4NUVA

Heterotetramer structure of region ii from plasmodium vivax duffy binding protein (pvdbp) bound to the ectodomain of the duffy antigen receptor for chemokines (darc)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
298
structure length
288
Chain Sequence
NTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVFHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Duffy receptor
publication title Red Blood Cell Invasion by Plasmodium vivax: Structural Basis for DBP Engagement of DARC.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Membrane protein, cell invasion
total genus 113
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4nuvA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4nuvA01
3RRCA 3BQKA 3CMLA 2WAUA 4NUVA 3BQIA 5F3JA 2XU0A 4YFSA 3BQLA 2Y8DA 4NUUA 3CPZA 2YK0A 3C64A
chains in the Genus database with same CATH superfamily
5HXHA 4DO0A 2CBIA 4APFB 4A97A 3CWZB 2NTYA 4H63H 3VHLA 5HWXA 2CE7A 3T1YT 1UX5A 1CUNA 2XQ3A 3QNUA 1MNEA 1KNPA 4IDQA 4UXNB 3L3PA 3ZN1B 5CJ5A 1J5ET 2V7LA 2HPJA 3AA6B 3AE4A 3JAFA 2EHOA 2D2SA 2W00A 2OA5A 4NXMT 1NEKA 1KEYA 2MAWA 2LSIA 2XAGB 1HX1B 4O8SA 4DBQA 2MYSA 4LMKA 1HG5A 4AXPA 1ZKEA 2BDEA 4F52A 3RIAA 3RH3A 3N5LA 3LDQB 2YU2A 1LDKB 2V1DB 4GK5E 4HWHA 5IHYA 5FNVE 2LLYA 2DLRA 1Z8UA 2W67A 5E0OA 5FL1A 1XZYA 2ACZA 3ONXA 3EHZA 4E7SA 2DNXA 2XM1A 5FMNA 2UUAT 4LMLA 3RHWA 4X20E 4EYYR 5JDMA 2D0TA 2CXFA 4CN6A 3AB3B 5AQUB 5HXCA 4YT0A 2CXDA 3RI5A 2YN6A 2BG9A 4ILAA 4GYSA 1D0ZA 2LM2A 4H9NC 2VWAA 1US7B 3SFDA 3AE6A 4CN4A 4YTMA 3LK42 1JNRA 3DJBA 2YKSA 3I9YA 2IHR1 2WDRA 3N2GE 3RRWA 3O1JA 5EK3A 1N33T 2XU0A 1X79A 5LGNB 4PJMA 5LOVE 3PUAA 2XZEA 4HFEA 5AQGB 4AP2B 2D0UA 5ADXL 4IE0A 4NUVA 2VURA 4C91A 2WP9A 4UEMA 4DR6T 1N32T 4O4HE 3R6NA 4GIWA 2VASA 5LHIB 4OYKA 2LKHA 4KUMB 4PJJA 2IC6A 5JDNA 4KX6A 2QRXA 3T8OA 4DR4T 4I55E 3WAJA 4GKJT 3EI0A 1FJGT 3VKGA 2LOPA 3CK6A 2JMHA 2W66A 3AVSA 3K3QC 3AEDA 3BQLA 3ZYKA 3C4ZA 2JIWA 4M1PA 2H89A 3PUZF 2VKJA 1D1CA 2LKGA 3FXDB 1ZOYA 2DCFA 2UU9T 3N9MA 4QKNA 5AQMB 2X0YA 3H3MA 4CN1A 2RA1A 5BR8T 4MFRA 2WBLA 4UV9B 2VL8A 5L47A 3PV0F 5CGMA 1XDPA 2UXDT 2UXCT 1YKEB 4FJOA 1D1BA 4F8HA 3L8RA 4TN7B 4FI5A 2EHOB 2VKOA 2F4VT 2CWOA 2V5DA 1HF8A 4TWHA 2XUEA 2X9XA 2GK9A 2NWBA 4IHJE 2XSBA 5JRCA 4PJLA 1KFYA 5FXVA 3N2OA 1T8BA 4MBQA 3JCFA 3RPUA 4DV5T 3AAIA 5CA0E 2LT3A 2C5JA 2E5LT 4WW0A 4PFPA 4EYUA 2BKNA 2B1EA 3QOFA 3N9PA 5A1LA 4ADZA 2DL1A 5AQPB 1ZHCA 2JMKA 4ISSA 3PE0A 4BAYB 3OKQA 4L0RA 4JI3T 1VOMA 4PK6A 3ZT7A 2YDRA 3ESLA 4HWCA 2WMNA 3AE2A 2V26A 2X51A 2N1GA 5HEUA 2BS3A 1FMWA 3EUHA 4IDOA 4DNDA 2BG9B 5AQTB 2FBWA 4HGAA 2JRKA 4ANJA 4L9IA 1OEDC 3UUXB 3N9QA 3LJCA 3RRCA 2DI4A 1N36T 2NW8A 2ES0A 1UUSA 2BZBA 4KI0F 2H88A 4ILUA 2BS4A 3AA7B 1D0XA 4G63A 3ZMSB 2Q9QA 3PUQA 3ZLIA 4DR2T 2CMRA 3KBUA 1HS7A 2XQ6A 4AQGA 3JC6C 4TNWA 2X9HA 5FXZA 2X0LB 5FL0A 4QH1A 4DUYT 2SPCA 3RKGA 2XAHB 3CX7B 1FIOA 2CXLA 4ZI3C 4JV5T 3ZPOA 3VRAA 1E7PA 2WS3A 5J1GA 3RYCE 3PUXF 4IGUA 4YSZA 3P4SA 3IHRA 3P50A 3VU7H 1OEDE 3AEFA 2XQ9A 4HKAA 3NRYA 5FVKA 4HXIB 2KZ7B 3EDUA 4ZZCA 1D0YA 2L8KA 2RPAA 1BR0A 2Y6XA 2X9WA 3ETVA 3NBXX 1ZV4X 4BJNA 2V7MA 2EHOC 4Z91A 4X62T 5H6QB 1MMGA 5FY1A 4JGHD 3EABA 4AQFC 3CX8B 3AA0B 1SE7A 4UIGA 3UU5A 4MALA 2KSRA 4O4JE 4JI5T 5JTGA 4H9OC 4EEDA 1ZEEA 2VB6A 1HCIA 3UUNA 3LK2B 5AQKB 4JYAT 2VKHA 4YTPA 4H9QC 3LBXA 2W62A 3HL6A 5HXEA 2PJQA 1M7KA 3QUJA 3CIRA 2LSJA 1LRZA 4P0BA 2B76A 5HAXA 2YU1A 4QH4A 4DV6T 5FY7A 4TWDA 4IL4A 4YFSA 1MIVA 3I1AA 5JR9C 2KINB 3LSVA 1QSDA 4TV8E 2EHOD 4IT4A 1HG2A 2ODVA 3K8PC 4NPPA 2I6HA 3Q5WA 2WWVA 1MIYA 4IDNA 4KMCA 2PTFA 3KV9A 3AE1A 5LCYA 2W0GA 3RYFE 3RGLA 5BMVE 3E08A 3RYHE 3M3ZB 2V8SV 4U74A 3PUSA 3TLSA 2I0MA 4XBFB 3E22E 4UVCB 1XWMA 2ZM2A 4YSYA 5HXSA 4X64T 5J2UE 3H37A 3VR8A 4DIDB 3JAEA 3QC9A 4IREA 4JBWF 3SWHA 5AQOB 3AE5A 2CEAA 1OWAA 4ZS2A 5JDLA 4P1NA 5J0ZA 2DWGA 1IBKT 3KINB 3TLUA 3P4RA 4HEAA 3ZEFB 4YJ2E 3KDSE 4CXWA 3PU3A 2CCQA 5C8YE 2N2NA 3UQ4A 3B5MA 1VCSA 2Q9QB 4JI4T 2NTXA 4HFIA 1U6GA 4CQIA 3PUVF 3AAEB 3AECA 4GYRA 2JQQA 4K0UA 2E9XA 3TKLB 5F3JA 3OJAA 1JNZA 3ZMUB 5FKYA 2J4GA 4I50E 4BJMA 2YK0A 5DQVA 3IA3A 4HN9A 2Y48B 2FJAA 4DV7T 3PU8A 4X1YE 1Z0PA 3RIUA 1IAPA 1T98A 4AKHA 1IZNB 2K9AA 2ZM8A 2XQYA 5DJQC 5L4HA 2YINA 4LF5T 3FZMB 2ZLYA 2K5BB 1LVKA 1L0VA 4XAXB 5AQSB 2J62A 5AQIB 5L4EA 3MA9A 4IDPA 3AEAA 2E2AA 1KNZA 4WYVA 4V1Av 4ISTA 5IWAT 3CQXC 1Y01A 4EZ4A 3UT5E 1U4QA 2KWHA 3LBXB 4ERRA 1SUMB 3FZLB 5L3EB 3BK9A 3ZC1A 4UF0A 4AKIA 1GQEA 4P5OA 4Z90A 4LMJA 4EAHA 3I0OA 3N9NA 3AEEA 3RYIE 3AXJA 1I94T 3P4QA 2LEHA 1O3XA 2IDOB 4OFZA 3WAKA 3SOLA 1UCUA 2KNDA 3UTKA 3A5XA 2VQFT 2V7IA 3HR0A 3K3NA 1G8XA 3FZHB 2VVSA 4G2AA 3AE9A 4H9SE 3GN5A 3NVOA 2KLQA 3RKOA 4GK0E 3NRXA 2IIUA 5LNKA 4U3CA 3ZN0B 2K24A 2V7JA 1MMDA 2XSAA 4ZI2C 3K3OA 2RP4A 3TLTA 2Q9QC 4EB6E 4EEBA 3IEEA 2A2FX 3PUWF 2V6YA 4HWDA 4K0KT 4EV6A 4HFVA 2LE8A 2VK9A 3ZT5A 2V7KA 4J2CA 5JH7E 2YEVC 3X1DA 2D5UA 2W4XA 3C4XA 2X68A 3SFEA 5KX5E 2BS2A 5H6RB 1IJ5A 1M62A 4WNKA 4ZHQE 2Z6EA 3IBPA 2G0UA 3C51A 2CLYB 2ZM6T 2MOZA 1W0BA 3U78A 3V5SA 3GA8A 5IUXA 1OXZA 3AE8A 4CI3B 2C5KT 2XHEB 4YJ3E 2DHRA 4EZHA 2WWUA 2WZHA 3ZCJA 2KWIB 2X0HA 4ZI2D 4HWFA 3UUBA 3QB5K 4HWIB 2E9XB 4ZXLA 2BVLA 4ASKA 4B3MT 3ZMZB 2NW7A 4B6XA 4JI8T 5DQWA 3PJAJ 2IAKA 3NKZA 1FEWA 5JREA 5L2LA 3CMLA 3RIFA 1QUUA 2PG8A 3ONLC 1HNXT 1UK5A 4LF9T 2KT9A 5ABGA 3Q5EA 3AVRA 3M65A 2X66A 2P9BA 5LA6E 5JDFA 1E1HB 2X9YA 4AISA 4Q25A 5J2TE 4QXCB 1J1JA 2XQ8A 3V5UA 3CPZA 4YTNA 1HX8A 4AQYT 2HPLA 2JQHA 1T7SA 5FXWA 3ZT6A 2HH7A 4LF4T 3C64A 2CM0A 3VKHA 4YHJA 2LHRA 2BKPA 1BR4A 3PJAA 5HEGA 5JVDE 5LYJE 2XQ7A 3FZFB 3OYXA 2LHNA 4UF0B 2FJDA 4JUYA 2JQKA 4X5TA 3HKBE 4QX8B 4UELA 3ONJA 1VRBA 4DR3T 3AXJB 2NW9A 4EIWA 3EDVA 1WRDA 2YDQA 2XAQB 2C5IT 3C50A 2JPFA 2WSSV 1MMAA 4TZ4C 2AE9A 2UXNB 3CKDA 5HCMA 3ZMTB 2YDSA 5LG4A 4P09A 4ZOLE 3GN5B 5L3FB 2I59A 3OVUA 4ZZBA 1YQ4A 3U3IA 2K3WA 4DUZT 2CLYC 4WZXA 2E8IA 3VRBA 4QXHB 5HEJA 5AQFB 3UU6A 3GMIA 3JC6D 3T1HT 4A5XA 4MLKA 4JEUB 3AAAB 2XAJB 5EK2A 3BQIA 4UV8B 4ZI3D 3K1SA 2E9XC 4X65T 4MHCA 3RF1A 3SS1A 4UR9A 1XMQT 3DP7A 4TNVA 1S35A 4CI2B 5F5WA 1YW0A 2VKDA 3HI2A 3ZSTA 3S4UA 3HKCE 1MIWA 5L3CB 3DPLC 5AQJB 5L3DB 4H9RC 4JI7T 3NWIA 4IE6A 1LVFA 3RIUC 2LM9A 4DMVA 5JRCB 3CVRA 3NZPA 3C98B 3MACA 4IIJE 4A64A 5HEHA 4DV4T 4O2AE 3DTOA 5C2TA 2BG9C 4U2YA 4XZCA 5KDMC 2CBJA 2JJ9A 5JDHA 4H63V 1XDOA 2FJEA 3N9LA 4QX7B 3ZC0A 4PK4A 5LJMA 3RQWA 3OTOT 1U5PA 1OEDA 1HNZT 5IYZE 3KBTA 4QWNB 3P7IA 4X1KE 5JDGA 3PDYA 5ABFA 4LFBT 2XQAA 2M6IA 2WDQA 3I0QA 3F31A 2W61A 3EAMA 5ETWA 1HFAA 5AQHB 4HFDA 2V6XA 4WBOA 4OK0A 1W0AA 1J5WA 3DQVC 3PUGA 2CA5A 2QVAA 1R8IA 5AFUL 3B57A 2BG9E 3HKDE 4KHPT 4B3ST 3KV6A 4UVAB 5AQLB 4PNIA 3OBVE 2UXBT 4TX5A 2XM2A 2BVMA 2VVNA 1LDJA 5M4YA 4I43B 1WLXA 2WU2A 2M6BA 3FBLA 4I0UA 2A3DA 5HYAA 1WFDA 2WZKA 3OPCA 1KK7A 5HXRA 3O9XA 2LSYA 1HNWT 1VCTA 4PK5A 5GONE 3LK3B 4AQFA 3P4WA 1XNRT 3RLFF 3UUMA 3Q9DA 3MXZA 2FJBA 5AQVB 4HFCA 4P0AA 3FZKB 3WI3A 2J47A 2W63A 1YXRA 4IE5A 3ZJ2A 1WYCA 3PUYF 4IE7A 2WZIA 3AE7A 5AQQB 4E7ZA 4OX9T 3ANWA 2LRKA 4OYJA 3BQKA 4GKKT 4QH5A 2LSGA 4JEHB 4ILBA 5FY0A 5AQNB 1SA0E 1KNRA 1QLBA 4HFHA 2R6GF 2WY2A 2WB5A 2QYWA 3ZYLA 4O4IE 2M67A 2XTLA 1W09A 4JI2T 3NZQA 5JR9A 5LJNA 1D1AA 4B3RT 1FMVA 4JI1T 4KHZF 5LMNT 1Y64B 2WU5A 2KMFA 3CX6B 3F2EA 2H7OA 4UVBB 5FP3A 1WYBA 2XY8B 1BR1A 5JQGE 4YY3T 5KXJA 3Q5DA 2BBHA 4HTEA 4AIUA 4C90A 1W9RA 4U31A 4IDZA 4CXXA 3ZJ1A 3O1IA 2L3LA 3H3AA 2HHHT 2H3RA 3RQUA 1N34T 3RTRA 2LOSA 3FHNA 4IL9A 4LF7T 4OHFA 4A56A 4YLHA 5CA1E 4O4LE 2OV9A 3ETUA 3J9X1 3N9OA 1OEDB 2ZMAA 4CZZB 2CHNA 5EK4A 1UGOA 4PW8A 2WMOA 1YQ3A 3TLWA 1H7CA 1E2AA 3KV4A 4DV1T 5ABFB 4DBRA 5L3BB 3QB5A 4JI0T 1WR6A 2IC9A 4CXYA 1V9DA 3PTRB 1IBMT 1LKXA 4AKRB 4U72A 4ZEYA 3O4XE 3KVAA 2ODUA 2OLTA 4YSXA 3EVYA 5ABHA 4KBMB 5CB4E 1DU2A 2MPKA 2KXPB 2CWYA 5LG3A 5LB7B 3RC8A 3RC3A 2WDVA 2PFVA 3N2KE 2BKOA 4TUYE 3C4WA 4WBNE 3ABVA 2CRBA 3P4PA 4NUUA 5LP6E 3KV5A 3CQGB 4O2BE 4PAGA 3UU8A 2J1DG 5LXTE 4X66T 1EZ3A 3CQCB 2LRLA 4YXDA 3UFGA 4AKGA 2NP9A 5HCJA 1B7TA 4NIQA 2Q9QD 3UU3A 2NOXA 3B13A 2K48A 4ILCA 3FXEB 3ZYMA 1MNDA 2XASB 4QHOA 4TWFA 2DWKA 1I6ZA 3HA4A 2IMLA 3ANWB 4LFCT 2MTQA 3ZSSA 3R84B 3ZMVB 5FYMA 1WR0A 4JI6T 1UURA 5LGUB 3D0TA 2WAUA 1WCRA 2Y8DA 3UU4A 5CFBA 2YOEA 1IJ6A 1CHUA 2XPKA 5JR9B 1IBLT 2WCAA 4H9PC 5LMUT 2N9DA 3KFWX 4X1IE 5JDQA 2VQET 3L09A 3JADA 3FBZA 2UXXB 4LFAT 2PBIA 4F6RC 4NXNT 4EXTA 3GWHA 3UFEA 3SRZA 4N78D 4KP3C 3VR9A 3RX6A 2XQ4A 2A72A 4HE8A 3AEGA 2MBGA 2V5CA 1ZP0A 2XAFB 3IF8B 1HR0T 3QK6A 4GOUA 2C0SA 3TLVA 1YD8G 5AQRB 2X67A 5FXXA 1X9BA 4DV2T 4EOZB 3G06A 3F57A 1NWMX 2XJ7A 4DR7T 2CPTA 1LDKA 3HKEE 2H7VC 4U33A 2VL0A 1UX4A 4EGWA 2IUBA 2D9DA 3J7Yq 2IW5B 2QA7A 3AA1B 1HTJF 2BBJA 4I4TE 4DV0T 2W2UA 4LF8T 5LBQB 3A8YC 2UUCT 2CHOA 3AE3A 4COFA 4N9F3 3A7MA 4IE4A 3AEBA 3W15B 5L3GB 3E0ZA 4YHHT 2WM9A 2HN1A 3P8CD 3FB2A 2V6YB 2A9UA 5LBMA 3L39A 5ABEA 4ZI7E 3Q2MA 2NR4A 4PJNA 4ZS3A 1S94A 4DR1T 1BR2A 5F8PA 4Z8XA 3MK7C 5KMGP 3MZKB 4LF6T 4DR5T 4DV3T 3ZKRA 4AI6A 4QXBB 4DMWA 2JQ9A 2HN2A 1MMNA 4BA9A 5HWYA 2ACXA 3KVBA 3LG7A 3O1HA 4TV9E 5LHGB 1SHZC 4A98A 2QGSA 5TAOA 1XNQT 2XQ5A 3MJXA 5FVLA 5LHHB 3UQ7A 2FUPA 3MKDA 4U7IA 2LJLA 4CI1B 3I9WA 4B3TT 4WQOD 2WQYA 1NENA 5DABA 4U2ZA 5HEOA 5LGTB 3Q5XA 3UULA 4L5GA 3LFMA 2ZM0A 3ZCIA 2LSKA 2E5VA 4AKLA 1AJ3A 2E9XD 2UUBT 1XMOT 3OYZA 1YKHB 3PURA 2AXDS 4HFBA 4PFOA 4DVDA 1T72A 5C3JA 4U7YA 5EZYE 1KF6A 2L9QA 1NAFA 4JLEA 1G73A
chains in the Genus database with same CATH topology
4UVBB 2C5KT 5FP3A 5HXHA 4DO0A 4HKAA 2XHEB 1WYBA 3NRYA 4YJ3E 2DHRA 4EZHA 2WWUA 1BR1A 5JQGE 2KZ7B 3EDUA 3CWZB 1D0YA 2NTYA 3ZCJA 2KWIB 4H63H 2L8KA 1BR0A 4HTEA 4C90A 3VHLA 4ZI2D 5HWXA 2CE7A 2Y6XA 1UX5A 2X9WA 1CUNA 4ASKA 2E9XB 2BVLA 4IDZA 3ETVA 3NBXX 1ZV4X 4BJNA 3ZMZB 2V7MA 2EHOC 1MNEA 2NW7A 4B6XA 5DQWA 4UXNB 5H6QB 1MMGA 2IAKA 4CXXA 5FY1A 3ZJ1A 3L3PA 3O1IA 2L3LA 1FEWA 3H3AA 3ZN1B 4AQFC 3CX8B 3AA0B 5JREA 2H3RA 5L2LA 3CMLA 4UIGA 2V7LA 1QUUA 2HPJA 3AA6B 4MALA 2LOSA 3FHNA 2PG8A 4O4JE 2EHOA 4H9OC 2D2SA 2W00A 4OHFA 2OA5A 1ZEEA 2KT9A 4A56A 4YLHA 5CA1E 3AVRA 3M65A 4O4LE 2VB6A 2LSIA 2XAGB 2X66A 2P9BA 1HCIA 3ETUA 3UUNA 3LK2B 3J9X1 5LA6E 5JDFA 4O8SA 3N9OA 2VKHA 4DBQA 1E1HB 4H9QC 2ZMAA 2MYSA 2X9YA 1HG5A 4AXPA 1ZKEA 3LBXA 4CZZB 2W62A 5EK4A 2BDEA 4PW8A 5J2TE 3HL6A 4QXCB 2WMOA 5HXEA 3RH3A 2PJQA 3QUJA 3N5LA 1H7CA 3V5UA 3CPZA 2LSJA 3KV4A 1LRZA 4P0BA 2YU2A 5HAXA 2YU1A 4DBRA 1HX8A 5L3BB 2HPLA 1WR6A 5FY7A 2V1DB 2IC9A 4GK5E 4CXYA 5FXWA 1V9DA 3PTRB 5IHYA 4YFSA 1LKXA 1MIVA 5FNVE 4AKRB 2HH7A 4U72A 3C64A 3I1AA 2CM0A 5JR9C 3VKHA 4YHJA 2KINB 2LHRA 2DLRA 1QSDA 3O4XE 1BR4A 5E0OA 4TV8E 3KVAA 5JVDE 2EHOD 5LYJE 3ONXA 1HG2A 2ODVA 4E7SA 2ODUA 3K8PC 2DNXA 3OYXA 2LHNA 3Q5WA 1MIYA 4UF0B 5FMNA 4KMCA 4JUYA 3EVYA 3KV9A 4X20E 4KBMB 5LCYA 2W0GA 5CB4E 3HKBE 3RYFE 4QX8B 4EYYR 5JDMA 2D0TA 4UELA 2CXFA 5BMVE 3AB3B 5HXCA 2KXPB 3E08A 1VRBA 2CXDA 3RYHE 2CWYA 3RC8A 3RC3A 2PFVA 3N2KE 4TUYE 4U74A 4GYSA 2NW9A 3C4WA 3PUSA 4WBNE 4NUUA 5LP6E 1D0ZA 3KV5A 3CQGB 4XBFB 4O2BE 4EIWA 4PAGA 3EDVA 1WRDA 2J1DG 4H9NC 2XAQB 2VWAA 5LXTE 2C5IT 1US7B 1EZ3A 3C50A 2JPFA 3E22E 2WSSV 3CQCB 4UVCB 1MMAA 4TZ4C 2ZM2A 2UXNB 3LK42 3CKDA 3DJBA 4AKGA 2NP9A 3ZMTB 1B7TA 5HXSA 5LG4A 4P09A 4ZOLE 3GN5B 2Q9QD 3I9YA 5L3FB 2I59A 5J2UE 3N2GE 3RRWA 2NOXA 3B13A 3U3IA 2K48A 3H37A 3O1JA 2CLYC 5EK3A 2XU0A 3FXEB 3ZYMA 1X79A 5LGNB 4PJMA 1MNDA 5LOVE 2E8IA 3QC9A 3SWHA 2XASB 3PUAA 4QHOA 4QXHB 2DWKA 2CEAA 3HA4A 1OWAA 4ZS2A 5JDLA 3ANWB 3GMIA 3JC6D 2D0UA 2MTQA 2DWGA 5ADXL 3KINB 4IE0A 4NUVA 3R84B 4HEAA 4MLKA 4C91A 3ZMVB 5FYMA 4JEUB 3ZEFB 4YJ2E 3AAAB 2XAJB 5EK2A 3BQIA 4UV8B 3KDSE 4CXWA 4ZI3D 2E9XC 3PU3A 4MHCA 2CCQA 4UEMA 3SS1A 2N2NA 5C8YE 5LGUB 3D0TA 2WAUA 2Q9QB 2Y8DA 2NTXA 4O4HE 3R6NA 3DP7A 4GIWA 1S35A 4CQIA 2VASA 4CI2B 1IJ6A 4OYKA 1YW0A 2VKDA 4KUMB 4PJJA 2IC6A 3AAEB 5JR9B 5LHIB 3HI2A 4GYRA 5JDNA 2JQQA 4H9PC 3T8OA 4K0UA 2E9XA 2N9DA 3KFWX 4X1IE 3S4UA 4I55E 5JDQA 3HKCE 3TKLB 3WAJA 1MIWA 5L3CB 3VKGA 5F3JA 3OJAA 2LOPA 5L3DB 4H9RC 3L09A 3ZMUB 4IE6A 1LVFA 2JMHA 3FBZA 3AVSA 3K3QC 4I50E 4BJMA 3BQLA 2UXXB 3ZYKA 3C4ZA 2LM9A 2PBIA 4F6RC 2YK0A 4DMVA 4EXTA 3GWHA 4M1PA 5JRCB 3UFEA 3CVRA 3NZPA 3C98B 3MACA 4IIJE 2VKJA 1D1CA 3FXDB 3SRZA 2DCFA 4N78D 3DTOA 4O2AE 5DQVA 4HN9A 4KP3C 2Y48B 3RX6A 2A72A 4HE8A 3PU8A 4X1YE 4XZCA 2MBGA 5KDMC 1Z0PA 3N9MA 4QKNA 1IAPA 2JJ9A 2XAFB 5JDHA 3IF8B 4H63V 1T98A 4AKHA 1IZNB 2K9AA 2ZM8A 3QK6A 4GOUA 2RA1A 2C0SA 3N9LA 4QX7B 2XQYA 5DJQC 4PK4A 3ZC0A 4MFRA 2WBLA 4UV9B 5LJMA 2VL8A 2YINA 1U5PA 1YD8G 2X67A 5IYZE 5FXXA 2ZLYA 2K5BB 3KBTA 1LVKA 4EOZB 1YKEB 3F57A 4QWNB 3P7IA 1NWMX 4XAXB 4FJOA 1D1BA 4X1KE 5JDGA 3PDYA 3MA9A 4TN7B 4FI5A 3HKEE 2EHOB 2VKOA 2H7VC 2CWOA 1HF8A 1UX4A 3I0QA 1KNZA 2XUEA 3F31A 2X9XA 2W61A 4V1Av 2GK9A 4ISTA 5ETWA 3J7Yq 2NWBA 2IW5B 1HFAA 2QA7A 3AA1B 1HTJF 4IHJE 3CQXC 4WBOA 4I4TE 4EZ4A 4OK0A 5JRCA 3UT5E 1U4QA 3PUGA 2KWHA 2CA5A 4PJLA 5FXVA 5LBQB 3LBXB 3N2OA 5AFUL 3B57A 4ERRA 3HKDE 5L3EB 3KV6A 4MBQA 4IE4A 4UVAB 3BK9A 3ZC1A 4UF0A 3W15B 4AKIA 4PNIA 3RPUA 5L3GB 3E0ZA 4EAHA 3AAIA 3I0OA 3N9NA 2WM9A 2LT3A 3OBVE 5CA0E 2C5JA 3P8CD 4TX5A 3FB2A 2BVMA 4WW0A 4PFPA 4EYUA 2B1EA 3RYIE 5M4YA 2LEHA 3N9PA 4I43B 5LBMA 5A1LA 1O3XA 4ADZA 4ZI7E 1WLXA 1ZHCA 2JMKA 4ISSA 3FBLA 4OFZA 3Q2MA 2A3DA 3WAKA 3PE0A 3SOLA 5HYAA 4BAYB 4PJNA 1UCUA 3OKQA 2KNDA 4ZS3A 4L0RA 1S94A 3UTKA 3A5XA 1KK7A 5HXRA 3O9XA 2LSYA 2V7IA 1BR2A 3HR0A 5F8PA 1VOMA 4PK5A 4Z8XA 4PK6A 5GONE 3MK7C 5KMGP 3LK3B 3MZKB 4AQFA 3K3NA 1G8XA 3ESLA 4G2AA 4AI6A 2WMNA 4H9SE 4QXBB 4DMWA 2V26A 3UUMA 3GN5A 1MMNA 2KLQA 2X51A 2N1GA 3RKOA 4GK0E 4BA9A 3MXZA 3NRXA 3Q9DA 2ACXA 1FMWA 3KVBA 5HWYA 3LG7A 3EUHA 3O1HA 4TV9E 4DNDA 5LNKA 5LHGB 4P0AA 3WI3A 3ZN0B 1SHZC 2K24A 2V7JA 4HGAA 2QGSA 2W63A 2JRKA 4IE5A 5TAOA 3ZJ2A 4ANJA 1WYCA 1MMDA 3MJXA 4IE7A 4ZI2C 3K3OA 4L9IA 5LHHB 2RP4A 4E7ZA 3ANWA 2Q9QC 4EB6E 3UUXB 3MKDA 3N9QA 4OYJA 3IEEA 3LJCA 2LJLA 2DI4A 2A2FX 3BQKA 3RRCA 2NW8A 4CI1B 2ES0A 2BZBA 2LSGA 3I9WA 4JEHB 5FY0A 1SA0E 4HFVA 5DABA 4ILUA 3AA7B 5LGTB 1D0XA 3Q5XA 4G63A 2LE8A 2VK9A 3UULA 3ZMSB 3ZYLA 4L5GA 3LFMA 4O4IE 2Q9QA 2V7KA 2ZM0A 3PUQA 4J2CA 2YEVC 3ZLIA 5JH7E 2CMRA 3ZCIA 2M67A 3KBUA 1HS7A 2XTLA 4AQGA 2D5UA 3C4XA 3JC6C 2X68A 2X9HA 2LSKA 5FXZA 4AKLA 3NZQA 1AJ3A 2X0LB 5KX5E 5JR9A 5LJNA 1D1AA 2E9XD 5H6RB 2SPCA 2XAHB 3CX7B 1FIOA 2CXLA 1FMVA 4ZI3C 1IJ5A 3OYZA 4WNKA 4ZHQE 1YKHB 1Y64B 3PURA 3ZPOA 2Z6EA 3IBPA 4PFOA 4DVDA 2G0UA 3C51A 5EZYE 2CLYB 2KMFA 2L9QA 2MOZA 5J1GA 3CX6B 3RYCE 1NAFA 3F2EA 4JLEA 2H7OA 3U78A 4IGUA 3V5SA 3GA8A 3IHRA 3VU7H 1G73A 1OXZA 4CI3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRC A;  3BQK A;  3CML A;  2WAU A;  4NUV A;  3BQI A;  5F3J A;  2XU0 A;  4YFS A;  3BQL A;  2Y8D A;  4NUU A;  3CPZ A;  2YK0 A;  3C64 A; 
#chains in the Genus database with same CATH topology
 5HXH A;  4DO0 A;  2CBI A;  4APF B;  4A97 A;  3CWZ B;  2NTY A;  4H63 H;  3VHL A;  5HWX A;  2CE7 A;  3T1Y T;  1UX5 A;  1CUN A;  2XQ3 A;  3QNU A;  1MNE A;  1KNP A;  4IDQ A;  4UXN B;  3L3P A;  3ZN1 B;  5CJ5 A;  1J5E T;  2V7L A;  2HPJ A;  3AA6 B;  3AE4 A;  3JAF A;  2EHO A;  2D2S A;  2W00 A;  2OA5 A;  4NXM T;  1NEK A;  1KEY A;  2MAW A;  2LSI A;  2XAG B;  1HX1 B;  4O8S A;  4DBQ A;  2MYS A;  4LMK A;  1HG5 A;  4AXP A;  1ZKE A;  2BDE A;  4F52 A;  3RIA A;  3RH3 A;  3N5L A;  3LDQ B;  2YU2 A;  1LDK B;  2V1D B;  4GK5 E;  4HWH A;  5IHY A;  5FNV E;  2LLY A;  2DLR A;  1Z8U A;  2W67 A;  5E0O A;  5FL1 A;  1XZY A;  2ACZ A;  3ONX A;  3EHZ A;  4E7S A;  2DNX A;  2XM1 A;  5FMN A;  2UUA T;  4LML A;  3RHW A;  4X20 E;  4EYY R;  5JDM A;  2D0T A;  2CXF A;  4CN6 A;  3AB3 B;  5AQU B;  5HXC A;  4YT0 A;  2CXD A;  3RI5 A;  2YN6 A;  2BG9 A;  4ILA A;  4GYS A;  1D0Z A;  2LM2 A;  4H9N C;  2VWA A;  1US7 B;  3SFD A;  3AE6 A;  4CN4 A;  4YTM A;  3LK4 2;  1JNR A;  3DJB A;  2YKS A;  3I9Y A;  2IHR 1;  2WDR A;  3N2G E;  3RRW A;  3O1J A;  5EK3 A;  1N33 T;  2XU0 A;  1X79 A;  5LGN B;  4PJM A;  5LOV E;  3PUA A;  2XZE A;  4HFE A;  5AQG B;  4AP2 B;  2D0U A;  5ADX L;  4IE0 A;  4NUV A;  2VUR A;  4C91 A;  2WP9 A;  4UEM A;  4DR6 T;  1N32 T;  4O4H E;  3R6N A;  4GIW A;  2VAS A;  5LHI B;  4OYK A;  2LKH A;  4KUM B;  4PJJ A;  2IC6 A;  5JDN A;  4KX6 A;  2QRX A;  3T8O A;  4DR4 T;  4I55 E;  3WAJ A;  4GKJ T;  3EI0 A;  1FJG T;  3VKG A;  2LOP A;  3CK6 A;  2JMH A;  2W66 A;  3AVS A;  3K3Q C;  3AED A;  3BQL A;  3ZYK A;  3C4Z A;  2JIW A;  4M1P A;  2H89 A;  3PUZ F;  2VKJ A;  1D1C A;  2LKG A;  3FXD B;  1ZOY A;  2DCF A;  2UU9 T;  3N9M A;  4QKN A;  5AQM B;  2X0Y A;  3H3M A;  4CN1 A;  2RA1 A;  5BR8 T;  4MFR A;  2WBL A;  4UV9 B;  2VL8 A;  5L47 A;  3PV0 F;  5CGM A;  1XDP A;  2UXD T;  2UXC T;  1YKE B;  4FJO A;  1D1B A;  4F8H A;  3L8R A;  4TN7 B;  4FI5 A;  2EHO B;  2VKO A;  2F4V T;  2CWO A;  2V5D A;  1HF8 A;  4TWH A;  2XUE A;  2X9X A;  2GK9 A;  2NWB A;  4IHJ E;  2XSB A;  5JRC A;  4PJL A;  1KFY A;  5FXV A;  3N2O A;  1T8B A;  4MBQ A;  3JCF A;  3RPU A;  4DV5 T;  3AAI A;  5CA0 E;  2LT3 A;  2C5J A;  2E5L T;  4WW0 A;  4PFP A;  4EYU A;  2BKN A;  2B1E A;  3QOF A;  3N9P A;  5A1L A;  4ADZ A;  2DL1 A;  5AQP B;  1ZHC A;  2JMK A;  4ISS A;  3PE0 A;  4BAY B;  3OKQ A;  4L0R A;  4JI3 T;  1VOM A;  4PK6 A;  3ZT7 A;  2YDR A;  3ESL A;  4HWC A;  2WMN A;  3AE2 A;  2V26 A;  2X51 A;  2N1G A;  5HEU A;  2BS3 A;  1FMW A;  3EUH A;  4IDO A;  4DND A;  2BG9 B;  5AQT B;  2FBW A;  4HGA A;  2JRK A;  4ANJ A;  4L9I A;  1OED C;  3UUX B;  3N9Q A;  3LJC A;  3RRC A;  2DI4 A;  1N36 T;  2NW8 A;  2ES0 A;  1UUS A;  2BZB A;  4KI0 F;  2H88 A;  4ILU A;  2BS4 A;  3AA7 B;  1D0X A;  4G63 A;  3ZMS B;  2Q9Q A;  3PUQ A;  3ZLI A;  4DR2 T;  2CMR A;  3KBU A;  1HS7 A;  2XQ6 A;  4AQG A;  3JC6 C;  4TNW A;  2X9H A;  5FXZ A;  2X0L B;  5FL0 A;  4QH1 A;  4DUY T;  2SPC A;  3RKG A;  2XAH B;  3CX7 B;  1FIO A;  2CXL A;  4ZI3 C;  4JV5 T;  3ZPO A;  3VRA A;  1E7P A;  2WS3 A;  5J1G A;  3RYC E;  3PUX F;  4IGU A;  4YSZ A;  3P4S A;  3IHR A;  3P50 A;  3VU7 H;  1OED E;  3AEF A;  2XQ9 A;  4HKA A;  3NRY A;  5FVK A;  4HXI B;  2KZ7 B;  3EDU A;  4ZZC A;  1D0Y A;  2L8K A;  2RPA A;  1BR0 A;  2Y6X A;  2X9W A;  3ETV A;  3NBX X;  1ZV4 X;  4BJN A;  2V7M A;  2EHO C;  4Z91 A;  4X62 T;  5H6Q B;  1MMG A;  5FY1 A;  4JGH D;  3EAB A;  4AQF C;  3CX8 B;  3AA0 B;  1SE7 A;  4UIG A;  3UU5 A;  4MAL A;  2KSR A;  4O4J E;  4JI5 T;  5JTG A;  4H9O C;  4EED A;  1ZEE A;  2VB6 A;  1HCI A;  3UUN A;  3LK2 B;  5AQK B;  4JYA T;  2VKH A;  4YTP A;  4H9Q C;  3LBX A;  2W62 A;  3HL6 A;  5HXE A;  2PJQ A;  1M7K A;  3QUJ A;  3CIR A;  2LSJ A;  1LRZ A;  4P0B A;  2B76 A;  5HAX A;  2YU1 A;  4QH4 A;  4DV6 T;  5FY7 A;  4TWD A;  4IL4 A;  4YFS A;  1MIV A;  3I1A A;  5JR9 C;  2KIN B;  3LSV A;  1QSD A;  4TV8 E;  2EHO D;  4IT4 A;  1HG2 A;  2ODV A;  3K8P C;  4NPP A;  2I6H A;  3Q5W A;  2WWV A;  1MIY A;  4IDN A;  4KMC A;  2PTF A;  3KV9 A;  3AE1 A;  5LCY A;  2W0G A;  3RYF E;  3RGL A;  5BMV E;  3E08 A;  3RYH E;  3M3Z B;  2V8S V;  4U74 A;  3PUS A;  3TLS A;  2I0M A;  4XBF B;  3E22 E;  4UVC B;  1XWM A;  2ZM2 A;  4YSY A;  5HXS A;  4X64 T;  5J2U E;  3H37 A;  3VR8 A;  4DID B;  3JAE A;  3QC9 A;  4IRE A;  4JBW F;  3SWH A;  5AQO B;  3AE5 A;  2CEA A;  1OWA A;  4ZS2 A;  5JDL A;  4P1N A;  5J0Z A;  2DWG A;  1IBK T;  3KIN B;  3TLU A;  3P4R A;  4HEA A;  3ZEF B;  4YJ2 E;  3KDS E;  4CXW A;  3PU3 A;  2CCQ A;  5C8Y E;  2N2N A;  3UQ4 A;  3B5M A;  1VCS A;  2Q9Q B;  4JI4 T;  2NTX A;  4HFI A;  1U6G A;  4CQI A;  3PUV F;  3AAE B;  3AEC A;  4GYR A;  2JQQ A;  4K0U A;  2E9X A;  3TKL B;  5F3J A;  3OJA A;  1JNZ A;  3ZMU B;  5FKY A;  2J4G A;  4I50 E;  4BJM A;  2YK0 A;  5DQV A;  3IA3 A;  4HN9 A;  2Y48 B;  2FJA A;  4DV7 T;  3PU8 A;  4X1Y E;  1Z0P A;  3RIU A;  1IAP A;  1T98 A;  4AKH A;  1IZN B;  2K9A A;  2ZM8 A;  2XQY A;  5DJQ C;  5L4H A;  2YIN A;  4LF5 T;  3FZM B;  2ZLY A;  2K5B B;  1LVK A;  1L0V A;  4XAX B;  5AQS B;  2J62 A;  5AQI B;  5L4E A;  3MA9 A;  4IDP A;  3AEA A;  2E2A A;  1KNZ A;  4WYV A;  4V1A v;  4IST A;  5IWA T;  3CQX C;  1Y01 A;  4EZ4 A;  3UT5 E;  1U4Q A;  2KWH A;  3LBX B;  4ERR A;  1SUM B;  3FZL B;  5L3E B;  3BK9 A;  3ZC1 A;  4UF0 A;  4AKI A;  1GQE A;  4P5O A;  4Z90 A;  4LMJ A;  4EAH A;  3I0O A;  3N9N A;  3AEE A;  3RYI E;  3AXJ A;  1I94 T;  3P4Q A;  2LEH A;  1O3X A;  2IDO B;  4OFZ A;  3WAK A;  3SOL A;  1UCU A;  2KND A;  3UTK A;  3A5X A;  2VQF T;  2V7I A;  3HR0 A;  3K3N A;  1G8X A;  3FZH B;  2VVS A;  4G2A A;  3AE9 A;  4H9S E;  3GN5 A;  3NVO A;  2KLQ A;  3RKO A;  4GK0 E;  3NRX A;  2IIU A;  5LNK A;  4U3C A;  3ZN0 B;  2K24 A;  2V7J A;  1MMD A;  2XSA A;  4ZI2 C;  3K3O A;  2RP4 A;  3TLT A;  2Q9Q C;  4EB6 E;  4EEB A;  3IEE A;  2A2F X;  3PUW F;  2V6Y A;  4HWD A;  4K0K T;  4EV6 A;  4HFV A;  2LE8 A;  2VK9 A;  3ZT5 A;  2V7K A;  4J2C A;  5JH7 E;  2YEV C;  3X1D A;  2D5U A;  2W4X A;  3C4X A;  2X68 A;  3SFE A;  5KX5 E;  2BS2 A;  5H6R B;  1IJ5 A;  1M62 A;  4WNK A;  4ZHQ E;  2Z6E A;  3IBP A;  2G0U A;  3C51 A;  2CLY B;  2ZM6 T;  2MOZ A;  1W0B A;  3U78 A;  3V5S A;  3GA8 A;  5IUX A;  1OXZ A;  3AE8 A;  4CI3 B;  2C5K T;  2XHE B;  4YJ3 E;  2DHR A;  4EZH A;  2WWU A;  2WZH A;  3ZCJ A;  2KWI B;  2X0H A;  4ZI2 D;  4HWF A;  3UUB A;  3QB5 K;  4HWI B;  2E9X B;  4ZXL A;  2BVL A;  4ASK A;  4B3M T;  3ZMZ B;  2NW7 A;  4B6X A;  4JI8 T;  5DQW A;  3PJA J;  2IAK A;  3NKZ A;  1FEW A;  5JRE A;  5L2L A;  3CML A;  3RIF A;  1QUU A;  2PG8 A;  3ONL C;  1HNX T;  1UK5 A;  4LF9 T;  2KT9 A;  5ABG A;  3Q5E A;  3AVR A;  3M65 A;  2X66 A;  2P9B A;  5LA6 E;  5JDF A;  1E1H B;  2X9Y A;  4AIS A;  4Q25 A;  5J2T E;  4QXC B;  1J1J A;  2XQ8 A;  3V5U A;  3CPZ A;  4YTN A;  1HX8 A;  4AQY T;  2HPL A;  2JQH A;  1T7S A;  5FXW A;  3ZT6 A;  2HH7 A;  4LF4 T;  3C64 A;  2CM0 A;  3VKH A;  4YHJ A;  2LHR A;  2BKP A;  1BR4 A;  3PJA A;  5HEG A;  5JVD E;  5LYJ E;  2XQ7 A;  3FZF B;  3OYX A;  2LHN A;  4UF0 B;  2FJD A;  4JUY A;  2JQK A;  4X5T A;  3HKB E;  4QX8 B;  4UEL A;  3ONJ A;  1VRB A;  4DR3 T;  3AXJ B;  2NW9 A;  4EIW A;  3EDV A;  1WRD A;  2YDQ A;  2XAQ B;  2C5I T;  3C50 A;  2JPF A;  2WSS V;  1MMA A;  4TZ4 C;  2AE9 A;  2UXN B;  3CKD A;  5HCM A;  3ZMT B;  2YDS A;  5LG4 A;  4P09 A;  4ZOL E;  3GN5 B;  5L3F B;  2I59 A;  3OVU A;  4ZZB A;  1YQ4 A;  3U3I A;  2K3W A;  4DUZ T;  2CLY C;  4WZX A;  2E8I A;  3VRB A;  4QXH B;  5HEJ A;  5AQF B;  3UU6 A;  3GMI A;  3JC6 D;  3T1H T;  4A5X A;  4MLK A;  4JEU B;  3AAA B;  2XAJ B;  5EK2 A;  3BQI A;  4UV8 B;  4ZI3 D;  3K1S A;  2E9X C;  4X65 T;  4MHC A;  3RF1 A;  3SS1 A;  4UR9 A;  1XMQ T;  3DP7 A;  4TNV A;  1S35 A;  4CI2 B;  5F5W A;  1YW0 A;  2VKD A;  3HI2 A;  3ZST A;  3S4U A;  3HKC E;  1MIW A;  5L3C B;  3DPL C;  5AQJ B;  5L3D B;  4H9R C;  4JI7 T;  3NWI A;  4IE6 A;  1LVF A;  3RIU C;  2LM9 A;  4DMV A;  5JRC B;  3CVR A;  3NZP A;  3C98 B;  3MAC A;  4IIJ E;  4A64 A;  5HEH A;  4DV4 T;  4O2A E;  3DTO A;  5C2T A;  2BG9 C;  4U2Y A;  4XZC A;  5KDM C;  2CBJ A;  2JJ9 A;  5JDH A;  4H63 V;  1XDO A;  2FJE A;  3N9L A;  4QX7 B;  3ZC0 A;  4PK4 A;  5LJM A;  3RQW A;  3OTO T;  1U5P A;  1OED A;  1HNZ T;  5IYZ E;  3KBT A;  4QWN B;  3P7I A;  4X1K E;  5JDG A;  3PDY A;  5ABF A;  4LFB T;  2XQA A;  2M6I A;  2WDQ A;  3I0Q A;  3F31 A;  2W61 A;  3EAM A;  5ETW A;  1HFA A;  5AQH B;  4HFD A;  2V6X A;  4WBO A;  4OK0 A;  1W0A A;  1J5W A;  3DQV C;  3PUG A;  2CA5 A;  2QVA A;  1R8I A;  5AFU L;  3B57 A;  2BG9 E;  3HKD E;  4KHP T;  4B3S T;  3KV6 A;  4UVA B;  5AQL B;  4PNI A;  3OBV E;  2UXB T;  4TX5 A;  2XM2 A;  2BVM A;  2VVN A;  1LDJ A;  5M4Y A;  4I43 B;  1WLX A;  2WU2 A;  2M6B A;  3FBL A;  4I0U A;  2A3D A;  5HYA A;  1WFD A;  2WZK A;  3OPC A;  1KK7 A;  5HXR A;  3O9X A;  2LSY A;  1HNW T;  1VCT A;  4PK5 A;  5GON E;  3LK3 B;  4AQF A;  3P4W A;  1XNR T;  3RLF F;  3UUM A;  3Q9D A;  3MXZ A;  2FJB A;  5AQV B;  4HFC A;  4P0A A;  3FZK B;  3WI3 A;  2J47 A;  2W63 A;  1YXR A;  4IE5 A;  3ZJ2 A;  1WYC A;  3PUY F;  4IE7 A;  2WZI A;  3AE7 A;  5AQQ B;  4E7Z A;  4OX9 T;  3ANW A;  2LRK A;  4OYJ A;  3BQK A;  4GKK T;  4QH5 A;  2LSG A;  4JEH B;  4ILB A;  5FY0 A;  5AQN B;  1SA0 E;  1KNR A;  1QLB A;  4HFH A;  2R6G F;  2WY2 A;  2WB5 A;  2QYW A;  3ZYL A;  4O4I E;  2M67 A;  2XTL A;  1W09 A;  4JI2 T;  3NZQ A;  5JR9 A;  5LJN A;  1D1A A;  4B3R T;  1FMV A;  4JI1 T;  4KHZ F;  5LMN T;  1Y64 B;  2WU5 A;  2KMF A;  3CX6 B;  3F2E A;  2H7O A;  4UVB B;  5FP3 A;  1WYB A;  2XY8 B;  1BR1 A;  5JQG E;  4YY3 T;  5KXJ A;  3Q5D A;  2BBH A;  4HTE A;  4AIU A;  4C90 A;  1W9R A;  4U31 A;  4IDZ A;  4CXX A;  3ZJ1 A;  3O1I A;  2L3L A;  3H3A A;  2HHH T;  2H3R A;  3RQU A;  1N34 T;  3RTR A;  2LOS A;  3FHN A;  4IL9 A;  4LF7 T;  4OHF A;  4A56 A;  4YLH A;  5CA1 E;  4O4L E;  2OV9 A;  3ETU A;  3J9X 1;  3N9O A;  1OED B;  2ZMA A;  4CZZ B;  2CHN A;  5EK4 A;  1UGO A;  4PW8 A;  2WMO A;  1YQ3 A;  3TLW A;  1H7C A;  1E2A A;  3KV4 A;  4DV1 T;  5ABF B;  4DBR A;  5L3B B;  3QB5 A;  4JI0 T;  1WR6 A;  2IC9 A;  4CXY A;  1V9D A;  3PTR B;  1IBM T;  1LKX A;  4AKR B;  4U72 A;  4ZEY A;  3O4X E;  3KVA A;  2ODU A;  2OLT A;  4YSX A;  3EVY A;  5ABH A;  4KBM B;  5CB4 E;  1DU2 A;  2MPK A;  2KXP B;  2CWY A;  5LG3 A;  5LB7 B;  3RC8 A;  3RC3 A;  2WDV A;  2PFV A;  3N2K E;  2BKO A;  4TUY E;  3C4W A;  4WBN E;  3ABV A;  2CRB A;  3P4P A;  4NUU A;  5LP6 E;  3KV5 A;  3CQG B;  4O2B E;  4PAG A;  3UU8 A;  2J1D G;  5LXT E;  4X66 T;  1EZ3 A;  3CQC B;  2LRL A;  4YXD A;  3UFG A;  4AKG A;  2NP9 A;  5HCJ A;  1B7T A;  4NIQ A;  2Q9Q D;  3UU3 A;  2NOX A;  3B13 A;  2K48 A;  4ILC A;  3FXE B;  3ZYM A;  1MND A;  2XAS B;  4QHO A;  4TWF A;  2DWK A;  1I6Z A;  3HA4 A;  2IML A;  3ANW B;  4LFC T;  2MTQ A;  3ZSS A;  3R84 B;  3ZMV B;  5FYM A;  1WR0 A;  4JI6 T;  1UUR A;  5LGU B;  3D0T A;  2WAU A;  1WCR A;  2Y8D A;  3UU4 A;  5CFB A;  2YOE A;  1IJ6 A;  1CHU A;  2XPK A;  5JR9 B;  1IBL T;  2WCA A;  4H9P C;  5LMU T;  2N9D A;  3KFW X;  4X1I E;  5JDQ A;  2VQE T;  3L09 A;  3JAD A;  3FBZ A;  2UXX B;  4LFA T;  2PBI A;  4F6R C;  4NXN T;  4EXT A;  3GWH A;  3UFE A;  3SRZ A;  4N78 D;  4KP3 C;  3VR9 A;  3RX6 A;  2XQ4 A;  2A72 A;  4HE8 A;  3AEG A;  2MBG A;  2V5C A;  1ZP0 A;  2XAF B;  3IF8 B;  1HR0 T;  3QK6 A;  4GOU A;  2C0S A;  3TLV A;  1YD8 G;  5AQR B;  2X67 A;  5FXX A;  1X9B A;  4DV2 T;  4EOZ B;  3G06 A;  3F57 A;  1NWM X;  2XJ7 A;  4DR7 T;  2CPT A;  1LDK A;  3HKE E;  2H7V C;  4U33 A;  2VL0 A;  1UX4 A;  4EGW A;  2IUB A;  2D9D A;  3J7Y q;  2IW5 B;  2QA7 A;  3AA1 B;  1HTJ F;  2BBJ A;  4I4T E;  4DV0 T;  2W2U A;  4LF8 T;  5LBQ B;  3A8Y C;  2UUC T;  2CHO A;  3AE3 A;  4COF A;  4N9F 3;  3A7M A;  4IE4 A;  3AEB A;  3W15 B;  5L3G B;  3E0Z A;  4YHH T;  2WM9 A;  2HN1 A;  3P8C D;  3FB2 A;  2V6Y B;  2A9U A;  5LBM A;  3L39 A;  5ABE A;  4ZI7 E;  3Q2M A;  2NR4 A;  4PJN A;  4ZS3 A;  1S94 A;  4DR1 T;  1BR2 A;  5F8P A;  4Z8X A;  3MK7 C;  5KMG P;  3MZK B;  4LF6 T;  4DR5 T;  4DV3 T;  3ZKR A;  4AI6 A;  4QXB B;  4DMW A;  2JQ9 A;  2HN2 A;  1MMN A;  4BA9 A;  5HWY A;  2ACX A;  3KVB A;  3LG7 A;  3O1H A;  4TV9 E;  5LHG B;  1SHZ C;  4A98 A;  2QGS A;  5TAO A;  1XNQ T;  2XQ5 A;  3MJX A;  5FVL A;  5LHH B;  3UQ7 A;  2FUP A;  3MKD A;  4U7I A;  2LJL A;  4CI1 B;  3I9W A;  4B3T T;  4WQO D;  2WQY A;  1NEN A;  5DAB A;  4U2Z A;  5HEO A;  5LGT B;  3Q5X A;  3UUL A;  4L5G A;  3LFM A;  2ZM0 A;  3ZCI A;  2LSK A;  2E5V A;  4AKL A;  1AJ3 A;  2E9X D;  2UUB T;  1XMO T;  3OYZ A;  1YKH B;  3PUR A;  2AXD S;  4HFB A;  4PFO A;  4DVD A;  1T72 A;  5C3J A;  4U7Y A;  5EZY E;  1KF6 A;  2L9Q A;  1NAF A;  4JLE A;  1G73 A; 
#chains in the Genus database with same CATH homology
 4UVB B;  2C5K T;  5FP3 A;  5HXH A;  4DO0 A;  4HKA A;  2XHE B;  1WYB A;  3NRY A;  4YJ3 E;  2DHR A;  4EZH A;  2WWU A;  1BR1 A;  5JQG E;  2KZ7 B;  3EDU A;  3CWZ B;  1D0Y A;  2NTY A;  3ZCJ A;  2KWI B;  4H63 H;  2L8K A;  1BR0 A;  4HTE A;  4C90 A;  3VHL A;  4ZI2 D;  5HWX A;  2CE7 A;  2Y6X A;  1UX5 A;  2X9W A;  1CUN A;  4ASK A;  2E9X B;  2BVL A;  4IDZ A;  3ETV A;  3NBX X;  1ZV4 X;  4BJN A;  3ZMZ B;  2V7M A;  2EHO C;  1MNE A;  2NW7 A;  4B6X A;  5DQW A;  4UXN B;  5H6Q B;  1MMG A;  2IAK A;  4CXX A;  5FY1 A;  3ZJ1 A;  3L3P A;  3O1I A;  2L3L A;  1FEW A;  3H3A A;  3ZN1 B;  4AQF C;  3CX8 B;  3AA0 B;  5JRE A;  2H3R A;  5L2L A;  3CML A;  4UIG A;  2V7L A;  1QUU A;  2HPJ A;  3AA6 B;  4MAL A;  2LOS A;  3FHN A;  2PG8 A;  4O4J E;  2EHO A;  4H9O C;  2D2S A;  2W00 A;  4OHF A;  2OA5 A;  1ZEE A;  2KT9 A;  4A56 A;  4YLH A;  5CA1 E;  3AVR A;  3M65 A;  4O4L E;  2VB6 A;  2LSI A;  2XAG B;  2X66 A;  2P9B A;  1HCI A;  3ETU A;  3UUN A;  3LK2 B;  3J9X 1;  5LA6 E;  5JDF A;  4O8S A;  3N9O A;  2VKH A;  4DBQ A;  1E1H B;  4H9Q C;  2ZMA A;  2MYS A;  2X9Y A;  1HG5 A;  4AXP A;  1ZKE A;  3LBX A;  4CZZ B;  2W62 A;  5EK4 A;  2BDE A;  4PW8 A;  5J2T E;  3HL6 A;  4QXC B;  2WMO A;  5HXE A;  3RH3 A;  2PJQ A;  3QUJ A;  3N5L A;  1H7C A;  3V5U A;  3CPZ A;  2LSJ A;  3KV4 A;  1LRZ A;  4P0B A;  2YU2 A;  5HAX A;  2YU1 A;  4DBR A;  1HX8 A;  5L3B B;  2HPL A;  1WR6 A;  5FY7 A;  2V1D B;  2IC9 A;  4GK5 E;  4CXY A;  5FXW A;  1V9D A;  3PTR B;  5IHY A;  4YFS A;  1LKX A;  1MIV A;  5FNV E;  4AKR B;  2HH7 A;  4U72 A;  3C64 A;  3I1A A;  2CM0 A;  5JR9 C;  3VKH A;  4YHJ A;  2KIN B;  2LHR A;  2DLR A;  1QSD A;  3O4X E;  1BR4 A;  5E0O A;  4TV8 E;  3KVA A;  5JVD E;  2EHO D;  5LYJ E;  3ONX A;  1HG2 A;  2ODV A;  4E7S A;  2ODU A;  3K8P C;  2DNX A;  3OYX A;  2LHN A;  3Q5W A;  1MIY A;  4UF0 B;  5FMN A;  4KMC A;  4JUY A;  3EVY A;  3KV9 A;  4X20 E;  4KBM B;  5LCY A;  2W0G A;  5CB4 E;  3HKB E;  3RYF E;  4QX8 B;  4EYY R;  5JDM A;  2D0T A;  4UEL A;  2CXF A;  5BMV E;  3AB3 B;  5HXC A;  2KXP B;  3E08 A;  1VRB A;  2CXD A;  3RYH E;  2CWY A;  3RC8 A;  3RC3 A;  2PFV A;  3N2K E;  4TUY E;  4U74 A;  4GYS A;  2NW9 A;  3C4W A;  3PUS A;  4WBN E;  4NUU A;  5LP6 E;  1D0Z A;  3KV5 A;  3CQG B;  4XBF B;  4O2B E;  4EIW A;  4PAG A;  3EDV A;  1WRD A;  2J1D G;  4H9N C;  2XAQ B;  2VWA A;  5LXT E;  2C5I T;  1US7 B;  1EZ3 A;  3C50 A;  2JPF A;  3E22 E;  2WSS V;  3CQC B;  4UVC B;  1MMA A;  4TZ4 C;  2ZM2 A;  2UXN B;  3LK4 2;  3CKD A;  3DJB A;  4AKG A;  2NP9 A;  3ZMT B;  1B7T A;  5HXS A;  5LG4 A;  4P09 A;  4ZOL E;  3GN5 B;  2Q9Q D;  3I9Y A;  5L3F B;  2I59 A;  5J2U E;  3N2G E;  3RRW A;  2NOX A;  3B13 A;  3U3I A;  2K48 A;  3H37 A;  3O1J A;  2CLY C;  5EK3 A;  2XU0 A;  3FXE B;  3ZYM A;  1X79 A;  5LGN B;  4PJM A;  1MND A;  5LOV E;  2E8I A;  3QC9 A;  3SWH A;  2XAS B;  3PUA A;  4QHO A;  4QXH B;  2DWK A;  2CEA A;  3HA4 A;  1OWA A;  4ZS2 A;  5JDL A;  3ANW B;  3GMI A;  3JC6 D;  2D0U A;  2MTQ A;  2DWG A;  5ADX L;  3KIN B;  4IE0 A;  4NUV A;  3R84 B;  4HEA A;  4MLK A;  4C91 A;  3ZMV B;  5FYM A;  4JEU B;  3ZEF B;  4YJ2 E;  3AAA B;  2XAJ B;  5EK2 A;  3BQI A;  4UV8 B;  3KDS E;  4CXW A;  4ZI3 D;  2E9X C;  3PU3 A;  4MHC A;  2CCQ A;  4UEM A;  3SS1 A;  2N2N A;  5C8Y E;  5LGU B;  3D0T A;  2WAU A;  2Q9Q B;  2Y8D A;  2NTX A;  4O4H E;  3R6N A;  3DP7 A;  4GIW A;  1S35 A;  4CQI A;  2VAS A;  4CI2 B;  1IJ6 A;  4OYK A;  1YW0 A;  2VKD A;  4KUM B;  4PJJ A;  2IC6 A;  3AAE B;  5JR9 B;  5LHI B;  3HI2 A;  4GYR A;  5JDN A;  2JQQ A;  4H9P C;  3T8O A;  4K0U A;  2E9X A;  2N9D A;  3KFW X;  4X1I E;  3S4U A;  4I55 E;  5JDQ A;  3HKC E;  3TKL B;  3WAJ A;  1MIW A;  5L3C B;  3VKG A;  5F3J A;  3OJA A;  2LOP A;  5L3D B;  4H9R C;  3L09 A;  3ZMU B;  4IE6 A;  1LVF A;  2JMH A;  3FBZ A;  3AVS A;  3K3Q C;  4I50 E;  4BJM A;  3BQL A;  2UXX B;  3ZYK A;  3C4Z A;  2LM9 A;  2PBI A;  4F6R C;  2YK0 A;  4DMV A;  4EXT A;  3GWH A;  4M1P A;  5JRC B;  3UFE A;  3CVR A;  3NZP A;  3C98 B;  3MAC A;  4IIJ E;  2VKJ A;  1D1C A;  3FXD B;  3SRZ A;  2DCF A;  4N78 D;  3DTO A;  4O2A E;  5DQV A;  4HN9 A;  4KP3 C;  2Y48 B;  3RX6 A;  2A72 A;  4HE8 A;  3PU8 A;  4X1Y E;  4XZC A;  2MBG A;  5KDM C;  1Z0P A;  3N9M A;  4QKN A;  1IAP A;  2JJ9 A;  2XAF B;  5JDH A;  3IF8 B;  4H63 V;  1T98 A;  4AKH A;  1IZN B;  2K9A A;  2ZM8 A;  3QK6 A;  4GOU A;  2RA1 A;  2C0S A;  3N9L A;  4QX7 B;  2XQY A;  5DJQ C;  4PK4 A;  3ZC0 A;  4MFR A;  2WBL A;  4UV9 B;  5LJM A;  2VL8 A;  2YIN A;  1U5P A;  1YD8 G;  2X67 A;  5IYZ E;  5FXX A;  2ZLY A;  2K5B B;  3KBT A;  1LVK A;  4EOZ B;  1YKE B;  3F57 A;  4QWN B;  3P7I A;  1NWM X;  4XAX B;  4FJO A;  1D1B A;  4X1K E;  5JDG A;  3PDY A;  3MA9 A;  4TN7 B;  4FI5 A;  3HKE E;  2EHO B;  2VKO A;  2H7V C;  2CWO A;  1HF8 A;  1UX4 A;  3I0Q A;  1KNZ A;  2XUE A;  3F31 A;  2X9X A;  2W61 A;  4V1A v;  2GK9 A;  4IST A;  5ETW A;  3J7Y q;  2NWB A;  2IW5 B;  1HFA A;  2QA7 A;  3AA1 B;  1HTJ F;  4IHJ E;  3CQX C;  4WBO A;  4I4T E;  4EZ4 A;  4OK0 A;  5JRC A;  3UT5 E;  1U4Q A;  3PUG A;  2KWH A;  2CA5 A;  4PJL A;  5FXV A;  5LBQ B;  3LBX B;  3N2O A;  5AFU L;  3B57 A;  4ERR A;  3HKD E;  5L3E B;  3KV6 A;  4MBQ A;  4IE4 A;  4UVA B;  3BK9 A;  3ZC1 A;  4UF0 A;  3W15 B;  4AKI A;  4PNI A;  3RPU A;  5L3G B;  3E0Z A;  4EAH A;  3AAI A;  3I0O A;  3N9N A;  2WM9 A;  2LT3 A;  3OBV E;  5CA0 E;  2C5J A;  3P8C D;  4TX5 A;  3FB2 A;  2BVM A;  4WW0 A;  4PFP A;  4EYU A;  2B1E A;  3RYI E;  5M4Y A;  2LEH A;  3N9P A;  4I43 B;  5LBM A;  5A1L A;  1O3X A;  4ADZ A;  4ZI7 E;  1WLX A;  1ZHC A;  2JMK A;  4ISS A;  3FBL A;  4OFZ A;  3Q2M A;  2A3D A;  3WAK A;  3PE0 A;  3SOL A;  5HYA A;  4BAY B;  4PJN A;  1UCU A;  3OKQ A;  2KND A;  4ZS3 A;  4L0R A;  1S94 A;  3UTK A;  3A5X A;  1KK7 A;  5HXR A;  3O9X A;  2LSY A;  2V7I A;  1BR2 A;  3HR0 A;  5F8P A;  1VOM A;  4PK5 A;  4Z8X A;  4PK6 A;  5GON E;  3MK7 C;  5KMG P;  3LK3 B;  3MZK B;  4AQF A;  3K3N A;  1G8X A;  3ESL A;  4G2A A;  4AI6 A;  2WMN A;  4H9S E;  4QXB B;  4DMW A;  2V26 A;  3UUM A;  3GN5 A;  1MMN A;  2KLQ A;  2X51 A;  2N1G A;  3RKO A;  4GK0 E;  4BA9 A;  3MXZ A;  3NRX A;  3Q9D A;  2ACX A;  1FMW A;  3KVB A;  5HWY A;  3LG7 A;  3EUH A;  3O1H A;  4TV9 E;  4DND A;  5LNK A;  5LHG B;  4P0A A;  3WI3 A;  3ZN0 B;  1SHZ C;  2K24 A;  2V7J A;  4HGA A;  2QGS A;  2W63 A;  2JRK A;  4IE5 A;  5TAO A;  3ZJ2 A;  4ANJ A;  1WYC A;  1MMD A;  3MJX A;  4IE7 A;  4ZI2 C;  3K3O A;  4L9I A;  5LHH B;  2RP4 A;  4E7Z A;  3ANW A;  2Q9Q C;  4EB6 E;  3UUX B;  3MKD A;  3N9Q A;  4OYJ A;  3IEE A;  3LJC A;  2LJL A;  2DI4 A;  2A2F X;  3BQK A;  3RRC A;  2NW8 A;  4CI1 B;  2ES0 A;  2BZB A;  2LSG A;  3I9W A;  4JEH B;  5FY0 A;  1SA0 E;  4HFV A;  5DAB A;  4ILU A;  3AA7 B;  5LGT B;  1D0X A;  3Q5X A;  4G63 A;  2LE8 A;  2VK9 A;  3UUL A;  3ZMS B;  3ZYL A;  4L5G A;  3LFM A;  4O4I E;  2Q9Q A;  2V7K A;  2ZM0 A;  3PUQ A;  4J2C A;  2YEV C;  3ZLI A;  5JH7 E;  2CMR A;  3ZCI A;  2M67 A;  3KBU A;  1HS7 A;  2XTL A;  4AQG A;  2D5U A;  3C4X A;  3JC6 C;  2X68 A;  2X9H A;  2LSK A;  5FXZ A;  4AKL A;  3NZQ A;  1AJ3 A;  2X0L B;  5KX5 E;  5JR9 A;  5LJN A;  1D1A A;  2E9X D;  5H6R B;  2SPC A;  2XAH B;  3CX7 B;  1FIO A;  2CXL A;  1FMV A;  4ZI3 C;  1IJ5 A;  3OYZ A;  4WNK A;  4ZHQ E;  1YKH B;  1Y64 B;  3PUR A;  3ZPO A;  2Z6E A;  3IBP A;  4PFO A;  4DVD A;  2G0U A;  3C51 A;  5EZY E;  2CLY B;  2KMF A;  2L9Q A;  2MOZ A;  5J1G A;  3CX6 B;  3RYC E;  1NAF A;  3F2E A;  4JLE A;  2H7O A;  3U78 A;  4IGU A;  3V5S A;  3GA8 A;  3IHR A;  3VU7 H;  1G73 A;  1OXZ A;  4CI3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...