2W2UA

Structural insight into the interaction between archaeal escrt-iii and aaa-atpase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
75
structure length
75
Chain Sequence
MSAQVMLEEMARKYAINAVKADKEGNAEEAITNYKKAIEVLAQLVSLYRDGSTAAIYEQMINEYKRRIEVLKELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL P60 KATANIN
publication title A Role for the Escrt System in Cell Division in Archaea.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase/transport
total genus 29
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2w2uA00
2WY2A 4U31A 2A9UA 2W2UA 2DL1A 5FVKA 5FVLA 2XZEA 1WCRA 4CN6A 2JQHA 4IT4A 2LRLA 5LB7B 2WWVA 1WR0A 2CPTA 2LRKA 4ZEYA 4U33A 4U3CA 4CN1A 5CGMA 4U7IA 4U2ZA 3ZSSA 2JQKA 1WFDA 2K3WA 2RPAA 3ZSTA 3ZT7A 4P1NA 4A5XA 4WZXA 3ZT5A 4NIQA 2V6XA 4U7YA 2V6YB 5CJ5A 2CRBA 2JQ9A 2MPKA 3K1SA 2V6YA 4U2YA 3ZT6A 1YXRA 3EABA 4CN4A
chains in the Genus database with same CATH superfamily
1Z8UA 5AQKB 4ZEYA 2X0LB 2VURA 4JI0T 4IE7A 1AJ3A 5JR9A 3AA0B 2VVNA 3C51A 4GIWA 2BKPA 3N5LA 4O4LE 4TV8E 3ZCIA 1ZEEA 2CCQA 2W62A 5L3FB 2MBGA 4LF4T 4P0AA 2CXFA 5LJNA 1T7SA 3ABVA 4TN7B 4ISTA 2RPAA 3AE6A 2X9HA 4Z91A 1HG5A 2CM0A 2V5CA 4OYJA 1NEKA 1W9RA 2C5KT 3IBPA 3BK9A 4H9QC 4X1KE 3ZC0A 2L9QA 3JC6D 4DNDA 4CXWA 4NUUA 5FVKA 3RIAA 5J2UE 3PTRB 2CLYB 4UVCB 2E9XA 2FJBA 2X51A 4QH4A 1QLBA 5HWYA 2V1DB 4IE5A 2LSGA 3KBTA 2WDVA 1W0AA 3WAKA 2WS3A 2V6XA 2XQ9A 3KV9A 4N78D 4JLEA 3C4WA 3N9LA 2CMRA 1IBLT 3QK6A 4LF6T 5ABFA 1YQ3A 2E5LT 3AEBA 3N2OA 2LRKA 3AEAA 2ZM2A 4A97A 4JI5T 2JMKA 2BZBA 5JDNA 3IEEA 2D0TA 1UUSA 5ABGA 2X9XA 3JAFA 1HNZT 2EHOB 2XAQB 1T72A 2Z6EA 5AFUL 3GA8A 4AKIA 1FIOA 2E5VA 5AQOB 2BG9B 5EZYE 4HKAA 2WU2A 1OXZA 3FB2A 5L2LA 5FP3A 3PE0A 4UXNB 3ZPOA 3KFWX 4TUYE 4AISA 5ABEA 1UX5A 2BBHA 4P1NA 2Q9QD 3ZN1B 3NBXX 4KI0F 2NW7A 2WCAA 4AKGA 2N1GA 2KWIB 4EEBA 3K1SA 3F2EA 4F8HA 5HEOA 3AAIA 4IGUA 3N2GE 3K3NA 2QRXA 3UFGA 4J2CA 3RIFA 3EHZA 4ZI3D 3I9YA 3PJAJ 1WFDA 1MNEA 3UU6A 1OEDB 5JTGA 2LSIA 2WP9A 3EDUA 2C5IT 5AQUB 2DLRA 4A56A 4UF0B 2H3RA 4NPPA 2XQ3A 5AQLB 1D1AA 4LFCT 2VKHA 3FXEB 5LGTB 2P9BA 2LSJA 2UXXB 1WLXA 5J1GA 3RKOA 5CFBA 1ZV4X 2KZ7B 3PUGA 3QC9A 1MIYA 4MHCA 1HX8A 3CK6A 4DV5T 3FHNA 4HFVA 5FL1A 2FJDA 2VWAA 4UEMA 3PV0F 2YDRA 5E0OA 4B3MT 2XTLA 1FEWA 4QXBB 5KXJA 1E7PA 2XQ7A 1XNRT 1WR0A 3ZLIA 2WB5A 2C5JA 2V26A 4AQFA 5IYZE 2LJLA 5LGUB 2SPCA 5HEHA 4MLKA 2Q9QA 4HFHA 4I0UA 4LMJA 5LP6E 5J2TE 1T8BA 2WWUA 3KV4A 5JQGE 1HR0T 2LM9A 2HPJA 3PU3A 4ZS2A 5L3GB 3AEGA 4H9NC 4YXDA 3KV6A 2YEVC 4EGWA 3ZMZB 3AAEB 3JCFA 3SS1A 2DI4A 3ETVA 4GK5E 4HWDA 3H3AA 5LHIB 4X62T 2CXLA 2ODVA 1NAFA 2BS2A 5HEUA 4X65T 5AQHB 4TWFA 2K3WA 4B3TT 1J1JA 2Y48B 5JVDE 5KDMC 4YJ2E 2H7OA 2K9AA 2XZEA 5AQVB 3RYFE 3AB3B 4CN1A 4ZXLA 2BVLA 4HFDA 4OHFA 4JI8T 3QOFA 4X20E 1KNPA 5LHHB 3L39A 2WAUA 2XQ4A 3SRZA 2FJAA 2V6YA 2OA5A 3PUWF 4U31A 1UCUA 4NXNT 2IUBA 3VU7H 5JR9C 1HCIA 5JREA 4LF8T 1HX1B 3VKGA 4YTPA 4EEDA 4OX9T 2XUEA 1D0ZA 3HKDE 3AECA 5KX5E 2M6IA 4CXYA 1MMGA 2XQ5A 2K48A 2IHR1 4TWHA 4CN6A 4ZS3A 3TLUA 2JJ9A 4TV9E 3AA1B 4UELA 2WM9A 4HWCA 4DR2T 3RIUA 3O9XA 5HXCA 4AI6A 3Q5WA 3RYHE 3ZT6A 3K3QC 2L8KA 2E9XC 3RQWA 4ILUA 4UIGA 3VRAA 3A7MA 3C4XA 3ZYMA 2PFVA 3J9X1 5LNKA 4JEHB 5JDLA 2YK0A 5JDMA 1U5PA 4U3CA 2A2FX 2DNXA 5J0ZA 3LBXB 4IL9A 3LSVA 4TNWA 4HWIB 5FKYA 3AE9A 4E7ZA 4DR7T 2ACXA 2QYWA 3BQLA 2BKOA 4IT4A 4JYAT 3CQXC 4ILAA 3VR8A 2G0UA 2BG9E 2W63A 1Z0PA 4ASKA 1N32T 2X68A 4DUYT 1KK7A 4U72A 5AQPB 1FJGT 1NWMX 3HL6A 4TZ4C 1X9BA 4E7SA 3FZMB 5LA6E 1BR1A 3JC6C 4YHJA 4AXPA 3UQ7A 2CWYA 1ZP0A 5LHGB 3EDVA 1HNWT 1Y01A 4P0BA 4A98A 5H6QB 3RI5A 1OEDE 2CWOA 3RF1A 4IDNA 3HKEE 3QNUA 4HN9A 2UUAT 2V8SV 4IL4A 5HXRA 3GN5A 2DWKA 2ZLYA 4EB6E 4QH1A 3EI0A 2UXNB 3RRWA 1WR6A 4GK0E 2I0MA 3UTKA 4EZ4A 4JI2T 4H9PC 3O4XE 4UVAB 3B13A 3UU5A 5HWXA 3RHWA 2H89A 4YT0A 4DV2T 2AXDS 4COFA 1HTJF 2VASA 3SOLA 4WNKA 4YSYA 1JNZA 4ZZCA 3PUXF 3CVRA 2XQ6A 3AVRA 3PU8A 3T1YT 2MTQA 4AQFC 4M1PA 2VQFT 4X5TA 4PJLA 2Q9QC 1S94A 4PK4A 5IHYA 1VCTA 4ERRA 2D9DA 2WMOA 5FNVE 3BQKA 2NW8A 2XAGB 3L3PA 4ZI3C 2XPKA 2E9XB 1LRZA 2XAHB 3RYIE 4EV6A 5HXEA 3AXJA 3NVOA 2X66A 1WCRA 4ANJA 3CWZB 3RRCA 2NTXA 4H9RC 5ABHA 3I0OA 4ZI7E 3S4UA 4O2AE 4I50E 3KVBA 1KFYA 2L3LA 3AE2A 4UV8B 4B6XA 5AQGB 2H7VC 4HFIA 3N9NA 3JADA 4P09A 4TWDA 4PK6A 3OBVE 5EK3A 4PJNA 4QWNB 2BVMA 4I43B 2V7IA 4KBMB 2UXBT 2ZMAA 3C98B 4IE0A 5LMNT 4V1Av 2XM2A 4MFRA 2YDQA 3MZKB 5DQWA 4IHJE 1MIWA 3P4RA 4IREA 1VCSA 2BG9A 1ZOYA 2RP4A 2WMNA 4KUMB 3AA7B 3CX8B 5AQTB 4DVDA 4QXCB 2LRLA 3N9MA 1T98A 3F57A 1CHUA 4AKLA 4EXTA 3ANWA 1MMNA 3RIUC 4H9OC 2X9WA 3ZT7A 4HFCA 4UR9A 1XWMA 5AQFB 1IBKT 4U7YA 2ES0A 4QHOA 5BMVE 2W00A 4GYSA 3PUZF 5F8PA 1IAPA 2WY2A 4ZHQE 3UT5E 4IIJE 3CKDA 3ONJA 4WW0A 5L3EB 4JUYA 3ZMVB 2XSBA 5L4HA 3ZYLA 1SUMB 4DV4T 2N9DA 2J4GA 4CZZB 1JNRA 2ODUA 5HCJA 3UULA 4QKNA 4UF0A 3UU4A 2IW5B 3Q5DA 1XDPA 2HPLA 1VRBA 2X0YA 5HXSA 1YKEB 2PBIA 4DBQA 5DABA 2WU5A 4ILCA 1KNRA 3TLSA 2MPKA 3EABA 1UX4A 4DR3T 3U3IA 1IJ6A 3TKLB 1IJ5A 1XZYA 3UU3A 3HR0A 3RLFF 3RC8A 1XNQT 3P4PA 4LFAT 2KXPB 3PUYF 3RPUA 2JQKA 3AVSA 2Q9QB 5IWAT 1BR4A 1M7KA 3PUQA 2BBJA 4O4IE 3T1HT 2YN6A 4MALA 3SFEA 1FMWA 2LKGA 1X79A 4U33A 2W61A 3KV5A 3LJCA 2VKJA 4DBRA 4K0KT 3ZSTA 1IZNB 3TLWA 2KWHA 2B76A 4HFBA 3EVYA 5L3DB 5AQNB 2VL8A 3C4ZA 2CEAA 4PW8A 2Y8DA 3JAEA 1SHZC 4CXXA 5FXWA 4LFBT 1OWAA 2LKHA 4ZZBA 1Y64B 2KT9A 2X67A 5LMUT 2VKDA 2UXCT 2BKNA 3ZMSB 5M4YA 3PUVF 3W15B 1KF6A 3QB5K 4TNVA 3LK2B 5L3CB 5FL0A 3A5XA 2LLYA 3UUNA 2XQAA 4HWFA 2V6YB 4KHPT 1QSDA 5JRCA 4YLHA 5A1LA 2DL1A 3ONXA 3O1HA 4WBNE 1MNDA 2WDRA 5AQMB 3RQUA 4OFZA 2XSAA 1GQEA 2BS3A 2LM2A 2JQQA 4PJMA 3OKQA 3G06A 3RKGA 1D0XA 5LGNB 2MOZA 4CN4A 3GMIA 2XQYA 3ZN0B 3ZCJA 4C91A 3I0QA 2PG8A 3AEFA 4K0UA 3FBLA 3PUAA 3TLTA 4QXHB 3OPCA 1XDOA 5LYJE 5AQIB 5L4EA 3TLVA 4Z90A 3I9WA 2KSRA 3SWHA 5AQRB 2CPTA 3CQCB 5AQJB 3H37A 2M67A 3V5SA 4L5GA 4OK0A 2XJ7A 3HKBE 1LVFA 5F3JA 2VK9A 4O4HE 4H9SE 2CRBA 2V7KA 3P7IA 2OV9A 2LT3A 4DMVA 5AQQB 3AEDA 3OVUA 3NRYA 5LB7B 5FY0A 3FXDB 2CBIA 4EZHA 1S35A 3CX6B 5FXVA 2WZHA 3D0TA 4HE8A 3PJAA 5FXXA 2OLTA 1ZHCA 2DCFA 3X1DA 3Q5XA 2W0GA 2WWVA 4EYUA 1V9DA 4XZCA 2LHRA 2X9YA 1ZKEA 2CBJA 3VHLA 4BA9A 4FI5A 3I1AA 3RYCE 2W66A 4H63H 3SFDA 2H88A 3MK7C 4IDQA 3DJBA 3FZHB 2V7MA 3RX6A 4Z8XA 4Q25A 1HG2A 4CQIA 2A72A 4AKHA 1MIVA 4IDOA 2C0SA 2BG9C 1LVKA 3E22E 3B5MA 5ETWA 5LJMA 3RC3A 2V5DA 3V5UA 4CI3B 3UUMA 1YW0A 5HAXA 4JBWF 4JEUB 3R6NA 4X66T 5FMNA 4NIQA 4DR4T 3GN5B 3LFMA 3ZYKA 2W2UA 2I59A 3MACA 1W0BA 3A8YC 1E2AA 4YTNA 5CB4E 2PJQA 2W67A 2B1EA 4YY3T 4YHHT 2UXDT 5CJ5A 3P50A 2LE8A 3ESLA 2J62A 3WI3A 1YQ4A 1KNZA 4CI1B 3C64A 1MMDA 2I6HA 3FBZA 3ZKRA 5JR9B 3T8OA 3R84B 1WYBA 2XY8B 2IDOB 2JRKA 2KLQA 4B3RT 3CQGB 2CHNA 2XAJB 1D0YA 2KINB 4DUZT 4LF7T 4EIWA 3AA6B 2NP9A 4UV9B 4DR5T 3NZPA 4ZI2C 4BJMA 4DV3T 1SE7A 2RA1A 4QX7B 5EK4A 4JI4T 1U4QA 2VL0A 3UUXB 2W4XA 3EAMA 3KVAA 3QB5A 2ZM6T 5L47A 2WBLA 2K24A 4XBFB 3AE5A 3AXJB 4L9IA 1B7TA 3HI2A 2IIUA 2AE9A 2QGSA 4YTMA 5ABFB 5LG4A 4LMKA 2LOPA 1I6ZA 4GOUA 2M6BA 4ZOLE 4BAYB 4BJNA 3P4WA 4DMWA 4QH5A 1G73A 5FXZA 3EUHA 3P4SA 2NWBA 2XAFB 1XMOT 3FZLB 2JIWA 3NKZA 5CGMA 2NTYA 4HFEA 3VKHA 2Y6XA 3MXZA 3PDYA 2LHNA 5TAOA 2HN1A 4ADZA 3ZJ1A 4X1IE 3MKDA 2EHOA 5AQSB 4PJJA 5FVLA 2YDSA 4IE6A 4YFSA 3L8RA 3GWHA 2XM1A 3KDSE 5LBQB 2J47A 2KNDA 5CA1E 4ZI2D 4DV1T 1UGOA 3OYZA 2LOSA 4PAGA 4LF5T 4O8SA 2CA5A 2NOXA 3ZC1A 1YXRA 5ADXL 3J7Yq 2JQHA 4GKJT 2MYSA 1H7CA 4HTEA 2IMLA 1BR2A 5C2TA 3ANWB 2XQ8A 5JDQA 3AE7A 3VR9A 5C3JA 3OTOT 3CMLA 1MMAA 2LSYA 4PNIA 4AKRB 2VKOA 2V7JA 5L3BB 1D1CA 2BS4A 4G63A 4UVBB 2WQYA 1W09A 4QX8B 2E8IA 1KEYA 1LKXA 1OEDA 3NZQA 1IBMT 4DR6T 2A9UA 3AE3A 3CX7B 4HEAA 3UQ4A 5FY7A 4IDZA 4EYYR 4XAXB 3LDQB 5JDFA 4DR1T 4WBOA 2GK9A 2D5UA 1UURA 5F5WA 4AQYT 5H6RB 2D0UA 3PURA 2NR4A 2J1DG 4I4TE 1I94T 4PFPA 4U2ZA 2ACZA 3FZFB 3DP7A 3O1JA 2K5BB 4ISSA 2X0HA 2JPFA 1N36T 1US7B 1HFAA 1YKHB 4JV5T 4KMCA 3RH3A 3CIRA 2V7LA 2LSKA 4FJOA 3AE4A 5EK2A 2YU1A 3Q9DA 4LMLA 1DU2A 2IAKA 2D2SA 5BR8T 2JQ9A 4U74A 2ZM0A 2BDEA 4H63V 4CI2B 3BQIA 3VRBA 4PK5A 4JI7T 2CE7A 4LF9T 4NXMT 3ZEFB 2DWGA 3KINB 3RGLA 4YSXA 4F6RC 2N2NA 3NRXA 1UK5A 4DO0A 4GKKT 3U78A 1O3XA 1L0VA 1M62A 2JMHA 2YU2A 2VVSA 4DV6T 2PTFA 2VB6A 3M65A 2DHRA 3NWIA 5HEGA 4I55E 4L0RA 2UUBT 2YKSA 4KHZF 4TX5A 3AEEA 3Q2MA 5LG3A 5JRCB 3FZKB 1QUUA 4ILBA 5JH7E 2VQET 2XASB 4X1YE 2IC9A 5IUXA 4JI6T 4A5XA 2FJEA 4KP3C 1D1BA 3K3OA 4JI1T 4IE4A 3DTOA 4B3ST 2MAWA 4DV0T 3UUBA 5C8YE 3ZT5A 3N9QA 2HH7A 1WYCA 4OYKA 1HS7A 1R8IA 2FUPA 1EZ3A 3AE8A 3LG7A 2UUCT 3OYXA 3KBUA 2IC6A 2WSSV 3E08A 2QA7A 1XMQT 1N33T 3ZMUB 4AQGA 2CXDA 5LCYA 5CA0E 1BR0A 2YOEA 2QVAA 3QUJA 3AAAB 2FBWA 1NENA 1FMVA 3LK3B 3WAJA 3F31A 2CLYC 2NW9A 5HXHA 1HNXT 4EAHA 4HWHA 4YSZA 3HA4A 5LBMA 3PUSA 4WYVA 4C90A 3MJXA 3UU8A 4DIDB 3ZMTB 1G8XA 3ETUA 4U7IA 3ZSSA 3LBXA 2EHOC 3MA9A 5LOVE 1YD8G 4U2YA 5GONE 3N9OA 3K8PC 3C50A 2WZIA 4G2AA 5FYMA 4EOZB 4IDPA 2R6GF 4KX6A 4HGAA 1J5ET 2A3DA 1J5WA 4O4JE 3IA3A 3P4QA 2XHEB 5FY1A 2E2AA 5DQVA 4YJ3E 3IF8B 5HCMA 2WDQA 3ZJ2A 4X64T 3M3ZB 1N34T 4DV7T 2KMFA 4MBQA 5JDGA 3H3MA 2YINA 1CUNA 3O1IA 3B57A 2E9XD 4AIUA 3L09A 1HF8A 4GYRA 4O2BE 3P8CD 1OEDC 5JDHA 3IHRA 3AE1A 4JI3T 1WRDA 3OJAA 1E1HB 3UFEA 5HYAA 1VOMA 5LXTE 2CHOA 3CPZA 2F4VT 3E0ZA 4NUVA 2HHHT 3Q5EA 3HKCE 2LEHA 2HN2A 3N2KE 4PFOA 5HEJA 4WZXA 3LK42 2UU9T 1SA0E 2EHOD 5DJQC 3ONLC 5KMGP 3N9PA 2ZM8A
chains in the Genus database with same CATH topology
2WY2A 4U31A 2A9UA 2W2UA 2DL1A 5FVKA 5FVLA 2XZEA 1WCRA 4CN6A 2JQHA 4IT4A 2LRLA 5LB7B 2WWVA 1WR0A 2CPTA 2LRKA 4ZEYA 4U33A 4U3CA 4CN1A 5CGMA 4U7IA 4U2ZA 3ZSSA 2JQKA 1WFDA 2K3WA 2RPAA 3ZSTA 3ZT7A 4P1NA 4A5XA 4WZXA 3ZT5A 4NIQA 2V6XA 4U7YA 2V6YB 5CJ5A 2CRBA 2JQ9A 2MPKA 3K1SA 2V6YA 4U2YA 3ZT6A 1YXRA 3EABA 4CN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WY2 A;  4U31 A;  2A9U A;  2W2U A;  2DL1 A;  5FVK A;  5FVL A;  2XZE A;  1WCR A;  4CN6 A;  2JQH A;  4IT4 A;  2LRL A;  5LB7 B;  2WWV A;  1WR0 A;  2CPT A;  2LRK A;  4ZEY A;  4U33 A;  4U3C A;  4CN1 A;  5CGM A;  4U7I A;  4U2Z A;  3ZSS A;  2JQK A;  1WFD A;  2K3W A;  2RPA A;  3ZST A;  3ZT7 A;  4P1N A;  4A5X A;  4WZX A;  3ZT5 A;  4NIQ A;  2V6X A;  4U7Y A;  2V6Y B;  5CJ5 A;  2CRB A;  2JQ9 A;  2MPK A;  3K1S A;  2V6Y A;  4U2Y A;  3ZT6 A;  1YXR A;  3EAB A;  4CN4 A; 
#chains in the Genus database with same CATH topology
 1Z8U A;  5AQK B;  4ZEY A;  2X0L B;  2VUR A;  4JI0 T;  4IE7 A;  1AJ3 A;  5JR9 A;  3AA0 B;  2VVN A;  3C51 A;  4GIW A;  2BKP A;  3N5L A;  4O4L E;  4TV8 E;  3ZCI A;  1ZEE A;  2CCQ A;  2W62 A;  5L3F B;  2MBG A;  4LF4 T;  4P0A A;  2CXF A;  5LJN A;  1T7S A;  3ABV A;  4TN7 B;  4IST A;  2RPA A;  3AE6 A;  2X9H A;  4Z91 A;  1HG5 A;  2CM0 A;  2V5C A;  4OYJ A;  1NEK A;  1W9R A;  2C5K T;  3IBP A;  3BK9 A;  4H9Q C;  4X1K E;  3ZC0 A;  2L9Q A;  3JC6 D;  4DND A;  4CXW A;  4NUU A;  5FVK A;  3RIA A;  5J2U E;  3PTR B;  2CLY B;  4UVC B;  2E9X A;  2FJB A;  2X51 A;  4QH4 A;  1QLB A;  5HWY A;  2V1D B;  4IE5 A;  2LSG A;  3KBT A;  2WDV A;  1W0A A;  3WAK A;  2WS3 A;  2V6X A;  2XQ9 A;  3KV9 A;  4N78 D;  4JLE A;  3C4W A;  3N9L A;  2CMR A;  1IBL T;  3QK6 A;  4LF6 T;  5ABF A;  1YQ3 A;  2E5L T;  3AEB A;  3N2O A;  2LRK A;  3AEA A;  2ZM2 A;  4A97 A;  4JI5 T;  2JMK A;  2BZB A;  5JDN A;  3IEE A;  2D0T A;  1UUS A;  5ABG A;  2X9X A;  3JAF A;  1HNZ T;  2EHO B;  2XAQ B;  1T72 A;  2Z6E A;  5AFU L;  3GA8 A;  4AKI A;  1FIO A;  2E5V A;  5AQO B;  2BG9 B;  5EZY E;  4HKA A;  2WU2 A;  1OXZ A;  3FB2 A;  5L2L A;  5FP3 A;  3PE0 A;  4UXN B;  3ZPO A;  3KFW X;  4TUY E;  4AIS A;  5ABE A;  1UX5 A;  2BBH A;  4P1N A;  2Q9Q D;  3ZN1 B;  3NBX X;  4KI0 F;  2NW7 A;  2WCA A;  4AKG A;  2N1G A;  2KWI B;  4EEB A;  3K1S A;  3F2E A;  4F8H A;  5HEO A;  3AAI A;  4IGU A;  3N2G E;  3K3N A;  2QRX A;  3UFG A;  4J2C A;  3RIF A;  3EHZ A;  4ZI3 D;  3I9Y A;  3PJA J;  1WFD A;  1MNE A;  3UU6 A;  1OED B;  5JTG A;  2LSI A;  2WP9 A;  3EDU A;  2C5I T;  5AQU B;  2DLR A;  4A56 A;  4UF0 B;  2H3R A;  4NPP A;  2XQ3 A;  5AQL B;  1D1A A;  4LFC T;  2VKH A;  3FXE B;  5LGT B;  2P9B A;  2LSJ A;  2UXX B;  1WLX A;  5J1G A;  3RKO A;  5CFB A;  1ZV4 X;  2KZ7 B;  3PUG A;  3QC9 A;  1MIY A;  4MHC A;  1HX8 A;  3CK6 A;  4DV5 T;  3FHN A;  4HFV A;  5FL1 A;  2FJD A;  2VWA A;  4UEM A;  3PV0 F;  2YDR A;  5E0O A;  4B3M T;  2XTL A;  1FEW A;  4QXB B;  5KXJ A;  1E7P A;  2XQ7 A;  1XNR T;  1WR0 A;  3ZLI A;  2WB5 A;  2C5J A;  2V26 A;  4AQF A;  5IYZ E;  2LJL A;  5LGU B;  2SPC A;  5HEH A;  4MLK A;  2Q9Q A;  4HFH A;  4I0U A;  4LMJ A;  5LP6 E;  5J2T E;  1T8B A;  2WWU A;  3KV4 A;  5JQG E;  1HR0 T;  2LM9 A;  2HPJ A;  3PU3 A;  4ZS2 A;  5L3G B;  3AEG A;  4H9N C;  4YXD A;  3KV6 A;  2YEV C;  4EGW A;  3ZMZ B;  3AAE B;  3JCF A;  3SS1 A;  2DI4 A;  3ETV A;  4GK5 E;  4HWD A;  3H3A A;  5LHI B;  4X62 T;  2CXL A;  2ODV A;  1NAF A;  2BS2 A;  5HEU A;  4X65 T;  5AQH B;  4TWF A;  2K3W A;  4B3T T;  1J1J A;  2Y48 B;  5JVD E;  5KDM C;  4YJ2 E;  2H7O A;  2K9A A;  2XZE A;  5AQV B;  3RYF E;  3AB3 B;  4CN1 A;  4ZXL A;  2BVL A;  4HFD A;  4OHF A;  4JI8 T;  3QOF A;  4X20 E;  1KNP A;  5LHH B;  3L39 A;  2WAU A;  2XQ4 A;  3SRZ A;  2FJA A;  2V6Y A;  2OA5 A;  3PUW F;  4U31 A;  1UCU A;  4NXN T;  2IUB A;  3VU7 H;  5JR9 C;  1HCI A;  5JRE A;  4LF8 T;  1HX1 B;  3VKG A;  4YTP A;  4EED A;  4OX9 T;  2XUE A;  1D0Z A;  3HKD E;  3AEC A;  5KX5 E;  2M6I A;  4CXY A;  1MMG A;  2XQ5 A;  2K48 A;  2IHR 1;  4TWH A;  4CN6 A;  4ZS3 A;  3TLU A;  2JJ9 A;  4TV9 E;  3AA1 B;  4UEL A;  2WM9 A;  4HWC A;  4DR2 T;  3RIU A;  3O9X A;  5HXC A;  4AI6 A;  3Q5W A;  3RYH E;  3ZT6 A;  3K3Q C;  2L8K A;  2E9X C;  3RQW A;  4ILU A;  4UIG A;  3VRA A;  3A7M A;  3C4X A;  3ZYM A;  2PFV A;  3J9X 1;  5LNK A;  4JEH B;  5JDL A;  2YK0 A;  5JDM A;  1U5P A;  4U3C A;  2A2F X;  2DNX A;  5J0Z A;  3LBX B;  4IL9 A;  3LSV A;  4TNW A;  4HWI B;  5FKY A;  3AE9 A;  4E7Z A;  4DR7 T;  2ACX A;  2QYW A;  3BQL A;  2BKO A;  4IT4 A;  4JYA T;  3CQX C;  4ILA A;  3VR8 A;  2G0U A;  2BG9 E;  2W63 A;  1Z0P A;  4ASK A;  1N32 T;  2X68 A;  4DUY T;  1KK7 A;  4U72 A;  5AQP B;  1FJG T;  1NWM X;  3HL6 A;  4TZ4 C;  1X9B A;  4E7S A;  3FZM B;  5LA6 E;  1BR1 A;  3JC6 C;  4YHJ A;  4AXP A;  3UQ7 A;  2CWY A;  1ZP0 A;  5LHG B;  3EDV A;  1HNW T;  1Y01 A;  4P0B A;  4A98 A;  5H6Q B;  3RI5 A;  1OED E;  2CWO A;  3RF1 A;  4IDN A;  3HKE E;  3QNU A;  4HN9 A;  2UUA T;  2V8S V;  4IL4 A;  5HXR A;  3GN5 A;  2DWK A;  2ZLY A;  4EB6 E;  4QH1 A;  3EI0 A;  2UXN B;  3RRW A;  1WR6 A;  4GK0 E;  2I0M A;  3UTK A;  4EZ4 A;  4JI2 T;  4H9P C;  3O4X E;  4UVA B;  3B13 A;  3UU5 A;  5HWX A;  3RHW A;  2H89 A;  4YT0 A;  4DV2 T;  2AXD S;  4COF A;  1HTJ F;  2VAS A;  3SOL A;  4WNK A;  4YSY A;  1JNZ A;  4ZZC A;  3PUX F;  3CVR A;  2XQ6 A;  3AVR A;  3PU8 A;  3T1Y T;  2MTQ A;  4AQF C;  4M1P A;  2VQF T;  4X5T A;  4PJL A;  2Q9Q C;  1S94 A;  4PK4 A;  5IHY A;  1VCT A;  4ERR A;  2D9D A;  2WMO A;  5FNV E;  3BQK A;  2NW8 A;  2XAG B;  3L3P A;  4ZI3 C;  2XPK A;  2E9X B;  1LRZ A;  2XAH B;  3RYI E;  4EV6 A;  5HXE A;  3AXJ A;  3NVO A;  2X66 A;  1WCR A;  4ANJ A;  3CWZ B;  3RRC A;  2NTX A;  4H9R C;  5ABH A;  3I0O A;  4ZI7 E;  3S4U A;  4O2A E;  4I50 E;  3KVB A;  1KFY A;  2L3L A;  3AE2 A;  4UV8 B;  4B6X A;  5AQG B;  2H7V C;  4HFI A;  3N9N A;  3JAD A;  4P09 A;  4TWD A;  4PK6 A;  3OBV E;  5EK3 A;  4PJN A;  4QWN B;  2BVM A;  4I43 B;  2V7I A;  4KBM B;  2UXB T;  2ZMA A;  3C98 B;  4IE0 A;  5LMN T;  4V1A v;  2XM2 A;  4MFR A;  2YDQ A;  3MZK B;  5DQW A;  4IHJ E;  1MIW A;  3P4R A;  4IRE A;  1VCS A;  2BG9 A;  1ZOY A;  2RP4 A;  2WMN A;  4KUM B;  3AA7 B;  3CX8 B;  5AQT B;  4DVD A;  4QXC B;  2LRL A;  3N9M A;  1T98 A;  3F57 A;  1CHU A;  4AKL A;  4EXT A;  3ANW A;  1MMN A;  3RIU C;  4H9O C;  2X9W A;  3ZT7 A;  4HFC A;  4UR9 A;  1XWM A;  5AQF B;  1IBK T;  4U7Y A;  2ES0 A;  4QHO A;  5BMV E;  2W00 A;  4GYS A;  3PUZ F;  5F8P A;  1IAP A;  2WY2 A;  4ZHQ E;  3UT5 E;  4IIJ E;  3CKD A;  3ONJ A;  4WW0 A;  5L3E B;  4JUY A;  3ZMV B;  2XSB A;  5L4H A;  3ZYL A;  1SUM B;  4DV4 T;  2N9D A;  2J4G A;  4CZZ B;  1JNR A;  2ODU A;  5HCJ A;  3UUL A;  4QKN A;  4UF0 A;  3UU4 A;  2IW5 B;  3Q5D A;  1XDP A;  2HPL A;  1VRB A;  2X0Y A;  5HXS A;  1YKE B;  2PBI A;  4DBQ A;  5DAB A;  2WU5 A;  4ILC A;  1KNR A;  3TLS A;  2MPK A;  3EAB A;  1UX4 A;  4DR3 T;  3U3I A;  1IJ6 A;  3TKL B;  1IJ5 A;  1XZY A;  3UU3 A;  3HR0 A;  3RLF F;  3RC8 A;  1XNQ T;  3P4P A;  4LFA T;  2KXP B;  3PUY F;  3RPU A;  2JQK A;  3AVS A;  2Q9Q B;  5IWA T;  1BR4 A;  1M7K A;  3PUQ A;  2BBJ A;  4O4I E;  3T1H T;  2YN6 A;  4MAL A;  3SFE A;  1FMW A;  2LKG A;  1X79 A;  4U33 A;  2W61 A;  3KV5 A;  3LJC A;  2VKJ A;  4DBR A;  4K0K T;  3ZST A;  1IZN B;  3TLW A;  2KWH A;  2B76 A;  4HFB A;  3EVY A;  5L3D B;  5AQN B;  2VL8 A;  3C4Z A;  2CEA A;  4PW8 A;  2Y8D A;  3JAE A;  1SHZ C;  4CXX A;  5FXW A;  4LFB T;  1OWA A;  2LKH A;  4ZZB A;  1Y64 B;  2KT9 A;  2X67 A;  5LMU T;  2VKD A;  2UXC T;  2BKN A;  3ZMS B;  5M4Y A;  3PUV F;  3W15 B;  1KF6 A;  3QB5 K;  4TNV A;  3LK2 B;  5L3C B;  5FL0 A;  3A5X A;  2LLY A;  3UUN A;  2XQA A;  4HWF A;  2V6Y B;  4KHP T;  1QSD A;  5JRC A;  4YLH A;  5A1L A;  2DL1 A;  3ONX A;  3O1H A;  4WBN E;  1MND A;  2WDR A;  5AQM B;  3RQU A;  4OFZ A;  2XSA A;  1GQE A;  2BS3 A;  2LM2 A;  2JQQ A;  4PJM A;  3OKQ A;  3G06 A;  3RKG A;  1D0X A;  5LGN B;  2MOZ A;  4CN4 A;  3GMI A;  2XQY A;  3ZN0 B;  3ZCJ A;  4C91 A;  3I0Q A;  2PG8 A;  3AEF A;  4K0U A;  3FBL A;  3PUA A;  3TLT A;  4QXH B;  3OPC A;  1XDO A;  5LYJ E;  5AQI B;  5L4E A;  3TLV A;  4Z90 A;  3I9W A;  2KSR A;  3SWH A;  5AQR B;  2CPT A;  3CQC B;  5AQJ B;  3H37 A;  2M67 A;  3V5S A;  4L5G A;  4OK0 A;  2XJ7 A;  3HKB E;  1LVF A;  5F3J A;  2VK9 A;  4O4H E;  4H9S E;  2CRB A;  2V7K A;  3P7I A;  2OV9 A;  2LT3 A;  4DMV A;  5AQQ B;  3AED A;  3OVU A;  3NRY A;  5LB7 B;  5FY0 A;  3FXD B;  2CBI A;  4EZH A;  1S35 A;  3CX6 B;  5FXV A;  2WZH A;  3D0T A;  4HE8 A;  3PJA A;  5FXX A;  2OLT A;  1ZHC A;  2DCF A;  3X1D A;  3Q5X A;  2W0G A;  2WWV A;  4EYU A;  1V9D A;  4XZC A;  2LHR A;  2X9Y A;  1ZKE A;  2CBJ A;  3VHL A;  4BA9 A;  4FI5 A;  3I1A A;  3RYC E;  2W66 A;  4H63 H;  3SFD A;  2H88 A;  3MK7 C;  4IDQ A;  3DJB A;  3FZH B;  2V7M A;  3RX6 A;  4Z8X A;  4Q25 A;  1HG2 A;  4CQI A;  2A72 A;  4AKH A;  1MIV A;  4IDO A;  2C0S A;  2BG9 C;  1LVK A;  3E22 E;  3B5M A;  5ETW A;  5LJM A;  3RC3 A;  2V5D A;  3V5U A;  4CI3 B;  3UUM A;  1YW0 A;  5HAX A;  4JBW F;  4JEU B;  3R6N A;  4X66 T;  5FMN A;  4NIQ A;  4DR4 T;  3GN5 B;  3LFM A;  3ZYK A;  2W2U A;  2I59 A;  3MAC A;  1W0B A;  3A8Y C;  1E2A A;  4YTN A;  5CB4 E;  2PJQ A;  2W67 A;  2B1E A;  4YY3 T;  4YHH T;  2UXD T;  5CJ5 A;  3P50 A;  2LE8 A;  3ESL A;  2J62 A;  3WI3 A;  1YQ4 A;  1KNZ A;  4CI1 B;  3C64 A;  1MMD A;  2I6H A;  3FBZ A;  3ZKR A;  5JR9 B;  3T8O A;  3R84 B;  1WYB A;  2XY8 B;  2IDO B;  2JRK A;  2KLQ A;  4B3R T;  3CQG B;  2CHN A;  2XAJ B;  1D0Y A;  2KIN B;  4DUZ T;  4LF7 T;  4EIW A;  3AA6 B;  2NP9 A;  4UV9 B;  4DR5 T;  3NZP A;  4ZI2 C;  4BJM A;  4DV3 T;  1SE7 A;  2RA1 A;  4QX7 B;  5EK4 A;  4JI4 T;  1U4Q A;  2VL0 A;  3UUX B;  2W4X A;  3EAM A;  3KVA A;  3QB5 A;  2ZM6 T;  5L47 A;  2WBL A;  2K24 A;  4XBF B;  3AE5 A;  3AXJ B;  4L9I A;  1B7T A;  3HI2 A;  2IIU A;  2AE9 A;  2QGS A;  4YTM A;  5ABF B;  5LG4 A;  4LMK A;  2LOP A;  1I6Z A;  4GOU A;  2M6B A;  4ZOL E;  4BAY B;  4BJN A;  3P4W A;  4DMW A;  4QH5 A;  1G73 A;  5FXZ A;  3EUH A;  3P4S A;  2NWB A;  2XAF B;  1XMO T;  3FZL B;  2JIW A;  3NKZ A;  5CGM A;  2NTY A;  4HFE A;  3VKH A;  2Y6X A;  3MXZ A;  3PDY A;  2LHN A;  5TAO A;  2HN1 A;  4ADZ A;  3ZJ1 A;  4X1I E;  3MKD A;  2EHO A;  5AQS B;  4PJJ A;  5FVL A;  2YDS A;  4IE6 A;  4YFS A;  3L8R A;  3GWH A;  2XM1 A;  3KDS E;  5LBQ B;  2J47 A;  2KND A;  5CA1 E;  4ZI2 D;  4DV1 T;  1UGO A;  3OYZ A;  2LOS A;  4PAG A;  4LF5 T;  4O8S A;  2CA5 A;  2NOX A;  3ZC1 A;  1YXR A;  5ADX L;  3J7Y q;  2JQH A;  4GKJ T;  2MYS A;  1H7C A;  4HTE A;  2IML A;  1BR2 A;  5C2T A;  3ANW B;  2XQ8 A;  5JDQ A;  3AE7 A;  3VR9 A;  5C3J A;  3OTO T;  3CML A;  1MMA A;  2LSY A;  4PNI A;  4AKR B;  2VKO A;  2V7J A;  5L3B B;  1D1C A;  2BS4 A;  4G63 A;  4UVB B;  2WQY A;  1W09 A;  4QX8 B;  2E8I A;  1KEY A;  1LKX A;  1OED A;  3NZQ A;  1IBM T;  4DR6 T;  2A9U A;  3AE3 A;  3CX7 B;  4HEA A;  3UQ4 A;  5FY7 A;  4IDZ A;  4EYY R;  4XAX B;  3LDQ B;  5JDF A;  4DR1 T;  4WBO A;  2GK9 A;  2D5U A;  1UUR A;  5F5W A;  4AQY T;  5H6R B;  2D0U A;  3PUR A;  2NR4 A;  2J1D G;  4I4T E;  1I94 T;  4PFP A;  4U2Z A;  2ACZ A;  3FZF B;  3DP7 A;  3O1J A;  2K5B B;  4ISS A;  2X0H A;  2JPF A;  1N36 T;  1US7 B;  1HFA A;  1YKH B;  4JV5 T;  4KMC A;  3RH3 A;  3CIR A;  2V7L A;  2LSK A;  4FJO A;  3AE4 A;  5EK2 A;  2YU1 A;  3Q9D A;  4LML A;  1DU2 A;  2IAK A;  2D2S A;  5BR8 T;  2JQ9 A;  4U74 A;  2ZM0 A;  2BDE A;  4H63 V;  4CI2 B;  3BQI A;  3VRB A;  4PK5 A;  4JI7 T;  2CE7 A;  4LF9 T;  4NXM T;  3ZEF B;  2DWG A;  3KIN B;  3RGL A;  4YSX A;  4F6R C;  2N2N A;  3NRX A;  1UK5 A;  4DO0 A;  4GKK T;  3U78 A;  1O3X A;  1L0V A;  1M62 A;  2JMH A;  2YU2 A;  2VVS A;  4DV6 T;  2PTF A;  2VB6 A;  3M65 A;  2DHR A;  3NWI A;  5HEG A;  4I55 E;  4L0R A;  2UUB T;  2YKS A;  4KHZ F;  4TX5 A;  3AEE A;  3Q2M A;  5LG3 A;  5JRC B;  3FZK B;  1QUU A;  4ILB A;  5JH7 E;  2VQE T;  2XAS B;  4X1Y E;  2IC9 A;  5IUX A;  4JI6 T;  4A5X A;  2FJE A;  4KP3 C;  1D1B A;  3K3O A;  4JI1 T;  4IE4 A;  3DTO A;  4B3S T;  2MAW A;  4DV0 T;  3UUB A;  5C8Y E;  3ZT5 A;  3N9Q A;  2HH7 A;  1WYC A;  4OYK A;  1HS7 A;  1R8I A;  2FUP A;  1EZ3 A;  3AE8 A;  3LG7 A;  2UUC T;  3OYX A;  3KBU A;  2IC6 A;  2WSS V;  3E08 A;  2QA7 A;  1XMQ T;  1N33 T;  3ZMU B;  4AQG A;  2CXD A;  5LCY A;  5CA0 E;  1BR0 A;  2YOE A;  2QVA A;  3QUJ A;  3AAA B;  2FBW A;  1NEN A;  1FMV A;  3LK3 B;  3WAJ A;  3F31 A;  2CLY C;  2NW9 A;  5HXH A;  1HNX T;  4EAH A;  4HWH A;  4YSZ A;  3HA4 A;  5LBM A;  3PUS A;  4WYV A;  4C90 A;  3MJX A;  3UU8 A;  4DID B;  3ZMT B;  1G8X A;  3ETU A;  4U7I A;  3ZSS A;  3LBX A;  2EHO C;  3MA9 A;  5LOV E;  1YD8 G;  4U2Y A;  5GON E;  3N9O A;  3K8P C;  3C50 A;  2WZI A;  4G2A A;  5FYM A;  4EOZ B;  4IDP A;  2R6G F;  4KX6 A;  4HGA A;  1J5E T;  2A3D A;  1J5W A;  4O4J E;  3IA3 A;  3P4Q A;  2XHE B;  5FY1 A;  2E2A A;  5DQV A;  4YJ3 E;  3IF8 B;  5HCM A;  2WDQ A;  3ZJ2 A;  4X64 T;  3M3Z B;  1N34 T;  4DV7 T;  2KMF A;  4MBQ A;  5JDG A;  3H3M A;  2YIN A;  1CUN A;  3O1I A;  3B57 A;  2E9X D;  4AIU A;  3L09 A;  1HF8 A;  4GYR A;  4O2B E;  3P8C D;  1OED C;  5JDH A;  3IHR A;  3AE1 A;  4JI3 T;  1WRD A;  3OJA A;  1E1H B;  3UFE A;  5HYA A;  1VOM A;  5LXT E;  2CHO A;  3CPZ A;  2F4V T;  3E0Z A;  4NUV A;  2HHH T;  3Q5E A;  3HKC E;  2LEH A;  2HN2 A;  3N2K E;  4PFO A;  5HEJ A;  4WZX A;  3LK4 2;  2UU9 T;  1SA0 E;  2EHO D;  5DJQ C;  3ONL C;  5KMG P;  3N9P A;  2ZM8 A; 
#chains in the Genus database with same CATH homology
 2WY2 A;  4U31 A;  2A9U A;  2W2U A;  2DL1 A;  5FVK A;  5FVL A;  2XZE A;  1WCR A;  4CN6 A;  2JQH A;  4IT4 A;  2LRL A;  5LB7 B;  2WWV A;  1WR0 A;  2CPT A;  2LRK A;  4ZEY A;  4U33 A;  4U3C A;  4CN1 A;  5CGM A;  4U7I A;  4U2Z A;  3ZSS A;  2JQK A;  1WFD A;  2K3W A;  2RPA A;  3ZST A;  3ZT7 A;  4P1N A;  4A5X A;  4WZX A;  3ZT5 A;  4NIQ A;  2V6X A;  4U7Y A;  2V6Y B;  5CJ5 A;  2CRB A;  2JQ9 A;  2MPK A;  3K1S A;  2V6Y A;  4U2Y A;  3ZT6 A;  1YXR A;  3EAB A;  4CN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...