3K3OA

Crystal structure of the catalytic core domain of human phf8 complexed with alpha-ketoglutarate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
355
structure length
350
Chain Sequence
LRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 8
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 96
structure length 350
sequence length 355
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3oA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3oA01
3K3NA 5FZHA 5FY5A 5A1LA 4BU2A 5A7SA 5FY4A 5FZ6A 5LW9A 4HOOA 5FZ9A 4EZHA 5CEHA 5IVEA 1VRBA 4IGOA 5FZCA 2YBSA 4CCOA 3PUAA 5FZ4A 5A7NA 4GJYA 4LXLA 3KVAA 3PUQA 5A7PA 4URAA 4GJZA 4ASKA 2XMLA 5A3TA 5F37A 4BISA 3AL6A 5FBJA 5FJKA 4CSWA 4IGQA 5A80A 4QWNA 3U4SA 4IGPA 2OS2A 5FZOA 4CCLA 3U78A 3AL5A 5FY7A 4LIVA 5FZ3A 4HONA 5FV3A 5FYUA 2PXJA 2W2IA 4QX8A 5FZKA 3PU8A 5F3GA 5A7WB 5K4LA 5FYHA 3PUSA 2OQ7A 4QXHA 5F3CA 5LWBA 5F39A 5FYTA 3KV4A 3AVSA 5A7QA 4Y4RA 4D6RA 4D6QA 5F2SA 4UF0B 3PU3A 3NJYA 4V2VA 3OPWA 4NUBA 4V2WA 5IVYA 4CCNA 5FP7A 4DO0A 5F5IA 5FZDA 4LITA 3KV6A 3ZPOA 5A7WA 5A3NA 3PURA 2XXZA 5FZ1A 4BXFA 3PTRB 4Y33A 3AVRA 4CCMA 2YPDA 5F3EA 5FP3A 3N9LA 5FP8A 3LDBA 4XDOA 5FZ7A 4D6SA 5FUNA 4CUGA 5FZLA 2Q8CA 4UF0A 2Q8DA 3KV9A 4QXBA 5F5AA 2OT7A 4AI9A 5FZMA 5FPAA 5FY1A 5A3WA 5A1FA 4LIUA 5IVCA 5FY0A 2WWJA 5FP4A 5ANQA 5FYVA 3UYJA 5LY2A 4EZ4A 2OQ6A 5FP9A 3KVBA 4AAPA 5F5CA 2XUEA 3N9QA 3KV5A 3PDQA 4QU1A 4QX7A 5FYMA 2YU2A 5FYCA 4Y3OA 4QXCA 4GD4A 5IWFA 5IVJA 5FPVA 5FXZA 2OX0A 4XDPA 3K3OA 5FUPA 2Q8EA 2GP5A 5FXVA 5FYYA 4C8DA 5F2WA 4E4HA 5FPBA 4TN7A 3DXTA 5FYBA 5IVVA 5F32A 5LY1A 5FXWA 3N9OA 5FZ8A 5KR7A 2GP3A 2XDVA 2WWUA 5IVFA 3OPTA 5FYZA 2YBKA 4CCKA 5FYIA 5FPLA 5FJHA 5FY9A 3LD8A 5FXXA 5FZAA 4DIQA 5ISLA 5FZIA 4GAZA 2YU1A 5IW0A 4CCJA 5IVBA 3RVHA 3DXUA 5A7OA 4EYUA 3N9NA 2YBPA 5FYSA 3K2OA 5FZ0A 3N9MA 5FZFA 2VD7A 3ZLIA 5FWJA 3N9PA 5FZGA 5FZBA 5FPUA 5FY8A 5F3IA 5FZEA 5E6HA 5FZOB 2P5BA 5FWEA 5A3PA
chains in the Genus database with same CATH superfamily
3ZSMA 4AQ6A 4F7ZA 2QRXA 1A6CA 3EUHA 1HNZT 5FZOA 1UPIA 4H14A 4COYA 2LM3A 1UYPA 3HQUA 2JB8A 1YQCA 2RS13 2C6SA 5KC6A 2Q1FA 2VCCA 1MZFA 5CFCA 1V9U2 1RUG2 3FFQA 3CNAA 4LHLA 2R1DA 3TKLB 4RGGA 1QLBA 1QWRA 4EGWA 4AGRA 3QB5K 5LG4A 1R081 4AL9A 5JPNB 4NPLA 1MS8A 1XYOA 1SBEA 4YVSA 2FBEA 5DAQA 1WW6A 1ZA4A 1CIYA 3JD73 3OBRA 3LDRA 4LBMA 4LA2A 3EBRA 2A6VA 1UZZA 4DVDA 2BGPA 4M4RA 5BUVA 3EB7A 3VBFC 4JDNA 4AQ2A 1N1SA 4JVAA 3B9CA 3TNPB 5FZ6A 3OJAA 1S35A 1YD8G 3PVBB 2JJ9A 4N78D 4XFGA 4CCLA 1RHI1 4LKFA 5H6RB 5FZ3A 4HPKB 4HONA 4LE3A 5EYXA 2DUOA 4OUMA 5A7QA 4JGYC 3X1DA 1ZBE3 2HKXA 4J1WA 3D82A 1LRHA 5JDHA 4X64T 4N9IA 3VBFB 1HB3A 1UIKA 3U1XA 3KZ4C 1Y9MA 1HW5A 3IDEA 1V6NA 3TWIA 4KI5M 5SV5A 4A5XA 1XNQT 1CR7A 5AQVB 3LSDA 3ZYLA 5L9RA 1NENA 3W5MA 3MJXA 4Y1UA 1VBD3 3RYCE 3H8XA 2VAUA 1U4QA 2WWSA 3LWCA 4AK3A 5CFCC 4AIUA 3LD8A 5I8TA 1O3TA 1GQEA 1LOFC 1WD4A 3ZMOA 3LIHA 3S4UA 1XYPA 1Y9GA 3I49A 5F3IA 1R1A2 5FZOB 1ODMA 5A3PA 2NYYA 2WRAA 5CEHA 4YFZA 4YVSC 5IUXA 3RI8A 2XTLA 4AKHA 1XU1A 1J5ET 3OBZA 3RKOA 2CE7A 4UXNB 1VB4A 4I01A 4UFJA 2SBAA 1ZBA2 3AKSA 3WVJA 3ONXA 2O1QA 3RRCA 2WMNA 1VBC2 4NJ4A 3GHNA 2Y38A 3DF0A 4NUBA 3UGGA 4HLTA 4RGKA 1OI6A 5C2TA 3E6DA 4HWHA 4M3CF 4HN1A 1MMDA 2QQLA 4D7SA 1JW6A 4XAEA 3I4IA 2W2UA 1WR6A 4LNVA 3HEIA 3HPNA 2OUJA 4HSJA 4IUGA 1QJFA 1UPSA 5F5CA 4NMIA 1I6XA 3MUY1 4IREA 2XGXA 5FYBA 5LBMA 3UQ7A 4CUBA 2Y0OA 1OH3A 5FZIA 2X0HA 1MMAA 3W21A 1CAVA 2RP4A 1WCUA 2LW8A 2XJ7A 4LMFA 4F8HA 1G8XA 2WS3A 4IEVA 2PHWA 5FLIA 4JI3T 3HJRA 5GALA 4Q1PA 3VKLA 5AFBA 2JE8A 1I9RA 1RMU2 5DUVA 2VVEA 2EHOA 1O4TA 5A1AA 1SBDA 4KQ7A 5A3TA 2VVNA 4DXRA 1I6ZA 3NKZA 2JICA 5DUUA 2VZVA 1XE8A 2WNOA 1QQP1 1SG3A 2VNOA 4KGQA 5AQIB 4R8HA 4QX3A 2QQOA 5JUVA 5KBFA 4YTMA 3I3EA 5LGTB 1PHMA 3UL2A 2X68A 3ETQA 1Q8SA 2MEV3 1ZOYA 1RL3A 2PLV1 2YXSA 5FKBA 1JNRA 4O2AE 3CZUA 5L7OC 2C1FA 3C51A 4R4XA 4QU1A 1SCSA 3A7MA 4W6YA 4X6RB 3TRSB 2XLAA 3TEXA 4MOAA 2JG9A 3NAPA 3AE7A 2D44A 2IC9A 4LK7A 3B5MA 2ACXA 1FYUA 1XYNA 1Z0PA 1VRBA 2WUHA 3MEPA 1QOOA 3FZ3A 5A7PA 3TAYA 1CZVA 1PMIA 1FIOA 4O8SA 2WC2A 1L7RA 1RHI2 2UXXB 5HYAA 2W00A 2JDKA 1LCLA 2VZQA 2PHRA 1Y9QA 2EHOC 1IS5A 3RIAA 5IT6A 3ME2A 2WDVA 2RM21 2J1UA 1CAUA 4A3XA 3ONJA 5CJ5A 5KXCA 4FP3A 2WINB 2EXIA 3C3VA 1J3PA 5FK7A 1CAVB 2XQYA 2D0UA 4EJRA 5F2WA 3JQXA 3ZSEA 5HV0A 3RNSA 4NR1A 2VBPA 4C90A 3KGZA 4JQTA 4EYUA 2HH9A 2AH2A 3VDBA 3TN91 4K0UA 4DV4T 5HV4A 1D0HA 5FZCA 1GNYA 1UCXA 2R061 3QBQA 2OUHA 1VALA 2J1RA 1JOPA 1AR73 2BDRA 3NAPC 4ASLA 4Q4W2 1RB8G 1GZTA 1RUF3 2VQ0A 4IDOA 2ZTNA 3DL3A 1GFF2 2R042 2PBIA 2PHXA 4MHRA 1IG0A 2DCJA 4BLJA 3ZPOA 3T8OA 4B3NA 4EAHA 2Q8DA 3ZKRA 4J1XA 1XNDA 3I1AA 1OLME 5B4NA 5J3UA 1L3JA 2D6NA 4FPGA 3UYJA 4BQ1A 3C8XA 3KVBA 3LFIA 3N9QA 2JG9B 3NAPB 2YG0A 2VZPA 3UT5E 4K21A 3K3OA 1WCKA 5C8CA 2F4PA 3E97A 4COUA 2VKJA 2GC0A 5KXJA 3ZYRA 2AEZA 2WSVA 3NRXA 2LS6A 1UZVA 2BV4A 2ZZQA 3RYPA 1YWKA 3ZFGA 1I3HA 3LSVA 4XFBA 3POYA 4UAPA 2DVFA 2XHKA 1UXXX 3ZFFA 4E27A 3FC0A 5K7PA 2JDMA 4UYBA 2OKXA 2BFUL 2VMEA 4EV0A 2ARBA 1BEV1 4EN9B 3OBAA 4XW3A 5J96B 5HEJA 1PM7A 3K8PC 1MR5A 4F8AA 4QPIB 3ECQA 1ZX5A 1AR93 1C3HA 1GNHA 1QJY1 5D21A 1QQP2 3NJYA 5JSRA 1CAUB 3V65A 3ZC0A 4RD7A 3K3QC 3WUCA 5C33A 1UKGA 1LU1A 1W9FA 5ANNA 1BR2A 5GLTA 2B5HA 4YG3A 3FE5A 2PLV2 4GH4A 1QKQA 3VHOA 2L3LA 2LJLA 3VBOC 2FJEA 2GP5A 2RR13 2V1DB 3PDYA 2CGPA 3AMQA 1CVNA 5JR2A 1YLLA 4GWIA 1UYZA 5DDJ1 5FMCA 3RZKA 4HZFA 3JB8A 1DZQA 1UOFA 2VW2A 3FMGA 3VBSC 3AE9A 2BS3A 1TQ5A 3R4SA 3OD0A 2JMHA 4WVVA 2GNTA 5FJKA 1MMNA 4YW5A 5C8CC 4QKFA 1B35A 3AA0B 3WHUA 4XTMA 4EN8B 4M1PA 4DV2T 4CZSA 3R0RA 2P9BA 2V26A 1SDDB 4NIHA 5LWBA 2UUAT 4CU6A 1RUE3 3ST7A 3RRDA 1AJKA 4RS5C 2IXHA 4LHNA 4L0PA 4OYJA 2WBLA 4HWFA 3EHKA 2CLYB 2TNFA 1G86A 4XDOA 5FZ7A 5I8SA 1COV1 2J1TA 4UF0A 5C8CB 2LUWA 2FCVA 1OSGA 3ILNA 2ES0A 5CBLA 2RM22 4XUTA 4M3CE 2XPJA 3O7OA 4CDQA 3AYAA 3ZFGB 3LKJA 4FFIA 2W61A 2WQ4A 2N9DA 5IWAT 4FFFA 2JMKA 3ZFFB 5FYZA 3SWHA 5DZFA 5FJHA 1OF3A 2H0BA 2VH9A 5IK8A 4QPYA 5D1IA 4ZZCA 3MIDA 3N35A 2PHLA 1M62A 4KP3C 2XAFB 3VKHA 3KSCA 4FI5A 1REEA 3K3NA 3VKOA 3HKEE 2C24A 4GJZA 4N53A 2YDQA 3ETUA 4CVUA 2WNVC 3APBA 5JOXA 3DV8A 3OBTA 3FZHB 1V9U3 1RUG3 2FDJA 1F5JA 4D6RA 3PU3A 2G1MA 2ZX3A 1G6NA 1BMV1 5FO7B 2XL9A 1MS4A 4Y33A 2W63A 3VZNA 1PMJX 3LDQB 4GH4B 3GN5A 2Y6HA 5T5LA 1ULDA 1N3OA 2WY2A 2OYZA 1C57A 4L97A 1DFQA 4AQSA 4HKAA 3H0OA 2V4VA 4XILA 2ZGSA 4AVVA 1S2BA 4PIZA 3R4UA 5LGUB 5BNOA 2WDBA 4FCAA 1LR5A 1WYCA 1Q43A 4B7EA 1KF6A 2J22A 4B1LA 1B35B 1DG6A 5IHYA 2D6OX 5CB7A 2E5LT 1KGYA 4GIQA 1IJ5A 5BY5A 4S2FA 5JZGC 1SQ4A 5JOYA 4UWDA 4KBMB 1RYYA 1BEV2 2KSRA 1U5IA 3N5LA 4MV2A 4YPJA 4EWEA 5K4LA 3PUSA 1CUNA 2BJSA 2ZEZA 2A1XA 3A5XA 1PGL1 3WZ1A 4UF0B 3O1UA 1TNRA 2D6MA 3MLLA 5IAXA 2W1SA 4AHXA 4CDQB 4N53C 3H3MA 4FXGB 2QZ3A 1LULA 1Y4WA 3T2OA 5LZ6A 3H37A 4AKRB 1X8EA 3PJQA 4LF7T 5HI0A 4W6XA 3WT3A 1I1EA 4JQRA 2A70A 5FYCA 4LO6B 4FQ4A 2B46X 2Y34A 1XNAA 1SBFA 1LNSA 4R9DA 3KDSE 1R1A3 4KBZA 3D0TA 2XQ7A 2VL8A 1U5ZA 5ETWA 4MGZE 5DDJ2 4FPLA 4N7UA 4XJUA 4A2UA 3AX4A 4N53B 1LAJA 1OEDA 1OA4A 2ERFA 4W8JA 2JDHA 3UUXB 5H6QB 3W15B 3A21A 3AE8A 3P4RA 3U4XA 4E8CA 4UVBB 3U4SA 1CONA 3LA3A 4LF8T 2W5FA 3WAKA 3I3BA 5BMVE 2WSUA 1ZBA3 5BNOC 1VBC3 4O4IE 5J09A 5C5UA 3DJBA 4O2BE 1ZRCA 1QMJA 5L3GB 5LBCA 3GN5B 2Y6LA 3RIUA 3J7HA 1B7TA 2FDGA 3HWJA 5LK5A 1F31A 1N1TA 2C5IT 2VQET 2ES3A 2HH7A 3VUOA 5A32A 1COV2 2H88A 1W2NA 1UZWA 5BNOB 5DXDA 1AX1A 2ZHNA 4YW3A 2XQ4A 4AE2A 4ILCA 1W04A 3NNGA 3ZEFB 3P5BA 4YW6A 1F35A 2CCQA 4Z82A 1RMU3 1UY0A 1JS9A 3ZN4A 4GZ9A 3ZYBA 4NPRA 1JZ3A 2J1VA 4E4ZA 2XLFA 3T0BA 4LHSA 4EZHA 2WT0A 3VL9A 1MNEA 5IJRA 3AC0A 5HAXA 4G9SB 2MPKA 1MS9A 1PGW1 4DIDB 2BNNA 1POQA 1RVF1 1WW5A 3R6NA 3NJZA 4JI4T 2OXBA 5FYHA 2ZBJA 1OEDC 3IDAA 2KXLA 2RG4A 2DVAA 2TEPA 1W8UA 1A8MA 1K12A 1BMV2 2LLYA 5FP3A 4BE3A 2GC2A 1A34A 1WBFA 4AW7A 4AHYA 2XY8B 2EIGA 2WL1A 4Y24A 4CP2A 1NAEA 1G9CA 4YXDA 4H7LA 1IG3A 1O3SA 2PTMA 3I2DA 5L9BA 1A8DA 1OEDB 1HR0T 1QOTA 4I09A 1Q8VA 2Y8DA 3PTYA 1WW7A 3UUNA 2JE9A 4AHWA 5LBEA 3OPCA 2C5DA 4HVQA 4MHCA 4HKOA 2X66A 4LO7A 1RHI3 2Z79A 1O3QA 3G6JB 1MZEA 1PO11 5JDBA 4AI1A 3H1MA 3T1YT 2WU5A 4ZONA 3ZYKA 2AGSA 2IVJA 3R84B 1ZRIA 3ZSLA 5CADA 3HKBE 4LQRA 4QU2A 4HEAA 1W8ZA 1J1TA 2ZGOA 2BW8A 4YZ1A 2UUCT 2C9AA 4W4ZA 5A32B 4KNCA 1PGL2 4JGZA 4QQ2A 1LTEA 5LGNB 5FO8B 1ULGA 2QCSB 4ZHNA 4DRRA 3QUJA 1UY3A 5KHGA 2WIIB 4X1KE 5GLVA 4HK8A 2GMMA 1OBNA 5KMGP 3ZN5A 3N7JA 4PQQA 2XAGB 4ZPIA 3BVCA 4W65A 4TN7A 4MLOA 1R091 4YSZA 3CZJA 4DBRA 3ZYIB 5LATA 1CAXA 5C3PA 5A7OA 3K51A 4TWFA 1IPJA 4FI9A 2VTXJ 4XF4A 3EVYA 4KHZF 1ENQA 5J37A 4Q1RA 1EYBA 3RS6A 4Q25A 2MBGA 1IKPA 4CQIA 4JKMA 4Q4W3 4JBWF 3VDDA 4CEWC 3EXUA 2J1DG 4IEUA 5LMNT 4QD2A 2R043 2QA7A 2QE3A 4LLOA 2M6BA 2FJBA 4NRMA 2GN3A 1OT5A 4KMQA 5A6QA 5ABFA 2QQIA 5JVDE 1E5RA 3CEWA 4AFCA 5FIXA 4ASMB 4KX6A 2D6LX 4KMCA 4I3PA 3ZXLA 4YSYA 3MW4A 3ZT5A 1NT0A 3S7IA 2OV9A 3FBLA 4QX7A 2EICA 3WW2A 1GBGA 3HD8B 3UKVA 3AFGA 1AX0A 2HN1A 4EIWA 3MZKB 4FTSA 1UW8A 4NHYA 1HQNA 3K2OA 5FZFA 3OUHA 5FWJA 2HWB1 3H8RA 1C5IA 2P4EA 3OEBA 3B93A 4LXLA 4IL4A 3P3NA 5EFUA 3ABZA 3ENRA 3T1LA 4Y20A 5FY7A 1QQP3 4QDRA 4YFSA 2BS4A 1PGW2 2RMU1 4JGZB 4KUMB 3PNAA 3CX7B 3QH7A 1KEXA 4CP0A 4QX2A 3ACHA 1RVF2 4FPOB 2G0UA 1G9DA 2Y6XA 4XHXA 5LOVE 2W95A 5L9VA 1PM4A 3H1WA 3WDUA 4Y1ZA 2OPWA 2XQRA 3FLTA 1BBT1 3GMIA 2PLV3 1PZ9A 1O6UA 3OJBA 4CCEA 3ETPA 3O0VA 2A3XA 4TN7B 4PAGA 2LSYA 3DUIA 3H1YA 5FYVA 1OVSA 1QU0A 3RYKA 1CAXB 2W08A 3WQ0A 2WAAA 4RHV2 5CG9A 1L7QA 2VCBA 1JZ8A 1PX4A 3C7OA 2JG8C 2DVGA 2K5BB 5GZCA 1OOPA 1JUHA 4HK9A 4I43B 2CWOA 1OA2A 4P02B 1YJLA 1GWLA 4JUYA 3VDDB 1YQ4A 4FQZA 2KNDA 3E0ZA 1UF2C 3WF2A 4O4HE 2FDKA 2HWC2 2DCKA 3CIHA 2VUDA 5C9AA 5LRRA 2RVAA 4UFIA 3VD3A 1PO12 2BWCA 4YJ2E 2CY6A 5ABFB 4XABA 3AYDA 3HOBA 1UOGA 3AJZA 2Y6JA 4X8PA 5KXDA 5EJ3A 2X9HA 1JUIA 3IDBB 1BLZA 3RMXA 4IE4A 2W9XA 2CMRA 4OUEA 4ANJA 3KD4A 4BOWA 3E5UA 2A5ZA 2YPDA 3CL1A 2RM23 1QNYA 2W62A 1WCSA 5KHIA 4QX7B 4YW1A 2PTFA 5F1RA 1V9DA 5HEGA 4A4AA 4UVCB 3WLUA 4ILUA 3Q2MA 4XDPA 1IGOA 4S2GA 1LESA 5F32A 2QUOA 1W09A 4ILBA 3MFCA 3OVUA 4PBPA 1R092 4OYKA 5IAVA 3VB9A 2J62A 3VL8A 1WZXA 1ZVFA 4GALA 2X51A 4Y1YA 4MH0E 4Y20B 4Z92B 1UU5A 4TZDA 4ZEYA 1ZRFA 1SCRA 4R52A 5L73A 3KB5A 5F37A 4IGPA 3B5LB 2ZHMA 3JC6C 4YFWA 2D6KA 3HA4A 1JZ2A 1LKNA 4EN7B 1WRDA 4PIYA 4DINB 3MICA 1OOPC 3USUA 3AMNA 4OI2A 4IDQA 4CN1A 2NOXA 3OGSA 1D2SA 4MVTA 2QVAA 4B4PA 3J4UH 1QY4A 3W58A 4E2GA 1WCDJ 3URFA 4ISSA 4XCAA 4GKKT 2ENRA 4OHWA 3CQGB 3WUDA 1IBKT 1H7CA 4XIOA 2FZ1A 4LMKA 1PNFA 2AR6A 1XE0A 3ITQA 2XKOA 3L9JT 1OOPB 4H9OC 2WP9A 4L8QA 1YXWA 2XLGA 1KNPA 1UMIA 1UU4A 1UY2A 2VMIA 4IXLA 5FPLA 3WAJA 3ZXFA 3AKTA 2WFPA 2XSAA 2VKOA 4P1NA 2ZM2A 3ZLIA 2I59A 1JOBA 5C9AB 3MIGA 5FY8A 5F5WA 4NAMA 2HWB2 1NKGA 2A6XA 4RGAA 3ACLA 4RQPB 1BEV3 2CAVA 2LSKA 3OGVA 5JLVA 2EIBA 2UXBT 5HWYA 3RGLA 4GWJA 2ID4A 3U11A 4XJZA 4DRVA 3O12A 4UV8B 3RQWA 1CZSA 3ZFEC 1PK6C 2RMU2 5F3CA 4JYAT 3KLSA 3FBZA 3RZLA 3FFZA 2XJPA 5FAXA 4XFCA 3UK9A 2LM9A 4KGGA 5JDLA 5G05L 3KQ4B 3CIRA 5H9SA 1UAIA 4H63V 3CVRA 3I3DA 1BBT2 3FXEB 1XMOT 4CUGA 1GYKA 2JPFA 3KV9A 4DR3T 1PMHX 2WT2A 2IVIB 5F8PA 3IBMA 4ORFA 3UKTA 4GD4A 5D8AA 4C8DA 2P37A 5DDJ3 3AYCA 4EEDA 2ZGKA 3LFMA 2Q4SA 4DIQA 4LF6T 4B3RT 4DEVA 1X36A 1RJ7A 3RPQA 3W9AA 1DYOA 4JRAA 5T5OA 4Y1XA 5E89A 4M4PA 1QJX1 4Y22A 3SKJE 5F5QA 3H9AA 2CBJA 5FBJA 2DVBA 4YLHA 2VQTA 2L8KA 4NROA 5CA1E 4BK4A 1LRZA 2W2IA 2LE8A 4DR7T 4KG0A 1US3A 1U5YA 2D3SA 3NNFA 3S5AA 2JIWA 4U2YA 1F15A 1VMJA 3TLUA 4U33A 3C2UA 5ABGA 4YG6A 1COV3 5H9PA 1VBA1 1NQDA 4CA9A 5A3NA 1M4WA 3ZXEA 4LMLA 5F3EA 4O4LE 2O14A 3AZVA 2OT7A 1S0JA 5GZFA 5LP6E 4R9AA 2NN8A 4QX0A 5B4XA 3NO8A 3T08A 5HXEA 3WCSA 4OI1A 1JXNA 1KK7A 4NAOA 2WWUA 3Q8CA 1WW4A 2V4AA 2YU1A 3BPSA 4V1PA 2WO2A 2YUEA 4ZS3A 5FMOL 5BYNA 1JYXA 2XG3A 4BH9A 2UY9A 5J48A 2YK0A 5AC91 4TNVA 1D0GA 5C8WA 4FO9A 5L47A 3H3UA 5DQWA 2ORZA 4LUMA 4LA3A 5D8AC 3ABVA 4ONUA 2Q9QC 1OMIA 4ZI2C 4CP9A 1ND2A 1NCQC 2E9XC 1IS4A 2XJTA 1W2UA 2V09A 4QDQA 5CZKA 4F83A 5JDGA 3LSEA 1MACA 4UFKA 2X05A 3RDIA 1VP6A 3F2ZA 5D8AB 3C7HA 2DFCA 4QGMA 4OYUA 3WEZA 4MUVA 3R4DB 2X8KA 3DYPA 1OWAA 5CA0E 4LKEA 1UUSA 2CXDA 2XHEB 2WB5A 4EE2A 2WDRA 1V6JA 2UXDT 5IVVA 5HCHA 1Z78A 3MI8A 3GZAA 2VASA 4UOJA 1LOCA 3ZR5A 2D5UA 4Y22B 1KDKA 3ZR6A 3LIGA 4CU7A 2X0LB 4J25A 1YRZA 3VZKA 5FKYA 2NPIA 3SMHA 3BK9A 4D8MA 2WA3A 1NY71 4XVHA 4QH4A 2Q1ZB 5FY4A 2ADEA 4XMAA 4XF0A 2FMDA 4LKSA 4B1MA 5JPMB 4OMDA 3PUZF 4HE8A 2VCAA 2F4LA 1YNAA 5BNPC 5CA6A 2CEAA 1HJFA 2GSYA 4DR1T 1NA1A 4NXNT 2K46A 3RH3A 1XDOA 4YZ4A 1AL0G 4XF9A 2YINA 3O1OA 4LFBT 1QOSA 5JIUA 2HWD2 1XXNA 4XZPA 4AI0A 4FPFA 1Z8UA 2XL7A 3A22A 1C28A 2N1GA 4OHZA 4WZXA 2Q30A 2D5FA 3SCHA 4BWOA 1JODA 1ND2C 2BYVE 4LLFA 4LOSA 3ZN0B 2X29A 3O1JA 2VCMA 4LBQA 5KR7A 1HV1A 5DAXA 1VMFA 2ZX4A 3HVDA 3AEDA 5J2TE 3RLFF 2NR4A 3U3IA 4HFCA 2QTWB 4BB3A 1Q8PA 4IIJE 3UU4A 3HQRA 1HLCA 3LEKA 4E8DA 3F2EA 4BU2A 2Q1MA 1EZ3A 1IPSA 1QJX2 4NPMA 4CP9B 4E7ZA 4UW6A 4BQWA 1ND2B 1QJZA 5G04L 2D40A 3IZOA 4COVA 1CAWA 1T6BX 4O7XA 1H0BA 2W46A 1AL22 1J3RA 2OZJA 3AVSA 2WO1A 4AFMA 3WNLA 3O1VA 3LOBA 4ZU5A 4ATFA 3BU0A 1UIJA 5FZDA 4MXWA 4U3CA 1VBA2 2MTQA 1JZ4A 2QQKA 3NKTA 3CKDA 3BALA 3LGRA 1VAKA 1BKZA 4NE9A 4NHMA 1SHWB 5CNAA 3NV3A 1ACCA 5FPVA 4Z91A 2OX0A 4HWIB 3AE1A 1OEDE 2W1WA 1SPPA 1BCXA 4YHHT 3AEGA 5AQGB 3KCCA 2H3RA 3NJXA 5FZAA 1UURA 5IW0A 3FZLB 2ZGNA 1Y3TA 1UZYA 1FJGT 2JQHA 5J0ZA 5L3DB 4Z07A 4FPKA 4UFLA 2VB6A 4LO5B 1NE6A 5AC92 1DHKB 1XU2A 2JDZA 3KMHA 5FZ9A 4XFHA 3OEAA 3H50A 1NA1B 1ULEA 1RVF3 3I9WA 2VUCA 3L09A 4AEDC 2NLRA 3V64A 1PVXA 2KA3A 2IUWA 4MO3M 3LK2B 4IT4A 3NQHA 1W6OA 1RIRA 4COZA 3MF9A 1W0PA 3SH5A 4DS0A 2YOEA 3ZMSB 4PLMA 4OHVA 5F7UA 4CYDA 2DDUA 1HRI1 3OGRA 4KG8A 4P00B 5C8YE 5DN2A 4K8FA 4CDXA 4ITCA 4RHV3 1SE7A 2HEYF 4JTNA 1POV0 1SUMB 3WF1A 3Q8EA 2C4XA 4NHLA 4Q0SA 3Q8AA 4W6WA 4ZKTB 4AQGA 2GALA 1UQXA 3DXTA 4DUVA 1WA6X 3MO4A 5CYYA 1VIWB 3AKRA 3ZC1A 2ZX1A 3DEMA 5JSPA 4ZZ8A 1NCRA 2HWC3 5CB4E 2ZKNA 5AVAA 3WDWA 4AFDA 1N1YA 1W2OA 1PO13 1T2XA 4E9KA 2A75A 1YW0A 2ET1A 4CUAA 1CAWB 1NY72 1V00A 3DGTA 4BJNA 4YRDA 3P4PA 5FV3A 2WN3A 4JI8T 2WZIA 3C7GA 4MXWB 2IXJA 3PMEA 1W05A 1OLRA 4PI0A 4AZZA 4N90A 4AISA 3KHBA 4LTAA 2K9AA 4DEQA 3U37A 5A6ZA 4A7ZA 3UV9A 2ZOEB 1OD5A 4N43A 1MIVA 5ACA1 4L2NA 1OQ1A 4XJ9A 1RXFA 1GZWA 5FY1A 5JI9A 1OURA 1SPPB 2XONA 4QAWA 3VV1A 4K7JA 3M3IA 2VQAA 5LBQB 1R093 3OGGA 2HPJA 2QQNA 1U12A 1GOHA 2YGMA 3K75B 1NLRA 2VTXA 2ZZJA 4P9GA 2ARCA 2OA5A 3GALA 4GYSA 2B9UA 4JI5T 2GC1A 2P1BA 5FVKA 4KU7A 1O5UA 3C7FA 4HVRA 5JOWA 1GZ9A 3ELNA 1OPOA 2P5BA 4PLNA 3CJIA 3ZJ1A 1CN1A 1ZRRA 2AREA 4I0WB 4EWDA 2W92A 3C7EA 3POEA 4PJJA 1LHNA 3S57A 5A80A 1W6OB 2VY0A 2HPLA 3VZJA 4L92A 3H3ZA 4UV9B 4X1IE 3VZMA 4QXHA 3MKDA 3ACGA 1QH6A 4Y4RA 1NCRC 1EV11 1EAH1 2CYFA 1RTVA 4XF1A 4CDXB 3SC7X 4CCNA 2WZ8A 2V7JA 3VU7H 2VNVA 2X0YA 4MBQA 3GJBA 3RFRA 1UY1A 3POWA 5HXCA 3AA7B 2KR2A 2WDQA 1H4GA 3I2HA 2YFUA 5DZGA 1MPXA 3VZOA 1W2TA 1MIYA 2WNUC 3GBWA 1NCRB 2XWJB 2W0XA 2JDAA 3GGLA 4XZUG 2IMLA 1XQNA 2HWB3 3RYIE 2VQUA 1OLQA 1QEXA 5GJ6A 3RZJA 1KDMA 5LMUT 2EXJA 2EAKA 5E6HA 4YVWB 3IF8B 1K3IA 4HANA 2UWBA 4LEJA 4XPVA 1ZZ7A 2RMU3 3FN9A 2E7TA 4FOWA 4UEMA 1AVBA 4FFGA 4N43B 3E5QA 2QDRA 3VD5A 2DYCA 1BBT3 2G9FA 2XQAA 3AE4A 3OPWA 4QQPA 1GZWB 3CJIC 5IVYA 5LNKA 4BJMA 2CTVA 1SLIA 1E2AA 3PTRB 1PX3A 1W8FA 4LUKA 2VPVA 4XC9A 5JI7A 4S2HA 1SACA 1HRI2 5ADXL 3DKWA 4ZU7A 3N2GE 2D3PA 4EYYR 2IHR1 2W3JA 1IBLT 2G19A 4DMIA 4OHFA 3A4UA 1X9TA 5I0UA 1FOD1 2VZOA 1WGPA 1W06A 3AM2A 4XUOA 2NMNA 5HCMA 4PK5A 4JI6T 2VMHA 5FZBA 3ALQA 3H7YA 2ZJCA 4XACA 3D6EA 5APAA 2KM2A 4MXVA 3OY8A 4QXHB 5JMCA 1AYN1 5LXTE 4IEWA 4HTEA 3IPVB 2VOTA 2BOJA 2CWSA 4CTEA 4CE8A 1VOMA 1XPWA 3T0DA 1QJU1 4CXXA 2W1UA 3KF3A 4ZOLE 1ZHCA 1W0NA 3WDXA 1NYWA 5JDFA 5L4HA 2KD7A 2A2FX 5FUNA 5ACA2 3I2KA 2VW1A 1LOBA 3RYRA 3MW2A 5LA9A 1ENXA 3VDAA 4WBOA 3MBWA 5CIRA 3WDVA 2DLRA 2Q8EA 1TNFA 5FTTC 1JYIA 1Z0HA 4HFEA 4CCKA 1ZZ6A 3ZDVA 4CPBA 5A6XA 4XOGA 1HRV1 3ZMUB 4FOYA 1V6OA 4PF5A 3WHTA 2I45A 3QOPA 2XQXA 2K2SA 4H2AA 4DUYT 4XUPA 2I0MA 2D0TA 2WAUA 1SDWA 1U5PA 4QPGA 2P3IA 2PAKA 2JDYA 3EO6A 4H55A 1W6QB 4FTEA 2YDSA 1US7B 1IAPA 3VKGA 5EIYB 4RSUA 2QZ2A 1EV12 1EAH2 1JZ7A 4MGKE 2XUMA 3ZSTA 3WNPA 2W94A 5JWPA 4P9JA 2PJQA 4SLIA 2VKHA 3NKGA 4IE7A 3UULA 1D0YA 1TME1 4CDUB 2XPKA 2V73A 5FLHA 4L99A 3NV2A 1YXRA 1K42A 2UXCT 2IFRA 4C0HA 1H2NA 3HKDE 2JIJA 3S7EA 4YM3A 2CA5A 3NSTA 4Q4X1 4H9QC 2BBAA 4JX0A 2BZDA 4HWCA 2E33A 4NIAA 1YYNA 2JJ6A 3AAAB 2C9KA 3IDCB 2A6WA 1PGSA 3OKQA 3OY8B 2VJXA 4CXYA 1AR81 4Q2FA 1LGBA 3GM8A 3VBHA 4JCKA 2XMLA 3GHMA 5A3OA 5FZKA 5HWXA 5B2GB 3U14A 2CV6A 1SLTA 4U31A 1S0EA 2HWD3 4EQVA 3M8LA 4TNWA 2V8SV 1LEDA 3J8F1 1SLAA 3ZDSA 3AB3B 1DQ6A 4GK0E 4QPGC 3O0WA 3MA9A 5A3WA 3ZM8A 5FY0A 3TLWA 2FQPA 2D5HA 5LJMA 3TB0A 3PJYA 3ZSKA 5ERLA 2VXJA 2YU2A 1STMA 2ZA9A 4FVVA 5BV6A 1KFXL 3WG1A 2WA4A 3MF6A 1FOD2 3HR0A 4A7YA 2D98A 1FPN1 1TEIA 3F31A 4ZXLA 1QJX3 3N9PA 2W47A 4QPGB 4TXWA 3WP5A 5FY5A 1KJLA 4IESA 4MGYE 3WD5A 3WW1A 2XBO1 2BPA2 1AL23 4AVSA 2A3WA 4JZRA 4NIDA 3PUYF 4AR2A 4Q26A 2OQ7A 2EA7A 3ZYJB 5EK4A 2BP6A 3AMMA 3I9YA 1VBA3 3T3YA 1DCSA 4MLKA 1XNCA 4V2VA 2PN5A 1QJU2 1FNYA 3LA7A 4H9RC 2IC6A 1YI9A 3TEYA 4XXAA 2SPCA 2JIGA 2WT1A 1ZM1A 2ZS6B 3UTKA 4PBOA 5L4EA 4AQFA 2QYWA 2XQ9A 5SV8A 3ZYPA 1FAYA 1HQLA 1NWMX 3S6PA 2QQUA 3KBTA 4PDWA 1JHNA 4TLFA 4EROA 2VMGA 3VBHB 5AC93 3RZGA 4N9HA 1HRV2 1S2KA 4DV6T 3FBMA 5FZ0A 4IL9A 3IMMA 3Q5DA 1K5MA 3O1MA 1CESA 2R32A 1AUYA 4XE9A 1YKHB 4FTBA 4OHXA 3CO2A 2VTFA 3ZYMA 5JXJA 4QWNA 1SFPA 1D1CA 4H9PC 4A56A 2HWE1 1VMHA 4U74A 3LK3B 4PT6A 4IGUA 2CBIA 4WNKA 3VN4A 1X33A 2A72A 1JTZX 3X29B 4LULA 1H8TA 1R082 2JQQA 4L9IA 3RC3A 1EY2A 4Q4Y1 1VCSA 4UIGA 2BGOA 3ORJA 2YN6A 3SHRA 3ZKUA 3WCRA 2VNRA 4BMBA 1P8JA 2YDRA 3UUMA 2N2NA 1TME2 1XC6A 1SFNA 3VGIA 4CPBD 4HBNA 3FXDB 3VKNA 5FXZA 2ZEYA 1CJDA 4Q4X2 1H4HA 2DCYA 2MYSA 5FXWA 2YC4A 4TV8E 4XBNA 1UYYA 1L0VA 2BRTA 1PIV1 4CI1B 4TZ4C 2RJKA 5FPZA 2FJAA 4O61A 5K0UA 1W3XA 2ZABA 5KHHA 1MS1A 3PIGA 4ARXA 2BU9A 1F4HA 1OLMA 1AR82 3THDA 4DV0T 1VBB1 1ZYBA 1HNXT 5E88A 2B1EA 3EAMA 1OXCA 2XZEA 4AQFC 1TVGA 4QPIA 2NW8A 4PW8A 4O65A 3IMNA 4KWUA 1AJ3A 3H3AA 4AGGA 2Y64A 4ZI7E 4QHZA 4FPHA 1G73A 5I0DA 3LE0A 2VE1A 2UWCA 2YC0A 2BKPA 2C0SA 4JHZA 2CWMA 3M1HA 3J8F2 4IE6A 2XB6C 3RYHE 3MIEA 4PFOA 5L19A 4AKLA 4ET7A 4N7IA 2E26A 2P3YA 3NWIA 1WA4A 2CHOA 4K9SA 1RUF1 3LQCA 4PDWB 2RDNA 4K1ZA 3VRBA 4QXCA 3N7LA 5C3SA 2VULA 1NZIA 4HKLA 4V1Av 1K5MB 3BN6A 5FYIA 1W8HA 3V0AA 2D7FA 5I91A 2EIDA 1XSRA 2LHNA 3N9MA 4GK5E 2GH8A 4YLZA 1FPN2 4QWNB 4WYVA 3F95A 2Z5WA 2WZHA 2JG9C 4EOZB 3J7NA 4AI8A 1E57A 4XIKA 2BQPA 1RC6A 4OUSA 3P3PA 3KVAA 4LBNA 3MIHA 1W28A 4B4QA 2XBO2 4Q0QA 3WG3A 2KWIB 3BOPA 1H8TB 3POSA 1V70A 3EHZA 5F39A 1H1IA 1LOGA 2JRKA 1C8M1 1YQ5A 4C91A 4A41A 4PLOA 1E5HA 4DQAA 3RWNA 1SA0E 2AENA 4KU8A 4LK6A 5EXOA 1LKXA 1H1MA 3D4KA 4BCUA 2XVKA 1YFXA 2R6QA 4QPIC 5IVCA 2XASB 4GKXA 4YNIA 1JI6A 2OLTA 3T4VA 3OTOT 5AQHB 1GP6A 3KT7A 3RWKX 1UKRA 3LPFA 5K0UB 2Q5TA 1FV3A 3M3QA 3ES4A 4XJAA 3NWKA 4K8RB 2FCTA 3HQXA 3HI2A 3MK7C 4I0BA 5FYSA 3EI0A 1YQ6A 2J47A 5FZGA 1YQ3A 1IPKA 3RGBA 4IERA 1NLSA 4G4FA 4M3CA 3LCPA 5DUWA 4BQ4A 2GC3A 2LSJA 2AEYA 2E32A 3HT1A 1W6NA 4IEPA 3SCFA 1Q3EA 1HJGA 3MFAA 2HWE2 3WQ7A 5EK2A 1JYCA 2QVSB 2XAJB 4AHZA 2ZGUA 5F2SA 4AOCA 4HFIA 4NUUA 4JI7T 1HRI3 1GKBA 4QHBA 4Q4Y2 5IATA 3O1PA 1VAMA 4QXCB 5F5AA 3MXZA 1NEKA 2M67A 5EP9A 4NVPA 3BTAA 1MZ6A 2ET7A 3RG0A 3WNMA 4B8EA 2HYKA 3V0AB 3PDQA 4GWMA 5IFTA 2XJSA 4CDWB 4PJMA 4A6SA 4DV1T 5FUPA 4G2AA 4O4JE 1F2NA 1GQGA 2WQZC 2CLYC 5FLJA 4E4HA 5BNNA 3ZXDA 1M06G 2OA2A 3ROUA 2IIUA 4AEJA 1ZA7A 5JXHA 3D0SA 4DZGA 3T1HT 3NNLA 3SXWA 1AX2A 5JRCA 3UNPA 1PIV2 2VD7A 1C4RA 3Q8BA 4CI3B 5FOBB 4IW3A 3ZFGC 3I3MA 1E5IA 2JE7A 1I94T 4NOTA 5LBFA 2OW4A 3NV1A 4X6QB 5AQRB 4QHOA 3ZFFC 3V5UA 1VBB2 2G4IA 4GWNA 2UY8A 1T98A 1BVP1 4MFRA 3WI3A 1OD3A 2BVVA 4P0BA 4JV5T 2I07B 1BK1A 3P1IA 4I2OA 5CFDA 5GLUA 1AYM1 3T0AA 2DFBA 4CRQA 5ACA3 3DPRA 2WCAA 1T7SA 3POJA 3PIJA 3CMLA 1DYPA 2YGLA 3UU5A 1EUUA 2AC1A 1UL9A 2J1SA 1TMF1 5A3LA 4AI9A 3WOGA 4YJ3E 2ZEXA 4DXSA 4KL1A 4HMZA 4RYDA 4AKIA 4XTPA 2DTWA 5LHIB 3KV5A 3NNMA 5HEOA 3TN92 5FYYA 5JOZA 4GH4C 4A42A 2C0ZA 1DGRA 1PVC1 3TBDA 4XMIA 2R062 3N9NA 4IETA 1OA3A 4XUQA 4QKDA 4M3CB 2P34A 1V6LA 3LOIA 1L7LA 2BTVC 3CPZA 4UBGA 1BR1A 1NX9A 1W6NB 3PUAA 3OUJA 3PUQA 3BUCA 4Z2WA 3WNKA 3ZCJA 3FLRA 1XE7A 5D2AA 5FVLA 3U10A 3JZVA 2BVLA 1EV13 1EAH3 1B35C 1OVPA 3UGFA 4GIWA 1LHUA 2VG9A 3IEEA 2FDFA 2RJLA 1O4YA 4YZ2A 1DGWX 1AZDA 5EJ1B 2NTXA 4M00A 1C8M2 2E2AA 4QMAA 5GKAC 1X50A 3AVRA 2BNMA 5E16A 2IUBA 3LDBA 1OXZA 4FT8A 5M0TA 4KBBA 5GLZA 1JZ5A 1VB2A 3OCPA 1J5WA 5BNNB 5A33A 1IQDC 2NP0A 1UCUA 1VR3A 5LEKA 2QNKA 5CAZA 5JRCB 5LY1A 2QKDA 4C0BA 4CDQC 3Q5XA 3AP9A 3RI9A 2GK9A 1WCQA 2P6CA 5DQ0A 2YPJA 3BIEA 4ISQA 3THTA 3OYXA 5JQGE 2YKSA 5LHHB 3B69A 1HX1B 4KHPT 1OC1A 1UXZA 5A1LA 1NG0A 1QJY2 1HB4A 4S2DA 4JKLA 5E1RA 2RDSA 5HXVA 3RI5A 5FR3A 5CFDB 5I0RA 1IKQA 1R1A1 4DPNA 5FYUA 3PLQA 1H2KA 3G7DA 3DPRB 2VL0A 5F3GA 4DB5A 3UFEA 3VHPA 1I5PA 1N33T 1JBCA 3B00A 2B4KA 1RGSA 3ZT7A 1YQ8A 4A44A 2X9XA 2NWBA 3BODA 4YG0A 1H9PA 1J1LA 5LA2A 1UMHA 1OUSA 3IWZA 1ZBA1 3KINB 1GUIA 4OQ9A 2CDPA 3H8UA 1FNZA 4EXTA 4KWLA 4JI0T 5LY2A 1WYBA 2VVSA 3LA2A 1Z7S1 4ISTA 1FOD3 5IWFA 3AEFA 2MHFA 2LT3A 2LRPA 2ARAA 1ZZBA 5J7MA 2ZGPA 1VCTA 1OPMA 3LBXA 3PVOA 4HFHA 2UU9T 1HN0A 4RFT0 1VBE1 5HCAA 5L36A 3C4XA 2UWAA 3AP5A 1UGOA 4AFAA 4BMEA 2ZXQA 4P9XA 3MACA 1X9PA 5CVRA 2W4XA 5AQFB 5I0TA 2CHHA 1H8VA 1MMGA 1WUVA 1HTJF 4NXMT 1CWPA 3WDTA 4GJYA 3JAEA 3L3PA 1POV3 5KXEA 4AI6A 1W8OA 3GXUA 5FNVE 2NMOA 3HNYM 2AUYA 4LIVA 1ULFA 3JXSA 4OVEA 1RMU1 1OQEA 5FRAA 1PO21 3SITA 1QJU3 3SNMA 3LAGA 3RZHA 3BOWA 4L9BA 2RE9A 4E4SA 3AAEB 1AYM2 2WU2A 2EIEA 5A33B 2OIIA 1GP4A 2DHRA 4TWTA 2HN2A 1UK5A 2P3JA 4I30A 2GMEA 1NZCA 1ODNA 2WNEA 1TMF2 1JNZA 2HJIA 5A3UA 1ENRA 1G9FA 5BPXA 5HXSA 2P6HA 4JI1T 1AXZA 3FHIB 1SEFA 1LOFA 1RUC1 3CBNA 3N3HA 4YW2A 1HRV3 1HB2A 2W91A 1W2AX 3SRZA 2NW9A 5T5JA 3SQOA 3Q9OA 4Y1VA 3RVHA 2DF7A 1D1BA 3NW4A 1PVC2 2ZMAA 1T6GC 2DCTA 3AMPA 4Q5OA 3EDVA 4RL7A 2V7KA 1LB2A 2PQSA 1IZNB 3MUZ1 4P9YA 5IVEA 1WD3A 1ZP0A 4GULA 2D2SA 2V5YA 5L3CB 3ZO0B 4ARYA 3M3ZB 2GAUA 3MLKA 1DU3D 4GMP0 1MEC1 3AK0A 5AVPA 4P9WA 3W20A 3PU8A 2EXHA 1G7YA 1R083 2IFWA 3H3LA 4PNIA 4JAAA 1I5ZA 1LEMA 4GA9A 4LOTA 1Y43B 2ZGRA 2N7GA 3B01A 3O1TA 4AAXA 1QXJA 3KV6A 1ND3A 5FUIA 1TME3 2DWRA 3RIUC 2E5VA 4AYUA 4OZXA 1WLCA 4IE5A 4QXBA 3GZEA 5A1FA 4G63A 4OLLA 3LBXB 3THCA 5FP4A 3KM5A 4JHTA 2WO7A 4Q4X3 2A7AA 2CWYA 3ZXGA 4U7IA 4HFBA 3ILRA 3AZXA 4BIFA 4K40A 4WVWA 3FLPA 2BZBA 2ZHKA 4IEYA 4ZI3D 5AQPB 1XNTA 3ZPYA 1AR83 3H7JA 3KCXA 3UQ4A 1HS7A 3KCYA 2RA1A 5FZEA 4AQTA 1W39A 1CHUA 2Y6KA 2LEHA 4JGYB 2RV9A 5C71A 1WLTA 2CRBA 1YQ2A 4YGBA 1Y64B 4Y5TA 3HR9A 3HNMA 2MNGA 5JH7E 3GZTB 2A3YA 3U0ZA 3AXDA 5DZEA 2XM1A 1GWMA 2C5KT 2XSBA 2BGCA 2CGOA 3A7QA 4LE4A 1AJOA 5FDBA 3E6CC 3EQEA 3NMBA 4AI2A 4HN0A 3J8F3 5LA6E 1WMEA 3PL0A 3KGLA 4BXSV 3FB2A 4BXFA 4BJ0A 2MOZA 4Q4W1 5CFCB 5L7OA 1FEWA 2YY1A 2KLQA 3PV0F 2R041 3I3QA 3VRAA 1LHOA 5KHJA 4PQ9A 4IQPA 3JQWA 1G9BA 2Z42A 5H9QA 2JENA 4BM8A 1Z7S2 3WNXA 2ODVA 2VU9A 2IXCA 4YVSB 3VD7A 2L9LA 2WLQA 4TSVA 1FPN3 2B7YA 2JB4A 1GV9A 1ND3C 2UYAA 2JDNA 2PFWA 5IVBA 1VBE2 1WMFA 1X8MA 2CSGA 4NHKA 4UW3A 1US2A 5DAWA 1LJ7A 1XNRT 3N2KE 2XBO3 2CM0A 2ZM0A 3H42B 4RN5A 5LCWL 2RPAA 5EPAA 4QDSA 3WP4A 3FHAA 3TOJA 3OUIA 3KQRA 3W59A 3AP7A 1ND3B 3RZZA 2CXFA 2C26A 1PO22 5J36A 4AKGA 1GP5A 4DR6T 4QXBB 4B3MT 4UFHA 3BTYA 2Q0AA 2R49A 2DL1A 2BKOA 4UR9A 3BI3A 2B9VA 1QXRA 4JGZC 3KS7A 3MV01 1LODA 3SKVA 4OHYA 1OHFA 3OTFA 2X67A 4EZ4A 2JKXA 1T72A 4BLIA 3KHCA 2R071 5C3RA 3RC8A 5FPBA 1JU3A 5IVFA 1GZCA 1RUC2 1ZEEA 2BBVA 1S0FA 2XVGA 4BZ4A 4E2QA 4MSVA 4QM8A 3M3EA 4CZZB 4NRPA 3P4SA 3POIA 3B57A 1GU3A 4CCOA 4ASKA 1YUDA 2DV9A 4YGEA 4CP1A 2VVDA 2R16A 2HWE3 2UURA 2P2KA 1EP0A 4B4RA 3BB6A 3VD4A 5LJNA 4E2SA 2W67A 1MEC2 2YHJA 2XJUA 3VDDC 1QUUA 2K9ZA 3FHNA 4QGNA 2IW5B 3ACFA 3PJAJ 3AE5A 3K4AA 5FKCA 5DUXA 4Q4Y3 4GXLA 4LKDA 5L7OB 5HXHA 3FL7A 4XQDA 3JCIA 1DBNA 1APNA 2KWHA 2XOMA 4F6RC 5FPXA 3QCWA 4I0UA 5F6KA 2PFVA 2FDHA 4YW4A 3RHWA 2R0FA 1QNWA 3GJAA 5ANQA 2Y33A 3WXPA 4XAXB 5FP9A 4CUCA 4YM1A 3AXJA 1H2LA 5A6YA 1N36T 4DBQA 1N47A 2HWF1 1CJPA 3DTOA 4GMP1 4HN9A 1PIV3 3QD6A 4BQXA 3QC9A 5FCCA 1DQ1A 4XFFA 3JU9A 2V6YA 5EK3A 3Q5WA 4D94A 3WV6A 2O8OA 2R7EB 2VW0A 2UXNB 1VBB3 1BQPA 2V5CA 4RQPA 2D97A 4Z8XA 2BFUS 2ZGMA 3ZYHA 2EHOB 5T54A 4DR2T 2ZGTA 2W68A 5DJQC 2IC1A 3AMHA 2JQ9A 2DWGA 4OX9T 4DOUA 1LU2A 1N3PA 1UX6A 4AEKA 5KWRA 1DZRA 4CN4A 2O8QA 1XSQA 2PMWB 1KNZA 4WBNE 2EXKA 3VBOA 5FPAA 2LSGA 2NZ9A 2VURA 4I02A 3MIFA 3TN93 2Z69A 5C5TA 4PFPA 2ZACA 2RS31 4KWKA 4A3ZA 3J9X1 4ISRA 1ENSA 4HETA 2YZ4A 2R063 4H63H 5C3QA 1LHVA 1YHFA 5FZ8A 3VBSA 4Z8BA 3D5OA 1J83A 1W99A 4OQ8A 2YBPA 3A0KA 2ZGQA 4HGAA 1HG2A 4ZY9A 2VXRA 5AQSB 3E08A 1YKEB 5IK4A 1J84A 1RUJ1 2A6YA 5A7SA 4JI2T 4QM9A 4LHKA 5ABHA 4MGTA 5FZ4A 5T52A 4HG6B 4CSWA 5LA0A 4PIXA 3GCXA 1YJKA 3ASIA 2VKDA 5HEUA 4YWAA 2WZEA 1DGRN 3CU7A 2H6CA 5C9AC 2WMOA 1C8M3 4RS5A 1DIWA 4Y5SA 1QGLA 2ZMLA 4UI9L 1UY4A 3JCFA 3A0NA 1DQ0A 2L9QA 2AZ5A 2GNMA 4RQPC 2BNOA 3I2FA 1C1FA 2VZTA 5LG3A 3MPPG 2QGSA 3AXJB 1RITA 2D6PA 4YTPA 2BERA 3WINE 5F9TA 4AEMA 4D7TA 1NQJA 1D2QA 2VZSA 3SISA 3NZPA 3MGUA 2QBXA 3ZIWA 3RQUA 4QX5A 2V6YB 5JXIA 2HEWF 2R072 5FXVA 3RQ0A 4XAAA 1HCIA 4DMWA 2GP3A 4XBQA 4CU9A 4GAZA 1RUOA 2WQ8A 3Q5EA 4B6XA 2CAUA 1GQPA 1QJY3 1N1VA 1ASJ1 2WNVA 3HBKA 3VBUA 3SFEA 3CKHA 4BISA 3ZMZB 1HKDA 2FUPA 2W39A 3U78A 3N36A 2EHOD 1LOEA 4FSJA 2X10A 1JYTA 3RZMA 1LECA 4P5HA 2J42A 3UU3A 3M2MA 3VBOB 1KEYA 5I93A 1YO8A 3D3AA 5FZ1A 2JD9A 3Q9DA 1NAFA 4ZZBA 3UU6A 4NIGA 2JECA 4QKNA 5H9RA 1W3VA 3B13A 2G9ZA 3VBSB 2XJQA 1YFUA 2H7VC 1VLNA 2CU5A 4DNYA 2HWF2 1OKOA 4JTOA 2HYXA 2X09A 1YFWA 2TUNA 4RFRB 4IEOA 4DXTA 4IDZA 4XURA 4LMJA 3AE2A 3FZKB 4WV8A 3M70A 3POFA 1RUI1 4MYEA 4OULA 4WM7A 4YW7A 3LPGA 5JZGA 1ZNPA 3SH3A 2F4VT 4RS5B 2ZGLA 2V7IA 2OS2A 2V7MA 5DAVA 2WABA 1NLQA 4QX8A 1AYM3 3WQBA 5KX5E 2WR9A 2ACZA 3E6BA 3P8CD 3IT8A 4V2WA 4XETA 1XMQT 2EVXA 3WP3A 5A70A 2WN2A 1TMF3 2J7MA 3VBUC 5K9YA 3D8CA 2JD4A 3AECA 4I3GA 2VZ3A 4ZU4A 2VL4A 3QB5A 2DU1A 3L2YA 1KXGA 3K77A 4NRQA 2VGDA 2VQFT 2BVMA 5FYMA 1HNWT 3VLBB 2RS32 2CL2A 4HVOA 1PVC3 4MGIE 2Z2SB 3OOXA 2WNVB 4IHJE 4P14A 2ZLYA 3WG2A 2V6XA 3VBUB 1BK0A 3AEAA 4ERRA 3I0OA 3G06A 5AQNB 3W5NA 1ULPA 2CPTA 1O3RA 3K46A 1RUJ2 3AL6A 1SMVA 3B3QE 3M3CA 5KDMC 4SBVA 3BKZA 2PG8A 4LBOA 3BQLA 4Z2AA 3AJYA 4H9SE 4L0RA 3T30A 5BR8T 2PAMA 2WM9A 3NZQA 4LBJA 4PF1A 3ZN1B 4EN0A 4YZ5A 1X82A 4WM7C 2E7QA 1AR61 2QDNA 3OSDA 2XXZA 1MS3A 2ZPXA 2AYHA 1DGWA 3HKCE 4GYRA 1A3KA 4WBBA 5AQKB 4IE0A 5EWSA 4MALA 4OI0A 5C3JA 3CQOA 1OH4A 5T5PA 3QLQA 2PHUA 4INDA 5GZEA 2ORXA 3MIBA 4BQ2A 4QGLA 4AXOA 2HBTA 1H6XA 3RX6A 1OQDA 5JTGA 3NL1A 2VUAA 5IYZE 4AI3A 3V0BA 5KXBA 2GH2A 5L3EB 2BOIA 4WM7B 4CCJA 5JZGB 2Y8KA 5EHDA 3WY6A 2V72A 4FAGA 2CXLA 3PVEA 2WKKA 3I2GA 1WKYA 1F5FA 5JXGA 1UX7A 4QX8B 1ASJ2 2WQYA 4R9CA 2YB7A 4CCDA 2C5JA 2VK9A 4OK0A 5IUQA 3SLIA 3JBG1 3KT1A 1R8IA 3TNQA 2SLIA 3O0XA 3ESLA 4Q0PA 3OGJA 4PJLA 1R1ZA 3AFKA 4LITA 4TWHA 3PURA 1GQHA 1BXHA 4YGCA 2FBWA 2R1BA 2K3WA 3WR0A 5DABA 3NNJA 1BZWA 1Z7S3 3VKMA 1TG7A 3UFGA 1O59A 3FUOA 1GMMA 1VBE3 2KXPB 2J1EA 5E8AA 3I8TA 1ZZ9A 1QXPA 3P50A 2IXKA 5ISLA 3HNBM 3O5SA 5C4WA 4H9NC 1QDOA 4FPCA 3GBFA 4YZ3A 3VBRA 2WYFA 3POBA 2PQQA 3GA8A 2XHNA 2XKPA 1VE0A 2FD8A 3O1RA 4PI2A 4LPLA 4QQOA 2VMCA 2ODUA 1RUI2 2DURA 2WFF1 3I59A 2BBHA 4IEXA 4QXKA 4DNDA 3BTXA 1PO23 4BA9A 1VRH1 4IL7A 1FMD1 2BUKA 5JIAA 3ACIA 4IDPA 5EQUA 2Q8OA 1U0AA 2GNDA 1D1AA 1BHGA 5JR7B 1D4VB 2DBIA 5TAOA 5JCTA 1DYKA 2WZR1 1NA1C 2D3RA 3NVOA 4A45A 5FBZA 4JLEA 2V5DA 3INAA 3VHRA 3LEGA 3ZMTB 4AGVA 2CGNA 4LT5A 2OVUA 4XYXA 3V0BB 4BA6A 4AAPA 1RUC3 4P5YA 1ULCA 2KMFA 1O4ZA 1RUH1 2E53A 4HWDA 2F6BA 1W9SA 2E9QA 1J59A 2XDVA 4Q0VA 4AVTA 1MS5A 2TBVA 1REDA 3BQKA 1WBLA 1GICA 4BDVB 1GOFA 1CZTA 2IXIA 4RHV1 2IWGB 2VOXA 4Z1VA 1CD3G 2RS51 4NPPA 5FO9B 1V6IA 4XBLA 4CEWA 1XB9A 2KZ7B 5A7NA 1WWYA 3JB4C 2I74A 1MEC3 1PNGA 5HCBA 4IGQA 1AXYA 1LVFA 4UW4A 1SFYA 2BBJA 5LBBA 4DY5A 3ZN6A 5FQ0A 1H9WA 1ULOA 5C4WC 4QQLA 1REFA 2HWC1 1HIXA 3VBRC 1VJ2A 1W0AA 3TYJA 4QH1A 2JEMA 1O5LA 2FHRA 4LFAT 4TTGA 1GANA 2FJDA 4NWWA 3MPBA 5LRSA 1YCIA 2WS91 5LYJE 1AXKA 1RUD1 5AQOB 1OFNA 3GZUC 1NOVA 4M01A 1AR62 1MVQA 3CMGA 2PHFA 3I2IA 1WCRA 3NRUA 1EPWA 2KINB 1MNDA 2XJVA 5M4YA 2WLPA 5C4WB 4Q8LA 3WF0A 2BEOA 2GMPA 1JZ6A 3VBRB 5J1XA 1JYWA 1JHJA 4GKJT 2VWAA 5FXXA 2LOSA 4Q27A 3CX6B 4DXZA 3VDCA 4YVWA 4N8MA 4B3TT 3I59B 2CHNA 2WSSV 4P9LA 4XEZA 1LGCA 1UWWA 4B3ST 3UETA 1W8TA 3AA1B 1HFAA 1BJQA 3HL6A 2VOKA 5I0SA 3IAQA 3SH4A 3V5SA 2QQWA 4TWDA 4HT1T 4COWA 1TZOA 1YFYA 3I2OA 3P4QA 4OCTA 4AVCA 3WDYA 3BIWE 4WVZA 1JH5A 1GR3A 4LR4A 2NQYA 3DYOA 4YHJA 3JBG2 1PZ7A 1HX6A 4Q4V1 2QQJA 4AF9A 1HB1A 4MHUA 5GZDA 4DO0A 1CQ9A 2DU0A 4MGSA 3N9LA 3MW3A 3B94A 2E31A 1K5JA 1XNKA 4ILAA 4FP2A 3RKGA 3BGAA 3D0JA 4YM2A 1NXMA 1BYHA 1S4CA 4CDXC 2VVFA 2R0HA 1FMWA 3DN7A 2JG8A 2OZ6A 2YDEA 4DV5T 4X1YE 3H8OA 3UKNA 3AB0A 4BK5A 1J1JA 4PK4A 1S0BA 4HFSA 4C1XA 3ONLC 3J7MA 2Z6EA 3AA6B 4CEWB 4ADZA 3E1F1 2XJRA 2YV8A 4DUZT 1FATA 4GB31 3ZN6B 4DR5T 3AZZA 5FQ0B 4A97A 3IPVA 5HCFA 2WO3A 3ZSSA 3TLVA 3T4HB 2WFF2 5L3BB 2LOPA 2A3DA 4X5TA 2PXJA 1QSDA 1VRH2 2YROA 4ZS2A 2WJSA 5J2UE 1FMD2 3SFDA 3FX3A 4YVWC 4I55E 4DY3A 1H2MA 1VPHA 4U7YA 3FBYA 1DF0A 1F4AA 3C50A 3IA3A 5C70A 2WZR2 2ZEWA 1T8BA 3LG7A 3CDZB 5DG1A 1D4M1 3V56A 2R073 2ZAAA 4N43C 3QACA 2ZX2A 3GWHA 4H3WA 4JC1A 1X9BA 2W0GA 4XDQA 4I4TE 5HXMA 1O3XA 1GWKA 4RA0A 3B02A 3ON7A 1RUH2 4XHBA 1GOGA 4IDNA 5BNQA 4XJWA 4MZUA 4O9EA 1HXS1 1V6MA 1DZTA 1WLDA 2J1AA 4DUWA 1XNBA 5AQJB 4AFBA 4DR4T 1KS5A 5LA1A 1CPNA 4TLGA 2ZMKA 4CI2B 1B09A 2CDOA 2RS52 2EAAA 1JOJA 4R4ZA 1E1HB 2ILMA 4X8NA 1HN1A 2P3KA 3RMYA 3PJAA 4YT0A 2BG9A 1OUXA 1ST8A 1W6QA 4D69A 5FREA 2VECA 4AG4A 2W66A 3OYZA 3HMYA 4Y5Z0 1ZZCA 4Z90A 3ZKYA 2LHRA 2YMZA 4CDUA 5FFOC 2WS92 1RUD2 3FWEA 2H7OA 2JG8B 4DV3T 3UU8A 4UVAB 3I54A 5FZMA 2WYSA 5K8SA 1UU6A 1D0XA 1HV0A 2HWF3 3NV4A 4IEZA 2E51A 1DQ4A 3ILFA 4GMP3 5LB6A 4BPZA 3K4ZA 4JEHB 2JKBA 3IKWA 3WNNA 2DVDA 4J2CA 2ADDA 4TV9E 2VMDA 1MS0A 4BQYA 2YBKA 2Y60A 1GLHA 5CKNA 2FDIA 1LENA 3AKQA 4I50E 4MADA 4FOQA 3M3OA 2GDFA 3AE6A 2PA7A 3ZFEA 1PK6A 4YSXA 4XFAA 4GQ7A 1W6MA 1XOYA 1MZ5A 3A8YC 3LEMA 5JAXA 4URTA 2VR4A 4FPYA 3AZWA 1DGLA 1N3QA 4Q4V2 5L2LA 1S0CA 2RS11 5AFUL 2A71A 3U07A 5FP7A 4WM8A 4D3WA 5DAPA 2IAKA 5CGMA 4UFMA 3PUGA 1UOBA 4OI4A 3AXEA 1EUTA 4F3JA 2BG9C 5HPOA 2RS33 1Q8QA 2B76A 3SCGA 4COFA 2BKNA 1OF4A 1UO9A 1RUNA 4WW0A 2VC9A 5JDQA 4LFCT 3AE3A 1SLBA 4BQ5A 3JD71 2VBDA 4CDUC 4NIIA 2LRKA 2RDRA 2ETEA 3PUIA 4QPWA 3IM0A 1SLLA 1ZRDA 3T2PA 1RUJ3 3MHZA 1CIWA 2BG9B 1H1AA 3N2OA 1W9TA 4GB32 1W9WA 2YBSA 1IS3A 2R30A 3O4XE 1LOAA 5CFBA 4YGDA 3IBPA 2BWAA 4FAHA 2RHPA 3EYPA 1O91A 3VR9A 2QFEA 4HFVA 2LKHA 1XJAA 1WLXA 4D6QA 2DBNA 1OKQA 3FUQA 1URXA 4MX3A 3POGA 1UN1A 3OBVE 1ZBE1 5A7WA 5LK7B 4LF5T 5FP8A 1HDKA 4BQ3A 1PZ8A 1RJ8A 3ZT6A 4LJHA 4LIUA 5FMBA 3PVNA 2B39A 2NM1A 1AHSA 1D4M2 3OB8A 2HWD1 3AYEA 1H30A 4EN6B 5LHGB 2Y6GA 5FMOS 3TLSA 4WM8C 1VBD1 3IIAA 4UBHA 4X62T 4XCBA 1UX4A 1S1AA 1W0OA 1HXS2 1DLLA 3I7DA 4RR3A 1ASJ3 4NIQA 2YFZA 3ZFEB 1PK6B 3ZVXA 3WX5A 5FWEA 2VUJA 1W6MB 3NBXX 5FZHA 3WSOA 2A9UA 2WBKA 2Q9QA 2ZKLA 3CHXA 2QQVA 3CX8B 4AXPA 1S55A 1KFYA 1UZ0A 2Z4FA 1FI2A 1GSLA 4B7KA 3ZX7A 1NCQA 3WNOA 4UELA 1IQAA 2VBBA 3QNUA 1UYXA 2E9XA 4WM8B 3RRWA 2LRLA 4EV6A 4YTNA 1JYNA 2CNAA 4PCRA 1YC61 4Y4YA 1E5SA 2X9WA 1C8NA 4CU8A 1ZZ8A 5ABJA 3PUWF 4FPJA 4LBKA 4XXPA 3USUB 5GONE 3VHLA 1TE1B 4KWJA 2DCZA 5IK5A 1AL21 3LZZA 4R9BA 5FL1A 3ZXKA 4LO4B 4QT6A 1QIQA 3B7MA 1UNBA 2W1QA 3P6BA 3SEEA 4QX1A 3MDPA 2AE9A 4Y3OA 1QDCA 2XWBB 3ES1A 3NVCA 5EV7A 4BAYB 1D7PM 1QHDA 5C7GA 3PUXF 4YSFA 3C4WA 3KBUA 3TEZA 2UYBA 3M7AA 2RDQA 2JDUA 2PAEA 3JC6D 3S0MA 1AYN2 1RUI3 2VMFA 3J7Yq 3IIIA 3JUUA 5FPUA 2YYOA 1W9RA 4E4DX 3ETVA 2VZ1A 2F17A 3RIFA 4K6BA 1S0IA 4BYYA 3QOFA 4L5GA 4URAA 3MZHA 1S0GA 5BNPA 4C1WA 2XQ5A 4AVBA 2XAHB 2HBUA 3KWVA 3VBHC 1WMXA 4BIOA 2WZPP 1SHZC 4Q0UA 3LF7A 1V6KA 5A7WB 2X5IA 4P0AA 3KV4A 4RR3C 5JMOA 5LEJA 2HLEA 2ZCWA 2RS12 2B45X 2Y26A 4D6SA 1WFDA 5FZLA 5GLWA 1WR0A 4K20A 2K24A 3AAIA 4TUYE 4L11A 2I2SA 2MEV1 2A73B 3O1IA 1HQWA 3CF6E 1KQRA 3OD4A 3PMSA 2LKGA 3F57A 2PHDA 4P9IA 4FFHA 2AACA 4RR3B 5ABJC 3N9OA 5EZYE 2W52A 5EZWA 1H6YA 2LSIA 5DMYA 5FY9A 3GCWA 3HT2A 4EEBA 2DUQA 3JD72 2Q9QB 3WP6A 3BPZA 4U36A 3NRYA 4KI0F 2PHTA 2H6BA 1SZBA 4OZOA 1O7FA 5A3MA 5LB7B 1NCQB 4AVAA 4HOOA 2E9XB 4IGOA 1W6PA 2GU9A 4D0QA 3OG2A 1W9YA 4OFGA 3O14A 4EWAA 4UXAA 1KFUL 4TYSA 5ABJB 3FZFB 2XQ8A 3WG4A 2QQMA 2JQKA 3FHQA 4MGQA 1AR63 1IOAA 1BR0A 3E22E 1W03A 1ZREA 3ZXAC 1UX5A 2DTYA 4U72A 2Y48B 2D43A 3DKQA 1ZBE2 2WAOA 4WVMA 3K48A 4QKBA 2HEVF 2Q8CA 3J7LA 1FMVA 3Q8FA 5FMNA 3E5XA 3VD9A 2OPKA 3MYXA 4HL0A 4CXWA 1MVEA 2X5IC 2BDEA 3UUBA 3ZOIA 1J3QA 4CN6A 1Q5OA 3K4DA 3GNEA 3BTZA 3VHNA 1IS6A 3CJXA 3I2JA 4HXCA 3PUVF 3GDBA 3T2QA 4Q8KA 1VBD2 3HAGA 4Y26A 5IFPA 5KHKA 5BNPB 1W8NA 3CWZB 2FMYA 4TX5A 4PDWC 4ES8A 4QB1A 3ZCIA 1FXZA 3DYMA 3WF4A 4GKYA 2ZHLA 5LW9A 1ALYA 1IJ6A 4UW5A 4AEDA 3EJKA 1C5HA 2XM2A 4OFZA 4XBFB 1K5MC 2X5IB 2ZMNA 3JBG3 3A23A 1RXGA 3LDKA 3O9XA 2G9GA 1LGNA 4FPEA 3AKPA 3AL5A 3P4WA 1N34T 3K1SA 4ZHQE 4LBLA 2MAWA 2E6VA 3USSA 1AR71 5HCJA 2WWVA 4B29A 5FYTA 2VOVA 3KFWX 2XQ6A 4P09A 3L2HA 5J1GA 2BS2A 1DQ2A 1DQ5A 1X79A 1OFSA 1NXD1 3L8RA 5LCYA 3VZLA 4DFSA 1KD7A 4MG2A 3N7MA 2MPFA 3C64A 5LASA 3UESA 4O9GA 4YY3T 1H8TC 1IBMT 1YI7A 1CX1A 2ZX0A 2P17A 5DG2A 3SOLA 4CDWA 3B9IA 5JDNA 3S5QA 1DDLA 2ZM6T 2UU8A 4PJNA 4AQYT 3BQIA 4J6GA 3HN3A 2GN7A 3PUHA 5TSWA 3JADA 1UOJA 4AWDA 3ZMVB 2QJVA 2V7LA 2EF6A 2Q9QD 1W6PB 2LM2A 2VO5A 4XQWA 3IAPA 4ZI2D 2PELA 3T1MA 2J4GA 2WFF3 3RF1A 4U2AA 4M0HA 5F3JA 1QF3A 5K0UC 2E9XD 1VRH3 5AQQB 3M65A 4HKWA 3GYDA 1FMD3 1BR4A 2UUBT 2KT9A 4PK6A 2WZR3 4JKKA 4WVMB 3M4FA 1G8WA 1AR91 4XQ4A 2O0OA 2XVLA 3U75A 4LO8A 4A98A 3AP6A 2D93A 4E7SA 4FXKB 5T3NA 3SEPA 3AEBA 3OPZA 1C1LA 5FMDA 2YEVC 5JR9A 1RUH3 2MEV2 1M7KA 2Y0IA 1NUKA 3UT0A 3ATGA 4ATEA 2VM9A 5KC5A 1O8PA 3O1HA 5HXRA 1Y7BA 1QJEA 2XAQB 2RR11 3AZYA 1JN2P 3QH6A 4IV1A 1W90A 4LBQB 4OMCA 5CKMA 1FV2A 4K3UA 2XQ3A 4AEDB 2IDOB 1DP0A 2RS53 5JREA 2JDPA 1W0BA 5HBAA 1S94A 3ANWA 4JRLA 4CDWC 1O8SA 3I0QA 1DLCA 4CCCA 3ZYGA 1AF9A 3THPA 3MV11 4ZXEA 1N32T 2K0GA 4X65T 4A7KA 5C3OA 1U5XA 1R64A 4I0AA 4YYOA 4K0KT 4PHZA 4CEYA 4NUVA 5FOJB 3AP4A 2R6GF 4QB2A 3OF1A 2WS93 1KJRA 1RUD3 2LROA 4UT5A 1RUE1 3TLTA 2VZRA 4WZCA 5J98B 3QK6A 2I6HA 2JX9A 2VNGA 4IEQA 3ZYFA 3HBZA 3T09A 5BXXA 1UD1A 2B42B 1Q8OA 2E63A 1EPZA 2WNUA 1KS4A 2WWJA 5JVVA 3R6SA 4DMVA 1BVVA 5JSOA 4LF9T 3OYWA 2XUEA 3RPUA 2VZUA 3WW3A 2ZM8A 3TEWA 3GF6A 3EMRA 5T50A 5GZGA 3CK6A 1HG5A 3DXUA 5C6CA 2D9DA 4QH5A 2FZ2A 5AFEA 4YARA 4X66T 5JR9C 3BU7A 1WMDA 3C98B 4P08A 4XFIA 4JEUB 3L39A 3IB3A 1LVKA 2RJ2A 4W50A 4DV7T 4Q4V3 2JWPA 4QQHA 4IV1C 2A6ZA 4XZCA 1DU2A 1VAVA 1AR72 5AQLB 2YC2A 1V9U1 3UJQA 1RUG1 2DNXA 2EALA 3ZMNA 5JR9B 2AXDS 3SS1A 1RUF2 3P7IA 1S0DA 3LB9A 5IYYA 3CQCB 3JAFA 3FJSA 3WW4A 1KRIA 1XDPA 5AQMB 4XJ8A 1MIWA 4CEYC 1WLWA 1QH7A 5FK8A 1J58A 4IV1B 2ATFA 3VR8A 2B8MA 1XBFA 1YIFA 5CU1A 4K1YA 3BYWA 2X9YA 2HHHT 4NN0A 1UMZA 4M0NA 3ANWB 2E7AA 4YM0A 5I8YA 2XH6A 2LTNA 3J26N 3UJOA 2H89A 3RJRA 1ZV4X 1MQTA 3KF5A 4LBQD 4GB33 3I97A 5BNNC 5IHRA 1JU4A 3S30A 3CLPA 4NO4A 2DWKA 5CG8A 4IV3A 4EB6E 5AQTB 2M6IA 2DUPA 2IZWA 3PHMA 4CEYB 2H0VA 1G9AA 1GNZA 5HEHA 3LEIA 4LORA 2IXLA 4ZZ5A 3RJ2X 2NTYA 3IHRA 4NHXA 5DPNA 3T2TA 4BHPA 1E7PA 4HFDA 3N4MA 3DCQA 4JV4A 3BCWA 3C4ZA 2GNBA 2NP9A 2XR4A 3R05A 4XUNA 1CX4A 3FZMB 1LHWA 3LJCA 1AR92 2WNUB 2VOWA 4NWVA 3ZIXA 4CCMA 5CFDC 2NW7A 1F9KA 1D4M3 3OYWB 4H7MA 1K45A 3O1SA 1FT9A 2GZWA 3PE0A 3DPRC 4DUXA 3UGHA 3DECA 1KITA 5ABEA 5EJZB 3RYFE 1HX8A 1Y01A 3NJVA 1IZ3A 2OQ6A 1XWMA 5CKQA 1RINA 1IHMA 5IVJA 4PJYA 1SLCA 2Y6FA 2W87A 1HXS3 3J9SA 3AEEA 4FBFA 2K48A 4D7YA 1ONAA 2RR12 3EDUA 3ZSJA 1F8VA 3LK42 3ZXJA 3IN9A 4WZFA 5GM0A 4FOVA 5AQUB 1FX5A 4GOUA 4G3YC 4LF4T 4ZXKA 4ZI3C 4META 3CJIB 4JDMA 5E0OA 4Q29A 5T55A 4FJOA 2ZAHA 1V0AA 4HSLA 3RSJA 5IK7A 3WQ1A 1KNRA 1A78A 5L3FB 2DCFA 4X20E 1MQTC 1VBC1 3HN1A 4U2ZA 4QB6A 2PYTA 1W8WA 4IV3C 4HPKA 1JMUB 4A6OA 5F5IA 1S2EA 2BVBA 2JXAA 1CGPA 1POV1 1YIPA 2X53S 1RUE2 1Q56A 1JYVA 5DQVA 3DP7A 4XF3A 2ARXA 3VBFA 5CISA 3VKFC 4ES9A 1CPMA 4KH9A 5F6LB 1X7NA 1MQTB 3CQXC 5FL0A 2DI4A 3GBGA 3KT4A 3MLJA 3HIFA 1AYN3 1XRUA 3OPTA 4IV3B 1NE4A 4JDOA 2QQPA 1D0ZA 3N7KA 3ZJ2A 5JDMA 1ZKEA 1XZYA 3WF3A 1HF8A 4JGYA 2E8IA 3EABA 1YEWA 2FCUA 2BG9E 5EYYA 2LALA
chains in the Genus database with same CATH topology
3K3NA 1Z0PA 3I0QA 3N2KE 2X66A 5A1LA 2CM0A 4CI2B 5FY4A 2ZM0A 3HKEE 1VRBA 2ODUA 4PJJA 4L5GA 3KVAA 5A7PA 4URAA 3EUHA 4GJZA 2XMLA 5F37A 4BISA 1E1HB 3ETUA 3ZMZB 5A80A 1FIOA 2XAHB 4DNDA 4IGPA 5FZOA 3ZYKA 3JC6C 3U78A 4BA9A 2HPLA 4O8SA 2EHOD 3HA4A 2KWIB 3R84B 5FYUA 1SHZC 5FZKA 4HE8A 2UXXB 3HKBE 5HYAA 4NUVA 2CEAA 5F3GA 4UV9B 4X1IE 3UFEA 1WRDA 5A7WB 4HEAA 5HWXA 4QXHA 1D1AA 3MKDA 3RH3A 4P0AA 2CXFA 5F39A 2W00A 3KV4A 4D6RA 4Y4RA 2YINA 4MHCA 2JRKA 4AKGA 3OYZA 5TAOA 3PU3A 4QXBB 4C91A 4CCNA 2NOXA 2X9XA 2V7JA 3VU7H 5LGNB 2NWBA 1SA0E 2LHRA 4MBQA 5FZ1A 4Y33A 2W63A 3Q9DA 2EHOC 3QK6A 1LKXA 4JLEA 1NAFA 3GN5A 3AB3B 4D6SA 3TKLB 5FZLA 2H7OA 4GK0E 4ISSA 3AA7B 5HXCA 3KINB 4QKNA 3ZMTB 4UVAB 3QUJA 3CQGB 2K24A 3AAIA 3MA9A 4TUYE 5FZMA 5A3WA 5IVCA 5FY0A 2XASB 2N1GA 3O1IA 5LG4A 4EXTA 1H7CA 2WWJA 1D0XA 3B13A 5LY2A 4X1KE 2X67A 4DMVA 4EZ4A 4HKAA 5LJMA 4AAPA 1WYBA 2XUEA 3RPUA 2H7VC 2YU2A 5KMGP 3F57A 4ISTA 2XQYA 5IWFA 2KMFA 2LT3A 2XAGB 1MIYA 4JEHB 2D0UA 4H9OC 4J2CA 3ZN0B 5F2WA 3RC8A 2ZM8A 3O1JA 4TN7A 5FPBA 3LBXA 3N9OA 5EZYE 4TV9E 5LGUB 5KR7A 5IVFA 2XDVA 2YBKA 4DBRA 2LSIA 5FPLA 5FY9A 1ZEEA 5J2TE 3HR0A 4DVDA 3WAJA 3BQKA 1WYCA 3U3IA 1HG5A 2Q9QB 3C4XA 3RYIE 4C90A 3DXUA 5A7OA 4EYUA 3NRYA 4IDZA 3HI2A 3MK7C 5FYSA 3F31A 2VKOA 2ZM2A 3ZLIA 2I59A 3N9PA 3MACA 4I50E 4IIJE 4K0UA 5FZGA 5FY8A 4CZZB 3EVYA 5E6HA 3IF8B 5IHYA 5JR9C 1MMGA 5FY5A 3F2EA 1HTJF 4BU2A 3B57A 5FZ6A 2MBGA 4HOOA 1EZ3A 3OJAA 2KZ7B 2E9XB 4IGOA 5FZCA 4CCOA 1S35A 5A7NA 3C98B 4GJYA 1YD8G 4ASKA 2LSKA 3L3PA 4E7ZA 2JJ9A 4IGQA 1LVFA 4JEUB 4CQIA 4N78D 4AI6A 1IJ5A 2LSJA 5HWYA 1LVKA 4CCLA 2V7IA 2OS2A 2J1DG 5FNVE 2V7MA 5H6RB 4LIVA 5FZ3A 4HONA 4KBMB 5LJNA 4QX8A 4UEMA 4UV8B 3N5LA 2QA7A 5K4LA 3PUSA 2OQ7A 1QUUA 5F3CA 4XZCA 3FHNA 1CUNA 5KX5E 5EK2A 5EK4A 3AVSA 2IW5B 5A7QA 3A5XA 2XAJB 3FBZA 3I9YA 5F2SA 4MLKA 4UF0B 3P8CD 5L2LA 1BR0A 4V2VA 3OPWA 3E22E 4NUUA 5JVDE 4V2WA 5HXHA 5AFUL 5IVYA 3AAEB 5JDHA 2PBIA 5LNKA 2LM9A 5FP7A 2DNXA 5JDLA 5FZDA 4BJMA 5LYJE 2IAKA 2KWHA 1UX5A 3ZPOA 3T8OA 5JR9B 4F6RC 3SS1A 3PTRB 3P7IA 3PUGA 4U72A 2Y48B 2DHRA 4H63V 4H9RC 2IC6A 3CVRA 3CQCB 4EAHA 2MTQA 3FXEB 2PFVA 4CUGA 2SPCA 2Q8CA 4KMCA 4QXCB 2JPFA 2Q8DA 3KV9A 5F5AA 1FMVA 3CKDA 3H37A 3MXZA 4AKRB 2M67A 5ADXL 3I1AA 5FMNA 3N2GE 1MIWA 5ANQA 4CXWA 3UYJA 2KINB 1MNDA 4XAXB 5F8PA 3ZYLA 4EYYR 3UTKA 3KVBA 5FP9A 3FBLA 5M4YA 3N9QA 2BDEA 3PDQA 4QX7A 2BVMA 5FYMA 5HXSA 5FYCA 3MJXA 4PJMA 3UT5E 4GD4A 5FPVA 2OX0A 3K3OA 3RYCE 4G2AA 4WW0A 4O4JE 4OHFA 4AQFA 4DBQA 5FUPA 4C8DA 1U4QA 3DTOA 2CLYC 4E4HA 2VKJA 5JDQA 4HN9A 1NWMX 2X9YA 3NRXA 2H3RA 2NW9A 3SRZA 2VWAA 3QC9A 3LFMA 3KDSE 3ANWB 4DIQA 5FZAA 3LD8A 5FXXA 2LOSA 3CX6B 3KBTA 3D0TA 5IW0A 4IHJE 4EIWA 2VL8A 2ZLYA 3RVHA 1ZV4X 3MZKB 5ETWA 1D1BA 4PK5A 5EK3A 3Q5WA 3S4UA 5JRCA 3K2OA 4ERRA 2ZMAA 5FZ0A 5FZFA 2WSSV 3I0OA 2VD7A 5FWJA 2DWKA 5L3DB 3CWZB 5FZBA 4CI3B 4TX5A 2UXNB 5F3IA 3EDVA 5FZOB 3AA1B 2V7KA 1HFAA 3ZCIA 4EB6E 2VB6A 5A3PA 3N2OA 3HL6A 4Z8XA 1IZNB 3UUXB 3V5SA 5LW9A 1YKHB 5H6QB 5FZ9A 1IJ6A 5CEHA 5IVEA 3W15B 2YBSA 4QHOA 4LXLA 4OFZA 4XBFB 2D2SA 4QXHB 3AL6A 5L3CB 3V5UA 5FBJA 4UVBB 3O4XE 3ZYMA 4QWNA 4YLHA 3IBPA 5LXTE 3U4SA 3O9XA 2L8KA 3I9WA 3L09A 2EHOB 3WAKA 5KDMC 2XTLA 1T98A 4HTEA 5BMVE 1D1CA 2PG8A 4MFRA 4H9PC 3WI3A 5FY7A 4A56A 3AL5A 2NTYA 3IHRA 3BQLA 4FI5A 4O4IE 4P0BA 4YFSA 5CA1E 4AKHA 1LRZA 2W2IA 5DJQC 2LE8A 3K8PC 3PU8A 4KUMB 4ZHQE 3CX7B 3RKOA 3DJBA 4U74A 2CE7A 4YHJA 4UXNB 4H9SE 4HFVA 4L0RA 4O2BE 3LK2B 1VOMA 3LK3B 4PNIA 4IGUA 2G0UA 4WNKA 5FYTA 5L3GB 3GN5B 2Y6XA 2DWGA 3C4ZA 2WM9A 3ONXA 1WLXA 2WMNA 3NZQA 2NP9A 5LOVE 3RRCA 3KFWX 4D6QA 1B7TA 4CXXA 2A72A 3NJYA 3ZN1B 4P09A 4ZOLE 5J1GA 4NUBA 1ZHCA 1X79A 2JQQA 4L9IA 4DO0A 3ZMSB 3ZC0A 3OBVE 3LJCA 3RC3A 3KV6A 5LCYA 3K3QC 5A7WA 5A3NA 2XXZA 4UIGA 5JDFA 3GMIA 4CCMA 5F3EA 3C64A 2NW7A 3CMLA 3N9LA 3HKCE 5FP8A 2C5IT 4GYRA 1KNZA 4O4LE 1MMDA 2A2FX 1BR2A 5FUNA 4WBNE 4IE0A 2HH7A 4MALA 3PE0A 5C8YE 4IE5A 4QXBA 2OT7A 3UUMA 4AI9A 5FPAA 5A1FA 4LIUA 2LSGA 2N2NA 1WR6A 3RYFE 5LP6E 4G63A 4TN7B 4PAGA 3LBXB 2LSYA 1HX8A 4YJ3E 3SOLA 4PFPA 5FP4A 5JDNA 5FYVA 4AKIA 2CWYA 4PJNA 2OQ6A 5LHIB 2L3LA 5HXEA 2LJLA 3BQIA 3KV5A 5F5CA 3J9X1 3FXDB 1FMWA 4WBOA 3RX6A 5IVJA 5FXZA 1KK7A 2DLRA 4X1YE 4AQGA 5LHGB 2GP5A 5FYYA 5IYZE 2Q8EA 2V1DB 3PDYA 4H63H 5FYBA 5LBMA 3DXTA 2MYSA 5FXWA 2BZBA 4PK4A 5FZ8A 4ZI3D 3ZEFB 2WWUA 4TV8E 5L3EB 4CCKA 2K48A 3ZC1A 2Z6EA 3AA6B 1UX4A 1MMAA 2YU1A 5FZIA 4CCJA 3ZMVB 2V7LA 2CCQA 3ZMUB 4ZS3A 2RP4A 3EDUA 4CI1B 2Q9QD 3N9NA 2K5BB 4ADZA 2YBPA 4TZ4C 4HGAA 1HG2A 3LK42 1HS7A 4I43B