4NUVA

Heterotetramer structure of region ii from plasmodium vivax duffy binding protein (pvdbp) bound to the ectodomain of the duffy antigen receptor for chemokines (darc)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
298
structure length
288
Chain Sequence
NTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVFHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Red Blood Cell Invasion by Plasmodium vivax: Structural Basis for DBP Engagement of DARC.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Membrane protein, cell invasion
molecule keywords Duffy receptor
total genus 113
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4nuvA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4nuvA01
2YK0A 3C64A 3CPZA 4YFSA 2WAUA 5F3JA 3BQKA 4NUVA 3BQIA 2XU0A 2Y8DA 3RRCA 3BQLA 3CMLA 4NUUA
chains in the Genus database with same CATH superfamily
4K0UA 4AKRB 3MKDA 4A5XA 2A72A 1W09A 4GIWA 1IJ5A 4Q25A 2EHOB 3X1DA 2YU1A 2WZHA 3ANWA 5C2TA 5IWAT 1IBMT 3CVRA 3ZCIA 5LJMA 3FZMB 3J7Yq 4N78D 4K0KT 2WDRA 5HEOA 5JDQA 5LHIB 2JQQA 4IL4A 4HWCA 1HNWT 5AQVB 1H7CA 4GKKT 4JYAT 3K3OA 3SWHA 1SHZC 2J62A 5L3CB 5EZYE 2M6IA 3UU3A 3SFDA 2FJDA 4YSXA 2E2AA 2DHRA 4U2YA 3BK9A 3GN5A 4CI2B 5AQOB 4CXWA 4JGHD 3LBXA 3LK42 3I0QA 4HKAA 1D1BA 2UXNB 5AFUL 4JI0T 1D1CA 2H88A 4IHJE 4IGUA 2X0YA 4ZHQE 2XQ3A 1E2AA 4TX5A 4EEDA 4JI5T 2V6YA 2VQFT 4YTMA 4U74A 1M62A 5CA0E 4O2BE 5JTGA 5LMNT 3RRWA 1YW0A 1B7TA 2K24A 2L3LA 3GA8A 3IBPA 3P4RA 5FXZA 3VRBA 1ZOYA 1LRZA 2DWGA 1KK7A 1YQ3A 2XASB 3PUZF 4HFBA 4I43B 2LOPA 2LSKA 2NW8A 2BG9B 4TV8E 3V5UA 3AE5A 5KDMC 1EZ3A 4EEBA 3AEBA 2A3DA 4YXDA 2Z6EA 5A1LA 1N33T 1IAPA 3CMLA 2LRLA 3FHNA 4I0UA 5GONE 4JI2T 4F8HA 2FJBA 1UX5A 4BAYB 5L47A 4DV1T 1XMOT 4KHPT 2H89A 2XQ5A 3JC6C 4LF6T 2BVMA 3ZC0A 3I1AA 5C8YE 3NVOA 1HG5A 2R6GF 3ANWB 5C3JA 1N36T 3L39A 1S94A 4HFVA 4U7IA 4DR1T 3JCFA 3VHLA 2Q9QB 1MIVA 1CHUA 3TLWA 5AQPB 4CN1A 4I4TE 3AE1A 3LSVA 5H6RB 3RKGA 2LHNA 2NOXA 2NWBA 3CQXC 4H9OC 4P0BA 3RIAA 1DU2A 3UFGA 3M65A 3LK3B 5E0OA 4DMVA 4YHJA 1X79A 5IHYA 5JVDE 4ILUA 5LB7B 4U72A 2NW7A 2X9XA 4O8SA 2KSRA 4ADZA 3JADA 3N2OA 3C64A 4DO0A 3R6NA 3C4WA 4ZI2D 4DMWA 5JR9A 2LKHA 4HTEA 1WYCA 3FZHB 3ZYLA 1KNZA 3NRXA 3P50A 2SPCA 3Q5DA 3OVUA 2JQ9A 3FZLB 4P09A 2WU5A 3ABVA 3P4QA 5LBQB 4DV0T 3ZMSB 1XWMA 5LMUT 2IUBA 4IE7A 3RF1A 1FMWA 1HNXT 2X68A 1WLXA 4GYRA 4ZI3D 2WCAA 3EHZA 4PFPA 3RRCA 3HI2A 5JR9C 3E22E 3KINB 3DP7A 1QLBA 4QX7B 5F5WA 2V7IA 1IBLT 4LF9T 2VKOA 2XPKA 3C51A 1OEDC 3K8PC 4IL9A 1VCTA 2CCQA 5L2LA 5HAXA 2D0UA 3LK2B 3M3ZB 2E9XA 4DNDA 4DV2T 4AP2B 2C5IT 4PJMA 1L0VA 4CN4A 5ABFB 4O4JE 2K5BB 1IBKT 5JRCB 4E7SA 1UK5A 3P4PA 3IHRA 1UUSA 3N9PA 2EHOA 2CEAA 5L3DB 5LNKA 2UXCT 2XQ8A 1X9BA 2BBHA 2XAQB 4IDNA 1SA0E 2OA5A 2PBIA 3UU6A 2X51A 2LRKA 3PJAJ 2VL0A 5L3BB 4QXHB 3EDVA 4B3MT 5HCMA 2L9QA 3QC9A 1IZNB 3ETVA 3RHWA 3UULA 3E0ZA 3PUXF 5AQMB 1YQ4A 4AKLA 2E5VA 4WBNE 5CFBA 2DNXA 3GMIA 3EAMA 4C90A 1XNRT 3P8CD 3ZPOA 4KBMB 1FMVA 3QUJA 1ZP0A 2YEVC 3EVYA 4PK5A 1HF8A 4O4IE 4JI3T 1YKEB 4BJMA 3FBZA 3ZLIA 3U3IA 2J4GA 5J2TE 3HKDE 2QYWA 3AAIA 2W61A 3RC3A 4EIWA 2XY8B 4QKNA 3ZT5A 4EV6A 2ZLYA 5JDLA 4NXNT 1MNEA 5JDMA 2DL1A 2XHEB 3DTOA 2V7KA 3A7MA 5LG3A 2BS3A 3MA9A 4UVAB 3TKLB 2H7VC 2RA1A 4MFRA 3UUXB 3V5SA 3IF8B 3H3MA 3ZN1B 4HWFA 2UUBT 2V7JA 4KMCA 3AB3B 1LKXA 4LMKA 4UV8B 5CGMA 4OX9T 1Z0PA 3CQGB 4OYJA 4LFAT 4LF4T 2CXFA 4UEMA 2WMOA 4JEHB 2XTLA 1MMGA 2CLYC 2V1DB 2CXLA 2B76A 2F4VT 2V6XA 5FYMA 5L3EB 2W4XA 3LFMA 3D0TA 3LBXB 1WFDA 3NZPA 5FY1A 4HFDA 3RQUA 3NRYA 1KF6A 2CMRA 2CBIA 4TNWA 5FL0A 4H9RC 5CB4E 1ZHCA 4ILBA 3RPUA 2V26A 4NIQA 2NP9A 4JLEA 3Q5EA 4UELA 3AE6A 3RIUC 2EHOC 4C91A 5ABFA 4WNKA 3UTKA 4U31A 2NR4A 5JDFA 3B5MA 3N2GE 3O1JA 1N32T 3KDSE 3KVAA 3ZMUB 1HTJF 4U2ZA 1WRDA 4YY3T 4IE4A 5LHGB 3CX6B 3UU4A 5LA6E 3CQCB 3C4XA 5LGTB 4XZCA 5JDGA 2G0UA 2NTYA 1LDKA 3KVBA 4H9SE 4YJ3E 2D9DA 3OYXA 4H9NC 4X1YE 3KFWX 3NBXX 3P4WA 2WBLA 4IDPA 5HWYA 2IMLA 2X66A 1J5ET 3UU5A 3PV0F 2WMNA 3AEGA 3PUVF 3LDQB 4GK0E 1HG2A 2BZBA 4KP3C 4PW8A 3UUNA 3AE3A 3NWIA 1XNQT 3HKEE 3NKZA 5DQWA 2XQAA 4IT4A 3RYCE 5ABGA 2E9XC 4A97A 2C5JA 2L8KA 2KMFA 2VURA 4PJLA 4TWDA 3PURA 4WZXA 5L4EA 3AE8A 3K3NA 5HEHA 2WU2A 5AQLB 4EYYR 4WYVA 2B1EA 2X0LB 5LYJE 2YDQA 1HFAA 2KZ7B 4OK0A 1YD8G 2JQKA 2N1GA 3OPCA 2IIUA 4JBWF 3RQWA 4FI5A 5HYAA 3VKGA 3HKCE 3DPLC 4A64A 3N9MA 2JJ9A 2JMHA 2VVNA 5KXJA 3MJXA 2XQ4A 3AE4A 5CJ5A 2HPLA 4J2CA 5HEUA 1HX8A 2YDSA 3BQKA 4U3CA 3RI5A 3O1IA 4AQFC 3PUGA 2LSJA 2YU2A 3N2KE 2LSGA 2Q9QD 4X20E 5DABA 3AA1B 2LLYA 4YTPA 3ZT6A 1N34T 4EOZB 2W67A 4GOUA 3MZKB 4MALA 5FL1A 5JREA 4GKJT 2ZMAA 2N2NA 4X66T 4IDQA 4KHZF 2XM1A 2JMKA 2M67A 2CA5A 2PTFA 3DJBA 3HA4A 3WI3A 5KX5E 1OEDA 4JI1T 4JI4T 2LJLA 3L09A 4AKIA 4L0RA 2BS4A 1I94T 3DQVC 2V6YB 2XZEA 1XMQT 5FY0A 4AKHA 2V7MA 5LCYA 3ZCJA 4NXMT 4IDOA 3KV9A 4P1NA 3WAJA 1WR6A 1KEYA 2HN1A 3FBLA 3SS1A 1AJ3A 4P0AA 4JI7T 3FXEB 4JV5T 3VR8A 4HWIB 3H3AA 2WP9A 4X1KE 3AEEA 1M7KA 1T8BA 2ODUA 4Z91A 3AA6B 3T8OA 4F6RC 4TN7B 5AQSB 5LGUB 3ZKRA 1XDOA 3FB2A 4YFSA 2W00A 5ABHA 4ILAA 4HFCA 4ILCA 1KFYA 3E08A 4M1PA 4MBQA 3B13A 4COFA 5CA1E 1SUMB 2BG9C 2LHRA 1FJGT 2HPJA 1YXRA 1UURA 2D2SA 4OHFA 2J47A 4DIDB 1BR0A 2X9WA 3PU8A 4APFB 2KINB 3ETUA 3JAFA 3RIUA 2JIWA 3N9LA 5HXEA 4B3TT 3LJCA 5TAOA 2MPKA 3CX8B 3QNUA 3AA0B 3L3PA 1MIYA 3PUSA 2X0HA 4YTNA 1Z8UA 4L5GA 4HGAA 1IJ6A 3CKDA 2DLRA 2OLTA 4BA9A 4BJNA 2BKOA 3Q2MA 5L3GB 4KX6A 3FXDB 4CXXA 3ZT7A 3OBVE 4HFEA 5FP3A 4NUUA 3AXJA 5LJNA 2LEHA 3KV4A 2W66A 3ONLC 4H9PC 4IE6A 4UVBB 2CHNA 3ONJA 5AQQB 4Z90A 5JRCA 1O3XA 4DR3T 3Q5WA 3C50A 2LOSA 2M6BA 3G06A 1E7PA 3JC6D 4TWHA 5AQHB 5AQJB 3ZN0B 5EK4A 5J0ZA 5LOVE 4CZZB 1ZEEA 4EB6E 4DV4T 1J1JA 2C0SA 3A8YC 4DV5T 5AQIB 2WZKA 2BKNA 2EHOD 2N9DA 5EK2A 4UR9A 4X62T 5J1GA 5AQNB 3J9X1 2FUPA 3R84B 1SE7A 2E5LT 2KLQA 2YINA 4O4HE 4PNIA 2CBJA 2WWUA 3UT5E 1D0XA 2JRKA 2GK9A 2NTXA 3L8RA 4MLKA 2C5KT 3F31A 5HXSA 3N9NA 1QUUA 2W62A 2YDRA 3K1SA 2WM9A 2IAKA 2YK0A 2RPAA 1WR0A 1S35A 5AQKB 4X65T 2W2UA 4A98A 3T1HT 1T7SA 1MMNA 3AAEB 4YSYA 2MYSA 1HS7A 3RX6A 2HN2A 4AQYT 3RGLA 3UU8A 2VKJA 3EDUA 4ZOLE 4DR2T 5EK3A 3TLTA 2VQET 1BR4A 1G73A 1VCSA 3MK7C 3OKQA 4HN9A 4UVCB 2HHHT 3FZFB 4ZS3A 5FVLA 4IIJE 5LG4A 2XSAA 3VRAA 3OTOT 1FIOA 3IA3A 3B57A 4JI6T 2BKPA 2HH7A 5HCJA 4B3RT 4QH5A 4QX8B 2XAFB 3PUAA 1UGOA 4I50E 3PDYA 4MHCA 5LBMA 2YOEA 4YHHT 4DR5T 1LDKB 4KI0F 1QSDA 2W63A 3AE9A 3W15B 4X64T 4LF5T 4LF8T 3TLUA 2ACZA 2WAUA 1D1AA 3KV5A 4LMLA 4DR4T 3ZJ2A 4OYKA 2VB6A 3ZMVB 3ZYKA 2XU0A 3UUBA 3QOFA 4GYSA 4AI6A 2XQ6A 5AQFB 3K3QC 4H63V 1LVKA 3AXJB 4QWNB 3UFEA 4H9QC 5AQTB 2UXBT 1D0YA 3RH3A 4E7ZA 3QK6A 4ERRA 4WW0A 2MAWA 3TLVA 1V9DA 2PFVA 3AVRA 2P9BA 2DWKA 4P5OA 4CXYA 2BG9A 4LF7T 2I6HA 2QGSA 2BVLA 2MBGA 2LT3A 3ZC1A 1WCRA 2VWAA 2X9HA 1GQEA 5HXHA 4DV7T 4B3ST 2H3RA 1BR1A 2KXPB 2LKGA 4HE8A 3TLSA 5F8PA 3AE7A 4EXTA 2ES0A 4QXCB 4PK4A 2OV9A 4X1IE 3T1YT 2BG9E 4ZEYA 3AECA 3CX7B 2K48A 3BQLA 5FY7A 5J2UE 2FBWA 1T98A 2H7OA 3N9OA 4G2AA 3U78A 4EGWA 5JDHA 2AE9A 5HXCA 2VK9A 1XZYA 3MXZA 5FNVE 5FKYA 3LG7A 4ZI3C 1T72A 1U4QA 2CLYB 1ZKEA 2DI4A 2J1DG 4PJNA 2D0TA 3PTRB 5LGNB 2DCFA 1OWAA 3HKBE 2VL8A 2KWHA 2UUCT 4DV3T 3SRZA 2Y6XA 3O1HA 4FJOA 2K9AA 4HFIA 4LMJA 3PUQA 4DUZT 3RC8A 3GWHA 2UUAT 4JI8T 4ZI2C 3EABA 3OYZA 1W0BA 4GK5E 3ZSTA 2A9UA 3PU3A 2CHOA 4L9IA 2ZM2A 4YJ2E 5HEJA 2RP4A 2VKDA 1WYBA 4TV9E 5DJQC 3PUYF 5H6QB 2IC9A 5FXWA 1VOMA 2ZM0A 1HCIA 1U5PA 2LSIA 3Q9DA 2CM0A 4PFOA 2XAHB 5HWXA 5JDNA 1U6GA 3NZQA 1VRBA 4Z8XA 2IHR1 3C4ZA 3I0OA 4UF0B 3RYIE 4LFCT 5ADXL 2Q9QA 1OEDB 2VASA 2Y8DA 2V8SV 2CPTA 2VVSA 2QA7A 2XM2A 3N5LA 3O4XE 4HEAA 4UIGA 3I9YA 3A5XA 4JEUB 5FXXA 4ZI7E 3CPZA 5LXTE 2MOZA 2FJAA 1LVFA 4IE5A 4ZXLA 4PJJA 4KUMB 3RKOA 2XAGB 5ABEA 2AXDS 2E8IA 1KNPA 3SOLA 4EZ4A 3QB5A 2X67A 2WSSV 2ODVA 5KMGP 5HXRA 2WZIA 5JH7E 2JQHA 4O2AE 5AQRB 5JQGE 5BMVE 3HR0A 5BR8T 2UXDT 4XBFB 4PK6A 1NWMX 3P7IA 3UUMA 3AEAA 4I55E 4HXIB 4NUVA 2BDEA 3HL6A 1W9RA 3C98B 2ZM8A 1LDJA 2Y48B 4EYUA 2WY2A 3O9XA 2V7LA 4LFBT 1JNRA 4ASKA 3RLFF 4CI1B 1MNDA 4F52A 2I59A 2XUEA 4V1Av 1UX4A 4TZ4C 2WWVA 5JR9B 1HNZT 1I6ZA 2W0GA 4QH1A 1MIWA 2WDQA 4UXNB 4DVDA 4X5TA 1YKHB 5FMNA 4TNVA 3P4SA 2CWYA 1Y64B 2XAJB 3CWZB 3JAEA 5ETWA 5IUXA 3FZKB 3AEFA 5AQUB 3F57A 5L4HA 3KBUA 4EZHA 2FJEA 1ZV4X 2IC6A 2V5DA 3ZSSA 4JUYA 3VR9A 3RTRA 4WBOA 3UQ4A 2XSBA 4AQGA 3ONXA 3N9QA 3RIFA 2CXDA 5LP6E 2PG8A 4G63A 2UU9T 2ACXA 1MMAA 2KT9A 3ZMZB 4U33A 2WDVA 3KBTA 1OXZA 3MACA 4AIUA 3ZEFB 4ZZCA 2UXXB 3UQ7A 3RYFE 4YSZA 2Q9QC 2BBJA 5IYZE 2K3WA 4QH4A 4IREA 4AISA 3QB5K 3AA7B 2LE8A 4XAXB 1KNRA 1NEKA 2VKHA 3ZMTB 2IW5B 3F2EA 3I9WA 2CWOA 3BQIA 4HWHA 5HEGA 2LSYA 4AQFA 1HR0T 1G8XA 4U7YA 1FEWA 1J5WA 4CI3B 1US7B 4TWFA 2BS2A 5M4YA 4YT0A 2A2FX 2X9YA 3CK6A 3GN5B 3AVSA 3OJAA 4IDZA 2ZM6T 2E9XD 4N9F3 3WAKA 4O4LE 4CQIA 2LM9A 4HWDA 3Q5XA 4IE0A 1NAFA 3AAAB 4NPPA 5F3JA 4DBRA 3ZJ1A 2XJ7A 4QHOA 1NENA 2E9XB 4ZS2A 5FVKA 1OEDE 1BR2A 4DV6T 2XQYA 3S4UA 1HX1B 3PJAA 1R8IA 2V5CA 3H37A 3KV6A 4ISTA 3PUWF 3AEDA 4ISSA 3SFEA 4ANJA 5DQVA 4B6XA 4HFHA 2XQ7A 2WB5A 4QXBB 2KWIB 2PJQA 1D0ZA 4ZZBA 2I0MA 1Y01A 2IDOB 2XQ9A 1UCUA 3ESLA 3RYHE 4DR6T 5L3FB 2WQYA 2CRBA 3EUHA 4EAHA 2QVAA 3IEEA 4TUYE 4OFZA 3VU7H 5LHHB 2YKSA 3PE0A 1E1HB 4A56A 2KNDA 2LM2A 2QRXA 4PAGA 4UV9B 3ZYMA 1CUNA 2JPFA 5FXVA 2CE7A 4H63H 4DR7T 1W0AA 2D5UA 5AQGB 3EI0A 2NW9A 4UF0A 2WS3A 4AKGA 3VKHA 1XDPA 3AE2A 1JNZA 2YN6A 4DBQA 4AXPA 4WQOD 4CN6A 4DUYT 4YLHA 2MTQA 3CIRA 1MMDA
chains in the Genus database with same CATH topology
4K0UA 3MKDA 2A72A 4GIWA 1IJ5A 2EHOB 2YU1A 3ANWA 3CVRA 3ZCIA 5LJMA 3J7Yq 4N78D 5JDQA 5LHIB 2JQQA 1H7CA 3K3OA 3SWHA 1SHZC 5L3CB 5EZYE 4CXWA 2DHRA 4CI2B 3BK9A 3GN5A 3LBXA 3LK42 3I0QA 4HKAA 1D1BA 2UXNB 5AFUL 1D1CA 4IHJE 4IGUA 4ZHQE 4TX5A 4U74A 5CA0E 4O2BE 3RRWA 1YW0A 1B7TA 2K24A 2L3LA 3GA8A 3IBPA 5FXZA 1LRZA 2DWGA 1KK7A 2XASB 4I43B 2LOPA 2LSKA 2NW8A 3V5UA 4TV8E 5KDMC 1EZ3A 2A3DA 2Z6EA 5A1LA 1IAPA 3CMLA 3FHNA 5GONE 4BAYB 1UX5A 3JC6C 2BVMA 3I1AA 5C8YE 1HG5A 3ANWB 1S94A 4HFVA 3VHLA 2Q9QB 1MIVA 5JDHA 4I4TE 5H6RB 2LHNA 3CQXC 2NOXA 2NWBA 4H9OC 4P0BA 3M65A 3LK3B 5E0OA 4DMVA 4YHJA 1X79A 5IHYA 5JVDE 4ILUA 4U72A 2NW7A 2X9XA 4O8SA 4ADZA 4ZI2D 3N2OA 3C64A 4DO0A 3R6NA 3C4WA 1KNZA 5JR9A 4HTEA 1WYCA 3ZYLA 3NRXA 2SPCA 4P09A 5LBQB 3ZMSB 4IE7A 1FMWA 2X68A 1WLXA 4GYRA 4ZI3D 4PFPA 3RRCA 3HI2A 5JR9C 3E22E 3KINB 3DP7A 4QX7B 2V7IA 2VKOA 3C51A 3K8PC 2CCQA 5L2LA 5HAXA 2D0UA 3LK2B 2E9XA 4DNDA 2C5IT 4PJMA 4O4JE 2K5BB 5JRCB 4E7SA 3IHRA 3N9PA 5L3DB 2EHOA 2CEAA 5LNKA 2XAQB 1SA0E 2OA5A 2PBIA 2X51A 5L3BB 4QXHB 3EDVA 2L9QA 3QC9A 1IZNB 3ETVA 3UULA 4DMWA 3E0ZA 4AKLA 4WBNE 2DNXA 3GMIA 4C90A 3P8CD 3ZPOA 4KBMB 1FMVA 3QUJA 2YEVC 3EVYA 4PK5A 1HF8A 4O4IE 1YKEB 4BJMA 3FBZA 3ZLIA 3U3IA 5J2TE 3HKDE 3AAIA 2W61A 3RC3A 4EIWA 4QKNA 5JDLA 2XU0A 2ZLYA 1MNEA 5JDMA 2XHEB 3DTOA 2V7KA 3MA9A 3TKLB 4UVAB 3UUXB 2H7VC 2RA1A 4MFRA 3V5SA 3ZN1B 3IF8B 5EK2A 2V7JA 4KMCA 3AB3B 1LKXA 4UV8B 1Z0PA 3CQGB 4OYJA 2CXFA 4UEMA 2WMOA 4JEHB 2XTLA 1MMGA 2CLYC 2CXLA 2V1DB 5L3EB 5FYMA 3LFMA 3D0TA 3LBXB 3NZPA 5FY1A 3NRYA 5CB4E 2CMRA 4H9RC 3ZC0A 1ZHCA 3RPUA 2V26A 2NP9A 4JLEA 4UELA 4C91A 2EHOC 4WNKA 3UTKA 5JDFA 3N2GE 3O1JA 3KDSE 3KVAA 3ZMUB 1HTJF 1WRDA 4IE4A 5LHGB 3CX6B 5LA6E 3CQCB 3C4XA 5LGTB 4XZCA 5JDGA 2G0UA 2NTYA 3KVBA 4H9SE 4YJ3E 3OYXA 4H9NC 4X1YE 3KFWX 3NBXX 5HWYA 2WBLA 2X66A 2WMNA 4GK0E 4KP3C 4PW8A 1HG2A 2BZBA 3UUNA 3HKEE 5DQWA 3RYCE 2E9XC 2C5JA 2L8KA 2KMFA 4PJLA 3PURA 3K3NA 4EYYR 2B1EA 2X0LB 5LYJE 1HFAA 2KZ7B 4OK0A 1YD8G 2N1GA 5HYAA 3VKGA 4FI5A 3HKCE 3N9MA 2JJ9A 2JMHA 3MJXA 2HPLA 4J2CA 1HX8A 3BQKA 4AQFC 3O1IA 1HS7A 3PUGA 2LSJA 2YU2A 3N2KE 2LSGA 2Q9QD 4X20E 5DABA 3AA1B 4EOZB 4GOUA 3MZKB 4MALA 5JREA 2ZMAA 2N2NA 2JMKA 2M67A 2CA5A 3HA4A 3DJBA 3WI3A 5KX5E 2LJLA 3L09A 4AKIA 4L0RA 5FY0A 4AKHA 2V7MA 5LCYA 3ZCJA 3KV9A 3WAJA 1WR6A 3FBLA 3SS1A 1AJ3A 4P0AA 3FXEB 3H3AA 4X1KE 2ODUA 5LGUB 3AA6B 3T8OA 4F6RC 4TN7B 3FB2A 4YFSA 2W00A 3E08A 4M1PA 4MBQA 3B13A 5CA1E 2LHRA 2HPJA 2D2SA 4OHFA 1BR0A 2X9WA 3PU8A 2KINB 3ETUA 3N9LA 5HXEA 3LJCA 5TAOA 3CX8B 3AA0B 3L3PA 1MIYA 3PUSA 4L5GA 4HGAA 1IJ6A 3CKDA 2DLRA 4BJNA 4BA9A 3Q2MA 5L3GB 3FXDB 4CXXA 3OBVE 5FP3A 4NUUA 5LJNA 2LEHA 3KV4A 4H9PC 4IE6A 4UVBB 5JRCA 1O3XA 3Q5WA 3C50A 2LOSA 3JC6D 3ZN0B 5EK4A 5LOVE 4CZZB 1ZEEA 4EB6E 2C0SA 2EHOD 2N9DA 5J1GA 3J9X1 3R84B 2KLQA 2YINA 4O4HE 4PNIA 2WWUA 3UT5E 1D0XA 2JRKA 2GK9A 2NTXA 4MLKA 3F31A 2C5KT 5HXSA 3N9NA 1QUUA 2W62A 2WM9A 2IAKA 2YK0A 1S35A 1MMNA 3AAEB 2MYSA 3RX6A 2VKJA 3EDUA 4ZOLE 5EK3A 1BR4A 1G73A 3OKQA 3MK7C 4UVCB 4HN9A 4ZS3A 5LG4A 4IIJE 1FIOA 3B57A 2HH7A 4QX8B 2XAFB 3PUAA 4I50E 3PDYA 4MHCA 5LBMA 1QSDA 2W63A 3W15B 2WAUA 3KV5A 1D1AA 3ZJ2A 4OYKA 2VB6A 3ZMVB 3ZYKA 4GYSA 3K3QC 4H63V 1LVKA 4QWNB 3UFEA 4H9QC 1D0YA 3RH3A 3QK6A 4ERRA 4WW0A 1V9DA 2PFVA 3AVRA 2P9BA 2DWKA 4CXYA 2QGSA 2BVLA 2MBGA 2LT3A 3ZC1A 2VWAA 2X9HA 5HXHA 4AI6A 2H3RA 1BR1A 2KXPB 4HE8A 5F8PA 4EXTA 2ES0A 4QXCB 4PK4A 4X1IE 5FY7A 3CX7B 2K48A 3BQLA 5J2UE 1T98A 2H7OA 3N9OA 4G2AA 3U78A 5HXCA 2VK9A 3MXZA 5FNVE 3LG7A 4ZI3C 1U4QA 2CLYB 4PJNA 1ZKEA 2DI4A 2J1DG 5LGNB 2D0TA 3PTRB 2DCFA 1OWAA 3HKBE 2VL8A 2KWHA 3SRZA 2Y6XA 3O1HA 4FJOA 2K9AA 3PUQA 3RC8A 3GWHA 4ZI2C 3OYZA 4GK5E 3PU3A 4YJ2E 4L9IA 2ZM2A 2RP4A 2VKDA 1WYBA 4TV9E 5DJQC 5H6QB 2IC9A 5FXWA 1VOMA 2ZM0A 1HCIA 1U5PA 2LSIA 3Q9DA 2CM0A 4PFOA 2XAHB 5HWXA 5JDNA 3NZQA 1VRBA 4Z8XA 3C4ZA 3I0OA 4UF0B 3RYIE 5ADXL 2Q9QA 2Y8DA 2VASA 2QA7A 3O4XE 3N5LA 4HEAA 4UIGA 5FXXA 3I9YA 3A5XA 4JEUB 4ZI7E 3CPZA 5LXTE 2MOZA 1LVFA 4IE5A 4PJJA 4KUMB 3RKOA 2XAGB 2E8IA 3SOLA 4EZ4A 2X67A 2WSSV 2ODVA 5KMGP 5HXRA 5JH7E 4O2AE 5JQGE 5BMVE 3HR0A 4XBFB 4PK6A 1NWMX 3P7IA 3UUMA 4I55E 4NUVA 2BDEA 3HL6A 3C98B 2ZM8A 2Y48B 4EYUA 3O9XA 2V7LA 4ASKA 4CI1B 1MNDA 2I59A 2XUEA 4V1Av 1UX4A 4TZ4C 5JR9B 2W0GA 1MIWA 4UXNB 4DVDA 5FMNA 1YKHB 2CWYA 1Y64B 2XAJB 3CWZB 5ETWA 4EZHA 3F57A 4E7ZA 3KBUA 2IC6A 1ZV4X 4JUYA 4WBOA 4AQGA 3ONXA 3N9QA 2CXDA 5LP6E 2PG8A 4G63A 2ACXA 1MMAA 2KT9A 3ZMZB 3KBTA 1OXZA 3MACA 3ZEFB 2UXXB 3RYFE 2Q9QC 5IYZE 3AA7B 2LE8A 4XAXB 2VKHA 3ZMTB 2IW5B 3F2EA 3I9WA 2CWOA 3BQIA 4AQFA 2LSYA 1G8XA 1FEWA 4CI3B 1US7B 5M4YA 3GN5B 2A2FX 2X9YA 3AVSA 3OJAA 4IDZA 2E9XD 3WAKA 4O4LE 4CQIA 2LM9A 3Q5XA 4IE0A 1NAFA 3AAAB 5F3JA 4DBRA 3ZJ1A 4QHOA 4ZS2A 2E9XB 1BR2A 2XQYA 3S4UA 3KV6A 3H37A 4ISSA 4ANJA 4ISTA 5DQVA 4B6XA 4QXBB 2KWIB 1D0ZA 2PJQA 3ESLA 1UCUA 3RYHE 5L3FB 3EUHA 4EAHA 3IEEA 4TUYE 4OFZA 3VU7H 5LHHB 3PE0A 1E1HB 4A56A 2KNDA 4UV9B 4PAGA 3ZYMA 4AKRB 1CUNA 2JPFA 5FXVA 2CE7A 4H63H 2D5UA 2NW9A 4UF0A 4AKGA 3VKHA 4DBQA 4AXPA 4YLHA 2MTQA 1MMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YK0 A;  3C64 A;  3CPZ A;  4YFS A;  2WAU A;  5F3J A;  3BQK A;  4NUV A;  3BQI A;  2XU0 A;  2Y8D A;  3RRC A;  3BQL A;  3CML A;  4NUU A; 
#chains in the Genus database with same CATH topology
 4K0U A;  4AKR B;  3MKD A;  4A5X A;  2A72 A;  1W09 A;  4GIW A;  1IJ5 A;  4Q25 A;  2EHO B;  3X1D A;  2YU1 A;  2WZH A;  3ANW A;  5C2T A;  5IWA T;  1IBM T;  3CVR A;  3ZCI A;  5LJM A;  3FZM B;  3J7Y q;  4N78 D;  4K0K T;  2WDR A;  5HEO A;  5JDQ A;  5LHI B;  2JQQ A;  4IL4 A;  4HWC A;  1HNW T;  5AQV B;  1H7C A;  4GKK T;  4JYA T;  3K3O A;  3SWH A;  1SHZ C;  2J62 A;  5L3C B;  5EZY E;  2M6I A;  3UU3 A;  3SFD A;  2FJD A;  4YSX A;  2E2A A;  2DHR A;  4U2Y A;  3BK9 A;  3GN5 A;  4CI2 B;  5AQO B;  4CXW A;  4JGH D;  3LBX A;  3LK4 2;  3I0Q A;  4HKA A;  1D1B A;  2UXN B;  5AFU L;  4JI0 T;  1D1C A;  2H88 A;  4IHJ E;  4IGU A;  2X0Y A;  4ZHQ E;  2XQ3 A;  1E2A A;  4TX5 A;  4EED A;  4JI5 T;  2V6Y A;  2VQF T;  4YTM A;  4U74 A;  1M62 A;  5CA0 E;  4O2B E;  5JTG A;  5LMN T;  3RRW A;  1YW0 A;  1B7T A;  2K24 A;  2L3L A;  3GA8 A;  3IBP A;  3P4R A;  5FXZ A;  3VRB A;  1ZOY A;  1LRZ A;  2DWG A;  1KK7 A;  1YQ3 A;  2XAS B;  3PUZ F;  4HFB A;  4I43 B;  2LOP A;  2LSK A;  2NW8 A;  2BG9 B;  4TV8 E;  3V5U A;  3AE5 A;  5KDM C;  1EZ3 A;  4EEB A;  3AEB A;  2A3D A;  4YXD A;  2Z6E A;  5A1L A;  1N33 T;  1IAP A;  3CML A;  2LRL A;  3FHN A;  4I0U A;  5GON E;  4JI2 T;  4F8H A;  2FJB A;  1UX5 A;  4BAY B;  5L47 A;  4DV1 T;  1XMO T;  4KHP T;  2H89 A;  2XQ5 A;  3JC6 C;  4LF6 T;  2BVM A;  3ZC0 A;  3I1A A;  5C8Y E;  3NVO A;  1HG5 A;  2R6G F;  3ANW B;  5C3J A;  1N36 T;  3L39 A;  1S94 A;  4HFV A;  4U7I A;  4DR1 T;  3JCF A;  3VHL A;  2Q9Q B;  1MIV A;  1CHU A;  3TLW A;  5AQP B;  4CN1 A;  4I4T E;  3AE1 A;  3LSV A;  5H6R B;  3RKG A;  2LHN A;  2NOX A;  2NWB A;  3CQX C;  4H9O C;  4P0B A;  3RIA A;  1DU2 A;  3UFG A;  3M65 A;  3LK3 B;  5E0O A;  4DMV A;  4YHJ A;  1X79 A;  5IHY A;  5JVD E;  4ILU A;  5LB7 B;  4U72 A;  2NW7 A;  2X9X A;  4O8S A;  2KSR A;  4ADZ A;  3JAD A;  3N2O A;  3C64 A;  4DO0 A;  3R6N A;  3C4W A;  4ZI2 D;  4DMW A;  5JR9 A;  2LKH A;  4HTE A;  1WYC A;  3FZH B;  3ZYL A;  1KNZ A;  3NRX A;  3P50 A;  2SPC A;  3Q5D A;  3OVU A;  2JQ9 A;  3FZL B;  4P09 A;  2WU5 A;  3ABV A;  3P4Q A;  5LBQ B;  4DV0 T;  3ZMS B;  1XWM A;  5LMU T;  2IUB A;  4IE7 A;  3RF1 A;  1FMW A;  1HNX T;  2X68 A;  1WLX A;  4GYR A;  4ZI3 D;  2WCA A;  3EHZ A;  4PFP A;  3RRC A;  3HI2 A;  5JR9 C;  3E22 E;  3KIN B;  3DP7 A;  1QLB A;  4QX7 B;  5F5W A;  2V7I A;  1IBL T;  4LF9 T;  2VKO A;  2XPK A;  3C51 A;  1OED C;  3K8P C;  4IL9 A;  1VCT A;  2CCQ A;  5L2L A;  5HAX A;  2D0U A;  3LK2 B;  3M3Z B;  2E9X A;  4DND A;  4DV2 T;  4AP2 B;  2C5I T;  4PJM A;  1L0V A;  4CN4 A;  5ABF B;  4O4J E;  2K5B B;  1IBK T;  5JRC B;  4E7S A;  1UK5 A;  3P4P A;  3IHR A;  1UUS A;  3N9P A;  2EHO A;  2CEA A;  5L3D B;  5LNK A;  2UXC T;  2XQ8 A;  1X9B A;  2BBH A;  2XAQ B;  4IDN A;  1SA0 E;  2OA5 A;  2PBI A;  3UU6 A;  2X51 A;  2LRK A;  3PJA J;  2VL0 A;  5L3B B;  4QXH B;  3EDV A;  4B3M T;  5HCM A;  2L9Q A;  3QC9 A;  1IZN B;  3ETV A;  3RHW A;  3UUL A;  3E0Z A;  3PUX F;  5AQM B;  1YQ4 A;  4AKL A;  2E5V A;  4WBN E;  5CFB A;  2DNX A;  3GMI A;  3EAM A;  4C90 A;  1XNR T;  3P8C D;  3ZPO A;  4KBM B;  1FMV A;  3QUJ A;  1ZP0 A;  2YEV C;  3EVY A;  4PK5 A;  1HF8 A;  4O4I E;  4JI3 T;  1YKE B;  4BJM A;  3FBZ A;  3ZLI A;  3U3I A;  2J4G A;  5J2T E;  3HKD E;  2QYW A;  3AAI A;  2W61 A;  3RC3 A;  4EIW A;  2XY8 B;  4QKN A;  3ZT5 A;  4EV6 A;  2ZLY A;  5JDL A;  4NXN T;  1MNE A;  5JDM A;  2DL1 A;  2XHE B;  3DTO A;  2V7K A;  3A7M A;  5LG3 A;  2BS3 A;  3MA9 A;  4UVA B;  3TKL B;  2H7V C;  2RA1 A;  4MFR A;  3UUX B;  3V5S A;  3IF8 B;  3H3M A;  3ZN1 B;  4HWF A;  2UUB T;  2V7J A;  4KMC A;  3AB3 B;  1LKX A;  4LMK A;  4UV8 B;  5CGM A;  4OX9 T;  1Z0P A;  3CQG B;  4OYJ A;  4LFA T;  4LF4 T;  2CXF A;  4UEM A;  2WMO A;  4JEH B;  2XTL A;  1MMG A;  2CLY C;  2V1D B;  2CXL A;  2B76 A;  2F4V T;  2V6X A;  5FYM A;  5L3E B;  2W4X A;  3LFM A;  3D0T A;  3LBX B;  1WFD A;  3NZP A;  5FY1 A;  4HFD A;  3RQU A;  3NRY A;  1KF6 A;  2CMR A;  2CBI A;  4TNW A;  5FL0 A;  4H9R C;  5CB4 E;  1ZHC A;  4ILB A;  3RPU A;  2V26 A;  4NIQ A;  2NP9 A;  4JLE A;  3Q5E A;  4UEL A;  3AE6 A;  3RIU C;  2EHO C;  4C91 A;  5ABF A;  4WNK A;  3UTK A;  4U31 A;  2NR4 A;  5JDF A;  3B5M A;  3N2G E;  3O1J A;  1N32 T;  3KDS E;  3KVA A;  3ZMU B;  1HTJ F;  4U2Z A;  1WRD A;  4YY3 T;  4IE4 A;  5LHG B;  3CX6 B;  3UU4 A;  5LA6 E;  3CQC B;  3C4X A;  5LGT B;  4XZC A;  5JDG A;  2G0U A;  2NTY A;  1LDK A;  3KVB A;  4H9S E;  4YJ3 E;  2D9D A;  3OYX A;  4H9N C;  4X1Y E;  3KFW X;  3NBX X;  3P4W A;  2WBL A;  4IDP A;  5HWY A;  2IML A;  2X66 A;  1J5E T;  3UU5 A;  3PV0 F;  2WMN A;  3AEG A;  3PUV F;  3LDQ B;  4GK0 E;  1HG2 A;  2BZB A;  4KP3 C;  4PW8 A;  3UUN A;  3AE3 A;  3NWI A;  1XNQ T;  3HKE E;  3NKZ A;  5DQW A;  2XQA A;  4IT4 A;  3RYC E;  5ABG A;  2E9X C;  4A97 A;  2C5J A;  2L8K A;  2KMF A;  2VUR A;  4PJL A;  4TWD A;  3PUR A;  4WZX A;  5L4E A;  3AE8 A;  3K3N A;  5HEH A;  2WU2 A;  5AQL B;  4EYY R;  4WYV A;  2B1E A;  2X0L B;  5LYJ E;  2YDQ A;  1HFA A;  2KZ7 B;  4OK0 A;  1YD8 G;  2JQK A;  2N1G A;  3OPC A;  2IIU A;  4JBW F;  3RQW A;  4FI5 A;  5HYA A;  3VKG A;  3HKC E;  3DPL C;  4A64 A;  3N9M A;  2JJ9 A;  2JMH A;  2VVN A;  5KXJ A;  3MJX A;  2XQ4 A;  3AE4 A;  5CJ5 A;  2HPL A;  4J2C A;  5HEU A;  1HX8 A;  2YDS A;  3BQK A;  4U3C A;  3RI5 A;  3O1I A;  4AQF C;  3PUG A;  2LSJ A;  2YU2 A;  3N2K E;  2LSG A;  2Q9Q D;  4X20 E;  5DAB A;  3AA1 B;  2LLY A;  4YTP A;  3ZT6 A;  1N34 T;  4EOZ B;  2W67 A;  4GOU A;  3MZK B;  4MAL A;  5FL1 A;  5JRE A;  4GKJ T;  2ZMA A;  2N2N A;  4X66 T;  4IDQ A;  4KHZ F;  2XM1 A;  2JMK A;  2M67 A;  2CA5 A;  2PTF A;  3DJB A;  3HA4 A;  3WI3 A;  5KX5 E;  1OED A;  4JI1 T;  4JI4 T;  2LJL A;  3L09 A;  4AKI A;  4L0R A;  2BS4 A;  1I94 T;  3DQV C;  2V6Y B;  2XZE A;  1XMQ T;  5FY0 A;  4AKH A;  2V7M A;  5LCY A;  3ZCJ A;  4NXM T;  4IDO A;  3KV9 A;  4P1N A;  3WAJ A;  1WR6 A;  1KEY A;  2HN1 A;  3FBL A;  3SS1 A;  1AJ3 A;  4P0A A;  4JI7 T;  3FXE B;  4JV5 T;  3VR8 A;  4HWI B;  3H3A A;  2WP9 A;  4X1K E;  3AEE A;  1M7K A;  1T8B A;  2ODU A;  4Z91 A;  3AA6 B;  3T8O A;  4F6R C;  4TN7 B;  5AQS B;  5LGU B;  3ZKR A;  1XDO A;  3FB2 A;  4YFS A;  2W00 A;  5ABH A;  4ILA A;  4HFC A;  4ILC A;  1KFY A;  3E08 A;  4M1P A;  4MBQ A;  3B13 A;  4COF A;  5CA1 E;  1SUM B;  2BG9 C;  2LHR A;  1FJG T;  2HPJ A;  1YXR A;  1UUR A;  2D2S A;  4OHF A;  2J47 A;  4DID B;  1BR0 A;  2X9W A;  3PU8 A;  4APF B;  2KIN B;  3ETU A;  3JAF A;  3RIU A;  2JIW A;  3N9L A;  5HXE A;  4B3T T;  3LJC A;  5TAO A;  2MPK A;  3CX8 B;  3QNU A;  3AA0 B;  3L3P A;  1MIY A;  3PUS A;  2X0H A;  4YTN A;  1Z8U A;  4L5G A;  4HGA A;  1IJ6 A;  3CKD A;  2DLR A;  2OLT A;  4BA9 A;  4BJN A;  2BKO A;  3Q2M A;  5L3G B;  4KX6 A;  3FXD B;  4CXX A;  3ZT7 A;  3OBV E;  4HFE A;  5FP3 A;  4NUU A;  3AXJ A;  5LJN A;  2LEH A;  3KV4 A;  2W66 A;  3ONL C;  4H9P C;  4IE6 A;  4UVB B;  2CHN A;  3ONJ A;  5AQQ B;  4Z90 A;  5JRC A;  1O3X A;  4DR3 T;  3Q5W A;  3C50 A;  2LOS A;  2M6B A;  3G06 A;  1E7P A;  3JC6 D;  4TWH A;  5AQH B;  5AQJ B;  3ZN0 B;  5EK4 A;  5J0Z A;  5LOV E;  4CZZ B;  1ZEE A;  4EB6 E;  4DV4 T;  1J1J A;  2C0S A;  3A8Y C;  4DV5 T;  5AQI B;  2WZK A;  2BKN A;  2EHO D;  2N9D A;  5EK2 A;  4UR9 A;  4X62 T;  5J1G A;  5AQN B;  3J9X 1;  2FUP A;  3R84 B;  1SE7 A;  2E5L T;  2KLQ A;  2YIN A;  4O4H E;  4PNI A;  2CBJ A;  2WWU A;  3UT5 E;  1D0X A;  2JRK A;  2GK9 A;  2NTX A;  3L8R A;  4MLK A;  2C5K T;  3F31 A;  5HXS A;  3N9N A;  1QUU A;  2W62 A;  2YDR A;  3K1S A;  2WM9 A;  2IAK A;  2YK0 A;  2RPA A;  1WR0 A;  1S35 A;  5AQK B;  4X65 T;  2W2U A;  4A98 A;  3T1H T;  1T7S A;  1MMN A;  3AAE B;  4YSY A;  2MYS A;  1HS7 A;  3RX6 A;  2HN2 A;  4AQY T;  3RGL A;  3UU8 A;  2VKJ A;  3EDU A;  4ZOL E;  4DR2 T;  5EK3 A;  3TLT A;  2VQE T;  1BR4 A;  1G73 A;  1VCS A;  3MK7 C;  3OKQ A;  4HN9 A;  4UVC B;  2HHH T;  3FZF B;  4ZS3 A;  5FVL A;  4IIJ E;  5LG4 A;  2XSA A;  3VRA A;  3OTO T;  1FIO A;  3IA3 A;  3B57 A;  4JI6 T;  2BKP A;  2HH7 A;  5HCJ A;  4B3R T;  4QH5 A;  4QX8 B;  2XAF B;  3PUA A;  1UGO A;  4I50 E;  3PDY A;  4MHC A;  5LBM A;  2YOE A;  4YHH T;  4DR5 T;  1LDK B;  4KI0 F;  1QSD A;  2W63 A;  3AE9 A;  3W15 B;  4X64 T;  4LF5 T;  4LF8 T;  3TLU A;  2ACZ A;  2WAU A;  1D1A A;  3KV5 A;  4LML A;  4DR4 T;  3ZJ2 A;  4OYK A;  2VB6 A;  3ZMV B;  3ZYK A;  2XU0 A;  3UUB A;  3QOF A;  4GYS A;  4AI6 A;  2XQ6 A;  5AQF B;  3K3Q C;  4H63 V;  1LVK A;  3AXJ B;  4QWN B;  3UFE A;  4H9Q C;  5AQT B;  2UXB T;  1D0Y A;  3RH3 A;  4E7Z A;  3QK6 A;  4ERR A;  4WW0 A;  2MAW A;  3TLV A;  1V9D A;  2PFV A;  3AVR A;  2P9B A;  2DWK A;  4P5O A;  4CXY A;  2BG9 A;  4LF7 T;  2I6H A;  2QGS A;  2BVL A;  2MBG A;  2LT3 A;  3ZC1 A;  1WCR A;  2VWA A;  2X9H A;  1GQE A;  5HXH A;  4DV7 T;  4B3S T;  2H3R A;  1BR1 A;  2KXP B;  2LKG A;  4HE8 A;  3TLS A;  5F8P A;  3AE7 A;  4EXT A;  2ES0 A;  4QXC B;  4PK4 A;  2OV9 A;  4X1I E;  3T1Y T;  2BG9 E;  4ZEY A;  3AEC A;  3CX7 B;  2K48 A;  3BQL A;  5FY7 A;  5J2U E;  2FBW A;  1T98 A;  2H7O A;  3N9O A;  4G2A A;  3U78 A;  4EGW A;  5JDH A;  2AE9 A;  5HXC A;  2VK9 A;  1XZY A;  3MXZ A;  5FNV E;  5FKY A;  3LG7 A;  4ZI3 C;  1T72 A;  1U4Q A;  2CLY B;  1ZKE A;  2DI4 A;  2J1D G;  4PJN A;  2D0T A;  3PTR B;  5LGN B;  2DCF A;  1OWA A;  3HKB E;  2VL8 A;  2KWH A;  2UUC T;  4DV3 T;  3SRZ A;  2Y6X A;  3O1H A;  4FJO A;  2K9A A;  4HFI A;  4LMJ A;  3PUQ A;  4DUZ T;  3RC8 A;  3GWH A;  2UUA T;  4JI8 T;  4ZI2 C;  3EAB A;  3OYZ A;  1W0B A;  4GK5 E;  3ZST A;  2A9U A;  3PU3 A;  2CHO A;  4L9I A;  2ZM2 A;  4YJ2 E;  5HEJ A;  2RP4 A;  2VKD A;  1WYB A;  4TV9 E;  5DJQ C;  3PUY F;  5H6Q B;  2IC9 A;  5FXW A;  1VOM A;  2ZM0 A;  1HCI A;  1U5P A;  2LSI A;  3Q9D A;  2CM0 A;  4PFO A;  2XAH B;  5HWX A;  5JDN A;  1U6G A;  3NZQ A;  1VRB A;  4Z8X A;  2IHR 1;  3C4Z A;  3I0O A;  4UF0 B;  3RYI E;  4LFC T;  5ADX L;  2Q9Q A;  1OED B;  2VAS A;  2Y8D A;  2V8S V;  2CPT A;  2VVS A;  2QA7 A;  2XM2 A;  3N5L A;  3O4X E;  4HEA A;  4UIG A;  3I9Y A;  3A5X A;  4JEU B;  5FXX A;  4ZI7 E;  3CPZ A;  5LXT E;  2MOZ A;  2FJA A;  1LVF A;  4IE5 A;  4ZXL A;  4PJJ A;  4KUM B;  3RKO A;  2XAG B;  5ABE A;  2AXD S;  2E8I A;  1KNP A;  3SOL A;  4EZ4 A;  3QB5 A;  2X67 A;  2WSS V;  2ODV A;  5KMG P;  5HXR A;  2WZI A;  5JH7 E;  2JQH A;  4O2A E;  5AQR B;  5JQG E;  5BMV E;  3HR0 A;  5BR8 T;  2UXD T;  4XBF B;  4PK6 A;  1NWM X;  3P7I A;  3UUM A;  3AEA A;  4I55 E;  4HXI B;  4NUV A;  2BDE A;  3HL6 A;  1W9R A;  3C98 B;  2ZM8 A;  1LDJ A;  2Y48 B;  4EYU A;  2WY2 A;  3O9X A;  2V7L A;  4LFB T;  1JNR A;  4ASK A;  3RLF F;  4CI1 B;  1MND A;  4F52 A;  2I59 A;  2XUE A;  4V1A v;  1UX4 A;  4TZ4 C;  2WWV A;  5JR9 B;  1HNZ T;  1I6Z A;  2W0G A;  4QH1 A;  1MIW A;  2WDQ A;  4UXN B;  4DVD A;  4X5T A;  1YKH B;  5FMN A;  4TNV A;  3P4S A;  2CWY A;  1Y64 B;  2XAJ B;  3CWZ B;  3JAE A;  5ETW A;  5IUX A;  3FZK B;  3AEF A;  5AQU B;  3F57 A;  5L4H A;  3KBU A;  4EZH A;  2FJE A;  1ZV4 X;  2IC6 A;  2V5D A;  3ZSS A;  4JUY A;  3VR9 A;  3RTR A;  4WBO A;  3UQ4 A;  2XSB A;  4AQG A;  3ONX A;  3N9Q A;  3RIF A;  2CXD A;  5LP6 E;  2PG8 A;  4G63 A;  2UU9 T;  2ACX A;  1MMA A;  2KT9 A;  3ZMZ B;  4U33 A;  2WDV A;  3KBT A;  1OXZ A;  3MAC A;  4AIU A;  3ZEF B;  4ZZC A;  2UXX B;  3UQ7 A;  3RYF E;  4YSZ A;  2Q9Q C;  2BBJ A;  5IYZ E;  2K3W A;  4QH4 A;  4IRE A;  4AIS A;  3QB5 K;  3AA7 B;  2LE8 A;  4XAX B;  1KNR A;  1NEK A;  2VKH A;  3ZMT B;  2IW5 B;  3F2E A;  3I9W A;  2CWO A;  3BQI A;  4HWH A;  5HEG A;  2LSY A;  4AQF A;  1HR0 T;  1G8X A;  4U7Y A;  1FEW A;  1J5W A;  4CI3 B;  1US7 B;  4TWF A;  2BS2 A;  5M4Y A;  4YT0 A;  2A2F X;  2X9Y A;  3CK6 A;  3GN5 B;  3AVS A;  3OJA A;  4IDZ A;  2ZM6 T;  2E9X D;  4N9F 3;  3WAK A;  4O4L E;  4CQI A;  2LM9 A;  4HWD A;  3Q5X A;  4IE0 A;  1NAF A;  3AAA B;  4NPP A;  5F3J A;  4DBR A;  3ZJ1 A;  2XJ7 A;  4QHO A;  1NEN A;  2E9X B;  4ZS2 A;  5FVK A;  1OED E;  1BR2 A;  4DV6 T;  2XQY A;  3S4U A;  1HX1 B;  3PJA A;  1R8I A;  2V5C A;  3H37 A;  3KV6 A;  4IST A;  3PUW F;  3AED A;  4ISS A;  3SFE A;  4ANJ A;  5DQV A;  4B6X A;  4HFH A;  2XQ7 A;  2WB5 A;  4QXB B;  2KWI B;  2PJQ A;  1D0Z A;  4ZZB A;  2I0M A;  1Y01 A;  2IDO B;  2XQ9 A;  1UCU A;  3ESL A;  3RYH E;  4DR6 T;  5L3F B;  2WQY A;  2CRB A;  3EUH A;  4EAH A;  2QVA A;  3IEE A;  4TUY E;  4OFZ A;  3VU7 H;  5LHH B;  2YKS A;  3PE0 A;  1E1H B;  4A56 A;  2KND A;  2LM2 A;  2QRX A;  4PAG A;  4UV9 B;  3ZYM A;  1CUN A;  2JPF A;  5FXV A;  2CE7 A;  4H63 H;  4DR7 T;  1W0A A;  2D5U A;  5AQG B;  3EI0 A;  2NW9 A;  4UF0 A;  2WS3 A;  4AKG A;  3VKH A;  1XDP A;  3AE2 A;  1JNZ A;  2YN6 A;  4DBQ A;  4AXP A;  4WQO D;  4CN6 A;  4DUY T;  4YLH A;  2MTQ A;  3CIR A;  1MMD A; 
#chains in the Genus database with same CATH homology
 4K0U A;  3MKD A;  2A72 A;  4GIW A;  1IJ5 A;  2EHO B;  2YU1 A;  3ANW A;  3CVR A;  3ZCI A;  5LJM A;  3J7Y q;  4N78 D;  5JDQ A;  5LHI B;  2JQQ A;  1H7C A;  3K3O A;  3SWH A;  1SHZ C;  5L3C B;  5EZY E;  4CXW A;  2DHR A;  4CI2 B;  3BK9 A;  3GN5 A;  3LBX A;  3LK4 2;  3I0Q A;  4HKA A;  1D1B A;  2UXN B;  5AFU L;  1D1C A;  4IHJ E;  4IGU A;  4ZHQ E;  4TX5 A;  4U74 A;  5CA0 E;  4O2B E;  3RRW A;  1YW0 A;  1B7T A;  2K24 A;  2L3L A;  3GA8 A;  3IBP A;  5FXZ A;  1LRZ A;  2DWG A;  1KK7 A;  2XAS B;  4I43 B;  2LOP A;  2LSK A;  2NW8 A;  3V5U A;  4TV8 E;  5KDM C;  1EZ3 A;  2A3D A;  2Z6E A;  5A1L A;  1IAP A;  3CML A;  3FHN A;  5GON E;  4BAY B;  1UX5 A;  3JC6 C;  2BVM A;  3I1A A;  5C8Y E;  1HG5 A;  3ANW B;  1S94 A;  4HFV A;  3VHL A;  2Q9Q B;  1MIV A;  5JDH A;  4I4T E;  5H6R B;  2LHN A;  3CQX C;  2NOX A;  2NWB A;  4H9O C;  4P0B A;  3M65 A;  3LK3 B;  5E0O A;  4DMV A;  4YHJ A;  1X79 A;  5IHY A;  5JVD E;  4ILU A;  4U72 A;  2NW7 A;  2X9X A;  4O8S A;  4ADZ A;  4ZI2 D;  3N2O A;  3C64 A;  4DO0 A;  3R6N A;  3C4W A;  1KNZ A;  5JR9 A;  4HTE A;  1WYC A;  3ZYL A;  3NRX A;  2SPC A;  4P09 A;  5LBQ B;  3ZMS B;  4IE7 A;  1FMW A;  2X68 A;  1WLX A;  4GYR A;  4ZI3 D;  4PFP A;  3RRC A;  3HI2 A;  5JR9 C;  3E22 E;  3KIN B;  3DP7 A;  4QX7 B;  2V7I A;  2VKO A;  3C51 A;  3K8P C;  2CCQ A;  5L2L A;  5HAX A;  2D0U A;  3LK2 B;  2E9X A;  4DND A;  2C5I T;  4PJM A;  4O4J E;  2K5B B;  5JRC B;  4E7S A;  3IHR A;  3N9P A;  5L3D B;  2EHO A;  2CEA A;  5LNK A;  2XAQ B;  1SA0 E;  2OA5 A;  2PBI A;  2X51 A;  5L3B B;  4QXH B;  3EDV A;  2L9Q A;  3QC9 A;  1IZN B;  3ETV A;  3UUL A;  4DMW A;  3E0Z A;  4AKL A;  4WBN E;  2DNX A;  3GMI A;  4C90 A;  3P8C D;  3ZPO A;  4KBM B;  1FMV A;  3QUJ A;  2YEV C;  3EVY A;  4PK5 A;  1HF8 A;  4O4I E;  1YKE B;  4BJM A;  3FBZ A;  3ZLI A;  3U3I A;  5J2T E;  3HKD E;  3AAI A;  2W61 A;  3RC3 A;  4EIW A;  4QKN A;  5JDL A;  2XU0 A;  2ZLY A;  1MNE A;  5JDM A;  2XHE B;  3DTO A;  2V7K A;  3MA9 A;  3TKL B;  4UVA B;  3UUX B;  2H7V C;  2RA1 A;  4MFR A;  3V5S A;  3ZN1 B;  3IF8 B;  5EK2 A;  2V7J A;  4KMC A;  3AB3 B;  1LKX A;  4UV8 B;  1Z0P A;  3CQG B;  4OYJ A;  2CXF A;  4UEM A;  2WMO A;  4JEH B;  2XTL A;  1MMG A;  2CLY C;  2CXL A;  2V1D B;  5L3E B;  5FYM A;  3LFM A;  3D0T A;  3LBX B;  3NZP A;  5FY1 A;  3NRY A;  5CB4 E;  2CMR A;  4H9R C;  3ZC0 A;  1ZHC A;  3RPU A;  2V26 A;  2NP9 A;  4JLE A;  4UEL A;  4C91 A;  2EHO C;  4WNK A;  3UTK A;  5JDF A;  3N2G E;  3O1J A;  3KDS E;  3KVA A;  3ZMU B;  1HTJ F;  1WRD A;  4IE4 A;  5LHG B;  3CX6 B;  5LA6 E;  3CQC B;  3C4X A;  5LGT B;  4XZC A;  5JDG A;  2G0U A;  2NTY A;  3KVB A;  4H9S E;  4YJ3 E;  3OYX A;  4H9N C;  4X1Y E;  3KFW X;  3NBX X;  5HWY A;  2WBL A;  2X66 A;  2WMN A;  4GK0 E;  4KP3 C;  4PW8 A;  1HG2 A;  2BZB A;  3UUN A;  3HKE E;  5DQW A;  3RYC E;  2E9X C;  2C5J A;  2L8K A;  2KMF A;  4PJL A;  3PUR A;  3K3N A;  4EYY R;  2B1E A;  2X0L B;  5LYJ E;  1HFA A;  2KZ7 B;  4OK0 A;  1YD8 G;  2N1G A;  5HYA A;  3VKG A;  4FI5 A;  3HKC E;  3N9M A;  2JJ9 A;  2JMH A;  3MJX A;  2HPL A;  4J2C A;  1HX8 A;  3BQK A;  4AQF C;  3O1I A;  1HS7 A;  3PUG A;  2LSJ A;  2YU2 A;  3N2K E;  2LSG A;  2Q9Q D;  4X20 E;  5DAB A;  3AA1 B;  4EOZ B;  4GOU A;  3MZK B;  4MAL A;  5JRE A;  2ZMA A;  2N2N A;  2JMK A;  2M67 A;  2CA5 A;  3HA4 A;  3DJB A;  3WI3 A;  5KX5 E;  2LJL A;  3L09 A;  4AKI A;  4L0R A;  5FY0 A;  4AKH A;  2V7M A;  5LCY A;  3ZCJ A;  3KV9 A;  3WAJ A;  1WR6 A;  3FBL A;  3SS1 A;  1AJ3 A;  4P0A A;  3FXE B;  3H3A A;  4X1K E;  2ODU A;  5LGU B;  3AA6 B;  3T8O A;  4F6R C;  4TN7 B;  3FB2 A;  4YFS A;  2W00 A;  3E08 A;  4M1P A;  4MBQ A;  3B13 A;  5CA1 E;  2LHR A;  2HPJ A;  2D2S A;  4OHF A;  1BR0 A;  2X9W A;  3PU8 A;  2KIN B;  3ETU A;  3N9L A;  5HXE A;  3LJC A;  5TAO A;  3CX8 B;  3AA0 B;  3L3P A;  1MIY A;  3PUS A;  4L5G A;  4HGA A;  1IJ6 A;  3CKD A;  2DLR A;  4BJN A;  4BA9 A;  3Q2M A;  5L3G B;  3FXD B;  4CXX A;  3OBV E;  5FP3 A;  4NUU A;  5LJN A;  2LEH A;  3KV4 A;  4H9P C;  4IE6 A;  4UVB B;  5JRC A;  1O3X A;  3Q5W A;  3C50 A;  2LOS A;  3JC6 D;  3ZN0 B;  5EK4 A;  5LOV E;  4CZZ B;  1ZEE A;  4EB6 E;  2C0S A;  2EHO D;  2N9D A;  5J1G A;  3J9X 1;  3R84 B;  2KLQ A;  2YIN A;  4O4H E;  4PNI A;  2WWU A;  3UT5 E;  1D0X A;  2JRK A;  2GK9 A;  2NTX A;  4MLK A;  3F31 A;  2C5K T;  5HXS A;  3N9N A;  1QUU A;  2W62 A;  2WM9 A;  2IAK A;  2YK0 A;  1S35 A;  1MMN A;  3AAE B;  2MYS A;  3RX6 A;  2VKJ A;  3EDU A;  4ZOL E;  5EK3 A;  1BR4 A;  1G73 A;  3OKQ A;  3MK7 C;  4UVC B;  4HN9 A;  4ZS3 A;  5LG4 A;  4IIJ E;  1FIO A;  3B57 A;  2HH7 A;  4QX8 B;  2XAF B;  3PUA A;  4I50 E;  3PDY A;  4MHC A;  5LBM A;  1QSD A;  2W63 A;  3W15 B;  2WAU A;  3KV5 A;  1D1A A;  3ZJ2 A;  4OYK A;  2VB6 A;  3ZMV B;  3ZYK A;  4GYS A;  3K3Q C;  4H63 V;  1LVK A;  4QWN B;  3UFE A;  4H9Q C;  1D0Y A;  3RH3 A;  3QK6 A;  4ERR A;  4WW0 A;  1V9D A;  2PFV A;  3AVR A;  2P9B A;  2DWK A;  4CXY A;  2QGS A;  2BVL A;  2MBG A;  2LT3 A;  3ZC1 A;  2VWA A;  2X9H A;  5HXH A;  4AI6 A;  2H3R A;  1BR1 A;  2KXP B;  4HE8 A;  5F8P A;  4EXT A;  2ES0 A;  4QXC B;  4PK4 A;  4X1I E;  5FY7 A;  3CX7 B;  2K48 A;  3BQL A;  5J2U E;  1T98 A;  2H7O A;  3N9O A;  4G2A A;  3U78 A;  5HXC A;  2VK9 A;  3MXZ A;  5FNV E;  3LG7 A;  4ZI3 C;  1U4Q A;  2CLY B;  4PJN A;  1ZKE A;  2DI4 A;  2J1D G;  5LGN B;  2D0T A;  3PTR B;  2DCF A;  1OWA A;  3HKB E;  2VL8 A;  2KWH A;  3SRZ A;  2Y6X A;  3O1H A;  4FJO A;  2K9A A;  3PUQ A;  3RC8 A;  3GWH A;  4ZI2 C;  3OYZ A;  4GK5 E;  3PU3 A;  4YJ2 E;  4L9I A;  2ZM2 A;  2RP4 A;  2VKD A;  1WYB A;  4TV9 E;  5DJQ C;  5H6Q B;  2IC9 A;  5FXW A;  1VOM A;  2ZM0 A;  1HCI A;  1U5P A;  2LSI A;  3Q9D A;  2CM0 A;  4PFO A;  2XAH B;  5HWX A;  5JDN A;  3NZQ A;  1VRB A;  4Z8X A;  3C4Z A;  3I0O A;  4UF0 B;  3RYI E;  5ADX L;  2Q9Q A;  2Y8D A;  2VAS A;  2QA7 A;  3O4X E;  3N5L A;  4HEA A;  4UIG A;  5FXX A;  3I9Y A;  3A5X A;  4JEU B;  4ZI7 E;  3CPZ A;  5LXT E;  2MOZ A;  1LVF A;  4IE5 A;  4PJJ A;  4KUM B;  3RKO A;  2XAG B;  2E8I A;  3SOL A;  4EZ4 A;  2X67 A;  2WSS V;  2ODV A;  5KMG P;  5HXR A;  5JH7 E;  4O2A E;  5JQG E;  5BMV E;  3HR0 A;  4XBF B;  4PK6 A;  1NWM X;  3P7I A;  3UUM A;  4I55 E;  4NUV A;  2BDE A;  3HL6 A;  3C98 B;  2ZM8 A;  2Y48 B;  4EYU A;  3O9X A;  2V7L A;  4ASK A;  4CI1 B;  1MND A;  2I59 A;  2XUE A;  4V1A v;  1UX4 A;  4TZ4 C;  5JR9 B;  2W0G A;  1MIW A;  4UXN B;  4DVD A;  5FMN A;  1YKH B;  2CWY A;  1Y64 B;  2XAJ B;  3CWZ B;  5ETW A;  4EZH A;  3F57 A;  4E7Z A;  3KBU A;  2IC6 A;  1ZV4 X;  4JUY A;  4WBO A;  4AQG A;  3ONX A;  3N9Q A;  2CXD A;  5LP6 E;  2PG8 A;  4G63 A;  2ACX A;  1MMA A;  2KT9 A;  3ZMZ B;  3KBT A;  1OXZ A;  3MAC A;  3ZEF B;  2UXX B;  3RYF E;  2Q9Q C;  5IYZ E;  3AA7 B;  2LE8 A;  4XAX B;  2VKH A;  3ZMT B;  2IW5 B;  3F2E A;  3I9W A;  2CWO A;  3BQI A;  4AQF A;  2LSY A;  1G8X A;  1FEW A;  4CI3 B;  1US7 B;  5M4Y A;  3GN5 B;  2A2F X;  2X9Y A;  3AVS A;  3OJA A;  4IDZ A;  2E9X D;  3WAK A;  4O4L E;  4CQI A;  2LM9 A;  3Q5X A;  4IE0 A;  1NAF A;  3AAA B;  5F3J A;  4DBR A;  3ZJ1 A;  4QHO A;  4ZS2 A;  2E9X B;  1BR2 A;  2XQY A;  3S4U A;  3KV6 A;  3H37 A;  4ISS A;  4ANJ A;  4IST A;  5DQV A;  4B6X A;  4QXB B;  2KWI B;  1D0Z A;  2PJQ A;  3ESL A;  1UCU A;  3RYH E;  5L3F B;  3EUH A;  4EAH A;  3IEE A;  4TUY E;  4OFZ A;  3VU7 H;  5LHH B;  3PE0 A;  1E1H B;  4A56 A;  2KND A;  4UV9 B;  4PAG A;  3ZYM A;  4AKR B;  1CUN A;  2JPF A;  5FXV A;  2CE7 A;  4H63 H;  2D5U A;  2NW9 A;  4UF0 A;  4AKG A;  3VKH A;  4DBQ A;  4AXP A;  4YLH A;  2MTQ A;  1MMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...