 1AR62 2WQ4A 3JAFA 1AR72 2ODUA 2KZ7B 2R042 4BDVB 4GYRA 3SEPA 3OF1A 1IS6A 1H9PA 1VBD1 4MXVA 4PHZA 3AA1B 5FYYA 3OJBA 1QXJA 3DUIA 2EALA 4AK3A 3M1HA 1W8OA 4B6XA 1UO9A 3EHKA 1WW7A 4O4JE 4Q1RA 3G6JB 4JGYC 3UGFA 1AYM1 2E2AA 5C8CB 1PO11 1RHI3 3ECQA 4AI9A 3LOBA 2YN6A 3RF1A 1KRIA 2HEWF 1IPKA 2X9WA 2QZ3A 3CJIC 4W8JA 1JYTA 5FKCA 3T2TA 3AYEA 1S0IA 3ZJ1A 1LJ7A 2ZACA 5JVVA 1FNZA 2C26A 3UUXB 1UY2A 2DVAA 2VBBA 1T72A 1EZ3A 1XPWA 3AXDA 2WZ8A 3AZYA 5EQUA 2BYVE 1HV1A 2V5YA 1HR0T 4NWWA 4U2AA 2GK9A 5A3UA 4OLLA 2CDPA 1EV12 1PZ7A 1PVC3 1QJU2 5HCFA 3AC0A 3N9PA 3MEPA 1LENA 3LFMA 2XTLA 4XIKA 4QPYA 4AE2A 1MS8A 4CP9A 5A7OA 2EF6A 3LKJA 3SS1A 3ITQA 3JC6D 3GGLA 4JQRA 2CHNA 2MEV3 5C3RA 4MGKE 2R063 4WNKA 3RQUA 2KINB 3V5UA 2W1WA 5F3EA 2VW2A 1QXRA 4EOZB 2VL8A 5JXIA 3WDWA 3BTAA 2JG9B 5JVDE 4LT5A 4H7LA 1YW0A 4MLOA 3SRZA 1WR0A 2UU8A 4CXWA 4ZI2C 2HEYF 5AFEA 2PFVA 1XNBA 5HCHA 4P9GA 1H7CA 4X6RB 1REFA 5LBFA 2FJEA 1JUIA 2W08A 1UW8A 1YKHB 1GZWA 2LKGA 3JCFA 1ZZCA 4KI5M 5FOJB 5ETWA 3TBDA 3FFQA 3ZVXA 5FL1A 4AXOA 2VMEA 3BQIA 3AXJA 3O12A 1A34A 2UUAT 3EBRA 3MO4A 2DNXA 3G06A 4FQ4A 3RYRA 2VNVA 2HN2A 5FZKA 4Q26A 3S5AA 1OOPA 5FL0A 1VJ2A 2JJ6A 3UGHA 5IYZE 3HMYA 1GOFA 3AMQA 1OEDA 1YQ3A 5I0TA 2HJIA 1DF0A 1JHNA 4K1YA 3VHLA 1LHVA 2PAMA 1R082 4NUBA 1FMD2 2WFF2 4AF9A 2ID4A 1YO8A 1NOVA 1NENA 4G4FA 3M3OA 3B7MA 4YZ3A 5LCYA 2FDIA 3GM8A 3ONLC 3I0QA 4P0BA 2CDOA 4LBOA 2WA4A 5HXCA 5FO9B 1HX8A 1VRH2 2BPA2 3WQBA 5DPNA 5FDBA 1UGOA 3MV01 2G9GA 3EABA 1HJGA 4JTOA 3V0AA 3UYJA 2BNNA 1LOCA 3VKNA 3DKWA 2EHOA 3AM2A 2C9AA 4JLEA 2OV9A 2VO5A 1SHZC 2BNOA 2RV9A 3WQ0A 3RGBA 5FPZA 2E63A 2G9ZA 3FUOA 3I2GA 1JNZA 3E97A 2HPLA 3O1MA 3A22A 2PHLA 4CPBA 4DV7T 1CAWB 1OSGA 3BB6A 2XVGA 2FCTA 2JKXA 4QAWA 1UNBA 3HOBA 3WP4A 3AFKA 4P9LA 2C6SA 5BV6A 4JRLA 2ZGRA 2CPTA 3SKVA 4E2SA 2KNDA 5JAXA 4KG8A 3N7MA 4FPFA 5C9AC 1LKNA 5I0RA 3ZT6A 5E89A 4CUGA 4DRVA 1MIYA 4JKLA 2CXDA 2WMNA 5AQOB 3K2OA 4WBOA 1W0NA 2UXBT 2NW7A 3OGVA 5DZEA 3OBAA 5LEKA 3T2OA 5AVPA 3ZCJA 1CJDA 4P9IA 4QPIA 2PHXA 4O2BE 1W6NA 2ZM2A 2R0FA 4MX3A 2WN2A 3EYPA 1PNGA 4YZ1A 4CN6A 1I3HA 3GHNA 4XAEA 1YKEB 3PJAJ 2B46X 2YDRA 4KBZA 2X66A 4FOVA 2ZKNA 4P0AA 3I3MA 4LNVA 3LA3A 3U37A 2ZMAA 2FMDA 4MHRA 2A6XA 4L2NA 4UFMA 2XHKA 4QGMA 5JPNB 4MGIE 1UK5A 3ZYGA 5IT6A 4OCTA 5FPXA 5CKMA 3POWA 5GONE 4XETA 2E32A 4KU8A 3JC6C 1XMQT 1ZZ6A 4O4LE 5T54A 2LRLA 3ETPA 4J6GA 5HPOA 5HCMA 2B7YA 2UXXB 2V7IA 3JZVA 4LHKA 4YSFA 1K5JA 3SH4A 5TSWA 2GC2A 1OQDA 1HTJF 1H8TC 3USUB 1G8XA 4HPKA 3ILFA 3PMEA 4CP0A 4DO0A 2UWBA 3ZO0B 3HJRA 1MZ6A 2YBSA 4AFMA 3PVOA 4U3CA 2CAVA 2R1BA 4QB6A 1KJLA 3VKFC 5FYIA 1S0EA 3GNEA 5JLVA 2WNVC 4CN4A 2WQ8A 5LA9A 4COWA 4TNWA 4EE2A 1XE7A 2PQQA 1D0ZA 2BVMA 3RYHE 4QX7A 4M01A 2RMU1 4KMCA 2OZJA 1R8IA 2HWC2 4YW7A 2VOWA 3CNAA 2RS31 3KM5A 1REEA 3OGJA 3FMGA 4KU7A 1V70A 2SPCA 1GWLA 1XYPA 4HZFA 4D6QA 5IVCA 1SQ4A 3HD8B 3TEWA 3AE7A 1NX9A 4N78D 2GC3A 4QQOA 4GWNA 1OQEA 3PV0F 1XJAA 3ZMNA 2WUHA 3ACGA 5L9RA 4X6QB 4Q0SA 1WFDA 4BU2A 4SLIA 3RZKA 2VASA 3MHZA 4B4RA 2Y8DA 3I3EA 3KT7A 1YFXA 3MI8A 5J96B 1VMJA 1Y3TA 1TME1 4QX0A 4CI3B 1ULFA 2OUHA 2UWCA 2QVSB 3ZFGB 2GMEA 3NO8A 4AEDC 3I59B 4NRMA 2WN3A 1RUOA 4MHCA 1AR81 5L3CB 5FY8A 1Y4WA 4RGGA 2V09A 3TEXA 4HWFA 5JDQA 1QU0A 4IEPA 2Y6GA 1SE7A 3EAMA 2GNTA 4B3TT 1C3HA 3MLLA 1K42A 4INDA 2X09A 1ND3C 2A6YA 3A4UA 2JWPA 4WM7A 3ZYFA 4HTEA 3A23A 4AQYT 2JE8A 3AMMA 1ZZBA 1ALYA 5DABA 5GM0A 5A7SA 2XG3A 2G0UA 1KITA 1E5HA 2ZOEB 1XYNA 4RD7A 4N43C 5A7NA 4XMAA 1W8NA 4M0HA 5IFTA 3VBSB 1ULCA 4XQWA 3HBZA 2B4KA 4D8MA 4PDWB 3OEAA 5LK7B 2ZM0A 1IKQA 1ZRDA 1SCSA 4UOJA 1AVBA 4IDQA 5BNPA 1XSRA 3FBYA 2D6OX 4UF0B 4FOYA 1F4AA 1SPPB 4PI0A 4PT6A 2VC9A 3HVDA 1N47A 4YPJA 3RZHA 5J1GA 1LU1A 1O5UA 3I2FA 3TLSA 1MS1A 4NAMA 3O1JA 2ZA9A 3N9QA 1ZX5A 4D0QA 4LBKA 1BJQA 2WNUA 2AUYA 3B5LB 1IKPA 2R0HA 1MMAA 2NTYA 4AGVA 1V00A 4PJYA 4YGDA 5A80A 3IT8A 5FYBA 4R8HA 1O3TA 5LBEA 1HG5A 3I1AA 5FPUA 3AYAA 5CVRA 5KDMC 3OGGA 5I0UA 3B3QE 3VL8A 1SDDB 4LA2A 3S57A 2FDFA 5IK7A 1IJ5A 4ORFA 1U5IA 4UFKA 3QNUA 4KP3C 2P4EA 2BOJA 5GZDA 3C7EA 1RIRA 1IBLT 1ZOYA 4OI1A 3MF6A 4P14A 1AR83 2JE9A 1SDWA 1M4WA 2WWSA 3AK0A 4XIOA 2VR4A 2BKOA 1W09A 3UK9A 3VLBB 2XM2A 1VAMA 2JE7A 3BOWA 3GMIA 2QA7A 2D0UA 3I4IA 4RS5A 4GWIA 1OUSA 1MNEA 2YGMA 4QXBB 1LTEA 5B4XA 1DGWX 4RL7A 3PU3A 4I01A 3LEMA 4YHJA 4W50A 2A3XA 3QH6A 1KEXA 5AQRB 1IZNB 1LRZA 5CFDA 1FYUA 1NLRA 2VB6A 3UU3A 2BGOA 3NRUA 2VMGA 1V9U2 1FOD1 5T55A 3NBXX 2XB6C 5FK7A 5HXEA 4BPZA 2K9ZA 2QQVA 3JB8A 2X10A 1LNSA 5A3OA 2Q9QB 4YRDA 2XBO1 3INAA 2AZ5A 5DAPA 1DLLA 2I74A 3MW3A 2ARBA 1JOPA 1J59A 4ZHQE 3WD5A 3THCA 3JD71 1AYM2 1PO12 5C4WB 4CU9A 5FO8B 4DNDA 3RYFE 4ZPIA 4NVPA 3H42B 4BLIA 1EUUA 5LJNA 3EDVA 4QHBA 2JRKA 2DLRA 1OEDB 3FX3A 4DNYA 4HSJA 1WCUA 1HW5A 2VMDA 2VULA 4YVSB 4K7JA 3GF6A 2WDVA 4U7IA 3PMSA 3A5XA 3DJBA 2GC0A 1WZXA 2VTXJ 2FZ1A 3PUVF 4AWDA 4DR5T 4UFIA 2FJAA 4PJJA 1VALA 4RQPA 5CKNA 4KGGA 4JGZC 1Q8QA 2JDPA 3DGTA 3WR0A 3C98B 2ZGSA 4AI2A 3S6PA 3NWIA 5JMOA 1N1VA 1CGPA 3THPA 1YQCA 3RZGA 4JBWF 3V0AB 1O4ZA 2WAOA 3CKHA 3BIWE 4MGYE 5LGUB 4RR3A 2EHOB 4GWJA 5D21A 2ARCA 1L7RA 5AQIB 2RP4A 2VWAA 2WS92 4XXAA 3WV6A 2UYAA 3H0OA 4CXXA 4P9WA 3VBRA 4IV3B 5CB4E 4UFJA 2LSKA 3WG3A 2OKXA 3PUIA 1MS5A 4PBOA 5JXGA 1XNDA 3U10A 4XJAA 1YXWA 2A73B 1B09A 5CFBA 4ZXKA 1VE0A 1SMVA 1W2NA 3PJAA 4GMP1 2XBO3 2XQAA 3ZT5A 3OTFA 2ZKLA 1R093 2GNBA 2VQAA 4C8DA 3VHPA 3MUY1 2RR13 1C5HA 5A3TA 4I55E 2ZMNA 2ZEXA 2Q8EA 1WMXA 4DIDB 2AEYA 4H63H 2RDNA 2ZEWA 5BMVE 3NRXA 3OBTA 3WAJA 4PLMA 2YBKA 4NE9A 2IC1A 2VVNA 2DBIA 5JOXA 2W0XA 1W8UA 5FWEA 5KXDA 5LRSA 4QPIB 4YJ2E 2EAAA 5FKBA 4YFWA 2VJXA 1W6NB 4BHPA 4YSYA 1K12A 4AAPA 4AQGA 4GOUA 4E2QA 2HBUA 3A21A 1X9BA 3BALA 3MGUA 3FZ3A 4I50E 3N36A 2PHDA 4EWDA 1KXGA 1QDOA 4K8RB 1JODA 4ZKTB 1ZRFA 1N34T 3TN93 4FAGA 2H6BA 3CIHA 3T1LA 2W66A 2VBDA 5FZDA 3AKPA 1X33A 4JC1A 4SBVA 4X8PA 4CDQB 3PDYA 4ATFA 1Z7S2 1W0AA 4AVSA 1H8VA 4BB3A 2QZ2A 1I6ZA 1QUUA 1DQ4A 2FHRA 2GH8A 3N2KE 4K0KT 1BBT2 4HFEA 2JG8A 4DRRA 1CAXA 3OY8B 2FCUA 5KHHA 2YROA 3WEZA 1VPHA 4IDOA 1NXMA 2Z79A 3RIUA 4E4ZA 1Q3EA 2WT0A 2VQFT 3RJ2X 3IM0A 3K4ZA 1JZ5A 3WF0A 3VZOA 3JQXA 2XONA 1K45A 3P50A 2OYZA 3LGRA 3RYCE 5IYYA 5JRCA 4IDZA 4YM2A 3C50A 3G7DA 4AHYA 1PK6A 1SBEA 1D4VB 1GFF2 1GQEA 4KWJA 5KHKA 4NJ4A 4M3CA 3J26N 3BQKA 2Q9QD 4ASMB 4MFRA 1KS4A 4LLFA 4F6RC 1JH5A 1OD5A 3R0RA 4IW3A 4BK4A 5ACA1 5AFBA 1X9TA 2VKHA 3IKWA 5EFUA 1LHWA 2VBPA 5EPAA 4LHNA 4YW4A 4JHTA 5KHJA 2VKJA 5ABGA 4F3JA 4NIAA 5LG3A 2B8MA 1GOGA 5A1FA 5FREA 4JI3T 4LO7A 3OCPA 4K3UA 5CEHA 2CWOA 3WF3A 5FZLA 2BVLA 2XQYA 4L9BA 2WLQA 1T6BX 5FYHA 2GN7A 4ILCA 5J1XA 5EV7A 4LE4A 4OUSA 3TNQA 1J58A 4CCDA 3QUJA 3AMPA 2FDGA 4MADA 4DEVA 2CNAA 1OLRA 2YDSA 5DZGA 3RYIE 2XWJB 3LEGA 2WSSV 3AE6A 1H0BA 2YV8A 3ES4A 2J4GA 3F2ZA 4YJ3E 1NUKA 2QQLA 2RDRA 1L0VA 3ZFGC 4X20E 3ZKUA 1QSDA 2W1SA 2KMFA 4CCCA 2Q5TA 5F3JA 3EDUA 1CQ9A 3WW2A 3I49A 1YD8G 3O14A 4TV8E 2EHOD 4K0UA 5EWSA 4LO8A 1O3XA 3P1IA 3E08A 2A72A 3O7OA 2EA7A 2R6GF 1Q8VA 5FZMA 1LULA 1HCIA 1GUIA 4UXAA 1NCRB 1K5MB 1LVKA 4H3WA 2CBIA 4CPBD 3R4UA 1F9KA 1KD7A 3KVAA 2J42A 2V4VA 4DXSA 4OHYA 3LG7A 2AENA 3PU8A 3ES1A 5A32A 3WY6A 4IGOA 4XDOA 5JR7B 4TYSA 3VBSC 2RMU2 4PDWC 2E9XA 1F8VA 4WV8A 2RS32 3HWJA 4QQ2A 3V65A 5AQKB 1Y9GA 2JDHA 3ACLA 5FXVA 3UL2A 2VU9A 5AC93 1YCIA 1NE4A 4AVVA 3U4SA 3NJXA 2Q1ZB 5JIAA 3AP6A 4LEJA 3WX5A 4JVAA 1DIWA 4L0RA 2W1UA 1IJ6A 5L4EA 1UD1A 1XDPA 2WT1A 2NPIA 2D40A 2WNEA 2YB7A 2R071 4DEQA 4DVDA 5JCTA 2WZR1 1RUG2 1FPN2 4ZU4A 1W39A 1RXGA 2X67A 5FZ1A 4R9CA 4CA9A 4E2GA 4EN7B 1TME2 4ISQA 2ZCWA 3OPWA 1AXKA 1PGSA 3Q8FA 3ZSTA 4OHFA 1AJOA 4YM3A 4IUGA 1T98A 3ZN1B 1NQJA 2A6ZA 2N9DA 3CBNA 1HXS1 2NWBA 3WT3A 1GNHA 1OF4A 2BW8A 4QU1A 1O3RA 3FL7A 2MYSA 4ZU5A 2XLAA 4BA9A 3ZT7A 4ET7A 1HX6A 2YEVC 1VBE3 1NLQA 4MLKA 3RRDA 1QNYA 2B1EA 1PO21 2UUCT 5LBQB 5A3LA 1BQPA 5C70A 4K1ZA 5J2TE 3CJIA 1W8HA 5L9BA 5FMNA 4WZXA 4DUXA 1Z0PA 2VOXA 4U2ZA 4KH9A 3EI0A 1UWWA 4XTMA 2Q8DA 1UYZA 2W95A 4OFGA 3WUCA 3BODA 1JZ7A 3N5LA 1ST8A 5LB6A 2Q9QC 1FMWA 4B1LA 5F9TA 5DAXA 3B01A 4XUTA 2JMKA 1DYPA 4XCBA 4AHZA 4COYA 2VZPA 1ODMA 4CSWA 1RTVA 4ARYA 1H2NA 4UW4A 2BS2A 5C4WC 2ZGKA 2Q8CA 4H9RC 5L4HA 2K0GA 2BNMA 4PW8A 3OUHA 4QMAA 2NW8A 4LO4B 3SWHA 4QDSA 4LOSA 3UUNA 1JN2P 1QJX3 3MW2A 2WZR3 4WZFA 4Y22A 1BZWA 3U4XA 3WDVA 1OEDC 2K24A 3J7NA 2DCJA 4DR1T 2X0LB 5C5UA 4YVSC 2RJKA 2PA7A 1D4M1 2V7KA 4HWIB 4G2AA 3DYPA 5BNOA 5GZCA 5GKAC 1QQP2 1N36T 3WHUA 5L3EB 5GLTA 4HBNA 5IVEA 3O1UA 5DDJ3 1QKQA 4O7XA 1HXS3 3R4DB 5JOYA 3RRWA 1CPMA 1AL23 1GZ9A 2XMLA 1SFPA 2NW9A 4XW3A 4DOUA 2KR2A 3IHRA 4IXLA 4J1WA 2B76A 4LF9T 2D9DA 2EHOC 3IPVB 4FFGA 4EB6E 4AKHA 3KBTA 5AQSB 4W65A 3VBRB 5FUNA 1CAVB 1FOD2 4IV3C 2VNRA 2XJSA 5IVVA 3FHIB 2HYXA 2JDAA 5BPXA 2Y34A 3J8F1 2D3SA 3LQCA 3AKRA 1W99A 2F4VT 3ZXKA 2XVKA 1NEKA 1XNCA 3KT4A 4RFRB 5EYXA 4AVBA 3MFAA 4FQZA 3RQ0A 3W20A 4HT1T 3AAEB 3I3DA 2JICA 3T08A 1XNTA 1AYN1 4FOWA 3D4KA 2QQNA 3JD72 4ILAA 1XZYA 5C3OA 5DZFA 4I0BA 3KF5A 2RS52 4D7YA 1NYWA 1OXZA 4LKFA 3RH3A 3NNFA 3NV1A 4NHKA 1UX4A 3JU9A 2R49A 4IE0A 1HN1A 1HV0A 4QPIC 2A9UA 4XF0A 3OB8A 2PHTA 2HWE3 2QQUA 3AYDA 3UJQA 4DR2T 1D4M3 1W2UA 4OMDA 1YFYA 4YW5A 3TB0A 1QWRA 5GALA 2P6CA 3LWCA 1G8WA 5AQUB 2C5IT 4UWDA 1PZ9A 2H3RA 3E1F1 2C5KT 4FPJA 1GQHA 1GYKA 3ZN4A 1S0GA 2HWB1 2HYKA 5IVBA 1DQ5A 4JDNA 3AB0A 4ZY9A 4PFOA 3LDQB 5A70A 3ZXJA 2WJSA 4JQTA 2ZS6B 5FYSA 1PNFA 5C71A 5EZYE 2AEZA 4CDQC 2JD9A 4MSVA 4BQWA 5IHYA 1URXA 5C9AA 4GYSA 4GKYA 1RVF1 1O59A 5HI0A 1SCRA 5K4LA 5LB7B 3RHWA 1H6XA 1MEC1 1SACA 2L8KA 1D2QA 5CA6A 3KFWX 2HLEA 3FLRA 4UW3A 3IMMA 4FFFA 1XB9A 3WZ1A 5BNQA 1RJ7A 3H1MA 2HH9A 4LKDA 2ZX1A 3NJYA 3AE1A 2G1MA 4IE6A 4DR6T 3AAIA 5FMCA 3MK7C 1SA0E 3WW1A 3I2DA 3S5QA 3VBFB 3AEEA 1VB2A 2UXCT 1H1MA 2WL1A 3QACA 1PK6B 1US7B 1G86A 2A5ZA 2Y33A 3VBOB 4DXZA 5FZ6A 3ILRA 5AFUL 2GMPA 3M3EA 4NWVA 3BK9A 1QOSA 4KMQA 4WBNE 1O91A 2XQRA 3GN5A 3IDAA 1PM7A 2R1DA 2DU0A 1MMNA 4ADZA 1VBC1 3U3IA 3SCGA 3B00A 2WKKA 1PIV1 4OUMA 2ZABA 1HB2A 3PJYA 3USSA 1WW4A 4UI9L 1LKXA 5JUVA 1PMIA 1O8SA 1SLIA 4YZ5A 4HFIA 1R64A 4QQLA 3N2OA 4PNIA 5AQHB 1YI7A 3VKLA 4U74A 4N53B 4X65T 4D6RA 2P5BA 3DCQA 3VZKA 2C5JA 2VL4A 5AQNB 2Q1MA 5JOWA 1OA3A 5IATA 3UQ4A 4EZHA 5FV3A 4UW5A 4XUQA 4P00B 2NP9A 1AR61 3PUYF 1LU2A 3I2KA 4CCOA 3OG2A 3ZXFA 5H6RB 1JS9A 4HETA 1IOAA 4IEYA 2E33A 3B9CA 4ZHNA 1RUJ3 1RGSA 4YGCA 4ILUA 1OI6A 4JUYA 4LLOA 5LBBA 2D98A 1KQRA 4TZ4C 3AECA 4AQFA 2Z6EA 2QDRA 5LBMA 1O4YA 4NPLA 2BBJA 4WM7C 3RKOA 1DGRN 4EIWA 1NCRC 3CQXC 3TEYA 2CRBA 4CP1A 2WCAA 3ZC1A 2E53A 3P8CD 4X1KE 4Q4X3 4C0HA 4BXSV 1NA1B 2DTWA 1SFNA 2ZXQA 4CCNA 4PK6A 1TVGA 2XL7A 4ASKA 2LS6A 3R4SA 3VD3A 4MZUA 4ES8A 2PN5A 3FZHB 1YQ2A 3D3AA 3T30A 4LO5B 3RC8A 1E5SA 4FPOB 2YKSA 1UOBA 5AQMB 4AEDA 5BY5A 5BXXA 4HLTA 2XSBA 5H9PA 1TQ5A 1ZZ7A 1QJU1 1DBNA 2VVEA 5IK5A 4IETA 4WM8B 3DTOA 5LY2A 1ND3A 1W3XA 1OKOA 2BV4A 4I02A 4QWNA 4AHWA 2Y6FA 1YFWA 2A6WA 1ZHCA 4YW2A 2XPKA 4N43A 4XEZA 4LMLA 2XJVA 1AR73 2NLRA 4Q4Y2 2R043 4B3NA 1VIWB 4D7SA 4CU8A 3J7Yq 4W6YA 3ILNA 4PLOA 1MS3A 3CL1A 4ANJA 1V6IA 4QQPA 3NNGA 4N90A 1DZTA 2KWHA 1FXZA 4XZCA 4I0UA 2WB5A 5CZKA 3DV8A 2HKXA 3CMLA 3Q8CA 2B42B 1SBFA 5JQGE 5EP9A 2XJPA 1A78A 5C8CA 4DB5A 2VQTA 3B57A 4ZEYA 3AP7A 3FWEA 2C1FA 3L2HA 1MQTB 1QJZA 5FMOL 1D7PM 2D93A 4OYKA 1CZVA 2G4IA 1KFUL 1R1A2 4PF5A 5F39A 2FUPA 1HQNA 5DMYA 3QOFA 1HS7A 1EAH1 2BRTA 1JYIA 5GLUA 5M0TA 3UFGA 4F7ZA 4OZXA 2XKOA 1FMD1 5FY9A 3RQWA 4H55A 4CDUB 4HWDA 3CX8B 2XQ6A 1EV13 4UVBB 2LUWA 2NM1A 4LFCT 1KEYA 1QJU3 3PUAA 1HG2A 2W0GA 3WP5A 4HK9A 1VRH1 3D0SA 1E57A 1Y7BA 3ZMSB 3D6EA 4E8DA 1UUSA 4HEAA 4GMP0 2R072 1D0XA 1JYWA 2FZ2A 5LW9A 2VZ3A 4M0NA 2W67A 2RM21 2X9YA 2R7EB 5FP7A 4Y22B 5L2LA 3AEGA 2CAUA 4DV6T 3FE5A 1Q5OA 5FZOB 4E4DX 2EXJA 1UU4A 4ISTA 5BNOB 1NZIA 2JG9A 2VGDA 4AL9A 4EJRA 5F37A 2ODVA 5F6KA 3AVRA 4AQ2A 4TWDA 4P9YA 5KWRA 3JADA 3BN6A 2XM1A 4IT4A 3R84B 2VCCA 4Q4V2 1NZCA 1KNZA 2VZRA 5T5OA 2W4XA 2VUJA 2ZEZA 3L3PA 4GJYA 4KX6A 4DY3A 4Y20B 3N3HA 4KQ7A 3ZOIA 2NQYA 3ZR5A 4QM9A 3U07A 1PO22 5A33A 2JQKA 1MZEA 4A42A 5BNNB 3MACA 4GD4A 4HKLA 4C1XA 2XDVA 2IXHA 2XAJB 3VBRC 4LBMA 3ACIA 4HFDA 3O9XA 3QLQA 2IAKA 4A56A 5C33A 2DYCA 3U14A 5DXDA 1A8MA 3GBFA 4M3CF 3KVBA 3KV5A 1FATA 4U7YA 2DWKA 1R083 1FMD3 1US2A 2I2SA 3ZFEB 2WFF3 3WG1A 4AFCA 1HFAA 5HEHA 1H9WA 3EB7A 4I09A 1YIFA 3WCRA 3OPCA 4CI2B 3KLSA 1VRH3 5FPLA 1C1FA 5AQPB 3C8XA 3HKDE 3EJKA 1IGOA 5L3GB 4S2GA 4CCJA 2DBNA 4CYDA 4OQ9A 5KC6A 4A5XA 3L8RA 2BJSA 4I3PA 1F31A 3UUMA 3AEDA 4Z91A 1CPNA 4G63A 1RUC1 2CL2A 4TN7A 3FC0A 5FYVA 2PXJA 3CQOA 4A3XA 4UFLA 3VBUB 3AX4A 1S0DA 2SBAA 2VOKA 1ZBE3 3W21A 3WQ1A 1M06G 3FN9A 1CAWA 4UW6A 2NOXA 4DUYT 3ETVA 3ZYRA 3E0ZA 4FPLA 4CRQA 4WVMA 4H9PC 1POV1 3ORJA 1SLCA 2HEVF 5A3WA 1V9DA 5HWYA 3CDZB 1V6LA 3HBKA 1WA4A 1YIPA 2O8QA 2IXLA 4N7UA 4CEYB 4Q0QA 1OWAA 2JG8C 5CFCA 2XXZA 5APAA 1BVP1 4BJNA 1Z8UA 2CY6A 3J8F2 2IUWA 3WW4A 1OPMA 5A6ZA 4KWLA 4A3ZA 4AKGA 2QNKA 2VZ1A 5DUUA 3F31A 3PE0A 3IMNA 4LK6A 3ZMZB 4L8QA 2H6CA 1WYCA 1AYN2 3TRSB 3VD4A 1NCQA 4GALA 4X66T 4B3MT 3URFA 3VBFC 2NZ9A 3MLJA 5HXVA 1PK6C 4ZOLE 2Y6XA 1UMZA 2WO1A 5JI7A 4ZONA 4K9SA 3ZPYA 4HN9A 5FBZA 3EO6A 3WW3A 2VM9A 1LGCA 3ZN5A 5KXJA 5HCJA 3ZPOA 1DZRA 2UWAA 4Z1VA 1ZP0A 2A2FX 4DR4T 2DWGA 1Q8OA 2YC2A 4Y1ZA 3LCPA 1DZQA 3VKHA 4NPRA 3N35A 2ZTNA 3ON7A 4RYDA 5C8WA 5KX5E 1YHFA 4AAXA 3USUA 1XMOT 2HWB2 4P9JA 3T0BA 4BMEA 4MXWB 1OBNA 4QX8A 3IWZA 1RUH2 4V1PA 1F15A 2XPJA 2P6HA 4KGQA 4XURA 4N53C 5J36A 1PMHX 4LOTA 1CUNA 2BG9E 2WBKA 1DU2A 1QH6A 3UKNA 5FK8A 4QD2A 1C8M1 2D6NA 2PJQA 4IERA 2C9KA 3WF1A 3BTYA 4YW3A 2V73A 4ZI7E 2EIBA 1OT5A 2SLIA 3KD4A 1L7LA 1J3QA 3C4ZA 2KLQA 4EV6A 2HWC3 2WA3A 2YU1A 2VK9A 3T0DA 3UULA 3K75B 5LEJA 4MHUA 5FY1A 5AQGB 1LODA 3M3CA 4Q4W2 1NG0A 4Q0UA 1UYPA 1AUYA 5L47A 3SH5A 5FZIA 2YMZA 2XJQA 5FLIA 2DF7A 3X1DA 4IV1A 3SC7X 2ADDA 2GZWA 3VGIA 3H7YA 4B3RT 4XFHA 3KINB 3NVOA 3K3NA 1G9CA 3WP6A 4FPEA 2WZPP 3I2OA 4IL9A 1UURA 1TG7A 3C7HA 1DFQA 4LHLA 1FJGT 3BIEA 2KT9A 5C3QA 1NA1C 2YYOA 3B02A 4MOAA 3OEBA 1HRI1 5A3NA 3DPRB 4LUMA 5H6QB 4H9QC 1VBC2 3AL6A 3DXTA 1CAUB 1PIV2 4QKNA 3ZFGA 3ZKYA 3GJAA 3I59A 3UU4A 2W61A 3WDYA 2VUAA 5KBFA 1W0OA 1OQ1A 2ZGTA 1W2AX 2WC2A 4WM8C 4PK4A 3I2HA 1JUHA 1XNKA 3Q9OA 4HFSA 3SH3A 5IVYA 2BU9A 1WCRA 2V7LA 1NAFA 4RHV2 4Z8BA 5G05L 4DQAA 5LZ6A 2Y0OA 4MO3M 4XHBA 1ND2A 2ZX2A 2C5DA 3OJAA 4E7SA 1H2LA 3NV3A 2VVSA 4DV4T 1DLCA 1F2NA 1V9U1 4Q0PA 5H9SA 2QQIA 4XDQA 3VBSA 3AEFA 2ORXA 1MPXA 1LAJA 2VQUA 3J7LA 4PDWA 4L92A 2NN8A 4UF0A 1SPPA 1PMJX 5FBJA 2YU2A 3I0OA 1WMDA 2XQ8A 1W90A 2D6PA 5B2GB 4DIQA 2W39A 3THTA 4P5YA 3RYPA 2OXBA 2YY1A 5JPMB 4N8MA 5CNAA 1HDKA 1SLBA 3HA4A 2ZMKA 2B5HA 3NKZA 2EIEA 3H3MA 2ZPXA 3IN9A 4BQXA 1J1JA 4QH1A 3BI3A 4NHLA 2D6KA 2CWMA 1LEMA 2V7MA 1RITA 3S0MA 2W47A 3OKQA 4PQ9A 1Q8PA 4CDUC 1GNZA 3EUHA 1Z0HA 5E6HA 3UT5E 4X5TA 2QVAA 5BR8T 4HMZA 3RRCA 3O4XE 4Q25A 2I45A 4LIUA 4LF7T 4TTGA 3WAKA 2DVDA 4GKJT 2AR6A 4M00A 3P5BA 2CGOA 5CGMA 4QXBA 5IVFA 3MKDA 2UU9T 3UT0A 2EIDA 2WS91 5F2WA 2QFEA 3VD5A 5I0DA 1WMEA 2CHOA 5BNOC 1O6UA 1MS9A 3UUBA 3IDCB 3ABZA 1RUD1 3NV4A 2HWF1 5IK8A 1DG6A 2FD8A 3DL3A 2E7QA 2QQJA 4CUCA 4CU7A 1VBD3 3GWHA 2D2SA 4LF5T 2UY8A 2Q9QA 2P34A 4FI9A 4YZ2A 1C1LA 1UZYA 1UY1A 2H88A 1SHWB 5A33B 2X9XA 5CJ5A 1AYM3 4EN8B 1PO13 5E88A 1H2KA 4DMVA 3BVCA 4UFHA 5C4WA 1COV1 2HWD1 2K46A 2YK0A 4KBMB 5JREA 5BNNC 1S0JA 3Q8AA 4Q29A 2ORZA 1G73A 5HV4A 1HRV1 4OK0A 1US3A 3O0VA 1VAKA 2JB8A 4ERRA 4IEWA 3VBHB 4BIOA 3OYXA 4AI8A 3UNPA 1OA2A 1EAH2 1N1SA 4YVSA 3CVRA 4S2FA 1D2SA 5FZ3A 1W8ZA 4UAPA 4W6XA 4A7YA 2YINA 3ZFEC 4JEUB 1NE6A 4EN9B 3E5UA 2VG9A 2XUEA 5FZEA 2IXKA 4HK8A 1XU1A 4BJMA 1PM4A 2UXDT 4FAHA 4Y5TA 2NTXA 1F35A 4HVRA 1NAEA 3HQXA 2VCMA 1HKDA 3KSCA 4AI6A 2RM22 3Q2MA 3LZZA 5FIXA 4AGRA 2W5FA 2IMLA 1HIXA 1Z7S1 1MIVA 4P1NA 2WS93 2YXSA 4AEJA 3HNYM 4AI3A 2D3PA 4TN7B 3RI9A 3P4PA 3NKTA 3WCSA 3QB5K 2IHR1 1BBT1 5AQTB 4IV3A 5E1RA 2WFPA 1RUE2 4IGUA 2KWIB 1RL3A 4AKIA 4LF8T 4QXCA 2PHRA 3VBUC 2LSYA 1O4TA 2ZAHA 3K48A 5DAVA 5A7WB 2FBWA 2WWVA 5IWFA 3OYWB 3E5XA 1O3SA 3TLVA 3U75A 4C0BA 3RIFA 4Q5OA 4IEUA 4WVMB 3WXPA 4ZXLA 3POSA 5CISA 4GK0E 1FEWA 3ZEFB 1UQXA 4R9AA 4Y3OA 1VP6A 1W2TA 2B9VA 2JDNA 4XJUA 1DQ1A 1DGRA 5M4YA 1W9SA 2E5VA 4GB31 3OOXA 3PUGA 1OXCA 1G9AA 1RUF1 4XBLA 1JZ3A 1UX5A 4AKLA 2WAAA 3SEEA 3GZAA 1WLCA 5CFCB 4MGZE 2ES3A 1YI9A 4CEYC 1HB3A 2Y8KA 4DBQA 2VMFA 2K3WA 3WQ7A 3F57A 3UKVA 3AMNA 3ESLA 4FPKA 1ZBA1 1GZCA 1EPWA 1HQLA 4A97A 1W0BA 1GQGA 5L3FB 4JHZA 2ILMA 4IIJE 3J9SA 3OD4A 4FXKB 1Y64B 1QLBA 1X36A 4HG6B 1NCQB 1Q43A 2AREA 3VDAA 1ZRRA 2CHHA 3U1XA 4L99A 3ETUA 3ZKRA 4EWAA 4CUAA 1BVVA 1N1TA 3TNPB 2WINB 2BFUL 4YNIA 2ZHMA 4CDQA 2VQET 5K0UB 5FRAA 1Z7S3 1IS3A 3AZVA 3NJZA 1W6OB 1LB2A 5A7PA 1I6XA 1RUC2 2CXFA 2Y6JA 3ZDSA 1YYNA 1IZ3A 5I8YA 1JMUB 3ZSLA 4H14A 2PELA 4OI4A 2BS3A 3KWVA 3WNOA 1AXZA 3OY8A 5LK5A 3VB9A 2GU9A 3ZIXA 2J1RA 1VRBA 3KBUA 3LBXB 2XKPA 3VKGA 2NP0A 2VECA 1OMIA 1ZYBA 3PURA 1IPSA 3PUWF 1RUI1 3WLUA 4QX8B 3EHZA 1UCXA 1BK1A 4CE8A 3SFEA 1B7TA 1ASJ1 3FFZA 4P02B 1WCQA 3K4DA 1HLCA 4QH4A 2DVGA 4YVWB 3RGLA 4YTPA 3FUQA 1XSQA 1APNA 3LJCA 1WW6A 1W0PA 2Y38A 3MUZ1 4GULA 4CZSA 4L5GA 2Q1FA 4A6OA 2XJ7A 4TX5A 4LR4A 2X51A 4V2WA 3C7GA 4S2HA 4AQFC 1RINA 1F5JA 4EROA 1ONAA 3POIA 2LOPA 4IV1B 1WCDJ 1E2AA 3NAPB 3C7OA 3H50A 3C3VA 1OD3A 3ZYMA 1UKRA 1DQ2A 2IFRA 3SMHA 3H3ZA 5JDGA 1PVXA 1OH4A 1NY72 3CZJA 2BQPA 4ZXEA 5DN2A 4EWEA 1RJ8A 3POGA 2PTMA 3KHCA 5L36A 1W03A 1RUG1 3B9IA 1FPN1 3HQUA 5KMGP 3DPRC 3P3NA 4MGQA 1MR5A 4HN0A 4L9IA 2ET1A 3RMXA 3JBG2 5T52A 2X0YA 4LTAA 2MOZA 5JDLA 4XF3A 2QE3A 2XHNA 2F4PA 3AKSA 4GAZA 3T1HT 3BUCA 1DCSA 4NN0A 4NPPA 4DS0A 2BERA 4Y26A 4HFBA 1AZDA 2RDSA 4GH4B 1QMJA 5CA0E 2P3IA 1IBMT 2IC9A 5HEUA 1UU5A 3BPSA 1JNRA 4CUBA 4E7ZA 1N3OA 1PX4A 3UJOA 3PUHA 1NCRA 3J7MA 2GNMA 4L0PA 2D44A 1K5MA 1S94A 3CX6B 1ND2B 3HKBE 2WYSA 1JYVA 2RJLA 4PQQA 3AE8A 3O0WA 1C8M2 4XPVA 1ACCA 4XC9A 2NMOA 5HYAA 4B8EA 4FSJA 2IWGB 1YC61 3ZX7A 4NIQA 1XOYA 2RMU3 5BYNA 4OYJA 1WWYA 4DV5T 1W8TA 3O1SA 3PUZF 1I1EA 5IVJA 4CDXB 2RS33 3LK42 2EXHA 1BMV2 4D69A 2VAUA 2P1BA 2WSUA 4JI4T 4G3YC 1U5XA 3VU7H 3FHQA 2F4LA 2MAWA 1Y43B 1AX2A 3QD6A 5C8CC 4YW6A 3LDBA 5FZBA 1VOMA 4FFIA 4AISA 3GBWA 3WDTA 3IDBB 1O7FA 4Z82A 4WZCA 1M62A 1BEV1 3K3OA 4XAXB 3SLIA 1S2EA 1HRI2 1RUG3 5GZGA 1FPN3 4PIXA 2AE9A 2WMOA 4Z07A 1IS5A 5I0SA 1CN1A 3JXSA 5FO7B 1TME3 3JQWA 1N33T 4LJHA 5HXSA 4O8SA 1LGNA 1QQP1 3P4RA 3CO2A 2BBHA 1IQDC 1V6KA 4QDRA 3IAQA 4WVVA 4WVWA 4GIWA 1JYXA 1O5LA 3HQRA 3C4XA 4XBFB 4LFBT 2YPJA 3CK6A 3APBA 1DYOA 5FP3A 2YC0A 4NXMT 5HXRA 4TLFA 4U33A 3ANWA 3ZXDA 5FQ0B 3B94A 5AQQB 2ZHLA 5C5TA 2JIJA 1YUDA 4XACA 3H8XA 2WR9A 2WSVA 5T5PA 1YWKA 4EGWA 3MFCA 2W63A 4A45A 3NQHA 2FJDA 3MF9A 4C1WA 1CHUA 3ZMVB 5JXJA 3GHMA 2Y64A 4B1MA 1KFXL 3FZLB 3KDSE 2EXKA 1SLLA 2JG9C 4EV0A 2IIUA 2Q4SA 2YPDA 3PUXF 3M70A 4TZDA 2B39A 4HVQA 2UURA 1QJY1 3ME2A 1XYOA 4EN6B 2PLV1 2RE9A 3V0BB 2CA5A 3SCHA 2I59A 1N32T 2X5IB 4HKWA 3AE4A 3N9LA 3PDQA 3UU5A 2DU1A 3POEA 2V1DB 4ONUA 3DYMA 4D6SA 4IQPA 3VV1A 2RS51 5ISLA 5EHDA 1CONA 5HXHA 1VBB1 2G19A 1G6NA 3P4SA 2FMYA 2K9AA 3VDBA 2BGCA 4ZS3A 2BVVA 2VUCA 2Z5WA 1OF3A 4YTNA 3VBHC 3EMRA 3CMGA 1POV0 1CIWA 1ZA7A 5H9RA 5L3BB 3HAGA 2JDKA 4X64T 3AJZA 3L39A 1QQP3 1EUTA 1MZ5A 4DBRA 2DURA 2WNVB 4CEWB 2BFUS 2VZUA 2VW0A 3A0KA 5LA0A 3ZYKA 4L11A 1ZREA 5FZ9A 2WU5A 2O0OA 2DDUA 5KR7A 2Q30A 2K2SA 2W62A 4EN0A 3NSTA 4LMJA 3GZTB 1BR1A 2V6YB 2VVDA 4PJMA 3W58A 2DFCA 4YWAA 1VLNA 2OS2A 1C57A 3IPVA 1UYXA 3E6CC 4BE3A 2H89A 4CVUA 1J83A 5KHGA 4JYAT 3H3LA 1FOD3 4QXCB 1CAVA 3FJSA 1RUD2 2HWF2 2IUBA 3ASIA 4DV3T 4CXYA 5ABJA 1GOHA 2FDKA 1RHI1 1H1IA 4XTPA 4Z8XA 4CQIA 1QEXA 4BAYB 1OVPA 3NMBA 2JQQA 1AR92 3RNSA 4BQ2A 3ALQA 4IL4A 2V4AA 4HONA 4QKFA 1OHFA 3MIEA 4XQ4A 2A3YA 3A0NA 3LEIA 3JD73 3RMYA 3RZZA 2A3WA 2QQOA 1BR2A 2RS12 1COV2 2HWD2 2RS53 3N9NA 3QC9A 2A71A 3BQLA 2JD4A 4OZOA 2VTFA 1HRV2 3M8LA 2XVLA 1RC6A 2LJLA 5CFCC 4DR7T 4XXPA 2V72A 4B3ST 3M3IA 5LHGB 1AXYA 3QK6A 4ES9A 5JZGB 3CU7A 5CG8A 1YJLA 4XFGA 4OQ8A 3AP5A 2JMHA 2VW1A 2MEV1 2R061 5HBAA 3GZEA 4TWTA 5D8AB 4NXNT 5J48A 3RZMA 1NCQC 5F3CA 4QPGB 4E4HA 3CX7B 1OC1A 3FXEB 2ERFA 2LM2A 3GYDA 4BQ5A 3MJXA 2VD7A 3IAPA 4NUVA 3B5MA 2OUJA 5K0UC 4OI2A 3MIFA 2ZAAA 3AE9A 2ZZQA 1ENRA 5FZ4A 3JAEA 1E5IA 5CIRA 3WI3A 3L2YA 1TNRA 1UMIA 2BDEA 2PAEA 4NUUA 3PJQA 5J3UA 2IXCA 2LOSA 3OYZA 4XF4A 4GMP3 3HEIA 4LPLA 2ZX3A 2P3KA 2N1GA 4DV1T 4X1YE 3AP9A 4I4TE 2LT3A 1GP5A 3BOPA 1VCSA 4IREA 3BTXA 3K4AA 4YXDA 4BXFA 3VBFA 4XQDA 5LA6E 3UU8A 1BHGA 3LB9A 4P9XA 4GB32 3FZFB 2FCVA 4FTBA 3CF6E 4YVWC 1RUF2 4ZZCA 2ZGQA 2XQ9A 5CU1A 1QXPA 3HPNA 4XOGA 4XFFA 5T50A 3VBOA 2DCYA 3E6DA 3T1YT 1CESA 4LBNA 5HEJA 5JI9A 4P08A 2BZDA 1SUMB 1W6PA 3OBVE 2C24A 1GANA 5ABFB 1S2KA 1ZBA2 2ZGUA 4BQYA 3B93A 1XXNA 5AVAA 3N7LA 1GP6A 2Q8OA 4JI5T 1TNFA 4LFAT 2VQ0A 3JCIA 1ZKEA 3POJA 3AZWA 4Y1VA 2ACZA 4IV1C 4CTEA 1U12A 3NAPC 4UVCB 2X9HA 3HN3A 3LSEA 3OVUA 2FQPA 1TEIA 4TSVA 2BG9A 4XUPA 4N53A 4QX1A 4D94A 2VL0A 2OLTA 2C4XA 3WNKA 3KCXA 4NROA 5I8TA 3ACHA 1WKYA 4JDOA 1V6NA 3LSDA 4WW0A 4Q4Y1 3W9AA 2WWJA 1ULDA 2Y26A 3N9OA 3ABVA 5GZEA 3SOLA 3ZYJB 2XLFA 4TNVA 3MLKA 1RUI2 3H37A 4RGKA 4PK5A 2P3JA 1W06A 3I2JA 1WCSA 2EAKA 4GH4C 3MPPG 4CN1A 1X8EA 4PBPA 5FY4A 5JMCA 3HIFA 1ASJ2 1W6MB 5FTTC 4LKEA 5LYJE 3WF4A 2LE8A 3BCWA 3IDEA 2CM0A 3DYOA 1TE1B 4NRPA 1OH3A 1RB8G 1ND2C 3KQRA 4LQRA 4JGZB 2YFUA 3WNLA 5IAXA 2JXAA 3PHMA 3HNBM 4Y4RA 1NA1A 5K7PA 2XL9A 5ACA3 1R1A1 5L19A 2WQYA 4HKAA 1I5PA 2TEPA 4CDXC 4OULA 3O5SA 1ZVFA 2LRKA 3NRYA 2VXRA 3H3AA 5ADXL 1ULOA 4EEDA 5F7UA 4NO4A 5GLZA 4L97A 2VXJA 2CE7A 4XE9A 5A6XA 2W94A 4PJNA 2R16A 1KS5A 1F5FA 2VMCA 3K8PC 2PQSA 2EIGA 3OPZA 2NMNA 3Q9DA 2GP3A 2L3LA 4M1PA 1FT9A 1XRUA 4BYYA 4WM8A 3RPUA 4MYEA 1ZBE2 3DXUA 2R32A 3E22E 2EXIA 3ZYIB 3QB5A 5HCBA 3E6BA 4N7IA 1IBKT 1SEFA 5AQVB 5L3DB 3HR0A 1W9TA 2A75A 1FV2A 1JOJA 4LIVA 4DY5A 3BTZA 4YARA 3O1OA 4Q4Y3 4GKKT 3N7JA 4DXRA 1DYKA 3MDPA 5J37A 2Z2SB 5KHIA 4Q4V1 2JIGA 4KL1A 3ANWB 2E31A 3WG4A 5JR9B 5FY0A 3RWNA 1ULGA 1WLWA 2VZOA 2X05A 3T4VA 4XFIA 4WVZA 3T1MA 1EYBA 4COZA 4FP2A 1XE0A 2ENRA 4AVCA 3V64A 2XJUA 3I9WA 4AEMA 2FJBA 4UV9B 3NKGA 1B35A 3M3ZB 1U0AA 1MQTA 2QQPA 1WW5A 5F5IA 1R1A3 4RGAA 5FKYA 5LJMA 4LXLA 1D1AA 1Z78A 4BJ0A 2EVXA 2O1QA 1OUXA 1MMGA 1LOFA 1TMF2 2ZHKA 1HN0A 1W9FA 3U0ZA 4CDUA 3T0AA 2X5IC 2XJRA 4FOQA 4AYUA 5GJ6A 5F5QA 1T7SA 3I54A 1GLHA 1VBA2 3AB3B 1V0AA 2Z42A 3UGGA 4DZGA 1BKZA 2L9LA 5LA1A 4N9IA 4H63V 2J1SA 3MV11 2R073 1HB4A 1BEV2 5IJRA 1LR5A 1PHMA 5FLJA 5DJQC 3WNNA 2JDMA 5FZOA 1QGLA 2JDUA 2D6LX 3POYA 5I91A 5JOZA 4FJOA 4IE4A 4U72A 2LW8A 2DV9A 4OHZA 4AGGA 4GJZA 3C51A 2JEMA 4I30A 1S0CA 4IL7A 4CEWC 4YM0A 5EIYB 4Q4V3 4HE8A 4JAAA 3VZNA 4MV2A 3I7DA 1NWMX 5JSPA 1LOGA 4O61A 4Y20A 1WLDA 4XBQA 4GIQA 4Y1XA 4HSLA 4ZZ5A 4RN5A 1JTZX 2JPFA 2JB4A 1PO23 1GNYA 2WS3A 3AAAB 4U36A 1H1AA 2X29A 4G9SB 2V26A 2E6VA 5BNNA 5JR2A 4Q0VA 1QDCA 1CX1A 1RMU2 5D2AA 1S4CA 4ISRA 1X50A 4E27A 5IUQA 5ABJB 1QJY2 3P4QA 3VRAA 4XZUG 3MW4A 4FT8A 5C3SA 4AEKA 3UETA 4Q8KA 2PLV2 4LO6B 5JSOA 3AKQA 2BWAA 2OZ6A 1ULPA 1T2XA 4Q8LA 3ZFEA 1FMVA 4GA9A 1A3KA 5LY1A 4NOTA 5JDMA 3WNMA 1YQ5A 4LBJA 2XAFB 5HCAA 4NR1A 4JKMA 2WZHA 5FP9A 3QH7A 5LHHB 2DUOA 3CZUA 1XE8A 2BZBA 5F6LB 2XY8B 1VBB2 1KF6A 4YZ4A 3ZLIA 2DCZA 4FFHA 5E0OA 3TKLB 3VZJA 4YHHT 5ERLA 3MXZA 2C0ZA 2DVBA 4IESA 4JKKA 5FYMA 4EZ4A 4OFZA 3ZN0B 4MG2A 4UR9A 5BUVA 4Y24A 1I5ZA 4Y5Z0 4XVHA 5JZGC 4QGLA 2CBJA 1D0YA 1GU3A 4HL0A 3VBUA 3ST7A 4MGTA 4LKSA 5D8AC 2W9XA 2J1EA 5CB7A 1MVQA 1QIQA 1GKBA 3ZMUB 5HWXA 4QPGC 3H8UA 5I93A 1UZ0A 1ULEA 2VZSA 5A6QA 5FY7A 1JW6A 5CKQA 1RUH1 4YG6A 1WMFA 3TOJA 4HFVA 1DGWA 2QTWB 2YBPA 1UOGA 5JSRA 4K40A 4KG0A 2OW4A 4RFT0 3W5MA 1HX1B 3UKTA 4CEYA 5LATA 5C3PA 2ADEA 3D5OA 1SZBA 2LEHA 1ZZ9A 2YDQA 3PVEA 2W00A 3J8F3 1UU6A 3L09A 4FPGA 3ZXEA 1RHI2 3OTOT 3H9AA 3FBLA 4AI0A 2CMRA 1YQ6A 5CADA 2I07B 2DCTA 2W2UA 4LORA 4Q4W1 5F2SA 1AYN3 4DUWA 5LHIB 3S7IA 4J2CA 2H7VC 2B9UA 5FMBA 1UZVA 3VDCA 2WIIB 2DTYA 1P8JA 2VMHA 2EICA 1LRHA 1PVC2 2VKDA 4JDMA 5G04L 4R4XA 4IEQA 2VH9A 2D7FA 5J09A 3H7JA 1W6PB 1UX6A 3DKQA 3RZJA 4CP9B 1TZOA 3VDDA 3PTRB 5GZFA 1ZEEA 1W3VA 1OLQA 4BWOA 3EXUA 3Q5DA 4A2UA 2LHNA 4AW7A 2MEV2 2RHPA 4H7MA 3GCWA 2R062 5D1IA 3S30A 3SISA 5EYYA 5SV5A 1O3QA 5FJKA 3NW4A 1H30A 2Q0AA 1OLME 4UIGA 4I3GA 4COUA 5FNVE 1YLLA 5L7OA 2HWB3 2HPJA 4AG4A 2NR4A 4I2OA 2CCQA 1OFSA 3MIDA 2Y6KA 5L9VA 4X1IE 2X0HA 5JTGA 1OVSA 3GCXA 2J22A 4BH9A 1J3RA 4MXWA 4A7KA 1RUH3 2XAQB 1W9YA 1LGBA 2BG9B 4OHVA 4AHXA 1VBD2 1FAYA 4RHV1 1RVF3 2YDEA 2ZGPA 1FV3A 2BVBA 4YLZA 4YFSA 4M4PA 1R091 2A3DA 1MEC3 1WD4A 1GZWB 4FO9A 1LECA 2RR11 3OGSA 2XQ4A 1JBCA 4JI0T 4CCMA 2YOEA 3AXJB 4W4ZA 5F32A 4QKDA 3UU6A 2W2IA 4M4RA 5B4NA 1V6JA 5AQLB 5F5WA 1LVFA 3ZN6A 3AE2A 5FPBA 4WBBA 1OOPB 4DMWA 5JH7E 4Q4W3 5LBCA 3Q5XA 2NYYA 1AHSA 2WO7A 2XUMA 2JDZA 4MUVA 4XMIA 4F83A 4XYXA 2BTVC 4YW1A 1K5MC 2FDJA 1Y9QA 4TXWA 5FR3A 2ZEYA 4EYYR 4CU6A 4ARXA 4AFDA 3BGAA 3MIBA 3PVNA 3H8OA 1MS4A 1C28A 3LIGA 3TN91 5F5AA 3DPRA 3K77A 1S1AA 4QX3A 3I8TA 2ZJCA 1VBC3 5KXEA 5FXZA 1JYCA 2W92A 4CDWA 4HN1A 2HHHT 2MHFA 1PIV3 1S2BA 1CAUA 1QJEA 3I2IA 3LSVA 1ENXA 3K46A 4AQ6A 1N1YA 1DQ6A 2LHRA 1BK0A 3IZOA 3ZMTB 4QX2A 1GZTA 3FLTA 1W6QA 4LE3A 5DQVA 5GLVA 3ZSSA 1LEDA 3OUJA 4FXGB 4RHV3 5SV8A 5FLHA 3SQOA 3PUSA 1HNZT 4DPNA 1H4HA 3U11A 3KCCA 3WP3A 1UY0A 4OUEA 2E51A 1WYBA 1W8WA 1AR63 2WT2A 5J98B 3LIHA 2LM9A 3FBMA 3NZQA 4W6WA 3T4HB 1CJPA 5LXTE 3KHBA 3S4UA 2LKHA 3WHTA 2AH2A 3ZDVA 4X8NA 3LPFA 1UOJA 3ZSEA 3ZXAC 1XDOA 3UFEA 3ZFFA 5T5LA 2WO2A 2Y6HA 3Q8EA 5JR9C 4S2DA 2PHWA 2VOVA 3TYJA 2LM3A 5ANNA 2GN3A 1EP0A 5E8AA 1GWMA 4QU2A 1S0BA 3RPQA 5TAOA 3R6SA 4XJ9A 4RSUA 2WRAA 1X82A 2PBIA 3WUDA 1B35B 4AFAA 2CWYA 2WU2A 4O4IE 3TLWA 1W9WA 2UXNB 4FI5A 4OX9T 1HNWT 4XBNA 4LBQA 5ABHA 2XQ7A 5IUXA 5FP4A 1VMHA 1CX4A 2V6XA 1LOBA 2QQMA 2RPAA 4IE5A 5IHRA 2D5FA 3M65A 3HKCE 3R05A 1NKGA 2N7GA 5LA2A 3ZSMA 2CYFA 4FTSA 2O14A 3VUOA 3J4UH 2J62A 4RA0A 4B7KA 3DP7A 4DV2T 3T2QA 4XF9A 3S7EA 3NV2A 4PI2A 4O9GA 4NIHA 3RIAA 3Q5WA 5CA1E 3C2UA 4LK7A 2X8KA 3M4FA 4HPKB 3LOIA 4GWMA 1WA6X 4JCKA 4ILBA 2R6QA 2VE1A 4A4AA 4ISSA 4JI1T 2A1XA 1RUE1 5ABEA 2WM9A 2GAUA 3T09A 1CIYA 1XU2A 3KQ4B 2XR4A 2PTFA 4PIYA 3PNAA 1SLTA 4UVAB 4LA3A 2YC4A 3SFDA 2HN1A 4X62T 4QX7B 3KT1A 3N2GE 2CSGA 1NT0A 4IDNA 2D3RA 4XHXA 5JXHA 2WLPA 3M2MA 2D43A 2WYFA 4XCAA 4COFA 5AC91 1IS4A 3DN7A 4D7TA 3B13A 3BPZA 4K8FA 3GBGA 5FFOC 5HXMA 2E7TA 1DU3D 1W05A 3VBHA 4LULA 3SNMA 3HN1A 1GP4A 5ABJC 2YUEA 1EAH3 5F8PA 4O65A 4CCEA 3WG2A 2WO3A 3LAGA 2XAHB 3JUUA 2XAGB 2PMWB 4O9EA 1IHMA 1S0FA 2VY0A 2TBVA 1MZFA 2QYWA 3FZMB 2GSYA 1NQDA 5LP6E 1WCKA 3LE0A 2ARXA 3ZMOA 3ZXGA 5HEOA 5LMNT 1CR7A 2LROA 3WINE 4HXCA 4R9BA 3WOGA 1A6CA 3PUQA 3OBRA 5C7GA 3T3YA 2QRXA 3OD0A 2XHEB 2YFZA 2RM23 5A1AA 4JZRA 2VKOA 3ONXA 5FZFA 4BISA 1RYYA 4EXTA 4KNCA 2QKDA 1VB4A 1J5WA 3ZM8A 3LA7A 2CLYB 3FB2A 3AVSA 1RUNA 2KXPB 5EK3A 1RUE3 4WM7B 2UUBT 1STMA 1UMHA 1VBE1 3ENRA 3H1WA 4E9KA 3X29B 5LMUT 1GMMA 2OPWA 1AX1A 1GBGA 2QBXA 5A7WA 2ZHNA 3OYWA 4IE7A 5HV0A 5LOVE 4XFCA 2BDRA 2H0VA 5F3IA 3EVYA 5JDNA 3PVBB 5JDHA 4Q2FA 5FMDA 4ATEA 4YLHA 3MICA 4JX0A 4DV0T 1KFYA 2XQ5A 1W8FA 4K20A 5BNPB 5LRRA 5HAXA 2IDOB 2XJTA 3IBPA 3LFIA 1J1LA 4AVTA 4I43B 4IDPA 4EYUA 4NRQA 2OQ7A 5DQ0A 5FZ0A 3POFA 4MH0E 2DFBA 1YEWA 1QY4A 3QBQA 5FAXA 3NL1A 2WNUB 5FP8A 2TUNA 1FIOA 5FXWA 3LK2B 4XILA 2K48A 2ZGLA 4H9SE 4OYUA 2M6BA 3CEWA 1KNRA 1AJ3A 1MIWA 2M6IA 3RG0A 3MIGA 1L7QA 5IWAT 2J1TA 3SITA 3O1PA 2JX9A 3LDRA 2ZM8A 1QJX1 1XC6A 2P9BA 2VZQA 4NHYA 4QDQA 3RKGA 3RI8A 5K8SA 3V5SA 4XJWA 4O4HE 3PTYA 3KV4A 1C4RA 2LRPA 5DAWA 3VL9A 2Y6LA 3NNMA 2XQXA 1JXNA 1PGW1 3VBOC 1NY71 1AR82 2VCAA 5K0UA 4YFZA 4LF4T 5JDFA 5DDJ1 4COVA 3VDDB 4AQTA 2ZBJA 3NWKA 1W6OA 4RS5B 1RUC3 4XABA 4YSXA 1AL21 3ROUA 4UXNB 2WDBA 2UYBA 3JBG1 4FBFA 3CQCB 2AC1A 4AFBA 4JGYA 1PZ8A 1JOBA 2F6BA 2BBAA 2J1VA 1HF8A 3LBXA 1DHKB 4YGBA 5C8YE 5CFDB 5L7OB 2MTQA 3FBZA 2RJ2A 3OPTA 3C64A 2DWRA 2YZ4A 1LHUA 1OA4A 5FJHA 1POV3 3ZCIA 2VTXA 2VPVA 5A7QA 3RDIA 3MZKB 3NNJA 4A7ZA 2J1DG 2BG9C 1U4QA 3CKDA 3NNLA 2KSRA 4YVWA 5C3JA 2DI4A 3CHXA 2IFWA 2P37A 1UN1A 3NVCA 2JIWA 5EZWA 5J0ZA 2W1QA 3KMHA 2DHRA 1WGPA 3R6NA 3K3QC 4LHSA 2X53S 2LSIA 4K6BA 1Q8SA 5CBLA 1REDA 2P3YA 1UXXX 4Y4YA 4ITCA 4B7EA 1S35A 4IEOA 4FCAA 5A3MA 3ZN6B 4CCKA 1AJKA 1BMV1 1JHJA 3BKZA 3CJXA 1I9RA 2ZMLA 1OOPC 1GICA 1V6MA 4FPHA 3VHRA 4Y1YA 2W68A 4JRAA 4IEVA 3NAPA 2HWE1 3P4WA 1LHOA 1OEDE 2W3JA 2M67A 4NIDA 2QUOA 5LCWL 3IB3A 4RQPB 4NHXA 3ZR6A 4KHPT 5A3PA 2VZVA 1HNXT 1YQ4A 4OHXA 4QHZA 4YG0A 2D97A 2BGPA 2GNDA 2BBVA 4NHMA 4URTA 4CDWB 3JBG3 4HVOA 3Q8BA 1KDMA 1QOOA 5T3NA 5J2UE 1U5PA 2K5BB 1JZ2A 4RR3B 3ZXLA 2J1AA 2BOIA 1UCUA 4GXLA 5EXOA 1WRDA 4PJLA 3TAYA 1UZWA 3MA9A 4FPYA 3HI2A 4TWFA 2W52A 4NAOA 4JI6T 3NJVA 1X7NA 3MPBA 3P3PA 4ZI3D 5F5CA 2WAUA 4GH4A 2BKPA 5A6YA 4ZZBA 3ELNA 2UY9A 5HEGA 5LASA 5DG2A 1W6QB 4BQ3A 4QB2A 1OKQA 4YY3T 4XDPA 3TEZA 1GSLA 1KGYA 2BEOA 2XBO2 2LTNA 3IIAA 4QXHA 1R092 3AKTA 4KWUA 3ACFA 2WY2A 2RR12 1C5IA 1C8M3 3LA2A 1N3QA 2D5UA 1O8PA 3OGRA 2ZX0A 4V1Av 1GV9A 3AE3A 3IEEA 5FYZA 3CLPA 4NPMA 2BKNA 1V6OA 3AEAA 4CDXA 3QOPA 1JYNA 2LSJA 2D0TA 2Y48B 3ZFFB 1WLXA 1UAIA 4QH5A 4MGSA 1UPSA 1UPIA 2AACA 1GQPA 4I0WB 3AZZA 4DUZT 4XZPA 1QH7A 4OHWA 2ATFA 1ZZ8A 1EY2A 5FZCA 3SHRA 2RVAA 2IW5B 4YYOA 4FTEA 3GXUA 2VNGA 4LMKA 4HOOA 1JI6A 2OVUA 2J47A 4Q27A 3O1IA 1B35C 1MQTC 2X68A 3IF8B 5FWJA 3PIJA 4EQVA 1HRI3 4QPWA 3TN92 4LBQB 3AEBA 2AYHA 1XQNA 1ENSA 1RXFA 3UQ7A 1KK7A 1LOFC 3T2PA 1AF9A 1ZRCA 3N9MA 3BYWA 3RZLA 1KJRA 2CU5A 2V5DA 3L9JT 1UZZA 3RSJA 4QM8A 2IVIB 3O1TA 1CWPA 3I3BA 2JG8B 2OA5A 1CAXB 3IIIA 2C0SA 3GZUC 5FQ0A 3H1YA 2XWBB 3RS6A 4QGNA 2PAKA 1RUJ1 4AZZA 3CQGB 4B4PA 1ZM1A 4I0AA 4JI2T 2GH2A 1PGL1 2GDFA 3SCFA 4BOWA 1E7PA 5IFPA 1V9U3 3HL6A 1XWMA 5JRCB 2BUKA 4F8HA 1W2OA 5EK2A 3ZC0A 3THDA 2H0BA 2OIIA 2XQ3A 2E9QA 4IEXA 2JQ9A 4NIGA 3V0BA 2DVFA 4M3CB 1AR91 4ZU7A 4Q4X1 1T6GC 2X5IA 3FHNA 1UY3A 1HQWA 3LF7A 4QT6A 2L9QA 4QHOA 5A1LA 3MYXA 1AL0G 4J25A 2D6MA 4HFCA 1MMDA 3VR9A 1QF3A 2FDHA 4EEBA 5FZHA 2RS11 3AYCA 3VKMA 2MNGA 4Y1UA 4AVAA 1VR3A 4GQ7A 3Q5EA 2J7MA 2PHFA 1N3PA 4URAA 1H8TA 3VR8A 3F2EA 2WZEA 4KWKA 1QOTA 4K21A 3IA3A 2GC1A 3GDBA 1HJFA 1D1CA 3VRBA 5FZ8A 2ARAA 5DUWA 1D0HA 1UYYA 4DUVA 3BU7A 3VHNA 3W59A 3ZSKA 2JQHA 2CXLA 1DGLA 5FCCA 2WNVA 3F95A 4CEWA 4HKOA 1IG0A 4Z2AA 2JENA 2G9FA 1HB1A 5IK4A 1R1ZA 1AR71 1G9DA 1POQA 1NLSA 2GALA 3WSOA 2R041 2XGXA 4D3WA 1UL9A 2RDQA 2Y0IA 3MIHA 1BXHA 3W15B 2V6YA 3AXEA 4JTNA 2PYTA 2E8IA 5IAVA 4ZI3C 1SFYA 4LBLA 1WLTA 1X8MA 2QCSB 2CLYC 1M7KA 4Q1PA 4DFSA 2I6HA 2VOTA 4FP3A 2ET7A 1RUD3 3FZKB 2HWF3 3POBA 5DAQA 3K51A 4AKRB 5C6CA 2VURA 4KI0F 3H3UA 2MPFA 4PAGA 3O0XA 1AR93 4LITA 2CTVA 1E5RA 5A32B 2KM2A 2RA1A 1UIJA 2E9XB 3ZYHA 5ACA2 2RG4A 2XLGA 3WVJA 4YTMA 3WNPA 2OA2A 5BNPC 3DEMA 2MBGA 1BCXA 1PX3A 4F8AA 4Z92B 5FY5A 2RS13 1COV3 4CCLA 2HWD3 1J5ET 1YNAA 3TLUA 3ZJ2A 5AC92 3BU0A 1HRV3 3M3QA 4PF1A 1EV11 2WABA 2QJVA 5AQJB 2IC6A 4PLNA 2ZGMA 2WNUC 3KB5A 1QNWA 2CV6A 5T5JA 4ASLA 2DUQA 2H7OA 4TUYE 5JZGA 1W04A 2OX0A 4JV5T 2OT7A 3RLFF 3VKOA 3ZIWA 2N2NA 3ETQA 3WDUA 4HWCA 1W9RA 4E8CA 4DMIA 2VNOA 5D8AA 4META 4UBGA 2LSGA 1ODNA 5FVLA 3RJRA 4Z2WA 2BS4A 4KUMB 2QGSA 1Q56A 3MZHA 4QPGA 1F4HA 4LBQD 4CP2A 3WNXA 5FUPA 1L3JA 3RI5A 1WBLA 5FXXA 5FZGA 3SXWA 1IAPA 4DINB 3JB4C 1Y9MA 3D0TA 3KF3A 5EJ3A 4V2VA 3EQEA 1YFUA 5FZ7A 3AP4A 1YRZA 4OVEA 1K3IA 4BA6A 3VDDC 3I97A 2O8OA 3K1SA 2IXJA 4RS5C 1VCTA 1JZ6A 3RX6A 1BBT3 1H4GA 2BWCA 3PL0A 2V8SV 4JGYB 1VBE2 2WQZC 3VN4A 2ZGNA 2DL1A 1UXZA 3HR9A 2JKBA 1J3PA 5LNKA 2A70A 5FUIA 3CJIB 5CFDC 5L7OC 1KNPA 3VD9A 3WDXA 3AA6B 1DP0A 5CYYA 4A44A 4FPCA 1SBDA 1YXRA 4HANA 2WBLA 1XBFA 4QQHA 4XJ8A 1Y01A 2ES0A 2QQKA 1UKGA 4GB33 4PCRA 5L73A 2JJ9A 1R081 1X9PA 1RUF3 2WFF1 3J7HA 1SG3A 4EAHA 4H9NC 1WR6A 2PG8A 3LD8A 5DUVA 4UYBA
chains in the Genus database with same CATH topology
1HFAA 1Y64B 5FP8A 4D6RA 2P5BA 4UF0B 2LHRA 2C0SA 3N5LA 1FIOA 3PDYA 5FXWA 2C5JA 3KDSE 2Q9QC 4UVCB 1FMWA 3LK2B 4ZS2A 2YPDA 3OJAA 2K48A 2X9HA 4E7SA 4H9SE 4UV8B 3ZMTB 2JMKA 4CI2B 5J1GA 4EZHA 3UYJA 1AJ3A 1MIWA 5FV3A 3C4WA 2NP9A 3CQGB 3ETUA 4CSWA 5DQVA 2EHOA 5FPLA 3O1JA 4CCOA 1QUUA 3N9QA 5H6RB 3N2KE 4JLEA 1FMVA 5LG4A 3PUSA 5FYTA 2CA5A 2ZM8A 3HKDE 1SHZC 2I59A 5DQWA 4UF0A 5L3GB 5LY1A 2P9BA 2Q8CA 4CCJA 1MMAA 5FBJA 2NTYA 4H9RC 3HL6A 5JDMA 1BR0A 2YU2A 3I0OA 5JRCB 3ZYLA 1WYBA 4ILUA 4PW8A 5EK2A 4C91A 3ZC0A 3V5SA 2XAFB 4O4HE 2HPLA 4JUYA 2LM9A 2NW8A 5A80A 3SWHA 5FP9A 3UUNA 3N9LA 5FYBA 3NZQA 3PDQA 5A7PA 4DIQA 1HG5A 3I1AA 3KV4A 2CXFA 5LHHB 5LXTE 4TZ4C 3S4UA 4WW0A 2BZBA 5FPUA 1E1HB 4AQFA 2Z6EA 2K24A 2V1DB 3UUMA 2WWJA 5KDMC 4UEMA 5LBMA 4G63A 3N9OA 2X0LB 4TN7A 4D6SA 3ZLIA 5FYVA 1VRBA 3RKOA 5ISLA 2PXJA 2CEAA 2V7KA 3KBUA 5E0OA 3RYCE 3SOLA 3TKLB 5HXHA 3FHNA 4EIWA 3LBXB 3CQXC 3KV6A 4G2AA 4IDZA 5JRCA 5ANQA 4IHJE 3VKGA 3UFEA 5JDFA 2K9AA 3MXZA 2E9XC 2L9QA 1IJ5A 4QHOA 2KNDA 3C50A 5A1LA 4KP3C 5FYMA 4EZ4A 2HH7A 2GP5A 3H37A 3ZC1A 4OFZA 4PK5A 3HA4A 4ZS3A 5JR9C 3PURA 3P8CD 5LGTB 1X79A 3ZN0B 1MMDA 2ACXA 4X1KE 3AA0B 5LGNB 4UXNB 5L3EB 2NOXA 3ETVA 5FY4A 5FZHA 4QX8B 4CUGA 3CQCB 3E0ZA 5IVEA 1MIYA 1D0YA 2CXDA 1D1BA 2WMNA 3BQKA 2Q9QD 5LYJE 5TAOA 4H9PC 2ZLYA 3K2OA 4WBOA 4MFRA 2LE8A 1B7TA 5L3BB 4IGPA 4CCNA 2CM0A 1HF8A 2V7MA 3LBXA 4F6RC 4LXLA 4PK6A 4TV9E 3RRWA 2NW7A 4URAA 4ASKA 1V9DA 5C8YE 5A3WA 2PBIA 2MTQA 3GMIA 3FBZA 2XMLA 2QA7A 2D0UA 3KV9A 3RC3A 5HWYA 2VKHA 3OKQA 2NW9A 3F2EA 3ZCJA 3OPTA 2CWYA 4DBRA 2XASB 3IHRA 3RC8A 3C64A 1MNEA 4O4IE 4O2BE 3EUHA 4QXBB 5E6HA 2UXNB 4FI5A 3ZMUB 5HWXA 5FJHA 2VKJA 2ZM2A 3ZCIA 4Y4RA 3PU3A 3UT5E 2EHOC 3LJCA 4PFPA 1D1CA 4YHJA 5FZ8A 4EB6E 5A7QA 5FY7A 4AKHA 3MZKB 3KBTA 3ZYKA 5FP4A 4QWNB 4QXHB 3RRCA 3P7IA 1OWAA 2J1DG 4HKAA 1IZNB 1LRZA 5FZ9A 5A1FA 2XXZA 5KR7A 2CXLA 3O4XE 4UELA 5EK4A 4LIUA 5FUNA 1U4QA 1BR4A 3CKDA 2W62A 3WAKA 4HFVA 4IE5A 4BJNA 4L5GA 2VB6A 5F3GA 2YBPA 2DI4A 4MBQA 3CPZA 1YKEB 5IVVA 5CEHA 2CWOA 1BR1A 3NRYA 3M65A 4TX5A 4PJMA 4QXBA 3H3AA 5FZLA 3DTOA 5ADXL 5LY2A 5IVFA 2BVLA 3NBXX 2XQYA 3HKCE 2X66A 4AKGA 5FYHA 5HXEA 2X51A 2OS2A 4V2WA 2DHRA 3F31A 4P0AA 2ODUA 2CE7A 3MKDA 3R6NA 3PE0A 2KZ7B 4JEHB 3K3QC 4AQFC 2ZMAA 4GYRA 4QWNA 4PJNA 2E9XD 3ZMZB 2LSIA 3K8PC 2LOPA 2LEHA 5F2WA 1WYCA 2Q9QB 3QUJA 4BISA 3DP7A 3Q9DA 4QXCB 1ZHCA 2GP3A 2W00A 2L3LA 1S35A 4M1PA 3RVHA 3AAEB 3L09A 4AXPA 3RPUA 4CCKA 3ZYMA 3W15B 3AA1B 4CXYA 5LWBA 3RYIE 5FYYA 3FBLA 4MALA 3DXUA 2CMRA 2E8IA 2WSSV 3Q5WA 5CA1E 2DCFA 4ZHQE 4ZI3C 4Z8XA 3E22E 3HKEE 4ZOLE 4B6XA 4CQIA 5JDGA 5GONE 4BAYB 2Y6XA 3JC6C 2JQQA 4O4JE 4YJ3E 2CLYC 3J7Yq 3GWHA 4O4LE 2D2SA 4H9OC 5F2SA 1OXZA 4HN9A 4DNDA 4ISSA 5L3DB 2Q9QA 3RH3A 3RYFE 4X20E 3HR0A 4ANJA 2UXXB 4HONA 1QSDA 4AKRB 2V7IA 5LHIB 5IW0A 1UX4A 2KMFA 4LIVA 4AI9A 2KWHA 5KMGP 4J2CA 5FYUA 2H7VC 5F3JA 2WM9A 2M67A 3EDUA 3ZPOA 4XZCA 1HTJF 1YD8G 4IE0A 5LJNA 3EDVA 1G8XA 4L9IA 2EHOD 3CMLA 4K0UA 4TV8E 2X9WA 1BR2A 1O3XA 3E08A 4PAGA 2JRKA 2A72A 2DLRA 3ZJ1A 2X9XA 4LITA 2MOZA 4DO0A 5JQGE 5A3PA 3N9NA 3QC9A 3UUXB 1ZV4X 2A2FX 5JDLA 3BQLA 2DWGA 4UVAB 5FYCA 4DMVA 5FZMA 3FXDB 1HCIA 2VKDA 2YBSA 2RA1A 3A5XA 2YK0A 4KBMB 3VKHA 1MNDA 3DJBA 2LJLA 5JREA 4GAZA 1EZ3A 2E9XB 3B57A 1LVKA 3ANWB 4QX7B 1G73A 5KX5E 5FYIA 5FPAA 3N2GE 2C5IT 4OK0A 5JR9B 5FY0A 3PTRB 4PJJA 2MBGA 5LHGB 1ZEEA 2H3RA 5CA0E 4ERRA 5FY5A 3KVAA 3GA8A 3AA7B 3OYXA 2IC9A 4O2AE 5J2UE 4CCLA 1U5PA 2C5KT 2GK9A 2K5BB 3LG7A 3QK6A 4CI1B 3PU8A 2LHNA 4OYKA 3ZJ2A 5IVBA 1UCUA 4E7ZA 3C98B 4QX8A 1WRDA 3CVRA 5F39A 4PJLA 4IGOA 4XDOA 4PFOA 5FZ3A 3MA9A 3AL5A 1HS7A 2JMHA 3HI2A 3N9PA 1D0ZA 2E9XA 3LFMA 5FJKA 3B13A 2BVMA 1S94A 3CX6B 2YINA 3RYHE 4QX7A 2XTLA 5FYSA 2IC6A 3UTKA 4JEUB 4UIGA 3HKBE 3I9WA 5A7OA 4UV9B 5EZYE 5FNVE 5JR9A 5F5CA 5FY9A 4ZI3D 2XUEA 4KMCA 5FZEA 3SS1A 2HPJA 3CX8B 2WAUA 2H7OA 3T8OA 2CCQA 1CUNA 5IHYA 5F3CA 3JC6D 5FXVA 4TUYE 4UVBB 4GYSA 4BJMA 4X1IE 5F8PA 4E4HA 5HYAA 5LGUB 5F5IA 5K4LA 2EHOB 2OX0A 3CX7B 2PJQA 5LJMA 2OT7A 3U4SA 3PUAA 2XAHB 2RP4A 4Y33A 4WNKA 1HG2A 2N2NA 2VWAA 2KINB 1D1AA 2XAGB 2XAQB 3FXEB 3V5UA 4OYJA 2OQ6A 4XDPA 2L8KA 2W0GA 2SPCA 1MMGA 5F3EA 2NTXA 4ZI7E 3KFWX 4QXHA 4EOZB 5IVJA 4CXXA 2VL8A 4D6QA 5IVCA 5CB4E 3LK42 3C4ZA 2LSKA 2KLQA 3ZMSB 2LSGA 4IGQA 3MJXA 2VD7A 4YFSA 5JVDE 2YU1A 4AI6A 4NUVA 2VK9A 5LP6E 3Q2MA 4L0RA 4N78D 2A3DA 4P09A 2D5UA 1IJ6A 4HEAA 3U78A 3UULA 4KUMB 1D0XA 5FY1A 2QGSA 5LW9A 1YW0A 4V1Av 3VU7H 3NJYA 2X9YA 5FP7A 3SRZA 4CCMA 1MIVA 5L2LA 5FUPA 5FZ4A 4CXWA 4ZI2C 5FXXA 3IEEA