4NUVA

Heterotetramer structure of region ii from plasmodium vivax duffy binding protein (pvdbp) bound to the ectodomain of the duffy antigen receptor for chemokines (darc)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
298
structure length
288
Chain Sequence
NTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVFHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Red Blood Cell Invasion by Plasmodium vivax: Structural Basis for DBP Engagement of DARC.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Membrane protein, cell invasion
molecule keywords Duffy receptor
total genus 113
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4nuvA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4nuvA01
3BQKA 3C64A 2XU0A 5F3JA 3BQIA 2Y8DA 3RRCA 4NUUA 4NUVA 3BQLA 2WAUA 4YFSA 2YK0A 3CMLA 3CPZA
chains in the Genus database with same CATH superfamily
1MMAA 4AQYT 1BR1A 1Z0PA 3Q5EA 1Y01A 4GOUA 3AE1A 4LMKA 4L0RA 4MLKA 4DV6T 4H63H 4DR2T 5HWYA 5HCMA 1OEDE 1ZKEA 2Q9QB 2VL0A 3F57A 3NRXA 5CB4E 4BJNA 1EZ3A 3PU8A 4U7IA 3VKGA 5HCJA 5L47A 2Y48B 1XWMA 1JNRA 3G06A 3P4SA 4IDPA 3RQUA 1X79A 3W15B 4CI3B 5LNKA 2YU1A 2Z6EA 2B1EA 4HWDA 3AE8A 3GN5A 3L3PA 2JQHA 4QXBB 5FXZA 3VRBA 4AP2B 3OPCA 5DQVA 5LA6E 3IHRA 3I9WA 3PUXF 4GK5E 1W9RA 1T7SA 2MOZA 4YHJA 3K1SA 4QH4A 5FVLA 3F2EA 2WY2A 4EXTA 3PTRB 5F8PA 2PTFA 4KP3C 4NUUA 5HWXA 4DV4T 4N78D 2W62A 3N9QA 5J1GA 1HNWT 4ZI3C 4EB6E 1H7CA 2KXPB 2LT3A 2JJ9A 2VVSA 4MBQA 3N2KE 5FXWA 3RF1A 3L8RA 3RH3A 2G0UA 2WWUA 3LK2B 4G2AA 4F8HA 3CX7B 5LHIB 2IDOB 4DR1T 1D0YA 3VU7H 5LMUT 1AJ3A 2BG9A 3A5XA 3NVOA 2VKHA 3CWZB 4QXCB 3PUQA 4QX8B 2C0SA 3KV6A 3PUAA 2X9HA 1IJ6A 4CI1B 2L3LA 3JC6D 3TLWA 4JV5T 4F6RC 2LSKA 4TZ4C 4IDNA 5LBQB 1SUMB 1T98A 1I94T 1KEYA 2UXDT 3AEAA 4O8SA 5AQUB 2ZLYA 5HEHA 2WMOA 3EUHA 2DNXA 1UX4A 1LVFA 2XPKA 3VR8A 1HNXT 5AQOB 2X9YA 5J2TE 4APFB 4GKKT 3PUSA 2VQET 3ZMVB 4HFHA 4DIDB 2M67A 4X20E 1NENA 3HA4A 2C5IT 4Z90A 2V5CA 4WYVA 4EV6A 3ZMZB 2LKGA 3AAAB 5DJQC 4X62T 4JEUB 2AE9A 5KX5E 3ONJA 3N9PA 2CLYB 1O3XA 1V9DA 2NR4A 3V5SA 4AQFA 2LLYA 2XUEA 2KWIB 4MHCA 4MALA 3OYZA 3U3IA 3VKHA 1ZHCA 1R8IA 2E2AA 3D0TA 3C64A 3KVBA 4U7YA 1KF6A 1QSDA 2MBGA 4ANJA 2LEHA 3RPUA 2CXFA 4ZZCA 3ONLC 4A98A 5L4EA 2BKPA 2Q9QA 3UTKA 4LF9T 2PG8A 2VURA 3OVUA 2OV9A 4IIJE 4JI3T 2Y8DA 2IAKA 5FL1A 3JADA 2VASA 1HG2A 4NIQA 4H9NC 2FJDA 4ILAA 3RYCE 3UU3A 3HR0A 2K3WA 4PAGA 2LM9A 5IWAT 2UUCT 3Q9DA 3CX6B 3ZN0B 3RTRA 4ZZBA 3N9OA 4XZCA 1YXRA 5FL0A 4LFBT 2LHRA 1ZP0A 3EABA 4ZS2A 2OLTA 2WU5A 1OXZA 3PV0F 3SOLA 3RIUC 3T8OA 5LBMA 4TV9E 3RRCA 4O2AE 5FP3A 3P7IA 5C2TA 1J5WA 1US7B 2E5VA 2IUBA 1D0ZA 4ISTA 3AVRA 3AE6A 4PNIA 4G63A 3UULA 4AKLA 2UXCT 5LG4A 2A9UA 4UR9A 2JIWA 4AISA 1GQEA 1WFDA 1BR0A 1HS7A 2PJQA 1J1JA 2XTLA 1CHUA 2UXXB 4PK4A 2X68A 2SPCA 3DQVC 2HN2A 3ESLA 3RGLA 4CZZB 5IUXA 4X66T 3OBVE 1VRBA 4H9SE 1D1CA 4DV2T 1J5ET 2IMLA 1UUSA 5KMGP 2CWOA 4QKNA 5JR9C 2LSYA 1G8XA 2LM2A 4HWHA 4JLEA 4JI1T 3PU3A 4FJOA 4BA9A 5AQNB 2WZHA 4DVDA 4EEDA 3A7MA 3FBZA 3UUBA 3EDUA 2XZEA 3SFDA 2BG9E 3ZCIA 4P0AA 1N32T 3U78A 2EHOA 1XDPA 2WMNA 3RIUA 4GK0E 5CGMA 3AEBA 4KHZF 4A97A 2YDSA 1E7PA 3NZPA 4CXXA 4JBWF 1WRDA 4I4TE 4P5OA 1BR4A 2FBWA 2WBLA 3NZQA 5AQFB 4NUVA 2IW5B 4AKHA 3CK6A 1D0XA 1XNRT 2RPAA 4YLHA 3UU6A 4YFSA 4ZEYA 5CFBA 3BK9A 5FXVA 4F52A 5AQGB 4LFAT 2WM9A 3GA8A 2DI4A 2WCAA 5JDNA 4B3TT 3RLFF 3RIAA 1XNQT 2KWHA 2UXNB 1IBMT 3LBXA 3O9XA 4JYAT 2VKDA 2XQYA 1HR0T 3AE9A 2V1DB 3C50A 1KFYA 3QOFA 2J47A 4GYRA 4PK5A 4DR3T 1L0VA 3PUWF 4PK6A 3ZN1B 2CLYC 1HX1B 2CCQA 4DUYT 4OX9T 3PUYF 5GONE 2I0MA 5HEOA 2BVLA 2XJ7A 2LHNA 4DR4T 4AQFC 4ZI2D 2V26A 2KLQA 4YT0A 4U74A 3PJAA 2V7IA 4JI6T 1E1HB 3PURA 5LCYA 3T1YT 2QGSA 2DL1A 3ZMSB 2MPKA 2XU0A 4HN9A 2X51A 5ABFB 1QUUA 3LG7A 4CQIA 5CA1E 5KDMC 5LMNT 2XQAA 2VWAA 2UUBT 4PJJA 4EGWA 1B7TA 5ABFA 4DR6T 2ZM6T 5LHGB 3KV9A 3BQIA 4P0BA 3C4WA 5IHYA 3T1HT 5LYJE 3OJAA 5FY1A 3UUMA 4O2BE 4UEMA 1UGOA 2RP4A 3IBPA 3UUNA 4A5XA 3P4QA 3ZEFB 3C4ZA 3HKEE 4HFBA 2WDRA 4UF0A 3UUXB 5H6QB 2XAQB 4IT4A 4OFZA 2E8IA 3MACA 4O4IE 2LRLA 2BS4A 2H3RA 5FYMA 3SRZA 3V5UA 3SWHA 4ZHQE 3ZSSA 2WDQA 4A56A 3Q5WA 3AA6B 3LBXB 4TNVA 5EK3A 2VQFT 3N5LA 3AEFA 1HF8A 2CM0A 2WDVA 2FUPA 4PFPA 4B3RT 2H88A 2CA5A 4Z91A 2XAGB 4IDQA 5LHHB 2ODUA 4WBOA 5JDMA 4YY3T 3GN5B 2YKSA 4OK0A 3RQWA 2WSSV 2KSRA 4BAYB 3MZKB 3RHWA 5LG3A 1XMOT 4V1Av 2HPLA 5KXJA 2KZ7B 1IBKT 4DV5T 4AXPA 1T8BA 2CBIA 5ETWA 2WWVA 3UFGA 2GK9A 1HG5A 1D1BA 1MNDA 3H37A 4HWCA 3RX6A 3TLSA 5FNVE 2XQ5A 3AAEB 4DV3T 4U3CA 1KNPA 2MTQA 4OYKA 2IC9A 5AQHB 2LE8A 2LSGA 5LGUB 1E2AA 2DCFA 2XASB 4IE0A 4NPPA 4Q25A 4IE4A 5BR8T 1IBLT 3ANWA 4I0UA 2MAWA 4EAHA 4C91A 3KV4A 1NEKA 3FHNA 3LDQB 1T72A 2WS3A 2X66A 5DQWA 5HXCA 3CKDA 3WAKA 1M7KA 1HCIA 3ZT5A 1S94A 1VCSA 2XQ7A 1MIVA 1NWMX 4KUMB 2KINB 4TNWA 2BKNA 2A72A 2CHNA 5HXHA 4A64A 4B3MT 1IZNB 4YTMA 3J7Yq 3FXDB 3M65A 1X9BA 2AXDS 1N36T 4LMJA 4YTPA 4JI0T 5LXTE 1YW0A 3AECA 2V7KA 1KNRA 3NBXX 4PFOA 1XZYA 4HGAA 5JTGA 2CMRA 2X9XA 3CX8B 5L3FB 2V8SV 4EEBA 1MMGA 1YKEB 4AKGA 1LKXA 2DWGA 5HXRA 2LOPA 4COFA 3AVSA 5TAOA 2JQKA 4TWDA 3UU4A 2UXBT 3AE3A 2YN6A 1HFAA 4HWFA 2Q9QC 3B57A 2WB5A 2VK9A 3J9X1 4CXYA 2X9WA 4TWFA 3PE0A 5AQKB 3LK3B 4DV1T 3AEDA 1FJGT 3E0ZA 4IHJE 3EDVA 3AAIA 5JH7E 4LFCT 2F4VT 1WR6A 3ZCJA 2X0LB 1UCUA 3EI0A 4O4LE 3P8CD 5ABEA 4EOZB 5AQPB 4GYSA 2IC6A 3N9MA 2XQ6A 2CXLA 2Q9QD 2WZIA 3JAFA 3Q5DA 2H89A 3LJCA 4U2ZA 2BKOA 4JEHB 5J2UE 2XQ4A 4X1IE 3WAJA 2BG9B 1WCRA 3UU8A 4TV8E 3AEGA 3GWHA 2NW7A 3L09A 1KNZA 3QB5A 1LDJA 3AA7B 1WLXA 2X0HA 4QHOA 4TUYE 3HL6A 4UIGA 4Z8XA 4QWNB 4FI5A 5JRCA 2D0UA 2XQ8A 3B5MA 4LF6T 4GKJT 2DHRA 2FJEA 4PJNA 2NW9A 2BBHA 3CMLA 2PFVA 2X0YA 3Q5XA 3FBLA 4IE7A 5L3BB 2YDRA 3JC6C 5AQTB 1BR2A 2V7JA 4DV7T 4ASKA 1FIOA 4JI8T 3KV5A 3DPLC 5JDLA 3X1DA 1WR0A 4WNKA 2NW8A 1N33T 4KHPT 1I6ZA 5LGNB 5FVKA 2JPFA 2LOSA 2PBIA 2J4GA 3I0OA 5IYZE 4DBQA 2ACXA 3ETUA 5C8YE 5HXSA 4ZS3A 4YXDA 2WAUA 4AIUA 4YTNA 3RC8A 2CXDA 2J1DG 2ZM2A 3UT5E 5JDQA 4O4HE 2Y6XA 5L3EB 1VCTA 2NP9A 3R6NA 3VR9A 4X65T 4AKIA 4B3ST 2FJBA 1XDOA 3H3AA 2XAFB 4JI5T 3WI3A 3O4XE 2P9BA 5JDHA 1LVKA 2YEVC 4U2YA 5JR9A 2WU2A 4ILCA 4YSZA 2BG9C 3ONXA 4H9QC 2W66A 1MMNA 3AA0B 3FZFB 3HI2A 2RA1A 3O1JA 2D5UA 3AEEA 1JNZA 4DNDA 3IA3A 2V6XA 3NWIA 3LSVA 3RI5A 4DR5T 1DU2A 4WQOD 1IAPA 4JI2T 3ZT6A 4C90A 1ZEEA 3K3QC 5ABGA 3CQXC 2LSJA 4LF8T 3JAEA 3RYHE 2XHEB 3TKLB 5ABHA 3HKBE 4P1NA 3AXJA 5LOVE 2R6GF 4U72A 4EZHA 4M1PA 3NRYA 4H63V 3ETVA 2V6YB 3AXJB 1UX5A 2EHOD 3DP7A 3O1HA 4HE8A 5AQRB 3ZMTB 4DO0A 4CN1A 4E7ZA 3BQKA 4P09A 5EK4A 3RIFA 3ZLIA 5JQGE 2K48A 4AI6A 2YINA 2W61A 2XY8B 4QX7B 4KI0F 3P50A 3E08A 4UVCB 3DJBA 4QH5A 5HXEA 5HYAA 4AQGA 1MMDA 1CUNA 3KFWX 4PJLA 2H7OA 2ES0A 2JMHA 3ZJ2A 2LRKA 2CBJA 2QA7A 3K3OA 4H9PC 3AE7A 2CRBA 4HFEA 4KX6A 4CI2B 2CWYA 2QYWA 5EK2A 1OEDA 5JR9B 3M3ZB 3FZLB 3SS1A 3N9LA 3IF8B 2WQYA 3GMIA 2YK0A 3FB2A 5AQQB 5L3GB 2ODVA 2HHHT 1U5PA 2JQQA 2FJAA 2D9DA 3I1AA 3Q2MA 5E0OA 2N2NA 4CN6A 4HKAA 5L3DB 3RYIE 3PUGA 4ERRA 1W0BA 2W67A 2LKHA 2N9DA 1Z8UA 4IREA 4DMVA 5J0ZA 1FMWA 3PJAJ 2VKJA 3QNUA 5HEJA 5CJ5A 4L5GA 2D0TA 1U6GA 1LDKA 4KMCA 1QLBA 2YDQA 4UF0B 2OA5A 3RRWA 4WZXA 5FXXA 4YJ2E 3ZC0A 3KINB 4JI4T 2DLRA 2LSIA 3TLVA 3OKQA 2N1GA 1FEWA 5AFUL 2CPTA 3UQ7A 3ZYLA 3AE4A 3O1IA 4ADZA 4JUYA 4CN4A 3ZT7A 5AQIB 4JGHD 5C3JA 4N9F3 4UELA 3C51A 4K0KT 1MIWA 4TX5A 3MK7C 5FMNA 3MJXA 4I43B 1MIYA 1OEDC 4HXIB 5L2LA 2UU9T 3CQGB 5CA0E 1SHZC 1HTJF 1UK5A 3QB5K 3N2GE 3RC3A 4H9OC 4X1KE 3TLTA 2E5LT 4MFRA 2CE7A 4B6XA 2XM2A 2L9QA 2C5JA 4XBFB 4LF4T 2JQ9A 4KBMB 4X1YE 3VHLA 1SA0E 5HAXA 2EHOC 4HEAA 4H9RC 4IE5A 3ZYKA 4LF5T 1HX8A 3PDYA 3IEEA 4DUZT 3EVYA 4TWHA 1U4QA 3FZHB 4I55E 4LMLA 3ZPOA 4WBNE 1D1AA 2EHOB 4HFCA 5A1LA 4NXMT 2C5KT 3RKOA 3PUVF 4GIWA 4YSYA 3K3NA 4HWIB 5LB7B 4AKRB 5BMVE 5AQVB 3FZMB 3P4PA 3QK6A 4YHHT 2K24A 3F31A 5L4HA 2DWKA 4ZOLE 4TN7B 4ILBA 2K9AA 3SFEA 4X64T 3FXEB 3B13A 1N34T 4XAXB 3C98B 3OYXA 3CIRA 4HFVA 4L9IA 4PW8A 4UVBB 2K5BB 4IL4A 2HN1A 3JCFA 2E9XB 2V5DA 5AQMB 5FY7A 1SE7A 3C4XA 3N9NA 5M4YA 2V7MA 1FMVA 3I0QA 3AE2A 3K8PC 3PUZF 4IDOA 5JDGA 3ZMUB 3ZSTA 3MXZA 4EYYR 4DV0T 2HPJA 1ZV4X 4J2CA 2ZM0A 4CXWA 3LK42 3QUJA 1VOMA 1IJ5A 2KNDA 5HEGA 2M6IA 2VKOA 1ZOYA 2B76A 2HH7A 2I59A 5JDFA 3NKZA 5HEUA 1UURA 2QVAA 3MKDA 3I9YA 3RKGA 3AB3B 4QH1A 2IHR1 3FZKB 5AQJB 4ZI7E 3CVRA 5DABA 4HFIA 3ZJ1A 1LDKB 5ADXL 2I6HA 4WW0A 4NXNT 1G73A 4K0UA 5LJMA 2ZM8A 4ZXLA 5LJNA 1Y64B 3UQ4A 4ZI3D 1WYBA 2W0GA 2L8KA 1LRZA 4EZ4A 1YD8G 2WP9A 2JMKA 4OYJA 3LFMA 3RYFE 3ZKRA 3ZYMA 3L39A 3CQCB 2BS2A 3EAMA 4UV8B 2H7VC 3DTOA 1WYCA 3KBUA 1MNEA 1OEDB 1NAFA 3VRAA 2KT9A 3ABVA 1YKHB 4DBRA 1HNZT 2E9XA 5AQSB 2BS3A 1OWAA 2XAHB 1M62A 3AA1B 4YJ3E 2W4XA 3TLUA 2XM1A 3KDSE 5EZYE 4EYUA 5LP6E 2D2SA 3MA9A 5JRCB 2ZMAA 2NTXA 3H3MA 4YSXA 3KVAA 5H6RB 2XQ3A 2LJLA 2VL8A 3HKCE 4O4JE 3BQLA 4ISSA 4UV9B 5AQLB 3R84B 4BJMA 3P4WA 5F5WA 3N2OA 2A3DA 2VB6A 5FKYA 2BVMA 2XAJB 2V7LA 2YOEA 4PJMA 4JI7T 4LF7T 2BZBA 4DR7T 4QXHB 2XSBA 3ZC1A 4E7SA 3EHZA 2MYSA 2J62A 1KK7A 2JRKA 4ILUA 4UVAB 3P4RA 2VVNA 1YQ4A 4I50E 3S4UA 4OHFA 3OTOT 4ZI2C 1W0AA 2QRXA 1YQ3A 2E9XD 2V6YA 2XQ9A 2YU2A 3E22E 4HFDA 4HTEA 4IDZA 4U33A 3CPZA 2NTYA 2IIUA 3A8YC 4UXNB 5JVDE 4IL9A 2ACZA 2BBJA 2M6BA 5FY0A 2W2UA 2NOXA 2W63A 2E9XC 3UFEA 4EIWA 5L3CB 2CEAA 2NWBA 4IGUA 1W09A 3ANWB 3KBTA 5F3JA 2XSAA 2BDEA 2X67A 2A2FX 4DMWA 5JREA 1XMQT 2UUAT 2WZKA 2KMFA 2W00A 4IE6A 4U31A 4X5TA 3AE5A 3QC9A 3UU5A 1S35A 5LGTB 2CHOA 3HKDE
chains in the Genus database with same CATH topology
1MMAA 1BR1A 1Z0PA 4GOUA 4MLKA 4L0RA 4H63H 5HWYA 3F57A 1ZKEA 2Q9QB 3NRXA 5CB4E 4BJNA 1EZ3A 3PU8A 3VKGA 2Y48B 3W15B 5LNKA 1X79A 2YU1A 2Z6EA 2B1EA 4QXBB 3L3PA 3GN5A 5FXZA 4BJMA 5DQVA 5LA6E 3IHRA 3I9WA 4GK5E 2MOZA 4YHJA 3F2EA 4EXTA 3PTRB 5F8PA 4NUUA 4KP3C 5HWXA 4N78D 2W62A 3N9QA 5J1GA 4ZI3C 4EB6E 1H7CA 2KXPB 2LT3A 2JJ9A 5FXWA 4MBQA 3N2KE 3RH3A 2G0UA 2WWUA 3LK2B 4G2AA 3CX7B 5LHIB 1D0YA 3VU7H 1AJ3A 3A5XA 2VKHA 3CWZB 4QXCB 3PUQA 4QX8B 2C0SA 3KV6A 3PUAA 2X9HA 1IJ6A 4CI1B 2L3LA 3JC6D 4F6RC 2LSKA 4TZ4C 5LBQB 1T98A 4O8SA 2ZLYA 2WMOA 3EUHA 2DNXA 1UX4A 1LVFA 2X9YA 5J2TE 3PUSA 3ZMVB 2M67A 4X20E 3HA4A 2C5IT 3ZMZB 3AAAB 5DJQC 4JEUB 5KX5E 3N9PA 2CLYB 1O3XA 1V9DA 3V5SA 4AQFA 2XUEA 2KWIB 4MHCA 4MALA 3OYZA 3U3IA 3VKHA 1ZHCA 3D0TA 3KVBA 4ANJA 3C64A 1QSDA 2MBGA 2LEHA 3RPUA 2CXFA 2Q9QA 3UTKA 2PG8A 4IIJE 2Y8DA 2IAKA 2VASA 1HG2A 4H9NC 3RYCE 3HR0A 4PAGA 2LM9A 3Q9DA 3CX6B 3ZN0B 3N9OA 4XZCA 2LHRA 4ZS2A 3SOLA 1OXZA 3T8OA 5LBMA 4TV9E 3RRCA 4O2AE 5FP3A 3P7IA 1US7B 4CI3B 3UULA 4AKLA 1D0ZA 4ISTA 3AVRA 4PNIA 4DNDA 4G63A 5LG4A 1BR0A 1HS7A 2PJQA 2XTLA 4PK4A 2UXXB 2X68A 2SPCA 3ESLA 4CZZB 3OBVE 1VRBA 4H9SE 1D1CA 5KMGP 2CWOA 4QKNA 5JR9C 2LSYA 1G8XA 4JLEA 3PU3A 4FJOA 4BA9A 4DVDA 3FBZA 3EDUA 3ZCIA 4P0AA 3U78A 2EHOA 2WMNA 4GK0E 3NZPA 4CXXA 1WRDA 4I4TE 1BR4A 2WBLA 3NZQA 4NUVA 2IW5B 4AKHA 1D0XA 4YLHA 4YFSA 3BK9A 5FXVA 2WM9A 3GA8A 2DI4A 5JDNA 2KWHA 2UXNB 3LBXA 3O9XA 2VKDA 2XQYA 2V1DB 3C50A 4PK5A 4GYRA 4PK6A 3ZN1B 2CLYC 2CCQA 5GONE 2BVLA 2LHNA 4AQFC 4ZI2D 2V26A 2KLQA 4U74A 2V7IA 1E1HB 3PURA 5LCYA 2QGSA 3ZMSB 2XU0A 4HN9A 2X51A 1QUUA 3LG7A 4CQIA 5CA1E 5KDMC 2VWAA 4PJJA 1B7TA 5LHGB 3KV9A 3BQIA 4P0BA 3C4WA 5IHYA 5LYJE 3OJAA 5FY1A 3UUMA 4O2BE 4UEMA 2RP4A 3IBPA 3UUNA 3ZEFB 3C4ZA 3HKEE 4UF0A 3UUXB 5H6QB 2XAQB 4OFZA 4EIWA 2E8IA 3MACA 4O4IE 3V5UA 5FYMA 2H3RA 3SRZA 3SWHA 4ZHQE 4A56A 3Q5WA 3AA6B 3LBXB 5EK3A 3N5LA 1HF8A 2CM0A 4PFPA 2CA5A 2XAGB 5LHHB 2ODUA 4WBOA 5JDMA 3GN5B 4OK0A 4BAYB 2WSSV 3MZKB 4V1Av 2HPLA 2KZ7B 4AXPA 5ETWA 2GK9A 1HG5A 1D1BA 1MNDA 3H37A 3RX6A 5FNVE 3AAEB 2MTQA 4OYKA 2IC9A 2LE8A 2LSGA 5LGUB 2DCFA 2XASB 4IE0A 4IE4A 3ANWA 4EAHA 4C91A 3KV4A 3FHNA 5DQWA 2X66A 5HXCA 3WAKA 3CKDA 1HCIA 1S94A 4KUMB 1MIVA 1NWMX 2KINB 2A72A 5HXHA 1IZNB 3J7Yq 3FXDB 3M65A 5LXTE 1YW0A 2V7KA 3NBXX 4PFOA 4HGAA 2CMRA 2X9XA 3CX8B 5L3FB 1MMGA 1YKEB 4AKGA 1LKXA 2DWGA 5HXRA 2LOPA 3AVSA 5TAOA 1HFAA 2Q9QC 3B57A 2VK9A 4CXYA 2X9WA 3PE0A 3LK3B 3E0ZA 4IHJE 3EDVA 3AAIA 5JH7E 1WR6A 3ZCJA 2X0LB 1UCUA 4O4LE 3P8CD 4EOZB 4GYSA 2IC6A 3N9MA 2CXLA 2Q9QD 3J9X1 5J2UE 3LJCA 4JEHB 4X1IE 3WAJA 4TV8E 3GWHA 2NW7A 3L09A 1KNZA 3AA7B 1WLXA 4QHOA 4TUYE 3HL6A 4UIGA 4Z8XA 4QWNB 4FI5A 5JRCA 2D0UA 2DHRA 4PJNA 2NW9A 3CMLA 2PFVA 3Q5XA 5L3BB 3FBLA 4IE7A 3JC6C 1BR2A 2V7JA 4ASKA 1FIOA 3KV5A 5JDLA 4WNKA 2NW8A 5LGNB 2JPFA 2LOSA 2PBIA 3I0OA 5IYZE 4DBQA 5HXSA 2ACXA 3ETUA 5C8YE 3RC8A 4ZS3A 2WAUA 2CXDA 2J1DG 2ZM2A 3UT5E 5JDQA 4O4HE 2Y6XA 5L3EB 2NP9A 3R6NA 4AKIA 3H3AA 2XAFB 3WI3A 3O4XE 2P9BA 5JDHA 1LVKA 2YEVC 5JR9A 3ONXA 4H9QC 3AA0B 1MMNA 3HI2A 2RA1A 3O1JA 2D5UA 1IAPA 4C90A 1ZEEA 3K3QC 3CQXC 2LSJA 3RYHE 2XHEB 3TKLB 3HKBE 5LOVE 4U72A 4EZHA 4M1PA 3NRYA 4H63V 3ETVA 1UX5A 2EHOD 3DP7A 3O1HA 4HE8A 3ZMTB 4DO0A 5JQGE 4E7ZA 3BQKA 4P09A 5EK4A 3ZLIA 2K48A 4AI6A 2YINA 2W61A 4QX7B 3E08A 4UVCB 3DJBA 5HXEA 5HYAA 4AQGA 1MMDA 1CUNA 3KFWX 4PJLA 2H7OA 2ES0A 2JMHA 3ZJ2A 2QA7A 3K3OA 4H9PC 4CI2B 2CWYA 5EK2A 5JR9B 3SS1A 3N9LA 3IF8B 3GMIA 2YK0A 3FB2A 5L3GB 2ODVA 1U5PA 2JQQA 3I1AA 3Q2MA 5E0OA 2N2NA 4HKAA 5L3DB 3RYIE 3PUGA 4ERRA 2N9DA 4DMVA 1FMWA 2VKJA 4L5GA 2D0TA 4KMCA 4UF0B 3RRWA 2OA5A 4YJ2E 5FXXA 3ZC0A 3KINB 2DLRA 2LSIA 5AFUL 3OKQA 2N1GA 1FEWA 3ZYLA 3O1IA 4ADZA 4JUYA 4UELA 3C51A 1MIWA 4TX5A 3MK7C 5FMNA 3MJXA 4I43B 1MIYA 5L2LA 3CQGB 5CA0E 1SHZC 1HTJF 3N2GE 3RC3A 4H9OC 4X1KE 4MFRA 2CE7A 4B6XA 2L9QA 2C5JA 4XBFB 4KBMB 4X1YE 3VHLA 1SA0E 5HAXA 2EHOC 4HEAA 4H9RC 4IE5A 3ZYKA 1HX8A 3PDYA 3IEEA 3EVYA 3ZPOA 1U4QA 4I55E 4WBNE 5A1LA 1D1AA 2EHOB 2C5KT 3RKOA 4GIWA 3K3NA 4AKRB 5BMVE 3QK6A 2K24A 3F31A 2DWKA 4ZOLE 4TN7B 2K9AA 3FXEB 3B13A 4XAXB 3C98B 3OYXA 4HFVA 4L9IA 4PW8A 4UVBB 2K5BB 2E9XB 5FY7A 3C4XA 3N9NA 5M4YA 2V7MA 1FMVA 3I0QA 3K8PC 5JDGA 3ZMUB 3MXZA 4EYYR 2HPJA 1ZV4X 4J2CA 2ZM0A 4CXWA 3LK42 3QUJA 1VOMA 1IJ5A 2KNDA 2VKOA 2I59A 2HH7A 5JDFA 3MKDA 3I9YA 3AB3B 4ZI7E 3CVRA 5DABA 3ZJ1A 5ADXL 4WW0A 1G73A 4K0UA 5LJMA 2ZM8A 5LJNA 1Y64B 4ZI3D 1WYBA 2W0GA 2L8KA 1LRZA 4EZ4A 1YD8G 2JMKA 4OYJA 3LFMA 3RYFE 3ZYMA 3CQCB 4UV8B 2H7VC 3DTOA 1WYCA 3KBUA 1MNEA 1NAFA 2KT9A 4DBRA 1YKHB 2E9XA 1OWAA 2XAHB 3AA1B 4YJ3E 4EYUA 5LP6E 3KDSE 5EZYE 5JRCB 2D2SA 3MA9A 2ZMAA 2NTXA 3KVAA 5H6RB 2LJLA 2VL8A 3HKCE 4O4JE 3BQLA 4ISSA 4UV9B 3R84B 3N2OA 2A3DA 2VB6A 2BVMA 2XAJB 2V7LA 4PJMA 2BZBA 4QXHB 4E7SA 2MYSA 2JRKA 1KK7A 4ILUA 4UVAB 3S4UA 4I50E 4OHFA 4ZI2C 3ZC1A 2E9XD 3E22E 2YU2A 4IDZA 4HTEA 3CPZA 2NTYA 4UXNB 5JVDE 5FY0A 2W63A 2NOXA 2E9XC 3UFEA 5L3CB 2CEAA 2NWBA 4IGUA 3ANWB 3KBTA 5F3JA 2BDEA 2X67A 2A2FX 4DMWA 5JREA 2KMFA 2W00A 4IE6A 3QC9A 5LGTB 1S35A 3HKDE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQK A;  3C64 A;  2XU0 A;  5F3J A;  3BQI A;  2Y8D A;  3RRC A;  4NUU A;  4NUV A;  3BQL A;  2WAU A;  4YFS A;  2YK0 A;  3CML A;  3CPZ A; 
#chains in the Genus database with same CATH topology
 1MMA A;  4AQY T;  1BR1 A;  1Z0P A;  3Q5E A;  1Y01 A;  4GOU A;  3AE1 A;  4LMK A;  4L0R A;  4MLK A;  4DV6 T;  4H63 H;  4DR2 T;  5HWY A;  5HCM A;  1OED E;  1ZKE A;  2Q9Q B;  2VL0 A;  3F57 A;  3NRX A;  5CB4 E;  4BJN A;  1EZ3 A;  3PU8 A;  4U7I A;  3VKG A;  5HCJ A;  5L47 A;  2Y48 B;  1XWM A;  1JNR A;  3G06 A;  3P4S A;  4IDP A;  3RQU A;  1X79 A;  3W15 B;  4CI3 B;  5LNK A;  2YU1 A;  2Z6E A;  2B1E A;  4HWD A;  3AE8 A;  3GN5 A;  3L3P A;  2JQH A;  4QXB B;  5FXZ A;  3VRB A;  4AP2 B;  3OPC A;  5DQV A;  5LA6 E;  3IHR A;  3I9W A;  3PUX F;  4GK5 E;  1W9R A;  1T7S A;  2MOZ A;  4YHJ A;  3K1S A;  4QH4 A;  5FVL A;  3F2E A;  2WY2 A;  4EXT A;  3PTR B;  5F8P A;  2PTF A;  4KP3 C;  4NUU A;  5HWX A;  4DV4 T;  4N78 D;  2W62 A;  3N9Q A;  5J1G A;  1HNW T;  4ZI3 C;  4EB6 E;  1H7C A;  2KXP B;  2LT3 A;  2JJ9 A;  2VVS A;  4MBQ A;  3N2K E;  5FXW A;  3RF1 A;  3L8R A;  3RH3 A;  2G0U A;  2WWU A;  3LK2 B;  4G2A A;  4F8H A;  3CX7 B;  5LHI B;  2IDO B;  4DR1 T;  1D0Y A;  3VU7 H;  5LMU T;  1AJ3 A;  2BG9 A;  3A5X A;  3NVO A;  2VKH A;  3CWZ B;  4QXC B;  3PUQ A;  4QX8 B;  2C0S A;  3KV6 A;  3PUA A;  2X9H A;  1IJ6 A;  4CI1 B;  2L3L A;  3JC6 D;  3TLW A;  4JV5 T;  4F6R C;  2LSK A;  4TZ4 C;  4IDN A;  5LBQ B;  1SUM B;  1T98 A;  1I94 T;  1KEY A;  2UXD T;  3AEA A;  4O8S A;  5AQU B;  2ZLY A;  5HEH A;  2WMO A;  3EUH A;  2DNX A;  1UX4 A;  1LVF A;  2XPK A;  3VR8 A;  1HNX T;  5AQO B;  2X9Y A;  5J2T E;  4APF B;  4GKK T;  3PUS A;  2VQE T;  3ZMV B;  4HFH A;  4DID B;  2M67 A;  4X20 E;  1NEN A;  3HA4 A;  2C5I T;  4Z90 A;  2V5C A;  4WYV A;  4EV6 A;  3ZMZ B;  2LKG A;  3AAA B;  5DJQ C;  4X62 T;  4JEU B;  2AE9 A;  5KX5 E;  3ONJ A;  3N9P A;  2CLY B;  1O3X A;  1V9D A;  2NR4 A;  3V5S A;  4AQF A;  2LLY A;  2XUE A;  2KWI B;  4MHC A;  4MAL A;  3OYZ A;  3U3I A;  3VKH A;  1ZHC A;  1R8I A;  2E2A A;  3D0T A;  3C64 A;  3KVB A;  4U7Y A;  1KF6 A;  1QSD A;  2MBG A;  4ANJ A;  2LEH A;  3RPU A;  2CXF A;  4ZZC A;  3ONL C;  4A98 A;  5L4E A;  2BKP A;  2Q9Q A;  3UTK A;  4LF9 T;  2PG8 A;  2VUR A;  3OVU A;  2OV9 A;  4IIJ E;  4JI3 T;  2Y8D A;  2IAK A;  5FL1 A;  3JAD A;  2VAS A;  1HG2 A;  4NIQ A;  4H9N C;  2FJD A;  4ILA A;  3RYC E;  3UU3 A;  3HR0 A;  2K3W A;  4PAG A;  2LM9 A;  5IWA T;  2UUC T;  3Q9D A;  3CX6 B;  3ZN0 B;  3RTR A;  4ZZB A;  3N9O A;  4XZC A;  1YXR A;  5FL0 A;  4LFB T;  2LHR A;  1ZP0 A;  3EAB A;  4ZS2 A;  2OLT A;  2WU5 A;  1OXZ A;  3PV0 F;  3SOL A;  3RIU C;  3T8O A;  5LBM A;  4TV9 E;  3RRC A;  4O2A E;  5FP3 A;  3P7I A;  5C2T A;  1J5W A;  1US7 B;  2E5V A;  2IUB A;  1D0Z A;  4IST A;  3AVR A;  3AE6 A;  4PNI A;  4G63 A;  3UUL A;  4AKL A;  2UXC T;  5LG4 A;  2A9U A;  4UR9 A;  2JIW A;  4AIS A;  1GQE A;  1WFD A;  1BR0 A;  1HS7 A;  2PJQ A;  1J1J A;  2XTL A;  1CHU A;  2UXX B;  4PK4 A;  2X68 A;  2SPC A;  3DQV C;  2HN2 A;  3ESL A;  3RGL A;  4CZZ B;  5IUX A;  4X66 T;  3OBV E;  1VRB A;  4H9S E;  1D1C A;  4DV2 T;  1J5E T;  2IML A;  1UUS A;  5KMG P;  2CWO A;  4QKN A;  5JR9 C;  2LSY A;  1G8X A;  2LM2 A;  4HWH A;  4JLE A;  4JI1 T;  3PU3 A;  4FJO A;  4BA9 A;  5AQN B;  2WZH A;  4DVD A;  4EED A;  3A7M A;  3FBZ A;  3UUB A;  3EDU A;  2XZE A;  3SFD A;  2BG9 E;  3ZCI A;  4P0A A;  1N32 T;  3U78 A;  2EHO A;  1XDP A;  2WMN A;  3RIU A;  4GK0 E;  5CGM A;  3AEB A;  4KHZ F;  4A97 A;  2YDS A;  1E7P A;  3NZP A;  4CXX A;  4JBW F;  1WRD A;  4I4T E;  4P5O A;  1BR4 A;  2FBW A;  2WBL A;  3NZQ A;  5AQF B;  4NUV A;  2IW5 B;  4AKH A;  3CK6 A;  1D0X A;  1XNR T;  2RPA A;  4YLH A;  3UU6 A;  4YFS A;  4ZEY A;  5CFB A;  3BK9 A;  5FXV A;  4F52 A;  5AQG B;  4LFA T;  2WM9 A;  3GA8 A;  2DI4 A;  2WCA A;  5JDN A;  4B3T T;  3RLF F;  3RIA A;  1XNQ T;  2KWH A;  2UXN B;  1IBM T;  3LBX A;  3O9X A;  4JYA T;  2VKD A;  2XQY A;  1HR0 T;  3AE9 A;  2V1D B;  3C50 A;  1KFY A;  3QOF A;  2J47 A;  4GYR A;  4PK5 A;  4DR3 T;  1L0V A;  3PUW F;  4PK6 A;  3ZN1 B;  2CLY C;  1HX1 B;  2CCQ A;  4DUY T;  4OX9 T;  3PUY F;  5GON E;  2I0M A;  5HEO A;  2BVL A;  2XJ7 A;  2LHN A;  4DR4 T;  4AQF C;  4ZI2 D;  2V26 A;  2KLQ A;  4YT0 A;  4U74 A;  3PJA A;  2V7I A;  4JI6 T;  1E1H B;  3PUR A;  5LCY A;  3T1Y T;  2QGS A;  2DL1 A;  3ZMS B;  2MPK A;  2XU0 A;  4HN9 A;  2X51 A;  5ABF B;  1QUU A;  3LG7 A;  4CQI A;  5CA1 E;  5KDM C;  5LMN T;  2XQA A;  2VWA A;  2UUB T;  4PJJ A;  4EGW A;  1B7T A;  5ABF A;  4DR6 T;  2ZM6 T;  5LHG B;  3KV9 A;  3BQI A;  4P0B A;  3C4W A;  5IHY A;  3T1H T;  5LYJ E;  3OJA A;  5FY1 A;  3UUM A;  4O2B E;  4UEM A;  1UGO A;  2RP4 A;  3IBP A;  3UUN A;  4A5X A;  3P4Q A;  3ZEF B;  3C4Z A;  3HKE E;  4HFB A;  2WDR A;  4UF0 A;  3UUX B;  5H6Q B;  2XAQ B;  4IT4 A;  4OFZ A;  2E8I A;  3MAC A;  4O4I E;  2LRL A;  2BS4 A;  2H3R A;  5FYM A;  3SRZ A;  3V5U A;  3SWH A;  4ZHQ E;  3ZSS A;  2WDQ A;  4A56 A;  3Q5W A;  3AA6 B;  3LBX B;  4TNV A;  5EK3 A;  2VQF T;  3N5L A;  3AEF A;  1HF8 A;  2CM0 A;  2WDV A;  2FUP A;  4PFP A;  4B3R T;  2H88 A;  2CA5 A;  4Z91 A;  2XAG B;  4IDQ A;  5LHH B;  2ODU A;  4WBO A;  5JDM A;  4YY3 T;  3GN5 B;  2YKS A;  4OK0 A;  3RQW A;  2WSS V;  2KSR A;  4BAY B;  3MZK B;  3RHW A;  5LG3 A;  1XMO T;  4V1A v;  2HPL A;  5KXJ A;  2KZ7 B;  1IBK T;  4DV5 T;  4AXP A;  1T8B A;  2CBI A;  5ETW A;  2WWV A;  3UFG A;  2GK9 A;  1HG5 A;  1D1B A;  1MND A;  3H37 A;  4HWC A;  3RX6 A;  3TLS A;  5FNV E;  2XQ5 A;  3AAE B;  4DV3 T;  4U3C A;  1KNP A;  2MTQ A;  4OYK A;  2IC9 A;  5AQH B;  2LE8 A;  2LSG A;  5LGU B;  1E2A A;  2DCF A;  2XAS B;  4IE0 A;  4NPP A;  4Q25 A;  4IE4 A;  5BR8 T;  1IBL T;  3ANW A;  4I0U A;  2MAW A;  4EAH A;  4C91 A;  3KV4 A;  1NEK A;  3FHN A;  3LDQ B;  1T72 A;  2WS3 A;  2X66 A;  5DQW A;  5HXC A;  3CKD A;  3WAK A;  1M7K A;  1HCI A;  3ZT5 A;  1S94 A;  1VCS A;  2XQ7 A;  1MIV A;  1NWM X;  4KUM B;  2KIN B;  4TNW A;  2BKN A;  2A72 A;  2CHN A;  5HXH A;  4A64 A;  4B3M T;  1IZN B;  4YTM A;  3J7Y q;  3FXD B;  3M65 A;  1X9B A;  2AXD S;  1N36 T;  4LMJ A;  4YTP A;  4JI0 T;  5LXT E;  1YW0 A;  3AEC A;  2V7K A;  1KNR A;  3NBX X;  4PFO A;  1XZY A;  4HGA A;  5JTG A;  2CMR A;  2X9X A;  3CX8 B;  5L3F B;  2V8S V;  4EEB A;  1MMG A;  1YKE B;  4AKG A;  1LKX A;  2DWG A;  5HXR A;  2LOP A;  4COF A;  3AVS A;  5TAO A;  2JQK A;  4TWD A;  3UU4 A;  2UXB T;  3AE3 A;  2YN6 A;  1HFA A;  4HWF A;  2Q9Q C;  3B57 A;  2WB5 A;  2VK9 A;  3J9X 1;  4CXY A;  2X9W A;  4TWF A;  3PE0 A;  5AQK B;  3LK3 B;  4DV1 T;  3AED A;  1FJG T;  3E0Z A;  4IHJ E;  3EDV A;  3AAI A;  5JH7 E;  4LFC T;  2F4V T;  1WR6 A;  3ZCJ A;  2X0L B;  1UCU A;  3EI0 A;  4O4L E;  3P8C D;  5ABE A;  4EOZ B;  5AQP B;  4GYS A;  2IC6 A;  3N9M A;  2XQ6 A;  2CXL A;  2Q9Q D;  2WZI A;  3JAF A;  3Q5D A;  2H89 A;  3LJC A;  4U2Z A;  2BKO A;  4JEH B;  5J2U E;  2XQ4 A;  4X1I E;  3WAJ A;  2BG9 B;  1WCR A;  3UU8 A;  4TV8 E;  3AEG A;  3GWH A;  2NW7 A;  3L09 A;  1KNZ A;  3QB5 A;  1LDJ A;  3AA7 B;  1WLX A;  2X0H A;  4QHO A;  4TUY E;  3HL6 A;  4UIG A;  4Z8X A;  4QWN B;  4FI5 A;  5JRC A;  2D0U A;  2XQ8 A;  3B5M A;  4LF6 T;  4GKJ T;  2DHR A;  2FJE A;  4PJN A;  2NW9 A;  2BBH A;  3CML A;  2PFV A;  2X0Y A;  3Q5X A;  3FBL A;  4IE7 A;  5L3B B;  2YDR A;  3JC6 C;  5AQT B;  1BR2 A;  2V7J A;  4DV7 T;  4ASK A;  1FIO A;  4JI8 T;  3KV5 A;  3DPL C;  5JDL A;  3X1D A;  1WR0 A;  4WNK A;  2NW8 A;  1N33 T;  4KHP T;  1I6Z A;  5LGN B;  5FVK A;  2JPF A;  2LOS A;  2PBI A;  2J4G A;  3I0O A;  5IYZ E;  4DBQ A;  2ACX A;  3ETU A;  5C8Y E;  5HXS A;  4ZS3 A;  4YXD A;  2WAU A;  4AIU A;  4YTN A;  3RC8 A;  2CXD A;  2J1D G;  2ZM2 A;  3UT5 E;  5JDQ A;  4O4H E;  2Y6X A;  5L3E B;  1VCT A;  2NP9 A;  3R6N A;  3VR9 A;  4X65 T;  4AKI A;  4B3S T;  2FJB A;  1XDO A;  3H3A A;  2XAF B;  4JI5 T;  3WI3 A;  3O4X E;  2P9B A;  5JDH A;  1LVK A;  2YEV C;  4U2Y A;  5JR9 A;  2WU2 A;  4ILC A;  4YSZ A;  2BG9 C;  3ONX A;  4H9Q C;  2W66 A;  1MMN A;  3AA0 B;  3FZF B;  3HI2 A;  2RA1 A;  3O1J A;  2D5U A;  3AEE A;  1JNZ A;  4DND A;  3IA3 A;  2V6X A;  3NWI A;  3LSV A;  3RI5 A;  4DR5 T;  1DU2 A;  4WQO D;  1IAP A;  4JI2 T;  3ZT6 A;  4C90 A;  1ZEE A;  3K3Q C;  5ABG A;  3CQX C;  2LSJ A;  4LF8 T;  3JAE A;  3RYH E;  2XHE B;  3TKL B;  5ABH A;  3HKB E;  4P1N A;  3AXJ A;  5LOV E;  2R6G F;  4U72 A;  4EZH A;  4M1P A;  3NRY A;  4H63 V;  3ETV A;  2V6Y B;  3AXJ B;  1UX5 A;  2EHO D;  3DP7 A;  3O1H A;  4HE8 A;  5AQR B;  3ZMT B;  4DO0 A;  4CN1 A;  4E7Z A;  3BQK A;  4P09 A;  5EK4 A;  3RIF A;  3ZLI A;  5JQG E;  2K48 A;  4AI6 A;  2YIN A;  2W61 A;  2XY8 B;  4QX7 B;  4KI0 F;  3P50 A;  3E08 A;  4UVC B;  3DJB A;  4QH5 A;  5HXE A;  5HYA A;  4AQG A;  1MMD A;  1CUN A;  3KFW X;  4PJL A;  2H7O A;  2ES0 A;  2JMH A;  3ZJ2 A;  2LRK A;  2CBJ A;  2QA7 A;  3K3O A;  4H9P C;  3AE7 A;  2CRB A;  4HFE A;  4KX6 A;  4CI2 B;  2CWY A;  2QYW A;  5EK2 A;  1OED A;  5JR9 B;  3M3Z B;  3FZL B;  3SS1 A;  3N9L A;  3IF8 B;  2WQY A;  3GMI A;  2YK0 A;  3FB2 A;  5AQQ B;  5L3G B;  2ODV A;  2HHH T;  1U5P A;  2JQQ A;  2FJA A;  2D9D A;  3I1A A;  3Q2M A;  5E0O A;  2N2N A;  4CN6 A;  4HKA A;  5L3D B;  3RYI E;  3PUG A;  4ERR A;  1W0B A;  2W67 A;  2LKH A;  2N9D A;  1Z8U A;  4IRE A;  4DMV A;  5J0Z A;  1FMW A;  3PJA J;  2VKJ A;  3QNU A;  5HEJ A;  5CJ5 A;  4L5G A;  2D0T A;  1U6G A;  1LDK A;  4KMC A;  1QLB A;  2YDQ A;  4UF0 B;  2OA5 A;  3RRW A;  4WZX A;  5FXX A;  4YJ2 E;  3ZC0 A;  3KIN B;  4JI4 T;  2DLR A;  2LSI A;  3TLV A;  3OKQ A;  2N1G A;  1FEW A;  5AFU L;  2CPT A;  3UQ7 A;  3ZYL A;  3AE4 A;  3O1I A;  4ADZ A;  4JUY A;  4CN4 A;  3ZT7 A;  5AQI B;  4JGH D;  5C3J A;  4N9F 3;  4UEL A;  3C51 A;  4K0K T;  1MIW A;  4TX5 A;  3MK7 C;  5FMN A;  3MJX A;  4I43 B;  1MIY A;  1OED C;  4HXI B;  5L2L A;  2UU9 T;  3CQG B;  5CA0 E;  1SHZ C;  1HTJ F;  1UK5 A;  3QB5 K;  3N2G E;  3RC3 A;  4H9O C;  4X1K E;  3TLT A;  2E5L T;  4MFR A;  2CE7 A;  4B6X A;  2XM2 A;  2L9Q A;  2C5J A;  4XBF B;  4LF4 T;  2JQ9 A;  4KBM B;  4X1Y E;  3VHL A;  1SA0 E;  5HAX A;  2EHO C;  4HEA A;  4H9R C;  4IE5 A;  3ZYK A;  4LF5 T;  1HX8 A;  3PDY A;  3IEE A;  4DUZ T;  3EVY A;  4TWH A;  1U4Q A;  3FZH B;  4I55 E;  4LML A;  3ZPO A;  4WBN E;  1D1A A;  2EHO B;  4HFC A;  5A1L A;  4NXM T;  2C5K T;  3RKO A;  3PUV F;  4GIW A;  4YSY A;  3K3N A;  4HWI B;  5LB7 B;  4AKR B;  5BMV E;  5AQV B;  3FZM B;  3P4P A;  3QK6 A;  4YHH T;  2K24 A;  3F31 A;  5L4H A;  2DWK A;  4ZOL E;  4TN7 B;  4ILB A;  2K9A A;  3SFE A;  4X64 T;  3FXE B;  3B13 A;  1N34 T;  4XAX B;  3C98 B;  3OYX A;  3CIR A;  4HFV A;  4L9I A;  4PW8 A;  4UVB B;  2K5B B;  4IL4 A;  2HN1 A;  3JCF A;  2E9X B;  2V5D A;  5AQM B;  5FY7 A;  1SE7 A;  3C4X A;  3N9N A;  5M4Y A;  2V7M A;  1FMV A;  3I0Q A;  3AE2 A;  3K8P C;  3PUZ F;  4IDO A;  5JDG A;  3ZMU B;  3ZST A;  3MXZ A;  4EYY R;  4DV0 T;  2HPJ A;  1ZV4 X;  4J2C A;  2ZM0 A;  4CXW A;  3LK4 2;  3QUJ A;  1VOM A;  1IJ5 A;  2KND A;  5HEG A;  2M6I A;  2VKO A;  1ZOY A;  2B76 A;  2HH7 A;  2I59 A;  5JDF A;  3NKZ A;  5HEU A;  1UUR A;  2QVA A;  3MKD A;  3I9Y A;  3RKG A;  3AB3 B;  4QH1 A;  2IHR 1;  3FZK B;  5AQJ B;  4ZI7 E;  3CVR A;  5DAB A;  4HFI A;  3ZJ1 A;  1LDK B;  5ADX L;  2I6H A;  4WW0 A;  4NXN T;  1G73 A;  4K0U A;  5LJM A;  2ZM8 A;  4ZXL A;  5LJN A;  1Y64 B;  3UQ4 A;  4ZI3 D;  1WYB A;  2W0G A;  2L8K A;  1LRZ A;  4EZ4 A;  1YD8 G;  2WP9 A;  2JMK A;  4OYJ A;  3LFM A;  3RYF E;  3ZKR A;  3ZYM A;  3L39 A;  3CQC B;  2BS2 A;  3EAM A;  4UV8 B;  2H7V C;  3DTO A;  1WYC A;  3KBU A;  1MNE A;  1OED B;  1NAF A;  3VRA A;  2KT9 A;  3ABV A;  1YKH B;  4DBR A;  1HNZ T;  2E9X A;  5AQS B;  2BS3 A;  1OWA A;  2XAH B;  1M62 A;  3AA1 B;  4YJ3 E;  2W4X A;  3TLU A;  2XM1 A;  3KDS E;  5EZY E;  4EYU A;  5LP6 E;  2D2S A;  3MA9 A;  5JRC B;  2ZMA A;  2NTX A;  3H3M A;  4YSX A;  3KVA A;  5H6R B;  2XQ3 A;  2LJL A;  2VL8 A;  3HKC E;  4O4J E;  3BQL A;  4ISS A;  4UV9 B;  5AQL B;  3R84 B;  4BJM A;  3P4W A;  5F5W A;  3N2O A;  2A3D A;  2VB6 A;  5FKY A;  2BVM A;  2XAJ B;  2V7L A;  2YOE A;  4PJM A;  4JI7 T;  4LF7 T;  2BZB A;  4DR7 T;  4QXH B;  2XSB A;  3ZC1 A;  4E7S A;  3EHZ A;  2MYS A;  2J62 A;  1KK7 A;  2JRK A;  4ILU A;  4UVA B;  3P4R A;  2VVN A;  1YQ4 A;  4I50 E;  3S4U A;  4OHF A;  3OTO T;  4ZI2 C;  1W0A A;  2QRX A;  1YQ3 A;  2E9X D;  2V6Y A;  2XQ9 A;  2YU2 A;  3E22 E;  4HFD A;  4HTE A;  4IDZ A;  4U33 A;  3CPZ A;  2NTY A;  2IIU A;  3A8Y C;  4UXN B;  5JVD E;  4IL9 A;  2ACZ A;  2BBJ A;  2M6B A;  5FY0 A;  2W2U A;  2NOX A;  2W63 A;  2E9X C;  3UFE A;  4EIW A;  5L3C B;  2CEA A;  2NWB A;  4IGU A;  1W09 A;  3ANW B;  3KBT A;  5F3J A;  2XSA A;  2BDE A;  2X67 A;  2A2F X;  4DMW A;  5JRE A;  1XMQ T;  2UUA T;  2WZK A;  2KMF A;  2W00 A;  4IE6 A;  4U31 A;  4X5T A;  3AE5 A;  3QC9 A;  3UU5 A;  1S35 A;  5LGT B;  2CHO A;  3HKD E; 
#chains in the Genus database with same CATH homology
 1MMA A;  1BR1 A;  1Z0P A;  4GOU A;  4MLK A;  4L0R A;  4H63 H;  5HWY A;  3F57 A;  1ZKE A;  2Q9Q B;  3NRX A;  5CB4 E;  4BJN A;  1EZ3 A;  3PU8 A;  3VKG A;  2Y48 B;  3W15 B;  5LNK A;  1X79 A;  2YU1 A;  2Z6E A;  2B1E A;  4QXB B;  3L3P A;  3GN5 A;  5FXZ A;  4BJM A;  5DQV A;  5LA6 E;  3IHR A;  3I9W A;  4GK5 E;  2MOZ A;  4YHJ A;  3F2E A;  4EXT A;  3PTR B;  5F8P A;  4NUU A;  4KP3 C;  5HWX A;  4N78 D;  2W62 A;  3N9Q A;  5J1G A;  4ZI3 C;  4EB6 E;  1H7C A;  2KXP B;  2LT3 A;  2JJ9 A;  5FXW A;  4MBQ A;  3N2K E;  3RH3 A;  2G0U A;  2WWU A;  3LK2 B;  4G2A A;  3CX7 B;  5LHI B;  1D0Y A;  3VU7 H;  1AJ3 A;  3A5X A;  2VKH A;  3CWZ B;  4QXC B;  3PUQ A;  4QX8 B;  2C0S A;  3KV6 A;  3PUA A;  2X9H A;  1IJ6 A;  4CI1 B;  2L3L A;  3JC6 D;  4F6R C;  2LSK A;  4TZ4 C;  5LBQ B;  1T98 A;  4O8S A;  2ZLY A;  2WMO A;  3EUH A;  2DNX A;  1UX4 A;  1LVF A;  2X9Y A;  5J2T E;  3PUS A;  3ZMV B;  2M67 A;  4X20 E;  3HA4 A;  2C5I T;  3ZMZ B;  3AAA B;  5DJQ C;  4JEU B;  5KX5 E;  3N9P A;  2CLY B;  1O3X A;  1V9D A;  3V5S A;  4AQF A;  2XUE A;  2KWI B;  4MHC A;  4MAL A;  3OYZ A;  3U3I A;  3VKH A;  1ZHC A;  3D0T A;  3KVB A;  4ANJ A;  3C64 A;  1QSD A;  2MBG A;  2LEH A;  3RPU A;  2CXF A;  2Q9Q A;  3UTK A;  2PG8 A;  4IIJ E;  2Y8D A;  2IAK A;  2VAS A;  1HG2 A;  4H9N C;  3RYC E;  3HR0 A;  4PAG A;  2LM9 A;  3Q9D A;  3CX6 B;  3ZN0 B;  3N9O A;  4XZC A;  2LHR A;  4ZS2 A;  3SOL A;  1OXZ A;  3T8O A;  5LBM A;  4TV9 E;  3RRC A;  4O2A E;  5FP3 A;  3P7I A;  1US7 B;  4CI3 B;  3UUL A;  4AKL A;  1D0Z A;  4IST A;  3AVR A;  4PNI A;  4DND A;  4G63 A;  5LG4 A;  1BR0 A;  1HS7 A;  2PJQ A;  2XTL A;  4PK4 A;  2UXX B;  2X68 A;  2SPC A;  3ESL A;  4CZZ B;  3OBV E;  1VRB A;  4H9S E;  1D1C A;  5KMG P;  2CWO A;  4QKN A;  5JR9 C;  2LSY A;  1G8X A;  4JLE A;  3PU3 A;  4FJO A;  4BA9 A;  4DVD A;  3FBZ A;  3EDU A;  3ZCI A;  4P0A A;  3U78 A;  2EHO A;  2WMN A;  4GK0 E;  3NZP A;  4CXX A;  1WRD A;  4I4T E;  1BR4 A;  2WBL A;  3NZQ A;  4NUV A;  2IW5 B;  4AKH A;  1D0X A;  4YLH A;  4YFS A;  3BK9 A;  5FXV A;  2WM9 A;  3GA8 A;  2DI4 A;  5JDN A;  2KWH A;  2UXN B;  3LBX A;  3O9X A;  2VKD A;  2XQY A;  2V1D B;  3C50 A;  4PK5 A;  4GYR A;  4PK6 A;  3ZN1 B;  2CLY C;  2CCQ A;  5GON E;  2BVL A;  2LHN A;  4AQF C;  4ZI2 D;  2V26 A;  2KLQ A;  4U74 A;  2V7I A;  1E1H B;  3PUR A;  5LCY A;  2QGS A;  3ZMS B;  2XU0 A;  4HN9 A;  2X51 A;  1QUU A;  3LG7 A;  4CQI A;  5CA1 E;  5KDM C;  2VWA A;  4PJJ A;  1B7T A;  5LHG B;  3KV9 A;  3BQI A;  4P0B A;  3C4W A;  5IHY A;  5LYJ E;  3OJA A;  5FY1 A;  3UUM A;  4O2B E;  4UEM A;  2RP4 A;  3IBP A;  3UUN A;  3ZEF B;  3C4Z A;  3HKE E;  4UF0 A;  3UUX B;  5H6Q B;  2XAQ B;  4OFZ A;  4EIW A;  2E8I A;  3MAC A;  4O4I E;  3V5U A;  5FYM A;  2H3R A;  3SRZ A;  3SWH A;  4ZHQ E;  4A56 A;  3Q5W A;  3AA6 B;  3LBX B;  5EK3 A;  3N5L A;  1HF8 A;  2CM0 A;  4PFP A;  2CA5 A;  2XAG B;  5LHH B;  2ODU A;  4WBO A;  5JDM A;  3GN5 B;  4OK0 A;  4BAY B;  2WSS V;  3MZK B;  4V1A v;  2HPL A;  2KZ7 B;  4AXP A;  5ETW A;  2GK9 A;  1HG5 A;  1D1B A;  1MND A;  3H37 A;  3RX6 A;  5FNV E;  3AAE B;  2MTQ A;  4OYK A;  2IC9 A;  2LE8 A;  2LSG A;  5LGU B;  2DCF A;  2XAS B;  4IE0 A;  4IE4 A;  3ANW A;  4EAH A;  4C91 A;  3KV4 A;  3FHN A;  5DQW A;  2X66 A;  5HXC A;  3WAK A;  3CKD A;  1HCI A;  1S94 A;  4KUM B;  1MIV A;  1NWM X;  2KIN B;  2A72 A;  5HXH A;  1IZN B;  3J7Y q;  3FXD B;  3M65 A;  5LXT E;  1YW0 A;  2V7K A;  3NBX X;  4PFO A;  4HGA A;  2CMR A;  2X9X A;  3CX8 B;  5L3F B;  1MMG A;  1YKE B;  4AKG A;  1LKX A;  2DWG A;  5HXR A;  2LOP A;  3AVS A;  5TAO A;  1HFA A;  2Q9Q C;  3B57 A;  2VK9 A;  4CXY A;  2X9W A;  3PE0 A;  3LK3 B;  3E0Z A;  4IHJ E;  3EDV A;  3AAI A;  5JH7 E;  1WR6 A;  3ZCJ A;  2X0L B;  1UCU A;  4O4L E;  3P8C D;  4EOZ B;  4GYS A;  2IC6 A;  3N9M A;  2CXL A;  2Q9Q D;  3J9X 1;  5J2U E;  3LJC A;  4JEH B;  4X1I E;  3WAJ A;  4TV8 E;  3GWH A;  2NW7 A;  3L09 A;  1KNZ A;  3AA7 B;  1WLX A;  4QHO A;  4TUY E;  3HL6 A;  4UIG A;  4Z8X A;  4QWN B;  4FI5 A;  5JRC A;  2D0U A;  2DHR A;  4PJN A;  2NW9 A;  3CML A;  2PFV A;  3Q5X A;  5L3B B;  3FBL A;  4IE7 A;  3JC6 C;  1BR2 A;  2V7J A;  4ASK A;  1FIO A;  3KV5 A;  5JDL A;  4WNK A;  2NW8 A;  5LGN B;  2JPF A;  2LOS A;  2PBI A;  3I0O A;  5IYZ E;  4DBQ A;  5HXS A;  2ACX A;  3ETU A;  5C8Y E;  3RC8 A;  4ZS3 A;  2WAU A;  2CXD A;  2J1D G;  2ZM2 A;  3UT5 E;  5JDQ A;  4O4H E;  2Y6X A;  5L3E B;  2NP9 A;  3R6N A;  4AKI A;  3H3A A;  2XAF B;  3WI3 A;  3O4X E;  2P9B A;  5JDH A;  1LVK A;  2YEV C;  5JR9 A;  3ONX A;  4H9Q C;  3AA0 B;  1MMN A;  3HI2 A;  2RA1 A;  3O1J A;  2D5U A;  1IAP A;  4C90 A;  1ZEE A;  3K3Q C;  3CQX C;  2LSJ A;  3RYH E;  2XHE B;  3TKL B;  3HKB E;  5LOV E;  4U72 A;  4EZH A;  4M1P A;  3NRY A;  4H63 V;  3ETV A;  1UX5 A;  2EHO D;  3DP7 A;  3O1H A;  4HE8 A;  3ZMT B;  4DO0 A;  5JQG E;  4E7Z A;  3BQK A;  4P09 A;  5EK4 A;  3ZLI A;  2K48 A;  4AI6 A;  2YIN A;  2W61 A;  4QX7 B;  3E08 A;  4UVC B;  3DJB A;  5HXE A;  5HYA A;  4AQG A;  1MMD A;  1CUN A;  3KFW X;  4PJL A;  2H7O A;  2ES0 A;  2JMH A;  3ZJ2 A;  2QA7 A;  3K3O A;  4H9P C;  4CI2 B;  2CWY A;  5EK2 A;  5JR9 B;  3SS1 A;  3N9L A;  3IF8 B;  3GMI A;  2YK0 A;  3FB2 A;  5L3G B;  2ODV A;  1U5P A;  2JQQ A;  3I1A A;  3Q2M A;  5E0O A;  2N2N A;  4HKA A;  5L3D B;  3RYI E;  3PUG A;  4ERR A;  2N9D A;  4DMV A;  1FMW A;  2VKJ A;  4L5G A;  2D0T A;  4KMC A;  4UF0 B;  3RRW A;  2OA5 A;  4YJ2 E;  5FXX A;  3ZC0 A;  3KIN B;  2DLR A;  2LSI A;  5AFU L;  3OKQ A;  2N1G A;  1FEW A;  3ZYL A;  3O1I A;  4ADZ A;  4JUY A;  4UEL A;  3C51 A;  1MIW A;  4TX5 A;  3MK7 C;  5FMN A;  3MJX A;  4I43 B;  1MIY A;  5L2L A;  3CQG B;  5CA0 E;  1SHZ C;  1HTJ F;  3N2G E;  3RC3 A;  4H9O C;  4X1K E;  4MFR A;  2CE7 A;  4B6X A;  2L9Q A;  2C5J A;  4XBF B;  4KBM B;  4X1Y E;  3VHL A;  1SA0 E;  5HAX A;  2EHO C;  4HEA A;  4H9R C;  4IE5 A;  3ZYK A;  1HX8 A;  3PDY A;  3IEE A;  3EVY A;  3ZPO A;  1U4Q A;  4I55 E;  4WBN E;  5A1L A;  1D1A A;  2EHO B;  2C5K T;  3RKO A;  4GIW A;  3K3N A;  4AKR B;  5BMV E;  3QK6 A;  2K24 A;  3F31 A;  2DWK A;  4ZOL E;  4TN7 B;  2K9A A;  3FXE B;  3B13 A;  4XAX B;  3C98 B;  3OYX A;  4HFV A;  4L9I A;  4PW8 A;  4UVB B;  2K5B B;  2E9X B;  5FY7 A;  3C4X A;  3N9N A;  5M4Y A;  2V7M A;  1FMV A;  3I0Q A;  3K8P C;  5JDG A;  3ZMU B;  3MXZ A;  4EYY R;  2HPJ A;  1ZV4 X;  4J2C A;  2ZM0 A;  4CXW A;  3LK4 2;  3QUJ A;  1VOM A;  1IJ5 A;  2KND A;  2VKO A;  2I59 A;  2HH7 A;  5JDF A;  3MKD A;  3I9Y A;  3AB3 B;  4ZI7 E;  3CVR A;  5DAB A;  3ZJ1 A;  5ADX L;  4WW0 A;  1G73 A;  4K0U A;  5LJM A;  2ZM8 A;  5LJN A;  1Y64 B;  4ZI3 D;  1WYB A;  2W0G A;  2L8K A;  1LRZ A;  4EZ4 A;  1YD8 G;  2JMK A;  4OYJ A;  3LFM A;  3RYF E;  3ZYM A;  3CQC B;  4UV8 B;  2H7V C;  3DTO A;  1WYC A;  3KBU A;  1MNE A;  1NAF A;  2KT9 A;  4DBR A;  1YKH B;  2E9X A;  1OWA A;  2XAH B;  3AA1 B;  4YJ3 E;  4EYU A;  5LP6 E;  3KDS E;  5EZY E;  5JRC B;  2D2S A;  3MA9 A;  2ZMA A;  2NTX A;  3KVA A;  5H6R B;  2LJL A;  2VL8 A;  3HKC E;  4O4J E;  3BQL A;  4ISS A;  4UV9 B;  3R84 B;  3N2O A;  2A3D A;  2VB6 A;  2BVM A;  2XAJ B;  2V7L A;  4PJM A;  2BZB A;  4QXH B;  4E7S A;  2MYS A;  2JRK A;  1KK7 A;  4ILU A;  4UVA B;  3S4U A;  4I50 E;  4OHF A;  4ZI2 C;  3ZC1 A;  2E9X D;  3E22 E;  2YU2 A;  4IDZ A;  4HTE A;  3CPZ A;  2NTY A;  4UXN B;  5JVD E;  5FY0 A;  2W63 A;  2NOX A;  2E9X C;  3UFE A;  5L3C B;  2CEA A;  2NWB A;  4IGU A;  3ANW B;  3KBT A;  5F3J A;  2BDE A;  2X67 A;  2A2F X;  4DMW A;  5JRE A;  2KMF A;  2W00 A;  4IE6 A;  3QC9 A;  5LGT B;  1S35 A;  3HKD E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...