4NUVA

Heterotetramer structure of region ii from plasmodium vivax duffy binding protein (pvdbp) bound to the ectodomain of the duffy antigen receptor for chemokines (darc)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
298
structure length
288
Chain Sequence
NTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVFHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Duffy receptor
publication title Red Blood Cell Invasion by Plasmodium vivax: Structural Basis for DBP Engagement of DARC.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Membrane protein, cell invasion
total genus 113
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4nuvA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4nuvA01
4YFSA 4NUVA 3BQKA 3RRCA 2Y8DA 3BQLA 3C64A 4NUUA 2YK0A 2WAUA 3CPZA 5F3JA 3BQIA 2XU0A 3CMLA
chains in the Genus database with same CATH superfamily
2LM9A 3PUWF 3LDQB 2IHR1 2XAHB 4DR3T 4ZZBA 5JDHA 5HAXA 1ZV4X 5LHGB 3UUXB 3OPCA 4OHFA 4A98A 4JV5T 4A5XA 1LKXA 3MACA 3FBLA 2CE7A 5L3DB 3IEEA 4O2AE 2QGSA 2E2AA 3L8RA 5LP6E 4H63V 4U3CA 4HGAA 3ZCJA 3ZMVB 2ES0A 3DTOA 5FXVA 5FYMA 2XQ6A 2WCAA 4Q25A 5HEOA 3NWIA 4EGWA 2WZHA 4I0UA 4U7YA 3ETVA 2CWOA 3ZC1A 2HN2A 2GK9A 3Q5XA 3L39A 2LSGA 3FHNA 4DR1T 1E1HB 4G2AA 4QX8B 5JVDE 2CBJA 2XHEB 4DV0T 3VRBA 2WZKA 3N5LA 1VOMA 2H89A 3UFGA 4ZS3A 4IE0A 1W09A 4PK6A 4OX9T 1L0VA 1LDKB 1X79A 4YTMA 5H6QB 2WB5A 3SRZA 4DVDA 2FBWA 3H37A 4EEDA 1ZOYA 1OEDB 3QB5A 2YKSA 1NEKA 1J5ET 2D9DA 5AQKB 3A5XA 1HNXT 3CX6B 3PUVF 1MIWA 3BQKA 3ZYKA 3UQ4A 2NR4A 2X67A 2BVLA 3VR8A 2FJBA 3DPLC 4LF8T 1U6GA 1AJ3A 1SUMB 1N36T 3Q5WA 2X51A 1IZNB 2V7IA 2HHHT 2LRLA 2CBIA 3Q2MA 5CA0E 4ZXLA 3TKLB 3OBVE 1MMNA 3PDYA 1KNZA 3OTOT 2KXPB 4DR2T 2VL0A 4JBWF 3UU4A 2WMNA 3O9XA 2N1GA 5LA6E 4GK5E 4PJJA 5J1GA 4UV9B 2EHOC 3DJBA 1UX5A 3J9X1 3RKOA 4YTNA 4AKRB 5DQWA 4IREA 2FJAA 4ERRA 1WFDA 4IL4A 2CLYB 1HNWT 1CHUA 3TLSA 4U33A 2LLYA 4JLEA 1YW0A 3LFMA 5LMUT 5F3JA 2H7VC 3LBXA 2V7MA 3UULA 2QA7A 2CHNA 2E5LT 1LRZA 3LK3B 2KLQA 4B3RT 2CXDA 2J4GA 2WS3A 3PV0F 2VKDA 3ZMUB 5JDQA 2A9UA 4WNKA 3W15B 2WDRA 3PJAJ 5AQTB 2E9XA 3ZYLA 5LGTB 3HA4A 3KBUA 5HEGA 3AEGA 3PUXF 2YK0A 2LJLA 4UF0A 1WLXA 5FY7A 3ONXA 4JGHD 3I0QA 1X9BA 5IHYA 2CHOA 4YHHT 2ZM6T 2B1EA 5AQUB 4CXXA 2WWUA 3BK9A 3PU8A 4HWDA 2FJEA 5J2TE 2WSSV 4E7ZA 1VCTA 1YKHB 5ABGA 3CQXC 4QKNA 4X66T 3TLTA 1MIVA 4AQFA 2C0SA 4UVAB 1QLBA 1D1CA 2C5JA 3EVYA 3KINB 3UU6A 1SA0E 4DNDA 4M1PA 4CN6A 4HFDA 2EHOA 1KEYA 4Z91A 2LSYA 3OJAA 1D0XA 1W9RA 3AAIA 1HG2A 2W62A 3UUNA 4DMWA 3ZSTA 4H9PC 5HWYA 4FI5A 3JCFA 1Y01A 1MMDA 5AQPB 4TWFA 4MFRA 2W63A 2XQ7A 5C8YE 1XNRT 3ONLC 3FXDB 4BA9A 4IHJE 5L3BB 3C98B 1HX1B 1Y64B 4DBRA 3CX8B 4B3ST 4LF6T 1IJ6A 4KI0F 2XQYA 4YLHA 4EYYR 4PFOA 5JR9A 5AQHB 4HFIA 2LSJA 2Y48B 2J1DG 5FMNA 5BR8T 2D5UA 2VWAA 1IAPA 3RYIE 3ZLIA 2ZLYA 4AKGA 2YEVC 4ZI3D 2X68A 4U72A 4QHOA 1KFYA 3AEFA 1HS7A 2ZM0A 2CXFA 2Y8DA 3BQLA 3GA8A 4GYSA 4WYVA 5M4YA 2YU1A 1T7SA 5HEJA 2LKGA 5LG4A 1ZKEA 2XAGB 2BBHA 1FEWA 2QVAA 5JREA 2F4VT 4ZS2A 5AQFB 3U78A 2D0TA 3KFWX 3TLWA 2V1DB 4CN4A 3HKDE 3TLUA 2V6YB 4KP3C 4EEBA 4QH4A 3IHRA 3P50A 4TUYE 4P1NA 4NUVA 3RYCE 4H9OC 3N9NA 5IUXA 3RHWA 3ZEFB 4QX7B 3RIUA 5HXCA 2V5DA 1SE7A 1Z8UA 4DMVA 1BR1A 3VRAA 4A64A 4HEAA 2BBJA 3P4RA 2MAWA 2CEAA 4GK0E 1S35A 3CK6A 3RYFE 4PK4A 2MBGA 4KHPT 1IBMT 1XDOA 2BVMA 5IYZE 3C50A 3A8YC 4ZI3C 2WMOA 3PUGA 2LM2A 3B57A 2DWKA 4ZHQE 3HKBE 2H88A 3OYZA 4DV7T 4HWCA 5L47A 3ZMTB 1KK7A 2W0GA 2Q9QB 3P4SA 3K3NA 4UVCB 3ZPOA 4U74A 3EUHA 4NXMT 4AQGA 5DQVA 3ESLA 4TX5A 5HXRA 1BR0A 4NIQA 3X1DA 2X66A 2NOXA 4UR9A 3B13A 3E22E 1HNZT 2PTFA 3CMLA 4IDOA 3RH3A 1JNZA 4KHZF 1W0BA 4YSZA 4CI1B 1UURA 4G63A 2PG8A 3AVRA 5BMVE 4ZZCA 1WCRA 5LXTE 1FIOA 3FZFB 2LEHA 5L2LA 3AXJA 3UFEA 4AKHA 5CGMA 3BQIA 3AEAA 5F8PA 5C2TA 3ZT5A 3K8PC 4AKLA 3AE8A 5JDMA 3NZQA 4LMKA 4EXTA 1FMWA 3GN5A 3AE9A 2E9XD 2IW5B 2VQET 2WQYA 4QXCB 2X9WA 3ZKRA 4F52A 5JDFA 3EABA 3U3IA 2BG9A 2I59A 3AEEA 4ISSA 2LKHA 4PJMA 2XZEA 5AQIB 4U7IA 2YU2A 4IDNA 3RQUA 3DP7A 3P8CD 4KMCA 2N2NA 4X1YE 4EYUA 2UUBT 2M6BA 3DQVC 4TN7B 2WP9A 4DUYT 2BG9E 2VKHA 3LG7A 3CKDA 2WY2A 5LHIB 1XMOT 1MIYA 1KF6A 2VKJA 2J62A 3ZC0A 3F57A 3UU3A 3IBPA 3B5MA 1UK5A 4O4JE 2WBLA 5ABFB 4HFVA 2PBIA 4ADZA 4LMJA 2EHOD 1T8BA 4HWFA 3CPZA 4CXYA 3FBZA 4ZI7E 1UX4A 3ANWA 4F6RC 3N2GE 3CQGB 5EZYE 2YDQA 5FL0A 1MNDA 2MYSA 1YKEB 1LVFA 4JI2T 3RKGA 4ZEYA 3M3ZB 4WW0A 3MA9A 3AB3B 2E9XC 3UU8A 5L4HA 3AA0B 4JYAT 4WQOD 3CQCB 2YDSA 3F31A 4MHCA 1IBLT 1H7CA 2IC6A 1UCUA 4ISTA 1Z0PA 4MBQA 2VVNA 2XQ8A 3ABVA 3R84B 3EAMA 3VU7H 2ZM8A 2N9DA 3ZT7A 2KWIB 2XQAA 4UVBB 2XM1A 4JI4T 1XDPA 4DR7T 5JRCB 1XWMA 4AQFC 2UU9T 4ANJA 3V5UA 3UQ7A 3ETUA 2RPAA 4DV1T 5LBQB 3H3MA 5DABA 1T72A 5ETWA 3JAFA 2C5KT 5LGUB 2W00A 4EOZB 3CX7B 2LSIA 5JDLA 5KX5E 4HFCA 2LSKA 2W2UA 5FXZA 5KDMC 1G8XA 3KVAA 2SPCA 2JJ9A 3PJAA 1SHZC 3OYXA 4KX6A 2ACXA 4YFSA 3KVBA 5CA1E 4AP2B 2CLYC 4O4IE 3N2OA 4KBMB 3MJXA 4B3TT 3AE3A 3AAEB 2M6IA 4CN1A 2BS2A 3LSVA 4LF7T 3RRCA 3P7IA 4WZXA 5JR9C 2ZMAA 5LG3A 2VURA 4IT4A 4I43B 3AA6B 2IDOB 1JNRA 3ZMSB 1XNQT 1LDKA 4TV9E 3RTRA 4H9QC 5EK2A 1D0ZA 2VL8A 2VQFT 1GQEA 2LOSA 1OEDA 3VKGA 4IL9A 2V5CA 1MNEA 4O4HE 2BKPA 3PE0A 5AQSB 4ILBA 1QUUA 5LYJE 2RP4A 1OEDE 3MKDA 3E08A 2VKOA 3AEDA 4ZOLE 1HX8A 1E2AA 2L8KA 3SS1A 2CWYA 3QOFA 4YSXA 2LHRA 1I94T 3QK6A 4L9IA 4GKKT 5LCYA 4AI6A 2P9BA 2Y6XA 1XZYA 1D0YA 3PURA 2J47A 1IJ5A 2QYWA 4IIJE 2WZIA 1UGOA 4GYRA 3SFEA 5FY0A 3TLVA 1N33T 3RIUC 2DWGA 4PJNA 2HN1A 4X65T 2WU5A 5LHHB 3AEBA 4A97A 4ZI2D 5LOVE 3NKZA 3O1HA 4TV8E 4I55E 3UU5A 2R6GF 2H3RA 3IF8B 5C3JA 2ZM2A 2XAQB 3ZMZB 1NWMX 4DIDB 2VVSA 4LFAT 4DV6T 4PW8A 5IWAT 4DV3T 3C64A 3ZT6A 2DNXA 1YQ3A 1FJGT 4JI3T 1EZ3A 4DR4T 2D0UA 2HH7A 3S4UA 1G73A 3QUJA 2A3DA 4DR6T 3AE6A 2UXCT 2MOZA 1QSDA 2L9QA 2BKOA 5L4EA 1W0AA 1VRBA 2IAKA 3K3QC 3C4ZA 2CM0A 3AA7B 2KSRA 2XTLA 5HCJA 1KNRA 1O3XA 2CMRA 2WM9A 5AQRB 1OXZA 1J5WA 2YDRA 4CZZB 2ACZA 4COFA 1WR0A 2CPTA 4E7SA 4CI2B 4ZI2C 1ZP0A 3RF1A 3HKEE 3I1AA 5FVKA 4YY3T 3I0OA 1U5PA 3AXJB 4Z90A 3F2EA 3QB5K 2JPFA 1ZHCA 4JI8T 1YD8G 3ZJ2A 5CJ5A 5AQLB 2QRXA 2X0LB 4OYJA 2V7LA 4IDPA 4K0KT 1T98A 5KMGP 1E7PA 5H6RB 4TNVA 3GN5B 5L3CB 4IE5A 5F5WA 4JI5T 3N9PA 3FB2A 2V7JA 1UUSA 4CQIA 3NRYA 2BKNA 3AE1A 2H7OA 4JEHB 4B3MT 4TWDA 1LDJA 2AXDS 5A1LA 2XSAA 2X9YA 1HFAA 2BG9C 4HWIB 4YT0A 4DV5T 1YXRA 4IGUA 3E0ZA 1D1BA 2K3WA 5FXXA 5LJMA 4P0BA 3UTKA 2X0HA 2CCQA 1BR4A 1VCSA 3CWZB 4EZHA 4BJNA 3CVRA 5EK3A 4U2YA 4HFHA 4H9SE 4JEUB 4ILAA 3RC8A 5JTGA 4QH5A 2X0YA 5LGNB 4L0RA 2Q9QC 4AKIA 4HFEA 4QH1A 2HPJA 3SFDA 3AECA 2VK9A 2LT3A 5AQVB 4X62T 2KT9A 3KDSE 2XQ3A 5HCMA 5KXJA 4L5GA 4OFZA 4F8HA 2CXLA 2IMLA 5LBMA 2NW7A 2IIUA 2XJ7A 2VASA 2W61A 3P4PA 2BS4A 2UXXB 2V6YA 4CXWA 2JMKA 3Q5DA 2E8IA 2XASB 3L09A 3PU3A 3N9MA 4YTPA 4FJOA 2XUEA 4HKAA 3LK42 3O1IA 4A56A 2XU0A 4B6XA 4P09A 1WYCA 2DL1A 4O4LE 2M67A 3N9QA 4EZ4A 1FMVA 3C4WA 3EHZA 3NVOA 4JI6T 4GOUA 2DI4A 3KV5A 4APFB 2V8SV 2JIWA 4X1KE 3P4WA 4HFBA 1M7KA 4AISA 1I6ZA 2Q9QA 2MPKA 2WDVA 5ADXL 4CI3B 4DO0A 3ONJA 5L3FB 2UXNB 3J7Yq 3LBXB 2I6HA 2WDQA 4UV8B 2BS3A 3AE2A 3P4QA 4YJ2E 5LJNA 1XMQT 4XAXB 3EDVA 2XAFB 4IE6A 2V7KA 3RIAA 4LFCT 2NWBA 3RX6A 2NTYA 2E9XB 4OK0A 2XQ5A 3RPUA 2DCFA 2OV9A 4UF0B 2A72A 5AQQB 4IE7A 3V5SA 2JQQA 5AQOB 2X9XA 2YOEA 5JDNA 4GKJT 5GONE 1HTJF 5LNKA 1N34T 3AE7A 1OEDC 1HF8A 2A2FX 2YINA 3NRXA 4U2ZA 3JADA 4KUMB 5HXEA 3T1HT 3AE5A 3HKCE 4X20E 2WU2A 5FNVE 3Q9DA 2OA5A 2L3LA 3IA3A 4IE4A 4EB6E 1IBKT 2JQ9A 4K0UA 4P5OA 4QXHB 3AVSA 5EK4A 1DU2A 2EHOB 2NTXA 3RIFA 4OYKA 5CB4E 3FZHB 2XAJB 3HR0A 4LFBT 2FUPA 4YJ3E 3MXZA 2I0MA 2IC9A 2V26A 3FXEB 1KNPA 2LOPA 3ZYMA 4NXNT 4J2CA 4JI1T 5JH7E 4TWHA 4AIUA 3G06A 2B76A 4PJLA 4UIGA 2LE8A 4LF5T 5L3EB 3GMIA 5HXHA 2PJQA 3ZSSA 3O1JA 5ABEA 5ABFA 1NAFA 3SOLA 3N9OA 3Q5EA 3WAKA 3RYHE 2UUAT 2ODVA 3HI2A 5HWXA 2IUBA 4JI7T 5JDGA 3QC9A 3FZLB 5JR9B 4PFPA 2CRBA 3L3PA 5ABHA 2LRKA 3RC3A 4O2BE 3NBXX 3QNUA 2K24A 3RLFF 4MLKA 3PUYF 3JC6D 3OVUA 2YN6A 4XZCA 4O8SA 3PUAA 4AQYT 3I9WA 4BAYB 5AQMB 4TNWA 1OWAA 3C4XA 4H9NC 1S94A 4ILUA 3D0TA 1HCIA 5HXSA 3RI5A 2WAUA 3WAJA 4EAHA 3KV6A 5AFUL 4H63H 2CA5A 2ODUA 1R8IA 5J0ZA 5FKYA 3CIRA 3FZKB 5JRCA 4PNIA 1WYBA 2C5IT 3ZN0B 3SWHA 4JI0T 5AQJB 4AXPA 3K1SA 2UXDT 4N9F3 3C51A 5LMNT 2JMHA 4MALA 4UELA 4X5TA 4C91A 5L3GB 1J1JA 5AQNB 4YXDA 3GWHA 3UUMA 2G0UA 3JAEA 5AQGB 2AE9A 4EV6A 3T8OA 3MZKB 3R6NA 3JC6C 2X9HA 1MMGA 4YHJA 2W66A 4IDQA 3A7MA 1HR0T 3WI3A 2Z6EA 2LHNA 2OLTA 4BJMA 4HE8A 1WRDA 4WBOA 1N32T 4UXNB 2BZBA 2NW8A 2K48A 2K5BB 2JQHA 3HL6A 4DBQA 2KMFA 4IDZA 4XBFB 2WWVA 3KBTA 4DUZT 2XQ9A 1YQ4A 2XPKA 3LJCA 3EDUA 4ILCA 4NUUA 4JUYA 2XM2A 4V1Av 4DV4T 4HXIB 3PTRB 2XY8B 4EIWA 4PAGA 4DV2T 1V9DA 1ZEEA 5E0OA 3ZJ1A 5FVLA 3ZCIA 3AE4A 5FY1A 4TZ4C 3ZN1B 5DJQC 4DR5T 1B7TA 2Q9QD 4PK5A 2KINB 4Z8XA 4ASKA 3H3AA 3PUZF 4H9RC 4I4TE 5TAOA 1D1AA 5J2UE 4NPPA 2PFVA 2NW9A 3K3OA 4LF9T 5HYAA 2DLRA 3N9LA 3KV9A 1M62A 2KZ7B 2UUCT 1U4QA 3AA1B 2W67A 2BDEA 5HEUA 1MMAA 3T1YT 1LVKA 4QWNB 4HTEA 3PUSA 4UEMA 2BG9B 3UT5E 2XQ4A 1BR2A 1NENA 3FZMB 3OKQA 1CUNA 3O4XE 3EI0A 2JRKA 2XSBA 2W4XA 3NZPA 5LB7B 2RA1A 2NP9A 4QXBB 4P0AA 2E5VA 3RGLA 4N78D 2FJDA 4HN9A 3MK7C 2K9AA 3KV4A 4U31A 4X1IE 3I9YA 3M65A 2VB6A 5HEHA 4HWHA 2V6XA 4X64T 3RRWA 2KWHA 3VKHA 5FL1A 2UXBT 2DHRA 4LF4T 3ANWB 3VR9A 3UUBA 1WR6A 3PUQA 5FP3A 2JQKA 4YSYA 5CFBA 4WBNE 2HPLA 3AAAB 5FXWA 2MTQA 4GIWA 2D2SA 4LMLA 3RQWA 2KNDA 4C90A 1HG5A 1US7B 3N2KE 3VHLA 3LK2B 5JQGE 4I50E
chains in the Genus database with same CATH topology
2CWYA 2OA5A 2L3LA 2LM9A 4NUVA 3RYCE 4H9OC 4IE4A 2XAHB 3N9NA 2LHRA 4EB6E 3ZEFB 3QK6A 5JDHA 4QX7B 4L9IA 5HAXA 5LCYA 4AI6A 2P9BA 1ZV4X 2Y6XA 4K0UA 1D0YA 4QXHB 5LHGB 3AVSA 5EK4A 3UUXB 2EHOB 5HXCA 3PURA 4OHFA 2NTXA 1LKXA 4OYKA 1IJ5A 5CB4E 2XAJB 3MACA 3HR0A 4IIJE 3FBLA 1BR1A 2CE7A 4DMVA 5L3DB 4HEAA 4YJ3E 4GYRA 5FY0A 3MXZA 2DWGA 2CEAA 4GK0E 4PJNA 1S35A 3IEEA 2IC9A 2V26A 4O2AE 2QGSA 3FXEB 3RYFE 2LOPA 3ZYMA 5LHHB 4J2CA 4PK4A 2MBGA 5LP6E 5JH7E 4ZI2D 4H63V 4HGAA 5LOVE 4PJLA 2BVMA 2LE8A 4UIGA 3O1HA 4TV8E 5IYZE 3ZCJA 3C50A 3ZMVB 4I55E 2ES0A 2WMOA 3PUGA 3B57A 3DTOA 4ZI3C 5L3EB 5FXVA 3GMIA 5FYMA 2H3RA 2DWKA 3IF8B 4ZHQE 3HKBE 5HXHA 2PJQA 2ZM2A 3OYZA 2XAQB 3O1JA 3ZMZB 1NWMX 3ZMTB 1KK7A 3ETVA 2W0GA 4PW8A 1NAFA 3SOLA 3C64A 2CWOA 3N9OA 3WAKA 2DNXA 2Q9QB 3RYHE 3ZC1A 2ODVA 3K3NA 1EZ3A 4UVCB 3HI2A 5HWXA 3ZPOA 2GK9A 2D0UA 3Q5XA 2HH7A 2LSGA 3FHNA 4U74A 3S4UA 1E1HB 3EUHA 1G73A 3QUJA 2A3DA 4G2AA 4AQGA 5DQVA 5JDGA 3QC9A 5JR9B 4PFPA 3ESLA 4QX8B 3L3PA 2MOZA 1QSDA 2L9QA 4TX5A 5HXRA 5JVDE 3RC3A 2XHEB 1BR0A 4O2BE 3NBXX 3N5LA 2X66A 1VOMA 2K24A 2NOXA 1VRBA 2IAKA 4MLKA 3JC6D 4ZS3A 3B13A 3K3QC 3E22E 4IE0A 3C4ZA 4PK6A 2CM0A 3AA7B 3CMLA 4XZCA 4O8SA 3PUAA 3RH3A 1X79A 5H6QB 2XTLA 3I9WA 3SRZA 4DVDA 1O3XA 4BAYB 4CI1B 2CMRA 1OWAA 3H37A 4G63A 2PG8A 3AVRA 2WM9A 3C4XA 4H9NC 1S94A 1OXZA 4ILUA 3D0TA 5BMVE 4CZZB 1HCIA 5LXTE 1FIOA 5HXSA 2WAUA 3WAJA 3A5XA 4EAHA 3KV6A 4E7SA 2LEHA 4CI2B 5AFUL 3CX6B 5L2LA 4H63H 1MIWA 3BQKA 3ZYKA 4ZI2C 3UFEA 4AKHA 2CA5A 2ODUA 3BQIA 3HKEE 2X67A 3I1AA 2BVLA 3I0OA 5F8PA 1U5PA 3K8PC 4AKLA 5JDMA 5JRCA 3F2EA 4PNIA 1AJ3A 1WYBA 3NZQA 2C5IT 2JPFA 3ZN0B 1ZHCA 3Q5WA 4EXTA 3SWHA 1FMWA 1YD8G 2X51A 3GN5A 3ZJ2A 1IZNB 2E9XD 2V7IA 2X0LB 2IW5B 4AXPA 4OYJA 2V7LA 3Q2MA 5CA0E 3TKLB 3C51A 1T98A 2JMHA 3OBVE 5KMGP 4MALA 5H6RB 3GN5B 1MMNA 3PDYA 4UELA 1KNZA 4QXCB 2X9WA 5L3CB 4C91A 4IE5A 2KXPB 3N9PA 5JDFA 3FB2A 5L3GB 2V7JA 2WMNA 3U3IA 2I59A 4CQIA 4ISSA 3NRYA 3O9XA 4PJMA 2N1GA 5LA6E 4GK5E 3GWHA 4PJJA 3UUMA 5J1GA 2G0UA 2H7OA 4JEHB 5A1LA 2YU2A 4UV9B 2EHOC 3DP7A 3P8CD 2X9YA 3T8OA 1HFAA 4KMCA 2N2NA 4X1YE 3DJBA 1UX5A 4EYUA 3MZKB 3R6NA 3J9X1 3RKOA 4AKRB 5DQWA 4TN7B 3JC6C 2VKHA 3LG7A 4ERRA 2X9HA 3CKDA 5LHIB 1MIYA 1MMGA 2CLYB 4IGUA 3E0ZA 4YHJA 1D1BA 2VKJA 5FXXA 5LJMA 4P0BA 3UTKA 2CCQA 3ZC0A 1BR4A 4JLEA 3F57A 1YW0A 3LFMA 4EZHA 3CWZB 3IBPA 5F3JA 4BJNA 3WI3A 2Z6EA 2LHNA 2H7VC 3LBXA 3CVRA 4O4JE 5EK3A 2WBLA 4BJMA 4HE8A 4HFVA 2V7MA 1WRDA 4WBOA 3UULA 2QA7A 2BZBA 2PBIA 4H9SE 4UXNB 2NW8A 1LRZA 2K48A 2KLQA 3LK3B 4JEUB 4ADZA 2EHOD 3RC8A 2K5BB 3HL6A 3CPZA 4DBQA 2CXDA 4CXYA 2KMFA 3FBZA 2VKDA 5LGNB 4IDZA 3ZMUB 4XBFB 4ZI7E 4L0RA 2Q9QC 3KBTA 5JDQA 1UX4A 3ANWA 4F6RC 4AKIA 3LJCA 3N2GE 3CQGB 5EZYE 3EDUA 4WNKA 3W15B 2HPJA 2E9XA 3ZYLA 5LGTB 1MNDA 3HA4A 2MYSA 3KBUA 1YKEB 2VK9A 4NUUA 1LVFA 2YK0A 2LJLA 2LT3A 4JUYA 4UF0A 4V1Av 1WLXA 2KT9A 5FY7A 3KDSE 4WW0A 3MA9A 3AB3B 2E9XC 3PTRB 4L5GA 4OFZA 3ONXA 4EIWA 3I0QA 5IHYA 2CXLA 4PAGA 3AA0B 5LBMA 2NW7A 1V9DA 1ZEEA 2B1EA 5E0OA 3ZJ1A 4CXXA 2VASA 2WWUA 3ZCIA 3CQCB 3BK9A 5FY1A 3F31A 4TZ4C 2W61A 4MHCA 3ZN1B 1H7CA 2IC6A 5DJQC 3PU8A 1UCUA 4ISTA 1B7TA 2Q9QD 5J2TE 2WSSV 1Z0PA 4MBQA 4PK5A 2UXXB 4E7ZA 1YKHB 3CQXC 4QKNA 4CXWA 2KINB 2JMKA 4Z8XA 3R84B 4ASKA 3H3AA 1MIVA 4AQFA 2C0SA 2ZM8A 4H9RC 4I4TE 5TAOA 3VU7H 1D1AA 4UVAB 5J2UE 2N9DA 1D1CA 2C5JA 2PFVA 3EVYA 2KWIB 2NW9A 4UVBB 3KINB 2E8IA 2XASB 3L09A 3K3OA 5JRCB 4AQFC 2DLRA 5HYAA 3PU3A 3N9LA 3KV9A 3N9MA 2KZ7B 1SA0E 4DNDA 4M1PA 1U4QA 4FJOA 4ANJA 3AA1B 2EHOA 2XUEA 3V5UA 2BDEA 4HKAA 3LK42 2LSYA 1MMAA 3ETUA 3O1IA 3OJAA 1D0XA 4A56A 1LVKA 2XU0A 4B6XA 4P09A 1WYCA 4QWNB 3AAIA 4HTEA 5LBQB 3PUSA 4UEMA 1HG2A 5DABA 4O4LE 2W62A 3UUNA 2M67A 3UT5E 5ETWA 3N9QA 4EZ4A 1BR2A 2C5KT 1FMVA 4DMWA 3C4WA 5LGUB 2W00A 4H9PC 3OKQA 1CUNA 3O4XE 5HWYA 3CX7B 4EOZB 2JRKA 4FI5A 2LSIA 5JDLA 5KX5E 1MMDA 4GOUA 3NZPA 2DI4A 3KV5A 2LSKA 2RA1A 2NP9A 4QXBB 5FXZA 4MFRA 2W63A 1G8XA 5KDMC 4P0AA 5C8YE 3FXDB 2SPCA 3KVAA 4BA9A 2JJ9A 4X1KE 4IHJE 5L3BB 1SHZC 4N78D 3C98B 1Y64B 3OYXA 4HN9A 4DBRA 3CX8B 3MK7C 2ACXA 2K9AA 2Q9QA 4YFSA 3KV4A 1IJ6A 5ADXL 4CI3B 2XQYA 4DO0A 3KVBA 4X1IE 4YLHA 2UXNB 4EYYR 3LBXB 4PFOA 5CA1E 5L3FB 2CLYC 4O4IE 4UV8B 3J7Yq 3I9YA 3M65A 3N2OA 2VB6A 5JR9A 4YJ2E 3RRWA 4KBMB 2LSJA 5LJNA 3MJXA 2KWHA 2Y48B 2J1DG 5FMNA 3VKHA 3AAEB 4XAXB 3EDVA 2XAFB 4IE6A 2DHRA 2V7KA 2D5UA 3RRCA 2VWAA 1IAPA 3P7IA 3RYIE 2NWBA 3RX6A 3ANWB 3ZLIA 5JR9C 2ZLYA 2NTYA 4AKGA 2YEVC 2ZMAA 4ZI3D 4I43B 3AA6B 2E9XB 4OK0A 3ZMSB 1WR6A 2X68A 3PUQA 4TV9E 4U72A 4QHOA 5FP3A 3RPUA 1HS7A 2ZM0A 4H9QC 2CXFA 2DCFA 2Y8DA 3BQLA 3GA8A 4UF0B 2A72A 4GYSA 5EK2A 4WBNE 5M4YA 2HPLA 2YU1A 1D0ZA 2VL8A 4IE7A 3V5SA 3AAAB 5FXWA 2LOSA 2MTQA 4GIWA 2D2SA 5LG4A 2JQQA 3VKGA 1ZKEA 2X9XA 2XAGB 1FEWA 2KNDA 5JDNA 5GONE 5JREA 1HTJF 5LNKA 1MNEA 4ZS2A 4C90A 3U78A 2D0TA 3KFWX 1HG5A 1US7B 4O4HE 2V1DB 3PE0A 1HF8A 3HKDE 2A2FX 2YINA 3N2KE 3NRXA 5LYJE 1QUUA 3VHLA 2RP4A 4KP3C 3MKDA 4KUMB 3LK2B 5JQGE 5HXEA 3E08A 2VKOA 3IHRA 4ZOLE 4TUYE 3HKCE 4X20E 5FNVE 1HX8A 4I50E 3Q9DA 2L8KA 3SS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFS A;  4NUV A;  3BQK A;  3RRC A;  2Y8D A;  3BQL A;  3C64 A;  4NUU A;  2YK0 A;  2WAU A;  3CPZ A;  5F3J A;  3BQI A;  2XU0 A;  3CML A; 
#chains in the Genus database with same CATH topology
 2LM9 A;  3PUW F;  3LDQ B;  2IHR 1;  2XAH B;  4DR3 T;  4ZZB A;  5JDH A;  5HAX A;  1ZV4 X;  5LHG B;  3UUX B;  3OPC A;  4OHF A;  4A98 A;  4JV5 T;  4A5X A;  1LKX A;  3MAC A;  3FBL A;  2CE7 A;  5L3D B;  3IEE A;  4O2A E;  2QGS A;  2E2A A;  3L8R A;  5LP6 E;  4H63 V;  4U3C A;  4HGA A;  3ZCJ A;  3ZMV B;  2ES0 A;  3DTO A;  5FXV A;  5FYM A;  2XQ6 A;  2WCA A;  4Q25 A;  5HEO A;  3NWI A;  4EGW A;  2WZH A;  4I0U A;  4U7Y A;  3ETV A;  2CWO A;  3ZC1 A;  2HN2 A;  2GK9 A;  3Q5X A;  3L39 A;  2LSG A;  3FHN A;  4DR1 T;  1E1H B;  4G2A A;  4QX8 B;  5JVD E;  2CBJ A;  2XHE B;  4DV0 T;  3VRB A;  2WZK A;  3N5L A;  1VOM A;  2H89 A;  3UFG A;  4ZS3 A;  4IE0 A;  1W09 A;  4PK6 A;  4OX9 T;  1L0V A;  1LDK B;  1X79 A;  4YTM A;  5H6Q B;  2WB5 A;  3SRZ A;  4DVD A;  2FBW A;  3H37 A;  4EED A;  1ZOY A;  1OED B;  3QB5 A;  2YKS A;  1NEK A;  1J5E T;  2D9D A;  5AQK B;  3A5X A;  1HNX T;  3CX6 B;  3PUV F;  1MIW A;  3BQK A;  3ZYK A;  3UQ4 A;  2NR4 A;  2X67 A;  2BVL A;  3VR8 A;  2FJB A;  3DPL C;  4LF8 T;  1U6G A;  1AJ3 A;  1SUM B;  1N36 T;  3Q5W A;  2X51 A;  1IZN B;  2V7I A;  2HHH T;  2LRL A;  2CBI A;  3Q2M A;  5CA0 E;  4ZXL A;  3TKL B;  3OBV E;  1MMN A;  3PDY A;  1KNZ A;  3OTO T;  2KXP B;  4DR2 T;  2VL0 A;  4JBW F;  3UU4 A;  2WMN A;  3O9X A;  2N1G A;  5LA6 E;  4GK5 E;  4PJJ A;  5J1G A;  4UV9 B;  2EHO C;  3DJB A;  1UX5 A;  3J9X 1;  3RKO A;  4YTN A;  4AKR B;  5DQW A;  4IRE A;  2FJA A;  4ERR A;  1WFD A;  4IL4 A;  2CLY B;  1HNW T;  1CHU A;  3TLS A;  4U33 A;  2LLY A;  4JLE A;  1YW0 A;  3LFM A;  5LMU T;  5F3J A;  2H7V C;  3LBX A;  2V7M A;  3UUL A;  2QA7 A;  2CHN A;  2E5L T;  1LRZ A;  3LK3 B;  2KLQ A;  4B3R T;  2CXD A;  2J4G A;  2WS3 A;  3PV0 F;  2VKD A;  3ZMU B;  5JDQ A;  2A9U A;  4WNK A;  3W15 B;  2WDR A;  3PJA J;  5AQT B;  2E9X A;  3ZYL A;  5LGT B;  3HA4 A;  3KBU A;  5HEG A;  3AEG A;  3PUX F;  2YK0 A;  2LJL A;  4UF0 A;  1WLX A;  5FY7 A;  3ONX A;  4JGH D;  3I0Q A;  1X9B A;  5IHY A;  2CHO A;  4YHH T;  2ZM6 T;  2B1E A;  5AQU B;  4CXX A;  2WWU A;  3BK9 A;  3PU8 A;  4HWD A;  2FJE A;  5J2T E;  2WSS V;  4E7Z A;  1VCT A;  1YKH B;  5ABG A;  3CQX C;  4QKN A;  4X66 T;  3TLT A;  1MIV A;  4AQF A;  2C0S A;  4UVA B;  1QLB A;  1D1C A;  2C5J A;  3EVY A;  3KIN B;  3UU6 A;  1SA0 E;  4DND A;  4M1P A;  4CN6 A;  4HFD A;  2EHO A;  1KEY A;  4Z91 A;  2LSY A;  3OJA A;  1D0X A;  1W9R A;  3AAI A;  1HG2 A;  2W62 A;  3UUN A;  4DMW A;  3ZST A;  4H9P C;  5HWY A;  4FI5 A;  3JCF A;  1Y01 A;  1MMD A;  5AQP B;  4TWF A;  4MFR A;  2W63 A;  2XQ7 A;  5C8Y E;  1XNR T;  3ONL C;  3FXD B;  4BA9 A;  4IHJ E;  5L3B B;  3C98 B;  1HX1 B;  1Y64 B;  4DBR A;  3CX8 B;  4B3S T;  4LF6 T;  1IJ6 A;  4KI0 F;  2XQY A;  4YLH A;  4EYY R;  4PFO A;  5JR9 A;  5AQH B;  4HFI A;  2LSJ A;  2Y48 B;  2J1D G;  5FMN A;  5BR8 T;  2D5U A;  2VWA A;  1IAP A;  3RYI E;  3ZLI A;  2ZLY A;  4AKG A;  2YEV C;  4ZI3 D;  2X68 A;  4U72 A;  4QHO A;  1KFY A;  3AEF A;  1HS7 A;  2ZM0 A;  2CXF A;  2Y8D A;  3BQL A;  3GA8 A;  4GYS A;  4WYV A;  5M4Y A;  2YU1 A;  1T7S A;  5HEJ A;  2LKG A;  5LG4 A;  1ZKE A;  2XAG B;  2BBH A;  1FEW A;  2QVA A;  5JRE A;  2F4V T;  4ZS2 A;  5AQF B;  3U78 A;  2D0T A;  3KFW X;  3TLW A;  2V1D B;  4CN4 A;  3HKD E;  3TLU A;  2V6Y B;  4KP3 C;  4EEB A;  4QH4 A;  3IHR A;  3P50 A;  4TUY E;  4P1N A;  4NUV A;  3RYC E;  4H9O C;  3N9N A;  5IUX A;  3RHW A;  3ZEF B;  4QX7 B;  3RIU A;  5HXC A;  2V5D A;  1SE7 A;  1Z8U A;  4DMV A;  1BR1 A;  3VRA A;  4A64 A;  4HEA A;  2BBJ A;  3P4R A;  2MAW A;  2CEA A;  4GK0 E;  1S35 A;  3CK6 A;  3RYF E;  4PK4 A;  2MBG A;  4KHP T;  1IBM T;  1XDO A;  2BVM A;  5IYZ E;  3C50 A;  3A8Y C;  4ZI3 C;  2WMO A;  3PUG A;  2LM2 A;  3B57 A;  2DWK A;  4ZHQ E;  3HKB E;  2H88 A;  3OYZ A;  4DV7 T;  4HWC A;  5L47 A;  3ZMT B;  1KK7 A;  2W0G A;  2Q9Q B;  3P4S A;  3K3N A;  4UVC B;  3ZPO A;  4U74 A;  3EUH A;  4NXM T;  4AQG A;  5DQV A;  3ESL A;  4TX5 A;  5HXR A;  1BR0 A;  4NIQ A;  3X1D A;  2X66 A;  2NOX A;  4UR9 A;  3B13 A;  3E22 E;  1HNZ T;  2PTF A;  3CML A;  4IDO A;  3RH3 A;  1JNZ A;  4KHZ F;  1W0B A;  4YSZ A;  4CI1 B;  1UUR A;  4G63 A;  2PG8 A;  3AVR A;  5BMV E;  4ZZC A;  1WCR A;  5LXT E;  1FIO A;  3FZF B;  2LEH A;  5L2L A;  3AXJ A;  3UFE A;  4AKH A;  5CGM A;  3BQI A;  3AEA A;  5F8P A;  5C2T A;  3ZT5 A;  3K8P C;  4AKL A;  3AE8 A;  5JDM A;  3NZQ A;  4LMK A;  4EXT A;  1FMW A;  3GN5 A;  3AE9 A;  2E9X D;  2IW5 B;  2VQE T;  2WQY A;  4QXC B;  2X9W A;  3ZKR A;  4F52 A;  5JDF A;  3EAB A;  3U3I A;  2BG9 A;  2I59 A;  3AEE A;  4ISS A;  2LKH A;  4PJM A;  2XZE A;  5AQI B;  4U7I A;  2YU2 A;  4IDN A;  3RQU A;  3DP7 A;  3P8C D;  4KMC A;  2N2N A;  4X1Y E;  4EYU A;  2UUB T;  2M6B A;  3DQV C;  4TN7 B;  2WP9 A;  4DUY T;  2BG9 E;  2VKH A;  3LG7 A;  3CKD A;  2WY2 A;  5LHI B;  1XMO T;  1MIY A;  1KF6 A;  2VKJ A;  2J62 A;  3ZC0 A;  3F57 A;  3UU3 A;  3IBP A;  3B5M A;  1UK5 A;  4O4J E;  2WBL A;  5ABF B;  4HFV A;  2PBI A;  4ADZ A;  4LMJ A;  2EHO D;  1T8B A;  4HWF A;  3CPZ A;  4CXY A;  3FBZ A;  4ZI7 E;  1UX4 A;  3ANW A;  4F6R C;  3N2G E;  3CQG B;  5EZY E;  2YDQ A;  5FL0 A;  1MND A;  2MYS A;  1YKE B;  1LVF A;  4JI2 T;  3RKG A;  4ZEY A;  3M3Z B;  4WW0 A;  3MA9 A;  3AB3 B;  2E9X C;  3UU8 A;  5L4H A;  3AA0 B;  4JYA T;  4WQO D;  3CQC B;  2YDS A;  3F31 A;  4MHC A;  1IBL T;  1H7C A;  2IC6 A;  1UCU A;  4IST A;  1Z0P A;  4MBQ A;  2VVN A;  2XQ8 A;  3ABV A;  3R84 B;  3EAM A;  3VU7 H;  2ZM8 A;  2N9D A;  3ZT7 A;  2KWI B;  2XQA A;  4UVB B;  2XM1 A;  4JI4 T;  1XDP A;  4DR7 T;  5JRC B;  1XWM A;  4AQF C;  2UU9 T;  4ANJ A;  3V5U A;  3UQ7 A;  3ETU A;  2RPA A;  4DV1 T;  5LBQ B;  3H3M A;  5DAB A;  1T72 A;  5ETW A;  3JAF A;  2C5K T;  5LGU B;  2W00 A;  4EOZ B;  3CX7 B;  2LSI A;  5JDL A;  5KX5 E;  4HFC A;  2LSK A;  2W2U A;  5FXZ A;  5KDM C;  1G8X A;  3KVA A;  2SPC A;  2JJ9 A;  3PJA A;  1SHZ C;  3OYX A;  4KX6 A;  2ACX A;  4YFS A;  3KVB A;  5CA1 E;  4AP2 B;  2CLY C;  4O4I E;  3N2O A;  4KBM B;  3MJX A;  4B3T T;  3AE3 A;  3AAE B;  2M6I A;  4CN1 A;  2BS2 A;  3LSV A;  4LF7 T;  3RRC A;  3P7I A;  4WZX A;  5JR9 C;  2ZMA A;  5LG3 A;  2VUR A;  4IT4 A;  4I43 B;  3AA6 B;  2IDO B;  1JNR A;  3ZMS B;  1XNQ T;  1LDK A;  4TV9 E;  3RTR A;  4H9Q C;  5EK2 A;  1D0Z A;  2VL8 A;  2VQF T;  1GQE A;  2LOS A;  1OED A;  3VKG A;  4IL9 A;  2V5C A;  1MNE A;  4O4H E;  2BKP A;  3PE0 A;  5AQS B;  4ILB A;  1QUU A;  5LYJ E;  2RP4 A;  1OED E;  3MKD A;  3E08 A;  2VKO A;  3AED A;  4ZOL E;  1HX8 A;  1E2A A;  2L8K A;  3SS1 A;  2CWY A;  3QOF A;  4YSX A;  2LHR A;  1I94 T;  3QK6 A;  4L9I A;  4GKK T;  5LCY A;  4AI6 A;  2P9B A;  2Y6X A;  1XZY A;  1D0Y A;  3PUR A;  2J47 A;  1IJ5 A;  2QYW A;  4IIJ E;  2WZI A;  1UGO A;  4GYR A;  3SFE A;  5FY0 A;  3TLV A;  1N33 T;  3RIU C;  2DWG A;  4PJN A;  2HN1 A;  4X65 T;  2WU5 A;  5LHH B;  3AEB A;  4A97 A;  4ZI2 D;  5LOV E;  3NKZ A;  3O1H A;  4TV8 E;  4I55 E;  3UU5 A;  2R6G F;  2H3R A;  3IF8 B;  5C3J A;  2ZM2 A;  2XAQ B;  3ZMZ B;  1NWM X;  4DID B;  2VVS A;  4LFA T;  4DV6 T;  4PW8 A;  5IWA T;  4DV3 T;  3C64 A;  3ZT6 A;  2DNX A;  1YQ3 A;  1FJG T;  4JI3 T;  1EZ3 A;  4DR4 T;  2D0U A;  2HH7 A;  3S4U A;  1G73 A;  3QUJ A;  2A3D A;  4DR6 T;  3AE6 A;  2UXC T;  2MOZ A;  1QSD A;  2L9Q A;  2BKO A;  5L4E A;  1W0A A;  1VRB A;  2IAK A;  3K3Q C;  3C4Z A;  2CM0 A;  3AA7 B;  2KSR A;  2XTL A;  5HCJ A;  1KNR A;  1O3X A;  2CMR A;  2WM9 A;  5AQR B;  1OXZ A;  1J5W A;  2YDR A;  4CZZ B;  2ACZ A;  4COF A;  1WR0 A;  2CPT A;  4E7S A;  4CI2 B;  4ZI2 C;  1ZP0 A;  3RF1 A;  3HKE E;  3I1A A;  5FVK A;  4YY3 T;  3I0O A;  1U5P A;  3AXJ B;  4Z90 A;  3F2E A;  3QB5 K;  2JPF A;  1ZHC A;  4JI8 T;  1YD8 G;  3ZJ2 A;  5CJ5 A;  5AQL B;  2QRX A;  2X0L B;  4OYJ A;  2V7L A;  4IDP A;  4K0K T;  1T98 A;  5KMG P;  1E7P A;  5H6R B;  4TNV A;  3GN5 B;  5L3C B;  4IE5 A;  5F5W A;  4JI5 T;  3N9P A;  3FB2 A;  2V7J A;  1UUS A;  4CQI A;  3NRY A;  2BKN A;  3AE1 A;  2H7O A;  4JEH B;  4B3M T;  4TWD A;  1LDJ A;  2AXD S;  5A1L A;  2XSA A;  2X9Y A;  1HFA A;  2BG9 C;  4HWI B;  4YT0 A;  4DV5 T;  1YXR A;  4IGU A;  3E0Z A;  1D1B A;  2K3W A;  5FXX A;  5LJM A;  4P0B A;  3UTK A;  2X0H A;  2CCQ A;  1BR4 A;  1VCS A;  3CWZ B;  4EZH A;  4BJN A;  3CVR A;  5EK3 A;  4U2Y A;  4HFH A;  4H9S E;  4JEU B;  4ILA A;  3RC8 A;  5JTG A;  4QH5 A;  2X0Y A;  5LGN B;  4L0R A;  2Q9Q C;  4AKI A;  4HFE A;  4QH1 A;  2HPJ A;  3SFD A;  3AEC A;  2VK9 A;  2LT3 A;  5AQV B;  4X62 T;  2KT9 A;  3KDS E;  2XQ3 A;  5HCM A;  5KXJ A;  4L5G A;  4OFZ A;  4F8H A;  2CXL A;  2IML A;  5LBM A;  2NW7 A;  2IIU A;  2XJ7 A;  2VAS A;  2W61 A;  3P4P A;  2BS4 A;  2UXX B;  2V6Y A;  4CXW A;  2JMK A;  3Q5D A;  2E8I A;  2XAS B;  3L09 A;  3PU3 A;  3N9M A;  4YTP A;  4FJO A;  2XUE A;  4HKA A;  3LK4 2;  3O1I A;  4A56 A;  2XU0 A;  4B6X A;  4P09 A;  1WYC A;  2DL1 A;  4O4L E;  2M67 A;  3N9Q A;  4EZ4 A;  1FMV A;  3C4W A;  3EHZ A;  3NVO A;  4JI6 T;  4GOU A;  2DI4 A;  3KV5 A;  4APF B;  2V8S V;  2JIW A;  4X1K E;  3P4W A;  4HFB A;  1M7K A;  4AIS A;  1I6Z A;  2Q9Q A;  2MPK A;  2WDV A;  5ADX L;  4CI3 B;  4DO0 A;  3ONJ A;  5L3F B;  2UXN B;  3J7Y q;  3LBX B;  2I6H A;  2WDQ A;  4UV8 B;  2BS3 A;  3AE2 A;  3P4Q A;  4YJ2 E;  5LJN A;  1XMQ T;  4XAX B;  3EDV A;  2XAF B;  4IE6 A;  2V7K A;  3RIA A;  4LFC T;  2NWB A;  3RX6 A;  2NTY A;  2E9X B;  4OK0 A;  2XQ5 A;  3RPU A;  2DCF A;  2OV9 A;  4UF0 B;  2A72 A;  5AQQ B;  4IE7 A;  3V5S A;  2JQQ A;  5AQO B;  2X9X A;  2YOE A;  5JDN A;  4GKJ T;  5GON E;  1HTJ F;  5LNK A;  1N34 T;  3AE7 A;  1OED C;  1HF8 A;  2A2F X;  2YIN A;  3NRX A;  4U2Z A;  3JAD A;  4KUM B;  5HXE A;  3T1H T;  3AE5 A;  3HKC E;  4X20 E;  2WU2 A;  5FNV E;  3Q9D A;  2OA5 A;  2L3L A;  3IA3 A;  4IE4 A;  4EB6 E;  1IBK T;  2JQ9 A;  4K0U A;  4P5O A;  4QXH B;  3AVS A;  5EK4 A;  1DU2 A;  2EHO B;  2NTX A;  3RIF A;  4OYK A;  5CB4 E;  3FZH B;  2XAJ B;  3HR0 A;  4LFB T;  2FUP A;  4YJ3 E;  3MXZ A;  2I0M A;  2IC9 A;  2V26 A;  3FXE B;  1KNP A;  2LOP A;  3ZYM A;  4NXN T;  4J2C A;  4JI1 T;  5JH7 E;  4TWH A;  4AIU A;  3G06 A;  2B76 A;  4PJL A;  4UIG A;  2LE8 A;  4LF5 T;  5L3E B;  3GMI A;  5HXH A;  2PJQ A;  3ZSS A;  3O1J A;  5ABE A;  5ABF A;  1NAF A;  3SOL A;  3N9O A;  3Q5E A;  3WAK A;  3RYH E;  2UUA T;  2ODV A;  3HI2 A;  5HWX A;  2IUB A;  4JI7 T;  5JDG A;  3QC9 A;  3FZL B;  5JR9 B;  4PFP A;  2CRB A;  3L3P A;  5ABH A;  2LRK A;  3RC3 A;  4O2B E;  3NBX X;  3QNU A;  2K24 A;  3RLF F;  4MLK A;  3PUY F;  3JC6 D;  3OVU A;  2YN6 A;  4XZC A;  4O8S A;  3PUA A;  4AQY T;  3I9W A;  4BAY B;  5AQM B;  4TNW A;  1OWA A;  3C4X A;  4H9N C;  1S94 A;  4ILU A;  3D0T A;  1HCI A;  5HXS A;  3RI5 A;  2WAU A;  3WAJ A;  4EAH A;  3KV6 A;  5AFU L;  4H63 H;  2CA5 A;  2ODU A;  1R8I A;  5J0Z A;  5FKY A;  3CIR A;  3FZK B;  5JRC A;  4PNI A;  1WYB A;  2C5I T;  3ZN0 B;  3SWH A;  4JI0 T;  5AQJ B;  4AXP A;  3K1S A;  2UXD T;  4N9F 3;  3C51 A;  5LMN T;  2JMH A;  4MAL A;  4UEL A;  4X5T A;  4C91 A;  5L3G B;  1J1J A;  5AQN B;  4YXD A;  3GWH A;  3UUM A;  2G0U A;  3JAE A;  5AQG B;  2AE9 A;  4EV6 A;  3T8O A;  3MZK B;  3R6N A;  3JC6 C;  2X9H A;  1MMG A;  4YHJ A;  2W66 A;  4IDQ A;  3A7M A;  1HR0 T;  3WI3 A;  2Z6E A;  2LHN A;  2OLT A;  4BJM A;  4HE8 A;  1WRD A;  4WBO A;  1N32 T;  4UXN B;  2BZB A;  2NW8 A;  2K48 A;  2K5B B;  2JQH A;  3HL6 A;  4DBQ A;  2KMF A;  4IDZ A;  4XBF B;  2WWV A;  3KBT A;  4DUZ T;  2XQ9 A;  1YQ4 A;  2XPK A;  3LJC A;  3EDU A;  4ILC A;  4NUU A;  4JUY A;  2XM2 A;  4V1A v;  4DV4 T;  4HXI B;  3PTR B;  2XY8 B;  4EIW A;  4PAG A;  4DV2 T;  1V9D A;  1ZEE A;  5E0O A;  3ZJ1 A;  5FVL A;  3ZCI A;  3AE4 A;  5FY1 A;  4TZ4 C;  3ZN1 B;  5DJQ C;  4DR5 T;  1B7T A;  2Q9Q D;  4PK5 A;  2KIN B;  4Z8X A;  4ASK A;  3H3A A;  3PUZ F;  4H9R C;  4I4T E;  5TAO A;  1D1A A;  5J2U E;  4NPP A;  2PFV A;  2NW9 A;  3K3O A;  4LF9 T;  5HYA A;  2DLR A;  3N9L A;  3KV9 A;  1M62 A;  2KZ7 B;  2UUC T;  1U4Q A;  3AA1 B;  2W67 A;  2BDE A;  5HEU A;  1MMA A;  3T1Y T;  1LVK A;  4QWN B;  4HTE A;  3PUS A;  4UEM A;  2BG9 B;  3UT5 E;  2XQ4 A;  1BR2 A;  1NEN A;  3FZM B;  3OKQ A;  1CUN A;  3O4X E;  3EI0 A;  2JRK A;  2XSB A;  2W4X A;  3NZP A;  5LB7 B;  2RA1 A;  2NP9 A;  4QXB B;  4P0A A;  2E5V A;  3RGL A;  4N78 D;  2FJD A;  4HN9 A;  3MK7 C;  2K9A A;  3KV4 A;  4U31 A;  4X1I E;  3I9Y A;  3M65 A;  2VB6 A;  5HEH A;  4HWH A;  2V6X A;  4X64 T;  3RRW A;  2KWH A;  3VKH A;  5FL1 A;  2UXB T;  2DHR A;  4LF4 T;  3ANW B;  3VR9 A;  3UUB A;  1WR6 A;  3PUQ A;  5FP3 A;  2JQK A;  4YSY A;  5CFB A;  4WBN E;  2HPL A;  3AAA B;  5FXW A;  2MTQ A;  4GIW A;  2D2S A;  4LML A;  3RQW A;  2KND A;  4C90 A;  1HG5 A;  1US7 B;  3N2K E;  3VHL A;  3LK2 B;  5JQG E;  4I50 E; 
#chains in the Genus database with same CATH homology
 2CWY A;  2OA5 A;  2L3L A;  2LM9 A;  4NUV A;  3RYC E;  4H9O C;  4IE4 A;  2XAH B;  3N9N A;  2LHR A;  4EB6 E;  3ZEF B;  3QK6 A;  5JDH A;  4QX7 B;  4L9I A;  5HAX A;  5LCY A;  4AI6 A;  2P9B A;  1ZV4 X;  2Y6X A;  4K0U A;  1D0Y A;  4QXH B;  5LHG B;  3AVS A;  5EK4 A;  3UUX B;  2EHO B;  5HXC A;  3PUR A;  4OHF A;  2NTX A;  1LKX A;  4OYK A;  1IJ5 A;  5CB4 E;  2XAJ B;  3MAC A;  3HR0 A;  4IIJ E;  3FBL A;  1BR1 A;  2CE7 A;  4DMV A;  5L3D B;  4HEA A;  4YJ3 E;  4GYR A;  5FY0 A;  3MXZ A;  2DWG A;  2CEA A;  4GK0 E;  4PJN A;  1S35 A;  3IEE A;  2IC9 A;  2V26 A;  4O2A E;  2QGS A;  3FXE B;  3RYF E;  2LOP A;  3ZYM A;  5LHH B;  4J2C A;  4PK4 A;  2MBG A;  5LP6 E;  5JH7 E;  4ZI2 D;  4H63 V;  4HGA A;  5LOV E;  4PJL A;  2BVM A;  2LE8 A;  4UIG A;  3O1H A;  4TV8 E;  5IYZ E;  3ZCJ A;  3C50 A;  3ZMV B;  4I55 E;  2ES0 A;  2WMO A;  3PUG A;  3B57 A;  3DTO A;  4ZI3 C;  5L3E B;  5FXV A;  3GMI A;  5FYM A;  2H3R A;  2DWK A;  3IF8 B;  4ZHQ E;  3HKB E;  5HXH A;  2PJQ A;  2ZM2 A;  3OYZ A;  2XAQ B;  3O1J A;  3ZMZ B;  1NWM X;  3ZMT B;  1KK7 A;  3ETV A;  2W0G A;  4PW8 A;  1NAF A;  3SOL A;  3C64 A;  2CWO A;  3N9O A;  3WAK A;  2DNX A;  2Q9Q B;  3RYH E;  3ZC1 A;  2ODV A;  3K3N A;  1EZ3 A;  4UVC B;  3HI2 A;  5HWX A;  3ZPO A;  2GK9 A;  2D0U A;  3Q5X A;  2HH7 A;  2LSG A;  3FHN A;  4U74 A;  3S4U A;  1E1H B;  3EUH A;  1G73 A;  3QUJ A;  2A3D A;  4G2A A;  4AQG A;  5DQV A;  5JDG A;  3QC9 A;  5JR9 B;  4PFP A;  3ESL A;  4QX8 B;  3L3P A;  2MOZ A;  1QSD A;  2L9Q A;  4TX5 A;  5HXR A;  5JVD E;  3RC3 A;  2XHE B;  1BR0 A;  4O2B E;  3NBX X;  3N5L A;  2X66 A;  1VOM A;  2K24 A;  2NOX A;  1VRB A;  2IAK A;  4MLK A;  3JC6 D;  4ZS3 A;  3B13 A;  3K3Q C;  3E22 E;  4IE0 A;  3C4Z A;  4PK6 A;  2CM0 A;  3AA7 B;  3CML A;  4XZC A;  4O8S A;  3PUA A;  3RH3 A;  1X79 A;  5H6Q B;  2XTL A;  3I9W A;  3SRZ A;  4DVD A;  1O3X A;  4BAY B;  4CI1 B;  2CMR A;  1OWA A;  3H37 A;  4G63 A;  2PG8 A;  3AVR A;  2WM9 A;  3C4X A;  4H9N C;  1S94 A;  1OXZ A;  4ILU A;  3D0T A;  5BMV E;  4CZZ B;  1HCI A;  5LXT E;  1FIO A;  5HXS A;  2WAU A;  3WAJ A;  3A5X A;  4EAH A;  3KV6 A;  4E7S A;  2LEH A;  4CI2 B;  5AFU L;  3CX6 B;  5L2L A;  4H63 H;  1MIW A;  3BQK A;  3ZYK A;  4ZI2 C;  3UFE A;  4AKH A;  2CA5 A;  2ODU A;  3BQI A;  3HKE E;  2X67 A;  3I1A A;  2BVL A;  3I0O A;  5F8P A;  1U5P A;  3K8P C;  4AKL A;  5JDM A;  5JRC A;  3F2E A;  4PNI A;  1AJ3 A;  1WYB A;  3NZQ A;  2C5I T;  2JPF A;  3ZN0 B;  1ZHC A;  3Q5W A;  4EXT A;  3SWH A;  1FMW A;  1YD8 G;  2X51 A;  3GN5 A;  3ZJ2 A;  1IZN B;  2E9X D;  2V7I A;  2X0L B;  2IW5 B;  4AXP A;  4OYJ A;  2V7L A;  3Q2M A;  5CA0 E;  3TKL B;  3C51 A;  1T98 A;  2JMH A;  3OBV E;  5KMG P;  4MAL A;  5H6R B;  3GN5 B;  1MMN A;  3PDY A;  4UEL A;  1KNZ A;  4QXC B;  2X9W A;  5L3C B;  4C91 A;  4IE5 A;  2KXP B;  3N9P A;  5JDF A;  3FB2 A;  5L3G B;  2V7J A;  2WMN A;  3U3I A;  2I59 A;  4CQI A;  4ISS A;  3NRY A;  3O9X A;  4PJM A;  2N1G A;  5LA6 E;  4GK5 E;  3GWH A;  4PJJ A;  3UUM A;  5J1G A;  2G0U A;  2H7O A;  4JEH B;  5A1L A;  2YU2 A;  4UV9 B;  2EHO C;  3DP7 A;  3P8C D;  2X9Y A;  3T8O A;  1HFA A;  4KMC A;  2N2N A;  4X1Y E;  3DJB A;  1UX5 A;  4EYU A;  3MZK B;  3R6N A;  3J9X 1;  3RKO A;  4AKR B;  5DQW A;  4TN7 B;  3JC6 C;  2VKH A;  3LG7 A;  4ERR A;  2X9H A;  3CKD A;  5LHI B;  1MIY A;  1MMG A;  2CLY B;  4IGU A;  3E0Z A;  4YHJ A;  1D1B A;  2VKJ A;  5FXX A;  5LJM A;  4P0B A;  3UTK A;  2CCQ A;  3ZC0 A;  1BR4 A;  4JLE A;  3F57 A;  1YW0 A;  3LFM A;  4EZH A;  3CWZ B;  3IBP A;  5F3J A;  4BJN A;  3WI3 A;  2Z6E A;  2LHN A;  2H7V C;  3LBX A;  3CVR A;  4O4J E;  5EK3 A;  2WBL A;  4BJM A;  4HE8 A;  4HFV A;  2V7M A;  1WRD A;  4WBO A;  3UUL A;  2QA7 A;  2BZB A;  2PBI A;  4H9S E;  4UXN B;  2NW8 A;  1LRZ A;  2K48 A;  2KLQ A;  3LK3 B;  4JEU B;  4ADZ A;  2EHO D;  3RC8 A;  2K5B B;  3HL6 A;  3CPZ A;  4DBQ A;  2CXD A;  4CXY A;  2KMF A;  3FBZ A;  2VKD A;  5LGN B;  4IDZ A;  3ZMU B;  4XBF B;  4ZI7 E;  4L0R A;  2Q9Q C;  3KBT A;  5JDQ A;  1UX4 A;  3ANW A;  4F6R C;  4AKI A;  3LJC A;  3N2G E;  3CQG B;  5EZY E;  3EDU A;  4WNK A;  3W15 B;  2HPJ A;  2E9X A;  3ZYL A;  5LGT B;  1MND A;  3HA4 A;  2MYS A;  3KBU A;  1YKE B;  2VK9 A;  4NUU A;  1LVF A;  2YK0 A;  2LJL A;  2LT3 A;  4JUY A;  4UF0 A;  4V1A v;  1WLX A;  2KT9 A;  5FY7 A;  3KDS E;  4WW0 A;  3MA9 A;  3AB3 B;  2E9X C;  3PTR B;  4L5G A;  4OFZ A;  3ONX A;  4EIW A;  3I0Q A;  5IHY A;  2CXL A;  4PAG A;  3AA0 B;  5LBM A;  2NW7 A;  1V9D A;  1ZEE A;  2B1E A;  5E0O A;  3ZJ1 A;  4CXX A;  2VAS A;  2WWU A;  3ZCI A;  3CQC B;  3BK9 A;  5FY1 A;  3F31 A;  4TZ4 C;  2W61 A;  4MHC A;  3ZN1 B;  1H7C A;  2IC6 A;  5DJQ C;  3PU8 A;  1UCU A;  4IST A;  1B7T A;  2Q9Q D;  5J2T E;  2WSS V;  1Z0P A;  4MBQ A;  4PK5 A;  2UXX B;  4E7Z A;  1YKH B;  3CQX C;  4QKN A;  4CXW A;  2KIN B;  2JMK A;  4Z8X A;  3R84 B;  4ASK A;  3H3A A;  1MIV A;  4AQF A;  2C0S A;  2ZM8 A;  4H9R C;  4I4T E;  5TAO A;  3VU7 H;  1D1A A;  4UVA B;  5J2U E;  2N9D A;  1D1C A;  2C5J A;  2PFV A;  3EVY A;  2KWI B;  2NW9 A;  4UVB B;  3KIN B;  2E8I A;  2XAS B;  3L09 A;  3K3O A;  5JRC B;  4AQF C;  2DLR A;  5HYA A;  3PU3 A;  3N9L A;  3KV9 A;  3N9M A;  2KZ7 B;  1SA0 E;  4DND A;  4M1P A;  1U4Q A;  4FJO A;  4ANJ A;  3AA1 B;  2EHO A;  2XUE A;  3V5U A;  2BDE A;  4HKA A;  3LK4 2;  2LSY A;  1MMA A;  3ETU A;  3O1I A;  3OJA A;  1D0X A;  4A56 A;  1LVK A;  2XU0 A;  4B6X A;  4P09 A;  1WYC A;  4QWN B;  3AAI A;  4HTE A;  5LBQ B;  3PUS A;  4UEM A;  1HG2 A;  5DAB A;  4O4L E;  2W62 A;  3UUN A;  2M67 A;  3UT5 E;  5ETW A;  3N9Q A;  4EZ4 A;  1BR2 A;  2C5K T;  1FMV A;  4DMW A;  3C4W A;  5LGU B;  2W00 A;  4H9P C;  3OKQ A;  1CUN A;  3O4X E;  5HWY A;  3CX7 B;  4EOZ B;  2JRK A;  4FI5 A;  2LSI A;  5JDL A;  5KX5 E;  1MMD A;  4GOU A;  3NZP A;  2DI4 A;  3KV5 A;  2LSK A;  2RA1 A;  2NP9 A;  4QXB B;  5FXZ A;  4MFR A;  2W63 A;  1G8X A;  5KDM C;  4P0A A;  5C8Y E;  3FXD B;  2SPC A;  3KVA A;  4BA9 A;  2JJ9 A;  4X1K E;  4IHJ E;  5L3B B;  1SHZ C;  4N78 D;  3C98 B;  1Y64 B;  3OYX A;  4HN9 A;  4DBR A;  3CX8 B;  3MK7 C;  2ACX A;  2K9A A;  2Q9Q A;  4YFS A;  3KV4 A;  1IJ6 A;  5ADX L;  4CI3 B;  2XQY A;  4DO0 A;  3KVB A;  4X1I E;  4YLH A;  2UXN B;  4EYY R;  3LBX B;  4PFO A;  5CA1 E;  5L3F B;  2CLY C;  4O4I E;  4UV8 B;  3J7Y q;  3I9Y A;  3M65 A;  3N2O A;  2VB6 A;  5JR9 A;  4YJ2 E;  3RRW A;  4KBM B;  2LSJ A;  5LJN A;  3MJX A;  2KWH A;  2Y48 B;  2J1D G;  5FMN A;  3VKH A;  3AAE B;  4XAX B;  3EDV A;  2XAF B;  4IE6 A;  2DHR A;  2V7K A;  2D5U A;  3RRC A;  2VWA A;  1IAP A;  3P7I A;  3RYI E;  2NWB A;  3RX6 A;  3ANW B;  3ZLI A;  5JR9 C;  2ZLY A;  2NTY A;  4AKG A;  2YEV C;  2ZMA A;  4ZI3 D;  4I43 B;  3AA6 B;  2E9X B;  4OK0 A;  3ZMS B;  1WR6 A;  2X68 A;  3PUQ A;  4TV9 E;  4U72 A;  4QHO A;  5FP3 A;  3RPU A;  1HS7 A;  2ZM0 A;  4H9Q C;  2CXF A;  2DCF A;  2Y8D A;  3BQL A;  3GA8 A;  4UF0 B;  2A72 A;  4GYS A;  5EK2 A;  4WBN E;  5M4Y A;  2HPL A;  2YU1 A;  1D0Z A;  2VL8 A;  4IE7 A;  3V5S A;  3AAA B;  5FXW A;  2LOS A;  2MTQ A;  4GIW A;  2D2S A;  5LG4 A;  2JQQ A;  3VKG A;  1ZKE A;  2X9X A;  2XAG B;  1FEW A;  2KND A;  5JDN A;  5GON E;  5JRE A;  1HTJ F;  5LNK A;  1MNE A;  4ZS2 A;  4C90 A;  3U78 A;  2D0T A;  3KFW X;  1HG5 A;  1US7 B;  4O4H E;  2V1D B;  3PE0 A;  1HF8 A;  3HKD E;  2A2F X;  2YIN A;  3N2K E;  3NRX A;  5LYJ E;  1QUU A;  3VHL A;  2RP4 A;  4KP3 C;  3MKD A;  4KUM B;  3LK2 B;  5JQG E;  5HXE A;  3E08 A;  2VKO A;  3IHR A;  4ZOL E;  4TUY E;  3HKC E;  4X20 E;  5FNV E;  1HX8 A;  4I50 E;  3Q9D A;  2L8K A;  3SS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...