2W2UA

Structural insight into the interaction between archaeal escrt-iii and aaa-atpase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
75
structure length
75
Chain Sequence
b'MSAQVMLEEMARKYAINAVKADKEGNAEEAITNYKKAIEVLAQLVSLYRDGSTAAIYEQMINEYKRRIEVLKELI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL P60 KATANIN
molecule tags Hydrolase/transport
source organism Sulfolobus acidocaldarius
publication title A Role for the Escrt System in Cell Division in Archaea.
pubmed doi rcsb
total genus 29
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2w2uA00
5CGMA 2WY2A 3ZT6A 2K3WA 2V6XA 4CN1A 5CJ5A 4U33A 3ZSTA 5FVKA 2LRLA 4CN6A 2V6YA 2DL1A 5FVLA 2JQ9A 2JQKA 2MPKA 3EABA 4P1NA 2WWVA 3ZSSA 2RPAA 1YXRA 2JQHA 4WZXA 2A9UA 2LRKA 3K1SA 4U7IA 1WCRA 4U2ZA 4CN4A 2V6YB 1WR0A 5LB7B 4IT4A 4U7YA 3ZT7A 2CRBA 1WFDA 4NIQA 2CPTA 3ZT5A 2W2UA 4U31A 4A5XA 2XZEA 4U2YA 4ZEYA 4U3CA
chains in the Genus database with same CATH superfamily
3P4QA 5A1LA 3JADA 3CMLA 5AQMB 3O9XA 3SFEA 3BQKA 3QOFA 2BKPA 1U5PA 2FJBA 3AE6A 3KINB 4JEHB 4V1Av 5LA6E 4BA9A 3RQUA 4JI4T 4C91A 4ADZA 2VQET 1ZV4X 3UUXB 3T1YT 2XQYA 3N2GE 2V6YA 1NWMX 3UU4A 2N9DA 4CQIA 2I59A 5J0ZA 4DV4T 4P1NA 5ABHA 5KXJA 2HHHT 4GK0E 5LOVE 4X64T 4DR1T 4QH1A 1S35A 3MXZA 1VCSA 3AE8A 3D0TA 3K1SA 4UIGA 1XDPA 3Q5DA 4YFSA 2IW5B 3CQGB 4YXDA 2LKGA 4U2ZA 4ANJA 2BVMA 1LKXA 3IF8B 4H63H 4HFHA 4PFOA 3F57A 3UU8A 2VQFT 4Q25A 5IUXA 4IT4A 2BVLA 4O2AE 3VR8A 2XAJB 2L3LA 4NIQA 3RYHE 3ZCJA 5IHYA 2CCQA 4COFA 1N33T 3OTOT 1IBLT 2WZIA 3P4WA 1MIYA 1MMGA 2J4GA 2WCAA 3PUQA 3PJAJ 2M6IA 5HXRA 3PV0F 2WBLA 2HN1A 4QKNA 4I55E 5JDHA 3S4UA 2QVAA 2DCFA 4JYAT 1D0ZA 3ZSTA 4DNDA 5HCMA 1QSDA 4PK6A 5L3EB 4HWCA 5L3GB 4J2CA 3AEFA 3PURA 4PJLA 3TLUA 4LF4T 1J5ET 4OX9T 2LHRA 1XDOA 3PUZF 5EK4A 2WWVA 3N9MA 4AIUA 4DIDB 2Q9QB 3KV9A 4HTEA 2VL0A 4BJNA 2CMRA 3PU8A 1HNZT 5LHGB 4GIWA 3AE3A 4OHFA 3UFEA 1Z0PA 4IDZA 5TAOA 5LJMA 4CXYA 3I1AA 3ZT5A 4GKJT 3HKDE 4ILUA 3VU7H 4JEUB 3ZMUB 1ZEEA 2WU5A 1N32T 5JR9C 1XWMA 5CFBA 4PFPA 5IWAT 3C51A 4CN1A 4CXXA 5AQPB 2VWAA 5HEUA 2CLYC 4YTNA 4DO0A 1D1CA 2I0MA 3AE4A 5L4EA 1YW0A 4UVAB 4TV8E 3HKEE 5LG3A 2NW8A 2LOPA 2MBGA 4G63A 4LMJA 3BQIA 2K24A 1M7KA 2JQHA 5DJQC 2XM2A 3UTKA 3ABVA 3F2EA 3GN5B 3CQXC 3K3QC 3LJCA 2XSAA 4KUMB 2M67A 3HA4A 1AJ3A 1B7TA 3U3IA 4YTMA 2CHNA 2QGSA 3MACA 4O4LE 4HWHA 4ZS3A 3O4XE 3RF1A 4B3ST 2JJ9A 2P9BA 3KV6A 4K0KT 3MK7C 4IHJE 2LM9A 5FXZA 4B3TT 3AE7A 4DR5T 2BBHA 3OVUA 4ISTA 4ZEYA 4GYRA 4UV8B 3CQCB 4I4TE 3RH3A 1CHUA 1OXZA 3FBZA 3KBUA 4UELA 5LHIB 5J2TE 4ASKA 2E9XC 5EK3A 5AQSB 3N9LA 4IIJE 2E8IA 4WBNE 5L3FB 2CE7A 3ZCIA 2V5CA 4OK0A 1QUUA 1W0BA 4YTPA 1SE7A 1HFAA 4UV9B 2LJLA 1SUMB 2WB5A 4EXTA 4YHHT 2RPAA 4H9SE 4CXWA 5ABFB 5BMVE 5L3CB 4DR3T 2LSIA 5F3JA 2VVNA 3UUNA 4AQYT 4E7ZA 2CXLA 5AQQB 1ZP0A 2X51A 4QH4A 5FY0A 3GA8A 3RKOA 1KK7A 2PFVA 4LFAT 4IDQA 2IHR1 3KVAA 4AKGA 4O4IE 2YINA 2CHOA 2PJQA 1T7SA 2H7VC 2OLTA 3P8CD 1ZOYA 2DNXA 4IDPA 4M1PA 4MALA 4X62T 4MFRA 1HX8A 1D1BA 2ZMAA 5HXCA 5CGMA 4ILBA 2WP9A 1HTJF 2WY2A 4LF8T 2UXCT 1CUNA 4K0UA 5LXTE 3AAEB 2H3RA 3ONJA 1ZKEA 2E2AA 3I9YA 3N9PA 3SRZA 5LMUT 2PG8A 1D0XA 3C50A 5JDLA 5JRCB 4MLKA 4ISSA 2DWGA 2VL8A 3LG7A 1IBKT 4IGUA 3L8RA 2CBIA 3OYZA 4TX5A 4ZS2A 1R8IA 5LNKA 3DTOA 2B76A 2CXFA 2WMNA 5HEHA 4JI2T 3MJXA 3ZC0A 2UXDT 2LRKA 4LF6T 4DV0T 4DBQA 2W63A 3O1HA 1XMOT 3Q2MA 1S94A 1XNRT 4TUYE 4H63V 2B1EA 1O3XA 2UUCT 2R6GF 2X0YA 3A7MA 2H7OA 3LBXA 1LVKA 5ADXL 1WFDA 3AA0B 2XY8B 3FZFB 3K3NA 2BS4A 2FJAA 1Z8UA 3KVBA 5H6QB 4TNVA 3ONLC 2ZM6T 3ZKRA 3HKCE 1WR6A 4TWDA 1W9RA 5AQGB 4B3MT 4EZ4A 2MAWA 2LSKA 4ERRA 5EZYE 4EYYR 3ZPOA 1FIOA 2DHRA 3PUYF 3UT5E 3VHLA 2NP9A 3ZMTB 3ONXA 3VKHA 1T72A 2JMHA 1MMDA 4HFIA 3L09A 4IREA 2LRLA 2XQ7A 3FXDB 1KF6A 5AQOB 4CN6A 4DUZT 1HNWT 2JMKA 5HYAA 3ZN1B 2K5BB 1BR1A 1KNZA 2E5VA 5KX5E 3M65A 2N2NA 2JQQA 2BS2A 3RC3A 4EIWA 4CI3B 4HWDA 1KEYA 1UK5A 3W15B 3AB3B 5JRCA 3VKGA 4HE8A 5BR8T 3P50A 3EDVA 4YSXA 4LF7T 5C2TA 3AE1A 2XSBA 3N9NA 4QX7B 2W66A 3L39A 3ZT7A 1U4QA 2CPTA 3ZMSB 3RI5A 3WAJA 4IL4A 2XQ3A 4OFZA 3FZHB 4HEAA 5CA0E 4HGAA 3DP7A 2KWIB 4AISA 1UGOA 4L9IA 2ES0A 4FJOA 5HCJA 2Q9QC 3RHWA 2ZLYA 5CJ5A 4HWFA 4HFCA 2FUPA 4U33A 1L0VA 2MTQA 5HWXA 4OYJA 1WLXA 2G0UA 3QK6A 4IDNA 4IE6A 4N78D 4TWHA 3PUGA 4EB6E 4X20E 2Q9QD 2JQ9A 2JQKA 2WQYA 3EABA 5J2UE 1HG2A 1VRBA 2UUAT 1OEDC 2VKOA 3C64A 4PK5A 4X1KE 4ZXLA 4HFVA 2A9UA 1H7CA 3LDQB 1EZ3A 1MIVA 2NWBA 3G06A 3GMIA 1VOMA 1WRDA 3IHRA 3B13A 4WBOA 4CI2B 4EEBA 4A97A 2SPCA 4HFDA 2C0SA 4JV5T 2J47A 3UU5A 1E7PA 3RIUC 5LGTB 4A5XA 4QWNB 3VRAA 3PUSA 2BDEA 1MNDA 2GK9A 4U74A 5HEOA 3RKGA 2UU9T 1SHZC 2N1GA 3AECA 1IJ5A 4ZI2D 4L0RA 1J1JA 4HWIB 5LHHB 2CEAA 2HH7A 4MBQA 1HR0T 4EZHA 3O1IA 3PUXF 4YLHA 5AQIB 4GKKT 4JI7T 4AKLA 4KX6A 1FMVA 4X65T 4ZI2C 2X9XA 3NWIA 2IC9A 3Q5WA 1OEDE 3H37A 3AEBA 5JR9B 1YKHB 4B3RT 2Y8DA 5AQNB 4EYUA 4Z91A 2C5JA 5LGNB 4YJ2E 3FXEB 2WMOA 1QLBA 3A5XA 4UR9A 1I6ZA 1UURA 4X1YE 2NTXA 2V5DA 3UUMA 3KFWX 3AE5A 3FZMB 4WYVA 5JVDE 4CZZB 2H88A 2V7JA 4TV9E 3JAEA 4X66T 2UUBT 3UQ7A 2X9YA 2LLYA 2LKHA 4UF0A 3SOLA 5C3JA 1DU2A 4AKIA 2V7IA 4HKAA 5C8YE 2EHOC 4KHZF 3ZLIA 1J5WA 3KDSE 3MKDA 1HCIA 2XZEA 3JAFA 3K3OA 2CXDA 3QNUA 4C90A 3J7Yq 2BG9C 1GQEA 2X66A 4PW8A 4DV2T 4ZZCA 3CK6A 1HF8A 2BKOA 2Z6EA 3CWZB 3P4RA 3TLSA 2JRKA 2W4XA 3NZPA 1YD8G 3TLTA 5LP6E 3AEAA 3B57A 3PUVF 1KNPA 3RYFE 2F4VT 2WS3A 4Z8XA 1HS7A 3C4ZA 2BG9A 3QB5A 5ABEA 2UXXB 3AA7B 3AVSA 5H6RB 2VB6A 3CPZA 2J1DG 4WZXA 5L4HA 3ZYKA 1KFYA 2AXDS 2BKNA 4EOZB 5JTGA 4ZOLE 2NW9A 3E08A 5JDMA 1ZHCA 3RRCA 2CWYA 5FY1A 2VKJA 3IA3A 3RIFA 3RYIE 5AQUB 1D1AA 2YOEA 1W0AA 2V7KA 4LF5T 5HXHA 2WZHA 3CX7B 3T1HT 4A56A 2BG9E 1X9BA 2WDQA 2ACZA 2E9XD 2LHNA 3N2KE 2WU2A 3N9QA 4L5GA 2L9QA 4IE4A 3EVYA 2IC6A 2VVSA 4TN7B 3AAIA 3GN5A 4U2YA 2LSJA 1UCUA 2C5IT 3AXJB 4IE7A 2BS3A 4P0BA 5FP3A 1HG5A 3HL6A 1WYCA 2V6XA 2YEVC 4LMLA 1XZYA 4H9OC 1OEDB 5AQLB 2Y6XA 4P09A 4PJMA 3RX6A 2RP4A 3C4WA 4DR2T 3LK42 4QXCB 5FL1A 4LF9T 2C5KT 2KNDA 4DUYT 2VKHA 5HWYA 1MIWA 4P0AA 3EAMA 4DR7T 2W62A 1LVFA 2KINB 2XAGB 3I9WA 4F8HA 3EHZA 2CA5A 4YY3T 4QX8B 1NENA 1IAPA 2VK9A 2QRXA 4FI5A 3UFGA 4ZHQE 4DVDA 2BZBA 5ABFA 1MMAA 2BG9B 2ODVA 3P4PA 4EV6A 1WCRA 4HFEA 4F6RC 4CN4A 2DWKA 2X9WA 2MYSA 2XM1A 1WR0A 2YK0A 3H3AA 3L3PA 4X1IE 4Z90A 3ZEFB 2KT9A 2W0GA 4YSYA 3EUHA 2CLYB 2UXNB 4HN9A 2LEHA 2NOXA 3MZKB 4EGWA 5HEGA 3I0QA 2KLQA 3NRYA 4IE0A 4YHJA 1MNEA 2AE9A 3NZQA 4GYSA 2HN2A 3F31A 3DJBA 4O2BE 2I6HA 5IYZE 4DMWA 1KNRA 3UU6A 4YT0A 3LFMA 4DR4T 3V5SA 3MA9A 4H9QC 5FVKA 3C4XA 5JH7E 3SWHA 2K9AA 3OPCA 1US7B 3PJAA 1N34T 4GK5E 2DL1A 2XPKA 3TKLB 5AQVB 4NUVA 2XJ7A 3LK2B 3P4SA 3ZSSA 4DV1T 4LMKA 3ZJ2A 2Y48B 5EK2A 2WM9A 2DLRA 2VASA 2KMFA 3SS1A 4LFBT 3QC9A 3QB5K 2E9XB 5LYJE 3CIRA 2FJEA 1BR2A 3B5MA 4U7YA 2KXPB 4AI6A 2ACXA 2X9HA 2JPFA 4X5TA 5FNVE 3KV4A 3NBXX 3PUWF 2W00A 3AE2A 2A2FX 4I0UA 5LBMA 2YDSA 2V7LA 3ZT6A 2K3WA 3LSVA 4HFBA 5FXWA 4GOUA 5AFUL 5HXEA 2EHOB 3ZYMA 5LJNA 1XNQT 3OJAA 2PTFA 4TNWA 3WAKA 4OYKA 3KBTA 2XQ6A 4XAXB 2NR4A 5AQJB 2KSRA 4PJJA 1HNXT 3UQ4A 3AEGA 3ETUA 1T98A 2J62A 4XBFB 5L3BB 2Q9QA 2ODUA 4NXNT 4KMCA 1VCTA 3JC6C 3E22E 2HPLA 4TZ4C 2V1DB 3AA6B 4UXNB 3X1DA 3ANWB 5JDNA 3OKQA 5F8PA 3RGLA 3LK3B 1BR0A 4UF0B 3NVOA 3VR9A 5JDGA 1OEDA 3AEDA 4KP3C 4AKHA 4I50E 1UUSA 4O8SA 4ILCA 3OYXA 3AXJA 4IL9A 4YJ3E 3FZLB 4PJNA 2NTYA 3ZN0B 2EHOD 1T8BA 2XAQB 2V26A 3ESLA 5L2LA 5GONE 2WDRA 3FHNA 3UUBA 4B6XA 2D2SA 2NW7A 2LOSA 3H3MA 2CWOA 2LT3A 4JI3T 5FKYA 5FVLA 1IZNB 2WWUA 3UULA 2XAHB 5J1GA 2UXBT 3J9X1 2XQ9A 4UVBB 4AQGA 2IMLA 3CKDA 4JLEA 5HAXA 3M3ZB 2D9DA 4MHCA 3U78A 4JI8T 5FXXA 3KV5A 4JUYA 4DV5T 5FYMA 4AKRB 1I94T 1JNRA 2PBIA 2V6YB 2LE8A 4G2AA 2IIUA 5LB7B 3N2OA 3HKBE 3NKZA 2W2UA 4U31A 5LBQB 5L47A 2LM2A 2D0TA 3JCFA 2CBJA 1YKEB 4ILAA 5JDFA 1X79A 2YDRA 3ZC1A 2YKSA 2LSGA 4ZI7E 3TLVA 1UX5A 4ZZBA 5AQTB 3AA1B 2A72A 2YN6A 1IJ6A 3OBVE 4AXPA 4DMVA 1D0YA 3AEEA 2QYWA 3PDYA 4DBRA 2KZ7B 3FBLA 2ZM8A 4TWFA 3RLFF 4NPPA 4DV7T 5DQVA 4JI6T 2X0HA 3HR0A 4UVCB 4NXMT 3PU3A 4QHOA 2HPJA 2XAFB 4O4HE 3IEEA 2XUEA 4O4JE 4JI1T 4WNKA 2IUBA 1SA0E 5L3DB 4BJMA 2E5LT 3ETVA 5JR9A 3ZMZB 3EDUA 2WSSV 3N9OA 3ZYLA 4AQFC 2X68A 3CVRA 2E9XA 5LGUB 3EI0A 3IBPA 2CRBA 3CX6B 2KWHA 4XZCA 4UEMA 4IDOA 2XQ4A 4KBMB 5FY7A 3V5UA 2VURA 3C98B 3NRXA 3A8YC 2YDQA 4KHPT 4U72A 5JQGE 4H9NC 5AQHB 3AE9A 1OWAA 3PTRB 2FJDA 2V8SV 4QXBB 4NUUA 2D5UA 3CX8B 2CM0A 2FBWA 3RQWA 5DABA 4E7SA 1FEWA 4ZI3D 5M4YA 3FZKB 4AQFA 1E2AA 3RIAA 1FMWA 5HEJA 3ANWA 1XMQT 2XQ8A 5AQKB 5F5WA 3R6NA 4ZI3C 1NEKA 3RC8A 2OA5A 3Q5EA 3AVRA 2VKDA 3K8PC 3FB2A 1YQ4A 2DI4A 5ETWA 2WAUA 3N5LA 4DR6T 5FMNA 4CI1B 2X0LB 2LSYA 5FL0A 2IAKA 2BBJA 2X67A 2XQ5A 4IE5A 5FXVA 1YQ3A 2EHOA 3LBXB 5LCYA 5KMGP 1FJGT 3PE0A 2XQAA 5KDMC 5LG4A 2ZM2A 4I43B 1W09A 3R84B 3BK9A 1JNZA 3HI2A 3RYCE 1V9DA 3SFDA 5ABGA 5LMNT 3E0ZA 1LRZA 1G8XA 2YU1A 3AAAB 5E0OA 3RIUA 4WW0A 4EEDA 4YSZA 5JDQA 3O1JA 3P7IA 2XASB 3QUJA 5JREA 5CA1E 1N36T 4JI0T 1MMNA 3RPUA 4JI5T 2L8KA 3RRWA 3ZJ1A 3UU3A 5AQFB 5HXSA 2ZM0A 2OV9A 1HX1B 5CB4E 2RA1A 1M62A 4H9PC 4PNIA 2MPKA 4DV3T 3I0OA 2WDVA 4KI0F 2YU2A 1YXRA 2W61A 1WYBA 1UX4A 4A98A 2MOZA 4EAHA 2V7MA 1G73A 2XHEB 4U7IA 3VRBA 3ZMVB 4DV6T 3Q9DA 3Q5XA 2JIWA 4H9RC 2A3DA 4QH5A 1Y01A 2D0UA 1NAFA 5AQRB 1IBMT 3BQLA 4PAGA 1BR4A 2IDOB 1Y64B 3JC6D 4QXHB 3PUAA 5DQWA 3T8OA 3TLWA 2K48A 2QA7A 2H89A 3GWHA 4JBWF 2M6BA 2XTLA 4PK4A 4BAYB 2W67A 4LFCT 1E1HB 4U3CA 3WI3A
chains in the Genus database with same CATH topology
5CGMA 2WY2A 3ZT6A 2K3WA 2V6XA 4CN1A 5CJ5A 4U33A 3ZSTA 5FVKA 2LRLA 4CN6A 2V6YA 2DL1A 5FVLA 2JQ9A 2JQKA 2MPKA 3EABA 4P1NA 2WWVA 3ZSSA 2RPAA 1YXRA 2JQHA 4WZXA 2A9UA 2LRKA 3K1SA 4U7IA 1WCRA 4U2ZA 4CN4A 2V6YB 1WR0A 5LB7B 4IT4A 4U7YA 3ZT7A 2CRBA 1WFDA 4NIQA 2CPTA 3ZT5A 2W2UA 4U31A 4A5XA 2XZEA 4U2YA 4ZEYA 4U3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CGM A;  2WY2 A;  3ZT6 A;  2K3W A;  2V6X A;  4CN1 A;  5CJ5 A;  4U33 A;  3ZST A;  5FVK A;  2LRL A;  4CN6 A;  2V6Y A;  2DL1 A;  5FVL A;  2JQ9 A;  2JQK A;  2MPK A;  3EAB A;  4P1N A;  2WWV A;  3ZSS A;  2RPA A;  1YXR A;  2JQH A;  4WZX A;  2A9U A;  2LRK A;  3K1S A;  4U7I A;  1WCR A;  4U2Z A;  4CN4 A;  2V6Y B;  1WR0 A;  5LB7 B;  4IT4 A;  4U7Y A;  3ZT7 A;  2CRB A;  1WFD A;  4NIQ A;  2CPT A;  3ZT5 A;  2W2U A;  4U31 A;  4A5X A;  2XZE A;  4U2Y A;  4ZEY A;  4U3C A; 
#chains in the Genus database with same CATH topology
 3P4Q A;  5A1L A;  3JAD A;  3CML A;  5AQM B;  3O9X A;  3SFE A;  3BQK A;  3QOF A;  2BKP A;  1U5P A;  2FJB A;  3AE6 A;  3KIN B;  4JEH B;  4V1A v;  5LA6 E;  4BA9 A;  3RQU A;  4JI4 T;  4C91 A;  4ADZ A;  2VQE T;  1ZV4 X;  3UUX B;  3T1Y T;  2XQY A;  3N2G E;  2V6Y A;  1NWM X;  3UU4 A;  2N9D A;  4CQI A;  2I59 A;  5J0Z A;  4DV4 T;  4P1N A;  5ABH A;  5KXJ A;  2HHH T;  4GK0 E;  5LOV E;  4X64 T;  4DR1 T;  4QH1 A;  1S35 A;  3MXZ A;  1VCS A;  3AE8 A;  3D0T A;  3K1S A;  4UIG A;  1XDP A;  3Q5D A;  4YFS A;  2IW5 B;  3CQG B;  4YXD A;  2LKG A;  4U2Z A;  4ANJ A;  2BVM A;  1LKX A;  3IF8 B;  4H63 H;  4HFH A;  4PFO A;  3F57 A;  3UU8 A;  2VQF T;  4Q25 A;  5IUX A;  4IT4 A;  2BVL A;  4O2A E;  3VR8 A;  2XAJ B;  2L3L A;  4NIQ A;  3RYH E;  3ZCJ A;  5IHY A;  2CCQ A;  4COF A;  1N33 T;  3OTO T;  1IBL T;  2WZI A;  3P4W A;  1MIY A;  1MMG A;  2J4G A;  2WCA A;  3PUQ A;  3PJA J;  2M6I A;  5HXR A;  3PV0 F;  2WBL A;  2HN1 A;  4QKN A;  4I55 E;  5JDH A;  3S4U A;  2QVA A;  2DCF A;  4JYA T;  1D0Z A;  3ZST A;  4DND A;  5HCM A;  1QSD A;  4PK6 A;  5L3E B;  4HWC A;  5L3G B;  4J2C A;  3AEF A;  3PUR A;  4PJL A;  3TLU A;  4LF4 T;  1J5E T;  4OX9 T;  2LHR A;  1XDO A;  3PUZ F;  5EK4 A;  2WWV A;  3N9M A;  4AIU A;  4DID B;  2Q9Q B;  3KV9 A;  4HTE A;  2VL0 A;  4BJN A;  2CMR A;  3PU8 A;  1HNZ T;  5LHG B;  4GIW A;  3AE3 A;  4OHF A;  3UFE A;  1Z0P A;  4IDZ A;  5TAO A;  5LJM A;  4CXY A;  3I1A A;  3ZT5 A;  4GKJ T;  3HKD E;  4ILU A;  3VU7 H;  4JEU B;  3ZMU B;  1ZEE A;  2WU5 A;  1N32 T;  5JR9 C;  1XWM A;  5CFB A;  4PFP A;  5IWA T;  3C51 A;  4CN1 A;  4CXX A;  5AQP B;  2VWA A;  5HEU A;  2CLY C;  4YTN A;  4DO0 A;  1D1C A;  2I0M A;  3AE4 A;  5L4E A;  1YW0 A;  4UVA B;  4TV8 E;  3HKE E;  5LG3 A;  2NW8 A;  2LOP A;  2MBG A;  4G63 A;  4LMJ A;  3BQI A;  2K24 A;  1M7K A;  2JQH A;  5DJQ C;  2XM2 A;  3UTK A;  3ABV A;  3F2E A;  3GN5 B;  3CQX C;  3K3Q C;  3LJC A;  2XSA A;  4KUM B;  2M67 A;  3HA4 A;  1AJ3 A;  1B7T A;  3U3I A;  4YTM A;  2CHN A;  2QGS A;  3MAC A;  4O4L E;  4HWH A;  4ZS3 A;  3O4X E;  3RF1 A;  4B3S T;  2JJ9 A;  2P9B A;  3KV6 A;  4K0K T;  3MK7 C;  4IHJ E;  2LM9 A;  5FXZ A;  4B3T T;  3AE7 A;  4DR5 T;  2BBH A;  3OVU A;  4IST A;  4ZEY A;  4GYR A;  4UV8 B;  3CQC B;  4I4T E;  3RH3 A;  1CHU A;  1OXZ A;  3FBZ A;  3KBU A;  4UEL A;  5LHI B;  5J2T E;  4ASK A;  2E9X C;  5EK3 A;  5AQS B;  3N9L A;  4IIJ E;  2E8I A;  4WBN E;  5L3F B;  2CE7 A;  3ZCI A;  2V5C A;  4OK0 A;  1QUU A;  1W0B A;  4YTP A;  1SE7 A;  1HFA A;  4UV9 B;  2LJL A;  1SUM B;  2WB5 A;  4EXT A;  4YHH T;  2RPA A;  4H9S E;  4CXW A;  5ABF B;  5BMV E;  5L3C B;  4DR3 T;  2LSI A;  5F3J A;  2VVN A;  3UUN A;  4AQY T;  4E7Z A;  2CXL A;  5AQQ B;  1ZP0 A;  2X51 A;  4QH4 A;  5FY0 A;  3GA8 A;  3RKO A;  1KK7 A;  2PFV A;  4LFA T;  4IDQ A;  2IHR 1;  3KVA A;  4AKG A;  4O4I E;  2YIN A;  2CHO A;  2PJQ A;  1T7S A;  2H7V C;  2OLT A;  3P8C D;  1ZOY A;  2DNX A;  4IDP A;  4M1P A;  4MAL A;  4X62 T;  4MFR A;  1HX8 A;  1D1B A;  2ZMA A;  5HXC A;  5CGM A;  4ILB A;  2WP9 A;  1HTJ F;  2WY2 A;  4LF8 T;  2UXC T;  1CUN A;  4K0U A;  5LXT E;  3AAE B;  2H3R A;  3ONJ A;  1ZKE A;  2E2A A;  3I9Y A;  3N9P A;  3SRZ A;  5LMU T;  2PG8 A;  1D0X A;  3C50 A;  5JDL A;  5JRC B;  4MLK A;  4ISS A;  2DWG A;  2VL8 A;  3LG7 A;  1IBK T;  4IGU A;  3L8R A;  2CBI A;  3OYZ A;  4TX5 A;  4ZS2 A;  1R8I A;  5LNK A;  3DTO A;  2B76 A;  2CXF A;  2WMN A;  5HEH A;  4JI2 T;  3MJX A;  3ZC0 A;  2UXD T;  2LRK A;  4LF6 T;  4DV0 T;  4DBQ A;  2W63 A;  3O1H A;  1XMO T;  3Q2M A;  1S94 A;  1XNR T;  4TUY E;  4H63 V;  2B1E A;  1O3X A;  2UUC T;  2R6G F;  2X0Y A;  3A7M A;  2H7O A;  3LBX A;  1LVK A;  5ADX L;  1WFD A;  3AA0 B;  2XY8 B;  3FZF B;  3K3N A;  2BS4 A;  2FJA A;  1Z8U A;  3KVB A;  5H6Q B;  4TNV A;  3ONL C;  2ZM6 T;  3ZKR A;  3HKC E;  1WR6 A;  4TWD A;  1W9R A;  5AQG B;  4B3M T;  4EZ4 A;  2MAW A;  2LSK A;  4ERR A;  5EZY E;  4EYY R;  3ZPO A;  1FIO A;  2DHR A;  3PUY F;  3UT5 E;  3VHL A;  2NP9 A;  3ZMT B;  3ONX A;  3VKH A;  1T72 A;  2JMH A;  1MMD A;  4HFI A;  3L09 A;  4IRE A;  2LRL A;  2XQ7 A;  3FXD B;  1KF6 A;  5AQO B;  4CN6 A;  4DUZ T;  1HNW T;  2JMK A;  5HYA A;  3ZN1 B;  2K5B B;  1BR1 A;  1KNZ A;  2E5V A;  5KX5 E;  3M65 A;  2N2N A;  2JQQ A;  2BS2 A;  3RC3 A;  4EIW A;  4CI3 B;  4HWD A;  1KEY A;  1UK5 A;  3W15 B;  3AB3 B;  5JRC A;  3VKG A;  4HE8 A;  5BR8 T;  3P50 A;  3EDV A;  4YSX A;  4LF7 T;  5C2T A;  3AE1 A;  2XSB A;  3N9N A;  4QX7 B;  2W66 A;  3L39 A;  3ZT7 A;  1U4Q A;  2CPT A;  3ZMS B;  3RI5 A;  3WAJ A;  4IL4 A;  2XQ3 A;  4OFZ A;  3FZH B;  4HEA A;  5CA0 E;  4HGA A;  3DP7 A;  2KWI B;  4AIS A;  1UGO A;  4L9I A;  2ES0 A;  4FJO A;  5HCJ A;  2Q9Q C;  3RHW A;  2ZLY A;  5CJ5 A;  4HWF A;  4HFC A;  2FUP A;  4U33 A;  1L0V A;  2MTQ A;  5HWX A;  4OYJ A;  1WLX A;  2G0U A;  3QK6 A;  4IDN A;  4IE6 A;  4N78 D;  4TWH A;  3PUG A;  4EB6 E;  4X20 E;  2Q9Q D;  2JQ9 A;  2JQK A;  2WQY A;  3EAB A;  5J2U E;  1HG2 A;  1VRB A;  2UUA T;  1OED C;  2VKO A;  3C64 A;  4PK5 A;  4X1K E;  4ZXL A;  4HFV A;  2A9U A;  1H7C A;  3LDQ B;  1EZ3 A;  1MIV A;  2NWB A;  3G06 A;  3GMI A;  1VOM A;  1WRD A;  3IHR A;  3B13 A;  4WBO A;  4CI2 B;  4EEB A;  4A97 A;  2SPC A;  4HFD A;  2C0S A;  4JV5 T;  2J47 A;  3UU5 A;  1E7P A;  3RIU C;  5LGT B;  4A5X A;  4QWN B;  3VRA A;  3PUS A;  2BDE A;  1MND A;  2GK9 A;  4U74 A;  5HEO A;  3RKG A;  2UU9 T;  1SHZ C;  2N1G A;  3AEC A;  1IJ5 A;  4ZI2 D;  4L0R A;  1J1J A;  4HWI B;  5LHH B;  2CEA A;  2HH7 A;  4MBQ A;  1HR0 T;  4EZH A;  3O1I A;  3PUX F;  4YLH A;  5AQI B;  4GKK T;  4JI7 T;  4AKL A;  4KX6 A;  1FMV A;  4X65 T;  4ZI2 C;  2X9X A;  3NWI A;  2IC9 A;  3Q5W A;  1OED E;  3H37 A;  3AEB A;  5JR9 B;  1YKH B;  4B3R T;  2Y8D A;  5AQN B;  4EYU A;  4Z91 A;  2C5J A;  5LGN B;  4YJ2 E;  3FXE B;  2WMO A;  1QLB A;  3A5X A;  4UR9 A;  1I6Z A;  1UUR A;  4X1Y E;  2NTX A;  2V5D A;  3UUM A;  3KFW X;  3AE5 A;  3FZM B;  4WYV A;  5JVD E;  4CZZ B;  2H88 A;  2V7J A;  4TV9 E;  3JAE A;  4X66 T;  2UUB T;  3UQ7 A;  2X9Y A;  2LLY A;  2LKH A;  4UF0 A;  3SOL A;  5C3J A;  1DU2 A;  4AKI A;  2V7I A;  4HKA A;  5C8Y E;  2EHO C;  4KHZ F;  3ZLI A;  1J5W A;  3KDS E;  3MKD A;  1HCI A;  2XZE A;  3JAF A;  3K3O A;  2CXD A;  3QNU A;  4C90 A;  3J7Y q;  2BG9 C;  1GQE A;  2X66 A;  4PW8 A;  4DV2 T;  4ZZC A;  3CK6 A;  1HF8 A;  2BKO A;  2Z6E A;  3CWZ B;  3P4R A;  3TLS A;  2JRK A;  2W4X A;  3NZP A;  1YD8 G;  3TLT A;  5LP6 E;  3AEA A;  3B57 A;  3PUV F;  1KNP A;  3RYF E;  2F4V T;  2WS3 A;  4Z8X A;  1HS7 A;  3C4Z A;  2BG9 A;  3QB5 A;  5ABE A;  2UXX B;  3AA7 B;  3AVS A;  5H6R B;  2VB6 A;  3CPZ A;  2J1D G;  4WZX A;  5L4H A;  3ZYK A;  1KFY A;  2AXD S;  2BKN A;  4EOZ B;  5JTG A;  4ZOL E;  2NW9 A;  3E08 A;  5JDM A;  1ZHC A;  3RRC A;  2CWY A;  5FY1 A;  2VKJ A;  3IA3 A;  3RIF A;  3RYI E;  5AQU B;  1D1A A;  2YOE A;  1W0A A;  2V7K A;  4LF5 T;  5HXH A;  2WZH A;  3CX7 B;  3T1H T;  4A56 A;  2BG9 E;  1X9B A;  2WDQ A;  2ACZ A;  2E9X D;  2LHN A;  3N2K E;  2WU2 A;  3N9Q A;  4L5G A;  2L9Q A;  4IE4 A;  3EVY A;  2IC6 A;  2VVS A;  4TN7 B;  3AAI A;  3GN5 A;  4U2Y A;  2LSJ A;  1UCU A;  2C5I T;  3AXJ B;  4IE7 A;  2BS3 A;  4P0B A;  5FP3 A;  1HG5 A;  3HL6 A;  1WYC A;  2V6X A;  2YEV C;  4LML A;  1XZY A;  4H9O C;  1OED B;  5AQL B;  2Y6X A;  4P09 A;  4PJM A;  3RX6 A;  2RP4 A;  3C4W A;  4DR2 T;  3LK4 2;  4QXC B;  5FL1 A;  4LF9 T;  2C5K T;  2KND A;  4DUY T;  2VKH A;  5HWY A;  1MIW A;  4P0A A;  3EAM A;  4DR7 T;  2W62 A;  1LVF A;  2KIN B;  2XAG B;  3I9W A;  4F8H A;  3EHZ A;  2CA5 A;  4YY3 T;  4QX8 B;  1NEN A;  1IAP A;  2VK9 A;  2QRX A;  4FI5 A;  3UFG A;  4ZHQ E;  4DVD A;  2BZB A;  5ABF A;  1MMA A;  2BG9 B;  2ODV A;  3P4P A;  4EV6 A;  1WCR A;  4HFE A;  4F6R C;  4CN4 A;  2DWK A;  2X9W A;  2MYS A;  2XM1 A;  1WR0 A;  2YK0 A;  3H3A A;  3L3P A;  4X1I E;  4Z90 A;  3ZEF B;  2KT9 A;  2W0G A;  4YSY A;  3EUH A;  2CLY B;  2UXN B;  4HN9 A;  2LEH A;  2NOX A;  3MZK B;  4EGW A;  5HEG A;  3I0Q A;  2KLQ A;  3NRY A;  4IE0 A;  4YHJ A;  1MNE A;  2AE9 A;  3NZQ A;  4GYS A;  2HN2 A;  3F31 A;  3DJB A;  4O2B E;  2I6H A;  5IYZ E;  4DMW A;  1KNR A;  3UU6 A;  4YT0 A;  3LFM A;  4DR4 T;  3V5S A;  3MA9 A;  4H9Q C;  5FVK A;  3C4X A;  5JH7 E;  3SWH A;  2K9A A;  3OPC A;  1US7 B;  3PJA A;  1N34 T;  4GK5 E;  2DL1 A;  2XPK A;  3TKL B;  5AQV B;  4NUV A;  2XJ7 A;  3LK2 B;  3P4S A;  3ZSS A;  4DV1 T;  4LMK A;  3ZJ2 A;  2Y48 B;  5EK2 A;  2WM9 A;  2DLR A;  2VAS A;  2KMF A;  3SS1 A;  4LFB T;  3QC9 A;  3QB5 K;  2E9X B;  5LYJ E;  3CIR A;  2FJE A;  1BR2 A;  3B5M A;  4U7Y A;  2KXP B;  4AI6 A;  2ACX A;  2X9H A;  2JPF A;  4X5T A;  5FNV E;  3KV4 A;  3NBX X;  3PUW F;  2W00 A;  3AE2 A;  2A2F X;  4I0U A;  5LBM A;  2YDS A;  2V7L A;  3ZT6 A;  2K3W A;  3LSV A;  4HFB A;  5FXW A;  4GOU A;  5AFU L;  5HXE A;  2EHO B;  3ZYM A;  5LJN A;  1XNQ T;  3OJA A;  2PTF A;  4TNW A;  3WAK A;  4OYK A;  3KBT A;  2XQ6 A;  4XAX B;  2NR4 A;  5AQJ B;  2KSR A;  4PJJ A;  1HNX T;  3UQ4 A;  3AEG A;  3ETU A;  1T98 A;  2J62 A;  4XBF B;  5L3B B;  2Q9Q A;  2ODU A;  4NXN T;  4KMC A;  1VCT A;  3JC6 C;  3E22 E;  2HPL A;  4TZ4 C;  2V1D B;  3AA6 B;  4UXN B;  3X1D A;  3ANW B;  5JDN A;  3OKQ A;  5F8P A;  3RGL A;  3LK3 B;  1BR0 A;  4UF0 B;  3NVO A;  3VR9 A;  5JDG A;  1OED A;  3AED A;  4KP3 C;  4AKH A;  4I50 E;  1UUS A;  4O8S A;  4ILC A;  3OYX A;  3AXJ A;  4IL9 A;  4YJ3 E;  3FZL B;  4PJN A;  2NTY A;  3ZN0 B;  2EHO D;  1T8B A;  2XAQ B;  2V26 A;  3ESL A;  5L2L A;  5GON E;  2WDR A;  3FHN A;  3UUB A;  4B6X A;  2D2S A;  2NW7 A;  2LOS A;  3H3M A;  2CWO A;  2LT3 A;  4JI3 T;  5FKY A;  5FVL A;  1IZN B;  2WWU A;  3UUL A;  2XAH B;  5J1G A;  2UXB T;  3J9X 1;  2XQ9 A;  4UVB B;  4AQG A;  2IML A;  3CKD A;  4JLE A;  5HAX A;  3M3Z B;  2D9D A;  4MHC A;  3U78 A;  4JI8 T;  5FXX A;  3KV5 A;  4JUY A;  4DV5 T;  5FYM A;  4AKR B;  1I94 T;  1JNR A;  2PBI A;  2V6Y B;  2LE8 A;  4G2A A;  2IIU A;  5LB7 B;  3N2O A;  3HKB E;  3NKZ A;  2W2U A;  4U31 A;  5LBQ B;  5L47 A;  2LM2 A;  2D0T A;  3JCF A;  2CBJ A;  1YKE B;  4ILA A;  5JDF A;  1X79 A;  2YDR A;  3ZC1 A;  2YKS A;  2LSG A;  4ZI7 E;  3TLV A;  1UX5 A;  4ZZB A;  5AQT B;  3AA1 B;  2A72 A;  2YN6 A;  1IJ6 A;  3OBV E;  4AXP A;  4DMV A;  1D0Y A;  3AEE A;  2QYW A;  3PDY A;  4DBR A;  2KZ7 B;  3FBL A;  2ZM8 A;  4TWF A;  3RLF F;  4NPP A;  4DV7 T;  5DQV A;  4JI6 T;  2X0H A;  3HR0 A;  4UVC B;  4NXM T;  3PU3 A;  4QHO A;  2HPJ A;  2XAF B;  4O4H E;  3IEE A;  2XUE A;  4O4J E;  4JI1 T;  4WNK A;  2IUB A;  1SA0 E;  5L3D B;  4BJM A;  2E5L T;  3ETV A;  5JR9 A;  3ZMZ B;  3EDU A;  2WSS V;  3N9O A;  3ZYL A;  4AQF C;  2X68 A;  3CVR A;  2E9X A;  5LGU B;  3EI0 A;  3IBP A;  2CRB A;  3CX6 B;  2KWH A;  4XZC A;  4UEM A;  4IDO A;  2XQ4 A;  4KBM B;  5FY7 A;  3V5U A;  2VUR A;  3C98 B;  3NRX A;  3A8Y C;  2YDQ A;  4KHP T;  4U72 A;  5JQG E;  4H9N C;  5AQH B;  3AE9 A;  1OWA A;  3PTR B;  2FJD A;  2V8S V;  4QXB B;  4NUU A;  2D5U A;  3CX8 B;  2CM0 A;  2FBW A;  3RQW A;  5DAB A;  4E7S A;  1FEW A;  4ZI3 D;  5M4Y A;  3FZK B;  4AQF A;  1E2A A;  3RIA A;  1FMW A;  5HEJ A;  3ANW A;  1XMQ T;  2XQ8 A;  5AQK B;  5F5W A;  3R6N A;  4ZI3 C;  1NEK A;  3RC8 A;  2OA5 A;  3Q5E A;  3AVR A;  2VKD A;  3K8P C;  3FB2 A;  1YQ4 A;  2DI4 A;  5ETW A;  2WAU A;  3N5L A;  4DR6 T;  5FMN A;  4CI1 B;  2X0L B;  2LSY A;  5FL0 A;  2IAK A;  2BBJ A;  2X67 A;  2XQ5 A;  4IE5 A;  5FXV A;  1YQ3 A;  2EHO A;  3LBX B;  5LCY A;  5KMG P;  1FJG T;  3PE0 A;  2XQA A;  5KDM C;  5LG4 A;  2ZM2 A;  4I43 B;  1W09 A;  3R84 B;  3BK9 A;  1JNZ A;  3HI2 A;  3RYC E;  1V9D A;  3SFD A;  5ABG A;  5LMN T;  3E0Z A;  1LRZ A;  1G8X A;  2YU1 A;  3AAA B;  5E0O A;  3RIU A;  4WW0 A;  4EED A;  4YSZ A;  5JDQ A;  3O1J A;  3P7I A;  2XAS B;  3QUJ A;  5JRE A;  5CA1 E;  1N36 T;  4JI0 T;  1MMN A;  3RPU A;  4JI5 T;  2L8K A;  3RRW A;  3ZJ1 A;  3UU3 A;  5AQF B;  5HXS A;  2ZM0 A;  2OV9 A;  1HX1 B;  5CB4 E;  2RA1 A;  1M62 A;  4H9P C;  4PNI A;  2MPK A;  4DV3 T;  3I0O A;  2WDV A;  4KI0 F;  2YU2 A;  1YXR A;  2W61 A;  1WYB A;  1UX4 A;  4A98 A;  2MOZ A;  4EAH A;  2V7M A;  1G73 A;  2XHE B;  4U7I A;  3VRB A;  3ZMV B;  4DV6 T;  3Q9D A;  3Q5X A;  2JIW A;  4H9R C;  2A3D A;  4QH5 A;  1Y01 A;  2D0U A;  1NAF A;  5AQR B;  1IBM T;  3BQL A;  4PAG A;  1BR4 A;  2IDO B;  1Y64 B;  3JC6 D;  4QXH B;  3PUA A;  5DQW A;  3T8O A;  3TLW A;  2K48 A;  2QA7 A;  2H89 A;  3GWH A;  4JBW F;  2M6B A;  2XTL A;  4PK4 A;  4BAY B;  2W67 A;  4LFC T;  1E1H B;  4U3C A;  3WI3 A; 
#chains in the Genus database with same CATH homology
 5CGM A;  2WY2 A;  3ZT6 A;  2K3W A;  2V6X A;  4CN1 A;  5CJ5 A;  4U33 A;  3ZST A;  5FVK A;  2LRL A;  4CN6 A;  2V6Y A;  2DL1 A;  5FVL A;  2JQ9 A;  2JQK A;  2MPK A;  3EAB A;  4P1N A;  2WWV A;  3ZSS A;  2RPA A;  1YXR A;  2JQH A;  4WZX A;  2A9U A;  2LRK A;  3K1S A;  4U7I A;  1WCR A;  4U2Z A;  4CN4 A;  2V6Y B;  1WR0 A;  5LB7 B;  4IT4 A;  4U7Y A;  3ZT7 A;  2CRB A;  1WFD A;  4NIQ A;  2CPT A;  3ZT5 A;  2W2U A;  4U31 A;  4A5X A;  2XZE A;  4U2Y A;  4ZEY A;  4U3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...