4NUVA

Heterotetramer structure of region ii from plasmodium vivax duffy binding protein (pvdbp) bound to the ectodomain of the duffy antigen receptor for chemokines (darc)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
298
structure length
288
Chain Sequence
NTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVFHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, cell invasion
molecule keywords Duffy receptor
publication title Red Blood Cell Invasion by Plasmodium vivax: Structural Basis for DBP Engagement of DARC.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 113
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4nuvA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4nuvA01
2XU0A 3BQIA 3CMLA 4YFSA 3RRCA 2YK0A 4NUUA 5F3JA 2Y8DA 3BQLA 2WAUA 3C64A 3CPZA 4NUVA 3BQKA
chains in the Genus database with same CATH superfamily
2X0LB 5FXXA 4C90A 2YOEA 3ONXA 3CMLA 4YTMA 4OK0A 4U3CA 3P4QA 3WI3A 3P50A 3R6NA 1T7SA 3LSVA 5L3DB 1CUNA 3PUGA 4I55E 4IDNA 4GK5E 5JTGA 2WSSV 2XSAA 3H37A 4O4IE 2X51A 3AEGA 3TKLB 4TV9E 5ABGA 3NBXX 3I0OA 2MAWA 3AXJA 4MALA 3I1AA 2SPCA 2XHEB 5LG4A 1SUMB 5H6RB 4OHFA 5LHGB 2C5JA 4GKKT 4ZI3D 5FXWA 5EZYE 2A3DA 4GOUA 5DABA 3AAAB 4X65T 4QX7B 1KNRA 2WMNA 4GYSA 2P9BA 4LFCT 4AQFA 1HG2A 3SFEA 1D0XA 5L3BB 3UUNA 3OKQA 2Y48B 3P4RA 4IHJE 4CQIA 2LRLA 3AE6A 5CJ5A 4AQYT 3K3OA 2L9QA 4GK0E 2VQFT 4U2ZA 2OLTA 4JI2T 4JEHB 1L0VA 2R6GF 2W61A 3PJAJ 2Q9QC 5AQQB 3F57A 3WAJA 4IIJE 4EOZB 3PUYF 2CXFA 4UVAB 4X64T 2GK9A 3F2EA 4UR9A 1U6GA 3MKDA 4U33A 1Z8UA 2CLYB 4HWCA 2V7KA 3AA0B 4JUYA 3AE4A 2BBJA 2WP9A 5ABFB 1JNZA 4UF0B 5LJNA 2BBHA 3SS1A 4GYRA 1U4QA 4H9PC 2LOPA 2MPKA 2KSRA 2RPAA 2H7VC 1MNDA 2K9AA 5LA6E 2V6YA 5ABFA 2DHRA 3C4XA 3CK6A 4HKAA 4HWHA 2ZLYA 3EHZA 2V6XA 1OEDB 2WDRA 3ESLA 1I94T 4O2BE 3RYIE 5FL0A 1T98A 4IDQA 1HNWT 5HAXA 4QXBB 4YFSA 2X66A 3VR8A 4HGAA 4NUUA 3OVUA 3ZT7A 3CQXC 3AAEB 5F8PA 4K0UA 4PJMA 2WZKA 4DV7T 5ETWA 3PUSA 1OEDA 1UX5A 4JI4T 3IA3A 3P8CD 3AEAA 4HEAA 3PUWF 2XQAA 4IE0A 4DR3T 1MMDA 1KFYA 1XWMA 2XQ8A 3S4UA 4DMWA 3RGLA 3CKDA 2WZHA 4PK5A 5IWAT 2VKHA 4PJNA 3EABA 4PK4A 2NR4A 3CQCB 2JMKA 3AE5A 4JYAT 2Q9QB 2EHOB 3O1IA 5HEUA 2V7IA 4EEBA 3LG7A 5FNVE 3BQIA 4IE4A 2OV9A 5KX5E 5L2LA 4EAHA 3L3PA 4KX6A 5JQGE 4XBFB 5LHIB 5BMVE 5DQVA 2LKHA 4AP2B 2EHOA 3O4XE 4WNKA 4DV5T 3RIFA 2A9UA 3K8PC 2X9HA 2XM1A 2YN6A 4WW0A 4CN4A 4H63H 2KXPB 2K3WA 4TX5A 4EV6A 2VQET 2B1EA 3CX6B 1UUSA 5FL1A 4JGHD 5H6QB 2X9XA 4DMVA 5JRCA 2X9YA 2W00A 3PJAA 1MIWA 3AA6B 1D1BA 3J7Yq 4JI6T 3AA7B 2ZM8A 3U3IA 4ILBA 3QB5A 2QVAA 4YHJA 3V5UA 3ZJ1A 5AQLB 4JEUB 2E2AA 3C51A 3CPZA 3ANWB 2YDSA 1X79A 2QRXA 4DR6T 2LT3A 4DV1T 3IEEA 4YHHT 3RYCE 5L3CB 4ANJA 3NZQA 4UVCB 1XMQT 3CX8B 3FB2A 3VR9A 2FJBA 2A2FX 5C2TA 3ZPOA 2E9XC 3ANWA 4U2YA 4LMJA 4O4HE 2JQHA 4IGUA 2C0SA 4IE7A 2WDVA 2ZM6T 4JV5T 3NVOA 5HCJA 2BS2A 5DQWA 5FVKA 2G0UA 3R84B 1BR0A 3F31A 3RQUA 2WDQA 5JDGA 4ZI7E 3ZMVB 4YTNA 5HXCA 3QC9A 1LDJA 4DBQA 4JI8T 3I9WA 2A72A 4LF7T 2UUAT 1CHUA 5J2UE 2KZ7B 3TLUA 5LCYA 1UURA 4U74A 1Z0PA 2Q9QD 3PUXF 2V7LA 2CXDA 3UQ7A 2DL1A 2M6IA 4U7YA 5HWYA 3L39A 1IBKT 3E08A 3UQ4A 1HFAA 3FBLA 1N34T 1O3XA 3NRYA 4AQFC 4AXPA 3RKOA 1UK5A 4DR1T 4ISTA 1W0AA 4PW8A 5AQOB 1E2AA 2WM9A 1KNPA 2LSGA 3OJAA 4OYKA 3ZYMA 3T1YT 1LVFA 4OX9T 4EB6E 4X66T 5EK3A 2E5LT 3RHWA 2VVNA 3AEFA 5JDHA 4PK6A 2XTLA 1YD8G 3HKCE 1SHZC 2MTQA 4AI6A 1D1CA 3KV5A 4UXNB 3ZYKA 5L3FB 3RTRA 3OTOT 2WBLA 4QHOA 2K24A 2YINA 2V5DA 2WWUA 2UUCT 5FKYA 4H9RC 1WFDA 5CFBA 3OYXA 2CCQA 4HFBA 2VKJA 4LF4T 3Q5DA 4E7ZA 4EEDA 2E9XB 2VASA 5AQUB 2N9DA 2W0GA 3X1DA 4PFPA 1UGOA 3KV9A 3N9NA 4DBRA 2MYSA 2CPTA 5AQNB 4QWNB 4CXWA 4JBWF 1GQEA 2E9XA 5FYMA 3N9QA 4IREA 2HPJA 3GA8A 3AXJB 2KINB 3Q9DA 3AE1A 4X1IE 2UUBT 2OA5A 2VVSA 5HEOA 3ETVA 1S35A 2KT9A 3RPUA 1MNEA 4ASKA 4E7SA 5IYZE 3RF1A 3Q5WA 3PTRB 3J9X1 2C5KT 1OEDC 3NKZA 4EXTA 1HR0T 3EDVA 2AE9A 3JCFA 2V8SV 1QLBA 5CGMA 3RC8A 4M1PA 3ZKRA 4ZI2C 3W15B 4TWDA 1KEYA 1KF6A 4YSYA 4DR4T 5ABHA 1N33T 5AQGB 4ILAA 2RA1A 2UXCT 2H89A 4IE6A 4O2AE 1IBMT 4ZS2A 1J1JA 2XUEA 2XJ7A 4BA9A 2YU2A 3KFWX 1QSDA 5LGNB 3EVYA 5CA0E 5HXRA 1LDKB 2PG8A 3UTKA 1BR4A 1HNZT 3ZSTA 4ZOLE 2XAQB 4DO0A 2EHOC 1LVKA 4FI5A 4ZEYA 3NZPA 3KVBA 2CBIA 2ODUA 3K3NA 2XAGB 1WRDA 4HE8A 2CHOA 3AE8A 1LDKA 5KDMC 2VKDA 3IF8B 1IBLT 2E5VA 3ZN1B 3UULA 3VRAA 3UU6A 4PJLA 3JAFA 3DP7A 4IE5A 3MA9A 4DR5T 2VB6A 4MHCA 2LHNA 2XAJB 3UT5E 4HXIB 3D0TA 2V6YB 2MBGA 3A8YC 5L4HA 1MMAA 4X5TA 1OWAA 5JVDE 3KVAA 5HEHA 3PURA 2NP9A 3A5XA 3PDYA 4O8SA 3C98B 1D0ZA 1FIOA 3RRWA 3AEBA 5AQMB 4YLHA 3P4SA 4UVBB 4Z91A 3AE9A 2N1GA 4MFRA 3QB5K 1ZEEA 3A7MA 3ZC1A 5HEJA 2XZEA 2LM2A 3LK3B 2PJQA 4N9F3 1WLXA 3G06A 1HX1B 5HXSA 2LLYA 1UCUA 4FJOA 4P09A 3E22E 4KUMB 3GN5B 3Q5EA 5F5WA 3N9LA 4I50E 1UX4A 2DCFA 2CM0A 3ZMSB 1E1HB 1OXZA 2UXNB 4F8HA 1J5WA 4UEMA 4GIWA 3ABVA 2WU5A 4X1KE 2XQ4A 3GN5A 2YDRA 1W0BA 3Q5XA 4TZ4C 5LYJE 4KHPT 2V5CA 4YY3T 3Q2MA 3RIAA 3N9PA 5A1LA 4IDZA 3C64A 2XQ5A 2YEVC 4DV2T 5AQKB 4CI3B 4F6RC 1S94A 3T1HT 2DLRA 3NWIA 5AQHB 4HFIA 4EIWA 3FBZA 2I6HA 3KV6A 2NWBA 5LG3A 4YJ3E 3C4ZA 2IC9A 3ZSSA 1XMOT 2I59A 4B3ST 4YSZA 4EZ4A 3NRXA 1U5PA 1NWMX 5LMNT 3AEEA 3CX7B 1I6ZA 2K5BB 5FVLA 5JRCB 4APFB 4CI1B 3P7IA 4DR2T 3ZMUB 4ILCA 2CBJA 3M65A 3I9YA 4QH4A 4KI0F 3KINB 4OFZA 3CIRA 3L09A 4YT0A 3QOFA 1IZNB 4MBQA 1Y01A 4BJMA 1LKXA 2QGSA 3O1HA 1ZOYA 2YKSA 2KLQA 3UUBA 3VU7H 4QH1A 2KWIB 2C5IT 3VHLA 2VL0A 2XQ3A 3I0QA 3SOLA 4LF9T 2XQ9A 1J5ET 5GONE 5LGTB 4ZI2D 5JR9A 3B5MA 3PUVF 5DJQC 1BR2A 3RRCA 2B76A 3ZCIA 5L3EB 1WR0A 5FY1A 4QXHB 3LBXB 4HFVA 4AKIA 4NIQA 2ZMAA 4P5OA 3TLWA 3KV4A 4LF6T 1T72A 4ILUA 2IDOB 4TUYE 2DWKA 3AE7A 2X0HA 1ZKEA 1QUUA 2H3RA 3ETUA 5ADXL 3LBXA 4LF8T 3GWHA 2WMOA 2LE8A 2J4GA 2NTYA 4AKRB 3EI0A 5IUXA 5M4YA 4CXXA 1FEWA 4COFA 4IT4A 4EYUA 1NEKA 2W62A 4EYYR 1NENA 4ERRA 4AQGA 4IL9A 4AKGA 1IAPA 2EHOD 3ZCJA 4JI0T 2LKGA 3PV0F 2E8IA 2WCAA 4AISA 2QA7A 4WBOA 3HKEE 4CN1A 2FJEA 4K0KT 4JI7T 3GMIA 1HTJF 3KBTA 4PAGA 3V5SA 5BR8T 2XM2A 5AQVB 4DNDA 2Z6EA 3ZT5A 4L0RA 1IJ5A 2WAUA 5AQTB 1JNRA 5L47A 1D1AA 2ZM0A 1FJGT 4UIGA 3FZFB 3H3MA 4LMKA 3ZJ2A 3FXEB 5L4EA 4HFDA 5AQSB 4A5XA 3FZKB 2W63A 2XQYA 2NW8A 3RKGA 4YTPA 3PE0A 3LK42 2ACZA 3AE2A 3JAEA 4LFAT 2BS4A 1YW0A 2X9WA 2ODVA 2BG9E 2XU0A 2LRKA 4TNVA 5HEGA 1T8BA 3AECA 4DV0T 5LNKA 2BVLA 3HKBE 3IBPA 1E7PA 2N2NA 4TNWA 3QUJA 4G2AA 2FJAA 3LFMA 4YJ2E 1N32T 3SRZA 3RC3A 2LSKA 4TV8E 3O1JA 4PFOA 4U7IA 4X20E 3UU4A 2BDEA 4CN6A 3DTOA 3P4PA 3QNUA 2VURA 2FBWA 3EDUA 4XAXB 3N9OA 2LHRA 2BKNA 4PNIA 2VKOA 2WB5A 2HN2A 3M3ZB 1MIYA 4ZS3A 5J2TE 3RYHE 1MMGA 3N2OA 4DUYT 2ES0A 2BVMA 4TN7B 4WZXA 3ZMZB 2D0TA 3FZMB 2JQKA 2HHHT 1LRZA 2XQ6A 4IDPA 4C91A 5LB7B 3O9XA 2X68A 5L3GB 3TLSA 2JPFA 3LJCA 5E0OA 2YDQA 2WY2A 4HFHA 4QX8B 2LSIA 4JLEA 5CA1E 3HR0A 2IHR1 2L3LA 5IHYA 5FP3A 3FZHB 2D0UA 3EUHA 4LFBT 3MACA 3DQVC 2BS3A 2D2SA 2NW9A 4B3RT 1WR6A 1N36T 5HYAA 4LMLA 5KMGP 4X62T 4B3MT 3RQWA 4JI5T 5TAOA 3RYFE 1R8IA 2Y8DA 3CVRA 5HWXA 2H88A 2CXLA 3RIUA 3UU8A 4LF5T 4I0UA 1G73A 2K48A 3ZN0B 3DPLC 2JQQA 3ZYLA 2PFVA 5FXVA 1MMNA 2WZIA 1DU2A 2X0YA 3FZLB 4UV8B 2UXBT 2DI4A 3JC6C 2UXXB 4QKNA 3LDQB 2J1DG 2YU1A 3B13A 4H9OC 4I4TE 3IHRA 4AKLA 1HCIA 5AFUL 2FJDA 2CA5A 2M67A 4WYVA 1G8XA 2XPKA 3HI2A 2E9XD 2IAKA 3JADA 3MXZA 3TLVA 3CQGB 2CRBA 4DVDA 1WYBA 1YKEB 1X9BA 5ABEA 4U31A 4A97A 3N5LA 1KK7A 3FXDB 2IIUA 4BAYB 3N9MA 4H9QC 4KP3C 2WWVA 2LJLA 4A98A 3PUAA 1W09A 2KNDA 2J62A 2CWOA 2PTFA 4HWFA 5C3JA 4DV6T 5JR9C 4UELA 4X1YE 1XNRT 2X67A 4QH5A 2HPLA 4L9IA 1NAFA 2NTXA 4XZCA 1OEDE 5JREA 3KDSE 3HL6A 2LM9A 4UF0A 3T8OA 1HG5A 2FUPA 3PUQA 2V1DB 4DV3T 3BQLA 2MOZA 2LSJA 4ZXLA 5AQRB 2XAFB 3KBUA 3ZMTB 2BKPA 3AA1B 1XDOA 1HF8A 1V9DA 4UV9B 2W4XA 4QXCB 3UU5A 5HXEA 4CI2B 4ISSA 1SE7A 2WS3A 5LP6E 4JI1T 3N2KE 5C8YE 3MZKB 1IJ6A 2IC6A 4H63V 4HFCA 2JJ9A 2DWGA 4J2CA 4HWDA 3ONLC 1MIVA 1VOMA 3P4WA 3C50A 1W9RA 4Z90A 5AQFB 3ONJA 2VK9A 4KHZF 3L8RA 3RI5A 2XSBA 5CB4E 4YSXA 3B57A 5HCMA 1Y64B 2HH7A 1AJ3A 2L8KA 3HKDE 4IDOA 2BZBA 2LOSA 4TWFA 5FXZA 4HTEA 5F3JA 3RX6A 3FHNA 4KMCA 2IW5B 4CZZB 2CWYA 3AVSA 4P0BA 5LBMA 1WYCA 4CXYA 2F4VT 5FMNA 2CHNA 4ZI3C 5JH7E 2ZM2A 3OBVE 2V7MA 3DJBA 2Q9QA 3AEDA 4WBNE 2XY8B 1M7KA 1YKHB 4G63A 1HX8A 3EAMA 5LXTE 5LJMA 5LHHB 2UU9T 1FMVA 5JDNA 1YXRA 4AKHA 4MLKA 4PJJA 3H3AA 1BR1A 5JR9B 3AAIA 4A56A 4B3TT 2JRKA 4AIUA 3LK2B 4B6XA 5JDFA 1VCSA 4NUVA 4NPPA 3UFEA 2V26A 3QK6A 1D0YA 1US7B 3ZEFB 2BG9C 1HS7A 1XNQT 4O4LE 3VKGA 4ZZCA 2CEAA 3OPCA 4A64A 2VL8A 4DV4T 4L5GA 4KBMB 3CWZB 3MJXA 4NXMT 4V1Av 4YXDA 4U72A 1EZ3A 2UXDT 1XZYA 2CMRA 2KWHA 3PU8A 2ACXA 3TLTA 4N78D 3N2GE 2HN1A 2W67A 2XASB 4H9SE 4ZHQE 3UU3A 1ZP0A 2NW7A 1VCTA 2W66A 3RLFF 3AB3B 2PBIA 3JC6D 2J47A 3ZC0A 1B7TA 4HWIB 2CE7A 1ZHCA 3RH3A 5JDMA 4OYJA 3C4WA 2D5UA 4I43B 5LGUB 3MK7C 5FY7A 2H7OA 4IL4A 5AQJB 5J1GA 2YK0A 2VWAA 3HA4A 1KNZA 2AXDS 1ZV4X 3PU3A 4H9NC 2Y6XA 4GKJT 2W2UA 3RIUC 2LSYA 4O4JE 3PUZF 2LEHA 3BK9A 1H7CA 2I0MA 4P1NA 5JDQA 5JDLA 5AQPB 3ZLIA 2IUBA 1SA0E 1XDPA 1HNXT 4F52A 4DIDB 2DNXA 3UUMA 4HFEA 4ADZA 5EK4A 5LMUT 2IMLA 4P0AA 4Z8XA 3UFGA 3WAKA 3SWHA 1WCRA 4ZZBA 2QYWA 5KXJA 3AVRA 2M6BA 2RP4A 2JMHA 3U78A 5HXHA 5J0ZA 2XAHB 4BJNA 3UUXB 2D9DA 2BKOA 4EZHA 1YQ3A 5LOVE 2BG9B 2JQ9A 2NOXA 3E0ZA 4TWHA 4JI3T 2XQ7A 4DR7T 4HN9A 3VRBA 3ZT6A 2WU2A 1FMWA 1VRBA 2V7JA 5EK2A 4NXNT 3K1SA 2KMFA 1YQ4A 5LBQB 3SFDA 1M62A 2CLYC 2BG9A 3BQKA 3K3QC 2WQYA 4EGWA 3OYZA 4DUZT 4WQOD 5AQIB 4Q25A 3VKHA 3AE3A 5FY0A 2JIWA
chains in the Genus database with same CATH topology
2X0LB 5FXXA 3NRXA 4C90A 5LCYA 1U5PA 1NWMX 3N5LA 4U74A 1Z0PA 3ONXA 1KK7A 3CMLA 3FXDB 2Q9QD 3CX7B 2V7LA 2K5BB 5JRCB 4OK0A 2CXDA 3WI3A 4CI1B 5HWYA 3P7IA 3R6NA 3E08A 4BAYB 3ZMUB 5L3DB 1CUNA 3PUGA 3N9MA 4I55E 1HFAA 3M65A 4H9QC 4GK5E 3FBLA 4KP3C 2WSSV 2LJLA 3PUAA 1O3XA 2KNDA 3H37A 2CWOA 3I9YA 4O4IE 2X51A 3NRYA 3TKLB 3RKOA 4AQFC 4AXPA 4TV9E 3NBXX 3I0OA 4ISTA 3KINB 4OFZA 5JR9C 4UELA 4X1YE 4PW8A 2X67A 4MALA 2HPLA 3L09A 3I1AA 2WM9A 2SPCA 2XHEB 5LG4A 4L9IA 1NAFA 2NTXA 1IZNB 4XZCA 5H6RB 4MBQA 4OHFA 5LHGB 5JREA 2C5JA 3KDSE 3HL6A 2LSGA 3OJAA 4ZI3D 4OYKA 2LM9A 4UF0A 5FXWA 1HG5A 1LVFA 3PUQA 3T8OA 1LKXA 3ZYMA 4BJMA 4EB6E 2V1DB 5EZYE 2QGSA 3O1HA 2A3DA 3BQLA 2MOZA 4GOUA 2LSJA 5EK3A 5DABA 2XAFB 3KBUA 3AAAB 3ZMTB 2KLQA 3VU7H 2KWIB 3AA1B 4QX7B 1HF8A 1V9DA 2C5IT 4UV9B 3VHLA 5JDHA 4QXCB 3I0QA 2WMNA 4PK6A 4GYSA 3SOLA 2P9BA 4CI2B 5HXEA 4ISSA 2XTLA 1YD8G 4AQFA 3HKCE 1SHZC 2MTQA 4AI6A 5LP6E 1HG2A 1D1CA 3N2KE 1D0XA 5L3BB 5GONE 5LGTB 3UUNA 3KV5A 5C8YE 4ZI2D 4UXNB 3MZKB 1IJ6A 5JR9A 3ZYKA 3OKQA 5L3FB 2IC6A 2Y48B 4H63V 4IHJE 4CQIA 2WBLA 1BR2A 5DJQC 2JJ9A 2DWGA 4QHOA 4J2CA 2K24A 2YINA 2WWUA 1MIVA 1VOMA 3RRCA 3C50A 3ZCIA 3K3OA 2L9QA 5L3EB 4GK0E 5FY1A 4QXHB 3LBXB 4HFVA 4AKIA 4H9RC 3OYXA 2CCQA 2VKJA 2VK9A 4JEHB 2ZMAA 3KV4A 4E7ZA 5CB4E 3B57A 2W61A 4ILUA 4TUYE 2Q9QC 2E9XB 2VASA 2DWKA 1Y64B 3F57A 3WAJA 2HH7A 1AJ3A 2N9DA 2W0GA 2L8KA 4PFPA 4IIJE 4EOZB 1ZKEA 1QUUA 2CXFA 3HKDE 4UVAB 2BZBA 2H3RA 3ETUA 3KV9A 2LOSA 3LBXA 3N9NA 5FXZA 2MYSA 4HTEA 4DBRA 5ADXL 2GK9A 3GWHA 3F2EA 2WMOA 4QWNB 3RX6A 5F3JA 3FHNA 4KMCA 2LE8A 2NTYA 3MKDA 4AKRB 4CXWA 2IW5B 2CLYB 5M4YA 4CZZB 2CWYA 4CXXA 2E9XA 1FEWA 5FYMA 4EYUA 3AVSA 2W62A 4EYYR 4P0BA 4AQGA 4ERRA 4AKGA 3N9QA 5LBMA 2HPJA 2V7KA 1IAPA 1WYCA 3AA0B 3GA8A 2EHOD 4CXYA 3ZCJA 2KINB 3Q9DA 5FMNA 4X1IE 4ZI3C 5JH7E 4JUYA 2OA5A 3ETVA 1S35A 2KT9A 3RPUA 2ZM2A 1MNEA 3OBVE 4UF0B 4ASKA 2V7MA 3DJBA 4E7SA 2Q9QA 5IYZE 5LJNA 2E8IA 3Q5WA 3SS1A 4GYRA 1U4QA 4WBNE 3PTRB 4H9PC 3J9X1 1YKHB 2C5KT 2LOPA 2QA7A 4G63A 4WBOA 1HX8A 3HKEE 4EXTA 2H7VC 3EDVA 1MNDA 2K9AA 5LXTE 5LJMA 5LHHB 5LA6E 3GMIA 1HTJF 3KBTA 4PAGA 3V5SA 3RC8A 4M1PA 1FMVA 5JDNA 2DHRA 3C4XA 4AKHA 4ZI2C 4HKAA 4DNDA 2ZLYA 2Z6EA 4L0RA 1IJ5A 2WAUA 3W15B 4MLKA 3ESLA 4PJJA 3H3AA 1BR1A 5JR9B 1D1AA 4O2BE 3RYIE 2ZM0A 3AAIA 4UIGA 1T98A 5HAXA 4QXBB 4YFSA 2X66A 4HGAA 4A56A 2RA1A 4NUUA 4IE6A 2JRKA 3LK2B 3ZJ2A 3FXEB 4B6XA 5JDFA 3CQXC 3AAEB 5F8PA 4K0UA 4PJMA 5ETWA 3PUSA 4O2AE 4NUVA 2W63A 4ZS2A 2XQYA 3UFEA 2XUEA 1UX5A 2NW8A 2V26A 3QK6A 4BA9A 2YU2A 3PE0A 3LK42 1D0YA 1US7B 1QSDA 3KFWX 3P8CD 3ZEFB 5LGNB 3EVYA 4HEAA 1HS7A 5CA0E 4O4LE 1YW0A 2X9WA 4IE0A 1MMDA 2ODVA 5HXRA 3VKGA 2XU0A 2CEAA 2PG8A 3UTKA 1BR4A 3S4UA 5LNKA 2BVLA 3HKBE 2VL8A 4ZOLE 2XAQB 3IBPA 4L5GA 4DMWA 2N2NA 4DO0A 3CKDA 4KBMB 2EHOC 3CWZB 3MJXA 3QUJA 4G2AA 1LVKA 4PK5A 3LFMA 2VKHA 4V1Av 4FI5A 4YJ2E 3NZPA 3KVBA 4PJNA 2LSKA 3RC3A 2ODUA 3SRZA 4TV8E 4U72A 3O1JA 4PFOA 3K3NA 4X20E 1EZ3A 4PK4A 2XAGB 2BDEA 2CMRA 2KWHA 1WRDA 3PU8A 4HE8A 2ACXA 3DTOA 4N78D 3N2GE 3CQCB 2VKDA 3IF8B 5KDMC 2JMKA 3ZN1B 3EDUA 4XAXB 3N9OA 3UULA 2Q9QB 2EHOB 4PJLA 3O1IA 3DP7A 2V7IA 2XASB 4IE5A 3MA9A 2LHRA 4H9SE 4ZHQE 4PNIA 3LG7A 5FNVE 2VKOA 3BQIA 4IE4A 1MIYA 2NW7A 2VB6A 4MHCA 5KX5E 2LHNA 5L2LA 4EAHA 2XAJB 4ZS3A 3UT5E 5J2TE 3RYHE 3L3PA 3AB3B 3D0TA 2PBIA 5JQGE 3JC6D 4XBFB 1MMGA 3N2OA 5LHIB 3ZC0A 2MBGA 5BMVE 1B7TA 5DQVA 2CE7A 1ZHCA 3RH3A 5JDMA 2ES0A 2BVMA 1MMAA 4OYJA 4TN7B 1OWAA 3C4WA 2EHOA 2D5UA 4I43B 5JVDE 3ZMZB 5LGUB 3O4XE 3KVAA 4WNKA 3PURA 2D0TA 3K8PC 3MK7C 5FY7A 2NP9A 1LRZA 2X9HA 2H7OA 3A5XA 4C91A 3O9XA 2X68A 3PDYA 5J1GA 5L3GB 4WW0A 2YK0A 2VWAA 3HA4A 1KNZA 4H63H 4O8SA 2JPFA 3C98B 1D0ZA 1FIOA 2KXPB 3LJCA 5E0OA 1ZV4X 3RRWA 3PU3A 4TX5A 4YLHA 2B1EA 3CX6B 4H9NC 4QX8B 2Y6XA 4UVBB 5H6QB 2LSIA 4JLEA 2LSYA 2N1GA 4MFRA 4O4JE 2X9XA 4DMVA 2LEHA 3HR0A 5CA1E 5JRCA 2X9YA 2W00A 1ZEEA 1H7CA 3BK9A 2L3LA 5JDQA 3ZC1A 5IHYA 5JDLA 5FP3A 1MIWA 3AA6B 2D0UA 3ZLIA 3EUHA 1SA0E 3MACA 1D1BA 3J7Yq 2D2SA 3AA7B 2ZM8A 3U3IA 2DNXA 3UUMA 3LK3B 2PJQA 2NW9A 1WLXA 5HXSA 4ADZA 1WR6A 5HYAA 4YHJA 3V5UA 5KMGP 3ZJ1A 5EK4A 1UCUA 4JEUB 4P0AA 4Z8XA 4FJOA 4P09A 3WAKA 3SWHA 3E22E 3C51A 3CPZA 4KUMB 3GN5B 3ANWB 5TAOA 3RYFE 3AVRA 1X79A 3N9LA 2RP4A 4I50E 1UX4A 2JMHA 2DCFA 2LT3A 2Y8DA 3U78A 3CVRA 3IEEA 5HXHA 3RYCE 2CM0A 5HWXA 4ANJA 3ZMSB 1E1HB 3NZQA 4UVCB 1OXZA 5L3CB 2XAHB 3CX8B 2UXNB 2CXLA 3FB2A 4BJNA 4UEMA 3UUXB 4GIWA 1G73A 2K48A 2A2FX 3ZN0B 4X1KE 3ZPOA 2JQQA 3ZYLA 4EZHA 3GN5A 2PFVA 5LOVE 2E9XC 2NOXA 3ANWA 3E0ZA 1MMNA 5FXVA 3Q5XA 4TZ4C 4O4HE 5LYJE 3Q2MA 4UV8B 3N9PA 4HN9A 5A1LA 4IDZA 3C64A 2C0SA 2DI4A 4IGUA 3JC6C 4IE7A 2YEVC 1FMWA 1VRBA 2V7JA 2UXXB 4QKNA 2J1DG 2YU1A 3B13A 4H9OC 4CI3B 4I4TE 5EK2A 5DQWA 2G0UA 3R84B 1BR0A 3IHRA 4F6RC 1S94A 3F31A 2KMFA 4AKLA 2DLRA 5LBQB 5JDGA 1HCIA 5AFUL 2CLYC 4ZI7E 3ZMVB 5HXCA 4EIWA 3FBZA 3BQKA 2CA5A 2M67A 3K3QC 3OYZA 3KV6A 2NWBA 3QC9A 1G8XA 3HI2A 4DBQA 2E9XD 2IAKA 3I9WA 3MXZA 4YJ3E 2A72A 3C4ZA 3CQGB 2IC9A 4DVDA 3VKHA 1WYBA 5J2UE 2KZ7B 1YKEB 2I59A 5FY0A 4EZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU0 A;  3BQI A;  3CML A;  4YFS A;  3RRC A;  2YK0 A;  4NUU A;  5F3J A;  2Y8D A;  3BQL A;  2WAU A;  3C64 A;  3CPZ A;  4NUV A;  3BQK A; 
#chains in the Genus database with same CATH topology
 2X0L B;  5FXX A;  4C90 A;  2YOE A;  3ONX A;  3CML A;  4YTM A;  4OK0 A;  4U3C A;  3P4Q A;  3WI3 A;  3P50 A;  3R6N A;  1T7S A;  3LSV A;  5L3D B;  1CUN A;  3PUG A;  4I55 E;  4IDN A;  4GK5 E;  5JTG A;  2WSS V;  2XSA A;  3H37 A;  4O4I E;  2X51 A;  3AEG A;  3TKL B;  4TV9 E;  5ABG A;  3NBX X;  3I0O A;  2MAW A;  3AXJ A;  4MAL A;  3I1A A;  2SPC A;  2XHE B;  5LG4 A;  1SUM B;  5H6R B;  4OHF A;  5LHG B;  2C5J A;  4GKK T;  4ZI3 D;  5FXW A;  5EZY E;  2A3D A;  4GOU A;  5DAB A;  3AAA B;  4X65 T;  4QX7 B;  1KNR A;  2WMN A;  4GYS A;  2P9B A;  4LFC T;  4AQF A;  1HG2 A;  3SFE A;  1D0X A;  5L3B B;  3UUN A;  3OKQ A;  2Y48 B;  3P4R A;  4IHJ E;  4CQI A;  2LRL A;  3AE6 A;  5CJ5 A;  4AQY T;  3K3O A;  2L9Q A;  4GK0 E;  2VQF T;  4U2Z A;  2OLT A;  4JI2 T;  4JEH B;  1L0V A;  2R6G F;  2W61 A;  3PJA J;  2Q9Q C;  5AQQ B;  3F57 A;  3WAJ A;  4IIJ E;  4EOZ B;  3PUY F;  2CXF A;  4UVA B;  4X64 T;  2GK9 A;  3F2E A;  4UR9 A;  1U6G A;  3MKD A;  4U33 A;  1Z8U A;  2CLY B;  4HWC A;  2V7K A;  3AA0 B;  4JUY A;  3AE4 A;  2BBJ A;  2WP9 A;  5ABF B;  1JNZ A;  4UF0 B;  5LJN A;  2BBH A;  3SS1 A;  4GYR A;  1U4Q A;  4H9P C;  2LOP A;  2MPK A;  2KSR A;  2RPA A;  2H7V C;  1MND A;  2K9A A;  5LA6 E;  2V6Y A;  5ABF A;  2DHR A;  3C4X A;  3CK6 A;  4HKA A;  4HWH A;  2ZLY A;  3EHZ A;  2V6X A;  1OED B;  2WDR A;  3ESL A;  1I94 T;  4O2B E;  3RYI E;  5FL0 A;  1T98 A;  4IDQ A;  1HNW T;  5HAX A;  4QXB B;  4YFS A;  2X66 A;  3VR8 A;  4HGA A;  4NUU A;  3OVU A;  3ZT7 A;  3CQX C;  3AAE B;  5F8P A;  4K0U A;  4PJM A;  2WZK A;  4DV7 T;  5ETW A;  3PUS A;  1OED A;  1UX5 A;  4JI4 T;  3IA3 A;  3P8C D;  3AEA A;  4HEA A;  3PUW F;  2XQA A;  4IE0 A;  4DR3 T;  1MMD A;  1KFY A;  1XWM A;  2XQ8 A;  3S4U A;  4DMW A;  3RGL A;  3CKD A;  2WZH A;  4PK5 A;  5IWA T;  2VKH A;  4PJN A;  3EAB A;  4PK4 A;  2NR4 A;  3CQC B;  2JMK A;  3AE5 A;  4JYA T;  2Q9Q B;  2EHO B;  3O1I A;  5HEU A;  2V7I A;  4EEB A;  3LG7 A;  5FNV E;  3BQI A;  4IE4 A;  2OV9 A;  5KX5 E;  5L2L A;  4EAH A;  3L3P A;  4KX6 A;  5JQG E;  4XBF B;  5LHI B;  5BMV E;  5DQV A;  2LKH A;  4AP2 B;  2EHO A;  3O4X E;  4WNK A;  4DV5 T;  3RIF A;  2A9U A;  3K8P C;  2X9H A;  2XM1 A;  2YN6 A;  4WW0 A;  4CN4 A;  4H63 H;  2KXP B;  2K3W A;  4TX5 A;  4EV6 A;  2VQE T;  2B1E A;  3CX6 B;  1UUS A;  5FL1 A;  4JGH D;  5H6Q B;  2X9X A;  4DMV A;  5JRC A;  2X9Y A;  2W00 A;  3PJA A;  1MIW A;  3AA6 B;  1D1B A;  3J7Y q;  4JI6 T;  3AA7 B;  2ZM8 A;  3U3I A;  4ILB A;  3QB5 A;  2QVA A;  4YHJ A;  3V5U A;  3ZJ1 A;  5AQL B;  4JEU B;  2E2A A;  3C51 A;  3CPZ A;  3ANW B;  2YDS A;  1X79 A;  2QRX A;  4DR6 T;  2LT3 A;  4DV1 T;  3IEE A;  4YHH T;  3RYC E;  5L3C B;  4ANJ A;  3NZQ A;  4UVC B;  1XMQ T;  3CX8 B;  3FB2 A;  3VR9 A;  2FJB A;  2A2F X;  5C2T A;  3ZPO A;  2E9X C;  3ANW A;  4U2Y A;  4LMJ A;  4O4H E;  2JQH A;  4IGU A;  2C0S A;  4IE7 A;  2WDV A;  2ZM6 T;  4JV5 T;  3NVO A;  5HCJ A;  2BS2 A;  5DQW A;  5FVK A;  2G0U A;  3R84 B;  1BR0 A;  3F31 A;  3RQU A;  2WDQ A;  5JDG A;  4ZI7 E;  3ZMV B;  4YTN A;  5HXC A;  3QC9 A;  1LDJ A;  4DBQ A;  4JI8 T;  3I9W A;  2A72 A;  4LF7 T;  2UUA T;  1CHU A;  5J2U E;  2KZ7 B;  3TLU A;  5LCY A;  1UUR A;  4U74 A;  1Z0P A;  2Q9Q D;  3PUX F;  2V7L A;  2CXD A;  3UQ7 A;  2DL1 A;  2M6I A;  4U7Y A;  5HWY A;  3L39 A;  1IBK T;  3E08 A;  3UQ4 A;  1HFA A;  3FBL A;  1N34 T;  1O3X A;  3NRY A;  4AQF C;  4AXP A;  3RKO A;  1UK5 A;  4DR1 T;  4IST A;  1W0A A;  4PW8 A;  5AQO B;  1E2A A;  2WM9 A;  1KNP A;  2LSG A;  3OJA A;  4OYK A;  3ZYM A;  3T1Y T;  1LVF A;  4OX9 T;  4EB6 E;  4X66 T;  5EK3 A;  2E5L T;  3RHW A;  2VVN A;  3AEF A;  5JDH A;  4PK6 A;  2XTL A;  1YD8 G;  3HKC E;  1SHZ C;  2MTQ A;  4AI6 A;  1D1C A;  3KV5 A;  4UXN B;  3ZYK A;  5L3F B;  3RTR A;  3OTO T;  2WBL A;  4QHO A;  2K24 A;  2YIN A;  2V5D A;  2WWU A;  2UUC T;  5FKY A;  4H9R C;  1WFD A;  5CFB A;  3OYX A;  2CCQ A;  4HFB A;  2VKJ A;  4LF4 T;  3Q5D A;  4E7Z A;  4EED A;  2E9X B;  2VAS A;  5AQU B;  2N9D A;  2W0G A;  3X1D A;  4PFP A;  1UGO A;  3KV9 A;  3N9N A;  4DBR A;  2MYS A;  2CPT A;  5AQN B;  4QWN B;  4CXW A;  4JBW F;  1GQE A;  2E9X A;  5FYM A;  3N9Q A;  4IRE A;  2HPJ A;  3GA8 A;  3AXJ B;  2KIN B;  3Q9D A;  3AE1 A;  4X1I E;  2UUB T;  2OA5 A;  2VVS A;  5HEO A;  3ETV A;  1S35 A;  2KT9 A;  3RPU A;  1MNE A;  4ASK A;  4E7S A;  5IYZ E;  3RF1 A;  3Q5W A;  3PTR B;  3J9X 1;  2C5K T;  1OED C;  3NKZ A;  4EXT A;  1HR0 T;  3EDV A;  2AE9 A;  3JCF A;  2V8S V;  1QLB A;  5CGM A;  3RC8 A;  4M1P A;  3ZKR A;  4ZI2 C;  3W15 B;  4TWD A;  1KEY A;  1KF6 A;  4YSY A;  4DR4 T;  5ABH A;  1N33 T;  5AQG B;  4ILA A;  2RA1 A;  2UXC T;  2H89 A;  4IE6 A;  4O2A E;  1IBM T;  4ZS2 A;  1J1J A;  2XUE A;  2XJ7 A;  4BA9 A;  2YU2 A;  3KFW X;  1QSD A;  5LGN B;  3EVY A;  5CA0 E;  5HXR A;  1LDK B;  2PG8 A;  3UTK A;  1BR4 A;  1HNZ T;  3ZST A;  4ZOL E;  2XAQ B;  4DO0 A;  2EHO C;  1LVK A;  4FI5 A;  4ZEY A;  3NZP A;  3KVB A;  2CBI A;  2ODU A;  3K3N A;  2XAG B;  1WRD A;  4HE8 A;  2CHO A;  3AE8 A;  1LDK A;  5KDM C;  2VKD A;  3IF8 B;  1IBL T;  2E5V A;  3ZN1 B;  3UUL A;  3VRA A;  3UU6 A;  4PJL A;  3JAF A;  3DP7 A;  4IE5 A;  3MA9 A;  4DR5 T;  2VB6 A;  4MHC A;  2LHN A;  2XAJ B;  3UT5 E;  4HXI B;  3D0T A;  2V6Y B;  2MBG A;  3A8Y C;  5L4H A;  1MMA A;  4X5T A;  1OWA A;  5JVD E;  3KVA A;  5HEH A;  3PUR A;  2NP9 A;  3A5X A;  3PDY A;  4O8S A;  3C98 B;  1D0Z A;  1FIO A;  3RRW A;  3AEB A;  5AQM B;  4YLH A;  3P4S A;  4UVB B;  4Z91 A;  3AE9 A;  2N1G A;  4MFR A;  3QB5 K;  1ZEE A;  3A7M A;  3ZC1 A;  5HEJ A;  2XZE A;  2LM2 A;  3LK3 B;  2PJQ A;  4N9F 3;  1WLX A;  3G06 A;  1HX1 B;  5HXS A;  2LLY A;  1UCU A;  4FJO A;  4P09 A;  3E22 E;  4KUM B;  3GN5 B;  3Q5E A;  5F5W A;  3N9L A;  4I50 E;  1UX4 A;  2DCF A;  2CM0 A;  3ZMS B;  1E1H B;  1OXZ A;  2UXN B;  4F8H A;  1J5W A;  4UEM A;  4GIW A;  3ABV A;  2WU5 A;  4X1K E;  2XQ4 A;  3GN5 A;  2YDR A;  1W0B A;  3Q5X A;  4TZ4 C;  5LYJ E;  4KHP T;  2V5C A;  4YY3 T;  3Q2M A;  3RIA A;  3N9P A;  5A1L A;  4IDZ A;  3C64 A;  2XQ5 A;  2YEV C;  4DV2 T;  5AQK B;  4CI3 B;  4F6R C;  1S94 A;  3T1H T;  2DLR A;  3NWI A;  5AQH B;  4HFI A;  4EIW A;  3FBZ A;  2I6H A;  3KV6 A;  2NWB A;  5LG3 A;  4YJ3 E;  3C4Z A;  2IC9 A;  3ZSS A;  1XMO T;  2I59 A;  4B3S T;  4YSZ A;  4EZ4 A;  3NRX A;  1U5P A;  1NWM X;  5LMN T;  3AEE A;  3CX7 B;  1I6Z A;  2K5B B;  5FVL A;  5JRC B;  4APF B;  4CI1 B;  3P7I A;  4DR2 T;  3ZMU B;  4ILC A;  2CBJ A;  3M65 A;  3I9Y A;  4QH4 A;  4KI0 F;  3KIN B;  4OFZ A;  3CIR A;  3L09 A;  4YT0 A;  3QOF A;  1IZN B;  4MBQ A;  1Y01 A;  4BJM A;  1LKX A;  2QGS A;  3O1H A;  1ZOY A;  2YKS A;  2KLQ A;  3UUB A;  3VU7 H;  4QH1 A;  2KWI B;  2C5I T;  3VHL A;  2VL0 A;  2XQ3 A;  3I0Q A;  3SOL A;  4LF9 T;  2XQ9 A;  1J5E T;  5GON E;  5LGT B;  4ZI2 D;  5JR9 A;  3B5M A;  3PUV F;  5DJQ C;  1BR2 A;  3RRC A;  2B76 A;  3ZCI A;  5L3E B;  1WR0 A;  5FY1 A;  4QXH B;  3LBX B;  4HFV A;  4AKI A;  4NIQ A;  2ZMA A;  4P5O A;  3TLW A;  3KV4 A;  4LF6 T;  1T72 A;  4ILU A;  2IDO B;  4TUY E;  2DWK A;  3AE7 A;  2X0H A;  1ZKE A;  1QUU A;  2H3R A;  3ETU A;  5ADX L;  3LBX A;  4LF8 T;  3GWH A;  2WMO A;  2LE8 A;  2J4G A;  2NTY A;  4AKR B;  3EI0 A;  5IUX A;  5M4Y A;  4CXX A;  1FEW A;  4COF A;  4IT4 A;  4EYU A;  1NEK A;  2W62 A;  4EYY R;  1NEN A;  4ERR A;  4AQG A;  4IL9 A;  4AKG A;  1IAP A;  2EHO D;  3ZCJ A;  4JI0 T;  2LKG A;  3PV0 F;  2E8I A;  2WCA A;  4AIS A;  2QA7 A;  4WBO A;  3HKE E;  4CN1 A;  2FJE A;  4K0K T;  4JI7 T;  3GMI A;  1HTJ F;  3KBT A;  4PAG A;  3V5S A;  5BR8 T;  2XM2 A;  5AQV B;  4DND A;  2Z6E A;  3ZT5 A;  4L0R A;  1IJ5 A;  2WAU A;  5AQT B;  1JNR A;  5L47 A;  1D1A A;  2ZM0 A;  1FJG T;  4UIG A;  3FZF B;  3H3M A;  4LMK A;  3ZJ2 A;  3FXE B;  5L4E A;  4HFD A;  5AQS B;  4A5X A;  3FZK B;  2W63 A;  2XQY A;  2NW8 A;  3RKG A;  4YTP A;  3PE0 A;  3LK4 2;  2ACZ A;  3AE2 A;  3JAE A;  4LFA T;  2BS4 A;  1YW0 A;  2X9W A;  2ODV A;  2BG9 E;  2XU0 A;  2LRK A;  4TNV A;  5HEG A;  1T8B A;  3AEC A;  4DV0 T;  5LNK A;  2BVL A;  3HKB E;  3IBP A;  1E7P A;  2N2N A;  4TNW A;  3QUJ A;  4G2A A;  2FJA A;  3LFM A;  4YJ2 E;  1N32 T;  3SRZ A;  3RC3 A;  2LSK A;  4TV8 E;  3O1J A;  4PFO A;  4U7I A;  4X20 E;  3UU4 A;  2BDE A;  4CN6 A;  3DTO A;  3P4P A;  3QNU A;  2VUR A;  2FBW A;  3EDU A;  4XAX B;  3N9O A;  2LHR A;  2BKN A;  4PNI A;  2VKO A;  2WB5 A;  2HN2 A;  3M3Z B;  1MIY A;  4ZS3 A;  5J2T E;  3RYH E;  1MMG A;  3N2O A;  4DUY T;  2ES0 A;  2BVM A;  4TN7 B;  4WZX A;  3ZMZ B;  2D0T A;  3FZM B;  2JQK A;  2HHH T;  1LRZ A;  2XQ6 A;  4IDP A;  4C91 A;  5LB7 B;  3O9X A;  2X68 A;  5L3G B;  3TLS A;  2JPF A;  3LJC A;  5E0O A;  2YDQ A;  2WY2 A;  4HFH A;  4QX8 B;  2LSI A;  4JLE A;  5CA1 E;  3HR0 A;  2IHR 1;  2L3L A;  5IHY A;  5FP3 A;  3FZH B;  2D0U A;  3EUH A;  4LFB T;  3MAC A;  3DQV C;  2BS3 A;  2D2S A;  2NW9 A;  4B3R T;  1WR6 A;  1N36 T;  5HYA A;  4LML A;  5KMG P;  4X62 T;  4B3M T;  3RQW A;  4JI5 T;  5TAO A;  3RYF E;  1R8I A;  2Y8D A;  3CVR A;  5HWX A;  2H88 A;  2CXL A;  3RIU A;  3UU8 A;  4LF5 T;  4I0U A;  1G73 A;  2K48 A;  3ZN0 B;  3DPL C;  2JQQ A;  3ZYL A;  2PFV A;  5FXV A;  1MMN A;  2WZI A;  1DU2 A;  2X0Y A;  3FZL B;  4UV8 B;  2UXB T;  2DI4 A;  3JC6 C;  2UXX B;  4QKN A;  3LDQ B;  2J1D G;  2YU1 A;  3B13 A;  4H9O C;  4I4T E;  3IHR A;  4AKL A;  1HCI A;  5AFU L;  2FJD A;  2CA5 A;  2M67 A;  4WYV A;  1G8X A;  2XPK A;  3HI2 A;  2E9X D;  2IAK A;  3JAD A;  3MXZ A;  3TLV A;  3CQG B;  2CRB A;  4DVD A;  1WYB A;  1YKE B;  1X9B A;  5ABE A;  4U31 A;  4A97 A;  3N5L A;  1KK7 A;  3FXD B;  2IIU A;  4BAY B;  3N9M A;  4H9Q C;  4KP3 C;  2WWV A;  2LJL A;  4A98 A;  3PUA A;  1W09 A;  2KND A;  2J62 A;  2CWO A;  2PTF A;  4HWF A;  5C3J A;  4DV6 T;  5JR9 C;  4UEL A;  4X1Y E;  1XNR T;  2X67 A;  4QH5 A;  2HPL A;  4L9I A;  1NAF A;  2NTX A;  4XZC A;  1OED E;  5JRE A;  3KDS E;  3HL6 A;  2LM9 A;  4UF0 A;  3T8O A;  1HG5 A;  2FUP A;  3PUQ A;  2V1D B;  4DV3 T;  3BQL A;  2MOZ A;  2LSJ A;  4ZXL A;  5AQR B;  2XAF B;  3KBU A;  3ZMT B;  2BKP A;  3AA1 B;  1XDO A;  1HF8 A;  1V9D A;  4UV9 B;  2W4X A;  4QXC B;  3UU5 A;  5HXE A;  4CI2 B;  4ISS A;  1SE7 A;  2WS3 A;  5LP6 E;  4JI1 T;  3N2K E;  5C8Y E;  3MZK B;  1IJ6 A;  2IC6 A;  4H63 V;  4HFC A;  2JJ9 A;  2DWG A;  4J2C A;  4HWD A;  3ONL C;  1MIV A;  1VOM A;  3P4W A;  3C50 A;  1W9R A;  4Z90 A;  5AQF B;  3ONJ A;  2VK9 A;  4KHZ F;  3L8R A;  3RI5 A;  2XSB A;  5CB4 E;  4YSX A;  3B57 A;  5HCM A;  1Y64 B;  2HH7 A;  1AJ3 A;  2L8K A;  3HKD E;  4IDO A;  2BZB A;  2LOS A;  4TWF A;  5FXZ A;  4HTE A;  5F3J A;  3RX6 A;  3FHN A;  4KMC A;  2IW5 B;  4CZZ B;  2CWY A;  3AVS A;  4P0B A;  5LBM A;  1WYC A;  4CXY A;  2F4V T;  5FMN A;  2CHN A;  4ZI3 C;  5JH7 E;  2ZM2 A;  3OBV E;  2V7M A;  3DJB A;  2Q9Q A;  3AED A;  4WBN E;  2XY8 B;  1M7K A;  1YKH B;  4G63 A;  1HX8 A;  3EAM A;  5LXT E;  5LJM A;  5LHH B;  2UU9 T;  1FMV A;  5JDN A;  1YXR A;  4AKH A;  4MLK A;  4PJJ A;  3H3A A;  1BR1 A;  5JR9 B;  3AAI A;  4A56 A;  4B3T T;  2JRK A;  4AIU A;  3LK2 B;  4B6X A;  5JDF A;  1VCS A;  4NUV A;  4NPP A;  3UFE A;  2V26 A;  3QK6 A;  1D0Y A;  1US7 B;  3ZEF B;  2BG9 C;  1HS7 A;  1XNQ T;  4O4L E;  3VKG A;  4ZZC A;  2CEA A;  3OPC A;  4A64 A;  2VL8 A;  4DV4 T;  4L5G A;  4KBM B;  3CWZ B;  3MJX A;  4NXM T;  4V1A v;  4YXD A;  4U72 A;  1EZ3 A;  2UXD T;  1XZY A;  2CMR A;  2KWH A;  3PU8 A;  2ACX A;  3TLT A;  4N78 D;  3N2G E;  2HN1 A;  2W67 A;  2XAS B;  4H9S E;  4ZHQ E;  3UU3 A;  1ZP0 A;  2NW7 A;  1VCT A;  2W66 A;  3RLF F;  3AB3 B;  2PBI A;  3JC6 D;  2J47 A;  3ZC0 A;  1B7T A;  4HWI B;  2CE7 A;  1ZHC A;  3RH3 A;  5JDM A;  4OYJ A;  3C4W A;  2D5U A;  4I43 B;  5LGU B;  3MK7 C;  5FY7 A;  2H7O A;  4IL4 A;  5AQJ B;  5J1G A;  2YK0 A;  2VWA A;  3HA4 A;  1KNZ A;  2AXD S;  1ZV4 X;  3PU3 A;  4H9N C;  2Y6X A;  4GKJ T;  2W2U A;  3RIU C;  2LSY A;  4O4J E;  3PUZ F;  2LEH A;  3BK9 A;  1H7C A;  2I0M A;  4P1N A;  5JDQ A;  5JDL A;  5AQP B;  3ZLI A;  2IUB A;  1SA0 E;  1XDP A;  1HNX T;  4F52 A;  4DID B;  2DNX A;  3UUM A;  4HFE A;  4ADZ A;  5EK4 A;  5LMU T;  2IML A;  4P0A A;  4Z8X A;  3UFG A;  3WAK A;  3SWH A;  1WCR A;  4ZZB A;  2QYW A;  5KXJ A;  3AVR A;  2M6B A;  2RP4 A;  2JMH A;  3U78 A;  5HXH A;  5J0Z A;  2XAH B;  4BJN A;  3UUX B;  2D9D A;  2BKO A;  4EZH A;  1YQ3 A;  5LOV E;  2BG9 B;  2JQ9 A;  2NOX A;  3E0Z A;  4TWH A;  4JI3 T;  2XQ7 A;  4DR7 T;  4HN9 A;  3VRB A;  3ZT6 A;  2WU2 A;  1FMW A;  1VRB A;  2V7J A;  5EK2 A;  4NXN T;  3K1S A;  2KMF A;  1YQ4 A;  5LBQ B;  3SFD A;  1M62 A;  2CLY C;  2BG9 A;  3BQK A;  3K3Q C;  2WQY A;  4EGW A;  3OYZ A;  4DUZ T;  4WQO D;  5AQI B;  4Q25 A;  3VKH A;  3AE3 A;  5FY0 A;  2JIW A; 
#chains in the Genus database with same CATH homology
 2X0L B;  5FXX A;  3NRX A;  4C90 A;  5LCY A;  1U5P A;  1NWM X;  3N5L A;  4U74 A;  1Z0P A;  3ONX A;  1KK7 A;  3CML A;  3FXD B;  2Q9Q D;  3CX7 B;  2V7L A;  2K5B B;  5JRC B;  4OK0 A;  2CXD A;  3WI3 A;  4CI1 B;  5HWY A;  3P7I A;  3R6N A;  3E08 A;  4BAY B;  3ZMU B;  5L3D B;  1CUN A;  3PUG A;  3N9M A;  4I55 E;  1HFA A;  3M65 A;  4H9Q C;  4GK5 E;  3FBL A;  4KP3 C;  2WSS V;  2LJL A;  3PUA A;  1O3X A;  2KND A;  3H37 A;  2CWO A;  3I9Y A;  4O4I E;  2X51 A;  3NRY A;  3TKL B;  3RKO A;  4AQF C;  4AXP A;  4TV9 E;  3NBX X;  3I0O A;  4IST A;  3KIN B;  4OFZ A;  5JR9 C;  4UEL A;  4X1Y E;  4PW8 A;  2X67 A;  4MAL A;  2HPL A;  3L09 A;  3I1A A;  2WM9 A;  2SPC A;  2XHE B;  5LG4 A;  4L9I A;  1NAF A;  2NTX A;  1IZN B;  4XZC A;  5H6R B;  4MBQ A;  4OHF A;  5LHG B;  5JRE A;  2C5J A;  3KDS E;  3HL6 A;  2LSG A;  3OJA A;  4ZI3 D;  4OYK A;  2LM9 A;  4UF0 A;  5FXW A;  1HG5 A;  1LVF A;  3PUQ A;  3T8O A;  1LKX A;  3ZYM A;  4BJM A;  4EB6 E;  2V1D B;  5EZY E;  2QGS A;  3O1H A;  2A3D A;  3BQL A;  2MOZ A;  4GOU A;  2LSJ A;  5EK3 A;  5DAB A;  2XAF B;  3KBU A;  3AAA B;  3ZMT B;  2KLQ A;  3VU7 H;  2KWI B;  3AA1 B;  4QX7 B;  1HF8 A;  1V9D A;  2C5I T;  4UV9 B;  3VHL A;  5JDH A;  4QXC B;  3I0Q A;  2WMN A;  4PK6 A;  4GYS A;  3SOL A;  2P9B A;  4CI2 B;  5HXE A;  4ISS A;  2XTL A;  1YD8 G;  4AQF A;  3HKC E;  1SHZ C;  2MTQ A;  4AI6 A;  5LP6 E;  1HG2 A;  1D1C A;  3N2K E;  1D0X A;  5L3B B;  5GON E;  5LGT B;  3UUN A;  3KV5 A;  5C8Y E;  4ZI2 D;  4UXN B;  3MZK B;  1IJ6 A;  5JR9 A;  3ZYK A;  3OKQ A;  5L3F B;  2IC6 A;  2Y48 B;  4H63 V;  4IHJ E;  4CQI A;  2WBL A;  1BR2 A;  5DJQ C;  2JJ9 A;  2DWG A;  4QHO A;  4J2C A;  2K24 A;  2YIN A;  2WWU A;  1MIV A;  1VOM A;  3RRC A;  3C50 A;  3ZCI A;  3K3O A;  2L9Q A;  5L3E B;  4GK0 E;  5FY1 A;  4QXH B;  3LBX B;  4HFV A;  4AKI A;  4H9R C;  3OYX A;  2CCQ A;  2VKJ A;  2VK9 A;  4JEH B;  2ZMA A;  3KV4 A;  4E7Z A;  5CB4 E;  3B57 A;  2W61 A;  4ILU A;  4TUY E;  2Q9Q C;  2E9X B;  2VAS A;  2DWK A;  1Y64 B;  3F57 A;  3WAJ A;  2HH7 A;  1AJ3 A;  2N9D A;  2W0G A;  2L8K A;  4PFP A;  4IIJ E;  4EOZ B;  1ZKE A;  1QUU A;  2CXF A;  3HKD E;  4UVA B;  2BZB A;  2H3R A;  3ETU A;  3KV9 A;  2LOS A;  3LBX A;  3N9N A;  5FXZ A;  2MYS A;  4HTE A;  4DBR A;  5ADX L;  2GK9 A;  3GWH A;  3F2E A;  2WMO A;  4QWN B;  3RX6 A;  5F3J A;  3FHN A;  4KMC A;  2LE8 A;  2NTY A;  3MKD A;  4AKR B;  4CXW A;  2IW5 B;  2CLY B;  5M4Y A;  4CZZ B;  2CWY A;  4CXX A;  2E9X A;  1FEW A;  5FYM A;  4EYU A;  3AVS A;  2W62 A;  4EYY R;  4P0B A;  4AQG A;  4ERR A;  4AKG A;  3N9Q A;  5LBM A;  2HPJ A;  2V7K A;  1IAP A;  1WYC A;  3AA0 B;  3GA8 A;  2EHO D;  4CXY A;  3ZCJ A;  2KIN B;  3Q9D A;  5FMN A;  4X1I E;  4ZI3 C;  5JH7 E;  4JUY A;  2OA5 A;  3ETV A;  1S35 A;  2KT9 A;  3RPU A;  2ZM2 A;  1MNE A;  3OBV E;  4UF0 B;  4ASK A;  2V7M A;  3DJB A;  4E7S A;  2Q9Q A;  5IYZ E;  5LJN A;  2E8I A;  3Q5W A;  3SS1 A;  4GYR A;  1U4Q A;  4WBN E;  3PTR B;  4H9P C;  3J9X 1;  1YKH B;  2C5K T;  2LOP A;  2QA7 A;  4G63 A;  4WBO A;  1HX8 A;  3HKE E;  4EXT A;  2H7V C;  3EDV A;  1MND A;  2K9A A;  5LXT E;  5LJM A;  5LHH B;  5LA6 E;  3GMI A;  1HTJ F;  3KBT A;  4PAG A;  3V5S A;  3RC8 A;  4M1P A;  1FMV A;  5JDN A;  2DHR A;  3C4X A;  4AKH A;  4ZI2 C;  4HKA A;  4DND A;  2ZLY A;  2Z6E A;  4L0R A;  1IJ5 A;  2WAU A;  3W15 B;  4MLK A;  3ESL A;  4PJJ A;  3H3A A;  1BR1 A;  5JR9 B;  1D1A A;  4O2B E;  3RYI E;  2ZM0 A;  3AAI A;  4UIG A;  1T98 A;  5HAX A;  4QXB B;  4YFS A;  2X66 A;  4HGA A;  4A56 A;  2RA1 A;  4NUU A;  4IE6 A;  2JRK A;  3LK2 B;  3ZJ2 A;  3FXE B;  4B6X A;  5JDF A;  3CQX C;  3AAE B;  5F8P A;  4K0U A;  4PJM A;  5ETW A;  3PUS A;  4O2A E;  4NUV A;  2W63 A;  4ZS2 A;  2XQY A;  3UFE A;  2XUE A;  1UX5 A;  2NW8 A;  2V26 A;  3QK6 A;  4BA9 A;  2YU2 A;  3PE0 A;  3LK4 2;  1D0Y A;  1US7 B;  1QSD A;  3KFW X;  3P8C D;  3ZEF B;  5LGN B;  3EVY A;  4HEA A;  1HS7 A;  5CA0 E;  4O4L E;  1YW0 A;  2X9W A;  4IE0 A;  1MMD A;  2ODV A;  5HXR A;  3VKG A;  2XU0 A;  2CEA A;  2PG8 A;  3UTK A;  1BR4 A;  3S4U A;  5LNK A;  2BVL A;  3HKB E;  2VL8 A;  4ZOL E;  2XAQ B;  3IBP A;  4L5G A;  4DMW A;  2N2N A;  4DO0 A;  3CKD A;  4KBM B;  2EHO C;  3CWZ B;  3MJX A;  3QUJ A;  4G2A A;  1LVK A;  4PK5 A;  3LFM A;  2VKH A;  4V1A v;  4FI5 A;  4YJ2 E;  3NZP A;  3KVB A;  4PJN A;  2LSK A;  3RC3 A;  2ODU A;  3SRZ A;  4TV8 E;  4U72 A;  3O1J A;  4PFO A;  3K3N A;  4X20 E;  1EZ3 A;  4PK4 A;  2XAG B;  2BDE A;  2CMR A;  2KWH A;  1WRD A;  3PU8 A;  4HE8 A;  2ACX A;  3DTO A;  4N78 D;  3N2G E;  3CQC B;  2VKD A;  3IF8 B;  5KDM C;  2JMK A;  3ZN1 B;  3EDU A;  4XAX B;  3N9O A;  3UUL A;  2Q9Q B;  2EHO B;  4PJL A;  3O1I A;  3DP7 A;  2V7I A;  2XAS B;  4IE5 A;  3MA9 A;  2LHR A;  4H9S E;  4ZHQ E;  4PNI A;  3LG7 A;  5FNV E;  2VKO A;  3BQI A;  4IE4 A;  1MIY A;  2NW7 A;  2VB6 A;  4MHC A;  5KX5 E;  2LHN A;  5L2L A;  4EAH A;  2XAJ B;  4ZS3 A;  3UT5 E;  5J2T E;  3RYH E;  3L3P A;  3AB3 B;  3D0T A;  2PBI A;  5JQG E;  3JC6 D;  4XBF B;  1MMG A;  3N2O A;  5LHI B;  3ZC0 A;  2MBG A;  5BMV E;  1B7T A;  5DQV A;  2CE7 A;  1ZHC A;  3RH3 A;  5JDM A;  2ES0 A;  2BVM A;  1MMA A;  4OYJ A;  4TN7 B;  1OWA A;  3C4W A;  2EHO A;  2D5U A;  4I43 B;  5JVD E;  3ZMZ B;  5LGU B;  3O4X E;  3KVA A;  4WNK A;  3PUR A;  2D0T A;  3K8P C;  3MK7 C;  5FY7 A;  2NP9 A;  1LRZ A;  2X9H A;  2H7O A;  3A5X A;  4C91 A;  3O9X A;  2X68 A;  3PDY A;  5J1G A;  5L3G B;  4WW0 A;  2YK0 A;  2VWA A;  3HA4 A;  1KNZ A;  4H63 H;  4O8S A;  2JPF A;  3C98 B;  1D0Z A;  1FIO A;  2KXP B;  3LJC A;  5E0O A;  1ZV4 X;  3RRW A;  3PU3 A;  4TX5 A;  4YLH A;  2B1E A;  3CX6 B;  4H9N C;  4QX8 B;  2Y6X A;  4UVB B;  5H6Q B;  2LSI A;  4JLE A;  2LSY A;  2N1G A;  4MFR A;  4O4J E;  2X9X A;  4DMV A;  2LEH A;  3HR0 A;  5CA1 E;  5JRC A;  2X9Y A;  2W00 A;  1ZEE A;  1H7C A;  3BK9 A;  2L3L A;  5JDQ A;  3ZC1 A;  5IHY A;  5JDL A;  5FP3 A;  1MIW A;  3AA6 B;  2D0U A;  3ZLI A;  3EUH A;  1SA0 E;  3MAC A;  1D1B A;  3J7Y q;  2D2S A;  3AA7 B;  2ZM8 A;  3U3I A;  2DNX A;  3UUM A;  3LK3 B;  2PJQ A;  2NW9 A;  1WLX A;  5HXS A;  4ADZ A;  1WR6 A;  5HYA A;  4YHJ A;  3V5U A;  5KMG P;  3ZJ1 A;  5EK4 A;  1UCU A;  4JEU B;  4P0A A;  4Z8X A;  4FJO A;  4P09 A;  3WAK A;  3SWH A;  3E22 E;  3C51 A;  3CPZ A;  4KUM B;  3GN5 B;  3ANW B;  5TAO A;  3RYF E;  3AVR A;  1X79 A;  3N9L A;  2RP4 A;  4I50 E;  1UX4 A;  2JMH A;  2DCF A;  2LT3 A;  2Y8D A;  3U78 A;  3CVR A;  3IEE A;  5HXH A;  3RYC E;  2CM0 A;  5HWX A;  4ANJ A;  3ZMS B;  1E1H B;  3NZQ A;  4UVC B;  1OXZ A;  5L3C B;  2XAH B;  3CX8 B;  2UXN B;  2CXL A;  3FB2 A;  4BJN A;  4UEM A;  3UUX B;  4GIW A;  1G73 A;  2K48 A;  2A2F X;  3ZN0 B;  4X1K E;  3ZPO A;  2JQQ A;  3ZYL A;  4EZH A;  3GN5 A;  2PFV A;  5LOV E;  2E9X C;  2NOX A;  3ANW A;  3E0Z A;  1MMN A;  5FXV A;  3Q5X A;  4TZ4 C;  4O4H E;  5LYJ E;  3Q2M A;  4UV8 B;  3N9P A;  4HN9 A;  5A1L A;  4IDZ A;  3C64 A;  2C0S A;  2DI4 A;  4IGU A;  3JC6 C;  4IE7 A;  2YEV C;  1FMW A;  1VRB A;  2V7J A;  2UXX B;  4QKN A;  2J1D G;  2YU1 A;  3B13 A;  4H9O C;  4CI3 B;  4I4T E;  5EK2 A;  5DQW A;  2G0U A;  3R84 B;  1BR0 A;  3IHR A;  4F6R C;  1S94 A;  3F31 A;  2KMF A;  4AKL A;  2DLR A;  5LBQ B;  5JDG A;  1HCI A;  5AFU L;  2CLY C;  4ZI7 E;  3ZMV B;  5HXC A;  4EIW A;  3FBZ A;  3BQK A;  2CA5 A;  2M67 A;  3K3Q C;  3OYZ A;  3KV6 A;  2NWB A;  3QC9 A;  1G8X A;  3HI2 A;  4DBQ A;  2E9X D;  2IAK A;  3I9W A;  3MXZ A;  4YJ3 E;  2A72 A;  3C4Z A;  3CQG B;  2IC9 A;  4DVD A;  3VKH A;  1WYB A;  5J2U E;  2KZ7 B;  1YKE B;  2I59 A;  5FY0 A;  4EZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...