2W2UA

Structural insight into the interaction between archaeal escrt-iii and aaa-atpase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
75
structure length
75
Chain Sequence
MSAQVMLEEMARKYAINAVKADKEGNAEEAITNYKKAIEVLAQLVSLYRDGSTAAIYEQMINEYKRRIEVLKELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Role for the Escrt System in Cell Division in Archaea.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase/transport
molecule keywords HYPOTHETICAL P60 KATANIN
total genus 29
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2w2uA00
2XZEA 4CN4A 5CJ5A 4WZXA 1WR0A 4U33A 5FVLA 5CGMA 1YXRA 3ZT6A 2CRBA 4IT4A 4CN6A 2CPTA 2JQKA 2LRKA 2MPKA 4NIQA 3ZT7A 2W2UA 4P1NA 1WCRA 5LB7B 2WWVA 3ZSTA 2K3WA 4U3CA 2WY2A 2LRLA 2JQHA 3K1SA 2RPAA 4U31A 5FVKA 2DL1A 2V6XA 2V6YB 3ZSSA 4ZEYA 2JQ9A 3EABA 4U2ZA 4CN1A 2V6YA 4U7IA 3ZT5A 1WFDA 4A5XA 2A9UA 4U2YA 4U7YA
chains in the Genus database with same CATH superfamily
2FJDA 5A1LA 5LOVE 3IBPA 4UF0A 4E7SA 2LEHA 3T1HT 3GN5A 3TLVA 2H89A 3GMIA 3J7Yq 4KI0F 4H63V 5IHYA 2YN6A 1OEDA 4HFVA 4A56A 2XQ8A 4IGUA 4CN6A 4DV2T 3MKDA 5JTGA 1N33T 4JI5T 2W2UA 2WAUA 3AAEB 2CHNA 1KNZA 2UXCT 2E9XD 2JPFA 2XAJB 3UUXB 4DR2T 3EDUA 1E7PA 4ILBA 4TV8E 5HWXA 1I94T 2XM2A 5M4YA 4JI7T 2BBJA 2LKGA 3OBVE 4JEHB 5LNKA 1XNRT 4QX7B 1QUUA 4ZI7E 2E9XA 3QUJA 5J1GA 2XUEA 3AA1B 2VKDA 2KINB 4IE5A 5AQLB 3KV5A 5AQRB 5AQOB 4BJNA 5DQWA 5HEHA 4LF6T 2V6YA 4TWDA 1YKHB 1FMVA 2VL8A 3JCFA 4ZI3D 3D0TA 5L2LA 1E2AA 2J4GA 5L47A 4QH1A 2KT9A 3AVRA 2XZEA 4UF0B 3HA4A 2N1GA 3N9MA 3PUWF 4EEDA 2K9AA 4ZZBA 1OWAA 5HEUA 3HKDE 3I1AA 2Q9QC 3L8RA 4AI6A 2DHRA 4YHHT 5DQVA 3AA0B 4OK0A 3O9XA 5AQQB 3NRYA 2BG9E 3PJAA 1MIYA 3AE5A 5IUXA 2X0HA 2BKOA 2WDQA 1Y01A 4MHCA 2ZM0A 3KBUA 5LCYA 3CIRA 1HTJF 3UQ7A 5HEOA 3RRWA 4B3ST 2ZMAA 2BS4A 4U3CA 3RC8A 3K3OA 4PK4A 1YQ3A 3NKZA 2XAGB 2YINA 4JI4T 4GKJT 2VURA 2V6YB 2PJQA 3KV4A 4DV1T 4DV4T 2XAQB 3RYCE 3V5SA 5F3JA 5HXSA 3OTOT 5AQNB 3F2EA 2UXBT 2RA1A 4A97A 4CXYA 3ONLC 2VVNA 5IYZE 3RIUA 2UXNB 1BR4A 2XY8B 1D1BA 1FIOA 3DTOA 2KMFA 3JAFA 3JAEA 3U3IA 1WR6A 2B1EA 1HNWT 5AQVB 5LMUT 1NENA 2BVMA 3M65A 2X0YA 4UVAB 3AECA 3HKEE 2KLQA 3LJCA 1KNRA 2CRBA 2V7JA 3NRXA 5AQKB 5ABFA 3RGLA 5FL1A 4LFCT 4ASKA 4EYYR 4EAHA 4WYVA 3ZT7A 3PJAJ 2M6IA 2V7MA 4P0BA 4LF8T 5AQTB 2DWGA 2WWVA 1LVFA 2X9XA 4L0RA 1VOMA 3W15B 2UUAT 2QYWA 3AXJB 3C51A 4U74A 5ABEA 2BKNA 4UV9B 2NW9A 4QHOA 2X51A 3SFDA 3EHZA 3RKGA 3UTKA 2E9XC 4WBNE 3VR8A 1NEKA 2E9XB 3AA7B 2LLYA 2VQET 4PAGA 2KWHA 4PFPA 3Q2MA 3ZMVB 3RH3A 2PBIA 2F4VT 2CWOA 2LM9A 3OPCA 1S35A 2X0LB 2H7VC 2RP4A 4EEBA 2CBIA 2JMHA 4TNVA 4DO0A 3RPUA 3ZJ2A 2MAWA 1Z8UA 3LSVA 3OYZA 4B3MT 1L0VA 4C90A 1W0AA 5AQGB 4DR3T 2IIUA 3LFMA 4NPPA 3ZYLA 5LGUB 4AKRB 4UR9A 4JI1T 2B76A 5AFUL 1BR1A 3AE6A 4TWFA 5LGNB 4HE8A 3TLTA 5F8PA 5LHIB 2CHOA 4H9SE 5L3EB 4TZ4C 3IA3A 3SWHA 4DV0T 5HXEA 2CMRA 2XQYA 3K1SA 2VQFT 5L3BB 4I55E 3QC9A 2UUBT 4NXNT 3BQKA 3V5UA 2V5DA 3RIFA 5JR9B 3UFEA 2N9DA 1UX4A 1XWMA 1OEDE 1HNXT 5EK2A 1MNDA 4IDPA 3PUAA 3Q5XA 4O4JE 4X1KE 2QA7A 2D2SA 3EI0A 3EVYA 2CLYC 4IDQA 2VK9A 4U33A 4I50E 4U72A 5AQHB 4DUYT 2K48A 2JJ9A 2WDVA 2YK0A 3I9WA 2DCFA 2A72A 3AAIA 2IC6A 3K3QC 4LMJA 3RYIE 2CLYB 1HCIA 3HKBE 4DBRA 5IWAT 5LMNT 3KINB 1U5PA 3ZMSB 2KNDA 1T7SA 1D0XA 4XBFB 1D1AA 5ETWA 3ZSTA 4PNIA 3A8YC 3E08A 1VRBA 5AQSB 4OHFA 2PG8A 3N9LA 5FY1A 4DV3T 4AQGA 2OV9A 3CMLA 5JQGE 4JLEA 2X68A 2FJBA 1YD8G 2VKHA 3CX8B 4IE0A 3N2GE 4QWNB 4N78D 4GK0E 3ZN0B 3SS1A 1IJ6A 1FMWA 4UELA 1BR0A 4ILUA 4JBWF 3QNUA 4AQFA 2IUBA 4DNDA 2BG9A 4EYUA 1XNQT 4HWDA 3X1DA 5C3JA 2H88A 2WS3A 3ZJ1A 4LF7T 5LJMA 1HX8A 4HFBA 2K24A 2XSAA 2M67A 3FZHB 2WZHA 2LKHA 1CUNA 1W9RA 2FUPA 3AEAA 4ZS2A 5L4HA 4ADZA 5HEJA 4Z91A 5DABA 2WP9A 4EB6E 5C2TA 3VRAA 3GA8A 4P1NA 4GYSA 3VKHA 3LK2B 4CXXA 1T8BA 5AQMB 2E5LT 1OEDB 4Z90A 4ZXLA 1KK7A 1SE7A 3OKQA 3C4WA 1VCSA 5AQUB 3UQ4A 2E2AA 3LG7A 4G2AA 2EHOA 5KMGP 3KFWX 5EZYE 1ZV4X 4YJ2E 5LXTE 1IBKT 5FXZA 1N32T 4KP3C 5FNVE 3AE7A 3RI5A 3AAAB 2Y6XA 5LHGB 3TLUA 3FZLB 4U7IA 2BG9C 4I43B 3PUVF 4A5XA 2X66A 1D1CA 1EZ3A 2L3LA 2XHEB 4H9RC 4IE6A 4PJJA 3AXJA 4MFRA 1UGOA 2D0TA 2H3RA 4IHJE 4EZ4A 3N2OA 1HR0T 3P4PA 4I0UA 4QKNA 4LFBT 2J47A 2VKJA 3K8PC 2A2FX 4UEMA 1IZNB 4ZEYA 3FXEB 2V1DB 2CCQA 3FZMB 1WYCA 3C50A 1IAPA 3JC6D 3NVOA 3ZYKA 5LHHB 2NW7A 4XZCA 1DU2A 2LT3A 2Q9QD 4O2AE 4EZHA 2KSRA 2XPKA 4HGAA 4L5GA 2P9BA 4HFEA 5JDFA 4FJOA 3I9YA 1W09A 3LDQB 4MLKA 2CWYA 2LOSA 2J1DG 2CA5A 4TX5A 5FVKA 5FXVA 5JR9A 2CE7A 3UU4A 5L4EA 4UVCB 4HEAA 2XQAA 3A5XA 1QSDA 5LBQB 2BS2A 2WMNA 3P7IA 4KX6A 1WFDA 3RQWA 3OYXA 3Q5WA 2M6BA 5CFBA 4JV5T 2IDOB 4A98A 2YDRA 4HTEA 4YSXA 4X20E 4IIJE 4TN7B 3JADA 5HWYA 4TNWA 4PJMA 3AB3B 3ABVA 5FVLA 4EIWA 3TKLB 5CGMA 4YJ3E 3RKOA 1YW0A 3ZKRA 4X62T 4BA9A 1XMOT 2K5BB 5FMNA 1XMQT 3PE0A 4JI6T 3OVUA 2JQKA 4QXHB 4QX8B 5HEGA 3O1IA 2C5IT 4PW8A 4X5TA 3N2KE 4LF4T 3P4SA 3CX6B 3RIUC 1FEWA 2BS3A 3ONXA 4P09A 1M7KA 5FYMA 5ABHA 5BR8T 4DR6T 2EHOC 2SPCA 2CM0A 3EUHA 5JR9C 5HYAA 3O1JA 1SA0E 1M62A 2VKOA 2V6XA 4ZOLE 4DR5T 3JC6C 1NWMX 3PUYF 2LHRA 4UV8B 4V1Av 5TAOA 4EOZB 5JREA 3AA6B 3UU6A 4P0AA 3ZT5A 5C8YE 3MACA 4LMLA 4AXPA 1AJ3A 4IL9A 2D0UA 1D0ZA 1S94A 4L9IA 5HXCA 4CN4A 2LM2A 1UK5A 4PK5A 4YSYA 5FXXA 4EXTA 4NUVA 3L3PA 3PUQA 3UULA 2UUCT 5HXHA 2HN2A 2W67A 4UVBB 1ZHCA 2QRXA 5JH7E 3ONJA 4NUUA 4DBQA 3LK42 3CX7B 3TLSA 2IMLA 2XTLA 3L39A 2FBWA 3OJAA 4X65T 2LSJA 4LMKA 5LB7B 3C64A 4PJNA 3QK6A 3RLFF 3UUBA 4E7ZA 2WM9A 1UURA 4YLHA 4ANJA 5JRCA 2YDSA 4H9OC 3ZMUB 4M1PA 4U31A 3ZSSA 2DL1A 2OA5A 5HCJA 2XQ5A 2HHHT 1E1HB 2HPJA 1WRDA 3WAJA 4JYAT 5FY7A 1MIVA 3LBXA 4CI3B 4EV6A 1W0BA 4DV7T 3ZPOA 2HN1A 3PUZF 3QB5A 2OLTA 3AE3A 4HWHA 3P4QA 2ZLYA 3WAKA 2WSSV 4K0KT 2VB6A 4DMWA 3R84B 2XQ6A 1SUMB 1B7TA 4QH4A 5EK4A 2V7LA 3QB5K 1T98A 4HKAA 3KVAA 1HG5A 3LK3B 2LE8A 3MJXA 4H9PC 4H9NC 4DV6T 4H63H 1HNZT 3PDYA 2CPTA 2MPKA 2LRKA 3AE2A 3AEBA 3BK9A 2HH7A 3M3ZB 1CHUA 2G0UA 2NTYA 4HWFA 3WI3A 4AQFC 3ZMZB 2XQ3A 4O4LE 3R6NA 3AEGA 4AISA 3SOLA 2IC9A 2H7OA 2NOXA 3DP7A 3ZC1A 2D9DA 1KEYA 4B6XA 1J5ET 2DNXA 3H3AA 4MALA 2XAFB 3FHNA 1HG2A 3GWHA 2D5UA 3PTRB 3CVRA 5LBMA 2XAHB 3UFGA 4ZI2C 5ADXL 2WBLA 5FP3A 3PV0F 2CXLA 3BQLA 3F57A 3NZPA 1LKXA 2PTFA 4K0UA 5H6RB 5LA6E 2L8KA 3VU7H 3ZEFB 2XQ7A 5ABFB 4B3TT 1MNEA 2I0MA 4WZXA 4KHPT 4GIWA 5GONE 3ZC0A 1LRZA 4HN9A 1Y64B 2CXFA 1KNPA 3E0ZA 4DR7T 1OEDC 1UUSA 5JDNA 2MTQA 2KZ7B 5FL0A 4PFOA 5HXRA 4TV9E 2I59A 4JI3T 4QH5A 4ZI3C 4PJLA 2Q9QB 4X1IE 4OYJA 3HR0A 1KF6A 3CQGB 4GK5E 3ESLA 1MMGA 3AEDA 3AVSA 1D0YA 2NW8A 3FB2A 4AQYT 4JI8T 2A3DA 3MA9A 2R6GF 3EAMA 4IDNA 4CI1B 5JRCB 4YY3T 3K3NA 1XDPA 5JDGA 2LRLA 4GYRA 2Q9QA 3IHRA 3T8OA 4UIGA 4U2ZA 4CQIA 4IL4A 1FJGT 1WYBA 3VHLA 4X66T 4DR4T 1I6ZA 2YU1A 2EHOB 3UUMA 2JMKA 3PU8A 2WDRA 3FZFB 1H7CA 4WW0A 1HF8A 2LSYA 2PFVA 1IJ5A 3EDVA 5HCMA 3RHWA 3IEEA 5J2UE 4DUZT 4QXBB 4ZZCA 4WBOA 5LP6E 3DJBA 2QGSA 3UU5A 3PUSA 3ETUA 1MIWA 3ZN1B 2KWIB 1YXRA 3KVBA 3N5LA 4HWIB 2IAKA 2X9HA 4KMCA 3UU8A 3ZT6A 4DR1T 4LF9T 2ZM8A 3N9OA 2V7IA 2VWAA 1JNZA 4O2BE 2BBHA 3S4UA 1JNRA 2FJEA 3KV9A 4HFCA 2V8SV 5J0ZA 5L3GB 4DV5T 4AKGA 3O1HA 5AQPB 3MZKB 4IDZA 5ABGA 3SFEA 4TUYE 2BDEA 4HFIA 4YT0A 1YQ4A 2XQ4A 2V7KA 3B13A 1IBMT 1XDOA 3U78A 2Y8DA 2WU2A 3HL6A 2NTXA 4UXNB 2IW5B 1T72A 3C98B 3C4ZA 4JUYA 1NAFA 3ETVA 3NWIA 1N36T 3PU3A 5L3CB 4LF5T 4AKHA 5LG3A 2LOPA 4YTNA 3CK6A 4ZHQE 2YKSA 2AE9A 2N2NA 4F6RC 2FJAA 2JIWA 3RX6A 4CZZB 4YTPA 4FI5A 5CJ5A 1XZYA 2ZM6T 4Q25A 4DMVA 2HPLA 2ACZA 3H3MA 4PK6A 3FXDB 3N9QA 3HI2A 3RYHE 5AQFB 3LBXB 3AE1A 1QLBA 3H37A 1J1JA 2BVLA 2DWKA 4ILAA 3I0QA 3AEFA 2XJ7A 1WLXA 4GKKT 2CBJA 1HS7A 2ODUA 5JDLA 2E8IA 2X9WA 2Y48B 3B57A 2XQ9A 4C91A 3RYFE 3F31A 2JQHA 5KDMC 2RPAA 2NP9A 2MYSA 2IHR1 2LSIA 2WWUA 3FBZA 4IE7A 4IDOA 3GN5B 2L9QA 3P4RA 4TWHA 2W4XA 2WMOA 3RF1A 3NZQA 3UT5E 2WU5A 2MBGA 4ISSA 4HWCA 4AKIA 3ZMTB 5JVDE 2XM1A 3UU3A 1SHZC 4YTMA 1KFYA 1Z0PA 4OX9T 4KUMB 2JQQA 4WNKA 5DJQC 5L3FB 3E22E 4O4HE 4OFZA 5L3DB 3N9NA 4F8HA 4KHZF 3O4XE 2I6HA 2W00A 4ZI2D 3AE9A 2VASA 3CQCB 3RC3A 1G73A 1LVKA 2ACXA 2BZBA 1WCRA 2WQYA 1G8XA 4HFHA 2CXDA 4BAYB 1R8IA 3CKDA 2MOZA 3ZCIA 4Z8XA 5J2TE 4AKLA 4OYKA 2J62A 2W0GA 2WY2A 5H6QB 1ZP0A 2DLRA 3N9PA 5KX5E 1ZOYA 3ANWB 3NBXX 4IREA 1U4QA 2X67A 3Q5DA 3VR9A 3EABA 4YXDA 2W62A 1VCTA 2E5VA 2C5JA 3MK7C 3J9X1 1MMDA 2A9UA 3ZCJA 3SRZA 4U2YA 3Q9DA 4U7YA 2V26A 4ISTA 4ZS3A 2VL0A 4JI2T 1YKEB 2BKPA 5LJNA 3AE4A 1UX5A 5KXJA 5JDHA 4O4IE 2V5CA 3FBLA 2WB5A 2NR4A 4HFDA 4ILCA 2C5KT 3P8CD 3CWZB 4CXWA 1OXZA 4YSZA 1US7B 3P4WA 1J5WA 4AIUA 5LG4A 4XAXB 1HX1B 2CEAA 3RRCA 3P50A 4IT4A 4NXMT 4CI2B 4X64T 1BR2A 3KDSE 4NIQA 4I4TE 3Q5EA 3A7MA 3CPZA 4JEUB 4EGWA 2LHNA 4O8SA 5CA1E 2EHOD 2Z6EA 2W63A 3CQXC 2YOEA 1ZKEA 2AXDS 4J2CA 2K3WA 3PUGA 4MBQA 5FY0A 4ERRA 5BMVE 4GOUA 2VVSA 5CB4E 2YU2A 3HKCE 2LSGA 2W61A 4COFA 2WZIA 3G06A 3KBTA 3UUNA 3VRBA 4DIDB 2YDQA 5JDMA 3RQUA 4G63A 2QVAA 3MXZA 3BQIA 4B3RT 2DI4A 2XASB 5EK3A 5FKYA 3RIAA 2ZM2A 1MMAA 3KV6A 4X1YE 1O3XA 2YEVC 1MMNA 3AE8A 5LYJE 4QXCB 2LSKA 2C0SA 1WR0A 1HFAA 2NWBA 1GQEA 1ZEEA 3FZKB 5F5WA 3TLWA 3ZYMA 1N34T 3PURA 1X79A 2UXDT 3IF8B 1UCUA 2WCAA 4LFAT 2ES0A 2KXPB 4H9QC 2JRKA 2LJLA 2W66A 5HAXA 3I0OA 3T1YT 3L09A 1X9BA 2XSBA 4KBMB 4BJMA 5JDQA 3QOFA 5AQIB 5AQJB 1IBLT 2ODVA 2GK9A 3B5MA 3ZLIA 1V9DA 2BG9B 3AEEA 5FXWA 4YHJA 5E0OA 3ANWA 4YFSA 2JQ9A 4CN1A 4DVDA 2X9YA 5CA0E 5LGTB 2UU9T 4IE4A 2UXXB 3VKGA 3PUXF 3C4XA 4JI0T
chains in the Genus database with same CATH topology
2XZEA 4CN4A 5CJ5A 4WZXA 1WR0A 4U33A 5FVLA 5CGMA 1YXRA 3ZT6A 2CRBA 4IT4A 4CN6A 2CPTA 2JQKA 2LRKA 2MPKA 4NIQA 3ZT7A 2W2UA 4P1NA 1WCRA 5LB7B 2WWVA 3ZSTA 2K3WA 4U3CA 2WY2A 2LRLA 2JQHA 3K1SA 2RPAA 4U31A 5FVKA 2DL1A 2V6XA 2V6YB 3ZSSA 4ZEYA 2JQ9A 3EABA 4U2ZA 4CN1A 2V6YA 4U7IA 3ZT5A 1WFDA 4A5XA 2A9UA 4U2YA 4U7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZE A;  4CN4 A;  5CJ5 A;  4WZX A;  1WR0 A;  4U33 A;  5FVL A;  5CGM A;  1YXR A;  3ZT6 A;  2CRB A;  4IT4 A;  4CN6 A;  2CPT A;  2JQK A;  2LRK A;  2MPK A;  4NIQ A;  3ZT7 A;  2W2U A;  4P1N A;  1WCR A;  5LB7 B;  2WWV A;  3ZST A;  2K3W A;  4U3C A;  2WY2 A;  2LRL A;  2JQH A;  3K1S A;  2RPA A;  4U31 A;  5FVK A;  2DL1 A;  2V6X A;  2V6Y B;  3ZSS A;  4ZEY A;  2JQ9 A;  3EAB A;  4U2Z A;  4CN1 A;  2V6Y A;  4U7I A;  3ZT5 A;  1WFD A;  4A5X A;  2A9U A;  4U2Y A;  4U7Y A; 
#chains in the Genus database with same CATH topology
 2FJD A;  5A1L A;  5LOV E;  3IBP A;  4UF0 A;  4E7S A;  2LEH A;  3T1H T;  3GN5 A;  3TLV A;  2H89 A;  3GMI A;  3J7Y q;  4KI0 F;  4H63 V;  5IHY A;  2YN6 A;  1OED A;  4HFV A;  4A56 A;  2XQ8 A;  4IGU A;  4CN6 A;  4DV2 T;  3MKD A;  5JTG A;  1N33 T;  4JI5 T;  2W2U A;  2WAU A;  3AAE B;  2CHN A;  1KNZ A;  2UXC T;  2E9X D;  2JPF A;  2XAJ B;  3UUX B;  4DR2 T;  3EDU A;  1E7P A;  4ILB A;  4TV8 E;  5HWX A;  1I94 T;  2XM2 A;  5M4Y A;  4JI7 T;  2BBJ A;  2LKG A;  3OBV E;  4JEH B;  5LNK A;  1XNR T;  4QX7 B;  1QUU A;  4ZI7 E;  2E9X A;  3QUJ A;  5J1G A;  2XUE A;  3AA1 B;  2VKD A;  2KIN B;  4IE5 A;  5AQL B;  3KV5 A;  5AQR B;  5AQO B;  4BJN A;  5DQW A;  5HEH A;  4LF6 T;  2V6Y A;  4TWD A;  1YKH B;  1FMV A;  2VL8 A;  3JCF A;  4ZI3 D;  3D0T A;  5L2L A;  1E2A A;  2J4G A;  5L47 A;  4QH1 A;  2KT9 A;  3AVR A;  2XZE A;  4UF0 B;  3HA4 A;  2N1G A;  3N9M A;  3PUW F;  4EED A;  2K9A A;  4ZZB A;  1OWA A;  5HEU A;  3HKD E;  3I1A A;  2Q9Q C;  3L8R A;  4AI6 A;  2DHR A;  4YHH T;  5DQV A;  3AA0 B;  4OK0 A;  3O9X A;  5AQQ B;  3NRY A;  2BG9 E;  3PJA A;  1MIY A;  3AE5 A;  5IUX A;  2X0H A;  2BKO A;  2WDQ A;  1Y01 A;  4MHC A;  2ZM0 A;  3KBU A;  5LCY A;  3CIR A;  1HTJ F;  3UQ7 A;  5HEO A;  3RRW A;  4B3S T;  2ZMA A;  2BS4 A;  4U3C A;  3RC8 A;  3K3O A;  4PK4 A;  1YQ3 A;  3NKZ A;  2XAG B;  2YIN A;  4JI4 T;  4GKJ T;  2VUR A;  2V6Y B;  2PJQ A;  3KV4 A;  4DV1 T;  4DV4 T;  2XAQ B;  3RYC E;  3V5S A;  5F3J A;  5HXS A;  3OTO T;  5AQN B;  3F2E A;  2UXB T;  2RA1 A;  4A97 A;  4CXY A;  3ONL C;  2VVN A;  5IYZ E;  3RIU A;  2UXN B;  1BR4 A;  2XY8 B;  1D1B A;  1FIO A;  3DTO A;  2KMF A;  3JAF A;  3JAE A;  3U3I A;  1WR6 A;  2B1E A;  1HNW T;  5AQV B;  5LMU T;  1NEN A;  2BVM A;  3M65 A;  2X0Y A;  4UVA B;  3AEC A;  3HKE E;  2KLQ A;  3LJC A;  1KNR A;  2CRB A;  2V7J A;  3NRX A;  5AQK B;  5ABF A;  3RGL A;  5FL1 A;  4LFC T;  4ASK A;  4EYY R;  4EAH A;  4WYV A;  3ZT7 A;  3PJA J;  2M6I A;  2V7M A;  4P0B A;  4LF8 T;  5AQT B;  2DWG A;  2WWV A;  1LVF A;  2X9X A;  4L0R A;  1VOM A;  3W15 B;  2UUA T;  2QYW A;  3AXJ B;  3C51 A;  4U74 A;  5ABE A;  2BKN A;  4UV9 B;  2NW9 A;  4QHO A;  2X51 A;  3SFD A;  3EHZ A;  3RKG A;  3UTK A;  2E9X C;  4WBN E;  3VR8 A;  1NEK A;  2E9X B;  3AA7 B;  2LLY A;  2VQE T;  4PAG A;  2KWH A;  4PFP A;  3Q2M A;  3ZMV B;  3RH3 A;  2PBI A;  2F4V T;  2CWO A;  2LM9 A;  3OPC A;  1S35 A;  2X0L B;  2H7V C;  2RP4 A;  4EEB A;  2CBI A;  2JMH A;  4TNV A;  4DO0 A;  3RPU A;  3ZJ2 A;  2MAW A;  1Z8U A;  3LSV A;  3OYZ A;  4B3M T;  1L0V A;  4C90 A;  1W0A A;  5AQG B;  4DR3 T;  2IIU A;  3LFM A;  4NPP A;  3ZYL A;  5LGU B;  4AKR B;  4UR9 A;  4JI1 T;  2B76 A;  5AFU L;  1BR1 A;  3AE6 A;  4TWF A;  5LGN B;  4HE8 A;  3TLT A;  5F8P A;  5LHI B;  2CHO A;  4H9S E;  5L3E B;  4TZ4 C;  3IA3 A;  3SWH A;  4DV0 T;  5HXE A;  2CMR A;  2XQY A;  3K1S A;  2VQF T;  5L3B B;  4I55 E;  3QC9 A;  2UUB T;  4NXN T;  3BQK A;  3V5U A;  2V5D A;  3RIF A;  5JR9 B;  3UFE A;  2N9D A;  1UX4 A;  1XWM A;  1OED E;  1HNX T;  5EK2 A;  1MND A;  4IDP A;  3PUA A;  3Q5X A;  4O4J E;  4X1K E;  2QA7 A;  2D2S A;  3EI0 A;  3EVY A;  2CLY C;  4IDQ A;  2VK9 A;  4U33 A;  4I50 E;  4U72 A;  5AQH B;  4DUY T;  2K48 A;  2JJ9 A;  2WDV A;  2YK0 A;  3I9W A;  2DCF A;  2A72 A;  3AAI A;  2IC6 A;  3K3Q C;  4LMJ A;  3RYI E;  2CLY B;  1HCI A;  3HKB E;  4DBR A;  5IWA T;  5LMN T;  3KIN B;  1U5P A;  3ZMS B;  2KND A;  1T7S A;  1D0X A;  4XBF B;  1D1A A;  5ETW A;  3ZST A;  4PNI A;  3A8Y C;  3E08 A;  1VRB A;  5AQS B;  4OHF A;  2PG8 A;  3N9L A;  5FY1 A;  4DV3 T;  4AQG A;  2OV9 A;  3CML A;  5JQG E;  4JLE A;  2X68 A;  2FJB A;  1YD8 G;  2VKH A;  3CX8 B;  4IE0 A;  3N2G E;  4QWN B;  4N78 D;  4GK0 E;  3ZN0 B;  3SS1 A;  1IJ6 A;  1FMW A;  4UEL A;  1BR0 A;  4ILU A;  4JBW F;  3QNU A;  4AQF A;  2IUB A;  4DND A;  2BG9 A;  4EYU A;  1XNQ T;  4HWD A;  3X1D A;  5C3J A;  2H88 A;  2WS3 A;  3ZJ1 A;  4LF7 T;  5LJM A;  1HX8 A;  4HFB A;  2K24 A;  2XSA A;  2M67 A;  3FZH B;  2WZH A;  2LKH A;  1CUN A;  1W9R A;  2FUP A;  3AEA A;  4ZS2 A;  5L4H A;  4ADZ A;  5HEJ A;  4Z91 A;  5DAB A;  2WP9 A;  4EB6 E;  5C2T A;  3VRA A;  3GA8 A;  4P1N A;  4GYS A;  3VKH A;  3LK2 B;  4CXX A;  1T8B A;  5AQM B;  2E5L T;  1OED B;  4Z90 A;  4ZXL A;  1KK7 A;  1SE7 A;  3OKQ A;  3C4W A;  1VCS A;  5AQU B;  3UQ4 A;  2E2A A;  3LG7 A;  4G2A A;  2EHO A;  5KMG P;  3KFW X;  5EZY E;  1ZV4 X;  4YJ2 E;  5LXT E;  1IBK T;  5FXZ A;  1N32 T;  4KP3 C;  5FNV E;  3AE7 A;  3RI5 A;  3AAA B;  2Y6X A;  5LHG B;  3TLU A;  3FZL B;  4U7I A;  2BG9 C;  4I43 B;  3PUV F;  4A5X A;  2X66 A;  1D1C A;  1EZ3 A;  2L3L A;  2XHE B;  4H9R C;  4IE6 A;  4PJJ A;  3AXJ A;  4MFR A;  1UGO A;  2D0T A;  2H3R A;  4IHJ E;  4EZ4 A;  3N2O A;  1HR0 T;  3P4P A;  4I0U A;  4QKN A;  4LFB T;  2J47 A;  2VKJ A;  3K8P C;  2A2F X;  4UEM A;  1IZN B;  4ZEY A;  3FXE B;  2V1D B;  2CCQ A;  3FZM B;  1WYC A;  3C50 A;  1IAP A;  3JC6 D;  3NVO A;  3ZYK A;  5LHH B;  2NW7 A;  4XZC A;  1DU2 A;  2LT3 A;  2Q9Q D;  4O2A E;  4EZH A;  2KSR A;  2XPK A;  4HGA A;  4L5G A;  2P9B A;  4HFE A;  5JDF A;  4FJO A;  3I9Y A;  1W09 A;  3LDQ B;  4MLK A;  2CWY A;  2LOS A;  2J1D G;  2CA5 A;  4TX5 A;  5FVK A;  5FXV A;  5JR9 A;  2CE7 A;  3UU4 A;  5L4E A;  4UVC B;  4HEA A;  2XQA A;  3A5X A;  1QSD A;  5LBQ B;  2BS2 A;  2WMN A;  3P7I A;  4KX6 A;  1WFD A;  3RQW A;  3OYX A;  3Q5W A;  2M6B A;  5CFB A;  4JV5 T;  2IDO B;  4A98 A;  2YDR A;  4HTE A;  4YSX A;  4X20 E;  4IIJ E;  4TN7 B;  3JAD A;  5HWY A;  4TNW A;  4PJM A;  3AB3 B;  3ABV A;  5FVL A;  4EIW A;  3TKL B;  5CGM A;  4YJ3 E;  3RKO A;  1YW0 A;  3ZKR A;  4X62 T;  4BA9 A;  1XMO T;  2K5B B;  5FMN A;  1XMQ T;  3PE0 A;  4JI6 T;  3OVU A;  2JQK A;  4QXH B;  4QX8 B;  5HEG A;  3O1I A;  2C5I T;  4PW8 A;  4X5T A;  3N2K E;  4LF4 T;  3P4S A;  3CX6 B;  3RIU C;  1FEW A;  2BS3 A;  3ONX A;  4P09 A;  1M7K A;  5FYM A;  5ABH A;  5BR8 T;  4DR6 T;  2EHO C;  2SPC A;  2CM0 A;  3EUH A;  5JR9 C;  5HYA A;  3O1J A;  1SA0 E;  1M62 A;  2VKO A;  2V6X A;  4ZOL E;  4DR5 T;  3JC6 C;  1NWM X;  3PUY F;  2LHR A;  4UV8 B;  4V1A v;  5TAO A;  4EOZ B;  5JRE A;  3AA6 B;  3UU6 A;  4P0A A;  3ZT5 A;  5C8Y E;  3MAC A;  4LML A;  4AXP A;  1AJ3 A;  4IL9 A;  2D0U A;  1D0Z A;  1S94 A;  4L9I A;  5HXC A;  4CN4 A;  2LM2 A;  1UK5 A;  4PK5 A;  4YSY A;  5FXX A;  4EXT A;  4NUV A;  3L3P A;  3PUQ A;  3UUL A;  2UUC T;  5HXH A;  2HN2 A;  2W67 A;  4UVB B;  1ZHC A;  2QRX A;  5JH7 E;  3ONJ A;  4NUU A;  4DBQ A;  3LK4 2;  3CX7 B;  3TLS A;  2IML A;  2XTL A;  3L39 A;  2FBW A;  3OJA A;  4X65 T;  2LSJ A;  4LMK A;  5LB7 B;  3C64 A;  4PJN A;  3QK6 A;  3RLF F;  3UUB A;  4E7Z A;  2WM9 A;  1UUR A;  4YLH A;  4ANJ A;  5JRC A;  2YDS A;  4H9O C;  3ZMU B;  4M1P A;  4U31 A;  3ZSS A;  2DL1 A;  2OA5 A;  5HCJ A;  2XQ5 A;  2HHH T;  1E1H B;  2HPJ A;  1WRD A;  3WAJ A;  4JYA T;  5FY7 A;  1MIV A;  3LBX A;  4CI3 B;  4EV6 A;  1W0B A;  4DV7 T;  3ZPO A;  2HN1 A;  3PUZ F;  3QB5 A;  2OLT A;  3AE3 A;  4HWH A;  3P4Q A;  2ZLY A;  3WAK A;  2WSS V;  4K0K T;  2VB6 A;  4DMW A;  3R84 B;  2XQ6 A;  1SUM B;  1B7T A;  4QH4 A;  5EK4 A;  2V7L A;  3QB5 K;  1T98 A;  4HKA A;  3KVA A;  1HG5 A;  3LK3 B;  2LE8 A;  3MJX A;  4H9P C;  4H9N C;  4DV6 T;  4H63 H;  1HNZ T;  3PDY A;  2CPT A;  2MPK A;  2LRK A;  3AE2 A;  3AEB A;  3BK9 A;  2HH7 A;  3M3Z B;  1CHU A;  2G0U A;  2NTY A;  4HWF A;  3WI3 A;  4AQF C;  3ZMZ B;  2XQ3 A;  4O4L E;  3R6N A;  3AEG A;  4AIS A;  3SOL A;  2IC9 A;  2H7O A;  2NOX A;  3DP7 A;  3ZC1 A;  2D9D A;  1KEY A;  4B6X A;  1J5E T;  2DNX A;  3H3A A;  4MAL A;  2XAF B;  3FHN A;  1HG2 A;  3GWH A;  2D5U A;  3PTR B;  3CVR A;  5LBM A;  2XAH B;  3UFG A;  4ZI2 C;  5ADX L;  2WBL A;  5FP3 A;  3PV0 F;  2CXL A;  3BQL A;  3F57 A;  3NZP A;  1LKX A;  2PTF A;  4K0U A;  5H6R B;  5LA6 E;  2L8K A;  3VU7 H;  3ZEF B;  2XQ7 A;  5ABF B;  4B3T T;  1MNE A;  2I0M A;  4WZX A;  4KHP T;  4GIW A;  5GON E;  3ZC0 A;  1LRZ A;  4HN9 A;  1Y64 B;  2CXF A;  1KNP A;  3E0Z A;  4DR7 T;  1OED C;  1UUS A;  5JDN A;  2MTQ A;  2KZ7 B;  5FL0 A;  4PFO A;  5HXR A;  4TV9 E;  2I59 A;  4JI3 T;  4QH5 A;  4ZI3 C;  4PJL A;  2Q9Q B;  4X1I E;  4OYJ A;  3HR0 A;  1KF6 A;  3CQG B;  4GK5 E;  3ESL A;  1MMG A;  3AED A;  3AVS A;  1D0Y A;  2NW8 A;  3FB2 A;  4AQY T;  4JI8 T;  2A3D A;  3MA9 A;  2R6G F;  3EAM A;  4IDN A;  4CI1 B;  5JRC B;  4YY3 T;  3K3N A;  1XDP A;  5JDG A;  2LRL A;  4GYR A;  2Q9Q A;  3IHR A;  3T8O A;  4UIG A;  4U2Z A;  4CQI A;  4IL4 A;  1FJG T;  1WYB A;  3VHL A;  4X66 T;  4DR4 T;  1I6Z A;  2YU1 A;  2EHO B;  3UUM A;  2JMK A;  3PU8 A;  2WDR A;  3FZF B;  1H7C A;  4WW0 A;  1HF8 A;  2LSY A;  2PFV A;  1IJ5 A;  3EDV A;  5HCM A;  3RHW A;  3IEE A;  5J2U E;  4DUZ T;  4QXB B;  4ZZC A;  4WBO A;  5LP6 E;  3DJB A;  2QGS A;  3UU5 A;  3PUS A;  3ETU A;  1MIW A;  3ZN1 B;  2KWI B;  1YXR A;  3KVB A;  3N5L A;  4HWI B;  2IAK A;  2X9H A;  4KMC A;  3UU8 A;  3ZT6 A;  4DR1 T;  4LF9 T;  2ZM8 A;  3N9O A;  2V7I A;  2VWA A;  1JNZ A;  4O2B E;  2BBH A;  3S4U A;  1JNR A;  2FJE A;  3KV9 A;  4HFC A;  2V8S V;  5J0Z A;  5L3G B;  4DV5 T;  4AKG A;  3O1H A;  5AQP B;  3MZK B;  4IDZ A;  5ABG A;  3SFE A;  4TUY E;  2BDE A;  4HFI A;  4YT0 A;  1YQ4 A;  2XQ4 A;  2V7K A;  3B13 A;  1IBM T;  1XDO A;  3U78 A;  2Y8D A;  2WU2 A;  3HL6 A;  2NTX A;  4UXN B;  2IW5 B;  1T72 A;  3C98 B;  3C4Z A;  4JUY A;  1NAF A;  3ETV A;  3NWI A;  1N36 T;  3PU3 A;  5L3C B;  4LF5 T;  4AKH A;  5LG3 A;  2LOP A;  4YTN A;  3CK6 A;  4ZHQ E;  2YKS A;  2AE9 A;  2N2N A;  4F6R C;  2FJA A;  2JIW A;  3RX6 A;  4CZZ B;  4YTP A;  4FI5 A;  5CJ5 A;  1XZY A;  2ZM6 T;  4Q25 A;  4DMV A;  2HPL A;  2ACZ A;  3H3M A;  4PK6 A;  3FXD B;  3N9Q A;  3HI2 A;  3RYH E;  5AQF B;  3LBX B;  3AE1 A;  1QLB A;  3H37 A;  1J1J A;  2BVL A;  2DWK A;  4ILA A;  3I0Q A;  3AEF A;  2XJ7 A;  1WLX A;  4GKK T;  2CBJ A;  1HS7 A;  2ODU A;  5JDL A;  2E8I A;  2X9W A;  2Y48 B;  3B57 A;  2XQ9 A;  4C91 A;  3RYF E;  3F31 A;  2JQH A;  5KDM C;  2RPA A;  2NP9 A;  2MYS A;  2IHR 1;  2LSI A;  2WWU A;  3FBZ A;  4IE7 A;  4IDO A;  3GN5 B;  2L9Q A;  3P4R A;  4TWH A;  2W4X A;  2WMO A;  3RF1 A;  3NZQ A;  3UT5 E;  2WU5 A;  2MBG A;  4ISS A;  4HWC A;  4AKI A;  3ZMT B;  5JVD E;  2XM1 A;  3UU3 A;  1SHZ C;  4YTM A;  1KFY A;  1Z0P A;  4OX9 T;  4KUM B;  2JQQ A;  4WNK A;  5DJQ C;  5L3F B;  3E22 E;  4O4H E;  4OFZ A;  5L3D B;  3N9N A;  4F8H A;  4KHZ F;  3O4X E;  2I6H A;  2W00 A;  4ZI2 D;  3AE9 A;  2VAS A;  3CQC B;  3RC3 A;  1G73 A;  1LVK A;  2ACX A;  2BZB A;  1WCR A;  2WQY A;  1G8X A;  4HFH A;  2CXD A;  4BAY B;  1R8I A;  3CKD A;  2MOZ A;  3ZCI A;  4Z8X A;  5J2T E;  4AKL A;  4OYK A;  2J62 A;  2W0G A;  2WY2 A;  5H6Q B;  1ZP0 A;  2DLR A;  3N9P A;  5KX5 E;  1ZOY A;  3ANW B;  3NBX X;  4IRE A;  1U4Q A;  2X67 A;  3Q5D A;  3VR9 A;  3EAB A;  4YXD A;  2W62 A;  1VCT A;  2E5V A;  2C5J A;  3MK7 C;  3J9X 1;  1MMD A;  2A9U A;  3ZCJ A;  3SRZ A;  4U2Y A;  3Q9D A;  4U7Y A;  2V26 A;  4IST A;  4ZS3 A;  2VL0 A;  4JI2 T;  1YKE B;  2BKP A;  5LJN A;  3AE4 A;  1UX5 A;  5KXJ A;  5JDH A;  4O4I E;  2V5C A;  3FBL A;  2WB5 A;  2NR4 A;  4HFD A;  4ILC A;  2C5K T;  3P8C D;  3CWZ B;  4CXW A;  1OXZ A;  4YSZ A;  1US7 B;  3P4W A;  1J5W A;  4AIU A;  5LG4 A;  4XAX B;  1HX1 B;  2CEA A;  3RRC A;  3P50 A;  4IT4 A;  4NXM T;  4CI2 B;  4X64 T;  1BR2 A;  3KDS E;  4NIQ A;  4I4T E;  3Q5E A;  3A7M A;  3CPZ A;  4JEU B;  4EGW A;  2LHN A;  4O8S A;  5CA1 E;  2EHO D;  2Z6E A;  2W63 A;  3CQX C;  2YOE A;  1ZKE A;  2AXD S;  4J2C A;  2K3W A;  3PUG A;  4MBQ A;  5FY0 A;  4ERR A;  5BMV E;  4GOU A;  2VVS A;  5CB4 E;  2YU2 A;  3HKC E;  2LSG A;  2W61 A;  4COF A;  2WZI A;  3G06 A;  3KBT A;  3UUN A;  3VRB A;  4DID B;  2YDQ A;  5JDM A;  3RQU A;  4G63 A;  2QVA A;  3MXZ A;  3BQI A;  4B3R T;  2DI4 A;  2XAS B;  5EK3 A;  5FKY A;  3RIA A;  2ZM2 A;  1MMA A;  3KV6 A;  4X1Y E;  1O3X A;  2YEV C;  1MMN A;  3AE8 A;  5LYJ E;  4QXC B;  2LSK A;  2C0S A;  1WR0 A;  1HFA A;  2NWB A;  1GQE A;  1ZEE A;  3FZK B;  5F5W A;  3TLW A;  3ZYM A;  1N34 T;  3PUR A;  1X79 A;  2UXD T;  3IF8 B;  1UCU A;  2WCA A;  4LFA T;  2ES0 A;  2KXP B;  4H9Q C;  2JRK A;  2LJL A;  2W66 A;  5HAX A;  3I0O A;  3T1Y T;  3L09 A;  1X9B A;  2XSB A;  4KBM B;  4BJM A;  5JDQ A;  3QOF A;  5AQI B;  5AQJ B;  1IBL T;  2ODV A;  2GK9 A;  3B5M A;  3ZLI A;  1V9D A;  2BG9 B;  3AEE A;  5FXW A;  4YHJ A;  5E0O A;  3ANW A;  4YFS A;  2JQ9 A;  4CN1 A;  4DVD A;  2X9Y A;  5CA0 E;  5LGT B;  2UU9 T;  4IE4 A;  2UXX B;  3VKG A;  3PUX F;  3C4X A;  4JI0 T; 
#chains in the Genus database with same CATH homology
 2XZE A;  4CN4 A;  5CJ5 A;  4WZX A;  1WR0 A;  4U33 A;  5FVL A;  5CGM A;  1YXR A;  3ZT6 A;  2CRB A;  4IT4 A;  4CN6 A;  2CPT A;  2JQK A;  2LRK A;  2MPK A;  4NIQ A;  3ZT7 A;  2W2U A;  4P1N A;  1WCR A;  5LB7 B;  2WWV A;  3ZST A;  2K3W A;  4U3C A;  2WY2 A;  2LRL A;  2JQH A;  3K1S A;  2RPA A;  4U31 A;  5FVK A;  2DL1 A;  2V6X A;  2V6Y B;  3ZSS A;  4ZEY A;  2JQ9 A;  3EAB A;  4U2Z A;  4CN1 A;  2V6Y A;  4U7I A;  3ZT5 A;  1WFD A;  4A5X A;  2A9U A;  4U2Y A;  4U7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...