2W2UA

Structural insight into the interaction between archaeal escrt-iii and aaa-atpase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
75
structure length
75
Chain Sequence
MSAQVMLEEMARKYAINAVKADKEGNAEEAITNYKKAIEVLAQLVSLYRDGSTAAIYEQMINEYKRRIEVLKELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Role for the Escrt System in Cell Division in Archaea.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase/transport
molecule keywords HYPOTHETICAL P60 KATANIN
total genus 29
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2w2uA00
2W2UA 2JQHA 2JQ9A 1WCRA 4U3CA 1WFDA 2DL1A 4A5XA 5CJ5A 4CN6A 5CGMA 2CPTA 2A9UA 2LRLA 4U7IA 5FVKA 2RPAA 3EABA 3ZT7A 4U2YA 4ZEYA 1YXRA 2V6YB 4CN1A 2V6YA 3ZT6A 4CN4A 3ZSTA 2CRBA 2V6XA 4P1NA 1WR0A 2K3WA 2MPKA 4NIQA 3ZSSA 3K1SA 4U31A 4U7YA 4WZXA 5FVLA 5LB7B 4IT4A 4U33A 2WWVA 4U2ZA 2LRKA 3ZT5A 2JQKA 2XZEA 2WY2A
chains in the Genus database with same CATH superfamily
2XAQB 4DIDB 1J5WA 2ODUA 3P4PA 4KBMB 1S35A 3FXDB 3ZMZB 3AVRA 4XAXB 4DV4T 2XQ9A 2V5CA 3AE4A 4I43B 2V7KA 5LBMA 5AQHB 1FJGT 1S94A 1MMNA 3E08A 3R84B 5KX5E 4KUMB 2XY8B 4IDOA 2LT3A 5JR9C 3P8CD 4IDZA 4AQYT 1OEDC 4ADZA 2E5VA 3MA9A 3UTKA 3AXJA 3C4ZA 3EI0A 3N9QA 4P1NA 4ZI2C 4H9OC 5EK3A 1WRDA 2XAJB 5J2TE 2E5LT 4HGAA 4O4IE 4OFZA 5AQVB 2UXNB 4XZCA 3NWIA 3JCFA 2LOSA 1YW0A 2QRXA 4YTMA 5HCMA 4ZOLE 2VL0A 2X9XA 1FMVA 3PUAA 4ILBA 2WWVA 1KNRA 4QX7B 3ZMUB 5LHIB 3AA7B 1YQ3A 2H89A 2ZM2A 1D1AA 2WU5A 2KINB 4ISSA 5HEJA 2ZLYA 4LF5T 5JDLA 4X64T 2UUCT 3DTOA 4K0UA 3R6NA 3RYIE 3AA0B 3HKBE 5HYAA 1UX4A 2UXDT 5JQGE 4U7IA 3BQLA 1EZ3A 3WI3A 2WSSV 4NXNT 2FUPA 5AQQB 3ZT7A 4BJNA 4G63A 2YEVC 2V6YB 4JI0T 3LBXB 3TLVA 2BBHA 4AKHA 2CXDA 2VVSA 2L9QA 4H63H 2ZM0A 3I1AA 5HEGA 2I59A 5FY7A 2VKHA 2IIUA 3AAAB 1WYCA 4DV0T 2NW7A 2AE9A 3EDVA 3L3PA 2BG9B 3T1HT 4TV9E 4QWNB 4JEUB 3J9X1 2WDQA 3PUQA 4AISA 1ZP0A 1LKXA 5LB7B 2NWBA 2XQ6A 3PUGA 3RIUC 3P4SA 3ETUA 4IIJE 2JMHA 2XZEA 5HXRA 4LF8T 2CM0A 4PK4A 3N2GE 4YXDA 3FZMB 4L9IA 4DVDA 3AB3B 4EV6A 2J4GA 3UULA 3C98B 3LK42 4PW8A 4CN6A 3AE7A 3AE9A 3Q5WA 4ZI3D 5LJNA 3AE3A 1WYBA 3VR9A 1WLXA 4H9QC 5CB4E 2XAHB 5FNVE 3BK9A 5KXJA 2Z6EA 4I4TE 3MXZA 4PFPA 2NW8A 2X51A 2YDRA 2JPFA 3FBLA 3H3MA 3CQXC 4H9RC 4IE4A 3WAKA 3ZJ1A 3BQIA 5HWYA 2BVMA 3AEEA 4PNIA 4PJNA 4I50E 3CIRA 3UFEA 2KT9A 3QUJA 3PU3A 4E7SA 5AFUL 3KDSE 4GYRA 1HG5A 4WZXA 3ABVA 4PFOA 1NEKA 2DWKA 2XSAA 4HFEA 1JNZA 4I0UA 2PJQA 4PAGA 5DJQC 1N33T 4YFSA 5JDHA 3ZYMA 3ZEFB 2WDRA 2XQ3A 5HEUA 4CZZB 1O3XA 2VK9A 4ILAA 2LJLA 4DV5T 4DR5T 1LRZA 3MK7C 4DR2T 5JR9B 4LMLA 2KXPB 1IAPA 3I9WA 3P4WA 4QH4A 1J1JA 5JR9A 2DL1A 4ZS3A 2NW9A 5LJMA 1HR0T 2VWAA 2A9UA 3F31A 3RIFA 1D1BA 2C5IT 3LJCA 4TUYE 1B7TA 3O1IA 4KX6A 2V5DA 5LG4A 3AEAA 3ZC1A 1KK7A 3N9NA 3O1HA 2QGSA 3FXEB 2PBIA 5LA6E 2W62A 4Q25A 2BVLA 2BS4A 2ODVA 3C51A 2YINA 4C91A 1VRBA 1Y01A 2HPJA 4UF0B 4NUUA 3WAJA 1XMQT 2H7VC 1M7KA 1HCIA 2XQ7A 2X9WA 4UVBB 1D0ZA 5FP3A 1NAFA 3RLFF 5C2TA 4O4LE 4A97A 3OTOT 3ZN1B 5FVLA 1U4QA 2C0SA 2KNDA 3ANWA 4MFRA 2Q9QC 2LHNA 3AE5A 3JAEA 4ILCA 4CXXA 3T1YT 3UU6A 3ZC0A 5C8YE 1E2AA 2VB6A 4GIWA 3HR0A 3CKDA 3J7Yq 1YD8G 3C64A 1XDPA 3AEBA 5FMNA 5DQWA 2KLQA 4IL4A 3UQ4A 2YDQA 2VVNA 4JI8T 5CJ5A 2V7IA 4TV8E 5JDMA 1FMWA 5JTGA 5KMGP 1HG2A 1HNZT 4LFAT 2WMNA 3C4WA 4HFCA 1BR1A 2X67A 1YXRA 3RQWA 4DUZT 5AQNB 3D0TA 4JV5T 1UK5A 1YQ4A 1Z0PA 4JI5T 4CN4A 5L3GB 3ANWB 3PUXF 4B3ST 1XNRT 4O4JE 5AQTB 2V1DB 2E9XB 3MKDA 1IBLT 5M4YA 2X9HA 4PK6A 5ABEA 3HKCE 2Y48B 1FEWA 2V26A 5FL0A 4CXWA 5LGNB 2X0HA 4DR3T 4HFDA 3RYHE 4U7YA 1YKHB 1I94T 4NXMT 4U33A 3Q5XA 4AKLA 3FHNA 3FZFB 3Q2MA 4U74A 1SHZC 3EDUA 3N2OA 3OKQA 2M67A 2YKSA 2Y6XA 3NRXA 4HFIA 4V1Av 4Z90A 4YT0A 2WBLA 4HEAA 1VCSA 1MIVA 1KNPA 3A5XA 3AEGA 4KP3C 3QB5A 1UCUA 5JDQA 2L8KA 3Q9DA 2LRLA 1KNZA 3GA8A 3PUWF 5FYMA 3U3IA 3VRBA 3I9YA 3ZMTB 4IHJE 4ZXLA 2N1GA 2A3DA 1HNXT 3O1JA 2C5JA 2WMOA 3SRZA 4EB6E 5H6QB 2A2FX 2X0LB 3KV6A 2UXXB 3B13A 5AQRB 4YHHT 1QLBA 1SA0E 5BR8T 3UU8A 2VKDA 2LM9A 2BS2A 4P0AA 4IDQA 4QXBB 4ZZBA 4JUYA 4DUYT 4KHZF 5L3EB 1WR6A 3AA6B 3CX6B 5HXEA 3KBUA 3ONLC 4EYUA 4J2CA 1U5PA 4IDPA 4QXHB 5HEOA 4IREA 1QUUA 4X62T 4YSYA 1ZHCA 2Y8DA 3DP7A 3QB5K 3I0OA 4AIUA 4HWFA 2X9YA 1YKEB 4JEHB 4GYSA 4PJMA 2BBJA 4JI2T 4GKKT 4AI6A 2X66A 4EEBA 1UURA 1T7SA 3OYZA 4IE6A 3RF1A 3V5UA 4CI1B 3PUSA 2RP4A 2CBJA 2AXDS 2K48A 2LSYA 2H88A 3CPZA 3NZPA 2MBGA 1AJ3A 4HN9A 2FJEA 2PG8A 4UEMA 4ZI3C 5LXTE 3PU8A 2WS3A 5H6RB 3AAEB 2D0TA 1QSDA 2GK9A 4GKJT 2CHNA 3AE6A 4FJOA 2W4XA 2IAKA 2V7JA 3P50A 4IGUA 4DO0A 2JJ9A 4BJMA 2CCQA 4JI7T 3CX8B 3GMIA 3PTRB 3RIUA 3SOLA 2XASB 3RRWA 3NVOA 3ZLIA 4HWIB 3AVSA 4GOUA 3LG7A 2UXCT 2I0MA 3RX6A 4ZI2D 4UR9A 3CX7B 1Y64B 2CMRA 2QVAA 3RPUA 4JI4T 4IT4A 3P7IA 4JI6T 3RC3A 2OLTA 3OPCA 3AECA 1HFAA 2WB5A 2NOXA 2HPLA 4CXYA 3AEDA 2X68A 4ERRA 5ABHA 1KEYA 4QX8B 1VOMA 4H9NC 2KZ7B 3LK2B 3MACA 1MNDA 5FVKA 2MYSA 4U2YA 3RH3A 4HWDA 2D9DA 2XHEB 2QYWA 5AQUB 3N5LA 5L4EA 5F8PA 4COFA 3FZKB 3HKDE 3KBTA 5HCJA 4BA9A 4B6XA 1X9BA 5FKYA 4HWCA 2LHRA 3H3AA 2XQAA 2H3RA 3N9MA 2BKNA 3OJAA 1L0VA 4LFCT 3IF8B 4IE7A 4U31A 3F57A 2W00A 1N34T 5CFBA 2CE7A 1MMGA 3KV9A 5FY0A 4ZI7E 5LGTB 4CI2B 5J1GA 3RGLA 3N9PA 3P4QA 2K5BB 5FL1A 4EXTA 1MIYA 3M3ZB 3ZSTA 2LE8A 4CI3B 1KF6A 1MMAA 3IA3A 2OV9A 3JADA 4U72A 2JQQA 3ZJ2A 3RC8A 2M6BA 2VURA 2JQ9A 2LSJA 2JMKA 3N9LA 2ACZA 3L39A 4OYJA 3ZKRA 2XQ4A 4DR4T 4OHFA 4YTPA 3Q5DA 4PJJA 1BR0A 2W63A 2WCAA 3CWZB 3QK6A 2ES0A 4ZEYA 2DNXA 3JAFA 5F3JA 4DV2T 4LF6T 2H7OA 4LFBT 2CXLA 3Q5EA 4X65T 1HS7A 4Z91A 2LKGA 3N9OA 2CRBA 2IMLA 4BAYB 2UU9T 3ZCJA 5ABFA 2BDEA 2IC6A 1W0AA 2K3WA 4UV8B 4X20E 5JDFA 3TLTA 5AQKB 1DU2A 5L3FB 2HH7A 4ILUA 4LF9T 2J1DG 5JH7E 1X79A 2VQFT 4AKIA 2EHOC 4MHCA 3N2KE 3L09A 3QC9A 2J47A 2YOEA 4UELA 1G8XA 2R6GF 5L2LA 2MOZA 1HF8A 3UU3A 1HX1B 2WZIA 3GN5A 5EZYE 2BG9A 3K3NA 1UGOA 2BZBA 2IUBA 4PJLA 4MBQA 5GONE 3OVUA 3BQKA 2L3LA 3S4UA 4YSXA 5LG3A 2JQHA 1WCRA 2LSIA 3AA1B 3AEFA 3QOFA 4N78D 4U3CA 3RQUA 4UXNB 4AKGA 3AXJB 1ZKEA 5HXHA 1US7B 3FZHB 5KDMC 3A8YC 3LBXA 2XQYA 5IWAT 4CN1A 4WYVA 1Z8UA 2MAWA 3UU4A 1HTJF 3DJBA 3PE0A 3PUZF 5L47A 1T8BA 4LF4T 3EAMA 2DHRA 5HWXA 5F5WA 4OK0A 2FJDA 3VHLA 1IJ5A 2XQ8A 3HI2A 3K3QC 2YN6A 3M65A 2I6HA 3H37A 3PV0F 4FI5A 4QH1A 3K1SA 3I0QA 3O4XE 2VASA 1XWMA 5AQJB 3TKLB 1ZOYA 1ZEEA 2LOPA 2CBIA 3PJAJ 4YJ3E 2YU2A 5LHGB 1JNRA 2PTFA 2XTLA 2KWIB 3UUMA 3TLSA 4O2AE 2XSBA 1MIWA 5LYJE 2N9DA 2EHOA 3ZMSB 4YSZA 2LEHA 5ETWA 2OA5A 4H9PC 1R8IA 2A72A 4AQFA 4DV3T 2IDOB 1H7CA 2ZMAA 5AQGB 4DR7T 3ZCIA 2VQET 1LVFA 4H63V 5FY1A 4I55E 3MJXA 3NBXX 1OEDA 2WDVA 1KFYA 2XUEA 5LCYA 2VL8A 4TZ4C 3VU7H 3RKOA 3ZT6A 2C5KT 3VRAA 2XPKA 5EK4A 2D2SA 2BS3A 2HN2A 3RIAA 4EIWA 4LF7T 2W66A 4UVAB 5HXSA 3KV5A 1XNQT 4DR6T 3V5SA 2XM2A 3T8OA 4WNKA 3LFMA 3NKZA 4O2BE 3EHZA 5E0OA 1D0XA 2P9BA 4DMWA 3K3OA 1IBMT 1GQEA 2NTXA 2J62A 2CLYB 4IDNA 5AQMB 4XBFB 4UF0A 5DQVA 4HE8A 2QA7A 2K9AA 4M1PA 5CA0E 5L4HA 5DABA 3KV4A 2E8IA 1E7PA 4G2AA 5J2UE 2WY2A 2XAFB 3SFEA 1CUNA 4CQIA 5JDGA 2W0GA 2RA1A 3RRCA 3W15B 5FXWA 3ZPOA 4ASKA 4DBQA 3UT5E 1M62A 4A5XA 4PK5A 4C90A 1XMOT 2CA5A 1XDOA 2V8SV 2ZM8A 4HFHA 3ZYKA 4LMJA 4QHOA 4A56A 3KFWX 4H9SE 3FBZA 2PFVA 4HTEA 4HWHA 3KVAA 5LMUT 4X5TA 1V9DA 1BR2A 3HL6A 2YK0A 3UUBA 5AQSB 4GK5E 2FBWA 1D0YA 4NIQA 2LKHA 1W09A 2Q9QD 4ZS2A 2HHHT 5JRCA 1MNEA 3X1DA 4EOZB 4EZHA 4F8HA 4TNVA 2XAGB 4P09A 3RI5A 3MZKB 4TWFA 2F4VT 1XZYA 3GN5B 3QNUA 4HFVA 2WU2A 3UU5A 2KWHA 4B3TT 3CQCB 4JYAT 3VKHA 1BR4A 5AQIB 3ESLA 2CWYA 1HX8A 2MTQA 3GWHA 4JLEA 2WZHA 3G06A 4DR1T 3FZLB 4OYKA 3AE1A 4ANJA 5AQLB 2CPTA 5JVDE 1W9RA 4K0KT 3SFDA 2RPAA 1W0BA 2W67A 3RKGA 1J5ET 2D5UA 1SE7A 5FXZA 2CWOA 1ZV4X 1OWAA 2B1EA 3L8RA 3IBPA 4WBOA 4A98A 3IEEA 2YDSA 4DV6T 2IC9A 3CVRA 1SUMB 2IHR1 2V6XA 5JREA 2HN1A 4WW0A 2E9XA 2LLYA 5FXXA 3P4RA 2LSGA 2ACXA 3RHWA 4KI0F 4AKRB 3PUVF 4DBRA 2CHOA 4B3RT 3O9XA 1NENA 4L0RA 2DCFA 5EK2A 3UQ7A 4B3MT 1HNWT 4U2ZA 3E22E 4ZZCA 2UUAT 2EHOB 2LRKA 1N32T 1IZNB 5AQFB 5LGUB 2JQKA 3K8PC 4WBNE 2KSRA 2WAUA 3OBVE 4JI1T 4HFBA 5HEHA 4YY3T 2LM2A 1WFDA 2FJBA 3AAIA 3KVBA 4UVCB 4KMCA 5LNKA 3HKEE 3PURA 2LSKA 3AE8A 3EABA 3ZMVB 4ISTA 2EHOD 4IE0A 4UIGA 4X66T 1VCTA 4EYYR 4TX5A 4IL9A 1MMDA 1G73A 2B76A 2E2AA 1OXZA 5LOVE 4E7ZA 3LK3B 3UUNA 4MALA 3PDYA 3ZN0B 4OX9T 2W61A 4MLKA 3OYXA 4NPPA 1WR0A 2MPKA 5AQOB 4AQGA 5L3CB 2D0UA 3VKGA 2WM9A 5ABFB 2NR4A 4Z8XA 1D1CA 4QKNA 4JI3T 2XJ7A 5C3JA 5LBQB 5A1LA 3CK6A 1IJ6A 3U78A 2BG9C 5IYZE 1NWMX 2NP9A 3LDQB 3NZQA 3CQGB 4X1YE 3ZT5A 3ETVA 5AQPB 4QH5A 2V7LA 2E9XD 3JC6C 2W2UA 3NRYA 2BKPA 3RYCE 5LMNT 2VKOA 1T72A 3PUYF 4IE5A 4AXPA 4DV7T 4TWHA 4EAHA 5IUXA 2JIWA 1UUSA 2UXBT 3C4XA 4LMKA 4X1KE 3UUXB 3C50A 5FXVA 5CA1E 4DNDA 2BG9E 2WQYA 2V6YA 4TN7B 4YJ2E 3SWHA 2NTYA 3ZYLA 2BKOA 4UV9B 4YLHA 5J0ZA 3HA4A 5TAOA 2UUBT 2X0YA 2DLRA 5ABGA 4DMVA 4QXCB 3B5MA 3B57A 1IBKT 2CEAA 2YU1A 3EVYA 1E1HB 4JBWF 4TNWA 5BMVE 3A7MA 2V7MA 4GK0E 2CXFA 4TWDA 4YHJA 2G0UA 3E0ZA 3VR8A 4F6RC 5ADXL 4L5GA 1I6ZA 2M6IA 2CLYC 4AQFC 2KMFA 4EZ4A 2E9XC 1FIOA 1T98A 2Q9QA 2VKJA 3IHRA 2WP9A 3CMLA 4O4HE 5HXCA 1N36T 5CGMA 5L3DB 3AE2A 2XM1A 4HKAA 2K24A 5HAXA 4EEDA 4ZHQE 2ZM6T 2DI4A 4O8SA 5LHHB 4X1IE 2SPCA 3PJAA 4KHPT 1OEDB 4P0BA 4EGWA 1UX5A 3F2EA 3UFGA 5LP6E 2DWGA 3JC6D 3ONJA 3TLWA 1LVKA 3KINB 3FB2A 3RYFE 3SS1A 2Q9QB 2XQ5A 3LSVA 3ZSSA 4YTNA 2IW5B 1OEDE 4DV1T 2N2NA 3ONXA 1CHUA 2FJAA 5IHYA 3TLUA 5L3BB 4NUVA 3EUHA 5JRCB 2JRKA 2WWUA 5JDNA
chains in the Genus database with same CATH topology
2W2UA 2JQHA 2JQ9A 1WCRA 4U3CA 1WFDA 2DL1A 4A5XA 5CJ5A 4CN6A 5CGMA 2CPTA 2A9UA 2LRLA 4U7IA 5FVKA 2RPAA 3EABA 3ZT7A 4U2YA 4ZEYA 1YXRA 2V6YB 4CN1A 2V6YA 3ZT6A 4CN4A 3ZSTA 2CRBA 2V6XA 4P1NA 1WR0A 2K3WA 2MPKA 4NIQA 3ZSSA 3K1SA 4U31A 4U7YA 4WZXA 5FVLA 5LB7B 4IT4A 4U33A 2WWVA 4U2ZA 2LRKA 3ZT5A 2JQKA 2XZEA 2WY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2U A;  2JQH A;  2JQ9 A;  1WCR A;  4U3C A;  1WFD A;  2DL1 A;  4A5X A;  5CJ5 A;  4CN6 A;  5CGM A;  2CPT A;  2A9U A;  2LRL A;  4U7I A;  5FVK A;  2RPA A;  3EAB A;  3ZT7 A;  4U2Y A;  4ZEY A;  1YXR A;  2V6Y B;  4CN1 A;  2V6Y A;  3ZT6 A;  4CN4 A;  3ZST A;  2CRB A;  2V6X A;  4P1N A;  1WR0 A;  2K3W A;  2MPK A;  4NIQ A;  3ZSS A;  3K1S A;  4U31 A;  4U7Y A;  4WZX A;  5FVL A;  5LB7 B;  4IT4 A;  4U33 A;  2WWV A;  4U2Z A;  2LRK A;  3ZT5 A;  2JQK A;  2XZE A;  2WY2 A; 
#chains in the Genus database with same CATH topology
 2XAQ B;  4DID B;  1J5W A;  2ODU A;  3P4P A;  4KBM B;  1S35 A;  3FXD B;  3ZMZ B;  3AVR A;  4XAX B;  4DV4 T;  2XQ9 A;  2V5C A;  3AE4 A;  4I43 B;  2V7K A;  5LBM A;  5AQH B;  1FJG T;  1S94 A;  1MMN A;  3E08 A;  3R84 B;  5KX5 E;  4KUM B;  2XY8 B;  4IDO A;  2LT3 A;  5JR9 C;  3P8C D;  4IDZ A;  4AQY T;  1OED C;  4ADZ A;  2E5V A;  3MA9 A;  3UTK A;  3AXJ A;  3C4Z A;  3EI0 A;  3N9Q A;  4P1N A;  4ZI2 C;  4H9O C;  5EK3 A;  1WRD A;  2XAJ B;  5J2T E;  2E5L T;  4HGA A;  4O4I E;  4OFZ A;  5AQV B;  2UXN B;  4XZC A;  3NWI A;  3JCF A;  2LOS A;  1YW0 A;  2QRX A;  4YTM A;  5HCM A;  4ZOL E;  2VL0 A;  2X9X A;  1FMV A;  3PUA A;  4ILB A;  2WWV A;  1KNR A;  4QX7 B;  3ZMU B;  5LHI B;  3AA7 B;  1YQ3 A;  2H89 A;  2ZM2 A;  1D1A A;  2WU5 A;  2KIN B;  4ISS A;  5HEJ A;  2ZLY A;  4LF5 T;  5JDL A;  4X64 T;  2UUC T;  3DTO A;  4K0U A;  3R6N A;  3RYI E;  3AA0 B;  3HKB E;  5HYA A;  1UX4 A;  2UXD T;  5JQG E;  4U7I A;  3BQL A;  1EZ3 A;  3WI3 A;  2WSS V;  4NXN T;  2FUP A;  5AQQ B;  3ZT7 A;  4BJN A;  4G63 A;  2YEV C;  2V6Y B;  4JI0 T;  3LBX B;  3TLV A;  2BBH A;  4AKH A;  2CXD A;  2VVS A;  2L9Q A;  4H63 H;  2ZM0 A;  3I1A A;  5HEG A;  2I59 A;  5FY7 A;  2VKH A;  2IIU A;  3AAA B;  1WYC A;  4DV0 T;  2NW7 A;  2AE9 A;  3EDV A;  3L3P A;  2BG9 B;  3T1H T;  4TV9 E;  4QWN B;  4JEU B;  3J9X 1;  2WDQ A;  3PUQ A;  4AIS A;  1ZP0 A;  1LKX A;  5LB7 B;  2NWB A;  2XQ6 A;  3PUG A;  3RIU C;  3P4S A;  3ETU A;  4IIJ E;  2JMH A;  2XZE A;  5HXR A;  4LF8 T;  2CM0 A;  4PK4 A;  3N2G E;  4YXD A;  3FZM B;  4L9I A;  4DVD A;  3AB3 B;  4EV6 A;  2J4G A;  3UUL A;  3C98 B;  3LK4 2;  4PW8 A;  4CN6 A;  3AE7 A;  3AE9 A;  3Q5W A;  4ZI3 D;  5LJN A;  3AE3 A;  1WYB A;  3VR9 A;  1WLX A;  4H9Q C;  5CB4 E;  2XAH B;  5FNV E;  3BK9 A;  5KXJ A;  2Z6E A;  4I4T E;  3MXZ A;  4PFP A;  2NW8 A;  2X51 A;  2YDR A;  2JPF A;  3FBL A;  3H3M A;  3CQX C;  4H9R C;  4IE4 A;  3WAK A;  3ZJ1 A;  3BQI A;  5HWY A;  2BVM A;  3AEE A;  4PNI A;  4PJN A;  4I50 E;  3CIR A;  3UFE A;  2KT9 A;  3QUJ A;  3PU3 A;  4E7S A;  5AFU L;  3KDS E;  4GYR A;  1HG5 A;  4WZX A;  3ABV A;  4PFO A;  1NEK A;  2DWK A;  2XSA A;  4HFE A;  1JNZ A;  4I0U A;  2PJQ A;  4PAG A;  5DJQ C;  1N33 T;  4YFS A;  5JDH A;  3ZYM A;  3ZEF B;  2WDR A;  2XQ3 A;  5HEU A;  4CZZ B;  1O3X A;  2VK9 A;  4ILA A;  2LJL A;  4DV5 T;  4DR5 T;  1LRZ A;  3MK7 C;  4DR2 T;  5JR9 B;  4LML A;  2KXP B;  1IAP A;  3I9W A;  3P4W A;  4QH4 A;  1J1J A;  5JR9 A;  2DL1 A;  4ZS3 A;  2NW9 A;  5LJM A;  1HR0 T;  2VWA A;  2A9U A;  3F31 A;  3RIF A;  1D1B A;  2C5I T;  3LJC A;  4TUY E;  1B7T A;  3O1I A;  4KX6 A;  2V5D A;  5LG4 A;  3AEA A;  3ZC1 A;  1KK7 A;  3N9N A;  3O1H A;  2QGS A;  3FXE B;  2PBI A;  5LA6 E;  2W62 A;  4Q25 A;  2BVL A;  2BS4 A;  2ODV A;  3C51 A;  2YIN A;  4C91 A;  1VRB A;  1Y01 A;  2HPJ A;  4UF0 B;  4NUU A;  3WAJ A;  1XMQ T;  2H7V C;  1M7K A;  1HCI A;  2XQ7 A;  2X9W A;  4UVB B;  1D0Z A;  5FP3 A;  1NAF A;  3RLF F;  5C2T A;  4O4L E;  4A97 A;  3OTO T;  3ZN1 B;  5FVL A;  1U4Q A;  2C0S A;  2KND A;  3ANW A;  4MFR A;  2Q9Q C;  2LHN A;  3AE5 A;  3JAE A;  4ILC A;  4CXX A;  3T1Y T;  3UU6 A;  3ZC0 A;  5C8Y E;  1E2A A;  2VB6 A;  4GIW A;  3HR0 A;  3CKD A;  3J7Y q;  1YD8 G;  3C64 A;  1XDP A;  3AEB A;  5FMN A;  5DQW A;  2KLQ A;  4IL4 A;  3UQ4 A;  2YDQ A;  2VVN A;  4JI8 T;  5CJ5 A;  2V7I A;  4TV8 E;  5JDM A;  1FMW A;  5JTG A;  5KMG P;  1HG2 A;  1HNZ T;  4LFA T;  2WMN A;  3C4W A;  4HFC A;  1BR1 A;  2X67 A;  1YXR A;  3RQW A;  4DUZ T;  5AQN B;  3D0T A;  4JV5 T;  1UK5 A;  1YQ4 A;  1Z0P A;  4JI5 T;  4CN4 A;  5L3G B;  3ANW B;  3PUX F;  4B3S T;  1XNR T;  4O4J E;  5AQT B;  2V1D B;  2E9X B;  3MKD A;  1IBL T;  5M4Y A;  2X9H A;  4PK6 A;  5ABE A;  3HKC E;  2Y48 B;  1FEW A;  2V26 A;  5FL0 A;  4CXW A;  5LGN B;  2X0H A;  4DR3 T;  4HFD A;  3RYH E;  4U7Y A;  1YKH B;  1I94 T;  4NXM T;  4U33 A;  3Q5X A;  4AKL A;  3FHN A;  3FZF B;  3Q2M A;  4U74 A;  1SHZ C;  3EDU A;  3N2O A;  3OKQ A;  2M67 A;  2YKS A;  2Y6X A;  3NRX A;  4HFI A;  4V1A v;  4Z90 A;  4YT0 A;  2WBL A;  4HEA A;  1VCS A;  1MIV A;  1KNP A;  3A5X A;  3AEG A;  4KP3 C;  3QB5 A;  1UCU A;  5JDQ A;  2L8K A;  3Q9D A;  2LRL A;  1KNZ A;  3GA8 A;  3PUW F;  5FYM A;  3U3I A;  3VRB A;  3I9Y A;  3ZMT B;  4IHJ E;  4ZXL A;  2N1G A;  2A3D A;  1HNX T;  3O1J A;  2C5J A;  2WMO A;  3SRZ A;  4EB6 E;  5H6Q B;  2A2F X;  2X0L B;  3KV6 A;  2UXX B;  3B13 A;  5AQR B;  4YHH T;  1QLB A;  1SA0 E;  5BR8 T;  3UU8 A;  2VKD A;  2LM9 A;  2BS2 A;  4P0A A;  4IDQ A;  4QXB B;  4ZZB A;  4JUY A;  4DUY T;  4KHZ F;  5L3E B;  1WR6 A;  3AA6 B;  3CX6 B;  5HXE A;  3KBU A;  3ONL C;  4EYU A;  4J2C A;  1U5P A;  4IDP A;  4QXH B;  5HEO A;  4IRE A;  1QUU A;  4X62 T;  4YSY A;  1ZHC A;  2Y8D A;  3DP7 A;  3QB5 K;  3I0O A;  4AIU A;  4HWF A;  2X9Y A;  1YKE B;  4JEH B;  4GYS A;  4PJM A;  2BBJ A;  4JI2 T;  4GKK T;  4AI6 A;  2X66 A;  4EEB A;  1UUR A;  1T7S A;  3OYZ A;  4IE6 A;  3RF1 A;  3V5U A;  4CI1 B;  3PUS A;  2RP4 A;  2CBJ A;  2AXD S;  2K48 A;  2LSY A;  2H88 A;  3CPZ A;  3NZP A;  2MBG A;  1AJ3 A;  4HN9 A;  2FJE A;  2PG8 A;  4UEM A;  4ZI3 C;  5LXT E;  3PU8 A;  2WS3 A;  5H6R B;  3AAE B;  2D0T A;  1QSD A;  2GK9 A;  4GKJ T;  2CHN A;  3AE6 A;  4FJO A;  2W4X A;  2IAK A;  2V7J A;  3P50 A;  4IGU A;  4DO0 A;  2JJ9 A;  4BJM A;  2CCQ A;  4JI7 T;  3CX8 B;  3GMI A;  3PTR B;  3RIU A;  3SOL A;  2XAS B;  3RRW A;  3NVO A;  3ZLI A;  4HWI B;  3AVS A;  4GOU A;  3LG7 A;  2UXC T;  2I0M A;  3RX6 A;  4ZI2 D;  4UR9 A;  3CX7 B;  1Y64 B;  2CMR A;  2QVA A;  3RPU A;  4JI4 T;  4IT4 A;  3P7I A;  4JI6 T;  3RC3 A;  2OLT A;  3OPC A;  3AEC A;  1HFA A;  2WB5 A;  2NOX A;  2HPL A;  4CXY A;  3AED A;  2X68 A;  4ERR A;  5ABH A;  1KEY A;  4QX8 B;  1VOM A;  4H9N C;  2KZ7 B;  3LK2 B;  3MAC A;  1MND A;  5FVK A;  2MYS A;  4U2Y A;  3RH3 A;  4HWD A;  2D9D A;  2XHE B;  2QYW A;  5AQU B;  3N5L A;  5L4E A;  5F8P A;  4COF A;  3FZK B;  3HKD E;  3KBT A;  5HCJ A;  4BA9 A;  4B6X A;  1X9B A;  5FKY A;  4HWC A;  2LHR A;  3H3A A;  2XQA A;  2H3R A;  3N9M A;  2BKN A;  3OJA A;  1L0V A;  4LFC T;  3IF8 B;  4IE7 A;  4U31 A;  3F57 A;  2W00 A;  1N34 T;  5CFB A;  2CE7 A;  1MMG A;  3KV9 A;  5FY0 A;  4ZI7 E;  5LGT B;  4CI2 B;  5J1G A;  3RGL A;  3N9P A;  3P4Q A;  2K5B B;  5FL1 A;  4EXT A;  1MIY A;  3M3Z B;  3ZST A;  2LE8 A;  4CI3 B;  1KF6 A;  1MMA A;  3IA3 A;  2OV9 A;  3JAD A;  4U72 A;  2JQQ A;  3ZJ2 A;  3RC8 A;  2M6B A;  2VUR A;  2JQ9 A;  2LSJ A;  2JMK A;  3N9L A;  2ACZ A;  3L39 A;  4OYJ A;  3ZKR A;  2XQ4 A;  4DR4 T;  4OHF A;  4YTP A;  3Q5D A;  4PJJ A;  1BR0 A;  2W63 A;  2WCA A;  3CWZ B;  3QK6 A;  2ES0 A;  4ZEY A;  2DNX A;  3JAF A;  5F3J A;  4DV2 T;  4LF6 T;  2H7O A;  4LFB T;  2CXL A;  3Q5E A;  4X65 T;  1HS7 A;  4Z91 A;  2LKG A;  3N9O A;  2CRB A;  2IML A;  4BAY B;  2UU9 T;  3ZCJ A;  5ABF A;  2BDE A;  2IC6 A;  1W0A A;  2K3W A;  4UV8 B;  4X20 E;  5JDF A;  3TLT A;  5AQK B;  1DU2 A;  5L3F B;  2HH7 A;  4ILU A;  4LF9 T;  2J1D G;  5JH7 E;  1X79 A;  2VQF T;  4AKI A;  2EHO C;  4MHC A;  3N2K E;  3L09 A;  3QC9 A;  2J47 A;  2YOE A;  4UEL A;  1G8X A;  2R6G F;  5L2L A;  2MOZ A;  1HF8 A;  3UU3 A;  1HX1 B;  2WZI A;  3GN5 A;  5EZY E;  2BG9 A;  3K3N A;  1UGO A;  2BZB A;  2IUB A;  4PJL A;  4MBQ A;  5GON E;  3OVU A;  3BQK A;  2L3L A;  3S4U A;  4YSX A;  5LG3 A;  2JQH A;  1WCR A;  2LSI A;  3AA1 B;  3AEF A;  3QOF A;  4N78 D;  4U3C A;  3RQU A;  4UXN B;  4AKG A;  3AXJ B;  1ZKE A;  5HXH A;  1US7 B;  3FZH B;  5KDM C;  3A8Y C;  3LBX A;  2XQY A;  5IWA T;  4CN1 A;  4WYV A;  1Z8U A;  2MAW A;  3UU4 A;  1HTJ F;  3DJB A;  3PE0 A;  3PUZ F;  5L47 A;  1T8B A;  4LF4 T;  3EAM A;  2DHR A;  5HWX A;  5F5W A;  4OK0 A;  2FJD A;  3VHL A;  1IJ5 A;  2XQ8 A;  3HI2 A;  3K3Q C;  2YN6 A;  3M65 A;  2I6H A;  3H37 A;  3PV0 F;  4FI5 A;  4QH1 A;  3K1S A;  3I0Q A;  3O4X E;  2VAS A;  1XWM A;  5AQJ B;  3TKL B;  1ZOY A;  1ZEE A;  2LOP A;  2CBI A;  3PJA J;  4YJ3 E;  2YU2 A;  5LHG B;  1JNR A;  2PTF A;  2XTL A;  2KWI B;  3UUM A;  3TLS A;  4O2A E;  2XSB A;  1MIW A;  5LYJ E;  2N9D A;  2EHO A;  3ZMS B;  4YSZ A;  2LEH A;  5ETW A;  2OA5 A;  4H9P C;  1R8I A;  2A72 A;  4AQF A;  4DV3 T;  2IDO B;  1H7C A;  2ZMA A;  5AQG B;  4DR7 T;  3ZCI A;  2VQE T;  1LVF A;  4H63 V;  5FY1 A;  4I55 E;  3MJX A;  3NBX X;  1OED A;  2WDV A;  1KFY A;  2XUE A;  5LCY A;  2VL8 A;  4TZ4 C;  3VU7 H;  3RKO A;  3ZT6 A;  2C5K T;  3VRA A;  2XPK A;  5EK4 A;  2D2S A;  2BS3 A;  2HN2 A;  3RIA A;  4EIW A;  4LF7 T;  2W66 A;  4UVA B;  5HXS A;  3KV5 A;  1XNQ T;  4DR6 T;  3V5S A;  2XM2 A;  3T8O A;  4WNK A;  3LFM A;  3NKZ A;  4O2B E;  3EHZ A;  5E0O A;  1D0X A;  2P9B A;  4DMW A;  3K3O A;  1IBM T;  1GQE A;  2NTX A;  2J62 A;  2CLY B;  4IDN A;  5AQM B;  4XBF B;  4UF0 A;  5DQV A;  4HE8 A;  2QA7 A;  2K9A A;  4M1P A;  5CA0 E;  5L4H A;  5DAB A;  3KV4 A;  2E8I A;  1E7P A;  4G2A A;  5J2U E;  2WY2 A;  2XAF B;  3SFE A;  1CUN A;  4CQI A;  5JDG A;  2W0G A;  2RA1 A;  3RRC A;  3W15 B;  5FXW A;  3ZPO A;  4ASK A;  4DBQ A;  3UT5 E;  1M62 A;  4A5X A;  4PK5 A;  4C90 A;  1XMO T;  2CA5 A;  1XDO A;  2V8S V;  2ZM8 A;  4HFH A;  3ZYK A;  4LMJ A;  4QHO A;  4A56 A;  3KFW X;  4H9S E;  3FBZ A;  2PFV A;  4HTE A;  4HWH A;  3KVA A;  5LMU T;  4X5T A;  1V9D A;  1BR2 A;  3HL6 A;  2YK0 A;  3UUB A;  5AQS B;  4GK5 E;  2FBW A;  1D0Y A;  4NIQ A;  2LKH A;  1W09 A;  2Q9Q D;  4ZS2 A;  2HHH T;  5JRC A;  1MNE A;  3X1D A;  4EOZ B;  4EZH A;  4F8H A;  4TNV A;  2XAG B;  4P09 A;  3RI5 A;  3MZK B;  4TWF A;  2F4V T;  1XZY A;  3GN5 B;  3QNU A;  4HFV A;  2WU2 A;  3UU5 A;  2KWH A;  4B3T T;  3CQC B;  4JYA T;  3VKH A;  1BR4 A;  5AQI B;  3ESL A;  2CWY A;  1HX8 A;  2MTQ A;  3GWH A;  4JLE A;  2WZH A;  3G06 A;  4DR1 T;  3FZL B;  4OYK A;  3AE1 A;  4ANJ A;  5AQL B;  2CPT A;  5JVD E;  1W9R A;  4K0K T;  3SFD A;  2RPA A;  1W0B A;  2W67 A;  3RKG A;  1J5E T;  2D5U A;  1SE7 A;  5FXZ A;  2CWO A;  1ZV4 X;  1OWA A;  2B1E A;  3L8R A;  3IBP A;  4WBO A;  4A98 A;  3IEE A;  2YDS A;  4DV6 T;  2IC9 A;  3CVR A;  1SUM B;  2IHR 1;  2V6X A;  5JRE A;  2HN1 A;  4WW0 A;  2E9X A;  2LLY A;  5FXX A;  3P4R A;  2LSG A;  2ACX A;  3RHW A;  4KI0 F;  4AKR B;  3PUV F;  4DBR A;  2CHO A;  4B3R T;  3O9X A;  1NEN A;  4L0R A;  2DCF A;  5EK2 A;  3UQ7 A;  4B3M T;  1HNW T;  4U2Z A;  3E22 E;  4ZZC A;  2UUA T;  2EHO B;  2LRK A;  1N32 T;  1IZN B;  5AQF B;  5LGU B;  2JQK A;  3K8P C;  4WBN E;  2KSR A;  2WAU A;  3OBV E;  4JI1 T;  4HFB A;  5HEH A;  4YY3 T;  2LM2 A;  1WFD A;  2FJB A;  3AAI A;  3KVB A;  4UVC B;  4KMC A;  5LNK A;  3HKE E;  3PUR A;  2LSK A;  3AE8 A;  3EAB A;  3ZMV B;  4IST A;  2EHO D;  4IE0 A;  4UIG A;  4X66 T;  1VCT A;  4EYY R;  4TX5 A;  4IL9 A;  1MMD A;  1G73 A;  2B76 A;  2E2A A;  1OXZ A;  5LOV E;  4E7Z A;  3LK3 B;  3UUN A;  4MAL A;  3PDY A;  3ZN0 B;  4OX9 T;  2W61 A;  4MLK A;  3OYX A;  4NPP A;  1WR0 A;  2MPK A;  5AQO B;  4AQG A;  5L3C B;  2D0U A;  3VKG A;  2WM9 A;  5ABF B;  2NR4 A;  4Z8X A;  1D1C A;  4QKN A;  4JI3 T;  2XJ7 A;  5C3J A;  5LBQ B;  5A1L A;  3CK6 A;  1IJ6 A;  3U78 A;  2BG9 C;  5IYZ E;  1NWM X;  2NP9 A;  3LDQ B;  3NZQ A;  3CQG B;  4X1Y E;  3ZT5 A;  3ETV A;  5AQP B;  4QH5 A;  2V7L A;  2E9X D;  3JC6 C;  2W2U A;  3NRY A;  2BKP A;  3RYC E;  5LMN T;  2VKO A;  1T72 A;  3PUY F;  4IE5 A;  4AXP A;  4DV7 T;  4TWH A;  4EAH A;  5IUX A;  2JIW A;  1UUS A;  2UXB T;  3C4X A;  4LMK A;  4X1K E;  3UUX B;  3C50 A;  5FXV A;  5CA1 E;  4DND A;  2BG9 E;  2WQY A;  2V6Y A;  4TN7 B;  4YJ2 E;  3SWH A;  2NTY A;  3ZYL A;  2BKO A;  4UV9 B;  4YLH A;  5J0Z A;  3HA4 A;  5TAO A;  2UUB T;  2X0Y A;  2DLR A;  5ABG A;  4DMV A;  4QXC B;  3B5M A;  3B57 A;  1IBK T;  2CEA A;  2YU1 A;  3EVY A;  1E1H B;  4JBW F;  4TNW A;  5BMV E;  3A7M A;  2V7M A;  4GK0 E;  2CXF A;  4TWD A;  4YHJ A;  2G0U A;  3E0Z A;  3VR8 A;  4F6R C;  5ADX L;  4L5G A;  1I6Z A;  2M6I A;  2CLY C;  4AQF C;  2KMF A;  4EZ4 A;  2E9X C;  1FIO A;  1T98 A;  2Q9Q A;  2VKJ A;  3IHR A;  2WP9 A;  3CML A;  4O4H E;  5HXC A;  1N36 T;  5CGM A;  5L3D B;  3AE2 A;  2XM1 A;  4HKA A;  2K24 A;  5HAX A;  4EED A;  4ZHQ E;  2ZM6 T;  2DI4 A;  4O8S A;  5LHH B;  4X1I E;  2SPC A;  3PJA A;  4KHP T;  1OED B;  4P0B A;  4EGW A;  1UX5 A;  3F2E A;  3UFG A;  5LP6 E;  2DWG A;  3JC6 D;  3ONJ A;  3TLW A;  1LVK A;  3KIN B;  3FB2 A;  3RYF E;  3SS1 A;  2Q9Q B;  2XQ5 A;  3LSV A;  3ZSS A;  4YTN A;  2IW5 B;  1OED E;  4DV1 T;  2N2N A;  3ONX A;  1CHU A;  2FJA A;  5IHY A;  3TLU A;  5L3B B;  4NUV A;  3EUH A;  5JRC B;  2JRK A;  2WWU A;  5JDN A; 
#chains in the Genus database with same CATH homology
 2W2U A;  2JQH A;  2JQ9 A;  1WCR A;  4U3C A;  1WFD A;  2DL1 A;  4A5X A;  5CJ5 A;  4CN6 A;  5CGM A;  2CPT A;  2A9U A;  2LRL A;  4U7I A;  5FVK A;  2RPA A;  3EAB A;  3ZT7 A;  4U2Y A;  4ZEY A;  1YXR A;  2V6Y B;  4CN1 A;  2V6Y A;  3ZT6 A;  4CN4 A;  3ZST A;  2CRB A;  2V6X A;  4P1N A;  1WR0 A;  2K3W A;  2MPK A;  4NIQ A;  3ZSS A;  3K1S A;  4U31 A;  4U7Y A;  4WZX A;  5FVL A;  5LB7 B;  4IT4 A;  4U33 A;  2WWV A;  4U2Z A;  2LRK A;  3ZT5 A;  2JQK A;  2XZE A;  2WY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...