3K3OA

Crystal structure of the catalytic core domain of human phf8 complexed with alpha-ketoglutarate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
355
structure length
350
Chain Sequence
b'LRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 8
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 96
structure length 350
sequence length 355
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3oA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3oA01
3LDBA 5FZGA 5FZ1A 5FZCA 5FP9A 3OPTA 4AAPA 4HONA 4LITA 4CCKA 4C8DA 5FZOA 2Q8EA 5FZ8A 4DIQA 4IGOA 4HOOA 3N9NA 2OX0A 5FYTA 5IVEA 5FJHA 2XDVA 4QX7A 5F3CA 4QXBA 4LXLA 4QX8A 5FYYA 3OPWA 5FP3A 5FZBA 5FY8A 4BISA 5FYUA 2YBKA 3LD8A 4XDPA 3PU8A 3DXUA 3KV4A 4IGQA 5FPBA 3N9MA 5FYCA 5IWFA 5IW0A 4BU2A 2OQ7A 5FY7A 4V2VA 5IVVA 3PUAA 3KV9A 4D6SA 4CUGA 5FYBA 3RVHA 5FZ7A 4NUBA 5E6HA 3AVRA 5FY1A 2Q8CA 5FZMA 5FWEA 3KVAA 4EYUA 4V2WA 3N9PA 4D6RA 4UF0A 2XMLA 4QU1A 5F39A 4Y4RA 5FY9A 4GAZA 5F5AA 4CCNA 2XUEA 3PDQA 5FZAA 5F3IA 5F3GA 2OT7A 5FXVA 2GP5A 2WWJA 5A7SA 4CCLA 4IGPA 2W2IA 4EZ4A 5FPUA 2OS2A 5FXWA 5A7QA 5A80A 4QXHA 5F37A 5FZLA 5FZDA 5IVBA 3KV6A 4AI9A 3UYJA 5FYVA 3KV5A 5FUPA 3K3NA 3N9OA 5ANQA 5F3EA 5FXZA 2YU1A 5A7OA 4GD4A 5LY1A 2OQ6A 5FZ3A 5A7WA 3U4SA 4URAA 4E4HA 5FYHA 5FYIA 3AL6A 5FZ6A 4BXFA 5FZEA 5A7PA 5FPAA 5A3WA 5FYMA 3PURA 4LIUA 5FY5A 5F5IA 5FP7A 4GJYA 5IVJA 3U78A 5FYZA 3AVSA 5ISLA 5IVCA 4QXCA 5FZFA 5FUNA 2VD7A 4CCJA 3AL5A 2GP3A 3K2OA 5FY4A 2YBSA 3N9QA 5IVYA 5KR7A 5F2SA 4CCMA 3K3OA 3PUSA 2PXJA 5LY2A 4UF0B 4Y3OA 5K4LA 5FBJA 5A1LA 5A1FA 3NJYA 3DXTA 5FZ0A 4ASKA 5FPVA 1VRBA 5FZOB 5CEHA 2WWUA 5FPLA 5F5CA 5FZHA 3N9LA 5FZ9A 2YU2A 2YPDA 5FWJA 2XXZA 4CSWA 3PUQA 3ZPOA 5A3PA 5A3TA 5A3NA 5FV3A 3ZLIA 4GJZA 4EZHA 4D6QA 2Q8DA 4LIVA 4CCOA 3PU3A 5LWBA 2YBPA 5FY0A 5FYSA 4XDOA 5FZIA 5FXXA 4QWNA 4Y33A 5FJKA 3KVBA 5F2WA 3PTRB 4DO0A 5FZ4A 5A7WB 4TN7A 5FZKA 5A7NA 5LW9A 5F32A 5IVFA 5FP4A 2P5BA 5FP8A
chains in the Genus database with same CATH superfamily
4X8PA 1FT9A 2O8QA 4Q4V1 2W66A 5JQGE 2JDMA 3HWJA 3IAQA 3RZHA 3RC3A 2A9UA 1IKPA 3EBRA 5F5QA 2DLRA 3N9PA 2WSVA 3Q8CA 2V4VA 5FK7A 5J96B 4Q8KA 5D8AB 2A70A 1HG2A 4UEMA 5FZDA 1BQPA 3LF7A 1HB1A 5DZGA 4EN6B 3VBOB 4V1PA 2NTYA 2M6IA 5B4NA 4B1LA 2IC1A 2WNUC 4KH9A 5GLTA 2DL1A 4KP3C 2CSGA 4UYBA 4QPGA 1TNRA 4Y3OA 1ZX5A 4Q26A 3WR0A 1L7RA 5JOWA 1VBC2 4L5GA 1ZZ9A 2EF6A 2XJQA 3AYAA 1UY3A 4DNDA 3HKBE 4GJZA 3J8F3 2VOXA 5EJ3A 4EWAA 2YHJA 1A8MA 5LRRA 3T2QA 1QXRA 1YI7A 4WW0A 4CP1A 4M3CA 4YVWB 5C5TA 2PYTA 4IERA 4FSJA 1ZEEA 3VBSA 5AQRB 1Z78A 1SDWA 1RMU1 3WNOA 1V6IA 4O2BE 2MPFA 4PIZA 3U3IA 2XAJB 5FZMA 1XNQT 1RUI3 3HOBA 3IDCB 3WD5A 2XQYA 4CDXC 5JIAA 3PJAA 2CTVA 2XLAA 3ZFGA 3SH5A 3ZIXA 4KNCA 3W58A 3HKCE 3KV6A 3AE1A 3JBG3 3GXUA 3NNJA 3MW2A 4FT8A 1H2LA 3W5NA 1G8WA 4HWDA 3VBOC 4LF6T 1POQA 3KLSA 2QZ3A 2HWC1 1PO11 1RINA 5LMNT 4PLMA 4A3XA 4LF7T 4AKLA 4XBLA 4CP9A 5F2SA 1ENRA 1K5MC 3DXTA 2VXJA 4YW7A 3HT2A 2V5YA 3UESA 2OPKA 1XJAA 2AH2A 2XQ6A 1AL22 1VBE2 4AGGA 1UYPA 1AYM1 1WLDA 3OEBA 1CGPA 4H14A 4GH4A 4Q27A 2R063 2EVXA 2ORZA 3OPTA 1PGW2 2VPVA 4GWIA 2XQ9A 3FB2A 4F3JA 2Y48B 2XLFA 2VNVA 3LDRA 3WINE 2AXDS 1S4CA 2YKSA 1ZRCA 2DTWA 4Y20A 1OEDC 2ORXA 2ZX0A 1R091 4NMIA 3EO6A 4J2CA 2QJVA 1ZYBA 4QU1A 4XHBA 1CWPA 3I0OA 1GZTA 3AAAB 3VBSC 3MLKA 3WVJA 3RJRA 2DYCA 2W91A 3RYFE 4FQZA 4BQWA 5J3UA 1YD8G 4XXPA 4ZPIA 4U31A 4QB2A 3N9OA 1ND2B 3OBZA 5DDJ1 4IV3A 1O3TA 4WM8B 3JCFA 1O4TA 3A4UA 3J8F1 4QXCA 2K9AA 3A8YC 2IHR1 3D8CA 3E6CC 4CCDA 2QQIA 1XOYA 2LJLA 4FOQA 1Y64B 3ZFFB 4WVMB 1EUTA 3OUJA 3OY8B 4WM7C 3D0JA 4FOVA 5KHIA 3EB7A 3RJ2X 4HKLA 4QM8A 2WNEA 3C7OA 4J1WA 2DFCA 2QQMA 3H8OA 2WY2A 1POV3 4WVZA 1ZA4A 3ZYFA 4DR7T 3DYOA 1RUI1 4Q1PA 5FZOA 3H0OA 4PIYA 1DQ4A 4S2DA 4NE9A 5CFDB 5G04L 4LXLA 2B42B 4H9OC 1SACA 1YO8A 4Y26A 4I55E 2IAKA 3FBLA 3D5OA 4LORA 2VZUA 4QPYA 5C9AB 2H7VC 3JBG1 4GALA 1U4QA 1GQPA 2WO3A 2PHRA 1IJ5A 3RI5A 3AM2A 2VNRA 1KF6A 2Y6FA 2RM22 3K77A 4ARYA 1G9BA 1C5HA 5JDGA 4JEUB 4NAMA 5DQ0A 3CHXA 2VQ0A 3H7JA 4XHXA 2W62A 1S0JA 2DI4A 5GZFA 3VBHA 4ATEA 2BFUL 1ZVFA 5EJ1B 1QH7A 2VCBA 4CXWA 3LK42 3SKVA 1OFNA 3ZFFC 2GC0A 4AR2A 4Y5SA 3WDWA 3GBGA 3BKZA 2W2UA 4P09A 1UU6A 3UTKA 4CTEA 4XW3A 1AR63 1ENSA 1ZV4X 1Y4WA 3ES1A 2HH9A 4GYRA 1PHMA 2XJTA 3N9NA 5L19A 1BMV2 1OD3A 2DU0A 4XFCA 5A32A 4IGQA 3DXUA 3KV4A 5C8WA 4LBQB 4ADZA 1PK6B 3ABVA 1HRI3 3ZYKA 3WP5A 2E7QA 1CZTA 1V9U3 4QDQA 2J42A 4YGBA 1MNDA 4GKYA 3IAPA 3UT0A 2JENA 1CVNA 4Q29A 4WZFA 5FZ3A 5FVKA 3AKPA 4QU2A 4O4LE 3VZOA 1F8VA 2LHNA 4MO3M 4I3GA 5I0DA 2KT9A 4AVVA 4IDZA 4QX1A 4BB3A 2WWUA 4AKGA 4MUVA 1GNYA 1QEXA 5LZ6A 1FYUA 4RYDA 3GZEA 4DEQA 4KHPT 2LSYA 3O0WA 3POYA 3GM8A 3LEMA 4XACA 4JGYA 3P6BA 4CCKA 3BALA 2BOIA 4FPFA 5DAXA 4IGOA 1WW5A 1JNZA 1SLLA 3AVRA 4HFVA 2DVFA 1VBA2 1LEMA 1PVXA 3MF6A 4HFHA 4HMZA 1NQDA 1CJDA 2GMEA 1CIWA 2VZTA 3K3NA 3R4SA 3A7MA 1EAH2 4LT5A 1E5RA 5FZ6A 4BXFA 2DFBA 2VQTA 4PDWA 2R042 2LRKA 2I0MA 2WZR2 1UGOA 5A1FA 3NV3A 2ZGSA 2ZGMA 3ACFA 3KQRA 4I09A 3M3ZB 2CL2A 4FXGB 1GZ9A 1YQ8A 4IUGA 3RHWA 2PHFA 3POGA 1MS9A 2DVBA 3LIHA 1HRI1 5KX5E 4ARXA 4JDOA 5JXIA 1V9U1 1LHOA 1S0BA 3NL1A 3M3IA 3PUHA 3SEPA 3ZMOA 2LM9A 1N3QA 3MHZA 2PJQA 3NNLA 4XF4A 5C33A 3U11A 2B46X 1W39A 1NLRA 3WUDA 2J1TA 1BK0A 2KMFA 4Y4RA 5CJ5A 4EQVA 3WV6A 4DUZT 3MDPA 5LB7B 3J7HA 1IS5A 1O5UA 2EIDA 1EV12 3ONLC 3GZAA 3WW1A 4J6GA 3GJAA 2WIIB 2WO7A 2PMWB 2VBPA 3OUHA 3VD7A 4Q2FA 2OA2A 2ARAA 4NJ4A 2ZM6T 1OLMA 4HN1A 2YYOA 4ET7A 3DUIA 2CNAA 2PXJA 4IEYA 2AUYA 4OLLA 1JZ6A 4XF0A 5HV0A 2EHOD 4D69A 3RYRA 4ILBA 5J1GA 1Q3EA 3KVBA 1CUNA 3CKHA 4AEMA 5LA2A 3AK0A 5L3EB 1FNZA 4WBOA 5BPXA 1DDLA 1SLAA 4QQLA 2HHHT 4BOWA 4A7YA 1HQLA 3SS1A 4JRAA 3OEAA 2X0LB 4UXAA 1VB2A 3FXEB 1ZZ8A 4ES8A 2QCSB 5C4WB 4QAWA 1BEV2 1VBC1 2BW8A 4DIDB 1HW5A 2XVLA 1E5HA 2BUKA 3WXPA 1MMAA 4FPGA 3RRWA 5G05L 3HBKA 1RUJ3 1RVF2 3E97A 3AEDA 3PURA 3F95A 2R0HA 2X29A 2ZX4A 4AVBA 4K40A 3VDDA 2D6LX 2YFUA 5IVYA 4UF0B 2Y8KA 1NAEA 1ZRDA 3MZKB 1YWKA 1LOEA 1O6UA 3HQUA 4PJYA 1PIV2 2VUCA 4CP2A 4ERRA 1A8DA 2O0OA 3ZCIA 3RX6A 5L3GB 3FHNA 5AQHB 1QHDA 1RUF2 2E51A 3AXJB 4L8QA 3SFDA 3CQCB 4AAPA 1B35A 5SV8A 4U36A 4QX2A 2B45X 3AE5A 4D7TA 3LEKA 5LG4A 5BNPB 1X8MA 2V6YB 4AL9A 4Y1YA 4IV1B 3U1XA 4DV3T 2RDQA 1W6QB 2VB6A 5J98B 3DYPA 3OGVA 2SPCA 3PVEA 2WA3A 5E16A 1AL21 5AVAA 4HEAA 2NW9A 2VCAA 4GKXA 4IIJE 3MLLA 1W6NB 3WUCA 2C26A 5L7OB 3WG4A 4AI8A 3RWNA 3NRUA 3U4SA 2OUJA 2F4VT 1OQDA 1PGW1 1XE0A 1IBMT 2M67A 4QHBA 3ZXGA 4ILUA 4FI5A 3GYDA 4L92A 4CI2B 4LF8T 3WDVA 5FZ0A 5FPVA 2CGOA 3SCHA 1LGCA 2HBTA 2IVJA 4ZI3D 4AIUA 3VDDC 4JEHB 3OUIA 1FI2A 2AZ5A 5ABJA 4A5XA 2YGLA 4X6QB 1YQ2A 5CVRA 4IE5A 1ST8A 5LHGB 3ASIA 4GWJA 4MHUA 5FZCA 5DPNA 3ORJA 3QCWA 4ILAA 2V6XA 1TME3 3AA6B 3FZHB 4YZ2A 4WZXA 4C0HA 2I45A 3V5SA 2L9LA 4QMAA 4Z8XA 1RJ8A 4QX8A 4TWFA 4N7UA 1B35C 5BNPC 4IV1C 3LFIA 2QTWB 3KS7A 1S0GA 3USUA 1N1YA 1RUJ1 2CWOA 4FTSA 2A7AA 4LBNA 3OCPA 1D7PM 2CE7A 5FQ0A 4U7YA 5A70A 4XZPA 4XTPA 3GCWA 3ITQA 2R072 2VMFA 2HWD3 4XBNA 3GALA 3OD4A 3AL6A 1OUXA 3FZKB 4R4XA 4I50E 4O9GA 5EPAA 5HXMA 3B01A 5JIUA 2JJ9A 4NUUA 4YZ1A 3GN5B 2YC0A 2VKOA 3PHMA 3FZ3A 1LHVA 2BGOA 3B00A 4LEJA 4LHSA 1OOPB 1G73A 4KG8A 4CEWA 1BVP1 4HANA 1ASJ3 2Y33A 4QX3A 3VHOA 3ZXLA 5HXVA 1QDCA 1MS4A 2R30A 2RM21 1IOAA 3LGRA 5FP8A 5JR9B 3MI8A 5ABJC 1MZ5A 2BZBA 5LK5A 3PUYF 1R083 3Q8EA 3RYIE 5CADA 1UURA 1VBA3 4DXTA 3LD8A 4KWLA 4UFLA 4BAYB 5EZWA 5AQQB 2A3XA 3GF6A 5FY7A 1WCUA 1JI6A 3IBMA 5FZ7A 2WFPA 1H8TA 1XWMA 2PELA 3FFQA 2R32A 4DMIA 1C28A 4CN1A 2PAKA 1IKQA 4IGPA 4DOUA 4AEKA 5A7QA 3K4DA 1PMHX 1UOBA 5FO8B 4YFSA 4K0KT 4E7ZA 2X67A 4X66T 1A34A 3C7GA 2N9DA 4YGEA 5T3NA 3AZVA 1HNXT 2VO5A 1VJ2A 2LS6A 2GP3A 4LOTA 5AC93 1BMV1 2KNDA 4OVEA 4CRQA 3NRYA 4N53A 3VUOA 2QA7A 1TNFA 1J1TA 5JXJA 3M70A 1NA1A 5L9VA 5F5CA 2IXKA 1TME1 2AE9A 3H1MA 3P7IA 5GLVA 4JI5T 1XNBA 5A3UA 2NQYA 1NCRA 2WZ8A 4BQYA 4YSYA 4YGDA 1W8TA 2GC1A 3QNUA 3CEWA 2GC3A 1EP0A 4EOZB 2RJ2A 4RR3B 3J9X1 4LHKA 4O61A 2Q8OA 3O0VA 3ACIA 3N9MA 4NRQA 1WBLA 1W9SA 2WDRA 4AVSA 4EWEA 2WBLA 5CFBA 1IG3A 1GICA 2LT3A 4PK6A 4R9DA 3Q9OA 4QPGB 1U5PA 4QKDA 5HBAA 3V64A 1XYNA 3RPUA 5HCAA 1H8TC 1WD3A 3ABZA 4LO7A 3HKDE 3WI3A 1LKXA 4FPOB 2VQFT 2GNTA 5C8CB 1IPKA 2MBGA 2E6VA 4PFOA 1NXD1 3WHTA 1PO23 5HWXA 2E5LT 3ZVXA 4CDQB 1WWYA 3RZLA 2VK9A 2RA1A 5FBZA 2VZQA 4H9SE 4OK0A 3TOJA 1R081 1VBA1 2UXNB 4N53C 4IEVA 1UWWA 1T2XA 3ONXA 1JYCA 1V00A 3E08A 4AQSA 4TV8E 3Q8AA 1H1AA 4HFEA 1OQEA 4O8SA 2VTXA 2GAUA 3CL1A 2ZHKA 3TB0A 3S6PA 3EHZA 1EAH1 1OMIA 5F6LB 4E8CA 1BEV3 4RR3C 1AYN2 4E2QA 2RPAA 2KINB 4MZUA 4FPJA 4P9JA 5IFPA 2WZR1 4IEZA 1XNRT 2GH8A 5IHYA 3S4UA 3GCXA 4YGCA 5I8TA 2YDSA 4WVVA 1AR93 5DZFA 2LEHA 2IC9A 1GV9A 3RRCA 4PF1A 3NW4A 3UYJA 5ANQA 4YVSA 1H2NA 4YRDA 3AKSA 4BM8A 4PAGA 3NNGA 1UY0A 2WMNA 3UV9A 4Q0SA 1S0EA 2X0YA 2ZBJA 4HN9A 1Q8QA 5LJMA 3RQWA 1S2BA 3OD0A 2ZGQA 4CDQC 1MQTA 2JDYA 1T7SA 5JOXA 4OQ8A 4AVCA 3E1F1 2IFWA 3OPZA 4DZGA 2BKPA 2DURA 4DR1T 4JKLA 5BUVA 1KEXA 5IYYA 3WCSA 1E1HB 4Y20B 5DUXA 2VCMA 3I2KA 2E8IA 4TN7A 3FC0A 1EV11 3H3LA 5HCFA 1COV3 3V5UA 3ETQA 4B7KA 4LE4A 1S94A 2CBIA 4KBZA 1N36T 3VZKA 1O59A 4U7IA 4Z90A 4MXVA 2DBNA 1JU4A 4IESA 4JGZA 3BYWA 4IV3B 1V6KA 5KXBA 2DVAA 1D1CA 1XZYA 1SLCA 4AEDA 3ETPA 2CPTA 2DU1A 3UJQA 4YYOA 2ZPXA 2NMOA 1VB4A 4OULA 2FD8A 1C8M2 3WP6A 4CU6A 4U2AA 5FPUA 4QXHA 4EAHA 4ZKTB 4K21A 4BQXA 1LOFC 2XQ7A 4D7SA 2VECA 4H9NC 5FP7A 1FMD3 2GU9A 4YVSC 3O1JA 5BR8T 3D0TA 4QQOA 4H55A 4FPEA 4Q4X3 3BTYA 2RDNA 4Z2WA 4DQAA 5FZOB 3B7MA 2G4IA 1J1JA 3LK2B 2ODUA 3PUQA 1MQTC 3RZMA 3GZTB 2D2SA 1BEV1 1YKEB 5EJZB 1YXWA 2KR2A 4FI9A 3OG2A 3KB5A 1AR82 3WEZA 2JB8A 1IJ6A 4HOOA 3ZSTA 4XJZA 2WT0A 1OH3A 4Q5OA 3HPNA 5HEGA 3EHKA 1RUNA 2ZGKA 3H3ZA 5DAQA 3NVCA 2QQJA 1NEKA 1RL3A 4N43B 1SLIA 4RQPA 1X7NA 2D0TA 2BNNA 1PIV1 1SE7A 5KC6A 2D5HA 1UZZA 3T2OA 2VMHA 3A0NA 1XNDA 2WDVA 4PFPA 3C7FA 1RUF1 2KSRA 3X1DA 3DV8A 4B29A 3RZZA 4LLFA 2C5JA 3GZUC 3UNPA 1W8FA 4JDMA 4AFCA 2RS32 5DQVA 4X62T 1EPWA 2NYYA 4I0BA 1COV1 1WA6X 2WAAA 5FMBA 1KK7A 3M3EA 4D6QA 2CXLA 4LIVA 1QJU3 2F17A 3FZMB 4CDWA 4ES9A 4AFDA 3S5AA 2VQAA 3OGJA 2WLQA 2GK9A 1EY2A 4DB5A 1QJY2 2G9FA 1DZRA 3TRSB 1D2QA 3VKFC 1LR5A 1LVKA 5HCMA 4M0HA 4QT6A 2RR13 1F4AA 3CU7A 3HMYA 4HKWA 2A3YA 2LTNA 1HDKA 4MGZE 3P4PA 3KCXA 1UIJA 1CAVA 3OYZA 3ZN0B 1RUC3 1ZM1A 4IDNA 3BVCA 1CAXB 5T5PA 4B4RA 4COUA 2UXBT 2CMRA 3AE7A 1N1VA 1PGL2 2LHRA 1LVFA 4Z2AA 5GLZA 4YJ3E 3V56A 3ZYMA 1H1MA 1JMUB 4RFRB 4N9IA 2XPKA 2J1VA 4XFFA 3ZYHA 4A7KA 1T8BA 5FZ1A 3FN9A 1YKHB 3N36A 4XFBA 2KM2A 4ZXKA 2VZPA 1PNFA 5H9QA 5F7UA 5AQTB 3TN93 2HYKA 2ZCWA 3NRXA 5EFUA 3U14A 1LOCA 1VMFA 2LRPA 5L4EA 1CD3G 1DCSA 4PDWB 3FMGA 2X0HA 3H37A 4R4ZA 4Q25A 2V5DA 2RG4A 5CG8A 4ASMB 4CCCA 1XNAA 1W8HA 3C50A 3POWA 1XSRA 2XPJA 1WD4A 4DFSA 3ZPYA 3M4FA 4NHXA 4GD4A 5DXDA 4XUOA 2GNDA 1IGOA 3WLUA 5DABA 5FYZA 3O1TA 3O1PA 4CCJA 2ZX2A 1WR6A 3C64A 5KR7A 4A7ZA 2ZABA 1TMF2 2ADEA 1GP4A 3L3PA 5C3JA 1HB3A 1OA2A 3AEBA 3DTOA 3UU8A 2WBKA 2UUAT 3B57A 5JZGA 1NZIA 5IFTA 3R4UA 2J1DG 4KMQA 2B8MA 3WNNA 2RR11 4XBQA 4YPJA 3WDYA 1BZWA 4K1ZA 2VL8A 2P3YA 1NCQB 3O1OA 3M7AA 3T3YA 1YI9A 1XDPA 5JR2A 2DUPA 2WJSA 2JB4A 5LMUT 4W4ZA 1SBEA 3ZN5A 3AKTA 1YEWA 2JMKA 1IG0A 5GLWA 1LESA 5I93A 4KMCA 2XQAA 4ZZBA 2A71A 5J48A 1CR7A 2FDHA 2Y6JA 1EPZA 1DGLA 1C4RA 1V70A 1OXZA 2W1WA 3PNAA 5JI7A 3ZFEA 3Q5XA 1V6NA 1B7TA 2E9XB 1GWMA 1JXNA 3PE0A 1D0ZA 2YDRA 1K42A 3MFAA 5KHJA 5A6XA 2WC2A 3ACHA 4P02B 2L9QA 1Q5OA 5DAPA 3FUQA 4CEYB 4AXPA 4YG0A 2CGPA 4LF5T 2BYVE 4ORFA 1O5LA 4HK8A 1Z8UA 2YU2A 1WMXA 3TEYA 1XSQA 1APNA 2MTQA 5APAA 1UYZA 4PJNA 3MIDA 1YRZA 3PVNA 2VZ1A 4FFIA 2JPFA 1JUIA 5JSRA 1QDOA 1GP6A 1F5JA 4K1YA 3D6EA 2NN8A 2CM0A 3SKJE 3BI3A 2PQSA 1OKOA 5JZGC 1NCQC 3O7OA 4JI1T 1FPN3 1H6YA 1HX6A 3OGSA 3KGLA 3H9AA 3PUVF 2W00A 5LHIB 1GOHA 1R1A2 5FY1A 2Y0OA 1YQ3A 2A73B 4W50A 3WOGA 2Z42A 4CCNA 1NE6A 4MYEA 2BDRA 3ZSJA 4IT4A 1JZ2A 4TNWA 3T08A 2DVGA 5IYZE 1KFXL 2E9XC 4Y5Z0 3N7MA 1JYTA 1MR5A 4BMBA 2HH7A 2E7TA 3MF9A 3JC6C 3UGGA 4CEYC 1AYN1 1JZ7A 5FUIA 4ZI2C 1VRBA 1MS1A 2W1UA 3C98B 5ABFB 3RS6A 4QB1A 4C0BA 3VRBA 3VKOA 4DO0A 5A7NA 4JI6T 2ZKNA 2IXLA 3E5XA 2XSBA 2BWCA 1W6PA 2R16A 1F4HA 3R4DB 2HWB2 4HE8A 1CONA 2D98A 3I3DA 3POEA 1RYYA 5EK3A 5L47A 1KGYA 2ACZA 5FTTC 1E5SA 1HN1A 1AVBA 1NUKA 1I3HA 1OC1A 2JICA 1V6OA 4B3RT 2LE8A 4PF5A 3PTYA 3Q8FA 3L09A 2PHXA 4L99A 2YU1A 2VQET 1UN1A 2XH6A 2WDQA 1LENA 5EK4A 4OQ9A 4Q1RA 5IVCA 1O91A 2A75A 3AFKA 5KXDA 1XU1A 2LALA 1STMA 1YXRA 3QB5A 3UKNA 3OTFA 5FWJA 4QX8B 2BBVA 1KDKA 3FX3A 2X5IA 5LWBA 3MPBA 1FPN1 4QWNA 1C8M1 2YDEA 1SEFA 2AYHA 3BB6A 4AK3A 3FLRA 4CPBA 2AC1A 5AQVB 4JV5T 4D8MA 1WCKA 2A6YA 5FQ0B 2OV9A 2W1SA 2ZZQA 1JYIA 3H8XA 5L9RA 3ES4A 4K7JA 3UULA 1PNGA 5FYCA 3VBUA 4XIKA 4IGUA 4OFZA 3KCCA 2LM2A 3R05A 1VCTA 1RUD3 5GZGA 4HWIB 3I59B 3N4MA 4R9CA 5T50A 2XB6C 1ND3B 4UFKA 5IHRA 1I5ZA 3VD5A 3P4SA 3I2HA 4GA9A 1MNEA 4CU7A 1AJKA 5FZFA 2JDKA 4CDUA 4E7SA 1US7B 4DUVA 2K3WA 3I54A 1RHI2 3H42B 5I91A 1WLWA 4NHKA 5AQNB 5KXCA 1XDOA 5GZCA 2MOZA 4IE0A 4QPWA 2WKKA 4XDQA 3O14A 3NKTA 2WP9A 2YBPA 2VUDA 3FE5A 1FX5A 1P8JA 4YM1A 3SITA 1VRH3 3HN1A 3CJIA 3MV11 2WQ4A 4Y22A 2XWBB 1TVGA 4L11A 3Q5WA 4KGQA 2Z2SB 4LOSA 3EABA 1QMJA 2YBKA 4PI0A 2RS31 3NWKA 4XE9A 1YCIA 1ZBE2 4AQ6A 1W90A 4NXNT 4L9IA 2LROA 3B9CA 1WA4A 3GGLA 4IE6A 1JUHA 4JVAA 5T52A 3VBFA 1O4ZA 5F5AA 3I49A 5GZDA 1DYKA 4EZ4A 3FZFB 1WR0A 3NMBA 1YJLA 5FAXA 3VBRB 1NA1B 2E7AA 1J3PA 4A45A 3AE6A 4LE3A 1IZ3A 4EN8B 2ARBA 1ZRRA 3Q5DA 4QX7B 3J26N 4EN7B 3BOPA 2VR4A 1NCRB 2D7FA 1QJY1 1DHKB 2ZHMA 4W6YA 5ETWA 3ZSSA 4GKJT 2BNOA 4MOAA 4QQPA 4RFT0 3AMQA 4EWDA 3SQOA 3ZN6B 2H0VA 1W04A 4CDUC 3HN3A 4A98A 3B02A 4CCOA 4WYVA 1UKGA 5FZIA 5FXXA 1JTZX 3VR9A 4N8MA 3ZMVB 2KWHA 4NPRA 2V1DB 1WCDJ 2J1RA 4B7EA 3H1YA 3QK6A 2PN5A 1W6MA 2CAUA 1DZTA 4A41A 1FMWA 2WM9A 2D43A 3UETA 1AX2A 3KBTA 3ILRA 4GWNA 3TLUA 1JW6A 1QXPA 3VDBA 3EXUA 4P5HA 1UCXA 2WUHA 1PGL1 1AR73 2CHHA 3I3EA 2VW2A 4O2AE 3NVOA 3ZSKA 2XQ3A 5LP6E 2YC2A 1J84A 2OT7A 3MO4A 2XY8B 1DGWX 2V5CA 2X9XA 3P3PA 2VZRA 2BG9E 2H0BA 2JG9B 3ZR5A 2ZA9A 1JN2P 3OSDA 2E2AA 1PM4A 1QH6A 1W9WA 5JWPA 4K6BA 5J1XA 2XTLA 1MS0A 4JV4A 2ES0A 1GOGA 2AEYA 5KHGA 3RF1A 1W2TA 5HXEA 5BNOA 4LKFA 3FWEA 3ZC0A 4TWDA 2ENRA 3WNXA 1VRH1 5JPMB 4G2AA 2BVMA 1DLCA 4ZU7A 2Y34A 1HRV2 4XOGA 1S0FA 3GHNA 2VKHA 3F31A 2W9XA 4GB32 5FP4A 1ODMA 3CK6A 1BVVA 2WS93 2H6CA 2DWKA 1F31A 2MEV3 1JYVA 4AVAA 3DKQA 3AYCA 4P9LA 3CJXA 5FP3A 2BGCA 1WMDA 3IPVA 5T5JA 3DP7A 2D6NA 1BHGA 1WCRA 4Y1XA 5E6HA 5FDBA 1JH5A 2Q30A 4O9EA 2HN1A 4W6XA 2WWJA 4CCLA 2B39A 1MMGA 1F9KA 2VOTA 5LA6E 2GH2A 5CKMA 3AAEB 2JG9C 1W8ZA 2LSIA 4B4QA 2VJXA 3VD4A 3ON7A 1LODA 3AJYA 4GYSA 2W47A 3O1IA 4LO5B 1JBCA 4DV2T 4ZS3A 2K24A 1ZKEA 1WW7A 1RC6A 4ASKA 1GKBA 4DR5T 4LA2A 1YW0A 2LSGA 1J1LA 1S0CA 3N3HA 4OUEA 2WZHA 4KU7A 2OZ6A 4YM2A 4PQ9A 5DUVA 1X9BA 2UY8A 4U74A 3IWZA 4JGZB 1GNZA 2E9QA 1L7LA 3QOFA 4LR4A 1C57A 3H8UA 4HFCA 2X9WA 4QGLA 5HAXA 4XF3A 5LW9A 4JQTA 3IHRA 1SPPB 4X8NA 3RG0A 1LJ7A 3MKDA 3VDAA 2WDBA 3ZXKA 2W0GA 4BQ3A 2Q1FA 2XR4A 5FYUA 1AJOA 1MACA 4NPPA 4V2VA 4Q4W3 5HPOA 4COFA 4HSLA 4OHFA 4A56A 2QQVA 5A1AA 2VVSA 2V72A 3ANWB 5HXRA 4QPIC 1MVQA 4KI5M 2CWYA 4YW1A 3U4XA 2UUCT 1QJZA 1V6LA 2FDJA 2HWF2 5JDQA 2ID4A 4LKSA 1H2MA 5LY1A 1UO9A 3S5QA 1QQP3 1TQ5A 4JZRA 1ZBA3 1GU3A 2EHOA 5CFCA 3CX7B 2WNVC 3K3QC 3ZKUA 2RV9A 2IXJA 4DV6T 3NJYA 4BLJA 2A72A 3NBXX 5GKAC 2WMOA 3AP7A 1R1A1 2ZS6B 1GBGA 1O3RA 3AXEA 1XE7A 5BV6A 5AQLB 2Z5WA 2ZEWA 3LBXA 3B9IA 5F2WA 4Q0UA 5JRCB 3ETVA 4QXKA 3LPFA 4RQPB 3VD9A 2GDFA 3ZXDA 3DEMA 4Q4V3 3LWCA 1HTJF 3T1HT 4RS5A 1LKNA 2ZGLA 4X5TA 1LEDA 5FZBA 1U0AA 4XQ4A 3KBUA 4JLEA 4GMP0 4Y24A 2C24A 5BXXA 1GLHA 3DCQA 4DV4T 4IEUA 2D93A 2B5HA 4F7ZA 1US3A 2BOJA 2RMU3 2CBJA 1L7QA 2LLYA 3GMIA 2V73A 5FYMA 4LK7A 5L3BB 1GR3A 4OYKA 2E33A 1S0IA 5JREA 3WDUA 4P00B 3ZMTB 3LEGA 2HWB1 2N1GA 3VHRA 2QQPA 4COYA 3JB4C 2TUNA 5GM0A 5FMDA 4JI3T 2EHOC 1ZRFA 1PM7A 4YFZA 2BKOA 4A3ZA 3ZLIA 2LW8A 3MACA 2DCYA 5FJKA 3RYHE 2WAUA 3PTRB 5H9RA 2C4XA 3SH3A 5F32A 4LBJA 4DY5A 2UXDT 2JQHA 1GZWB 4FPHA 5F6KA 2ZM8A 4MVTA 2VU9A 3VN4A 1CN1A 2BG9A 4XILA 3U75A 2W68A 2QVAA 1W05A 3MLJA 4M0NA 3AMPA 2LOSA 2AEZA 3UU4A 3H3UA 3LA7A 3K75B 2IW5B 3OJAA 2X9YA 4OZXA 1QQP1 1ZBA1 3J7NA 4ILCA 2CEAA 4DUXA 3VHLA 2ET1A 2VBBA 1R8IA 5A33B 3WF1A 4GOUA 1BK1A 4UVAB 1YFYA 2WFF2 2W0XA 2JIWA 5ABHA 2VWAA 5A3WA 4IDOA 2A6WA 4AQFA 1IQDC 5ISLA 5ERLA 1ULGA 1ONAA 5B2GB 1YQ4A 4LMLA 1RUH2 5K4LA 3O1SA 4MXWB 2JDZA 2XBO2 1VBB2 5J37A 4BQ5A 3E5UA 4DBQA 1A6CA 3W59A 1AYM3 4EZHA 5FLHA 3GNEA 5LBMA 4NHMA 4ZS2A 2CHNA 4Y1ZA 3PMSA 3THPA 4CDXA 1YHFA 1CAWB 4NIHA 4U3CA 5K8SA 2D6PA 2DWRA 4CI1B 5T5LA 1EUUA 4XUTA 4RA0A 2D3PA 2ZGOA 3VBOA 1SFNA 2JECA 4AYUA 1HLCA 3AA1B 5DUWA 1OLQA 4MGYE 4Q0QA 2CDPA 1RHI1 3IDAA 3PUAA 2RMU1 3GA8A 3P4WA 2XG3A 1R093 2BG9C 4ZZ5A 1K5MA 2X05A 2WQYA 2VH9A 1QOOA 1MVEA 2KD7A 2FDKA 1PVC3 4I0WB 1DBNA 3OYXA 3UL2A 1QY4A 5EK2A 5DDJ3 4BQ1A 2E31A 2XL9A 1BBT2 2G1MA 1M7KA 3CZJA 5J09A 1NX9A 4E2GA 1CX4A 4AQ2A 4ZI3C 4P08A 4AQFC 4TZ4C 1ZBE1 4UW4A 3IDBB 2VNGA 1CESA 5CZKA 2YZ4A 1OEDA 2VMDA 3DYMA 1XNCA 2GMPA 3IIAA 4AXOA 3OBTA 3MYXA 2Q9QB 1KNPA 4AI2A 4ITCA 5FZKA 5HV4A 3BU7A 5FLIA 1J5ET 4LMFA 3RWKX 2ZX1A 2CWMA 3J7MA 4DIQA 1HQWA 4IL4A 5D8AC 2BV4A 5LBBA 1BLZA 4KX6A 3BPSA 4CUBA 2YY1A 2P4EA 1H7CA 3ST7A 2XMLA 1KITA 4HPKB 4WM7A 3UUXB 4ATFA 1UY1A 5FNVE 5T55A 1UYYA 3WAJA 2CGNA 4YM3A 4OYJA 3T2PA 4AFAA 3N35A 1WKYA 2CY6A 4EEBA 4UFIA 3SHRA 1X79A 5BNQA 2I59A 1AUYA 5JSOA 1IS6A 4HSJA 4ZY9A 4NIIA 2XM1A 4SBVA 4B6XA 3C4ZA 1DZQA 2ET7A 3ZYIB 4UFMA 2B76A 1FNYA 5DMYA 1D2SA 4YHJA 3AEGA 2QQKA 4YVWC 2EAKA 5ACA2 2ZX3A 2ILMA 2XOMA 3IIIA 1H30A 2CDOA 5K0UB 5A6YA 3RQ0A 1I6ZA 1UUSA 1N1TA 1ND2A 3N2KE 4B3TT 5GLUA 1PVC1 5C3RA 3OPWA 2LUWA 3BGAA 2PG8A 4YSFA 2BS2A 2F4PA 3C3VA 4HWFA 3ZFFA 4WVMA 2VBDA 3OY8A 3AE3A 1HRV1 1W09A 4LJHA 3I2IA 4R8HA 3S7EA 3EMRA 3PUZF 2BVVA 2R0FA 5KWRA 4Z82A 4IW3A 1GNHA 3L2YA 4YTNA 5IVBA 1D4M2 4GB31 3E0ZA 1JYWA 2CLYB 3V65A 5FYHA 3KD4A 2PFWA 1MZEA 2C5DA 3FXDB 4LFBT 4OI2A 1KJRA 3O1MA 5CFDA 3O5SA 3AZXA 4NIAA 2VQUA 1LB2A 4F8AA 1G6NA 4XFGA 4DY3A 3DF0A 2HWE2 5IJRA 1LHUA 3AX4A 3T1LA 2YXSA 2N7GA 4MLOA 5L3FB 5K0UC 4UFHA 2IDOB 1CX1A 5J0ZA 4E8DA 4XMAA 1Y9GA 3UKVA 1RXFA 4AQGA 2XQRA 1H4GA 1J59A 5F3CA 4UVCB 5IW0A 5ABEA 3POJA 4JDNA 2A3DA 3SISA 2XASB 1ND2C 5CG9A 1FEWA 1OWAA 4WM8C 5HWYA 5CKQA 3AE9A 3FZLB 2UYAA 2XL7A 3TBDA 1VBD3 4XJ9A 1GUIA 2CWSA 1F35A 4I30A 3ZDVA 2JE8A 1J5WA 2CLYC 1GMMA 3AXDA 3Q8BA 3BN6A 3I3MA 4UVBB 4YWAA 4QWNB 4M4RA 1DQ5A 1GOFA 3VU7H 2RS52 1QJX3 2RDRA 2Y6HA 2FHRA 3OVUA 3ME2A 5LGTB 3RQUA 2VVNA 2VKJA 3UU5A 4HVRA 2FBWA 4BXSV 1U5YA 4NXMT 1ENQA 4LBQA 2UWCA 3FLPA 1PK6A 3BTZA 2VGDA 1L0VA 3KZ4C 4XIOA 3LSVA 4GKKT 5EIYB 5CFDC 3RFRA 1JHNA 4NIQA 2QFEA 4E4ZA 1JS9A 3AEAA 5C9AC 4IHJE 5FP9A 4HXCA 3ATGA 2IIUA 4NHYA 5EWSA 4XQDA 2BFUS 4BJ0A 2W92A 5JMOA 3WW3A 1XQNA 4BE3A 1V0AA 2FMDA 5LOVE 5CGMA 1HJFA 2VZOA 3LSEA 1JZ4A 1AZDA 1K3IA 2A6ZA 2QRXA 1RUG3 2XJRA 3KT7A 1HG5A 2JDNA 2JG8B 3JAFA 2JD9A 1LGNA 4YXDA 1LOGA 1RUH3 5H6RB 1HXS2 4AFBA 3MICA 3QLQA 1VBB3 2JMHA 5KHHA 2XAGB 1W03A 4W8JA 3NJZA 1UY4A 4LO8A 1NLSA 3GWHA 1QJFA 2UUBT 4AQTA 3AE4A 5DZEA 1GQEA 3WDXA 5CA0E 3N2GE 2K5BB 1W06A 4OMCA 2Z4FA 4YG6A 3VL9A 4XDOA 3IDEA 1H8VA 1RMU2 4AOCA 2ETEA 1PK6C 1REDA 3B13A 3M3QA 1KQRA 1UOGA 3CX6B 1VOMA 5BMVE 5CNAA 3U37A 2OXBA 2VMGA 1J58A 4UBHA 4X1KE 5LCYA 5T54A 1OA4A 1MIYA 4IEOA 1VBD1 5L4HA 3IBPA 5FPZA 3BOWA 2QYWA 3C7EA 4NUBA 5JVVA 4V2WA 1W6OA 2HWC2 1PO12 1VBC3 3MPPG 2P3KA 2YMZA 4KG0A 4XYXA 1QJX1 2JG8C 4AEJA 3N2OA 4XFAA 3AP4A 3AA0B 2G19A 5JMCA 4ANJA 2Y6XA 4EYYR 2ZXQA 2A5ZA 4GK0E 3AP9A 3MA9A 2JDPA 3INAA 3G06A 4E4HA 4XF9A 3ZX7A 3NAPB 2HPLA 4HFDA 5AFBA 3K2OA 1MIVA 3DPRB 5TSWA 4JYAT 4CZZB 1Q43A 3AAIA 5L3CB 4AKHA 4HK9A 3KF5A 5FZ9A 3JB8A 2LKHA 3MGUA 5I0UA 4AKRB 4JC1A 3A22A 3I2GA 4Y1UA 2YINA 5C3SA 1G9CA 3RI9A 2QDNA 1S2EA 3CMGA 3OYWA 3MUZ1 1A3KA 1VAKA 5H9PA 1W2OA 5C3QA 3AJZA 3SFEA 1RUG1 4OHWA 1D0YA 2XDVA 4QXBA 4EE2A 1PMIA 5EHDA 1NLQA 4IE4A 3BUCA 1QLBA 1RUH1 4LA3A 1ZA7A 2XBO1 1VBB1 4FPLA 4C90A 1AL23 1VBE3 3J8F2 5BNOB 5IK4A 2CV6A 4LFAT 3LSDA 1HCIA 2V7LA 2J4GA 1UIKA 2MHFA 2FJEA 4KHZF 4QKBA 4TUYE 1DG6A 2WZEA 3R84B 3JAEA 3HEIA 4OI4A 3VR8A 5JAXA 5FIXA 4TXWA 2FQPA 2AENA 1JYNA 3NAPC 3DPRC 1H4HA 2ZLYA 1YJKA 3RKOA 3POBA 2QQNA 3BODA 3TEZA 2TNFA 1LNSA 3HNMA 1RUI2 3ACLA 5LA1A 1NE4A 3HNBM 4J25A 4OI1A 2L8KA 3CNAA 4LTAA 3O1VA 2P17A 3WW4A 2FDFA 2J62A 3CIRA 4UIGA 3QUJA 4BYYA 1X50A 1S2KA 2XQ4A 1ZZ7A 1ZZCA 3JCIA 3M65A 3ZO0B 3ZSLA 2WU2A 5LASA 4K20A 4QKNA 2RVAA 1ALYA 4EB6E 4G9SB 5FMOL 3T09A 1OH4A 4WBBA 2XQXA 3ZYBA 4UF0A 1X82A 4AGRA 4M00A 4XEZA 3MW3A 4AI0A 4K8RB 4P9GA 4DUYT 4QH4A 1SCSA 4NPMA 4ZONA 2K9ZA 2R062 2RE9A 4CYDA 1EYBA 2AACA 3PLQA 3POSA 3VL8A 4H9QC 5LATA 4H2AA 3ZYRA 4B3NA 5AQGB 1O3QA 1SHWB 2R6GF 3ZXFA 5I0RA 3NV2A 4NPLA 3DECA 3D0SA 5HEHA 5C5UA 5FO7B 1JOBA 4I01A 2XWJB 4DV5T 3ONJA 5BNPA 2V6YA 4UWDA 4FAGA 2AGSA 4IV1A 1OUSA 3WZ1A 3MIFA 3TWIA 2JXAA 1UX4A 2DUQA 2RM23 3UU3A 3H7YA 1GSLA 4YLHA 1WFDA 4EIWA 3NV1A 1QIQA 4FPCA 3T0DA 4UR9A 5D2AA 1YUDA 1W6NA 3MIEA 3UFGA 1MZFA 1CAUB 2I07B 5C4WC 2RJKA 1GZCA 1VBE1 2FJDA 5KDMC 4OI0A 4AI1A 1OVPA 1Q8VA 4NRMA 1UZWA 3ESLA 5CFCB 2HEVF 3TLWA 5LK7B 5LYJE 5ACA1 4DR3T 2HEWF 2ZTNA 2ZGPA 3T0BA 5EP9A 4HLTA 4KWKA 4H7MA 2OA5A 2D6MA 3KV5A 4NAOA 3RMXA 2BBAA 3HBZA 5IUQA 5JI9A 1JOJA 2P6CA 4HL0A 5HYAA 3ZDSA 4X64T 2C0ZA 4JTNA 4FFHA 3PV0F 5BYNA 1QKQA 4AG4A 5EZYE 4FCAA 1IQAA 4XJWA 2XQ8A 1UMZA 4PI2A 1XNKA 1SHZC 4DXRA 5BNNB 3B93A 3IB3A 3NV4A 4U2ZA 2WZPP 1VR3A 4JI0T 1W8NA 2WR9A 2DHRA 3THCA 1V6MA 3GBFA 2DDUA 3P4RA 2V8SV 4ZI7E 1N32T 1SMVA 5JTGA 3TAYA 4CUCA 4TV9E 3I0QA 1UPIA 2W3JA 1FXZA 2RDSA 1SDDB 4AI3A 1NXMA 2K0GA 3WF0A 5H6QB 5L7OC 4FTEA 2WNOA 5JXGA 3RVHA 1PZ8A 2GALA 1HXS3 3GN5A 1T6GC 5FY9A 3QH6A 4YLZA 2HWE1 4QM9A 2NM1A 2CAVA 1UYXA 3U10A 2Z6EA 4ZXEA 4QH5A 2X51A 2BRTA 1PZ7A 1MMNA 2WCAA 2WSSV 1IBLT 1DP0A 4AI9A 1AR62 3CZUA 1R1ZA 3I7DA 3KT4A 5JR9A 1UL9A 5FY5A 3EAMA 3U78A 1MEC2 1OXCA 5LB6A 1E7PA 4FOWA 3V0BB 3PUSA 3WNPA 2Q9QD 1HRI2 4DV7T 2OLTA 4HWHA 1DYOA 2VUAA 2DF7A 4FPKA 3ILNA 1I5PA 1V9U2 3PMEA 1QJEA 2L3LA 4MGTA 3IM0A 2WNUB 3AZYA 5FY0A 3O9XA 2PLV2 2X53S 5CBLA 5FL0A 5A7WB 2PHTA 1EAH3 4P9IA 3IMMA 4LFCT 5FZ8A 1ZHCA 2R043 1NQJA 4UW5A 4XFHA 1POV0 2D6OX 3LEIA 4UW3A 2WZR3 2VVEA 4INDA 2WT2A 3TNQA 2K2SA 4EYUA 1G7YA 2VVDA 4BLIA 1ENXA 3R6NA 2XUEA 1OI6A 4BQ4A 3ENRA 3T1YT 1BYHA 1L3JA 4K0UA 4BCUA 5I0TA 5JOYA 2KXPB 3IF8B 3ZT6A 3NQHA 5EYXA 1SFPA 5CKNA 3QB5K 4CU8A 1OOPC 2QKDA 4CDXB 1YIPA 4I02A 3J7Yq 1O8PA 4RR3A 1O4YA 5JR9C 4LBMA 4D0QA 2ZGRA 4HTEA 3PDYA 1JU3A 4F6RC 2NWBA 1Q8SA 4PLOA 4OHYA 4HVQA 3RKGA 1T72A 1K5MB 1EV13 3B69A 3LDBA 4LQRA 2Y0IA 3WX5A 2MYSA 4E9KA 5DQWA 4DRVA 4X6RB 1HXS1 2ODVA 4DNYA 3UUMA 3A0KA 2CCQA 3MBWA 4KUMB 5JUVA 4BA6A 1CPMA 5C8CA 4BHPA 4XDPA 4BPZA 3RDIA 4Q8LA 3RMYA 2P9BA 4CDQA 3LQCA 4HFIA 5JR7B 5I8YA 5C6CA 4Q0PA 5JVDE 3VKGA 4Z92B 5A80A 3FHQA 4M3CB 2CYFA 1OEDB 3CQXC 4L2NA 4PK4A 2C5KT 1KS5A 1D4VB 3VBSB 4CU9A 1HKDA 4AFMA 4FAHA 4WV8A 3N9QA 1FAYA 4MGIE 1KEYA 4B3ST 2DCZA 4COZA 3H3AA 1NAFA 1J3RA 5FBJA 1DGRA 5FOBB 4X20E 3ZYGA 5L2LA 1GP5A 2BKNA 3ZFGB 1JZ5A 2YPDA 2XM2A 2R041 4BK5A 3QH7A 2OYZA 4MGSA 5TAOA 3DJBA 1OLRA 1LRHA 1OPOA 4NOTA 2ADDA 3BIWE 1RXGA 3K51A 4WM7B 5ADXL 1UPSA 2HKXA 1RVF3 2D5UA 3KT1A 2R49A 3SH4A 4CP9B 1LOFA 4QPGC 2JD4A 1VPHA 4MV2A 1BR4A 5FREA 4XJ8A 1OQ1A 4DBRA 4QX5A 3ZKRA 2BTVC 2WO2A 1N3PA 2XHKA 5C8CC 1YQCA 5HXSA 1PIV3 2MPKA 4GH4B 1D0GA 1H9PA 5C8YE 1ZRIA 1YQ5A 2EXIA 3VKLA 2Y6GA 1RUF3 2PAMA 4CPBD 2ZM0A 1QF3A 1VAVA 3RPQA 5KBFA 3SMHA 1ULOA 1DGWA 2EIGA 3HD8B 3APBA 3K4AA 2JQQA 2UU9T 1JYXA 2VD7A 3M3CA 2JIGA 2E32A 1H1IA 1LCLA 3WP3A 4AE2A 2TBVA 2BZDA 5FK8A 4GXLA 3RC8A 2KLQA 2XAFB 4PBOA 3ZFGC 3PUGA 3SCFA 2W52A 4TTGA 5E88A 1DQ6A 2Q8DA 1W8WA 3O0XA 1EZ3A 4UBGA 4I0UA 3M8LA 4NVPA 5JLVA 3I1AA 2NMNA 3LG7A 3H50A 3POIA 1IAPA 3PJYA 4QXCB 1RUJ2 3BU0A 2D44A 2ZACA 4PJMA 4I0AA 2OW4A 1G8XA 3USSA 4IEQA 5C3PA 1UZ0A 2PQQA 4YY3T 5IWFA 1OLME 4JHTA 3BCWA 1RUE2 2KZ7B 1VP6A 1W0NA 4IEXA 3KHCA 4Y1VA 1LRZA 1S1AA 3D3AA 1OSGA 4GH4C 3N5LA 1AX0A 3I8TA 5F3GA 1C1LA 4JHZA 1KRIA 2QGSA 4N78D 5FZLA 2QQWA 2QE3A 2XHEB 1XXNA 2PHDA 2VOVA 1VCSA 5J2UE 1HNZT 3PVOA 4CE8A 3EJKA 1HS7A 4BMEA 3JQXA 4CCMA 2JX9A 4EEDA 4RN5A 4HFSA 4QD2A 1HV1A 2XHNA 4AW7A 3LCPA 3AFGA 4CI3B 4E2SA 1LOAA 2H88A 3BQKA 4ZHQE 2D9DA 1RVF1 2G0UA 4XZUG 2QQOA 4META 3K1SA 4N43A 3KINB 1BXHA 1Y3TA 4IV3C 3VBHB 2R061 2FZ2A 3E22E 1MIWA 2R073 4YHHT 2P1BA 1W9YA 3W15B 1PMJX 1KFUL 1REEA 2MNGA 2WO1A 5LHHB 3WNMA 1W9TA 2PAEA 3QBQA 2UWBA 4QHOA 3B3QE 2ZGTA 3HT1A 1AF9A 3C4XA 3N7JA 1WW4A 4OYUA 2C1FA 2C6SA 3AP5A 2VL0A 3I2OA 1HF8A 3QC9A 1MEC3 3BK9A 5LBEA 5HXCA 4XXAA 1OT5A 3KM5A 1HN0A 3RI8A 3RIAA 3CDZB 1TME2 2XVGA 1GFF2 2YROA 5A32B 4YW3A 2PLV3 4A42A 2VZ3A 3FBMA 3VKHA 4M4PA 2NR4A 3FBZA 5A3TA 3DL3A 3VB9A 3ZN4A 3I2JA 1VALA 1RJ7A 5A3OA 3VBHC 4TNVA 2HWD2 1UKRA 4N43C 3S7IA 1POV1 2ZMNA 3IT8A 1PX4A 4MBQA 2YC4A 1CAXA 2BS3A 4DR2T 3S30A 5FYTA 4X1IE 3PUXF 2LRLA 2ZEYA 3TLVA 2EA7A 1CPNA 1X33A 4P9XA 2W67A 3DKWA 5FKCA 5FYBA 2Q8CA 5LEKA 3NJXA 2DCTA 2V7MA 1GYKA 4AAXA 1ASJ2 4P9WA 4LHNA 4CCEA 4JGYB 2W2IA 2FJAA 3I3BA 1VLNA 3OBVE 1NY72 1R082 3VHPA 1AXZA 3ALQA 1UK5A 4XMIA 2ZMKA 2ZMLA 3ZMNA 4U2YA 1BR2A 3FHIB 4RGAA 2J1EA 1NYWA 3RNSA 2P6HA 3C4WA 2JDHA 5CU1A 3LJCA 5CEHA 2R071 3BPZA 2IXIA 3JUUA 1UXZA 4EN0A 1WYCA 4H3WA 4NWVA 2VASA 2FCTA 2DCJA 2W46A 2P2KA 5E0OA 4KWJA 4A6OA 3D4KA 2X9HA 5JSPA 1W6OB 2YPJA 1AR61 1SFYA 1NT0A 3UKTA 3O1UA 2P37A 3L2HA 1MEC1 5AC92 5E8AA 4H63V 3RIFA 4NWWA 3UT5E 3IEEA 3U07A 2XUMA 1HIXA 1LGBA 4LF4T 2QQUA 1VMHA 4TX5A 2UXXB 2IC6A 4IDQA 4QDRA 4JGYC 4O65A 4N7IA 2PLV1 5FXWA 4L9BA 5HCBA 3CKDA 5FXZA 2K48A 1WBFA 2RHPA 4XJAA 1JODA 3TLTA 4Z07A 1QOTA 4M1PA 1AYN3 4I43B 2XQ5A 4O4IE 5KHKA 2XGXA 2F6BA 3MEPA 1NCQA 3OYWB 2CXFA 2WB5A 3NO8A 1IZNB 4ISRA 3WNLA 5HI0A 4QXBB 3HQXA 5KC5A 1W2UA 1XPWA 3OF1A 3MIBA 2QZ2A 4YFWA 1UQXA 1OURA 4NIGA 3LAGA 3BTXA 2IXHA 4OMDA 2R6QA 4PDWC 3ZOIA 1URXA 4Y4YA 2HN2A 3MW4A 2E9XA 4EJRA 4C8DA 1KXGA 1PO22 1N33T 4FOYA 3HR0A 1IPSA 3GBWA 5BY5A 4BU2A 1OKQA 2VW0A 4JRLA 3KV9A 4CEYA 3FUOA 3M1HA 1F15A 4NIDA 2VTXJ 5GALA 2XAQB 4AI6A 2XJ7A 2GN7A 4CN4A 2WL1A 3T30A 2LSJA 2GP5A 4TLFA 2IUWA 4PJLA 2HYXA 1UOJA 2ZHNA 2VG9A 4MHRA 1GWKA 1LECA 3P3NA 5FYIA 2XKPA 1ULCA 5AQUB 4B3MT 2YDQA 4PNIA 2YBSA 1UOFA 5LY2A 5IAXA 2NP9A 2VUJA 2WYSA 1Z0HA 2ACXA 2Q1ZB 4NHLA 5A3PA 1PGSA 3ZT7A 1AR92 1Q8OA 3LPGA 1C8M3 3VZJA 3CPZA 3PIGA 5M4YA 1RUE3 2Z79A 4FPYA 2V26A 3VDDB 4ONUA 4PT6A 2XJPA 4A44A 2O8OA 2D6KA 5AVPA 1U5XA 4N9HA 3ZIWA 2VMEA 1CZVA 5LA0A 3OBRA 1FATA 1Y9MA 3WF3A 1MMDA 4KI0F 3UUNA 3RZGA 2AREA 3ILFA 3KHBA 3AYEA 4ZOLE 5ABFA 5M0TA 3WNKA 2W63A 4H9PC 5JCTA 3SWHA 2OS2A 4QQHA 1B35B 5AQMB 4H7LA 3WHUA 3L9JT 3J7LA 1AR83 3WAKA 4YT0A 2JE7A 1COV2 4EN9B 5FRAA 3JADA 3K8PC 5LNKA 3T0AA 2C9KA 2HEYF 2RP4A 3LZZA 3POFA 2P3IA 3VD3A 5FPLA 2GZWA 4DXZA 3TKLB 4OX9T 1SG3A 1UU4A 3P8CD 2DBIA 5FZ4A 2J47A 4XUPA 3FJSA 4EV0A 3ZYJB 3BQLA 1LU1A 3IMNA 4OUSA 1C1FA 1IS3A 3KGZA 5IWAT 1FMD2 2DVDA 3K4ZA 1KNZA 3VV1A 2RS33 4Q4X2 5FPBA 3IA3A 2BQPA 5CA1E 2A1XA 2VZSA 2Y64A 4LBOA 5ABJB 3C2UA 3WG1A 4ZHNA 5HEOA 1DYPA 2WQZC 3IZOA 2CRBA 1ZREA 1Y01A 1QUUA 2G9ZA 2Y8DA 3GJBA 2OQ6A 4UV8B 1OA3A 3ZR6A 3OTOT 3N7LA 2EIEA 1QU0A 1AX1A 1QJY3 4YARA 4L97A 1S55A 4DEVA 4I2OA 3USUB 4MLKA 2WWVA 5GONE 5KXJA 3OGGA 1VIWB 2W39A 3HL6A 1RUE1 3ZMSB 5EV7A 4JI4T 2WU5A 2GC2A 1YFWA 3THTA 2PFVA 4AF9A 1NOVA 3K48A 3I59A 5CB7A 2YB7A 3MFCA 2B7YA 4AHZA 2RS12 1X8EA 2BNMA 4BH9A 1WCSA 1O8SA 4GQ7A 1ND3A 5I0SA 2YK0A 1FOD2 3SEEA 1HB4A 1KNRA 4CA9A 3ZXEA 3MXZA 1XBFA 3NKZA 3T4HB 1E5IA 4ISSA 5C2TA 5IVEA 1XU2A 5HEJA 2B9UA 4JX0A 1YQ6A 4O4HE 4RL7A 4ZU4A 1HV0A 1OF3A 5DUUA 2X09A 1AR81 4CUGA 4CEWB 3SC7X 4D6RA 2J1SA 4GAZA 4XUQA 1QWRA 1QJU2 1H6XA 1U12A 1IPJA 4A6SA 3WW2A 4JCKA 3WT3A 2XSAA 2ZKLA 3O4XE 4TZDA 3EDUA 2FZ1A 4XABA 5DN2A 3VZNA 1TZOA 3AYDA 4LMJA 2ERFA 2JE9A 4RHV2 4H9RC 3K46A 2PHUA 4Q4Y2 4S2FA 2VCCA 1SUMB 3LK3B 4W65A 1H8TB 4KGGA 3HAGA 5FKYA 2RR12 4YZ5A 3HVDA 2ZEZA 4TYSA 5KXEA 4IDPA 2EAAA 4HG6B 3ZXJA 5FPXA 2WABA 1UCUA 3H8RA 1Z7S2 2YGMA 4XCBA 4KL1A 5JDNA 1RUC2 2FCUA 5FZGA 1A78A 5EXOA 4GK5E 3VBRA 1QSDA 1DGRN 2R1DA 1Y7BA 3TEWA 4N53B 4YTPA 1MS5A 1UAIA 3THDA 2OX0A 4QX7A 5J7MA 1N47A 3EUHA 1ND3C 5DAWA 5CA6A 1ULEA 1TMF3 5B4XA 2VMCA 2H6BA 3PL0A 4UFJA 4CEWC 2DUOA 4JI2T 2X8KA 5CISA 3P5BA 4QGNA 3ZN6A 3S0MA 4R9BA 3ZSMA 3VRAA 2NTXA 2I74A 5A3MA 3I9WA 3CQOA 2BJSA 4QGMA 4RSUA 3IKWA 3N7KA 4ZXLA 2HWD1 4YZ4A 4ZZCA 2V7IA 4LK6A 2GSYA 4U72A 4Z8BA 3TN92 1FIOA 1W0BA 5FUNA 4AVTA 3JXSA 1RGSA 4CP0A 3WF4A 3VZMA 3X29B 5LGNB 3EI0A 4LF9T 4XTMA 1MS8A 3ZSEA 2QDRA 3P4QA 1K5JA 1H2KA 1Q8PA 1ASJ1 3GDBA 2OUHA 4DV0T 4LULA 4F8HA 5AQSB 4HONA 2TEPA 1NY71 4S2GA 2JG9A 1QOSA 4HWCA 2LOPA 3NZQA 3SRZA 3B5LB 4XQWA 5J2TE 5FYYA 2Q0AA 1MS3A 1LHWA 3VBRC 5JDHA 1VAMA 1NA1C 1LTEA 2VW1A 3ZEFB 3UQ7A 1WUVA 4FBFA 4NROA 3AE8A 5K9YA 4DMVA 2J7MA 5FO9B 1WYBA 2GMMA 1NCRC 2VKDA 4FO9A 2FUPA 3OBAA 4QDSA 3VKNA 5F5WA 2UY9A 4DS0A 3LOIA 2H3RA 5FZEA 5FPAA 5IK5A 3VHNA 3OOXA 2HLEA 4WVWA 5AC91 3HA4A 3I3QA 1UU5A 2WYFA 2G9GA 3R0RA 4RD7A 4TWHA 3QACA 2ZOEB 2P34A 1R1A3 3OKQA 2JIJA 4PQQA 4CSWA 1UX6A 4UAPA 5FMCA 4YVSB 4JUYA 4QPIA 4DPNA 4AISA 5AQJB 4YZ3A 1TMF1 4XZCA 3D82A 4JKMA 2VE1A 4LITA 1S0DA 1W2NA 2YFZA 1K12A 3JD72 4AKIA 1ZP0A 2CA5A 1MQTB 4QKFA 2VOKA 1ZZBA 4J1XA 3UUBA 2VNOA 5AFEA 2OQ7A 1YYNA 4LO6B 1W0PA 2WNVA 4OFGA 4LBQD 4JBWF 3RYPA 4TN7B 3PDQA 4MX3A 1UF2C 3W20A 2JKXA 4DVDA 1AL0G 1JNRA 5F8PA 5JDFA 4LMKA 4P9YA 4EROA 4YW4A 2K46A 1SPPA 1FPN2 2HWB3 1PO21 1C3HA 3H1WA 4AQYT 2UURA 4ZU5A 4AEDB 2V7KA 1W3XA 1AJ3A 3G6JB 5A3NA 4QXHB 3TEXA 2YG0A 5DG2A 3LA3A 2DNXA 3ANWA 5AQIB 4O4JE 3CF6E 3RH3A 2E5VA 4R52A 4CZSA 1DFQA 3E5QA 2OIIA 1W9RA 3CO2A 4XETA 3WQ0A 1Y43B 3R6SA 2Z69A 2KWIB 4MADA 5LJNA 4UI9L 5FFOC 3EVYA 4MH0E 1CJPA 1SBDA 2IWGB 3FFZA 2B4KA 3C7HA 2VZVA 1AR91 1N1SA 2IUBA 3AECA 5FYVA 2W87A 4L0PA 5JRCA 1JHJA 4HT1T 4X65T 3F2EA 1OPMA 4JGZC 4AEDC 4GWMA 2RS13 1HB2A 4BZ4A 1WRDA 3I2FA 1FOD3 3HJRA 5IT6A 1T98A 3MZHA 1W0AA 1ULFA 4W6WA 1NWMX 2X66A 4OHXA 3WQBA 4I4TE 2F4LA 4I3PA 4DXSA 2VL4A 3AA7B 2Q8EA 4TWTA 2WLPA 4P0AA 1RHI3 2W08A 3FLTA 1ULDA 5IVVA 1AXYA 3WG2A 4JTOA 3EYPA 3FL7A 4UV9B 4QQ2A 4B4PA 2Y38A 4EV6A 3VGIA 1WMEA 5CIRA 2QQLA 2C5IT 1X36A 4OZOA 4JI8T 2ZGUA 4CDWB 1HR0T 1UMIA 2JKBA 4RHV3 4D94A 2WZIA 1WLTA 3V0AA 4Q4Y3 3LIGA 2A2FX 1F5FA 5FUPA 4LBKA 2D3RA 1HFAA 3LFMA 4COWA 2WN2A 2VXRA 5EYYA 4U33A 2ES3A 1LULA 3UGFA 2Y26A 1I6XA 1GZWA 2ZZJA 5ANNA 2VOWA 3ZYPA 5K7PA 1FMD1 4LKEA 4CN6A 3LDKA 3URFA 1Z7S3 3RYKA 3Q2MA 4Q4X1 4RQPC 1ZBE3 4BJNA 1RUD2 2IXCA 2JQ9A 1CAVB 1W9FA 3KSCA 4GZ9A 5FYSA 3CBNA 2UU8A 4LLOA 1NKGA 1YNAA 2ZGNA 5A33A 3ECQA 3A23A 4MGQA 5JXHA 1GQHA 1UZYA 4M3CF 4GULA 3WY6A 2IZWA 3MV01 2EIBA 2JWPA 5FWEA 3O1RA 5LRSA 2B9VA 4MXWA 1K45A 4XF1A 3ELNA 2ZAHA 1I9RA 4CDWC 4G63A 4LO4B 1UW8A 1VRH2 3P1IA 1W2AX 5A7OA 2RS11 1Q56A 2VTFA 3AMMA 4UW6A 4ZZ8A 1PZ9A 4BIOA 3MIGA 4DRRA 5A7PA 1CAWA 4DR6T 1FOD1 4FVVA 3WQ1A 3AVSA 3WF2A 1CZSA 4KWUA 3OJBA 1QNWA 4IREA 1W0OA 5D8AA 1ZNPA 3KDSE 4PLNA 3P50A 5EQUA 4OCTA 4YW5A 3ZPOA 2RJLA 2HPJA 3NKGA 3PU3A 2WS3A 4FTBA 4BQ2A 1QJU1 3SOLA 2Y60A 5AFUL 1G9AA 3TNPB 3M3OA 4XAXB 2ATFA 1DU2A 3HI2A 5IK7A 5JPNB 5F3JA 5IK8A 1ZZ6A 1O3SA 4IL9A 4YM0A 2Y6KA 4XFIA 4YW6A 1GANA 4RHV1 4QH1A 3F57A 4Q4Y1 1FV3A 1D0HA 4D6SA 4K3UA 1XRUA 2VC9A 1KS4A 3U0ZA 2WRAA 2BERA 2AR6A 5F39A 1HRV3 2VURA 3WG3A 3J9SA 3ZKYA 5JZGB 3JZVA 4P5YA 1WLXA 3MUY1 5C3OA 4NUVA 2QBXA 4YVWA 1ACCA 1W3VA 3CIHA 3ACGA 4OHVA 1Z7S1 4GB33 4LUMA 4O7XA 2Q9QA 4S2HA 2J22A 4XAAA 4UXNB 1RUC1 2DTYA 4TSVA 4BWOA 5FR3A 3SLIA 2FBEA 1CQ9A 4MHCA 4KBMB 5FY4A 1IHMA 2V4AA 4DINB 1AR72 4A4AA 2FMYA 2OVUA 4NRPA 3ZFEB 1SBFA 1I1EA 3UK9A 2Q1MA 3LKJA 1DU3D 3JD73 1RITA 4NR1A 5F9TA 4UT5A 5H9SA 4HPKA 1SZBA 1PX3A 1D1BA 2BPA2 2P5BA 4RGKA 1FMVA 3AB0A 1IS4A 4L0RA 1J3QA 4YTMA 1ULPA 1UXXX 3NJVA 4CVUA 4GMP3 3TN91 2BVBA 1YIFA 4HN0A 2V7JA 1XYOA 1WCQA 2E63A 4LBLA 3ZM8A 3RSJA 2KXLA 1DQ1A 2ZM2A 3KFWX 2PHWA 1SQ4A 5C71A 2GNBA 1HX1B 1V6JA 5A7SA 1LAJA 3WQ7A 4EXTA 3RYCE 2JJ6A 1XMQT 4PBPA 1Z0PA 3RGLA 2WS92 4WNKA 5HCJA 5C70A 4XBFB 2BBJA 2MEV2 5K0UA 2R1BA 2W61A 1DLLA 2VAUA 4XJUA 2B1EA 2Q9QC 3RZKA 2YN6A 2E53A 1NENA 4A2UA 2J1AA 2X68A 3AKQA 1T6BX 4Y5TA 3ZFEC 3W9AA 2WT1A 2YUEA 1UMHA 2VM9A 5LGUB 4WM8A 4OUMA 2XJVA 1OBNA 3ROUA 3WCRA 1ZOYA 2HWF3 4LKDA 2EALA 5J36A 1OFSA 4AHWA 5A3LA 4PHZA 3CX8B 3Q9DA 2D0UA 2VY0A 1RIRA 5GZEA 5AQFB 2JQKA 2QVSB 1UZVA 3HR9A 1YLLA 5E89A 1RTVA 1US2A 1GQGA 1WGPA 4DV1T 2QNKA 1OHFA 4X1YE 2JEMA 4MFRA 4HETA 3BIEA 2W94A 4K8FA 3QD6A 4YNIA 1NG0A 3PUWF 5HCHA 4NO4A 2OKXA 1W6PB 2BBHA 5CB4E 5C9AA 2A3WA 4YSZA 3JD71 5FVLA 1SCRA 2DV9A 4G3YC 4HGAA 1REFA 2XVKA 4Q4W2 1XNTA 4XUNA 3IN9A 1IBKT 3HIFA 1XB9A 3N9LA 5JDLA 3CMLA 3NWIA 1OF4A 2FCVA 2NPIA 3JQWA 4MGKE 5LG3A 3I4IA 4GMP1 4Y33A 4NN0A 3VDCA 4XCAA 3B94A 2IMLA 2ARCA 1H9WA 3VLBB 3DN7A 4FXKB 2DCFA 3SCGA 4C1WA 4GIWA 1QQP2 1ZBA2 2JDUA 4IEWA 3AP6A 5LBQB 1BCXA 5A6QA 3FHAA 2EXKA 5FY8A 1WLCA 3PU8A 2PA7A 4SLIA 2J1UA 4M01A 2WWSA 1TE1B 1G86A 2X5IB 3CWZB 4FFGA 1M4WA 5A6ZA 2W5FA 4P14A 3QOPA 2O14A 2XKOA 2M6BA 1BR0A 3KMHA 3F2ZA 4FFFA 4Z1VA 1E2AA 4XAEA 1W99A 5F3EA 4JQRA 4HKAA 4COVA 5IATA 4Q4V2 3BQIA 2IFRA 5SV5A 1SLTA 2XLGA 3A21A 3MJXA 4LIUA 5F5IA 3ZC1A 3JU9A 4GJYA 4IL7A 3VBUB 4IEPA 3UU6A 4YG3A 5LBFA 1G9DA 4CUAA 3K3OA 2V09A 4HZFA 2YV8A 2HWF1 1HJGA 4F83A 5AQPB 1XC6A 3FBYA 2X10A 3HNYM 2Q5TA 2Y6LA 4LHLA 3UGHA 3CVRA 5FCCA 4AZZA 3C8XA 2RMU2 1W8UA 4FJOA 4H63H 1UX5A 2JG8A 5JH7E 3TLSA 4DR4T 2UXCT 2WFF3 4CDUB 3LE0A 4CXYA 1C5IA 2A6VA 2BDEA 5FKBA 4TLGA 1D1AA 2BVLA 2PTMA 4AGVA 5L73A 1WMFA 3MIHA 3PIJA 2X5IC 4FP3A 3E6BA 3GHMA 2XBO3 1R64A 1BR1A 4CQIA 2I2SA 3KWVA 4B8EA 3CJIB 5DAVA 3UFEA 4Y22B 4Q0VA 2W1QA 5HEUA 1RUOA 1HNWT 4OHZA 1ODNA 1F2NA 5FOJB 2H7OA 4PW8A 3VBUC 2YEVC 1WW6A 2FDGA 2VULA 1AHSA 3RIUA 1VE0A 4ISQA 4XC9A 2LM3A 3VBFB 3T4VA 2HBUA 3AEFA 4HFBA 4DMWA 2XZEA 3H3MA 3LA2A 4JI7T 4P1NA 1JOPA 5GJ6A 1BBT3 4XPVA 2CXDA 2ZAAA 2W95A 2WQ8A 4IQPA 5LXTE 1BKZA 5FLJA 3I2DA 4XVHA 3NAPA 3TYJA 5DG1A 5JOZA 4URTA 3DPRA 3RLFF 2IVIB 2PHLA 1RUD1 1AYM2 5FL1A 2D97A 1DIWA 5F3IA 1M62A 1LU2A 3CJIC 4R9AA 4YSXA 5LA9A 1B09A 1DQ2A 4PK5A 1W6MB 5F1RA 4MSVA 4CXXA 1OVSA 4URAA 5AQKB 1QGLA 3KF3A 2HJIA 3G7DA 2E26A 3WSOA 5JDBA 1SLBA 4G4FA 1FJGT 2DCKA 1CIYA 1LHNA 2PTFA 4DUWA 1H0BA 3NNFA 1VMJA 1MPXA 2XAHB 3VBFC 1R092 3SXWA 4HKOA 2UYBA 2WFF1 5JDMA 2XXZA 4YJ2E 3RIUC 5D21A 1X9PA 1TG7A 1PVC2 3T2TA 4KU8A 2D3SA 3A7QA 3CQGB 2ZJCA 3A5XA 4BIFA 1U5ZA 3HKEE 5DDJ2 2WN3A 4LPLA 3UQ4A 2DWGA 3ZN1B 2BS4A 3ZMZB 2NP0A 2O1QA 1OD5A 3ZJ1A 2NLRA 1GWLA 1DQ0A 1HX8A 4PIXA 2NOXA 3W21A 2N2NA 3RGBA 5ACA3 3O1HA 3UJOA 5LEJA 1KJLA 1KD7A 2NZ9A 3OB8A 2EICA 3J4UH 3PJAJ 2BWAA 2LKGA 4HVOA 5T5OA 2MAWA 2A6XA 2ZHLA 4P0BA 1Y9QA 2YOEA 4ZEYA 2JRKA 5ABGA 4K9SA 4ASLA 4AHXA 4QPIB 4GIQA 1CHUA 3VKMA 2P3JA 3IPVB 4YW2A 5C4WA 5CAZA 5KMGP 3I9YA 2W4XA 3NSTA 2QUOA 3JBG2 4PJJA 1U5IA 4AHYA 1QXJA 2BU9A 3WDTA 1BBT1 4B1MA 3PJQA 1N34T 1S35A 2GNMA 3ZXAC 2WNVB 3LB9A 3OGRA 1JZ3A 5HXHA 3ZJ2A 1D4M3 1V9DA 2CU5A 2SLIA 4FQ4A 4LUKA 5BNOC 3MK7C 3Q5EA 3EDVA 2WINB 4C1XA 4E27A 3PUIA 1AR71 3KVAA 2I6HA 3AXJA 2FJBA 2HWE3 4M3CE 2OPWA 1D0XA 5CYYA 1OEDE 1M06G 5E1RA 3VZLA 1W8OA 2ZMAA 2R7EB 2JDAA 3AMNA 3M2MA 3HQRA 1UY2A 1W6QA 2WSUA 5IVJA 4IETA 1CAUA 2KA3A 3AL5A 1KDMA 2C0SA 4RGGA 5IAVA 4KQ7A 5A1LA 4BDVB 2XONA 3AZWA 3L39A 1TEIA 5FZHA 5FMOS 1UD1A 5L7OA 2H89A 3E6DA 4E4DX 1MZ6A 2BEOA 2UWAA 5L9BA 1XYPA 3KQ4B 5L3DB 4KBBA 4BA9A 3WP4A 3AE2A 1E57A 4EGWA 5DJQC 5IVFA 4BK4A 3BTAA 2EHOB 2WA4A 2CHOA 1O3XA 2WS91 3EQEA 3S57A 2MEV1 4WBNE 1O7FA 2RS53 5FJHA 1FV2A 4BISA 1QNYA 3ZYLA 3LDQB 4AWDA 4JAAA 3I97A 3LBXB 4UOJA 4D7YA 5FZAA 3C51A 2PBIA 4A97A 3SNMA 3AB3B 5BNNA 2VMIA 5LBCA 5F37A 4LNVA 5I8SA 2XJSA 4UELA 4RS5B 3KCYA 2OZJA 4XURA 5D1IA 3ZMUB 4JKKA 1HQNA 1C8NA 5FMNA 4BJMA 2FDIA 1XE8A 4IE7A 1D4M1 2Q4SA 2D5FA 3AC0A 5C7GA 1VBD2 4FP2A 4MALA 2BGPA 1X9TA 3AKRA 1RB8G 3AMHA 1I94T 1G9FA 3CLPA 5CFCC 1YC61 3AEEA 4MG2A 1WZXA 3V0AB 3T8OA 3L8RA 1N3OA 1QJX2 4Z91A 1BJQA 2SBAA 1XMOT 3NNMA 1OOPA 2LSKA 1NZCA 5L36A 4V1Av 1W28A 4QHZA 1AXKA 4Q4W1 5LCWL 2XJUA 3T1MA 3V0BA 3DGTA 3ZT5A 3LOBA 4ISTA 2NW8A 1DF0A 1YFXA 2ZEXA 1J83A 4WZCA 5FXVA 1RMU3 2WNUA 4N90A 2D40A 4PCRA 1YFUA 3AZZA 4QX0A 4RS5C 2BG9B 5A7WA 2E9XD 1UX7A 5BNNC 2ARXA 1JZ8A 4IXLA 3OPCA 2VVFA 1LOBA 5IUXA 3B5MA 3NZPA 4HBNA 3JC6D 2EXHA 2EXJA 4E4SA 3PVBB 3RZJA 3W5MA 2NW7A 5AQOB 2WAOA 4D3WA 1UNBA 1RUG2 2HWC3 4ZI2D 1PO13 3O12A 5FV3A 3RRDA 4QB6A 1SA0E 1KFYA 2RS51 3ETUA 4C91A 2BP6A 2GN3A 3ZCJA 2C9AA
chains in the Genus database with same CATH topology
4O8SA 5FZ1A 5FZGA 3CX6B 1YKHB 3CQCB 1VOMA 4AAPA 1ZV4X 4GK5E 4QXCB 5BMVE 4I4TE 2E9XA 4PJMA 1QSDA 2DWGA 3ZN1B 4C8DA 4TV9E 3AA7B 2Q8EA 5JQGE 3I0QA 3MKDA 4GYRA 4DIQA 1G8XA 4X1KE 3N9NA 2W0GA 2OX0A 4QX7A 5LCYA 3HR0A 3CX8B 1MIYA 3NRXA 3ZMZB 3RC3A 4P0AA 2KINB 3Q9DA 3EUHA 5LG4A 5FYUA 2D0UA 3ZJ1A 3UULA 3DXUA 3KV4A 4IGQA 5FYCA 5IWFA 4BU2A 3IBPA 4ADZA 5H6QB 4V2VA 1HX8A 5IVVA 3KV9A 3ZYKA 1H7CA 2NOXA 2KZ7B 4IGUA 2N2NA 5IHYA 3S4UA 4UV9B 4OFZA 3RVHA 4NUBA 2DLRA 4OHFA 4A56A 2VB6A 3H37A 4V2WA 3N9PA 2SPCA 2XAQB 3GN5A 4AI6A 1LRZA 2XMLA 3ANWB 5HXRA 5FY9A 2C5IT 3O1HA 3N5LA 1MNDA 3UUXB 4HEAA 2NW9A 2LEHA 2CWYA 2IC9A 5FNVE 5F3GA 2LSJA 3C50A 3RRCA 1HG2A 3WAJA 2GP5A 4UEMA 4PJLA 2NTXA 4IIJE 4X1YE 3I9WA 2A2FX 2QGSA 2Z6EA 3N2OA 4N78D 5FZLA 2X51A 4OYJA 3AA0B 5FZDA 4MFRA 1MMNA 4AI9A 2WSSV 4ANJA 5JDQA 3UYJA 4P0BA 5FUPA 5ANQA 2XHEB 2Y6XA 4EYYR 4GD4A 5LY1A 5FZ3A 4GK0E 1HFAA 3LFMA 3MA9A 3U4SA 4E4HA 4PAGA 5FYIA 2NTYA 5CB4E 2JRKA 1X79A 2WMNA 2V7IA 5JR9A 1MNEA 4U72A 2I59A 5J2UE 5FY5A 2EHOA 5DABA 3U78A 1FIOA 4HN9A 5FYZA 2M67A 5FZFA 5FUNA 2HPLA 3CX7B 4CCJA 4E7SA 1WR6A 5LJMA 4KP3C 1US7B 3K3QC 3C64A 3I9YA 4ILUA 1MIVA 4O4LE 4FI5A 4PNIA 5KMGP 2YBSA 5KR7A 4CCMA 4CI2B 4HGAA 4CZZB 3AAIA 2LHNA 5L3CB 3PUSA 5LY2A 2Q9QD 4Y3OA 2NP9A 3Q2MA 3C4ZA 3L3PA 4B6XA 5LGNB 3NJYA 5FZ0A 2KT9A 4PJJA 4CI3B 2A72A 4AKHA 4IDZA 5FPVA 2ACXA 3BQKA 4BJNA 3NBXX 2WMOA 2MOZA 2WWUA 4IE0A 4ZHQE 4AKGA 3N9LA 4ZI3D 5JDLA 4L5GA 5FZ9A 4YHJA 3CMLA 4JEHB 2L3LA 5A3PA 2G0UA 3HKBE 4DNDA 4GJZA 4AKRB 2YBPA 5FY0A 3O9XA 5FYSA 3KINB 1E1HB 2LSYA 1S35A 3B13A 3DTOA 4Y33A 3LBXA 5F2WA 2YINA 5JRCB 3B57A 5A7WB 2E8IA 3ETVA 4TN7A 4IE5A 5HXHA 3CPZA 3ZJ2A 2J1DG 3E22E 1MIWA 5LHGB 1V9DA 5FZCA 2DCFA 5M4YA 4HONA 4WW0A 3V5UA 4CCKA 3W15B 4GIWA 3AA6B 1HTJF 2V26A 1S94A 5FZ8A 2VL8A 3V5SA 5LBQB 1D0YA 1ZHCA 2LOPA 3Q5WA 3N2KE 3NZQA 3MK7C 5LHHB 4IGOA 4Z8XA 3SRZA 2XDVA 4QXBA 5J2TE 4QX8A 5FYYA 3OPWA 1ZEEA 5FZBA 5FY8A 2YBKA 3EDVA 3PU8A 4QHOA 5JDHA 3ZEFB 2PG8A 4IE4A 3KBUA 3C4XA 4O2BE 4JLEA 1D1CA 4DMVA 3AVRA 4HFVA 3U3IA 2XAJB 5FZMA 3CWZB 3KVAA 2JMKA 4L9IA 4EYUA 5FWEA 4KMCA 2CWOA 1MMDA 4IE6A 3UUNA 2XQYA 3R6NA 4C90A 5F5AA 1WYBA 2XUEA 1HF8A 1OXZA 3QC9A 1BR0A 4ZOLE 2VKDA 4G63A 3BK9A 2CE7A 5HXCA 2W63A 4EZ4A 1D0XA 4H9PC 5FPUA 3SWHA 2OS2A 1HCIA 4QXHA 3Q5XA 4EAHA 2V7LA 4K0UA 1B7TA 3HKCE 2E9XB 5IVBA 3KV6A 4TUYE 3E0ZA 3K3NA 3WAKA 5F3EA 5A7OA 3PE0A 1D0ZA 4HKAA 2KXPB 2CLYB 3IF8B 3BQIA 2ZMAA 3R84B 5FYHA 4QX7B 3AL6A 3GMIA 5FZ6A 4BXFA 2H3RA 5FZEA 5A7PA 5FPAA 3MJXA 5FYMA 3K8PC 2L9QA 4H9NC 5L3BB 4LIUA 4OYKA 5F5IA 3ZC1A 4GJYA 3FXDB 5FP7A 3AVSA 5LNKA 5IVJA 4I50E 5JREA 3ZMTB 3O1JA 3AL5A 4AKLA 3D0TA 2C0SA 2RP4A 4AXPA 5ETWA 2N1GA 5F2SA 3K3OA 2JJ9A 3J7Yq 4NUUA 2ZLYA 3HA4A 3KDSE 3GN5B 3RKOA 2VKOA 5A1LA 3VKHA 5A1FA 3DXTA 5JR9C 5FZOB 2EHOC 5FPLA 5FZHA 3OKQA 4HTEA 3FBZA 2YU2A 3LK2B 2ODUA 3PUQA 3ZPOA 2HPJA 3TKLB 3ZLIA 4CSWA 5A3TA 2MTQA 3PDYA 2D2SA 5L3DB 1G73A 3PU3A 4CCOA 1YKEB 4PJNA 4F6RC 2L8KA 2NWBA 3P8CD 3CVRA 5FZIA 3MACA 5FXXA 4BA9A 5FJKA 3SOLA 4JUYA 2WAUA 3RYHE 5AFUL 3PTRB 5FZ4A 2JPFA 3ZMVB 2KWHA 4UIGA 4XAXB 5DJQC 5F32A 5IVFA 5L3FB 4FJOA 4H63H 2V1DB 1UX5A 3HI2A 3QUJA 4XZCA 5JH7E 5FP8A 3LDBA 5JR9B 2MYSA 5KX5E 3BQLA 5DQWA 5F3JA 2EHOB 3OPTA 3QK6A 2BZBA 2CM0A 4LITA 1O3XA 1IJ6A 3RYIE 2ODVA 4AQGA 4CXYA 2ZM8A 3UUMA 2BDEA 2CCQA 4AKIA 3FB2A 4MBQA 2CA5A 1D1AA 3M65A 2Y48B 1FMWA 2WM9A 4KUMB 4HOOA 1KNZA 5FYTA 4WBNE 4X1IE 5FJHA 2BVLA 5F3CA 3KBTA 4UVCB 3F57A 4QKNA 4BISA 4XDPA 3LD8A 2LM9A 4BAYB 3ZYLA 5FPBA 5IW0A 2PJQA 4EB6E 2OQ7A 5FY7A 2W00A 5LHIB 4D6SA 5CA1E 2LOSA 2A3DA 2P9BA 5FYBA 5FZ7A 2XASB 5FY1A 2Q8CA 4O2AE 1FEWA 1BR1A 1OWAA 2IW5B 4J2CA 4UF0A 4CQIA 4QU1A 5F39A 3OJAA 2KMFA 2X9YA 3I0OA 4Y4RA 2D0TA 3LBXB 3AAAB 5HWYA 2V7MA 3K2OA 4CCNA 4TN7B 5LP6E 3PDQA 5FZAA 1WLXA 3C51A 3RYFE 2PBIA 4NUVA 5JVDE 2CEAA 2OT7A 3UFEA 3AB3B 4IGPA 2X9XA 3VHLA 2W2IA 3VKGA 4PFPA 5A7QA 5A80A 5F37A 1YD8G 5IYZE 1QUUA 3OBVE 4GOUA 2E9XC 2Y8DA 4DVDA 4UVAB 2Q9QA 3N9OA 4UXNB 4UELA 5F8PA 4YFSA 3CQXC 4UV8B 2OQ6A 4H9QC 2CLYC 4E7ZA 5JDFA 4PK4A 2X67A 2VWAA 2C5KT 2C5JA 2XTLA 4UVBB 5A3WA 2HH7A 2N9DA 4QWNB 3ZMUB 1HS7A 2ES0A 2H7OA 4AQFA 5ISLA 3VU7H 4QXCA 4PW8A 3JC6C 2K9AA 4MHCA 2GP3A 1BR2A 4KBMB 2YEVC 5FY4A 3N9QA 5DQVA 2KNDA 5HXEA 2LJLA 5LGTB 4MLKA 5FMNA 1Y64B 3NRYA 4BJMA 2PXJA 3H3AA 3IHRA 5GONE 3C4WA 3ZC0A 1NAFA 5K4LA 5FBJA 2QA7A 2V7KA 4G2AA 4ZI2C 3LJCA 2BVMA 4IE7A 1VRBA 5CEHA 2VKJA 4X20E 3HL6A 5L2LA 3C98B 4DMWA 1AJ3A 5F5CA 3ZMSB 2YPDA 4DBQA 2VKHA 5A3NA 3F31A 2EHOD 4EZHA 1KK7A 4QXHB 4D6QA