2W2UA

Structural insight into the interaction between archaeal escrt-iii and aaa-atpase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
75
structure length
75
Chain Sequence
MSAQVMLEEMARKYAINAVKADKEGNAEEAITNYKKAIEVLAQLVSLYRDGSTAAIYEQMINEYKRRIEVLKELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport
molecule keywords HYPOTHETICAL P60 KATANIN
publication title A Role for the Escrt System in Cell Division in Archaea.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 29
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2w2uA00
3ZSSA 2JQ9A 2JQHA 5CJ5A 4U7IA 4ZEYA 4WZXA 4NIQA 4U33A 4P1NA 2CPTA 2K3WA 3ZT7A 2CRBA 2RPAA 2W2UA 4IT4A 4U2ZA 5CGMA 1YXRA 4U7YA 1WR0A 4A5XA 4CN1A 2JQKA 1WCRA 2LRKA 3ZSTA 4CN6A 3ZT5A 4U31A 1WFDA 5LB7B 3K1SA 2WY2A 2WWVA 3ZT6A 4U2YA 2DL1A 4U3CA 2V6XA 2V6YA 2MPKA 5FVLA 5FVKA 2XZEA 4CN4A 3EABA 2A9UA 2LRLA 2V6YB
chains in the Genus database with same CATH superfamily
1D0XA 2CXDA 4DR6T 3MK7C 4L9IA 2XQYA 1R8IA 3ABVA 3RIAA 1WR0A 4UEMA 2LSYA 2NWBA 3P4SA 2BG9A 3RYFE 4FJOA 2VKJA 4X1IE 3EAMA 4CI2B 2M67A 4L5GA 5HXEA 2FUPA 4HFIA 1U5PA 4AIUA 3AA7B 3QOFA 2UXCT 2EHOD 4HFBA 1G73A 3SWHA 3C64A 2VKHA 1L0VA 4DR3T 4NUVA 3HKDE 2KWIB 4U72A 3M3ZB 4PNIA 3OJAA 3ZN1B 3LK3B 5AQVB 5LP6E 5ABGA 1QSDA 5C3JA 2CLYC 4PJNA 1VCTA 3RIUA 3AE2A 5HXCA 1IBKT 1YKEB 5LG4A 5C2TA 1D1CA 2BBJA 3JC6D 3TLSA 3RIFA 1NENA 3UUMA 4HEAA 4H9OC 2AXDS 3MKDA 4HWCA 3TLWA 3NRXA 1HR0T 1FEWA 1KEYA 2YEVC 5BR8T 2D5UA 4DUZT 3ZMUB 5IHYA 2DLRA 3LDQB 4UVBB 3ZPOA 5JREA 4ZI3C 5L4EA 4GYRA 4JYAT 3R84B 2WZHA 3PU8A 4ISSA 2X51A 5FNVE 3N9OA 3NRYA 3QC9A 3HKBE 5FY7A 2CWYA 3KINB 3AEAA 5LG3A 4L0RA 3UU3A 2WQYA 4YHHT 3C50A 4YHJA 2HH7A 2K24A 3OKQA 4U7YA 4IE5A 4JI2T 2ACZA 3AE1A 2JRKA 1BR0A 2WS3A 2P9BA 4JI4T 4DR4T 4YTPA 3AB3B 1HX1B 3WAKA 1SHZC 1WRDA 2V7LA 5EZYE 3X1DA 5LJMA 1Z8UA 4LMJA 4QXBB 2IIUA 4LF5T 2Z6EA 2MAWA 1MMNA 3J7Yq 3UT5E 3NZPA 1MIVA 5AQSB 3DP7A 4EIWA 2WU2A 4IE6A 2A2FX 4PFOA 2QVAA 3CPZA 4MFRA 3H3MA 5ETWA 5JVDE 2CCQA 5F5WA 5IUXA 4CI3B 3AA1B 4ERRA 2UXDT 2EHOC 2LRKA 1HCIA 4GKKT 2PJQA 4YTMA 3G06A 3AXJA 5LBQB 2KWHA 1MIWA 4QH1A 4HWIB 3K3OA 5LA6E 3W15B 2DNXA 3I9WA 4AKRB 4AQGA 1BR2A 3ZT5A 4WBOA 4LFCT 1D0YA 4QH4A 2HN1A 3AXJB 3NKZA 3OPCA 3PUZF 4HKAA 4KI0F 1KNPA 4LF9T 4DBQA 2DL1A 3P4QA 3DTOA 2C5KT 2N9DA 4HFDA 2XAJB 5JQGE 2KXPB 1UX4A 2WP9A 2KZ7B 3B5MA 5GONE 3UUBA 3CIRA 2J1DG 5LJNA 3SS1A 4YY3T 5M4YA 3RPUA 4OX9T 2ZM8A 4EGWA 3Q9DA 2W00A 2VL0A 3U3IA 5CA1E 1SUMB 3O9XA 5FXZA 4HWFA 3VRAA 4PFPA 5L4HA 2LT3A 2OA5A 1I94T 2YU2A 2BVLA 4O4LE 1HNWT 2ACXA 2F4VT 3KV6A 3RC3A 3KDSE 3KVAA 2CA5A 1HF8A 3QUJA 4I4TE 3PUVF 2KLQA 1MMAA 2V5DA 4JI7T 2ZM2A 3PUWF 1QLBA 3UU6A 4DNDA 3LBXA 3H37A 2YKSA 3SFDA 2CHNA 3IBPA 3AE4A 5JDGA 5IWAT 2IAKA 4U2ZA 2ES0A 5J2TE 1HTJF 4LFAT 3FZLB 3UUXB 3RIUC 4IE0A 5FXWA 3VR9A 4IREA 4JI3T 2W67A 4U7IA 1HG5A 3LBXB 1M62A 1ZOYA 3HR0A 3I1AA 5JDQA 1DU2A 2LOPA 5AQLB 4E7SA 4PW8A 3A8YC 5LB7B 2V1DB 3L8RA 2V7IA 3MACA 1AJ3A 1D0ZA 1WYCA 5KXJA 2QA7A 4DV1T 3UFEA 3AE5A 3CQGB 4ZI2C 3ZMSB 1ZKEA 2W2UA 3EI0A 3F2EA 2D2SA 2W0GA 4YSXA 2ODUA 2YK0A 3ZCJA 3LG7A 4IL9A 3I9YA 3AEGA 2X67A 3O1IA 2XQ7A 3F57A 1Z0PA 2EHOA 5AQKB 4IDZA 2XSAA 4EYYR 5HCMA 2XASB 5L3GB 2HPJA 3ZMTB 4PAGA 4XBFB 3SFEA 2WDQA 1FJGT 2E9XA 3TLTA 3HKEE 4ILCA 3AEFA 4KHPT 4B3MT 3GWHA 4YFSA 4C90A 3O1HA 1KK7A 4QH5A 3PUSA 2X66A 3ZLIA 5CJ5A 4LF4T 2BS2A 3RQUA 2CPTA 4TV9E 4EZ4A 4CXXA 5L3FB 2E9XB 2UU9T 2NR4A 4AKLA 2L3LA 4EAHA 4EXTA 3CQCB 1ZP0A 4EV6A 5AQOB 2VKOA 3RRCA 5HEUA 3RC8A 1UURA 3FZHB 3AEDA 1N32T 2JQKA 3MXZA 4DV2T 5LGUB 2M6IA 2XTLA 4DO0A 5KMGP 4ILBA 4CN1A 3K3NA 4WYVA 1H7CA 2VQET 2J62A 4ZI7E 5JDLA 3O4XE 5AQIB 5LBMA 4E7ZA 4UIGA 4B3TT 4DR7T 2X68A 4WNKA 2R6GF 1FMVA 3OBVE 2MOZA 2NP9A 1SA0E 2CXLA 2CRBA 3KVBA 3H3AA 4X5TA 5AQHB 3ZT6A 3BK9A 1I6ZA 4IIJE 5HYAA 5JTGA 3KV5A 5LXTE 3IF8B 2E9XD 4QWNB 4TV8E 2KINB 4IDOA 4K0KT 4AKHA 2ODVA 1WLXA 2LE8A 4P0AA 4YLHA 4NIQA 3RYCE 4DVDA 3VU7H 2N2NA 2WU5A 4DR5T 4ILAA 1S94A 1MMDA 2IC9A 4C91A 1XMOT 4X62T 3IA3A 2LLYA 3L09A 4O8SA 2UXNB 5FY1A 3ZMZB 4DV3T 2IC6A 3BQKA 4XZCA 1WCRA 2VURA 4H9NC 2WMOA 4DR1T 3ZJ1A 2E5VA 4ZS3A 5A1LA 2Q9QD 2B76A 1HG2A 5HAXA 2W62A 4TWFA 3FBLA 1IZNB 3ZEFB 1HNZT 2IUBA 5CA0E 4O4IE 2CEAA 4QX7B 4TUYE 4KBMB 5JDNA 3RHWA 3SRZA 4YJ3E 2VQFT 1V9DA 3V5UA 2SPCA 5LHHB 4A98A 3J9X1 3VRBA 3FXEB 4O2BE 4HWHA 1YKHB 3Q5XA 3I0OA 5FY0A 2XAHB 2LKGA 1OEDE 2QYWA 3T8OA 3K1SA 2LHNA 3MJXA 4PK4A 4JI0T 3IHRA 2CBIA 5L47A 3CVRA 3QB5A 3K3QC 2L9QA 4IDQA 2H88A 3UULA 4DIDB 3AECA 3AEEA 1VCSA 2VL8A 3U78A 3ZC1A 3OVUA 4DMVA 2PBIA 3E08A 2D9DA 2XM2A 2LM2A 3TLUA 3AEBA 1T7SA 2YDRA 3FZMB 1XZYA 2E8IA 2E9XC 3AA0B 3B13A 3VKHA 4QX8B 4MBQA 2WB5A 3ZYLA 4DV7T 1KNZA 2Y6XA 2XQ8A 1CHUA 3P50A 5FVLA 1HX8A 5AQTB 3UU8A 3RX6A 4NPPA 3AAAB 3C51A 2XAQB 5HXRA 4ZOLE 5H6QB 2YDSA 2QGSA 2W61A 2FJEA 3BQLA 2CXFA 3NBXX 4BA9A 3JC6C 5ABHA 1T8BA 1OWAA 2XM1A 1D1BA 4TWHA 2MTQA 4Z8XA 1KFYA 4H9QC 2V7JA 1SE7A 2LHRA 5FVKA 4GK5E 1XWMA 2W4XA 1IAPA 4LMLA 2XAGB 4IDNA 1YQ4A 5J0ZA 1MNEA 3CK6A 4JI8T 4ILUA 3ZMVB 5HWXA 3CX8B 3SOLA 3RKGA 4I50E 4IL4A 2WCAA 4V1Av 1O3XA 3RH3A 4UF0B 4DUYT 3C98B 2V7KA 1QUUA 4QXCB 3C4XA 5EK3A 4P1NA 4DBRA 2Y8DA 5JR9B 3UU4A 3ZYMA 5HXSA 5AQUB 5DQVA 2PFVA 1NEKA 3LFMA 1FIOA 4JLEA 3ETVA 5HXHA 2VWAA 2L8KA 3GMIA 4EEDA 3IEEA 2WZIA 3ONJA 4JEHB 4A5XA 4PJLA 4EB6E 3HKCE 3ZYKA 2LSIA 2WY2A 2UUAT 3RGLA 3T1HT 1N36T 1OEDA 4TN7B 5DABA 2JQ9A 4ZEYA 5L3DB 4UXNB 1CUNA 2A3DA 1UCUA 4HE8A 3AVSA 2XQ5A 3OTOT 3OYZA 3V5SA 4LF7T 2PG8A 2YU1A 4UV9B 3F31A 4ZS2A 2QRXA 4A56A 3DJBA 2V6YB 5TAOA 2UXBT 2JQHA 4O4HE 1OEDB 4HFEA 3UQ4A 3KBTA 3ZN0B 5AQRB 3ANWA 4GIWA 4CN6A 4CXYA 3AAEB 1UUSA 4CN4A 3CX6B 3JAFA 2C5JA 3NVOA 4PJMA 1XDPA 5J1GA 2X0LB 4YXDA 2CWOA 4F6RC 2WBLA 3AA6B 4IT4A 2NW9A 1ZV4X 2XQ6A 3E22E 2V8SV 2YINA 4YSYA 4EEBA 3ANWB 3TLVA 2BZBA 2XQ3A 2FBWA 3FXDB 5C8YE 4DR2T 3UU5A 2A72A 4LF6T 5AQJB 4X65T 5HEHA 1WYBA 3LSVA 3Q5DA 5FL1A 3P7IA 5ABFB 5HEGA 2K5BB 4DMWA 5E0OA 2MPKA 3PE0A 2JIWA 3NWIA 2I6HA 2LEHA 3WI3A 5LYJE 3CWZB 1B7TA 3ONXA 4X20E 2HN2A 3VHLA 4MALA 3LJCA 4G63A 3P8CD 2NW7A 2LJLA 5DJQC 3MA9A 3LK42 3CMLA 4WBNE 5EK2A 5LGTB 2XQ9A 4CZZB 2YOEA 1J5ET 4GOUA 4OHFA 2KMFA 5AQNB 1YXRA 4YTNA 1KF6A 3ZC0A 1XNQT 4HFCA 1U4QA 4DV4T 5L3CB 1N34T 2Q9QA 2LSJA 2WMNA 2IMLA 2W66A 2X9WA 3Q5WA 3ZJ2A 1ZHCA 2XJ7A 3P4WA 4IE7A 4O2AE 5CGMA 2I59A 2LM9A 3RI5A 2BKOA 1J1JA 5JDHA 1IBMT 4F8HA 3HI2A 3RQWA 4OFZA 1W09A 4Z91A 4IHJE 2Q9QB 3PJAA 1MMGA 5AFUL 4I55E 4AQFC 3O1JA 1Y64B 3C4ZA 1US7B 4ADZA 1UX5A 4ZZBA 4P0BA 2XAFB 4BJNA 4KX6A 4DV5T 3EHZA 3EVYA 4YJ2E 4TNVA 4NXNT 1W9RA 4UVAB 2H3RA 2DWKA 4PK5A 1FMWA 2XHEB 4N78D 5KX5E 2BG9B 2VKDA 2LSGA 3WAJA 3GN5A 1VRBA 5JR9C 1J5WA 3D0TA 4PK6A 4GKJT 3RF1A 1KNRA 4XAXB 4CI1B 1NWMX 1WFDA 3PUAA 3UFGA 3LK2B 2VVSA 3JAEA 4IGUA 3PJAJ 2A9UA 4YT0A 3PUXF 5AQQB 4H9RC 1N33T 3HA4A 1G8XA 1WR6A 4HN9A 3GN5B 2RPAA 1HS7A 2V7MA 4X64T 1M7KA 3PUYF 3QB5K 2C5IT 4TX5A 5IYZE 3UQ7A 4I43B 5L3BB 4JI1T 1JNRA 3PUQA 2ZM6T 4OYKA 3K8PC 4X66T 2ZLYA 3UUNA 5ABEA 4EYUA 4HFHA 4ASKA 2N1GA 4JV5T 4B6XA 4U74A 4U2YA 1OEDC 3ZKRA 4DV6T 4JEUB 3CKDA 1D1AA 4LMKA 1XMQT 5KDMC 2CBJA 4EZHA 3FZKB 5LGNB 2CM0A 4AISA 3RYIE 3NZQA 4UV8B 5BMVE 2E5LT 1Y01A 3ETUA 4JI5T 2WAUA 1XNRT 4IE4A 4WZXA 3RYHE 2JQQA 2B1EA 3GA8A 1LKXA 2BS4A 2XQ4A 2WWVA 2XUEA 2OLTA 2V6XA 3FHNA 4LFBT 3EABA 4TNWA 3P4PA 4LF8T 2KNDA 3N9QA 3CX7B 3AAIA 2UUBT 2CHOA 4A97A 2VVNA 3PUGA 2Y48B 2NOXA 3A7MA 3AE7A 2V26A 4U3CA 4AKIA 1LVFA 2AE9A 2MYSA 5FMNA 2WM9A 3VKGA 4KP3C 4KUMB 3A5XA 2I0MA 2K9AA 4UR9A 4KMCA 2KSRA 3AE6A 2J4GA 2D0UA 1ZEEA 2GK9A 2IHR1 3KBUA 3L39A 2CMRA 1T98A 2NTXA 4NXMT 4MHCA 1BR4A 4TWDA 2CE7A 3L3PA 1E7PA 4Z90A 2OV9A 4ZI2D 1LRZA 2LSKA 5AQFB 5AQGB 2BBHA 3N9PA 1W0BA 1BR1A 4AQFA 2KT9A 1MIYA 2FJDA 4U31A 2H7OA 5CB4E 4GK0E 4UVCB 4H9SE 5LCYA 3PDYA 1MNDA 2NTYA 4K0UA 2G0UA 4JUYA 2WSSV 4BJMA 4UF0A 5EK4A 4BAYB 1X79A 3ZSTA 4JI6T 3RRWA 4ISTA 2YN6A 4OK0A 5J2UE 3AE8A 2DWGA 2Q9QC 3HL6A 5JR9A 4YSZA 2JMHA 3ZT7A 3Q2MA 3RLFF 1W0AA 4ANJA 3C4WA 2XSBA 2LOSA 5JDMA 4QHOA 2X9XA 2M6BA 2X9HA 2VASA 1VOMA 3VR8A 3JCFA 3ZSSA 4AQYT 3AVRA 4JBWF 5HEOA 2XY8B 2K3WA 1S35A 1T72A 4OYJA 2BG9C 4O4JE 4AXPA 1E1HB 3I0QA 2JPFA 4ZHQE 3FZFB 5CFBA 3PV0F 3M65A 1HNXT 2IDOB 2PTFA 5FXXA 3PTRB 4UELA 1JNZA 3OYXA 2CLYB 4M1PA 3E0ZA 3QK6A 2BVMA 3KV9A 2BG9E 5JRCA 2YDQA 2V6YA 2VB6A 4B3RT 4KHZF 2ZM0A 4PJJA 4H63H 2UXXB 2FJBA 5LOVE 2DHRA 2RP4A 2H7VC 4AI6A 2ZMAA 2RA1A 2BDEA 3CQXC 5AQPB 2V5CA 4QXHB 4HTEA 1HFAA 2UUCT 3N9LA 5JRCB 3N2KE 1OXZA 3EDVA 4X1YE 1NAFA 3Q5EA 4G2AA 2MBGA 1EZ3A 3PU3A 2NW8A 3UTKA 2BS3A 4I0UA 2JMKA 5FXVA 5H6RB 2K48A 3ZCIA 3KV4A 1YQ3A 3JADA 4J2CA 3EUHA 2XPKA 1YW0A 5LMUT 1UGOA 1IJ5A 3AE3A 5DQWA 5ADXL 4QKNA 2X9YA 2C0SA 4AKGA 4EOZB 5FKYA 2D0TA 5LNKA 5ABFA 4P09A 3R6NA 3RKOA 4COFA 5L3EB 3BQIA 2WDRA 3EDUA 5F3JA 5L2LA 3PURA 4GYSA 4TZ4C 1LVKA 1X9BA 5JH7E 4H9PC 3N9MA 2WDVA 2J47A 2E2AA 4B3ST 4U33A 2BKNA 1IJ6A 2DCFA 4HGAA 4ZXLA 3FBZA 5FP3A 2HPLA 2XZEA 3P4RA 4HFVA 2BKPA 3B57A 3N5LA 3TKLB 4FI5A 2H89A 2X0HA 3KFWX 1YD8G 4ZI3D 2XQAA 1E2AA 2W63A 5HEJA 1IBLT 4X1KE 5LHGB 4MLKA 3AE9A 2DI4A 3T1YT 2EHOB 3N9NA 2JJ9A 4CQIA 5JDFA 3QNUA 4IDPA 4CXWA 2IW5B 2FJAA 4Q25A 4H63V 2LKHA 5LMNT 1XDOA 2X0YA 3S4UA 2LRLA 3N2GE 1UK5A 3FB2A 1GQEA 5FYMA 2WWUA 5LHIB 2VK9A 4NUUA 5AQMB 3MZKB 2HHHT 3ONLC 4HWDA 4WW0A 5HCJA 5HWYA 5F8PA 4ZZCA 3ESLA 5FL0A 3N2OA 4DV0T
chains in the Genus database with same CATH topology
3ZSSA 2JQ9A 2JQHA 5CJ5A 4U7IA 4ZEYA 4WZXA 4NIQA 4U33A 4P1NA 2CPTA 2K3WA 3ZT7A 2CRBA 2RPAA 2W2UA 4IT4A 4U2ZA 5CGMA 1YXRA 4U7YA 1WR0A 4A5XA 4CN1A 2JQKA 1WCRA 2LRKA 3ZSTA 4CN6A 3ZT5A 4U31A 1WFDA 5LB7B 3K1SA 2WY2A 2WWVA 3ZT6A 4U2YA 2DL1A 4U3CA 2V6XA 2V6YA 2MPKA 5FVLA 5FVKA 2XZEA 4CN4A 3EABA 2A9UA 2LRLA 2V6YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSS A;  2JQ9 A;  2JQH A;  5CJ5 A;  4U7I A;  4ZEY A;  4WZX A;  4NIQ A;  4U33 A;  4P1N A;  2CPT A;  2K3W A;  3ZT7 A;  2CRB A;  2RPA A;  2W2U A;  4IT4 A;  4U2Z A;  5CGM A;  1YXR A;  4U7Y A;  1WR0 A;  4A5X A;  4CN1 A;  2JQK A;  1WCR A;  2LRK A;  3ZST A;  4CN6 A;  3ZT5 A;  4U31 A;  1WFD A;  5LB7 B;  3K1S A;  2WY2 A;  2WWV A;  3ZT6 A;  4U2Y A;  2DL1 A;  4U3C A;  2V6X A;  2V6Y A;  2MPK A;  5FVL A;  5FVK A;  2XZE A;  4CN4 A;  3EAB A;  2A9U A;  2LRL A;  2V6Y B; 
#chains in the Genus database with same CATH topology
 1D0X A;  2CXD A;  4DR6 T;  3MK7 C;  4L9I A;  2XQY A;  1R8I A;  3ABV A;  3RIA A;  1WR0 A;  4UEM A;  2LSY A;  2NWB A;  3P4S A;  2BG9 A;  3RYF E;  4FJO A;  2VKJ A;  4X1I E;  3EAM A;  4CI2 B;  2M67 A;  4L5G A;  5HXE A;  2FUP A;  4HFI A;  1U5P A;  4AIU A;  3AA7 B;  3QOF A;  2UXC T;  2EHO D;  4HFB A;  1G73 A;  3SWH A;  3C64 A;  2VKH A;  1L0V A;  4DR3 T;  4NUV A;  3HKD E;  2KWI B;  4U72 A;  3M3Z B;  4PNI A;  3OJA A;  3ZN1 B;  3LK3 B;  5AQV B;  5LP6 E;  5ABG A;  1QSD A;  5C3J A;  2CLY C;  4PJN A;  1VCT A;  3RIU A;  3AE2 A;  5HXC A;  1IBK T;  1YKE B;  5LG4 A;  5C2T A;  1D1C A;  2BBJ A;  3JC6 D;  3TLS A;  3RIF A;  1NEN A;  3UUM A;  4HEA A;  4H9O C;  2AXD S;  3MKD A;  4HWC A;  3TLW A;  3NRX A;  1HR0 T;  1FEW A;  1KEY A;  2YEV C;  5BR8 T;  2D5U A;  4DUZ T;  3ZMU B;  5IHY A;  2DLR A;  3LDQ B;  4UVB B;  3ZPO A;  5JRE A;  4ZI3 C;  5L4E A;  4GYR A;  4JYA T;  3R84 B;  2WZH A;  3PU8 A;  4ISS A;  2X51 A;  5FNV E;  3N9O A;  3NRY A;  3QC9 A;  3HKB E;  5FY7 A;  2CWY A;  3KIN B;  3AEA A;  5LG3 A;  4L0R A;  3UU3 A;  2WQY A;  4YHH T;  3C50 A;  4YHJ A;  2HH7 A;  2K24 A;  3OKQ A;  4U7Y A;  4IE5 A;  4JI2 T;  2ACZ A;  3AE1 A;  2JRK A;  1BR0 A;  2WS3 A;  2P9B A;  4JI4 T;  4DR4 T;  4YTP A;  3AB3 B;  1HX1 B;  3WAK A;  1SHZ C;  1WRD A;  2V7L A;  5EZY E;  3X1D A;  5LJM A;  1Z8U A;  4LMJ A;  4QXB B;  2IIU A;  4LF5 T;  2Z6E A;  2MAW A;  1MMN A;  3J7Y q;  3UT5 E;  3NZP A;  1MIV A;  5AQS B;  3DP7 A;  4EIW A;  2WU2 A;  4IE6 A;  2A2F X;  4PFO A;  2QVA A;  3CPZ A;  4MFR A;  3H3M A;  5ETW A;  5JVD E;  2CCQ A;  5F5W A;  5IUX A;  4CI3 B;  3AA1 B;  4ERR A;  2UXD T;  2EHO C;  2LRK A;  1HCI A;  4GKK T;  2PJQ A;  4YTM A;  3G06 A;  3AXJ A;  5LBQ B;  2KWH A;  1MIW A;  4QH1 A;  4HWI B;  3K3O A;  5LA6 E;  3W15 B;  2DNX A;  3I9W A;  4AKR B;  4AQG A;  1BR2 A;  3ZT5 A;  4WBO A;  4LFC T;  1D0Y A;  4QH4 A;  2HN1 A;  3AXJ B;  3NKZ A;  3OPC A;  3PUZ F;  4HKA A;  4KI0 F;  1KNP A;  4LF9 T;  4DBQ A;  2DL1 A;  3P4Q A;  3DTO A;  2C5K T;  2N9D A;  4HFD A;  2XAJ B;  5JQG E;  2KXP B;  1UX4 A;  2WP9 A;  2KZ7 B;  3B5M A;  5GON E;  3UUB A;  3CIR A;  2J1D G;  5LJN A;  3SS1 A;  4YY3 T;  5M4Y A;  3RPU A;  4OX9 T;  2ZM8 A;  4EGW A;  3Q9D A;  2W00 A;  2VL0 A;  3U3I A;  5CA1 E;  1SUM B;  3O9X A;  5FXZ A;  4HWF A;  3VRA A;  4PFP A;  5L4H A;  2LT3 A;  2OA5 A;  1I94 T;  2YU2 A;  2BVL A;  4O4L E;  1HNW T;  2ACX A;  2F4V T;  3KV6 A;  3RC3 A;  3KDS E;  3KVA A;  2CA5 A;  1HF8 A;  3QUJ A;  4I4T E;  3PUV F;  2KLQ A;  1MMA A;  2V5D A;  4JI7 T;  2ZM2 A;  3PUW F;  1QLB A;  3UU6 A;  4DND A;  3LBX A;  3H37 A;  2YKS A;  3SFD A;  2CHN A;  3IBP A;  3AE4 A;  5JDG A;  5IWA T;  2IAK A;  4U2Z A;  2ES0 A;  5J2T E;  1HTJ F;  4LFA T;  3FZL B;  3UUX B;  3RIU C;  4IE0 A;  5FXW A;  3VR9 A;  4IRE A;  4JI3 T;  2W67 A;  4U7I A;  1HG5 A;  3LBX B;  1M62 A;  1ZOY A;  3HR0 A;  3I1A A;  5JDQ A;  1DU2 A;  2LOP A;  5AQL B;  4E7S A;  4PW8 A;  3A8Y C;  5LB7 B;  2V1D B;  3L8R A;  2V7I A;  3MAC A;  1AJ3 A;  1D0Z A;  1WYC A;  5KXJ A;  2QA7 A;  4DV1 T;  3UFE A;  3AE5 A;  3CQG B;  4ZI2 C;  3ZMS B;  1ZKE A;  2W2U A;  3EI0 A;  3F2E A;  2D2S A;  2W0G A;  4YSX A;  2ODU A;  2YK0 A;  3ZCJ A;  3LG7 A;  4IL9 A;  3I9Y A;  3AEG A;  2X67 A;  3O1I A;  2XQ7 A;  3F57 A;  1Z0P A;  2EHO A;  5AQK B;  4IDZ A;  2XSA A;  4EYY R;  5HCM A;  2XAS B;  5L3G B;  2HPJ A;  3ZMT B;  4PAG A;  4XBF B;  3SFE A;  2WDQ A;  1FJG T;  2E9X A;  3TLT A;  3HKE E;  4ILC A;  3AEF A;  4KHP T;  4B3M T;  3GWH A;  4YFS A;  4C90 A;  3O1H A;  1KK7 A;  4QH5 A;  3PUS A;  2X66 A;  3ZLI A;  5CJ5 A;  4LF4 T;  2BS2 A;  3RQU A;  2CPT A;  4TV9 E;  4EZ4 A;  4CXX A;  5L3F B;  2E9X B;  2UU9 T;  2NR4 A;  4AKL A;  2L3L A;  4EAH A;  4EXT A;  3CQC B;  1ZP0 A;  4EV6 A;  5AQO B;  2VKO A;  3RRC A;  5HEU A;  3RC8 A;  1UUR A;  3FZH B;  3AED A;  1N32 T;  2JQK A;  3MXZ A;  4DV2 T;  5LGU B;  2M6I A;  2XTL A;  4DO0 A;  5KMG P;  4ILB A;  4CN1 A;  3K3N A;  4WYV A;  1H7C A;  2VQE T;  2J62 A;  4ZI7 E;  5JDL A;  3O4X E;  5AQI B;  5LBM A;  4E7Z A;  4UIG A;  4B3T T;  4DR7 T;  2X68 A;  4WNK A;  2R6G F;  1FMV A;  3OBV E;  2MOZ A;  2NP9 A;  1SA0 E;  2CXL A;  2CRB A;  3KVB A;  3H3A A;  4X5T A;  5AQH B;  3ZT6 A;  3BK9 A;  1I6Z A;  4IIJ E;  5HYA A;  5JTG A;  3KV5 A;  5LXT E;  3IF8 B;  2E9X D;  4QWN B;  4TV8 E;  2KIN B;  4IDO A;  4K0K T;  4AKH A;  2ODV A;  1WLX A;  2LE8 A;  4P0A A;  4YLH A;  4NIQ A;  3RYC E;  4DVD A;  3VU7 H;  2N2N A;  2WU5 A;  4DR5 T;  4ILA A;  1S94 A;  1MMD A;  2IC9 A;  4C91 A;  1XMO T;  4X62 T;  3IA3 A;  2LLY A;  3L09 A;  4O8S A;  2UXN B;  5FY1 A;  3ZMZ B;  4DV3 T;  2IC6 A;  3BQK A;  4XZC A;  1WCR A;  2VUR A;  4H9N C;  2WMO A;  4DR1 T;  3ZJ1 A;  2E5V A;  4ZS3 A;  5A1L A;  2Q9Q D;  2B76 A;  1HG2 A;  5HAX A;  2W62 A;  4TWF A;  3FBL A;  1IZN B;  3ZEF B;  1HNZ T;  2IUB A;  5CA0 E;  4O4I E;  2CEA A;  4QX7 B;  4TUY E;  4KBM B;  5JDN A;  3RHW A;  3SRZ A;  4YJ3 E;  2VQF T;  1V9D A;  3V5U A;  2SPC A;  5LHH B;  4A98 A;  3J9X 1;  3VRB A;  3FXE B;  4O2B E;  4HWH A;  1YKH B;  3Q5X A;  3I0O A;  5FY0 A;  2XAH B;  2LKG A;  1OED E;  2QYW A;  3T8O A;  3K1S A;  2LHN A;  3MJX A;  4PK4 A;  4JI0 T;  3IHR A;  2CBI A;  5L47 A;  3CVR A;  3QB5 A;  3K3Q C;  2L9Q A;  4IDQ A;  2H88 A;  3UUL A;  4DID B;  3AEC A;  3AEE A;  1VCS A;  2VL8 A;  3U78 A;  3ZC1 A;  3OVU A;  4DMV A;  2PBI A;  3E08 A;  2D9D A;  2XM2 A;  2LM2 A;  3TLU A;  3AEB A;  1T7S A;  2YDR A;  3FZM B;  1XZY A;  2E8I A;  2E9X C;  3AA0 B;  3B13 A;  3VKH A;  4QX8 B;  4MBQ A;  2WB5 A;  3ZYL A;  4DV7 T;  1KNZ A;  2Y6X A;  2XQ8 A;  1CHU A;  3P50 A;  5FVL A;  1HX8 A;  5AQT B;  3UU8 A;  3RX6 A;  4NPP A;  3AAA B;  3C51 A;  2XAQ B;  5HXR A;  4ZOL E;  5H6Q B;  2YDS A;  2QGS A;  2W61 A;  2FJE A;  3BQL A;  2CXF A;  3NBX X;  4BA9 A;  3JC6 C;  5ABH A;  1T8B A;  1OWA A;  2XM1 A;  1D1B A;  4TWH A;  2MTQ A;  4Z8X A;  1KFY A;  4H9Q C;  2V7J A;  1SE7 A;  2LHR A;  5FVK A;  4GK5 E;  1XWM A;  2W4X A;  1IAP A;  4LML A;  2XAG B;  4IDN A;  1YQ4 A;  5J0Z A;  1MNE A;  3CK6 A;  4JI8 T;  4ILU A;  3ZMV B;  5HWX A;  3CX8 B;  3SOL A;  3RKG A;  4I50 E;  4IL4 A;  2WCA A;  4V1A v;  1O3X A;  3RH3 A;  4UF0 B;  4DUY T;  3C98 B;  2V7K A;  1QUU A;  4QXC B;  3C4X A;  5EK3 A;  4P1N A;  4DBR A;  2Y8D A;  5JR9 B;  3UU4 A;  3ZYM A;  5HXS A;  5AQU B;  5DQV A;  2PFV A;  1NEK A;  3LFM A;  1FIO A;  4JLE A;  3ETV A;  5HXH A;  2VWA A;  2L8K A;  3GMI A;  4EED A;  3IEE A;  2WZI A;  3ONJ A;  4JEH B;  4A5X A;  4PJL A;  4EB6 E;  3HKC E;  3ZYK A;  2LSI A;  2WY2 A;  2UUA T;  3RGL A;  3T1H T;  1N36 T;  1OED A;  4TN7 B;  5DAB A;  2JQ9 A;  4ZEY A;  5L3D B;  4UXN B;  1CUN A;  2A3D A;  1UCU A;  4HE8 A;  3AVS A;  2XQ5 A;  3OTO T;  3OYZ A;  3V5S A;  4LF7 T;  2PG8 A;  2YU1 A;  4UV9 B;  3F31 A;  4ZS2 A;  2QRX A;  4A56 A;  3DJB A;  2V6Y B;  5TAO A;  2UXB T;  2JQH A;  4O4H E;  1OED B;  4HFE A;  3UQ4 A;  3KBT A;  3ZN0 B;  5AQR B;  3ANW A;  4GIW A;  4CN6 A;  4CXY A;  3AAE B;  1UUS A;  4CN4 A;  3CX6 B;  3JAF A;  2C5J A;  3NVO A;  4PJM A;  1XDP A;  5J1G A;  2X0L B;  4YXD A;  2CWO A;  4F6R C;  2WBL A;  3AA6 B;  4IT4 A;  2NW9 A;  1ZV4 X;  2XQ6 A;  3E22 E;  2V8S V;  2YIN A;  4YSY A;  4EEB A;  3ANW B;  3TLV A;  2BZB A;  2XQ3 A;  2FBW A;  3FXD B;  5C8Y E;  4DR2 T;  3UU5 A;  2A72 A;  4LF6 T;  5AQJ B;  4X65 T;  5HEH A;  1WYB A;  3LSV A;  3Q5D A;  5FL1 A;  3P7I A;  5ABF B;  5HEG A;  2K5B B;  4DMW A;  5E0O A;  2MPK A;  3PE0 A;  2JIW A;  3NWI A;  2I6H A;  2LEH A;  3WI3 A;  5LYJ E;  3CWZ B;  1B7T A;  3ONX A;  4X20 E;  2HN2 A;  3VHL A;  4MAL A;  3LJC A;  4G63 A;  3P8C D;  2NW7 A;  2LJL A;  5DJQ C;  3MA9 A;  3LK4 2;  3CML A;  4WBN E;  5EK2 A;  5LGT B;  2XQ9 A;  4CZZ B;  2YOE A;  1J5E T;  4GOU A;  4OHF A;  2KMF A;  5AQN B;  1YXR A;  4YTN A;  1KF6 A;  3ZC0 A;  1XNQ T;  4HFC A;  1U4Q A;  4DV4 T;  5L3C B;  1N34 T;  2Q9Q A;  2LSJ A;  2WMN A;  2IML A;  2W66 A;  2X9W A;  3Q5W A;  3ZJ2 A;  1ZHC A;  2XJ7 A;  3P4W A;  4IE7 A;  4O2A E;  5CGM A;  2I59 A;  2LM9 A;  3RI5 A;  2BKO A;  1J1J A;  5JDH A;  1IBM T;  4F8H A;  3HI2 A;  3RQW A;  4OFZ A;  1W09 A;  4Z91 A;  4IHJ E;  2Q9Q B;  3PJA A;  1MMG A;  5AFU L;  4I55 E;  4AQF C;  3O1J A;  1Y64 B;  3C4Z A;  1US7 B;  4ADZ A;  1UX5 A;  4ZZB A;  4P0B A;  2XAF B;  4BJN A;  4KX6 A;  4DV5 T;  3EHZ A;  3EVY A;  4YJ2 E;  4TNV A;  4NXN T;  1W9R A;  4UVA B;  2H3R A;  2DWK A;  4PK5 A;  1FMW A;  2XHE B;  4N78 D;  5KX5 E;  2BG9 B;  2VKD A;  2LSG A;  3WAJ A;  3GN5 A;  1VRB A;  5JR9 C;  1J5W A;  3D0T A;  4PK6 A;  4GKJ T;  3RF1 A;  1KNR A;  4XAX B;  4CI1 B;  1NWM X;  1WFD A;  3PUA A;  3UFG A;  3LK2 B;  2VVS A;  3JAE A;  4IGU A;  3PJA J;  2A9U A;  4YT0 A;  3PUX F;  5AQQ B;  4H9R C;  1N33 T;  3HA4 A;  1G8X A;  1WR6 A;  4HN9 A;  3GN5 B;  2RPA A;  1HS7 A;  2V7M A;  4X64 T;  1M7K A;  3PUY F;  3QB5 K;  2C5I T;  4TX5 A;  5IYZ E;  3UQ7 A;  4I43 B;  5L3B B;  4JI1 T;  1JNR A;  3PUQ A;  2ZM6 T;  4OYK A;  3K8P C;  4X66 T;  2ZLY A;  3UUN A;  5ABE A;  4EYU A;  4HFH A;  4ASK A;  2N1G A;  4JV5 T;  4B6X A;  4U74 A;  4U2Y A;  1OED C;  3ZKR A;  4DV6 T;  4JEU B;  3CKD A;  1D1A A;  4LMK A;  1XMQ T;  5KDM C;  2CBJ A;  4EZH A;  3FZK B;  5LGN B;  2CM0 A;  4AIS A;  3RYI E;  3NZQ A;  4UV8 B;  5BMV E;  2E5L T;  1Y01 A;  3ETU A;  4JI5 T;  2WAU A;  1XNR T;  4IE4 A;  4WZX A;  3RYH E;  2JQQ A;  2B1E A;  3GA8 A;  1LKX A;  2BS4 A;  2XQ4 A;  2WWV A;  2XUE A;  2OLT A;  2V6X A;  3FHN A;  4LFB T;  3EAB A;  4TNW A;  3P4P A;  4LF8 T;  2KND A;  3N9Q A;  3CX7 B;  3AAI A;  2UUB T;  2CHO A;  4A97 A;  2VVN A;  3PUG A;  2Y48 B;  2NOX A;  3A7M A;  3AE7 A;  2V26 A;  4U3C A;  4AKI A;  1LVF A;  2AE9 A;  2MYS A;  5FMN A;  2WM9 A;  3VKG A;  4KP3 C;  4KUM B;  3A5X A;  2I0M A;  2K9A A;  4UR9 A;  4KMC A;  2KSR A;  3AE6 A;  2J4G A;  2D0U A;  1ZEE A;  2GK9 A;  2IHR 1;  3KBU A;  3L39 A;  2CMR A;  1T98 A;  2NTX A;  4NXM T;  4MHC A;  1BR4 A;  4TWD A;  2CE7 A;  3L3P A;  1E7P A;  4Z90 A;  2OV9 A;  4ZI2 D;  1LRZ A;  2LSK A;  5AQF B;  5AQG B;  2BBH A;  3N9P A;  1W0B A;  1BR1 A;  4AQF A;  2KT9 A;  1MIY A;  2FJD A;  4U31 A;  2H7O A;  5CB4 E;  4GK0 E;  4UVC B;  4H9S E;  5LCY A;  3PDY A;  1MND A;  2NTY A;  4K0U A;  2G0U A;  4JUY A;  2WSS V;  4BJM A;  4UF0 A;  5EK4 A;  4BAY B;  1X79 A;  3ZST A;  4JI6 T;  3RRW A;  4IST A;  2YN6 A;  4OK0 A;  5J2U E;  3AE8 A;  2DWG A;  2Q9Q C;  3HL6 A;  5JR9 A;  4YSZ A;  2JMH A;  3ZT7 A;  3Q2M A;  3RLF F;  1W0A A;  4ANJ A;  3C4W A;  2XSB A;  2LOS A;  5JDM A;  4QHO A;  2X9X A;  2M6B A;  2X9H A;  2VAS A;  1VOM A;  3VR8 A;  3JCF A;  3ZSS A;  4AQY T;  3AVR A;  4JBW F;  5HEO A;  2XY8 B;  2K3W A;  1S35 A;  1T72 A;  4OYJ A;  2BG9 C;  4O4J E;  4AXP A;  1E1H B;  3I0Q A;  2JPF A;  4ZHQ E;  3FZF B;  5CFB A;  3PV0 F;  3M65 A;  1HNX T;  2IDO B;  2PTF A;  5FXX A;  3PTR B;  4UEL A;  1JNZ A;  3OYX A;  2CLY B;  4M1P A;  3E0Z A;  3QK6 A;  2BVM A;  3KV9 A;  2BG9 E;  5JRC A;  2YDQ A;  2V6Y A;  2VB6 A;  4B3R T;  4KHZ F;  2ZM0 A;  4PJJ A;  4H63 H;  2UXX B;  2FJB A;  5LOV E;  2DHR A;  2RP4 A;  2H7V C;  4AI6 A;  2ZMA A;  2RA1 A;  2BDE A;  3CQX C;  5AQP B;  2V5C A;  4QXH B;  4HTE A;  1HFA A;  2UUC T;  3N9L A;  5JRC B;  3N2K E;  1OXZ A;  3EDV A;  4X1Y E;  1NAF A;  3Q5E A;  4G2A A;  2MBG A;  1EZ3 A;  3PU3 A;  2NW8 A;  3UTK A;  2BS3 A;  4I0U A;  2JMK A;  5FXV A;  5H6R B;  2K48 A;  3ZCI A;  3KV4 A;  1YQ3 A;  3JAD A;  4J2C A;  3EUH A;  2XPK A;  1YW0 A;  5LMU T;  1UGO A;  1IJ5 A;  3AE3 A;  5DQW A;  5ADX L;  4QKN A;  2X9Y A;  2C0S A;  4AKG A;  4EOZ B;  5FKY A;  2D0T A;  5LNK A;  5ABF A;  4P09 A;  3R6N A;  3RKO A;  4COF A;  5L3E B;  3BQI A;  2WDR A;  3EDU A;  5F3J A;  5L2L A;  3PUR A;  4GYS A;  4TZ4 C;  1LVK A;  1X9B A;  5JH7 E;  4H9P C;  3N9M A;  2WDV A;  2J47 A;  2E2A A;  4B3S T;  4U33 A;  2BKN A;  1IJ6 A;  2DCF A;  4HGA A;  4ZXL A;  3FBZ A;  5FP3 A;  2HPL A;  2XZE A;  3P4R A;  4HFV A;  2BKP A;  3B57 A;  3N5L A;  3TKL B;  4FI5 A;  2H89 A;  2X0H A;  3KFW X;  1YD8 G;  4ZI3 D;  2XQA A;  1E2A A;  2W63 A;  5HEJ A;  1IBL T;  4X1K E;  5LHG B;  4MLK A;  3AE9 A;  2DI4 A;  3T1Y T;  2EHO B;  3N9N A;  2JJ9 A;  4CQI A;  5JDF A;  3QNU A;  4IDP A;  4CXW A;  2IW5 B;  2FJA A;  4Q25 A;  4H63 V;  2LKH A;  5LMN T;  1XDO A;  2X0Y A;  3S4U A;  2LRL A;  3N2G E;  1UK5 A;  3FB2 A;  1GQE A;  5FYM A;  2WWU A;  5LHI B;  2VK9 A;  4NUU A;  5AQM B;  3MZK B;  2HHH T;  3ONL C;  4HWD A;  4WW0 A;  5HCJ A;  5HWY A;  5F8P A;  4ZZC A;  3ESL A;  5FL0 A;  3N2O A;  4DV0 T; 
#chains in the Genus database with same CATH homology
 3ZSS A;  2JQ9 A;  2JQH A;  5CJ5 A;  4U7I A;  4ZEY A;  4WZX A;  4NIQ A;  4U33 A;  4P1N A;  2CPT A;  2K3W A;  3ZT7 A;  2CRB A;  2RPA A;  2W2U A;  4IT4 A;  4U2Z A;  5CGM A;  1YXR A;  4U7Y A;  1WR0 A;  4A5X A;  4CN1 A;  2JQK A;  1WCR A;  2LRK A;  3ZST A;  4CN6 A;  3ZT5 A;  4U31 A;  1WFD A;  5LB7 B;  3K1S A;  2WY2 A;  2WWV A;  3ZT6 A;  4U2Y A;  2DL1 A;  4U3C A;  2V6X A;  2V6Y A;  2MPK A;  5FVL A;  5FVK A;  2XZE A;  4CN4 A;  3EAB A;  2A9U A;  2LRL A;  2V6Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...