3K3OA

Crystal structure of the catalytic core domain of human phf8 complexed with alpha-ketoglutarate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
355
structure length
350
Chain Sequence
LRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords PHD finger protein 8
total genus 96
structure length 350
sequence length 355
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3oA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3oA01
5CEHA 3DXUA 3RVHA 2Q8CA 4EZHA 5FYZA 5A80A 5FY8A 5IVYA 5A7WA 4EYUA 4QX7A 3KV9A 4NUBA 5FZ0A 5IWFA 5LW9A 3AVRA 4ASKA 3ZPOA 4QXBA 3PUAA 2YU1A 4URAA 2XDVA 3K2OA 3KV6A 2YBKA 2OS2A 3PU3A 5FZDA 5FZ6A 2YU2A 5FY7A 5FWJA 2OQ7A 3OPTA 4GJZA 4CUGA 5FUPA 4CCNA 5FZ8A 2XMLA 4QX8A 4DO0A 4IGQA 5FYTA 5FP7A 2P5BA 4HONA 5FXVA 5FZ4A 5FYMA 3PUQA 5FYSA 4EZ4A 2XUEA 5LY1A 4Y33A 3KVBA 4XDOA 2Q8EA 3LDBA 5F5IA 5IVCA 5FZOA 4CCJA 3PDQA 5A1FA 5F5CA 3KV4A 5FY0A 4HOOA 4AAPA 3KVAA 4CCOA 5FYBA 3PU8A 3U78A 5F2WA 3AL6A 5FY1A 4AI9A 3N9LA 4BU2A 2YBSA 3NJYA 5FYYA 5FZLA 5E6HA 3UYJA 2YPDA 4XDPA 2GP3A 5FY4A 5F5AA 3N9NA 5A1LA 5F3CA 4C8DA 4D6SA 5ISLA 4GJYA 2OX0A 5FYVA 4QXHA 4TN7A 4CSWA 5ANQA 5FZIA 5FP9A 4E4HA 5FUNA 5A7OA 5LWBA 5KR7A 2Q8DA 5FZBA 5A3PA 5FWEA 3PTRB 5A3WA 5F3GA 3U4SA 2PXJA 4LXLA 5IVJA 4V2WA 2OQ6A 5FZ7A 5LY2A 5FZGA 2YBPA 4CCMA 2OT7A 5FY9A 5FZCA 5FZEA 5FXXA 4QWNA 4Y3OA 2WWUA 3N9OA 5FYCA 3AL5A 3AVSA 5FYUA 3N9MA 5A7WB 4GD4A 4Y4RA 4IGPA 4BXFA 5FPUA 5IVFA 4V2VA 2XXZA 5FPLA 5FZKA 5A7PA 4DIQA 5IVEA 5F32A 3KV5A 4CCKA 5F3IA 5F37A 3DXTA 5FPVA 4CCLA 3K3OA 4GAZA 5A7QA 5FP8A 4UF0B 5IVBA 5FZ1A 3K3NA 5FZHA 5FPBA 5FXZA 5FP3A 5A3TA 4LITA 1VRBA 5F3EA 2WWJA 5FP4A 5FJKA 3N9PA 5FPAA 5FYHA 5FZ9A 5FZMA 5FZAA 3PURA 5FXWA 5FZ3A 4D6RA 4QU1A 3OPWA 2GP5A 5FY5A 5FZOB 5A7NA 5FBJA 5FZFA 5A7SA 4D6QA 2VD7A 5IVVA 4UF0A 3PUSA 5K4LA 5IW0A 2W2IA 4BISA 4LIVA 5FYIA 4QXCA 5FJHA 5FV3A 5F2SA 3N9QA 4IGOA 5F39A 4LIUA 3LD8A 5A3NA 3ZLIA
chains in the Genus database with same CATH superfamily
4UXAA 1U5PA 2HWC1 2E7TA 2QJVA 4LMFA 2KR2A 2VU9A 4IEWA 3RVHA 3VGIA 4L11A 1GZWB 3MIGA 1W0AA 2FZ2A 5C5TA 4OMDA 2N1GA 3P50A 2YC2A 1MS9A 2BFUL 1V0AA 2UY8A 2VG9A 4AI1A 4OHYA 2ZGOA 4AKIA 3DPRC 2VNOA 4DNYA 1VE0A 2BVBA 4ILAA 2ZGSA 4AKRB 5C8WA 1PK6B 4GJZA 3LFMA 2B5HA 4W8JA 4JYAT 3HKEE 1H6YA 2VQ0A 2X5IA 3M4FA 4QGNA 4LFAT 4Q0PA 5BNPB 1QF3A 4OK0A 5JR9B 4BM8A 4E2QA 5BNOB 5AQJB 5FYMA 2XM1A 3ZSLA 4KI0F 2YFZA 5JR2A 4HFCA 2WCAA 2LM3A 3ETPA 1JHNA 2WYSA 1HQLA 1HXS3 4YGBA 1PX3A 5IATA 3LDBA 4Q0SA 5IVCA 1ZBA2 2OYZA 3JQXA 1C57A 4LR4A 3VKFC 1NKGA 4JBWF 4B1LA 5LA9A 5A3MA 4O4LE 4CUBA 1XSQA 3H8XA 2XHNA 4CCCA 5I0DA 2VK9A 3A7QA 2H88A 4QH5A 3FXDB 1BVVA 4CU7A 1H6XA 1OFSA 1JYXA 4ES9A 3HJRA 4PQQA 3PU8A 2IXJA 4LULA 3C7HA 5FVLA 3WLUA 2WDBA 3GM8A 3IF8B 3ABZA 3UFGA 2RVAA 2VZUA 4AXPA 3MIBA 3M3CA 5ACA1 1QJY3 2ZM2A 1RUC1 1ZEEA 2VOVA 3IMNA 2RJKA 1UIKA 5FYYA 3WZ1A 2NP9A 4E4ZA 5A32A 4XEZA 3FBYA 1AL22 4XZCA 3A23A 3SNMA 2Y34A 4F3JA 5C3OA 1UY1A 3OYWB 2JQHA 5JXGA 4H9QC 2LTNA 5ISLA 2XR4A 4YFSA 1H4HA 2QZ2A 2PHFA 1SFPA 2VZOA 2XOMA 4XQ4A 4O2AE 5FZIA 3HN1A 4CDWB 1YYNA 2BW8A 1LR5A 4O4HE 3ZSJA 3O1OA 1T7SA 2BWAA 4JKLA 3I49A 3KLSA 3NJVA 3JBG3 5CVRA 1VBB3 1PGW2 5A3PA 2V7KA 1UURA 4YW5A 1W6MA 2A6VA 4XJUA 2D2SA 1TE1B 2WABA 4PK4A 2ILMA 2WBKA 3B00A 1TG7A 1YQ6A 3ZYBA 1IS4A 5FZGA 3WHUA 4HL0A 4LK7A 5FMOS 1AR63 2JICA 4LKEA 4ZY9A 3O0WA 1GANA 5LHHB 1KD7A 3DV8A 4CQIA 1DQ0A 1W6NA 5A7WB 5HAXA 4BXFA 3HWJA 5J2TE 4LO8A 3DYPA 5KHJA 4M00A 3J4UH 3HAGA 2W46A 4AHYA 1G9BA 2FDIA 4DS0A 2O8OA 5F32A 1AYM2 3SKJE 1XU2A 1Q43A 4HKLA 2ZACA 4CDQA 3ALQA 5FPVA 2RPAA 4N9HA 3K3OA 1S55A 1UX5A 2SLIA 3TLWA 3D5OA 4PLMA 4R52A 5FZ1A 1YD8G 1OOPC 1O4TA 5CISA 3U4XA 3ME2A 1VRBA 1JNRA 2WWJA 2DWRA 5FJKA 5FZMA 4LBOA 2AEZA 4S2FA 1I6XA 2DCYA 5AVPA 1PNGA 2WZPP 2A75A 4ATEA 3I1AA 3IWZA 4M01A 4MZUA 2VKDA 5DUUA 5J48A 5AFEA 1W8ZA 4FOVA 2W94A 1N36T 1HR0T 1W8FA 2VNVA 4IUGA 3OPWA 4S2HA 4TV8E 5H9RA 2BVMA 4AG4A 4XVHA 4DFSA 2XONA 1PK6A 4FPHA 3P8CD 1TNFA 4KHZF 4K20A 4XF3A 1J59A 2DCZA 1OQ1A 1VBD3 2OZJA 3BGAA 3NQHA 1V9DA 3M7AA 3SKVA 5I0SA 1OOPA 4DR4T 4QDQA 4UW6A 2Y6JA 3U37A 5ACA2 1DP0A 5CA1E 2R49A 3OSDA 4L97A 1D7PM 2WB5A 4I01A 1X33A 4JTNA 4JTOA 3E97A 3VHOA 5FY8A 3X1DA 1W0PA 1US7B 1MIYA 2B45X 3NAPB 4H2AA 3QBQA 5DPNA 3ZPYA 5J37A 1O3SA 2LKGA 4META 2B76A 4DV5T 4CU9A 3C50A 3SH3A 5IT6A 5JIUA 5L47A 4R9CA 4H3WA 4UYBA 3ZMVB 2LSJA 3RYCE 1U5IA 4BZ4A 3C4WA 5BPXA 2GH2A 3ZC0A 2ZGQA 3QNUA 3R84B 4KMQA 2BOJA 3OPTA 4IEZA 1YJKA 5DAPA 3FZ3A 2SPCA 2HEWF 1SLLA 1VBE3 3H50A 4P9GA 3ZN5A 4RSUA 3O4XE 5J2UE 4UELA 1CJPA 3S57A 5LMNT 1SFYA 2WZ8A 1E5IA 5F3JA 1R083 2Y0IA 4QPGC 5FXVA 5L7OC 3K77A 3OYWA 3NKGA 1UY0A 2GNBA 3J7Yq 1J5WA 2R1BA 4WM8B 3S5QA 4NIGA 4RQPC 4FTSA 5LB6A 4IV3B 1G73A 1T72A 4UI9L 3CF6E 3WF0A 2E7AA 2RG4A 1LVKA 2HWE3 3LAGA 3RRDA 4LLOA 2WN2A 5FY0A 3TLSA 3DL3A 2CHOA 4Q4V1 4DV2T 4KUMB 1XJAA 1UOBA 3NKZA 2WNVB 4Q8KA 3B69A 1BBT3 2D93A 3P7IA 4MGZE 5KWRA 1CZSA 2LSYA 3MA9A 3EXUA 1YQ3A 4FO9A 5L7OA 5CFDA 5JWPA 5HXSA 4XMIA 3FZFB 1QJEA 3FE5A 1B35C 1IAPA 3ZFFC 4NROA 4X8PA 1H8TC 2MTQA 4DEVA 1OI6A 4L92A 2VASA 4MO3M 4YVSC 1ZOYA 1OLRA 3LB9A 4MADA 2ENRA 1BBT2 4WZFA 5D2AA 3K4DA 2GNMA 1HNXT 4I0WB 2R0FA 2BQPA 2WNVC 1J1TA 3LCPA 3OCPA 2CDPA 4Q5OA 5A7OA 5KR7A 1DZTA 2XVGA 1BK0A 2WRAA 2Y38A 3HIFA 5AVAA 1G9CA 5GZEA 2C24A 5ABFB 2WZIA 1W2AX 4OHXA 3KGZA 4QHZA 1GZ9A 4B3ST 4CEYB 3APBA 3H9AA 1A8MA 2D7FA 1UF2C 3AE3A 5EPAA 5JXHA 1EUTA 1U5YA 5T50A 3AFKA 2ZKNA 3T0BA 3A21A 2WMOA 1V70A 3K51A 1WRDA 5J09A 5JLVA 3AE4A 1N3PA 1MEC3 4IEUA 1U4QA 4RGKA 2VH9A 4JI3T 4UBGA 2R043 3RMXA 3MPBA 2A3XA 1JU3A 1Z7S2 4IEYA 4QPYA 3RI9A 4C91A 5KHGA 3AE7A 3RRCA 3ZT5A 1UYYA 2R072 1GICA 5C70A 5KXBA 3LA2A 2BGOA 3HQXA 2O14A 5CJ5A 4HWDA 4NOTA 3ZMOA 4ARYA 3H3MA 5CFCA 1CUNA 4LPLA 4GMP3 5H9QA 1V6JA 1BR1A 4BDVB 5B4XA 2GC2A 2VO5A 3VU7H 3Q8BA 1W6MB 3SISA 1X79A 2D6LX 4KU8A 2WUHA 2UXNB 1C3HA 4LITA 4OQ9A 1QWRA 2XKPA 5CG8A 2JENA 1RUF2 4Z8XA 3PURA 2ZX2A 5E89A 1NCQA 1UYXA 3AYDA 1HXS2 3VD4A 4AI0A 4HVRA 3AAEB 1GWMA 3ZX7A 4AEDA 4GALA 5L9BA 4LHKA 1RUJ3 4PBPA 5FZFA 1QNWA 3VLBB 2LALA 1LHWA 3GBGA 4LFCT 5DQ0A 4PT6A 2JECA 3WP4A 4KNCA 4Q4X2 1RUNA 2HWC3 1SE7A 5FQ0A 4YNIA 1EAH1 1JBCA 4TZDA 1DU3D 3RX6A 1A6CA 4PCRA 5JVDE 1B35B 2GC3A 4OUMA 5F39A 1LAJA 1GOFA 1APNA 3T4VA 4QGLA 4XJ8A 5L9VA 4F7ZA 2ZHLA 5A80A 2MPKA 3MLLA 4XTMA 5CB7A 2LRPA 4Q4W2 4UW4A 1LOGA 3ZSKA 3R4DB 4C1WA 5JMOA 4HVQA 4AQTA 1UYPA 3SH4A 1JYWA 2J7MA 3VKLA 2XTLA 3RYHE 2A9UA 4HWFA 5FTTC 4DRVA 5FPXA 5JZGB 5A33B 4QB1A 1KS4A 2A70A 3UKVA 4UFMA 3Q5DA 4OX9T 2NW8A 2FBEA 1YCIA 4LUKA 1VPHA 4OHVA 1AJOA 2W67A 3VBUC 3VKOA 1WR6A 4EXTA 2ZGNA 1CIWA 3LEKA 1H1MA 1ND2A 4P5HA 2JQQA 1VB4A 4LOTA 1OD5A 1YUDA 4LEJA 5T5OA 1IPSA 2QQKA 3PTYA 1O3XA 5DABA 2V7LA 1Q8VA 2B9VA 3O5SA 3UJOA 1UW8A 1JS9A 2PHWA 3GZTB 3MGUA 4LT5A 4AI2A 3LWCA 4NPPA 1GP6A 2P3JA 3GHNA 3THCA 4TWFA 1WLXA 2RM23 4NWWA 2PFWA 1R093 2VMCA 4XCBA 2VCMA 1LNSA 1VRH1 1MS3A 3PDQA 3T0AA 3QACA 3ILFA 3RYKA 2QBXA 3OYXA 2YV8A 5FL0A 4BLIA 3VBUB 3PHMA 4NJ4A 3IDCB 4TXWA 4AI6A 1IKQA 2KM2A 1XXNA 3NL1A 2XWBB 2I2SA 2QQUA 4AAPA 4AVCA 4BB3A 5FYBA 3PIGA 3UU5A 1RXGA 5FY1A 4QQHA 4XFIA 2CYFA 2HWB3 4LOSA 3IN9A 3F2EA 3M3IA 4O61A 5EK3A 1P8JA 2IFRA 4D7SA 5A3UA 1W8TA 3QOFA 1UZZA 4FPEA 1BVP1 1ULFA 3LPFA 2P1BA 3WQ0A 2PLV2 5JR9A 5BNOA 1G8WA 1O91A 3HD8B 4YXDA 3ACGA 1JZ7A 1YFUA 1OSGA 2WQ4A 1D0ZA 4HWCA 1CAXB 1WYCA 4EB6E 1PMHX 4L2NA 5FDBA 1QXPA 4NO4A 1SDWA 4YW1A 3JZVA 2X9YA 2IUWA 4CSWA 4HFBA 1Y4WA 1SG3A 1VP6A 4W6WA 5KXEA 3SH5A 1LENA 1TQ5A 3WP6A 3WCRA 1AYM3 3B01A 4QX0A 4DR6T 4JEUB 1RVF2 4FPOB 5F3GA 2X68A 4LXLA 4DY5A 1URXA 2WO3A 1S94A 3RMYA 5I8SA 2FBWA 2L3LA 4JV5T 1PIV1 3OY8B 1HB2A 2X0YA 2CGOA 2VXRA 2WNEA 1LHVA 2I74A 3AXEA 3MI8A 5LYJE 4OUSA 4AISA 5FY9A 4Z1VA 1DYKA 2PG8A 2P3YA 2VOKA 3N35A 1XDPA 2OPKA 1DGRN 3GDBA 4GMP1 3A0NA 4IESA 1D1CA 1FMD3 2XJVA 4DIDB 1LEMA 4KGGA 4YM2A 4CN1A 4DNDA 5FYUA 5LGNB 3RJRA 1RC6A 4ISRA 3RZZA 3PUWF 3M65A 4WZCA 4OQ8A 1WD4A 5FLJA 1N1VA 2VQTA 4LE4A 5A7PA 2W1QA 4EN0A 2G0UA 1PK6C 5HCAA 4YW7A 1CAVB 1RUF1 2Z6EA 1KGYA 2CNAA 2FHRA 1KK7A 1SUMB 4EEDA 1S0CA 5ABJC 3JCFA 3EVYA 3NMBA 4LHNA 1N32T 1LU1A 5EQUA 5FP8A 3VHNA 3WDXA 1Z78A 5FPBA 5LBEA 5C9AB 3PMEA 3NAPA 1GV9A 2BKPA 4AHWA 5ETWA 2GMEA 4XC9A 1KRIA 5FP4A 1HQWA 1ZHCA 3Q2MA 4IT4A 4KG8A 1AL23 4OMCA 3WQ7A 1JZ3A 4Q4X1 1ASJ3 3L09A 4DV7T 2GNTA 5JDFA 3NV3A 1XMOT 1CQ9A 1JZ8A 4M0NA 4A41A 1FYUA 1W8HA 4GIQA 4Q4V2 3CKDA 4K8FA 2G9FA 1JYNA 1KNRA 4ZI3D 1UOGA 4Y22B 3AYEA 5A7NA 3SITA 2BBVA 2NMNA 3P4QA 3CK6A 1WMDA 3HR9A 4D6QA 4AQGA 5HPOA 4NRPA 3HL6A 4YZ4A 3ZMTB 5DG2A 4U2ZA 1FPN3 1ND3A 3POGA 5DZEA 2W1SA 1WW6A 2JG9B 3OUHA 4K8RB 3NSTA 5FYIA 2WSUA 3ZYHA 1YKEB 2CAUA 1W6QA 2DFCA 3GJAA 3LIGA 3F95A 2IW5B 4XHXA 5DDJ3 1XQNA 3B94A 4FFGA 3WF2A 4Y20B 1QXRA 4CUAA 4IV3A 4IDZA 1D1BA 1Y01A 4X5TA 2VL4A 4JRLA 4NUBA 1BBT1 5LK7B 2YPJA 1DQ6A 3LOIA 5M4YA 4SBVA 3FHQA 3ZC1A 1SCRA 1W8UA 3IZOA 1YWKA 2W91A 4RQPB 5FIXA 3ZFGB 2V6YA 2R042 5I8TA 2WJSA 1MEC2 2EHOA 3NZQA 4UR9A 4Z90A 1X82A 3E6CC 2VZTA 3RWNA 2JIWA 3KF5A 4Q0UA 1XU1A 3POJA 4KI5M 1NA1C 1XNDA 2DHRA 1ENRA 1NT0A 4RGAA 2BNMA 1NYWA 1ULGA 5FZ8A 3U1XA 3ZKUA 3RZMA 1IZNB 2W1UA 5FKYA 3MUY1 4HN1A 3EBRA 4BQ1A 3V0AA 2DCTA 5FZ4A 1LOFC 1OKQA 5FYSA 2PTMA 3ROUA 4QXBB 4FAGA 3ZFFB 4GMP0 4AFDA 3JD73 1U0AA 2C5KT 1XE0A 4YW3A 4LMKA 2RM22 2PHDA 3NNLA 3VDCA 4CP1A 1CAWB 3MIDA 2GH8A 1EV13 3VKHA 2X9WA 1BR4A 5HXHA 2V7MA 3GHMA 1QOSA 4XF4A 5G05L 2A73B 2A6WA 3AAIA 3OBTA 5FYTA 4CI3B 1J3RA 2FCTA 2QTWB 2ZEXA 2ZHNA 3KS7A 3PLQA 4E7SA 1OOPB 3VBFB 4I3PA 2X05A 5JH7E 4DY3A 1C8NA 1DCSA 4Q0QA 4K6BA 4QB2A 3NJYA 2PTFA 1XRUA 1WCRA 1QJU3 4UW5A 2AXDS 1F15A 4N7IA 3TWIA 1W2OA 1BQPA 4CI2B 3UYJA 4CVUA 2XQXA 3FBMA 5JXIA 1VBA3 4DZGA 2WS93 4TNVA 2PHUA 4TN7A 5A6QA 5DN2A 3NO8A 3OUIA 3BOPA 2P6CA 1I94T 2EIEA 2XAJB 4WYVA 4NXNT 1PVC2 3VBFC 4BWOA 1S0IA 1K45A 4TNWA 1WZXA 3MFCA 4IW3A 4BJ0A 1NENA 2B42B 4XUOA 2PXJA 4LMJA 4Q4X3 4BE3A 3GZUC 5GKAC 3IDEA 2VURA 2D5FA 2EIDA 2OQ6A 1H2KA 1VBE2 2XHEB 5FZ7A 3SCFA 1V00A 3BB6A 4ASLA 3DYOA 1F5FA 2XJUA 3VBHB 2ZLYA 4FBFA 2DDUA 1X8MA 4AEDB 1LB2A 4F6RC 5LBCA 2CBIA 2V5CA 4QWNB 4LF6T 1C1FA 3B3QE 4TSVA 1W90A 4C1XA 3O1SA 2DWGA 1OLQA 2BDRA 4YHHT 3MF9A 4I09A 3ZT6A 3P3NA 3AE5A 1RUE2 5AQUB 4CCKA 2TNFA 3VBOB 4XABA 4FPFA 5CKMA 3TRSB 1H1IA 1ZBE2 3LFIA 3POBA 3LDKA 4WM7A 3AMNA 3D82A 4DV0T 1W0NA 5LK5A 3OBVE 3MW2A 3JAFA 1RHI1 3ZXFA 2DYCA 2ZCWA 2VQFT 3N7MA 5A3TA 3TEZA 4CP2A 1EAH2 1AJ3A 5LNKA 5I8YA 1BEV1 2ERFA 1CONA 2BBAA 3WEZA 3NNMA 4FOQA 5FZ3A 5C3RA 4YG3A 4ANJA 2XPKA 2NR4A 3UQ4A 2IFWA 3P5BA 2BS4A 3WNNA 2MYSA 4OFZA 4JRAA 4B4PA 2XUMA 1LEDA 1HJFA 4MSVA 1Z7S3 2VVEA 4F83A 4QQLA 1NQDA 5BUVA 4UF0A 2XM2A 1HG2A 3VD3A 4H63H 5FO7B 3ZR6A 3CQGB 2FMDA 3I2JA 5L3DB 2I45A 3RYIE 2EAKA 3UKTA 3AB3B 2D98A 2PLV1 4TWHA 2VMEA 2VTXA 4IGOA 5JPMB 1FAYA 5E88A 1FNYA 3ZLIA 5A3NA 2JB8A 2JDAA 3RH3A 3VR8A 4RFT0 4W6YA 4Y1YA 5DDJ2 2Q8CA 1FOD1 1PGSA 2DUQA 5FVKA 4ITCA 4EN9B 4MOAA 2RMU3 3KV9A 4COFA 3UGGA 3F2ZA 1UKGA 4WBNE 2CA5A 3CJXA 4Q0VA 3I97A 4MXWB 4GB31 4KHPT 3RZJA 5LB7B 2ZPXA 1STMA 1WLTA 2XLGA 3BQLA 3AEEA 3GF6A 5FZDA 2XJSA 3PJYA 2YYOA 3WW4A 4PIYA 2K46A 4K40A 3JAEA 5AQKB 1YQ5A 4E9KA 5JSOA 3VD5A 3W5NA 3A22A 2XQRA 3OGSA 4YZ1A 4QKBA 4CDXB 1GFF2 3VBHC 4IDPA 4IL4A 2EVXA 3CZUA 5FP7A 2A6XA 2E33A 1ULEA 2E5LT 4BJNA 2OKXA 4AR2A 1BKZA 1MPXA 5IK5A 1SZBA 5G04L 1YO8A 3WQBA 3NVOA 4Z8BA 2C9KA 4ILCA 3EO6A 2LRKA 2VC9A 1ZRFA 1NQJA 1QGLA 2EAAA 4IXLA 2HWD3 1XNTA 2NMOA 5F5CA 3CZJA 1HRI1 1MR5A 1ZA7A 3LQCA 4J6GA 4ZONA 3RLFF 5KDMC 4GKKT 4UEMA 3O1HA 3WUCA 5HEHA 2W66A 2DU0A 2WZHA 3KHCA 4YG6A 1WYBA 2AC1A 4PF1A 2NLRA 3BU0A 1O8SA 1W6PB 5AQHB 4UOJA 1LCLA 3VD7A 1Z0HA 2XQ6A 4DMVA 1AR93 1N1YA 3J7MA 1R082 4Q4Y1 4ZZ5A 2IC6A 4G4FA 1K5MA 4OYJA 5FY4A 4M3CA 1PVC1 3N9NA 2P3IA 3K4ZA 2V7JA 4C8DA 3NNGA 3ZXLA 3VL9A 4QXHA 2FJEA 1RGSA 2WNUB 4ZHNA 4ORFA 5A32B 5FL1A 1C28A 3FFQA 2E53A 5D1IA 3T1LA 2E31A 1F4AA 1DFQA 3E5UA 3J8F1 1FATA 2QUOA 2MEV2 2W52A 4LBQD 1IGOA 4WVMB 5HI0A 1OURA 5LG4A 1HTJF 1DU2A 2PHLA 3NW4A 1MMNA 2UU9T 2ARCA 4KGQA 3VRBA 4V2WA 1YEWA 2KT9A 2YBPA 5CFDC 2K48A 5CFCB 5M0TA 5HXEA 2FDKA 2Q8OA 2IAKA 2LEHA 3ZFFA 1WLDA 3TEWA 2ZX0A 5CZKA 4JI5T 3BCWA 2TUNA 1JN2P 4EEBA 4JHZA 1HRV3 4YVWB 3ZN6B 4AFMA 3POFA 4HKOA 3I0OA 4O7XA 2WC2A 2PYTA 4GKYA 4FFFA 4AEDC 5ABEA 4WW0A 2XXZA 3AZVA 3PE0A 4UVCB 1NCQB 1YI9A 2NZ9A 3KCCA 4EWEA 1OA3A 3KV5A 3VUOA 2IXLA 1ACCA 1FIOA 2R1DA 4Z82A 5EYXA 4JI1T 1IQAA 1ND3C 1HQNA 1KEXA 3DXTA 2D44A 3POWA 3R0RA 1VALA 3J7HA 4EGWA 4CDXC 5CFDB 2GMMA 4PDWB 2JMKA 1WCDJ 4BHPA 3BQIA 1FJGT 4L5GA 1QDOA 4L0PA 3E6BA 3TYJA 1W99A 5LG3A 2VUAA 3N9PA 1O59A 1SLBA 5FYHA 1OF3A 3WW1A 4AEKA 4JGZC 3AKRA 5IK4A 1AX1A 2R7EB 1CZVA 1GQPA 4XW3A 4P9LA 4ATFA 3C7OA 3HMYA 5DUXA 5J36A 4QU1A 4COVA 1KQRA 1ZNPA 4XQWA 1C8M2 3T2PA 2OPWA 3WVJA 1XDOA 4YM3A 2WN3A 3IAQA 5JDGA 1XNKA 3ILRA 1UN1A 2JWPA 5HXMA 3SOLA 3N36A 2VMFA 2E8IA 5BNPA 4DR5T 2VVNA 4CXWA 2ET7A 3S5AA 4UFKA 4ZI7E 3AYAA 3SCHA 1T8BA 5L2LA 4A3ZA 2YZ4A 5HYAA 4Z2AA 5LA6E 3E1F1 5JIAA 2WY2A 3UESA 4DMIA 3B13A 2GAUA 3CX8B 3JADA 3ETQA 4B3RT 2YU1A 2ZEWA 5J96B 2E2AA 1D2SA 3K2OA 3OTFA 1UPSA 2GMPA 1X9PA 2HWE1 2VE1A 1ZZ9A 1LGNA 2WSVA 3ST7A 5LCWL 4CYDA 3TNPB 2UWBA 4H9RC 3OD4A 2BS2A 5CKNA 4CUGA 4NE9A 5C8CC 1K42A 3POYA 4AEJA 5IWAT 2EHOD 1CD3G 1SFNA 2ZGPA 3UNPA 5D8AB 4YLZA 1ZREA 4CXYA 2CU5A 4UV8B 5EJ3A 1RB8G 2Z5WA 2V4VA 3ZOIA 2XAGB 3WINE 3WF4A 4Q25A 5JOXA 3C8XA 5F1RA 4R8HA 5FO9B 4Y22A 2IMLA 1Y9QA 3AEBA 2QQVA 4NVPA 4IDOA 1UQXA 1HCIA 3MLJA 5HCFA 4AZZA 3O0VA 3JC6D 4CXXA 3VR9A 4MGKE 4IDNA 3ACHA 4HOOA 4H55A 2HEYF 3BIEA 1MS1A 4AXOA 2WWVA 5L3EB 2RMU1 4XETA 4XJZA 2HWB2 2QRXA 2X67A 2UUCT 1WUVA 5FKCA 1RJ7A 2XJ7A 2AH2A 2YBSA 3H7YA 4HZFA 4FCAA 4JKKA 2CSGA 4JGZB 4PIZA 3I2FA 4U2AA 2V26A 3AA0B 2PLV3 3U0ZA 1WA6X 2WDVA 3I3MA 5F3CA 2W4XA 4GIWA 2Y6GA 3FLTA 4XOGA 1D1AA 5C71A 1XOYA 1OWAA 4JI0T 3WI3A 2CHNA 1Y64B 2IXCA 3W5MA 2C5IT 1HX1B 5JDNA 1IJ5A 3E0ZA 3KGLA 1YNAA 4XILA 3K48A 4WBBA 2RS11 5FUNA 4HPKA 5CKQA 1HN1A 1POV3 2WT0A 1ND2B 5FWEA 3WW2A 4K21A 3OYZA 5A6ZA 1WLWA 1M7KA 2ETEA 1AR91 3H7JA 4M1PA 1D4M3 4CA9A 5B4NA 3P1IA 4MXVA 3H42B 4HK8A 4DPNA 3N4MA 5IHRA 1RVF1 3OKQA 4EN7B 1JZ6A 2W39A 4MBQA 4MV2A 4RHV2 1IBKT 1JUIA 2B9UA 4RS5C 4XFHA 2LLYA 1RMU3 3UU4A 1EV11 1AR83 2UURA 4Y4RA 2XY8B 4K0UA 1UAIA 2DNXA 1W6NB 5T5PA 5JOWA 1CIYA 4V2VA 2WU2A 2WAAA 2W2UA 1VAMA 3FLPA 2WU5A 2WO7A 3G6JB 2WBLA 1OKOA 2DCJA 3M2MA 3SWHA 4P0AA 3PUIA 1AR73 1OHFA 3NKTA 2J1DG 2CTVA 1DQ4A 2IXIA 4UFIA 5A7QA 3EAMA 1KFYA 5HEGA 1IG3A 4C0HA 4CP9B 5AQVB 4ET7A 2GC1A 2KZ7B 4A4AA 3OEAA 3USUB 2JJ6A 3OB8A 2JRKA 1J84A 2HWF2 1LODA 2OUJA 2PMWB 4IE7A 2V4AA 3T2OA 4IIJE 4YWAA 2IIUA 4QXHB 5L73A 3ZXJA 1VBB1 3INAA 4BMBA 1ZRDA 4FQZA 4QHOA 4HKAA 3PUHA 4QPIC 2PAMA 5EFUA 2RS31 3T4HB 1E5SA 2PA7A 4YHJA 4HFEA 1V9U3 2GZWA 2MHFA 1QKQA 3V5SA 2J1SA 4UXNB 3RPUA 2L9QA 5FLHA 3M3ZB 4JGYC 3AKTA 4LIVA 4Q4Y2 2R16A 2EHOB 2ES0A 2I6HA 4QXCA 4A7YA 2V7IA 3GCWA 4JDNA 2OLTA 3LD8A 1PO22 3MIHA 1AJKA 4P0BA 1QEXA 3J9SA 4E4DX 1JYCA 4E8CA 4EYUA 2E9QA 4B4RA 4P9IA 4E4SA 2WKKA 5C6CA 1H0BA 2TBVA 2O0OA 3H0OA 4AVSA 2PHTA 1HG5A 4QM9A 4PW8A 3HNYM 3I2GA 2P4EA 2VAUA 2ZX3A 3R6SA 2QQLA 2ACZA 3OBRA 1FI2A 2AE9A 1Y7BA 3LA3A 4IV1B 4DOUA 4B3NA 1PVXA 3C7GA 2UWAA 3LZZA 3MDPA 4QDRA 3RS6A 3I59B 1DBNA 2BZDA 1J1JA 1BZWA 1JOPA 1S1AA 1YLLA 2RS51 3CBNA 3UK9A 3LK3B 3WG1A 3ZYGA 2P34A 3EI0A 2X5IB 3L9JT 1HS7A 1X9TA 3URFA 4HFSA 1NA1B 5E0OA 2GSYA 2P5BA 4XFAA 4EZ4A 3J7LA 1GOHA 2XUEA 1ULOA 1PM4A 3ORJA 3PNAA 1PGW1 3VDDC 4DV6T 5LEJA 3ZDVA 5T5LA 3OOXA 4ERRA 3ZXGA 1I9RA 1LOCA 3GNEA 1XZYA 3ITQA 2B46X 5JDMA 4EOZB 2Y64A 4BMEA 1ZZ8A 2LSIA 3KQ4B 4P9YA 5CNAA 2YXSA 4MG2A 1UUSA 5J1GA 1DGLA 3P3PA 2QQJA 1C4RA 1KJRA 2D5HA 4LBJA 4CU8A 1R8IA 2QGSA 3RIUA 2FCUA 1VAVA 2VL8A 4JI4T 4K0KT 1Z8UA 4AQFA 1IBLT 1W9WA 1ZBE3 4YG0A 4BH9A 3B02A 2YOEA 5DQWA 4GKJT 1K5JA 1QH7A 1L7QA 2QFEA 1YXRA 3AMHA 3IPVB 5BNPC 5GZCA 4QPGA 2LJLA 3ETVA 5J0ZA 1W2UA 4BIOA 5C33A 1D2QA 2ZX1A 2D6OX 3IA3A 1MIVA 3I3DA 2XSBA 2GP3A 4EN6B 4ZEYA 1V6LA 4RQPA 2E9XA 3ENRA 5CIRA 4MX3A 1Y43B 4AGRA 1SDDB 3K4AA 4GXLA 4XIOA 5F5QA 4FI9A 5L3FB 2XKOA 1V6MA 3I54A 2ARXA 1BK1A 4MFRA 3VHRA 4HN9A 5IK7A 2DTWA 4ZI2D 3AJZA 4JZRA 3IM0A 2LT3A 5KXJA 5LMUT 4RHV1 2Q8DA 1UWWA 5JRCB 2W0XA 4Q2FA 1RUC3 3PJAA 3T30A 2ZOEB 4CDXA 3CQOA 3PDYA 2XAHB 4EROA 1QSDA 3JBG2 2P37A 2NN8A 3T1YT 3RYFE 1XMQT 1REDA 4Q27A 3KBTA 4XBQA 4P02B 4ASMB 5DMYA 4AFBA 1QJY2 1E7PA 2JDKA 4XBFB 2JE8A 3FJSA 2FJAA 2N7GA 4K7JA 4XURA 2ZM8A 2E9XC 3V5UA 3BPSA 3AFGA 4HTEA 4JI7T 1VBA2 3LDRA 2JMHA 1ENXA 1NCRC 1V6IA 2VTXJ 3RC3A 4OHFA 1HX8A 4MALA 3OTOT 3FZHB 3ZYFA 1FMD2 5FPLA 5A3LA 1IPKA 2CLYC 3GZAA 4OZXA 1QDCA 3CMLA 3R6NA 2X0HA 2GU9A 2MEV3 4U36A 2ZS6B 4MGIE 4UVBB 2H0BA 1UZYA 4LO7A 3ZDSA 3ZFEA 1RMU1 5HV0A 2B7YA 3PJQA 4HPKB 1UGOA 2J62A 2WFF2 2DU1A 3QOPA 5FZHA 4B8EA 3J26N 5JSRA 3VDDB 5BY5A 1UY4A 5F3EA 3VDAA 1UMHA 2WFF3 2PHXA 1ZVFA 1LKXA 4N53C 1LESA 5FAXA 2ADDA 4I2OA 4EV0A 2ZA9A 3LGRA 5JSPA 5HWXA 5L3GB 2BKOA 1QH6A 3ILNA 3BVCA 1BLZA 1AXYA 3ZYLA 2FZ1A 1WCQA 2CMRA 2YROA 3NNFA 5IW0A 1MMDA 5LA0A 1YRZA 2V73A 3CKHA 2IC1A 4URTA 1GZTA 3BU7A 5DDJ1 4CDQC 5KC6A 5EK2A 5C8YE 1RUH3 4P9XA 4WM7C 4OUEA 4BXSV 3RRWA 2YEVC 5F2SA 2J4GA 4L8QA 4QX1A 4PF5A 4B3MT 3ZKRA 2XLAA 3MW3A 5K0UB 3ZXEA 3U3IA 4DV4T 4XXPA 1BJQA 5A7WA 2H6CA 2WS92 1XE7A 3K46A 4XAEA 3ZIWA 1OXCA 2WNUC 2WLPA 4NPLA 3E22E 3KWVA 3LEMA 1AX0A 2R062 1AR82 4KWUA 2Z4FA 1W39A 1PGL1 2V8SV 2I07B 2EA7A 1AUYA 4GB32 4M0HA 5A33A 3MBWA 2F4VT 1Q3EA 2E32A 2Z69A 4IV1C 4BOWA 3HT1A 2M67A 3NRXA 4Q8LA 2HYKA 3TN93 4CCEA 1XYPA 3RQ0A 2VGDA 3ZIXA 2ZMNA 2BNNA 1UOFA 2IZWA 3MZKB 2E9XB 1ZYBA 2RMU2 3CIRA 1HW5A 4PJLA 3DECA 1K5MC 3N7LA 1ZRIA 2RJLA 2J1TA 4ILBA 4XAXB 3OGGA 3CX6B 3JU9A 3PVOA 4NHMA 4AVVA 1XNBA 2VCBA 1ULCA 2VUJA 3GBWA 3WDWA 5JOZA 2X0LB 4PK5A 1MEC1 2JJ9A 4LTAA 1FMD1 2OW4A 3PV0F 2YN6A 3WSOA 4MUVA 5IK8A 3MEPA 4RA0A 4ZHQE 1SQ4A 1VCSA 4UFJA 4YGCA 3U78A 2J1UA 5EK4A 4AI9A 4LKSA 1NAFA 2YDSA 1PIV3 3I59A 3CVRA 2XZEA 3FUQA 5DAXA 1RUH2 5CGMA 4Z07A 4UFHA 4UWDA 2VB6A 1IS5A 3D0JA 4JDMA 5EJZB 3LDQB 4HE8A 4N53B 3RZHA 3MV01 4IEPA 2WLQA 2BS3A 1WW5A 4RS5A 4TZ4C 2E7QA 5DUVA 2WT1A 3RGBA 4DV1T 3HKDE 2F17A 2HBUA 3KM5A 3M3OA 4QH4A 5AQOB 5E8AA 2Y6XA 3HN3A 5FYVA 4YZ2A 3S0MA 3NWKA 1MVEA 4TX5A 2LHNA 2CWSA 1E2AA 3CJIB 1Z7S1 3EJKA 3I3EA 5HXCA 1BCXA 5JOYA 4NIDA 2YDRA 1POQA 1H2LA 4ZI2C 5FZBA 2A6YA 2M6IA 4ES8A 1UU5A 4Q4Y3 4QQ2A 3EHKA 5CADA 4LMLA 5C2TA 1QUUA 4JHTA 2XHKA 4K3UA 2BNOA 3VBRC 3MXZA 2FDGA 2WAOA 1KF6A 1ZZ6A 5JR9C 2VZ1A 5LGTB 2Q1FA 5BNOC 5C5UA 2J42A 3O1PA 3ZJ1A 3PUXF 4EIWA 4FFHA 5EHDA 1GMMA 3ZMZB 3N9OA 1TME2 2ZGLA 3I7DA 2FMYA 3LJCA 3I3BA 3AEGA 1UX4A 1YIPA 4JGZA 5FRAA 1MQTA 2FDHA 4CTEA 1HIXA 1GLHA 1NG0A 2AZ5A 2R061 2XBO2 4BQ4A 5FO8B 2VOTA 4HFIA 2RM21 5LBBA 4H9OC 2DVGA 2JKBA 1DLLA 2WNVA 1WCSA 4A56A 1SCSA 1UCUA 2VPVA 1NX9A 2OVUA 1RINA 4NHYA 2BG9C 1O5LA 3J9X1 2DURA 4D0QA 3VZJA 1S35A 4B3TT 3K3NA 1G8XA 1VBE1 3ECQA 2A5ZA 1C5HA 1DQ1A 1GR3A 2QKDA 3HOBA 4BA9A 3IBMA 3WX5A 3OVUA 3UV9A 2OZ6A 1S2EA 4IEOA 1LULA 5FZAA 1DGRA 2YINA 5FXWA 1GUIA 3RZKA 2NTYA 3OBAA 1MQTC 1YFYA 4HMZA 4AQSA 3WV6A 2XPJA 5ERLA 2QNKA 3L2YA 3FX3A 4AIUA 4GB33 2BUKA 3DUIA 4XBNA 3Q5EA 1OFNA 4LBLA 1H1AA 2JDYA 5JZGC 5J98B 3TKLB 2VD7A 1JYVA 3AXJB 4TV9E 2VKOA 1I6ZA 1US3A 4S2GA 2NP0A 4JVAA 4QX8B 2WS91 1FMVA 2UUBT 3LPGA 2IWGB 1NA1A 1QQP2 5GZFA 1SLCA 3AP5A 3CO2A 4MGSA 4JUYA 4OI0A 2QQMA 1RUH1 2XJTA 4IEQA 5EZYE 2RR11 3ZFEB 3AA7B 3OPCA 5L3CB 2L9LA 4LNVA 4UT5A 3NZPA 3SHRA 2EXIA 4AQ6A 4H9NC 4J1WA 2AEYA 2IVJA 1ZRRA 3H3UA 4OHZA 2HH9A 4DR1T 5BNNC 2VUDA 1YQ4A 2HWE2 5D8AA 5FK7A 1ZBE1 2CBJA 2TEPA 1DYOA 1EZ3A 2KLQA 2Y0OA 2XDVA 1HJGA 1UNBA 3WXPA 4AAXA 2VZQA 4PIXA 3A5XA 1OD3A 1AX2A 2XQ3A 3U07A 4FAHA 3RIUC 1UPIA 1WMFA 2WWSA 2HWC2 3O14A 4B6XA 2VOWA 4G2AA 1LHOA 1DZRA 4LBKA 3VBRB 2XQAA 3ZXKA 2VVFA 3QLQA 5BNQA 4IGQA 4AW7A 4QXCB 4AKHA 1FXZA 1ULDA 2ZAAA 3U14A 4ZZ8A 2VKJA 1MS5A 3PVBB 4PJYA 4Y1VA 1H9PA 5LY1A 1CHUA 1S0BA 2X29A 3KCYA 1Q8OA 3MACA 1J3PA 1MS8A 4XDOA 2PN5A 4COZA 1ODNA 1QXJA 1H4GA 3HA4A 1ONAA 1C8M1 1W2TA 1WCKA 2P6HA 4HKWA 4RYDA 4NR1A 4XUNA 5JI7A 3OJAA 3SQOA 3TLTA 5EZWA 3HNBM 3UULA 3I2KA 2CPTA 4Y24A 3U10A 5LA1A 2UWCA 4CCLA 4YM1A 1NY71 4LO5B 4BCUA 2WS3A 3CIHA 4P5YA 1AR61 1YXWA 2Y6HA 1V9U2 4M3CF 1UX6A 4FTBA 1VAKA 3WG3A 3BQKA 2H6BA 3JCIA 5JR7B 1CGPA 1PIV2 2H7OA 5LGUB 4XJ9A 3OBZA 3PUGA 4H63V 1H8TB 2JDUA 1KITA 2Z79A 4QKFA 2VKHA 4PK6A 4KP3C 3AZWA 1JYTA 1LHUA 4LF8T 2JG8B 3JBG1 4LBQA 5F5AA 4LJHA 2VQET 3W15B 1FT9A 5H9PA 1Q56A 3ZFGA 3NAPC 1TMF1 4A98A 1VBD1 2RDNA 1JH5A 1OQEA 4NIHA 2CXLA 4ZXLA 2FJBA 1LGBA 1OEDE 5KXDA 3CWZB 1COV2 1TMF3 3D0SA 4FQ4A 2RS33 4TLFA 3O9XA 2MBGA 4EE2A 2Q9QA 5LWBA 3THPA 1LOEA 1H7CA 5K9YA 1W0OA 1YIFA 1WKYA 1FMWA 4LHLA 5T3NA 5I91A 4CEYA 1Y9MA 2VCCA 5IVJA 1Q8SA 3TN92 4X66T 3GWHA 3NBXX 5JXJA 2YFUA 1KFUL 2NPIA 3M3QA 2VECA 3WG4A 4HLTA 2WZR1 2RA1A 2CWOA 4L9IA 1O7FA 4O9GA 1XSRA 4EWDA 4BYYA 1RUF3 4JAAA 5FPUA 3VBOC 2XGXA 1AVBA 1C8M3 1ENQA 3HPNA 3KB5A 4E2SA 1NE4A 4DIQA 4E2GA 1EV12 3SFDA 4GYSA 5I93A 3AZYA 3AC0A 1DGWA 4AGGA 3KHBA 1HLCA 4AQ2A 4CDQB 1JMUB 5IAVA 3ZSEA 5C3SA 3HBZA 3CX7B 1UU6A 2KWHA 4XPVA 5JCTA 1CZTA 5I0UA 3HKBE 4J2CA 3AX4A 4M3CB 1RUG2 4I55E 3A7MA 2CY6A 4NPRA 2BGPA 2I0MA 3POEA 2IUBA 4TN7B 3AMPA 4LA3A 3Q5WA 2RS12 4D6RA 2VMGA 2H0VA 5F8PA 1WW4A 5C4WA 2GP5A 3D6EA 5H9SA 4LF7T 1UK5A 3IIIA 5FK8A 5L4HA 5FFOC 1O3RA 3LSEA 2WDQA 2D40A 2Q1ZB 1F5JA 1VRH2 1ST8A 5GONE 2XJRA 2W2IA 4KWLA 4P08A 3S7EA 4Y1UA 1X50A 3UETA 3AEDA 1S0EA 4IV1A 3VZOA 5C9AC 2CHHA 1OUXA 4KG0A 3KCXA 4LBMA 3B57A 4QQPA 3RYPA 4LIUA 3VBHA 2XQ9A 3C4XA 4CCJA 4X62T 5LZ6A 1FPN1 2X10A 3DXUA 2G1MA 1WLCA 3AM2A 2WO1A 3EMRA 5FMNA 1OVSA 4MHCA 2H3RA 3FWEA 3M8LA 4PI0A 4QQOA 3VDDA 5FZ0A 3AYCA 2FD8A 2JE7A 3A4UA 2OIIA 3OGVA 1Z0PA 2QVAA 3ZPOA 2XL9A 4QXBA 3IKWA 1HF8A 4AE2A 4TUYE 3BYWA 1DLCA 4CDUB 2WP9A 2LHRA 3PU3A 2N2NA 1CAVA 1MZ6A 1UMIA 1W8NA 2OS2A 2RV9A 5FY7A 2VZSA 2UXDT 4NHLA 4NHKA 5FZ6A 5FWJA 1D0XA 4YTNA 4COYA 3T08A 3UUXB 3UJQA 1VMFA 4AK3A 3JD71 2QCSB 3S7IA 2HWF1 4DUYT 1OEDA 5LHIB 1W06A 1BXHA 1R1A3 2UXCT 3H37A 1S0FA 1KNZA 1S4CA 4ONUA 3E5QA 4U33A 1NY72 4KH9A 5JDHA 4U74A 4WV8A 3CJIA 5F5IA 2KSRA 2LRLA 4X8NA 3ZYRA 1CAWA 1IKPA 4JEHB 3KD4A 2C0SA 3DP7A 4XDQA 2R0HA 3ZN1B 3T09A 3V64A 4GH4B 4DUZT 2VVDA 1QY4A 5FMCA 3F57A 4IE0A 3D3AA 1ZZCA 3B7MA 4KBBA 4CCOA 4D3WA 5L3BB 1AR72 1CAUB 1SLIA 3GBFA 2W0GA 3H1MA 4XIKA 5CG9A 5L7OB 4AVBA 1OF4A 3AK0A 4ZOLE 4UVAB 5H6QB 2VTFA 2VQUA 2J1AA 3C3VA 5SV5A 3T3YA 4BU2A 1LU2A 5FZLA 4BLJA 5AFBA 5KBFA 3SS1A 1D0GA 3SXWA 1F2NA 1W04A 2FQPA 4D69A 3CEWA 1ZRCA 4Q1RA 3K3QC 1W9TA 3C51A 3P4SA 1RL3A 2V09A 3PMSA 2CL2A 4XZPA 4Y5SA 3K8PC 4Q1PA 5AQSB 4JQRA 4Q26A 5ANQA 4CEWC 2O1QA 1BR2A 3L39A 4B4QA 3AE6A 3RG0A 3WNKA 2Y48B 4E4HA 1JZ4A 3KT7A 3HQRA 5JREA 3FZMB 1D4M2 3KMHA 2IC9A 1W9FA 4GZ9A 4LK6A 4YRDA 2X66A 3OD0A 1QJY1 4P00B 3ZYKA 2K2SA 3M3EA 3U4SA 2BG9B 4N78D 2ZMLA 4CPBA 4CZZB 2BV4A 2HWB1 3N7JA 4X6QB 5FR3A 1RHI2 2V1DB 3AAAB 2X8KA 5LBFA 1JHJA 5FNVE 1C1LA 1LOBA 4N53A 4W6XA 4XFBA 5HEJA 4FOYA 4CEWB 4CDUC 2C9AA 4OYUA 5DAWA 4CI1B 1R091 3V0BB 4NUUA 4W4ZA 3ASIA 5CBLA 2CXFA 1HXS1 1QJFA 4PQ9A 1QJX2 2XJQA 5F3IA 5L19A 1GU3A 2R041 3GYDA 3M70A 4CU6A 4RR3B 2ZGTA 2HN1A 1PO23 3IDAA 3HBKA 1NE6A 1UX7A 4UF0B 3PIJA 4Y1ZA 3FC0A 2ARAA 2IVIB 2KINB 3LEIA 4QKDA 3RYRA 4QX3A 3RPQA 1XNQT 2JDNA 4LHSA 2WL1A 4BQXA 4NIIA 2W62A 1WMEA 2YY1A 5BNNB 5AQQB 1AXKA 4L9BA 4ZXEA 3BALA 1UO9A 2WNUA 3CU7A 2QVSB 4MGYE 5K0UC 1UL9A 2P17A 5J7MA 1OH3A 1HKDA 3FZKB 4AQYT 3AKPA 2BEOA 4N43C 2DWKA 5C3JA 3FL7A 4DR7T 2D9DA 4JDOA 4X1IE 1LKNA 5LBMA 1J58A 2K9AA 1H2NA 1VBC2 5FJHA 5IYYA 4XBLA 2ES3A 3AECA 2BGCA 2W92A 2X5IC 3CLPA 1N33T 1XPWA 3MUZ1 3POSA 1E1HB 3N3HA 1PM7A 3UGFA 1DZQA 4MGQA 2JXAA 1UZVA 3NVCA 2VW1A 3NNJA 5FMDA 1PGL2 3UFEA 3GA8A 1ZP0A 4ZKTB 2W1WA 4X1KE 1H9WA 1JZ5A 3PUAA 2VCAA 4IL7A 4ZZCA 4I30A 3BKZA 1HRI2 2UYBA 5HXRA 5HV4A 4MGTA 5GLWA 3MKDA 2W63A 3ZYJB 4YSXA 2YU2A 4I43B 2XAFB 2LW8A 2HWD1 3Q8EA 4FSJA 2SBAA 1F8VA 5AQIB 1JU4A 4EYYR 3H3LA 3LG7A 1UXZA 1S2KA 1B7TA 1RUOA 2WR9A 3BK9A 3LBXB 4QX8A 1GQEA 1SACA 4LBQB 5JAXA 2HHHT 2AYHA 4DB5A 1PO21 1G9DA 5F7UA 4Z92B 1UKRA 2BWCA 4HG6B 4R9BA 3QC9A 5TAOA 4X20E 1V6KA 1JOBA 2VY0A 3WDYA 2FDFA 2MEV1 1W6PA 5BR8T 4Y4YA 2G19A 4Q4V3 3I2IA 2BZBA 3EABA 3AKSA 3RSJA 2LOPA 2Q9QB 2HEVF 1QJX3 1SEFA 3ESLA 1VBD2 2DCKA 3ONXA 3LSDA 4XUPA 1VBB2 2YG0A 3VZNA 2J47A 3FBZA 1VCTA 1UY3A 1JUHA 2KXLA 4IQPA 3A0KA 4U7IA 1MS0A 4UFLA 1DG6A 4M4RA 1V6OA 2E63A 2F6BA 3C7EA 4HBNA 4PBOA 4P09A 2UUAT 2C1FA 5AQRB 2J1EA 4MVTA 3VBRA 2X51A 2ZM6T 2BOIA 5KX5E 4XF1A 1E5RA 1RUG3 3PUVF 4JV4A 1C5IA 4B29A 2XQ5A 2BPA2 3ANWB 1HNZT 3MJXA 3V0BA 1WWYA 2OX0A 1LGCA 2E6VA 1SLTA 1YKHB 1QIQA 1XC6A 3Q9OA 4N43B 5FP9A 2VMHA 2W9XA 2D3SA 4FP3A 3IMMA 3ZXDA 4KBZA 1OLMA 4HWHA 1HV1A 2WO2A 1YFWA 1D4VB 1QOOA 5FKBA 3BTAA 3PTRB 3L2HA 3OUJA 4J25A 1SA0E 1G86A 2HKXA 4NXMT 1FPN2 4EWAA 3O12A 1VOMA 2AREA 2K5BB 2A6ZA 1NXMA 1S2BA 1UOJA 2VNRA 4FP2A 1MZEA 4IEVA 2VUCA 5FMOL 4A45A 1BMV2 1CPNA 1OPMA 3NJXA 3ZN6A 2VZVA 4NAOA 3L8RA 4QX2A 5F5WA 3OPZA 4HN0A 3RKOA 4N90A 3AL5A 4QX7B 3C64A 1WW7A 3N9MA 5LHGB 1WR0A 4AKGA 2XJPA 2Y8KA 4OHWA 2ZZJA 4QPWA 4AI3A 3I2HA 3AE2A 2ZEYA 4S2DA 1XB9A 1X7NA 3SC7X 4BIFA 1H30A 5KHKA 1M06G 4DV3T 4EN8B 3OEBA 3WNMA 2WYFA 3IDBB 2CGNA 5E1RA 2EALA 4HFHA 5CYYA 1X8EA 4E27A 2YKSA 2Y33A 4DR2T 1CPMA 1LRHA 2PQQA 3ACIA 3RJ2X 3RIAA 1YHFA 5IVBA 4D7YA 3KSCA 4PLOA 5F6KA 3D8CA 5FP3A 2ZX4A 4NWVA 4A44A 5HCJA 4AI8A 4U72A 1R1A2 4O4IE 5LXTE 3DJBA 1GNHA 5AQLB 5T54A 2K0GA 2VW0A 1UU4A 3HQUA 4G9SB 3O1MA 2RHPA 4YVWC 5LRSA 3U75A 4OI2A 3WUDA 1KNPA 2XLFA 1CX1A 3KBUA 2XL7A 4GK5E 2KD7A 1E5HA 4QDSA 5FZOB 3VZMA 1GSLA 3O1RA 1IHMA 5A7SA 4NRMA 3VBSC 1R1ZA 2A72A 1KXGA 1S0DA 4NAMA 3NJZA 1IBMT 2W08A 4AFCA 2CM0A 4X64T 1TVGA 2XWJB 1RUI3 4FI5A 1AYN2 4DBRA 1W3VA 4PDWC 5GZGA 5DAQA 1OEDC 1IS3A 4RR3A 1ZA4A 1ZBA3 4AVTA 5HBAA 2ZMKA 5K8SA 1OA2A 1QQP1 1LVFA 1BHGA 1NXD1 2Y6LA 3JD72 4A7ZA 1XNAA 1JXNA 1IQDC 5IWFA 3RHWA 1EP0A 1MMGA 4N9IA 3RC8A 3EDVA 4RL7A 2X53S 3AE9A 4QU2A 4QXKA 1OQDA 3RQWA 2W3JA 1MS4A 1X36A 2YBKA 4GWNA 1PMIA 3PJAJ 3ZSMA 3LE0A 2UXXB 1KDMA 3I9WA 5ABHA 2LM9A 2AR6A 2D6PA 5EXOA 3MYXA 2E26A 4DEQA 4DINB 2JQKA 4E8DA 2XG3A 4AQFC 4ZI3C 3C2UA 3FN9A 2W68A 4I0AA 2D6KA 3IIAA 5HCHA 4O2BE 1MVQA 3ZN0B 2R30A 1W2NA 3PUQA 3EDUA 3G7DA 4FXGB 4QGMA 1H2MA 2X09A 2ZGKA 5BNNA 3JC6C 2VNGA 3KVBA 2Q8EA 1H8TA 2CCQA 4H14A 4YSZA 3F31A 3AXJA 1UIJA 3KV4A 4JLEA 3P6BA 2DVFA 4NHXA 3FZLB 1GZCA 4B1MA 1ZM1A 5B2GB 5IAXA 3S4UA 3UT5E 4QPIB 2A71A 2Q9QC 4QMAA 2PAKA 4YM0A 2RE9A 2AENA 4RD7A 1QMJA 4YJ3E 5C7GA 2ZTNA 2QQOA 2WSSV 3FFZA 3OF1A 2D0UA 5GZDA 3N9LA 1GYKA 5JDQA 4JGYB 4LA2A 4WM8A 4CEYC 5CA6A 1RUI2 5DXDA 4DUXA 3VBOA 4EJRA 1UXXX 2JB4A 3BPZA 3IEEA 4ZS3A 1EPZA 1F31A 1U5ZA 5DUWA 5E6HA 5T5JA 3N2GE 4KBMB 5CA0E 3WDUA 4HFDA 1WD3A 2DUPA 1WBLA 5IVEA 2BRTA 3R4UA 4U2YA 3FBLA 2IXHA 4CDUA 3ZKYA 4P14A 1SHZC 4LO4B 4HGAA 1ZKEA 2YC0A 3IAPA 3THDA 2AUYA 3MZHA 1COV3 1TMF2 3OG2A 5IFPA 4ADZA 2YDEA 2BYVE 3PUZF 1QJU1 3IB3A 1N1SA 5CFCC 4GK0E 4BAYB 3WW3A 1OEDB 1W05A 2WZR2 4BJMA 5AQPB 1OA4A 1ZZBA 2ZKLA 2NM1A 3DF0A 4X65T 4FPCA 5EYYA 5JUVA 2CV6A 3RQUA 3ZYMA 5LBQB 3ZT7A 2LROA 3VHLA 5AQFB 5FZCA 3WAKA 3I9YA 1UYZA 2YB7A 3WQ1A 4UBHA 4AYUA 5KMGP 2ZGUA 1A3KA 1PZ8A 2CWYA 4Y3OA 3JB8A 5FYCA 3KQRA 4CPBD 1NCQC 2Z2SB 4I02A 3AVSA 4GA9A 3L3PA 4WVWA 2BTVC 2DTYA 5CFBA 5AQGB 3I4IA 4Y26A 3LOBA 3SLIA 4YPJA 1F4HA 3ETUA 4GULA 2KNDA 2BG9E 1ULPA 4IREA 3ES4A 1HNWT 4AHZA 2LKHA 1WFDA 2DL1A 2ARBA 5IUQA 5K7PA 2LUWA 4GAZA 4QPGB 2XQ7A 3PVNA 1AR62 1JW6A 3SEEA 2MAWA 2RS53 2JE9A 4FXKB 1XNCA 1VBC1 4MHRA 3T2TA 2GK9A 2R6QA 2FUPA 2PELA 3ANWA 2P2KA 2XB6C 4WNKA 1HDKA 2GN3A 2ATFA 3T2QA 5I0RA 3W59A 1NOVA 1UMZA 1YQCA 1QLBA 2RS13 3H1YA 3LK42 2Q5TA 1W09A 4NIQA 4R4ZA 3DPRB 4NUVA 1DIWA 1RUD1 2Q0AA 3BN6A 3RF1A 5LATA 4RN5A 4IE5A 2LSGA 4XTPA 4CCDA 5LRRA 2I59A 1SBEA 5A6XA 4EAHA 1TME1 1ZBA1 3KDSE 2RR13 1PO12 2DI4A 1BYHA 2V72A 4JI6T 1HB1A 1G6NA 3AE1A 2JX9A 5T52A 5FV3A 2GN7A 2E51A 1BEV2 2WA3A 5A3OA 3VBSB 1RUI1 4XQDA 2NWBA 2CDOA 2J1VA 4AHXA 4A5XA 1K12A 4YYOA 2B39A 1W3XA 1HN0A 1SBFA 1WBFA 2VBBA 3O7OA 4RGGA 4TTGA 5IVYA 4PJJA 3BUCA 1DYPA 1POV0 4NRQA 2QQIA 1LRZA 4FJOA 4GOUA 1MZFA 2ODUA 2WFPA 1IZ3A 4MXWA 1NCRB 4JC1A 1LHNA 1M4WA 4AF9A 3AXDA 4XXAA 2UYAA 3I3QA 3GZEA 4A42A 3HKCE 4YTMA 4JGYA 4K9SA 1Q8QA 4KMCA 3QB5K 1GBGA 1VMJA 2C6SA 5CU1A 1OLME 4IDQA 4CE8A 5AFUL 5I0TA 4CCNA 4COWA 2X9HA 3UKNA 2BDEA 2V5YA 3MPPG 2ZGRA 3B5LB 2ZM0A 1M62A 3Q8FA 1AF9A 1AR92 2J1RA 5EWSA 3O1JA 2A3YA 4DUVA 1REFA 5GJ6A 4IERA 4BQYA 1HB3A 2Y8DA 3RI5A 3IPVA 3LKJA 2WT2A 4KWJA 1F9KA 4G63A 3RZGA 3KF3A 1OMIA 2WNOA 4H9SE 5LEKA 4IE6A 3DKWA 4JX0A 3GALA 4Q4W3 5FBZA 4I50E 1HV0A 2AACA 3M1HA 3W21A 3AZZA 3QUJA 2LOSA 1L7RA 1RJ8A 4GWIA 3C7FA 3ZYPA 4HK9A 5GLUA 1LOAA 3KVAA 1YQ8A 2ORZA 3AJYA 3E6DA 2HH7A 4TWTA 4X1YE 2EICA 1MNDA 4NN0A 1TZOA 4DVDA 3LBXA 1BR0A 5LJNA 4YZ3A 3TB0A 2DF7A 3J8F3 1FV3A 3OJBA 4IETA 5A1LA 1JTZX 4XHBA 3ZMNA 1RMU2 2ADEA 3ZMSB 3MK7C 1G9FA 1GOGA 3LK2B 1RUJ2 2QQNA 2Y6FA 4JKMA 4NPMA 1CR7A 4PHZA 5GLVA 4PJMA 4YGEA 4M3CE 3DN7A 4CP0A 2Q30A 1I5ZA 4OZOA 1SPPA 4YVSB 2BFUS 2FDJA 1DQ2A 1ZZ7A 4QHBA 1W9YA 1W6OA 4LBNA 4HSLA 3HI2A 4WVVA 2EXKA 5IJRA 2A3WA 5AQNB 1KDKA 1ND3B 2WFF1 1N3OA 2RDSA 2NOXA 5JMCA 3TEYA 4BQWA 3P4RA 3WNXA 1CAXA 1YQ2A 2Y6KA 4LUMA 2YDQA 1B35A 4QT6A 3MLKA 4FPJA 2LS6A 4XJAA 2JG8C 2V6XA 2XVKA 3O1TA 3GGLA 2JQ9A 3K75B 3I2DA 4KU7A 4LORA 4Y20A 2NTXA 2VXJA 2B1EA 3KT1A 2ORXA 4K1YA 1L7LA 4F8AA 1QJX1 3N7KA 2A3DA 5BMVE 1XYOA 4IGPA 1JNZA 5BYNA 2D3RA 2HBTA 1O8PA 5IVFA 3S6PA 1QNYA 4AWDA 3B5MA 4O4JE 1OXZA 4UIGA 1DHKB 4N43A 3VKGA 1Y9GA 3EB7A 3W9AA 2VW2A 4BK5A 2ET1A 3AP7A 2JG9C 3WF1A 4L99A 5DQVA 1YC61 3MFAA 2ZHKA 2C26A 5DG1A 4CP9A 3N5LA 3CL1A 4QKNA 5FOJB 3PVEA 2VZ3A 2HYXA 2RS52 4RR3C 3ZMUB 5FREA 1RXFA 5JQGE 2JG8A 3H8OA 4Y5TA 3UUBA 1T98A 2ZAHA 1N34T 5FLIA 3VL8A 3WT3A 2G4IA 2GDFA 5AC91 2WIIB 3AEAA 2QA7A 3ACFA 1JZ2A 1RUE3 1V6NA 5LCYA 2DBIA 3P4WA 2G9ZA 3D4KA 3I8TA 2E5VA 5E16A 4B7EA 2EHOC 2VZRA 4OYKA 3POIA 2ID4A 3PUSA 3ZSTA 2H89A 1REEA 2F4LA 4PNIA 3JXSA 1FX5A 4GWMA 3VB9A 3X29B 3ZFEC 4RFRB 3GJBA 4R9AA 2EXJA 2UY9A 2BBJA 2XH6A 4C90A 3N9QA 4HSJA 5L9RA 3RFRA 4DXRA 3ACLA 3ZN4A 2D97A 3AP6A 2PHRA 1D0HA 1AHSA 4WZXA 4EZHA 1O5UA 3HVDA 5FYZA 3A8YC 3ZO0B 2WDRA 4QX7A 2GC0A 1N3QA 4FPKA 1RUE1 1CX4A 2HLEA 2XQYA 5L4EA 1EPWA 4A97A 4AKLA 1UZWA 2HWD2 1Y3TA 1QU0A 2XBO1 1GNYA 4LF4T 3KV6A 2WQZC 3J7NA 3MO4A 4A6OA 1U12A 3ELNA 1I1EA 2JPFA 1I3HA 3LIHA 5AQTB 1W6QB 1VB2A 2CXDA 4QH1A 1VBC3 4MLOA 5FUPA 1JYIA 1NAEA 2XMLA 1GZWA 2IDOB 1MZ5A 1RIRA 5A6YA 1GKBA 4R9DA 3GCXA 1T6BX 3RDIA 5FOBB 1F35A 5JDBA 4AEMA 3RKGA 1CWPA 2QE3A 2V5DA 3IBPA 5GLZA 5LJMA 3MV11 1GWLA 4DXTA 3EYPA 4ZU4A 4YARA 2R071 5FZOA 5C4WB 4K1ZA 5IYZE 4YJ2E 4DRRA 3WAJA 4HWIB 1OBNA 4TWDA 2BVLA 3DPRA 3S30A 1W6OB 4ARXA 3PL0A 5J3UA 2HN2A 5EJ1B 5DAVA 1NEKA 1WMXA 2PBIA 5ABGA 3MF6A 4XE9A 2ZXQA 4XYXA 5F2WA 1ND2C 3AL6A 3OGRA 2VULA 3R05A 2ODVA 4LKFA 1I5PA 4ZU7A 2JEMA 5KHHA 1EUUA 3DYMA 2RR12 3AP4A 3W20A 4OFGA 4YGDA 1OUSA 2YGMA 2YPDA 1K5MB 2VWAA 4LF9T 3B9IA 1YFXA 2J22A 4XF0A 3N2KE 3T1HT 3H3ZA 4FTEA 1X9BA 2QDNA 3C4ZA 5HCMA 4KQ7A 5GLTA 2DVBA 2WQ8A 1PHMA 1XWMA 4IGUA 1W8OA 4EQVA 1DDLA 4A6SA 5HEOA 2ACXA 3RI8A 3MIEA 2GALA 5AC92 4N7UA 2PQSA 2BERA 1MNEA 4GH4C 4HETA 4CN4A 2DLRA 1GP4A 1PX4A 4W65A 2EF6A 1H8VA 1PNFA 3WY6A 5LOVE 4LQRA 1PZ9A 2W95A 3OY8A 4PFPA 4OLLA 1NLRA 1BMV1 4HT1T 4YW6A 2Q4SA 5LY2A 4CCMA 4QM8A 2XASB 2IHR1 3K1SA 3FUOA 2NQYA 3HR0A 1UZ0A 3ZSSA 3WDVA 5IFTA 2K24A 3ZFGC 2WWUA 4O8SA 1AR71 3H8UA 2CLYB 2RP4A 3EHZA 1J3QA 1GNZA 1HRI3 3HNMA 4FFIA 4GD4A 4YVWA 5APAA 3V56A 5TSWA 5JPNB 1EY2A 3TLVA 1O4YA 2D6NA 2BU9A 4QPIA 4GH4A 3WNPA 1IS6A 3MW4A 5AQMB 2IXKA 4GWJA 2W5FA 1GP5A 3EUHA 1CJDA 2C0ZA 4MH0E 3VBSA 4COUA 1AR81 2VR4A 5C8CB 4JI2T 4XFFA 2W87A 1XNRT 1R081 1W9SA 2C5JA 3ZEFB 1R1A1 1FNZA 3UQ7A 2ZHMA 4AOCA 1IJ6A 5C9AA 2WZR3 3AMQA 4PDWA 2JDPA 1MMAA 5EP9A 1AL0G 3ES1A 3LEGA 4A2UA 4YFZA 3AE8A 1PO11 4RS5B 1JI6A 3T1MA 3WF3A 3V0AB 2A1XA 1HRV2 1D4M1 1PMJX 5KC5A 3GMIA 1G7YA 4E7ZA 2X9XA 1T2XA 5IUXA 2EIGA 4NMIA 3WR0A 4YSFA 5CAZA 1W28A 3UGHA 4MLKA 1COV1 1Q8PA 1IOAA 5FBJA 2XVLA 1CVNA 5HWYA 2GNDA 1S0GA 2VVSA 1XYNA 2UU8A 2M6BA 4G3YC 4GKXA 1PZ7A 5K4LA 5IVVA 1VLNA 3FLRA 2MNGA 1W9RA 3BTYA 3C98B 1VIWB 3V65A 2KMFA 1YW0A 4H9PC 3WG2A 2QQWA 4BQ5A 5ABJA 3O1VA 4CRQA 4PAGA 1S0JA 2VBPA 3Q5XA 3ONLC 4XUQA 3ABVA 2JD4A 2CRBA 5DZFA 3I0QA 4JCKA 1N47A 2W61A 4ZU5A 1K3IA 5ACA3 4IL9A 4I0UA 4PJNA 1MQTB 1V9U1 3LF7A 2VM9A 2Y60A 3TAYA 4YTPA 5F9TA 3AVRA 4H7LA 4OULA 3UTKA 4ISSA 1KFXL 2C4XA 4LE3A 3RZLA 4URAA 4L0RA 2K9ZA 2DV9A 4WVZA 3BIWE 2Z42A 2JDMA 1ZV4X 3CNAA 3CMGA 1ASJ1 1O4ZA 3WNOA 1BEV3 3B9CA 4YY3T 4CDWA 3VZLA 2DCFA 2A2FX 3GN5B 2OQ7A 2R073 1L3JA 1PO13 2WZEA 1OH4A 4FPGA 4A3XA 5EIYB 1L0VA 1RHI3 2ZGMA 5CB4E 4DO0A 4FT8A 2E9XD 4I0BA 4WM8C 4Y5Z0 3ZXAC 2D43A 2OV9A 2D6MA 4HFVA 4IV3C 4QD2A 3IT8A 4Y33A 3ZCIA 1B09A 4PI2A 3ZCJA 1YI7A 5D8AC 1IG0A 1NZIA 2CEAA 2MOZA 3VN4A 1ZX5A 5F6LB 4YVSA 4GQ7A 2NYYA 5HCBA 1O3QA 1MACA 3KT4A 1Q5OA 1UY2A 3HEIA 4UW3A 3VRAA 3E08A 4I3GA 3TOJA 1FOD2 4XCAA 2ZZQA 3VBFA 4BA6A 3WOGA 3VDBA 1RYYA 3WNLA 3KZ4C 2BVVA 2C5DA 3TNQA 5FMBA 4LKDA 3CPZA 3MIFA 3BTZA 2G9GA 1QQP3 4WM7B 2XQ8A 3TLUA 1LOFA 3OGJA 4C0BA 2A7AA 3JQWA 4XDPA 2QDRA 1VMHA 2D5UA 4TYSA 3ON7A 2JIJA 4ZS2A 2Q9QD 1G9AA 3CJIC 3RNSA 4LO6B 1LECA 2Q1MA 4GJYA 1CN1A 4BK4A 1NCRA 3ONJA 2RDRA 2KWIB 2D0TA 3NV1A 4JQTA 1VBA1 5AC93 3Q9DA 5FUIA 3CQXC 2B8MA 5JRCA 1RUG1 3AZXA 4WVMA 4XJWA 1J1LA 3O1IA 1HFAA 1HB4A 1SLAA 1US2A 4ZZBA 4DQAA 1CESA 1EYBA 5A3WA 4OI1A 2O8QA 3UUMA 1TNRA 4DR3T 2JG9A 2XAQB 1J5ET 5JI9A 3MICA 2BBHA 1AL21 2RDQA 1UD1A 3FHAA 4D94A 5EV7A 2VZPA 5LP6E 5JVVA 3B93A 2ZBJA 1NZCA 3Q8CA 2OA5A 4M4PA 4XUTA 4AL9A 2MPFA 4QWNA 4XFCA 3BTXA 3DGTA 1QHDA 3QK6A 3USSA 4KX6A 4U3CA 3ZYIB 1AXZA 5K0UA 2YHJA 4CEWA 3U11A 4HANA 3PUYF 2LM2A 4BQ3A 5FZKA 4YZ5A 2AGSA 2HJIA 4PLNA 5FCCA 5JZGA 4SLIA 3G06A 5ADXL 1KJLA 3QD6A 4B7KA 1HRV1 1SPPB 2XQ4A 3UU6A 2JD9A 4MYEA 3THTA 3QB5A 3BOWA 2VMIA 4P9JA 4YW4A 3VHPA 3W58A 5A70A 4ILUA 3RWKX 3D0TA 3TBDA 2DFBA 5FXZA 5JTGA 2EIBA 2VMDA 2N9DA 1RVF3 4Q29A 1A34A 1W0BA 3AA6B 1XBFA 3CHXA 3FMGA 4IEXA 5FPAA 3P4PA 4DBQA 3J8F2 3SCGA 3FHNA 5FPZA 4Z91A 4DMWA 1ODMA 4LF5T 1RUD2 1RTVA 2ZABA 4OCTA 2NW9A 1AYM1 2BP6A 1POV1 4FOWA 1E57A 1LJ7A 2BJSA 5FY5A 5DZGA 3N2OA 3VZKA 4WBOA 1SMVA 2QZ3A 2VOXA 4IHJE 5T55A 4YSYA 3AEFA 4PFOA 4Z2WA 4BQ2A 4BISA 3VBUA 3CQCB 4FVVA 4O65A 3DKQA 2CWMA 3FB2A 2B4KA 5D21A 4KL1A 1PVC3 3SEPA 3O1UA 4X6RB 5SV8A 4XFGA 2ZEZA 4F8HA 3GXUA 1DF0A 3SRZA 2YC4A 3HT2A 3AA1B 4H7MA 5CEHA 2NW7A 1N1TA 3QH6A 2VBDA 4AGVA 2P3KA 2WQYA 5LW9A 2H7VC 4I4TE 5C3PA 4ASKA 5HXVA 2Y26A 5C4WC 3SFEA 1R092 3VKNA 1J83A 2FJDA 5L36A 4JI8T 1LTEA 3MHZA 2JIGA 1GWKA 4U7YA 4Q4W1 2DUOA 2EXHA 3AKQA 1KS5A 4INDA 4IE4A 3QCWA 3T0DA 3E5XA 4J1XA 2DBNA 2WMNA 3R4SA 4FPLA 2XSAA 1FV2A 2HPJA 5ABFA 4XAAA 5KXCA 3WP5A 2YGLA 3QH7A 1NWMX 4HONA 1CAUA 1JODA 2F4PA 3I2OA 1W03A 3ZR5A 4AVAA 3TN91 4XACA 4YFWA 1ALYA 1FEWA 2RS32 2VL0A 2YMZA 4FPYA 4N8MA 4V1Av 3DTOA 2JKXA 2R063 4ISQA 5A1FA 3TEXA 1RITA 4OI4A 5ANNA 3UU3A 3RIFA 3SMHA 4DUWA 3UT0A 2FCVA 2XBO3 4V1PA 5J1XA 1KEYA 2LSKA 3WP3A 2QYWA 4HXCA 4UAPA 2VQAA 3WDTA 5BV6A 4YT0A 1D0YA 4P1NA 3RGLA 2OA2A 5JDLA 2HPLA 3IHRA 3KINB 1OVPA 3DCQA 4QB6A 5GALA 3UU8A 3BODA 3GN5A 2WA4A 4TLGA 5C3QA 2KXPB 4R4XA 2W47A 5IHYA 1UCXA 3AP9A 1DGWX 3Q8AA 4XMAA 3ZM8A 4ZPIA 3JB4C 3LA7A 4BPZA 1AYN1 2W00A 4YLHA 1NUKA 2PAEA 1EAH3 3USUA 3T8OA 1TME3 4D6SA 2PFVA 2YK0A 2L8KA 3JUUA 3VD9A 2LE8A 1QOTA 3KFWX 4ZXKA 1T6GC 3UL2A 3VKMA 1RUD3 2OXBA 3BI3A 5A1AA 4A7KA 4CN6A 1NLSA 1O6UA 1RUJ1 3NV2A 5BXXA 1OT5A 1AYN3 2WM9A 4DXSA 1NLQA 4MHUA 5GM0A 4ISTA 5FQ0B 1MIWA 2DVAA 3LSVA 2D3PA 3ZVXA 1IPJA 1WGPA 2JDZA 1WA4A 1YJLA 5DJQC 2OT7A 4CZSA 3AB0A 4UV9B 1WCUA 5FXXA 4O9EA 5FZEA 2UXBT 2ZJCA 2PJQA 3CDZB 4QX5A 3ZJ2A 2BKNA 1R64A 3H8RA 1ASJ2 2KA3A 1A8DA 3H3AA 1VRH3 4CUCA 1GQGA 2K3WA 1OPOA 1W8WA 1ENSA 3FHIB 3NRYA 4YW2A 4D7TA 5ABJB 2QQPA 2V6YB 1HX6A 1O3TA 2R6GF 3UUNA 1AZDA 5F37A 1JOJA 2CAVA 1A78A 3ATGA 4LLFA 4QAWA 2R32A 1VJ2A 4GYRA 1XE8A 5LASA 5KHIA 1SBDA 2WAUA 1U5XA 2HWF3 3AMMA 3H1WA 2ZMAA 1RUC2 3NV4A 1VR3A 3FXEB 4KWKA 4XZUG 2VJXA 2DVDA 2YUEA 4OVEA 4Y1XA 5FZ9A 1QJZA 5LA2A 1TEIA 2CE7A 1QJU2 3NWIA 3WCSA 4P9WA 3WD5A 4HEAA 2JDHA 4EV6A 3DEMA 4LFBT 2WINB 4RHV3 3O0XA 3WHTA 4W50A 4HVOA 4D8MA 4NIAA 5H6RB 5HEUA 1SHWB 3EQEA 4AFAA 4DXZA 1DQ5A 4CDWC 2RJ2A 1FOD3 3VV1A 2CGPA 2BG9A 1GQHA 2OUHA 1OC1A 5C8CA 4U31A 2P9BA 3NRUA 4XF9A
chains in the Genus database with same CATH topology
3AA7B 5L3CB 1U5PA 3RH3A 3NZPA 3RVHA 2Q8CA 4H9NC 5IVYA 4PJJA 3KV9A 2N1GA 2CA5A 4WBNE 1LRZA 4FJOA 4GOUA 2ODUA 1EZ3A 2KLQA 2XDVA 4AKIA 3A5XA 5FZDA 3BQLA 4AKRB 3HKCE 4GJZA 4KMCA 3LFMA 4B6XA 3HKEE 4G2AA 4CCNA 5AFUL 2X9HA 4OK0A 2BDEA 5JR9B 4QXCB 4AKHA 4IGQA 2ZM0A 5FP7A 5FYTA 5FYMA 2VKJA 3O1JA 4BJNA 5LY1A 2Y8DA 3MACA 4XDOA 3LDBA 4G63A 3HA4A 5IVCA 3OJAA 4O4LE 4H9SE 5F5CA 4IE6A 3UULA 4I50E 5KDMC 4UEMA 2VK9A 3O1HA 3FXDB 2LOSA 3QUJA 3KVAA 1WYBA 2HH7A 3PU8A 4X1YE 3BQKA 3IF8B 1MNDA 4AXPA 2H7OA 5LGUB 4DMVA 3PUGA 3LBXA 2ZM2A 4H63V 4DVDA 1ZEEA 5LJNA 1BR0A 2VKHA 4PK6A 2IC6A 4KP3C 2NP9A 4OYJA 5FYYA 5FY4A 5F5AA 4XZCA 3N9NA 3W15B 5A1LA 2V7JA 3MK7C 4H9QC 3ZMSB 3LK2B 4C8DA 4YFSA 5ISLA 2CXLA 4QXHA 4PJMA 4O2AE 5FZIA 3CWZB 4O4HE 3O9XA 2MBGA 2Q9QA 5LWBA 1H7CA 5A3PA 2V7KA 3HI2A 1FMWA 5FYCA 2D2SA 5LG4A 1HTJF 4PK4A 1MMNA 5IVJA 4V2WA 2NOXA 3GWHA 2KT9A 3NBXX 2YBPA 2K48A 5FZGA 5HXEA 2IAKA 2LEHA 2RA1A 2CWOA 4L9IA 5LHHB 2NTXA 2B1EA 4CQIA 5A7WB 5HAXA 2A3DA 3I0OA 5BMVE 5J2TE 4IGPA 4BXFA 5FPUA 5IVFA 4WW0A 2XXZA 4DIQA 3PE0A 4UVCB 4O4JE 1OXZA 4UIGA 5F32A 3KV5A 3VKGA 1FIOA 4GYSA 3DXTA 5FPVA 4CCLA 3K3OA 1UX5A 5DQVA 2JMKA 5FZ1A 1YD8G 3BQIA 3CX7B 2KWHA 3N5LA 4L5GA 4QKNA 3ZMUB 1VRBA 3HKBE 4J2CA 5JQGE 2WWJA 5FJKA 3N9PA 5FZMA 5FYHA 4I55E 1T98A 3I1AA 2VKDA 4TN7B 3Q5WA 4D6RA 2QA7A 5F8PA 4QU1A 3OPWA 2GP5A 4TV8E 5LCYA 2BVMA 2EHOC 4OYKA 3P8CD 3PUSA 5GONE 2W2IA 4PNIA 5JDGA 1V9DA 4C90A 3N9QA 3SOLA 3B57A 2E8IA 4LIUA 3C4XA 4CCJA 4CXWA 5CA1E 3DXUA 4EZHA 4ZI7E 5FMNA 5FYZA 4MHCA 2H3RA 5L2LA 5HYAA 1US7B 1MIYA 5LA6E 4QX7A 5FY8A 5FZ0A 3B13A 2XQYA 3C50A 1Z0PA 3CX8B 3ZPOA 2YU1A 4AKLA 4QXBA 1HF8A 4TUYE 3K2OA 3KV6A 3ZMVB 2OS2A 2LHRA 2LSJA 2N2NA 2JPFA 3PU3A 3RYCE 5FZ6A 3C4WA 5FY7A 5FWJA 2CXDA 3ZC0A 1D0XA 4H9RC 3R84B 3OPTA 4CUGA 2SPCA 5FUPA 3UUXB 2XMLA 3O4XE 5J2UE 2EHOD 4UELA 5LHIB 3H37A 5F3JA 1KNZA 5FXVA 4CXYA 4UV8B 3J7Yq 3IBPA 5JDHA 2XAGB 5LJMA 4U74A 5F5IA 5FZOA 1G73A 5IYZE 4YJ2E 1HCIA 3WAJA 4JEHB 2C0SA 2BVLA 1LVKA 3DP7A 3ZN1B 3JC6D 4CXXA 5FY0A 4HOOA 3F57A 4IE0A 4KUMB 2PBIA 4CCOA 5L3BB 5F2WA 2W0GA 3P7IA 5L3EB 3AL6A 2ODVA 2LSYA 3MA9A 4ZOLE 4UVAB 2X67A 5H6QB 4BU2A 2YBSA 5HXSA 5FZLA 2YPDA 3SS1A 1IAPA 2VWAA 2V26A 3AA0B 3K3QC 3N2KE 3C51A 5F3CA 2MTQA 3C4ZA 4GIWA 2VASA 1D1AA 4IGUA 3K8PC 2ACXA 1OWAA 5ANQA 3WI3A 1Y64B 2C5IT 1BR2A 1IJ5A 3E0ZA 5JDNA 1MNEA 4E4HA 2DLRA 2Y48B 5FUNA 5A7OA 5KR7A 5JREA 5FWEA 2IC9A 3OYZA 2X66A 5LOVE 3ZYKA 3U4SA 4M1PA 4N78D 4PFPA 4CZZB 5LY2A 4CCMA 2XASB 3HR0A 2V1DB 3AAAB 3OKQA 4MBQA 2K24A 2WMOA 5FNVE 1WRDA 2WWUA 4O8SA 2CLYB 2RP4A 1U4QA 4GD4A 4Y4RA 4K0UA 2DNXA 4CI1B 4V2VA 4NUUA 4C91A 5IVEA 3RRCA 2CXFA 3EUHA 5F3IA 2WBLA 3SWHA 4P0AA 1CUNA 2C5JA 2J1DG 3ZEFB 5A7QA 1BR1A 1IJ6A 4UF0B 1MMAA 3VU7H 1X79A 2KINB 2KZ7B 2UXNB 4LITA 2JRKA 2W62A 4Z8XA 3PURA 4IE7A 3GMIA 4IIJE 4E7ZA 2X9XA 4QXHB 3AAEB 4QHOA 4HKAA 4MLKA 5FBJA 5FZFA 5HWYA 4YHJA 5IVVA 2DWKA 3V5SA 5K4LA 4UXNB 3RPUA 2L9QA 3C98B 4X1IE 2KMFA 1YW0A 4H9PC 4LIVA 5LBMA 2EHOB 2ES0A 2K9AA 4QXCA 5FJHA 2V7IA 4PAGA 3RX6A 3Q5XA 5F39A 5JVDE 1E1HB 3LD8A 4P0BA 3I0QA 2W61A 4EYUA 5A80A 4PJNA 3UFEA 3GA8A 3AVRA 3UTKA 1HG5A 4ISSA 4X1KE 3PUAA 4PW8A 2XTLA 4L0RA 3RYHE 4URAA 5HXRA 1ZV4X 3MKDA 2W63A 2YU2A 4I43B 2XAFB 2DCFA 2A2FX 2NW8A 3GN5B 2OQ7A 4EYYR 3LG7A 1B7TA 1WR6A 4EXTA 3BK9A 3LBXB 5CB4E 3LK3B 4QX8A 2JQQA 4DO0A 2E9XD 1HS7A 1O3XA 5DABA 2V7LA 5E0OA 4HFVA 2P5BA 4EZ4A 3QC9A 5TAOA 2XUEA 4X20E 4Y33A 3ZCIA 3ZCJA 1WLXA 4ERRA 2BZBA 2CEAA 2MOZA 5JDMA 4EOZB 2LOPA 2Q9QB 3PDQA 2LSIA 5J1GA 3OYXA 3ESLA 3E08A 3ONXA 4AI6A 2QGSA 3FBZA 4AAPA 2VL8A 4AQFA 5FYBA 5DQWA 5FY1A 3CPZA 3F2EA 5EK3A 2LJLA 3ETVA 4P09A 2X51A 1MIVA 5KX5E 5JR9A 2GP3A 4XDPA 2D5UA 4ZS2A 2Q9QD 2E9XA 3ANWB 1D0ZA 3MJXA 4GJYA 1WYCA 4EB6E 2OX0A 1YKHB 5L3FB 4CSWA 2KWIB 2D0TA 2X9YA 5FP9A 4MFRA 4HN9A 4ZI2D 3Q9DA 3CQXC 5JRCA 2LT3A 2Q8DA 3O1IA 1HFAA 5JRCB 3PTRB 4JEUB 5A3WA 1SA0E 2X68A 3UUMA 4LXLA 5F3GA 2XAQB 1S94A 2XAHB 3PDYA 1QSDA 2L3LA 1VOMA 3RYFE 2K5BB 5LP6E 3KBTA 5LYJE 5FY9A 2OA5A 2PG8A 4XBFB 2ZM8A 2E9XC 3V5UA 4QWNA 1D1CA 4HTEA 3QK6A 3RKOA 2JMHA 3AL5A 4QX7B 4DNDA 3C64A 5FP4A 3N9MA 5LGNB 5LHGB 4AKGA 5FYUA 3RC3A 4OHFA 1HX8A 3M65A 4MALA 5FPLA 5FZKA 5A7PA 2CLYC 2G0UA 3CMLA 3R6NA 5ADXL 4UVBB 2Z6EA 1KK7A 3EVYA 4ILUA 3D0TA 5FP8A 5IVBA 5FXZA 5FZHA 5FPBA 2N9DA 5FP3A 5ETWA 3AA6B 4U72A 5F3EA 1ZHCA 3Q2MA 4O4IE 5LXTE 4DBQA 5FPAA 3DJBA 3FHNA 1LKXA 3L09A 5JDFA 4DMWA 2NW9A 3CKDA 5HWXA 3KBUA 4ZI3D 3N2OA 4GK5E 5L3GB 5FY5A 5FZOB 4WBOA 5A7NA 4IHJE 3ZYLA 5A7SA 4D6QA 4PFOA 4AQGA 2CMRA 2A72A