1Z0PA

Crystal structure of the protein of unknown function spy1572 from streptococcus pyogenes
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
73
Chain Sequence
MSYEKEFLKDFEDWVKTQIQVNQLAMATSQEVADERAKDAFIRYESKLDAYEFLLGKFDNYKNGKAFHDIPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein SPy1572
publication title The 1.7A Crystal structure of the hypothetical protein SPy1572 from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
total genus 33
structure length 73
sequence length 77
ec nomenclature
pdb deposition date 2005-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08930 DUF1912 Domain of unknown function (DUF1912)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1z0pA00
1IJ6A 2C5IT 3QK6A 4FI5A 3CKDA 3FXDB 4L0RA 4J2CA 2IC9A 3N5LA 1LRZA 2K48A 1ZKEA 1Z0PA 2KWHA 2KWIB 3L3PA 3QUJA 3S4UA 2X9XA 1IJ5A 2MBGA 3CVRA 3P7IA 2CA5A 3TKLB 2IC6A 1QSDA 4B6XA 2C5KT 4DNDA 2C5JA 1LVFA 1H7CA 4EYYR 2X9YA 2X9WA 2G0UA 3MXZA 2XTLA 4CQIA 3FXEB
chains in the Genus database with same CATH superfamily
5ABFA 4LMLA 5EK4A 2X9XA 2JQQA 3MKDA 4DR4T 1XDPA 4HWDA 2PJQA 2PFVA 3O1IA 2Q9QC 2WCAA 3ZT5A 4HKAA 3ZC1A 1WLXA 4I0UA 5HCMA 3RYHE 4UV9B 1HTJF 2XAQB 2CBIA 2L9QA 3SS1A 2LOSA 3AEAA 4C91A 1G8XA 2DNXA 4M1PA 2F4VT 4JYAT 2LEHA 5L3CB 1FIOA 2J4GA 5LXTE 2BKPA 3K3QC 2CPTA 3CX6B 2V7IA 4IHJE 1N33T 2BG9E 2IHR1 3ZYMA 3ZPOA 4WBOA 4LF7T 3U3IA 4U7YA 2ZM8A 2XQ4A 3UUBA 3T1HT 1D1CA 3K3NA 1FJGT 2BKNA 1KF6A 4B3RT 5AQVB 3Q5WA 5LP6E 3PUWF 4TN7B 3LK42 4X5TA 5AQRB 2X0YA 2V7JA 4PJLA 3RRWA 5JREA 3QB5K 4GK0E 5DQVA 1X79A 4YTNA 2ODUA 2WWUA 4TV8E 2E9XC 3O1HA 4JEHB 5FP3A 1D0YA 2UUBT 2NOXA 4IT4A 4PK4A 5LBMA 4ZI3D 3FBLA 3CX7B 4HFBA 1L0VA 2D5UA 2BS2A 3C64A 2NTXA 3S4UA 5L3GB 3C98B 3RC3A 3QOFA 4KHZF 4O2BE 4LF6T 5FXVA 3RKGA 2GK9A 3FZMB 3LBXB 5ABEA 2VKOA 2CXDA 1J5ET 5LJMA 1R8IA 4YT0A 2BDEA 4F8HA 3QC9A 2DL1A 3HI2A 3O1JA 3EABA 2V1DB 3LK3B 4OFZA 4TWHA 4H9OC 2WSSV 2LT3A 2WMOA 5E0OA 5IHYA 3L09A 4JI3T 2AXDS 3TLTA 4H9QC 3IF8B 2WBLA 2NTYA 3UFEA 3EI0A 3SWHA 4J2CA 2B76A 2XQ8A 4U7IA 3ZN0B 2V7KA 3G06A 3ZJ1A 4O2AE 4O8SA 2C5KT 3A7MA 2FJDA 4QXBB 3LG7A 2G0UA 2VVSA 2VASA 2XUEA 4AISA 4ZZCA 4NXMT 2VB6A 3ZSTA 2H88A 5FNVE 1FMVA 3AVSA 3K8PC 1YD8G 2EHOD 1M7KA 2X9HA 2Y6XA 3FZLB 4YHHT 1KFYA 4AKRB 4OYJA 4UVBB 2ZM0A 3KBUA 3KV6A 4AQFA 4EXTA 5HWYA 4UELA 3OYZA 2LSIA 4XAXB 4QWNB 2ZMAA 2VURA 2BS4A 5HEGA 4ZZBA 2JQ9A 1HF8A 3RIFA 3KV5A 2ZM6T 5J1GA 2XASB 3RIUC 1J1JA 1KEYA 1XZYA 3KV4A 4H9RC 3J9X1 1AJ3A 4DR3T 4DBRA 2V6XA 3PU8A 4FI5A 4DV1T 5AQJB 1HX1B 2X66A 2DLRA 3RQUA 3LBXA 3FZKB 4YHJA 3UT5E 2YDQA 2QGSA 2LRLA 4LFBT 3UQ4A 4WBNE 5AQHB 3N9PA 2WZHA 3RC8A 3PU3A 5BMVE 3DTOA 4DUYT 1MMNA 3FZFB 4ILUA 3I1AA 2QA7A 5AQIB 4LMKA 3ZN1B 3AE3A 3AXJB 2BG9C 2X0HA 3AB3B 3GN5B 2YU2A 1IBKT 1FMWA 1T98A 4BA9A 1YXRA 5LCYA 5L3EB 2M6BA 3UU3A 3T1YT 2KNDA 1JNZA 3UU5A 1D1AA 5J2TE 3TLUA 3JAEA 2NW8A 4WNKA 3E08A 4O4LE 4AKGA 4KX6A 2Y8DA 2MPKA 4NIQA 5LYJE 4AQGA 4HEAA 3RX6A 3AE2A 2C5JA 3JADA 3PTRB 3NRXA 2K24A 3N2GE 3L3PA 2QYWA 4TWDA 5F3JA 4DMWA 2BBJA 5HXSA 3M3ZB 4IL9A 4LF8T 3F57A 5LHIB 4QX7B 2XQ5A 3Q2MA 2V7MA 1I94T 3ZYLA 3P7IA 2E5LT 2JQKA 4B6XA 4COFA 4DV7T 3KINB 4TV9E 3K3OA 3UQ7A 2Y48B 4ZHQE 3CQCB 3J7Yq 3ONJA 5J2UE 4X1KE 2DHRA 4A56A 4EYUA 5JR9C 2A9UA 2XAFB 4GYRA 5L3DB 4U31A 2WDRA 3N9NA 1W9RA 2PTFA 3I9YA 4QH5A 4Z90A 4DR7T 3AXJA 3Q5XA 2ZM2A 3GN5A 4YJ2E 3ZCIA 3JCFA 4IDQA 4UVAB 3R6NA 2J47A 5FY1A 2WP9A 3CMLA 3UTKA 4UF0B 4A98A 2YDRA 4GOUA 4LF5T 3KVBA 2LE8A 2UXCT 3GA8A 1XWMA 4JUYA 3TLVA 4ERRA 3GMIA 3ETUA 5L47A 2XQ7A 4TX5A 5DABA 2YN6A 5LBQB 5AQNB 2W61A 4YSXA 2XM1A 3AAEB 4EV6A 2XQAA 4MBQA 4K0KT 2N2NA 2V8SV 4IREA 2VVNA 3JAFA 1VCSA 1ZEEA 4ZXLA 3P4WA 2W0GA 4MALA 5AQFB 3IEEA 2L8KA 3RQWA 2BVMA 4GK5E 3I9WA 5FMNA 3VKGA 2E9XB 3RYIE 1SA0E 2DI4A 4JI5T 2OV9A 2IDOB 3B57A 4KUMB 3T8OA 4PJNA 2W2UA 1KNPA 1BR2A 4I55E 2BBHA 4IE0A 1WR0A 3ZYKA 5AQQB 3RGLA 2WMNA 4CXXA 2D0UA 4YTMA 3H37A 2XSBA 2C5IT 2VKJA 2NW9A 3RF1A 4YTPA 2XAHB 2WS3A 5AQKB 5LA6E 5AQTB 5JDNA 5L4HA 5LMUT 2MAWA 2KSRA 4YY3T 4YSZA 2HPJA 2WQYA 3D0TA 4DVDA 5FYMA 3AEBA 3AE4A 5AFUL 5IUXA 4CN1A 1QUUA 4TWFA 2CLYC 2LJLA 3I0OA 3FBZA 4UF0A 1HR0T 4KP3C 3WI3A 1BR1A 1W0AA 1BR4A 4X66T 3RH3A 4GKKT 5HXCA 4HFVA 2V26A 3VHLA 4BJNA 3N2OA 2QRXA 4OHFA 3A8YC 1MIYA 5CA0E 3OKQA 3BK9A 2LSGA 3TLWA 4MHCA 5L3BB 4ILBA 2KMFA 2XZEA 3VRBA 5FY0A 3GWHA 5LNKA 2DWGA 4ZI2D 1IJ5A 1MNDA 2C0SA 3F31A 5HAXA 3UU6A 1CUNA 5FVKA 1B7TA 2XAJB 3NWIA 4X64T 3ZMSB 4N78D 2CXFA 5C2TA 3ZCJA 3KFWX 2MYSA 3VRAA 2HH7A 2FJBA 2UXDT 3B5MA 3C4WA 5LMNT 3KBTA 4B3ST 4P1NA 4TNVA 4CZZB 1QSDA 1J5WA 2E2AA 3FHNA 1HNWT 2H3RA 3NRYA 3CPZA 2VQFT 4DV0T 1MMDA 4H63H 2I59A 3U78A 2OLTA 1SE7A 4LFAT 3N5LA 5JDGA 2W67A 3ZMZB 3EUHA 4JV5T 4G63A 3HKEE 2MOZA 3AA1B 2BG9B 4BAYB 4P0AA 4AQFC 3PUAA 4XZCA 4ADZA 3FZHB 2IC9A 3WAJA 1ZKEA 2KWHA 1T8BA 2XQ9A 4ANJA 4CXYA 2FJAA 4ZS2A 5L4EA 1XMQT 5HEUA 3N9MA 4LF4T 5CA1E 1I6ZA 2UUCT 2M67A 5JDLA 3QUJA 2CA5A 2JRKA 3TKLB 2CWYA 5KDMC 1XNQT 4JI8T 4IE4A 3N2KE 3AAAB 4HFDA 1MMAA 1WR6A 1S94A 2I0MA 4C90A 2LKHA 4OK0A 3C50A 5JDMA 4L0RA 5ABHA 1YQ3A 1SUMB 2KINB 4AKIA 4IE7A 4HWIB 5FY7A 3NZPA 3VU7H 3HKCE 1OEDB 4ZI3C 4TNWA 4EIWA 2WU5A 3AAIA 2VQET 3P8CD 4YLHA 4WZXA 1ZV4X 3R84B 4H63V 4JBWF 3UUMA 3RIUA 3JC6D 1MNEA 4IDOA 1U5PA 3M65A 2JMKA 5FXXA 4ASKA 1UURA 2KLQA 3OYXA 3ZEFB 3KDSE 4IDZA 3HKDE 2YINA 4AKLA 3I0QA 4LMJA 2RA1A 2YK0A 1W0BA 4AI6A 4EYYR 3SRZA 5EK3A 4CQIA 2LHRA 4DV5T 3ZSSA 2H7OA 1U4QA 4IE6A 2H89A 3RYCE 4PJJA 5FVLA 2BG9A 4EEDA 3AEEA 3P4QA 2LSJA 1LVFA 4DV4T 2X67A 1NENA 4X65T 3OVUA 5LHGB 5AQUB 2LLYA 2A72A 5HEHA 2HN2A 3QB5A 4CI3B 4JI7T 2QVAA 4PFOA 3AA6B 1HS7A 2IMLA 5FL1A 5AQOB 4ILCA 3H3MA 3ZJ2A 4YJ3E 2XHEB 5F8PA 2CCQA 2I6HA 2EHOC 1WCRA 4AXPA 1UCUA 5C8YE 3IHRA 5LGTB 4ISTA 4EZHA 2XY8B 1Y64B 5JQGE 2A2FX 3C4XA 4DMVA 2X51A 4JLEA 2WZIA 1IAPA 1GQEA 4CI1B 4JI0T 3ABVA 5L3FB 2NR4A 1Z8UA 2UUAT 5JRCB 4QKNA 4YSYA 2ACZA 2CHNA 2JJ9A 1OEDA 3AECA 5JVDE 4GKJT 3ANWB 1H7CA 3PJAJ 5HYAA 2Q9QB 3AEDA 2CBJA 2CXLA 1OXZA 2UU9T 1D0ZA 1HCIA 3C4ZA 2XQ6A 4X62T 2LRKA 3LDQB 3RHWA 4X1YE 3P50A 3AE9A 2IC6A 4QH1A 3PV0F 4DIDB 3OPCA 2HHHT 2X9WA 3PUXF 4ZOLE 5F5WA 2E5VA 3MJXA 4FJOA 3RI5A 3CKDA 3CK6A 3AE8A 5ABGA 3N9QA 1D1BA 3Q9DA 2E9XD 2DCFA 3LSVA 4NUUA 3EDVA 3UUXB 2WU2A 4NXNT 2D9DA 4HWFA 1HG2A 2LOPA 4JI4T 3VR8A 5HCJA 4ZI7E 2D2SA 3ESLA 1HFAA 2CLYB 3F2EA 4V1Av 3N9LA 2PBIA 4U2YA 3MK7C 1V9DA 4AQYT 3EDUA 2X9YA 5AQPB 2XTLA 4L5GA 2VL8A 4U33A 3O9XA 5LGNB 4WYVA 5JH7E 3KVAA 1S35A 2BS3A 2MBGA 2CHOA 4X1IE 3RLFF 2LSKA 4DR2T 2KXPB 3MXZA 5C3JA 3QK6A 2WDVA 4H9SE 3P4PA 3ZMTB 1O3XA 1MMGA 4QH4A 2CM0A 4ILAA 3Q5DA 3V5SA 4KI0F 3AE1A 5LG4A 3L8RA 2UXNB 5JRCA 3UU8A 4AKHA 5EK2A 4EB6E 1IJ6A 5FXWA 3K1SA 1G73A 2KWIB 4ISSA 4U2ZA 3ANWA 4HE8A 1VOMA 4PAGA 1ZP0A 2XAGB 5CB4E 3PUVF 1FEWA 2Q9QA 2BKOA 4QHOA 4GIWA 5CFBA 2JQHA 3B13A 2FJEA 4GYSA 3VKHA 4EOZB 2LKGA 4OX9T 4JI6T 4NUVA 2XSAA 1UX5A 4HWCA 4DR5T 4EAHA 1SHZC 3HR0A 5FXZA 4O4HE 3NBXX 2YEVC 3NKZA 4A97A 2KZ7B 3LK2B 2V6YB 4K0UA 3ZT7A 2N9DA 3TLSA 3RIAA 4CI2B 3EAMA 1D0XA 2KT9A 4UVCB 4IE5A 3DJBA 3IA3A 5CGMA 2NWBA 4HTEA 2FUPA 2IUBA 3FB2A 4PK5A 5L2LA 3P4SA 4TZ4C 3PUZF 3CQXC 2LHNA 4IDNA 1UK5A 5IYZE 5HEOA 1IZNB 1WYCA 2WWVA 4BJMA 4O4IE 2HPLA 4WW0A 4EEBA 3DP7A 3AA0B 4I4TE 2NW7A 2L3LA 5AQGB 4H9NC 1OEDE 4U72A 2E9XA 4IIJE 5BR8T 1HNXT 1DU2A 3UULA 2CMRA 3L39A 3IBPA 5JDHA 3RPUA 4DV3T 3AEGA 4KMCA 1UUSA 4TUYE 5LOVE 1N32T 4QXCB 1LVKA 5HXEA 3PDYA 4XBFB 3HKBE 5J0ZA 2LM9A 3AA7B 4U74A 2N1GA 4PK6A 4IL4A 4E7ZA 3AE5A 4DNDA 4ZEYA 1VRBA 1CHUA 2M6IA 4DO0A 4HWHA 4P09A 2LSYA 1OWAA 3ZLIA 4I50E 4EGWA 4PFPA 5ETWA 5KX5E 2VKHA 2W62A 5LGUB 5DJQC 2D0TA 2BZBA 2VWAA 3A5XA 3NVOA 4HFIA 2VKDA 3RRCA 4X20E 3BQKA 3ZC0A 3HA4A 2XM2A 5GONE 3OTOT 3MACA 5LJNA 2V6YA 5KXJA 3KV9A 3E22E 1YKEB 1ZOYA 2DWKA 2ODVA 3SFDA 4MLKA 4IGUA 3H3AA 3EHZA 1Y01A 2WB5A 3PUQA 2W4XA 4ZS3A 1E7PA 4CXWA 1KNRA 5EZYE 3MA9A 2HN1A 1UX4A 3N9OA 3AE7A 3UUNA 1E1HB 1BR0A 4DV6T 3ZT6A 4QXHB 5AQMB 1HNZT 4U3CA 1LRZA 4LF9T 3P4RA 3UU4A 4EZ4A 3BQLA 2ES0A 2K9AA 1YQ4A 2IAKA 4HFHA 1KK7A 3RYFE 5DQWA 2ZLYA 3W15B 3PUYF 2EHOB 2Z6EA 2RPAA 3CX8B 4ZI2C 1QLBA 5FKYA 3VR9A 2UXXB 3ONXA 5M4YA 3HL6A 3C51A 4CN6A 2LM2A 5A1LA 4HFEA 5LHHB 2WY2A 3OJAA 3QNUA 4AIUA 3PUGA 5JR9B 2BVLA 1X9BA 4UIGA 2W00A 2XQ3A 2SPCA 2VL0A 4UXNB 3Q5EA 3AVRA 1XDOA 5JTGA 4B3MT 3FXEB 4Q25A 3E0ZA 1JNRA 4UV8B 1MIVA 3CQGB 3CIRA 3RKOA 3SOLA 2IW5B 1NAFA 3CVRA 4Z91A 2YKSA 2W66A 4JI2T 2W63A 2YU1A 1T72A 1WFDA 4UR9A 4KHPT 4DUZT 4Z8XA 1MIWA 2XQYA 4H9PC 1IBMT 5JDFA 4DR6T 1UGOA 1NWMX 4DBQA 3AE6A 5H6RB 1US7B 4DR1T 5IWAT 4YXDA 2JPFA 3ONLC 2R6GF 5ADXL 2Q9QD 1LKXA 1EZ3A 5AQSB 1W09A 1Z0PA 3EVYA 5FL0A 2VK9A 5AQLB 5JDQA 2X0LB 2RP4A 5ABFB 4LFCT 1OEDC 1XNRT 5LB7B 4MFRA 2WAUA 4QX8B 4G2AA 2JMHA 1NEKA 2B1EA 2YDSA 3O4XE 5LG3A 3MZKB 4OYKA 3OBVE 2UXBT 3ETVA 1ZHCA 4PNIA 2MTQA 1YKHB 4O4JE 4A5XA 5CJ5A 1N34T 3CWZB 2FBWA 1M62A 2EHOA 2K3WA 2ACXA 2WDQA 3PE0A 4JEUB 5HXRA 2J1DG 2CEAA 4UEMA 2YOEA 1YW0A 1N36T 2XPKA 4HN9A 5H6QB 5HWXA 2E8IA 5TAOA 2J62A 1WYBA 2CRBA 2V5DA 4NPPA 4HFCA 4F6RC 5HEJA 4E7SA 3UFGA 5JR9A 3LFMA 2K48A 3WAKA 4CN4A 2A3DA 4P0BA 3JC6C 2V7LA 2IIUA 2H7VC 3SFEA 2P9BA 3PJAA 4HGAA 1VCTA 2JIWA 3LJCA 2V5CA 4YFSA 5KMGP 2K5BB 2WM9A 3PURA 1E2AA 2XJ7A 2NP9A 2CE7A 1XMOT 4L9IA 4IDPA 3ZMVB 4KBMB 4PJMA 3ZMUB 2PG8A 3BQIA 4PW8A 1HG5A 1IBLT 4DV2T 2OA5A 3AEFA 3V5UA 3FXDB 3NZQA 3ZKRA 2X68A 4B3TT 5HXHA 2CWOA 1WRDA 2AE9A 4I43B 1KNZA 1HX8A 1T7SA 3X1DA 3PUSA 4JI1T
chains in the Genus database with same CATH topology
3F57A 4U72A 4C90A 2E9XA 4IIJE 4OK0A 3C50A 4QX7B 5LHIB 5JDMA 4L0RA 3Q2MA 2V7MA 5EK4A 3UULA 2CMRA 2KINB 2X9XA 3ZYLA 4AKIA 4IE7A 3P7IA 2JQQA 3MKDA 3NZPA 5FY7A 3VU7H 4B6XA 3HKCE 3IBPA 5JDHA 3RPUA 3KINB 4TV9E 2PJQA 2PFVA 3O1IA 2Q9QC 4KMCA 3K3OA 4ZI3C 4TUYE 4EIWA 4HKAA 3AAIA 5LOVE 3ZC1A 3P8CD 1WLXA 4YLHA 1ZV4X 2Y48B 4H63V 3R84B 4QXCB 1LVKA 5HXEA 3PDYA 3UUMA 4ZHQE 4XBFB 3CQCB 3HKBE 3RYHE 3J7Yq 4UV9B 1HTJF 2LM9A 2XAQB 5J2UE 3AA7B 4U74A 2L9QA 4X1KE 3JC6D 1MNEA 2DHRA 4A56A 3SS1A 2N1GA 2LOSA 4PK6A 4EYUA 5JR9C 4E7ZA 1U5PA 4DNDA 4C91A 1G8XA 2DNXA 3M65A 2JMKA 4M1PA 1VRBA 5FXXA 4ASKA 2KLQA 2LEHA 3OYXA 4DO0A 4P09A 3ZEFB 5L3CB 2XAFB 3KDSE 4GYRA 5L3DB 4IDZA 3HKDE 1FIOA 2LSYA 2YINA 5LXTE 4AKLA 1OWAA 3I0QA 3K3QC 3ZLIA 4I50E 4PFPA 2RA1A 3N9NA 3CX6B 2V7IA 4IHJE 5ETWA 3I9YA 5KX5E 2VKHA 2W62A 2YK0A 5LGUB 5DJQC 2D0TA 2BZBA 3Q5XA 4AI6A 2VWAA 2ZM2A 3A5XA 3GN5A 2VKDA 3ZYMA 3RRCA 4X20E 3BQKA 3ZCIA 3ZPOA 4YJ2E 3HA4A 3ZC0A 4EYYR 4WBOA 5GONE 4UVAB 3R6NA 3SRZA 5EK3A 5FY1A 4CQIA 2LHRA 3U3IA 3MACA 3CMLA 2H7OA 3UTKA 5LJNA 2ZM8A 4UF0B 1U4QA 4IE6A 3KV9A 4GOUA 1D1CA 3KVBA 3K3NA 3E22E 1YKEB 2DWKA 2LE8A 4PJJA 3RYCE 2ODVA 3GA8A 4JUYA 4MLKA 4IGUA 3H3AA 4ERRA 3Q5WA 3GMIA 5LP6E 2LSJA 3ETUA 1LVFA 3PUQA 4TN7B 3LK42 4TX5A 2X67A 2V7JA 4PJLA 4ZS3A 3RRWA 5LHGB 5DABA 4CXWA 5JREA 5LBQB 4GK0E 5DQVA 5EZYE 1X79A 2W61A 3MA9A 2ODUA 2WWUA 4TV8E 1UX4A 2E9XC 3O1HA 3N9OA 2A72A 3AAEB 4CI3B 4MBQA 4JEHB 5FP3A 4PFOA 2N2NA 3UUNA 3AA6B 1D0YA 2NOXA 1HS7A 1E1HB 4PK4A 1BR0A 5LBMA 4ZI3D 4QXHB 1ZEEA 3FBLA 3ZJ2A 2W0GA 4MALA 3CX7B 3IEEA 2XHEB 2L8KA 4YJ3E 5F8PA 2BVMA 2CCQA 2D5UA 1LRZA 2EHOC 3C64A 2NTXA 3I9WA 4GK5E 5FMNA 3S4UA 3VKGA 4AXPA 1UCUA 5L3GB 2E9XB 3IHRA 1SA0E 3C98B 3RC3A 3RYIE 2DI4A 5C8YE 4EZ4A 5LGTB 4ISTA 3BQLA 4EZHA 1Y64B 2ES0A 2K9AA 4O2BE 5JQGE 5FXVA 3B57A 2A2FX 2IAKA 4KUMB 2GK9A 3LBXB 3C4XA 3T8OA 4DMVA 2X51A 4JLEA 4PJNA 1IAPA 4CI1B 2VKOA 1KK7A 1BR2A 5L3FB 2CXDA 4I55E 3RYFE 4IE0A 2ZLYA 5DQWA 3W15B 5LJMA 4QKNA 5JRCB 2JJ9A 3ZYKA 2EHOB 2Z6EA 3CX8B 4ZI2C 2WMNA 4CXXA 2D0UA 2BDEA 3QC9A 5JVDE 2UXXB 3ANWB 1H7CA 3HI2A 3O1JA 3ONXA 5M4YA 3HL6A 3H37A 5HYAA 2V1DB 3C51A 2Q9QB 5A1LA 3LK3B 4OFZA 2C5IT 2VKJA 2CXLA 5LHHB 3OJAA 4H9OC 2WSSV 2NW9A 1OXZA 1D0ZA 2LT3A 2WMOA 2XAHB 1HCIA 5E0OA 3C4ZA 5IHYA 3L09A 3PUGA 5LA6E 4X1YE 5JDNA 2IC6A 5JR9B 2BVLA 4UIGA 2W00A 2SPCA 4UXNB 4H9QC 3AVRA 2HPJA 2X9WA 3IF8B 4ZOLE 3FXEB 3D0TA 3MJXA 2WBLA 2NTYA 4DVDA 4FJOA 3UFEA 5FYMA 5AFUL 3CKDA 3E0ZA 4UV8B 3SWHA 4J2CA 1MIVA 3CQGB 1QUUA 3ZN0B 2CLYC 3N9QA 3RKOA 3SOLA 1D1BA 2IW5B 1NAFA 3Q9DA 2E9XD 3CVRA 2V7KA 2DCFA 3ZJ1A 2LJLA 4O2AE 4O8SA 4NUUA 2C5KT 3EDVA 3I0OA 3FBZA 3UUXB 4UF0A 4KP3C 3WI3A 2W63A 4QXBB 1BR1A 3LG7A 2YU1A 2G0UA 2VASA 2XUEA 1BR4A 2VB6A 3RH3A 1HG2A 2LOPA 4Z8XA 5FNVE 1FMVA 3AVSA 5HXCA 1MIWA 2XQYA 3K8PC 4H9PC 4ZI7E 4HFVA 1YD8G 2V26A 5JDFA 2EHOD 3VHLA 2D2SA 3ESLA 1HFAA 2X9HA 3N2OA 1NWMX 2CLYB 4BJNA 2Y6XA 4OHFA 4DBQA 1MIYA 5H6RB 3F2EA 4AKRB 1US7B 4OYJA 4V1Av 5CA0E 3OKQA 4UVBB 3N9LA 2PBIA 2ZM0A 3KBUA 3KV6A 4AQFA 3BK9A 2JPFA 1V9DA 3MK7C 2LSGA 4EXTA 3EDUA 5HWYA 5ADXL 2X9YA 4UELA 3OYZA 2Q9QD 1LKXA 4MHCA 2XTLA 4L5GA 5L3BB 2LSIA 4XAXB 4QWNB 2ZMAA 2KMFA 1EZ3A 2VL8A 5FY0A 3O9XA 5LGNB 3GWHA 5LNKA 1Z0PA 3EVYA 5JH7E 2VK9A 1HF8A 2DWGA 3KVAA 4ZI2D 1S35A 1IJ5A 1MNDA 2MBGA 5JDQA 2X0LB 2RP4A 3KV5A 4X1IE 2LSKA 5J1GA 2C0SA 2XASB 2KXPB 4MFRA 2WAUA 4QX8B 4G2AA 2JMHA 3F31A 5HAXA 3MXZA 3KV4A 4H9RC 3J9X1 2B1EA 1AJ3A 1CUNA 4DBRA 3O4XE 3QK6A 3PU8A 3MZKB 4FI5A 4OYKA 3OBVE 3ETVA 1ZHCA 4PNIA 4H9SE 1B7TA 2MTQA 2X66A 2XAJB 2DLRA 3ZMSB 1YKHB 4O4JE 3ZMTB 3LBXA 4N78D 1O3XA 2CXFA 1MMGA 2CM0A 4YHJA 3V5SA 3UT5E 3ZCJA 5LG4A 2QGSA 2UXNB 3CWZB 5JRCA 3KFWX 4WBNE 2EHOA 2MYSA 2ACXA 3N9PA 2HH7A 4AKHA 3PE0A 4JEUB 5HXRA 5EK2A 2J1DG 2CEAA 4UEMA 4EB6E 1IJ6A 3RC8A 3PU3A 5BMVE 3DTOA 5FXWA 1YW0A 1G73A 4HN9A 1MMNA 2KWIB 3C4WA 4ISSA 5H6QB 3ANWA 4HE8A 1VOMA 4PAGA 5HWXA 2XAGB 5CB4E 2E8IA 3KBTA 4ILUA 3I1AA 1FEWA 2Q9QA 5TAOA 4QHOA 1WYBA 4GIWA 4CZZB 2QA7A 1QSDA 3FHNA 3B13A 3ZN1B 4GYSA 3VKHA 4EOZB 2H3RA 3NRYA 3CPZA 4F6RC 1MMDA 3AB3B 4NUVA 3GN5B 2YU2A 4H63H 2I59A 4E7SA 1UX5A 1FMWA 1T98A 4BA9A 3U78A 5LCYA 5L3EB 4EAHA 1SHZC 3HR0A 5JR9A 3LFMA 3N5LA 5FXZA 5JDGA 2K48A 3WAKA 4O4HE 2A3DA 3NBXX 4P0BA 3JC6C 2YEVC 2KNDA 2V7LA 3ZMZB 2H7VC 3EUHA 1D1AA 2P9BA 2KZ7B 3LK2B 4G63A 3HKEE 2MOZA 4K0UA 2N9DA 5J2TE 3AA1B 4HGAA 4CI2B 2NW8A 4BAYB 4P0AA 3LJCA 4WNKA 4YFSA 4AQFC 3E08A 3PUAA 4XZCA 5KMGP 4ADZA 4O4LE 1D0XA 2IC9A 2K5BB 2KT9A 4AKGA 2Y8DA 4UVCB 1ZKEA 3DJBA 4IE5A 2KWHA 2WM9A 3WAJA 3PURA 2NWBA 4HTEA 5LYJE 4AQGA 2NP9A 4ANJA 2CE7A 4HEAA 3RX6A 4CXYA 4L9IA 4ZS2A 2C5JA 3FB2A 4PK5A 3ZMVB 3PTRB 3NRXA 4KBMB 5L2LA 4PJMA 3N9MA 3ZMUB 4TZ4C 2PG8A 3CQXC 3BQIA 4PW8A 2K24A 1HG5A 5CA1E 2LHNA 2OA5A 3V5UA 3FXDB 2M67A 3N2GE 5IYZE 5JDLA 3NZQA 3L3PA 3QUJA 1IZNB 1WYCA 2X68A 5HXHA 2CA5A 2JRKA 3TKLB 2CWOA 1WRDA 2CWYA 4BJMA 4O4IE 5F3JA 5KDMC 4DMWA 4I43B 1KNZA 2HPLA 1HX8A 4WW0A 3DP7A 3AA0B 4IE4A 4I4TE 3N2KE 3AAAB 5HXSA 1MMAA 2NW7A 1WR6A 3PUSA 2L3LA 1S94A 4H9NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ6 A;  2C5I T;  3QK6 A;  4FI5 A;  3CKD A;  3FXD B;  4L0R A;  4J2C A;  2IC9 A;  3N5L A;  1LRZ A;  2K48 A;  1ZKE A;  1Z0P A;  2KWH A;  2KWI B;  3L3P A;  3QUJ A;  3S4U A;  2X9X A;  1IJ5 A;  2MBG A;  3CVR A;  3P7I A;  2CA5 A;  3TKL B;  2IC6 A;  1QSD A;  4B6X A;  2C5K T;  4DND A;  2C5J A;  1LVF A;  1H7C A;  4EYY R;  2X9Y A;  2X9W A;  2G0U A;  3MXZ A;  2XTL A;  4CQI A;  3FXE B; 
#chains in the Genus database with same CATH topology
 5ABF A;  4LML A;  5EK4 A;  2X9X A;  2JQQ A;  3MKD A;  4DR4 T;  1XDP A;  4HWD A;  2PJQ A;  2PFV A;  3O1I A;  2Q9Q C;  2WCA A;  3ZT5 A;  4HKA A;  3ZC1 A;  1WLX A;  4I0U A;  5HCM A;  3RYH E;  4UV9 B;  1HTJ F;  2XAQ B;  2CBI A;  2L9Q A;  3SS1 A;  2LOS A;  3AEA A;  4C91 A;  1G8X A;  2DNX A;  4M1P A;  2F4V T;  4JYA T;  2LEH A;  5L3C B;  1FIO A;  2J4G A;  5LXT E;  2BKP A;  3K3Q C;  2CPT A;  3CX6 B;  2V7I A;  4IHJ E;  1N33 T;  2BG9 E;  2IHR 1;  3ZYM A;  3ZPO A;  4WBO A;  4LF7 T;  3U3I A;  4U7Y A;  2ZM8 A;  2XQ4 A;  3UUB A;  3T1H T;  1D1C A;  3K3N A;  1FJG T;  2BKN A;  1KF6 A;  4B3R T;  5AQV B;  3Q5W A;  5LP6 E;  3PUW F;  4TN7 B;  3LK4 2;  4X5T A;  5AQR B;  2X0Y A;  2V7J A;  4PJL A;  3RRW A;  5JRE A;  3QB5 K;  4GK0 E;  5DQV A;  1X79 A;  4YTN A;  2ODU A;  2WWU A;  4TV8 E;  2E9X C;  3O1H A;  4JEH B;  5FP3 A;  1D0Y A;  2UUB T;  2NOX A;  4IT4 A;  4PK4 A;  5LBM A;  4ZI3 D;  3FBL A;  3CX7 B;  4HFB A;  1L0V A;  2D5U A;  2BS2 A;  3C64 A;  2NTX A;  3S4U A;  5L3G B;  3C98 B;  3RC3 A;  3QOF A;  4KHZ F;  4O2B E;  4LF6 T;  5FXV A;  3RKG A;  2GK9 A;  3FZM B;  3LBX B;  5ABE A;  2VKO A;  2CXD A;  1J5E T;  5LJM A;  1R8I A;  4YT0 A;  2BDE A;  4F8H A;  3QC9 A;  2DL1 A;  3HI2 A;  3O1J A;  3EAB A;  2V1D B;  3LK3 B;  4OFZ A;  4TWH A;  4H9O C;  2WSS V;  2LT3 A;  2WMO A;  5E0O A;  5IHY A;  3L09 A;  4JI3 T;  2AXD S;  3TLT A;  4H9Q C;  3IF8 B;  2WBL A;  2NTY A;  3UFE A;  3EI0 A;  3SWH A;  4J2C A;  2B76 A;  2XQ8 A;  4U7I A;  3ZN0 B;  2V7K A;  3G06 A;  3ZJ1 A;  4O2A E;  4O8S A;  2C5K T;  3A7M A;  2FJD A;  4QXB B;  3LG7 A;  2G0U A;  2VVS A;  2VAS A;  2XUE A;  4AIS A;  4ZZC A;  4NXM T;  2VB6 A;  3ZST A;  2H88 A;  5FNV E;  1FMV A;  3AVS A;  3K8P C;  1YD8 G;  2EHO D;  1M7K A;  2X9H A;  2Y6X A;  3FZL B;  4YHH T;  1KFY A;  4AKR B;  4OYJ A;  4UVB B;  2ZM0 A;  3KBU A;  3KV6 A;  4AQF A;  4EXT A;  5HWY A;  4UEL A;  3OYZ A;  2LSI A;  4XAX B;  4QWN B;  2ZMA A;  2VUR A;  2BS4 A;  5HEG A;  4ZZB A;  2JQ9 A;  1HF8 A;  3RIF A;  3KV5 A;  2ZM6 T;  5J1G A;  2XAS B;  3RIU C;  1J1J A;  1KEY A;  1XZY A;  3KV4 A;  4H9R C;  3J9X 1;  1AJ3 A;  4DR3 T;  4DBR A;  2V6X A;  3PU8 A;  4FI5 A;  4DV1 T;  5AQJ B;  1HX1 B;  2X66 A;  2DLR A;  3RQU A;  3LBX A;  3FZK B;  4YHJ A;  3UT5 E;  2YDQ A;  2QGS A;  2LRL A;  4LFB T;  3UQ4 A;  4WBN E;  5AQH B;  3N9P A;  2WZH A;  3RC8 A;  3PU3 A;  5BMV E;  3DTO A;  4DUY T;  1MMN A;  3FZF B;  4ILU A;  3I1A A;  2QA7 A;  5AQI B;  4LMK A;  3ZN1 B;  3AE3 A;  3AXJ B;  2BG9 C;  2X0H A;  3AB3 B;  3GN5 B;  2YU2 A;  1IBK T;  1FMW A;  1T98 A;  4BA9 A;  1YXR A;  5LCY A;  5L3E B;  2M6B A;  3UU3 A;  3T1Y T;  2KND A;  1JNZ A;  3UU5 A;  1D1A A;  5J2T E;  3TLU A;  3JAE A;  2NW8 A;  4WNK A;  3E08 A;  4O4L E;  4AKG A;  4KX6 A;  2Y8D A;  2MPK A;  4NIQ A;  5LYJ E;  4AQG A;  4HEA A;  3RX6 A;  3AE2 A;  2C5J A;  3JAD A;  3PTR B;  3NRX A;  2K24 A;  3N2G E;  3L3P A;  2QYW A;  4TWD A;  5F3J A;  4DMW A;  2BBJ A;  5HXS A;  3M3Z B;  4IL9 A;  4LF8 T;  3F57 A;  5LHI B;  4QX7 B;  2XQ5 A;  3Q2M A;  2V7M A;  1I94 T;  3ZYL A;  3P7I A;  2E5L T;  2JQK A;  4B6X A;  4COF A;  4DV7 T;  3KIN B;  4TV9 E;  3K3O A;  3UQ7 A;  2Y48 B;  4ZHQ E;  3CQC B;  3J7Y q;  3ONJ A;  5J2U E;  4X1K E;  2DHR A;  4A56 A;  4EYU A;  5JR9 C;  2A9U A;  2XAF B;  4GYR A;  5L3D B;  4U31 A;  2WDR A;  3N9N A;  1W9R A;  2PTF A;  3I9Y A;  4QH5 A;  4Z90 A;  4DR7 T;  3AXJ A;  3Q5X A;  2ZM2 A;  3GN5 A;  4YJ2 E;  3ZCI A;  3JCF A;  4IDQ A;  4UVA B;  3R6N A;  2J47 A;  5FY1 A;  2WP9 A;  3CML A;  3UTK A;  4UF0 B;  4A98 A;  2YDR A;  4GOU A;  4LF5 T;  3KVB A;  2LE8 A;  2UXC T;  3GA8 A;  1XWM A;  4JUY A;  3TLV A;  4ERR A;  3GMI A;  3ETU A;  5L47 A;  2XQ7 A;  4TX5 A;  5DAB A;  2YN6 A;  5LBQ B;  5AQN B;  2W61 A;  4YSX A;  2XM1 A;  3AAE B;  4EV6 A;  2XQA A;  4MBQ A;  4K0K T;  2N2N A;  2V8S V;  4IRE A;  2VVN A;  3JAF A;  1VCS A;  1ZEE A;  4ZXL A;  3P4W A;  2W0G A;  4MAL A;  5AQF B;  3IEE A;  2L8K A;  3RQW A;  2BVM A;  4GK5 E;  3I9W A;  5FMN A;  3VKG A;  2E9X B;  3RYI E;  1SA0 E;  2DI4 A;  4JI5 T;  2OV9 A;  2IDO B;  3B57 A;  4KUM B;  3T8O A;  4PJN A;  2W2U A;  1KNP A;  1BR2 A;  4I55 E;  2BBH A;  4IE0 A;  1WR0 A;  3ZYK A;  5AQQ B;  3RGL A;  2WMN A;  4CXX A;  2D0U A;  4YTM A;  3H37 A;  2XSB A;  2C5I T;  2VKJ A;  2NW9 A;  3RF1 A;  4YTP A;  2XAH B;  2WS3 A;  5AQK B;  5LA6 E;  5AQT B;  5JDN A;  5L4H A;  5LMU T;  2MAW A;  2KSR A;  4YY3 T;  4YSZ A;  2HPJ A;  2WQY A;  3D0T A;  4DVD A;  5FYM A;  3AEB A;  3AE4 A;  5AFU L;  5IUX A;  4CN1 A;  1QUU A;  4TWF A;  2CLY C;  2LJL A;  3I0O A;  3FBZ A;  4UF0 A;  1HR0 T;  4KP3 C;  3WI3 A;  1BR1 A;  1W0A A;  1BR4 A;  4X66 T;  3RH3 A;  4GKK T;  5HXC A;  4HFV A;  2V26 A;  3VHL A;  4BJN A;  3N2O A;  2QRX A;  4OHF A;  3A8Y C;  1MIY A;  5CA0 E;  3OKQ A;  3BK9 A;  2LSG A;  3TLW A;  4MHC A;  5L3B B;  4ILB A;  2KMF A;  2XZE A;  3VRB A;  5FY0 A;  3GWH A;  5LNK A;  2DWG A;  4ZI2 D;  1IJ5 A;  1MND A;  2C0S A;  3F31 A;  5HAX A;  3UU6 A;  1CUN A;  5FVK A;  1B7T A;  2XAJ B;  3NWI A;  4X64 T;  3ZMS B;  4N78 D;  2CXF A;  5C2T A;  3ZCJ A;  3KFW X;  2MYS A;  3VRA A;  2HH7 A;  2FJB A;  2UXD T;  3B5M A;  3C4W A;  5LMN T;  3KBT A;  4B3S T;  4P1N A;  4TNV A;  4CZZ B;  1QSD A;  1J5W A;  2E2A A;  3FHN A;  1HNW T;  2H3R A;  3NRY A;  3CPZ A;  2VQF T;  4DV0 T;  1MMD A;  4H63 H;  2I59 A;  3U78 A;  2OLT A;  1SE7 A;  4LFA T;  3N5L A;  5JDG A;  2W67 A;  3ZMZ B;  3EUH A;  4JV5 T;  4G63 A;  3HKE E;  2MOZ A;  3AA1 B;  2BG9 B;  4BAY B;  4P0A A;  4AQF C;  3PUA A;  4XZC A;  4ADZ A;  3FZH B;  2IC9 A;  3WAJ A;  1ZKE A;  2KWH A;  1T8B A;  2XQ9 A;  4ANJ A;  4CXY A;  2FJA A;  4ZS2 A;  5L4E A;  1XMQ T;  5HEU A;  3N9M A;  4LF4 T;  5CA1 E;  1I6Z A;  2UUC T;  2M67 A;  5JDL A;  3QUJ A;  2CA5 A;  2JRK A;  3TKL B;  2CWY A;  5KDM C;  1XNQ T;  4JI8 T;  4IE4 A;  3N2K E;  3AAA B;  4HFD A;  1MMA A;  1WR6 A;  1S94 A;  2I0M A;  4C90 A;  2LKH A;  4OK0 A;  3C50 A;  5JDM A;  4L0R A;  5ABH A;  1YQ3 A;  1SUM B;  2KIN B;  4AKI A;  4IE7 A;  4HWI B;  5FY7 A;  3NZP A;  3VU7 H;  3HKC E;  1OED B;  4ZI3 C;  4TNW A;  4EIW A;  2WU5 A;  3AAI A;  2VQE T;  3P8C D;  4YLH A;  4WZX A;  1ZV4 X;  3R84 B;  4H63 V;  4JBW F;  3UUM A;  3RIU A;  3JC6 D;  1MNE A;  4IDO A;  1U5P A;  3M65 A;  2JMK A;  5FXX A;  4ASK A;  1UUR A;  2KLQ A;  3OYX A;  3ZEF B;  3KDS E;  4IDZ A;  3HKD E;  2YIN A;  4AKL A;  3I0Q A;  4LMJ A;  2RA1 A;  2YK0 A;  1W0B A;  4AI6 A;  4EYY R;  3SRZ A;  5EK3 A;  4CQI A;  2LHR A;  4DV5 T;  3ZSS A;  2H7O A;  1U4Q A;  4IE6 A;  2H89 A;  3RYC E;  4PJJ A;  5FVL A;  2BG9 A;  4EED A;  3AEE A;  3P4Q A;  2LSJ A;  1LVF A;  4DV4 T;  2X67 A;  1NEN A;  4X65 T;  3OVU A;  5LHG B;  5AQU B;  2LLY A;  2A72 A;  5HEH A;  2HN2 A;  3QB5 A;  4CI3 B;  4JI7 T;  2QVA A;  4PFO A;  3AA6 B;  1HS7 A;  2IML A;  5FL1 A;  5AQO B;  4ILC A;  3H3M A;  3ZJ2 A;  4YJ3 E;  2XHE B;  5F8P A;  2CCQ A;  2I6H A;  2EHO C;  1WCR A;  4AXP A;  1UCU A;  5C8Y E;  3IHR A;  5LGT B;  4IST A;  4EZH A;  2XY8 B;  1Y64 B;  5JQG E;  2A2F X;  3C4X A;  4DMV A;  2X51 A;  4JLE A;  2WZI A;  1IAP A;  1GQE A;  4CI1 B;  4JI0 T;  3ABV A;  5L3F B;  2NR4 A;  1Z8U A;  2UUA T;  5JRC B;  4QKN A;  4YSY A;  2ACZ A;  2CHN A;  2JJ9 A;  1OED A;  3AEC A;  5JVD E;  4GKJ T;  3ANW B;  1H7C A;  3PJA J;  5HYA A;  2Q9Q B;  3AED A;  2CBJ A;  2CXL A;  1OXZ A;  2UU9 T;  1D0Z A;  1HCI A;  3C4Z A;  2XQ6 A;  4X62 T;  2LRK A;  3LDQ B;  3RHW A;  4X1Y E;  3P50 A;  3AE9 A;  2IC6 A;  4QH1 A;  3PV0 F;  4DID B;  3OPC A;  2HHH T;  2X9W A;  3PUX F;  4ZOL E;  5F5W A;  2E5V A;  3MJX A;  4FJO A;  3RI5 A;  3CKD A;  3CK6 A;  3AE8 A;  5ABG A;  3N9Q A;  1D1B A;  3Q9D A;  2E9X D;  2DCF A;  3LSV A;  4NUU A;  3EDV A;  3UUX B;  2WU2 A;  4NXN T;  2D9D A;  4HWF A;  1HG2 A;  2LOP A;  4JI4 T;  3VR8 A;  5HCJ A;  4ZI7 E;  2D2S A;  3ESL A;  1HFA A;  2CLY B;  3F2E A;  4V1A v;  3N9L A;  2PBI A;  4U2Y A;  3MK7 C;  1V9D A;  4AQY T;  3EDU A;  2X9Y A;  5AQP B;  2XTL A;  4L5G A;  2VL8 A;  4U33 A;  3O9X A;  5LGN B;  4WYV A;  5JH7 E;  3KVA A;  1S35 A;  2BS3 A;  2MBG A;  2CHO A;  4X1I E;  3RLF F;  2LSK A;  4DR2 T;  2KXP B;  3MXZ A;  5C3J A;  3QK6 A;  2WDV A;  4H9S E;  3P4P A;  3ZMT B;  1O3X A;  1MMG A;  4QH4 A;  2CM0 A;  4ILA A;  3Q5D A;  3V5S A;  4KI0 F;  3AE1 A;  5LG4 A;  3L8R A;  2UXN B;  5JRC A;  3UU8 A;  4AKH A;  5EK2 A;  4EB6 E;  1IJ6 A;  5FXW A;  3K1S A;  1G73 A;  2KWI B;  4ISS A;  4U2Z A;  3ANW A;  4HE8 A;  1VOM A;  4PAG A;  1ZP0 A;  2XAG B;  5CB4 E;  3PUV F;  1FEW A;  2Q9Q A;  2BKO A;  4QHO A;  4GIW A;  5CFB A;  2JQH A;  3B13 A;  2FJE A;  4GYS A;  3VKH A;  4EOZ B;  2LKG A;  4OX9 T;  4JI6 T;  4NUV A;  2XSA A;  1UX5 A;  4HWC A;  4DR5 T;  4EAH A;  1SHZ C;  3HR0 A;  5FXZ A;  4O4H E;  3NBX X;  2YEV C;  3NKZ A;  4A97 A;  2KZ7 B;  3LK2 B;  2V6Y B;  4K0U A;  3ZT7 A;  2N9D A;  3TLS A;  3RIA A;  4CI2 B;  3EAM A;  1D0X A;  2KT9 A;  4UVC B;  4IE5 A;  3DJB A;  3IA3 A;  5CGM A;  2NWB A;  4HTE A;  2FUP A;  2IUB A;  3FB2 A;  4PK5 A;  5L2L A;  3P4S A;  4TZ4 C;  3PUZ F;  3CQX C;  2LHN A;  4IDN A;  1UK5 A;  5IYZ E;  5HEO A;  1IZN B;  1WYC A;  2WWV A;  4BJM A;  4O4I E;  2HPL A;  4WW0 A;  4EEB A;  3DP7 A;  3AA0 B;  4I4T E;  2NW7 A;  2L3L A;  5AQG B;  4H9N C;  1OED E;  4U72 A;  2E9X A;  4IIJ E;  5BR8 T;  1HNX T;  1DU2 A;  3UUL A;  2CMR A;  3L39 A;  3IBP A;  5JDH A;  3RPU A;  4DV3 T;  3AEG A;  4KMC A;  1UUS A;  4TUY E;  5LOV E;  1N32 T;  4QXC B;  1LVK A;  5HXE A;  3PDY A;  4XBF B;  3HKB E;  5J0Z A;  2LM9 A;  3AA7 B;  4U74 A;  2N1G A;  4PK6 A;  4IL4 A;  4E7Z A;  3AE5 A;  4DND A;  4ZEY A;  1VRB A;  1CHU A;  2M6I A;  4DO0 A;  4HWH A;  4P09 A;  2LSY A;  1OWA A;  3ZLI A;  4I50 E;  4EGW A;  4PFP A;  5ETW A;  5KX5 E;  2VKH A;  2W62 A;  5LGU B;  5DJQ C;  2D0T A;  2BZB A;  2VWA A;  3A5X A;  3NVO A;  4HFI A;  2VKD A;  3RRC A;  4X20 E;  3BQK A;  3ZC0 A;  3HA4 A;  2XM2 A;  5GON E;  3OTO T;  3MAC A;  5LJN A;  2V6Y A;  5KXJ A;  3KV9 A;  3E22 E;  1YKE B;  1ZOY A;  2DWK A;  2ODV A;  3SFD A;  4MLK A;  4IGU A;  3H3A A;  3EHZ A;  1Y01 A;  2WB5 A;  3PUQ A;  2W4X A;  4ZS3 A;  1E7P A;  4CXW A;  1KNR A;  5EZY E;  3MA9 A;  2HN1 A;  1UX4 A;  3N9O A;  3AE7 A;  3UUN A;  1E1H B;  1BR0 A;  4DV6 T;  3ZT6 A;  4QXH B;  5AQM B;  1HNZ T;  4U3C A;  1LRZ A;  4LF9 T;  3P4R A;  3UU4 A;  4EZ4 A;  3BQL A;  2ES0 A;  2K9A A;  1YQ4 A;  2IAK A;  4HFH A;  1KK7 A;  3RYF E;  5DQW A;  2ZLY A;  3W15 B;  3PUY F;  2EHO B;  2Z6E A;  2RPA A;  3CX8 B;  4ZI2 C;  1QLB A;  5FKY A;  3VR9 A;  2UXX B;  3ONX A;  5M4Y A;  3HL6 A;  3C51 A;  4CN6 A;  2LM2 A;  5A1L A;  4HFE A;  5LHH B;  2WY2 A;  3OJA A;  3QNU A;  4AIU A;  3PUG A;  5JR9 B;  2BVL A;  1X9B A;  4UIG A;  2W00 A;  2XQ3 A;  2SPC A;  2VL0 A;  4UXN B;  3Q5E A;  3AVR A;  1XDO A;  5JTG A;  4B3M T;  3FXE B;  4Q25 A;  3E0Z A;  1JNR A;  4UV8 B;  1MIV A;  3CQG B;  3CIR A;  3RKO A;  3SOL A;  2IW5 B;  1NAF A;  3CVR A;  4Z91 A;  2YKS A;  2W66 A;  4JI2 T;  2W63 A;  2YU1 A;  1T72 A;  1WFD A;  4UR9 A;  4KHP T;  4DUZ T;  4Z8X A;  1MIW A;  2XQY A;  4H9P C;  1IBM T;  5JDF A;  4DR6 T;  1UGO A;  1NWM X;  4DBQ A;  3AE6 A;  5H6R B;  1US7 B;  4DR1 T;  5IWA T;  4YXD A;  2JPF A;  3ONL C;  2R6G F;  5ADX L;  2Q9Q D;  1LKX A;  1EZ3 A;  5AQS B;  1W09 A;  1Z0P A;  3EVY A;  5FL0 A;  2VK9 A;  5AQL B;  5JDQ A;  2X0L B;  2RP4 A;  5ABF B;  4LFC T;  1OED C;  1XNR T;  5LB7 B;  4MFR A;  2WAU A;  4QX8 B;  4G2A A;  2JMH A;  1NEK A;  2B1E A;  2YDS A;  3O4X E;  5LG3 A;  3MZK B;  4OYK A;  3OBV E;  2UXB T;  3ETV A;  1ZHC A;  4PNI A;  2MTQ A;  1YKH B;  4O4J E;  4A5X A;  5CJ5 A;  1N34 T;  3CWZ B;  2FBW A;  1M62 A;  2EHO A;  2K3W A;  2ACX A;  2WDQ A;  3PE0 A;  4JEU B;  5HXR A;  2J1D G;  2CEA A;  4UEM A;  2YOE A;  1YW0 A;  1N36 T;  2XPK A;  4HN9 A;  5H6Q B;  5HWX A;  2E8I A;  5TAO A;  2J62 A;  1WYB A;  2CRB A;  2V5D A;  4NPP A;  4HFC A;  4F6R C;  5HEJ A;  4E7S A;  3UFG A;  5JR9 A;  3LFM A;  2K48 A;  3WAK A;  4CN4 A;  2A3D A;  4P0B A;  3JC6 C;  2V7L A;  2IIU A;  2H7V C;  3SFE A;  2P9B A;  3PJA A;  4HGA A;  1VCT A;  2JIW A;  3LJC A;  2V5C A;  4YFS A;  5KMG P;  2K5B B;  2WM9 A;  3PUR A;  1E2A A;  2XJ7 A;  2NP9 A;  2CE7 A;  1XMO T;  4L9I A;  4IDP A;  3ZMV B;  4KBM B;  4PJM A;  3ZMU B;  2PG8 A;  3BQI A;  4PW8 A;  1HG5 A;  1IBL T;  4DV2 T;  2OA5 A;  3AEF A;  3V5U A;  3FXD B;  3NZQ A;  3ZKR A;  2X68 A;  4B3T T;  5HXH A;  2CWO A;  1WRD A;  2AE9 A;  4I43 B;  1KNZ A;  1HX8 A;  1T7S A;  3X1D A;  3PUS A;  4JI1 T; 
#chains in the Genus database with same CATH homology
 3F57 A;  4U72 A;  4C90 A;  2E9X A;  4IIJ E;  4OK0 A;  3C50 A;  4QX7 B;  5LHI B;  5JDM A;  4L0R A;  3Q2M A;  2V7M A;  5EK4 A;  3UUL A;  2CMR A;  2KIN B;  2X9X A;  3ZYL A;  4AKI A;  4IE7 A;  3P7I A;  2JQQ A;  3MKD A;  3NZP A;  5FY7 A;  3VU7 H;  4B6X A;  3HKC E;  3IBP A;  5JDH A;  3RPU A;  3KIN B;  4TV9 E;  2PJQ A;  2PFV A;  3O1I A;  2Q9Q C;  4KMC A;  3K3O A;  4ZI3 C;  4TUY E;  4EIW A;  4HKA A;  3AAI A;  5LOV E;  3ZC1 A;  3P8C D;  1WLX A;  4YLH A;  1ZV4 X;  2Y48 B;  4H63 V;  3R84 B;  4QXC B;  1LVK A;  5HXE A;  3PDY A;  3UUM A;  4ZHQ E;  4XBF B;  3CQC B;  3HKB E;  3RYH E;  3J7Y q;  4UV9 B;  1HTJ F;  2LM9 A;  2XAQ B;  5J2U E;  3AA7 B;  4U74 A;  2L9Q A;  4X1K E;  3JC6 D;  1MNE A;  2DHR A;  4A56 A;  3SS1 A;  2N1G A;  2LOS A;  4PK6 A;  4EYU A;  5JR9 C;  4E7Z A;  1U5P A;  4DND A;  4C91 A;  1G8X A;  2DNX A;  3M65 A;  2JMK A;  4M1P A;  1VRB A;  5FXX A;  4ASK A;  2KLQ A;  2LEH A;  3OYX A;  4DO0 A;  4P09 A;  3ZEF B;  5L3C B;  2XAF B;  3KDS E;  4GYR A;  5L3D B;  4IDZ A;  3HKD E;  1FIO A;  2LSY A;  2YIN A;  5LXT E;  4AKL A;  1OWA A;  3I0Q A;  3K3Q C;  3ZLI A;  4I50 E;  4PFP A;  2RA1 A;  3N9N A;  3CX6 B;  2V7I A;  4IHJ E;  5ETW A;  3I9Y A;  5KX5 E;  2VKH A;  2W62 A;  2YK0 A;  5LGU B;  5DJQ C;  2D0T A;  2BZB A;  3Q5X A;  4AI6 A;  2VWA A;  2ZM2 A;  3A5X A;  3GN5 A;  2VKD A;  3ZYM A;  3RRC A;  4X20 E;  3BQK A;  3ZCI A;  3ZPO A;  4YJ2 E;  3HA4 A;  3ZC0 A;  4EYY R;  4WBO A;  5GON E;  4UVA B;  3R6N A;  3SRZ A;  5EK3 A;  5FY1 A;  4CQI A;  2LHR A;  3U3I A;  3MAC A;  3CML A;  2H7O A;  3UTK A;  5LJN A;  2ZM8 A;  4UF0 B;  1U4Q A;  4IE6 A;  3KV9 A;  4GOU A;  1D1C A;  3KVB A;  3K3N A;  3E22 E;  1YKE B;  2DWK A;  2LE8 A;  4PJJ A;  3RYC E;  2ODV A;  3GA8 A;  4JUY A;  4MLK A;  4IGU A;  3H3A A;  4ERR A;  3Q5W A;  3GMI A;  5LP6 E;  2LSJ A;  3ETU A;  1LVF A;  3PUQ A;  4TN7 B;  3LK4 2;  4TX5 A;  2X67 A;  2V7J A;  4PJL A;  4ZS3 A;  3RRW A;  5LHG B;  5DAB A;  4CXW A;  5JRE A;  5LBQ B;  4GK0 E;  5DQV A;  5EZY E;  1X79 A;  2W61 A;  3MA9 A;  2ODU A;  2WWU A;  4TV8 E;  1UX4 A;  2E9X C;  3O1H A;  3N9O A;  2A72 A;  3AAE B;  4CI3 B;  4MBQ A;  4JEH B;  5FP3 A;  4PFO A;  2N2N A;  3UUN A;  3AA6 B;  1D0Y A;  2NOX A;  1HS7 A;  1E1H B;  4PK4 A;  1BR0 A;  5LBM A;  4ZI3 D;  4QXH B;  1ZEE A;  3FBL A;  3ZJ2 A;  2W0G A;  4MAL A;  3CX7 B;  3IEE A;  2XHE B;  2L8K A;  4YJ3 E;  5F8P A;  2BVM A;  2CCQ A;  2D5U A;  1LRZ A;  2EHO C;  3C64 A;  2NTX A;  3I9W A;  4GK5 E;  5FMN A;  3S4U A;  3VKG A;  4AXP A;  1UCU A;  5L3G B;  2E9X B;  3IHR A;  1SA0 E;  3C98 B;  3RC3 A;  3RYI E;  2DI4 A;  5C8Y E;  4EZ4 A;  5LGT B;  4IST A;  3BQL A;  4EZH A;  1Y64 B;  2ES0 A;  2K9A A;  4O2B E;  5JQG E;  5FXV A;  3B57 A;  2A2F X;  2IAK A;  4KUM B;  2GK9 A;  3LBX B;  3C4X A;  3T8O A;  4DMV A;  2X51 A;  4JLE A;  4PJN A;  1IAP A;  4CI1 B;  2VKO A;  1KK7 A;  1BR2 A;  5L3F B;  2CXD A;  4I55 E;  3RYF E;  4IE0 A;  2ZLY A;  5DQW A;  3W15 B;  5LJM A;  4QKN A;  5JRC B;  2JJ9 A;  3ZYK A;  2EHO B;  2Z6E A;  3CX8 B;  4ZI2 C;  2WMN A;  4CXX A;  2D0U A;  2BDE A;  3QC9 A;  5JVD E;  2UXX B;  3ANW B;  1H7C A;  3HI2 A;  3O1J A;  3ONX A;  5M4Y A;  3HL6 A;  3H37 A;  5HYA A;  2V1D B;  3C51 A;  2Q9Q B;  5A1L A;  3LK3 B;  4OFZ A;  2C5I T;  2VKJ A;  2CXL A;  5LHH B;  3OJA A;  4H9O C;  2WSS V;  2NW9 A;  1OXZ A;  1D0Z A;  2LT3 A;  2WMO A;  2XAH B;  1HCI A;  5E0O A;  3C4Z A;  5IHY A;  3L09 A;  3PUG A;  5LA6 E;  4X1Y E;  5JDN A;  2IC6 A;  5JR9 B;  2BVL A;  4UIG A;  2W00 A;  2SPC A;  4UXN B;  4H9Q C;  3AVR A;  2HPJ A;  2X9W A;  3IF8 B;  4ZOL E;  3FXE B;  3D0T A;  3MJX A;  2WBL A;  2NTY A;  4DVD A;  4FJO A;  3UFE A;  5FYM A;  5AFU L;  3CKD A;  3E0Z A;  4UV8 B;  3SWH A;  4J2C A;  1MIV A;  3CQG B;  1QUU A;  3ZN0 B;  2CLY C;  3N9Q A;  3RKO A;  3SOL A;  1D1B A;  2IW5 B;  1NAF A;  3Q9D A;  2E9X D;  3CVR A;  2V7K A;  2DCF A;  3ZJ1 A;  2LJL A;  4O2A E;  4O8S A;  4NUU A;  2C5K T;  3EDV A;  3I0O A;  3FBZ A;  3UUX B;  4UF0 A;  4KP3 C;  3WI3 A;  2W63 A;  4QXB B;  1BR1 A;  3LG7 A;  2YU1 A;  2G0U A;  2VAS A;  2XUE A;  1BR4 A;  2VB6 A;  3RH3 A;  1HG2 A;  2LOP A;  4Z8X A;  5FNV E;  1FMV A;  3AVS A;  5HXC A;  1MIW A;  2XQY A;  3K8P C;  4H9P C;  4ZI7 E;  4HFV A;  1YD8 G;  2V26 A;  5JDF A;  2EHO D;  3VHL A;  2D2S A;  3ESL A;  1HFA A;  2X9H A;  3N2O A;  1NWM X;  2CLY B;  4BJN A;  2Y6X A;  4OHF A;  4DBQ A;  1MIY A;  5H6R B;  3F2E A;  4AKR B;  1US7 B;  4OYJ A;  4V1A v;  5CA0 E;  3OKQ A;  4UVB B;  3N9L A;  2PBI A;  2ZM0 A;  3KBU A;  3KV6 A;  4AQF A;  3BK9 A;  2JPF A;  1V9D A;  3MK7 C;  2LSG A;  4EXT A;  3EDU A;  5HWY A;  5ADX L;  2X9Y A;  4UEL A;  3OYZ A;  2Q9Q D;  1LKX A;  4MHC A;  2XTL A;  4L5G A;  5L3B B;  2LSI A;  4XAX B;  4QWN B;  2ZMA A;  2KMF A;  1EZ3 A;  2VL8 A;  5FY0 A;  3O9X A;  5LGN B;  3GWH A;  5LNK A;  1Z0P A;  3EVY A;  5JH7 E;  2VK9 A;  1HF8 A;  2DWG A;  3KVA A;  4ZI2 D;  1S35 A;  1IJ5 A;  1MND A;  2MBG A;  5JDQ A;  2X0L B;  2RP4 A;  3KV5 A;  4X1I E;  2LSK A;  5J1G A;  2C0S A;  2XAS B;  2KXP B;  4MFR A;  2WAU A;  4QX8 B;  4G2A A;  2JMH A;  3F31 A;  5HAX A;  3MXZ A;  3KV4 A;  4H9R C;  3J9X 1;  2B1E A;  1AJ3 A;  1CUN A;  4DBR A;  3O4X E;  3QK6 A;  3PU8 A;  3MZK B;  4FI5 A;  4OYK A;  3OBV E;  3ETV A;  1ZHC A;  4PNI A;  4H9S E;  1B7T A;  2MTQ A;  2X66 A;  2XAJ B;  2DLR A;  3ZMS B;  1YKH B;  4O4J E;  3ZMT B;  3LBX A;  4N78 D;  1O3X A;  2CXF A;  1MMG A;  2CM0 A;  4YHJ A;  3V5S A;  3UT5 E;  3ZCJ A;  5LG4 A;  2QGS A;  2UXN B;  3CWZ B;  5JRC A;  3KFW X;  4WBN E;  2EHO A;  2MYS A;  2ACX A;  3N9P A;  2HH7 A;  4AKH A;  3PE0 A;  4JEU B;  5HXR A;  5EK2 A;  2J1D G;  2CEA A;  4UEM A;  4EB6 E;  1IJ6 A;  3RC8 A;  3PU3 A;  5BMV E;  3DTO A;  5FXW A;  1YW0 A;  1G73 A;  4HN9 A;  1MMN A;  2KWI B;  3C4W A;  4ISS A;  5H6Q B;  3ANW A;  4HE8 A;  1VOM A;  4PAG A;  5HWX A;  2XAG B;  5CB4 E;  2E8I A;  3KBT A;  4ILU A;  3I1A A;  1FEW A;  2Q9Q A;  5TAO A;  4QHO A;  1WYB A;  4GIW A;  4CZZ B;  2QA7 A;  1QSD A;  3FHN A;  3B13 A;  3ZN1 B;  4GYS A;  3VKH A;  4EOZ B;  2H3R A;  3NRY A;  3CPZ A;  4F6R C;  1MMD A;  3AB3 B;  4NUV A;  3GN5 B;  2YU2 A;  4H63 H;  2I59 A;  4E7S A;  1UX5 A;  1FMW A;  1T98 A;  4BA9 A;  3U78 A;  5LCY A;  5L3E B;  4EAH A;  1SHZ C;  3HR0 A;  5JR9 A;  3LFM A;  3N5L A;  5FXZ A;  5JDG A;  2K48 A;  3WAK A;  4O4H E;  2A3D A;  3NBX X;  4P0B A;  3JC6 C;  2YEV C;  2KND A;  2V7L A;  3ZMZ B;  2H7V C;  3EUH A;  1D1A A;  2P9B A;  2KZ7 B;  3LK2 B;  4G63 A;  3HKE E;  2MOZ A;  4K0U A;  2N9D A;  5J2T E;  3AA1 B;  4HGA A;  4CI2 B;  2NW8 A;  4BAY B;  4P0A A;  3LJC A;  4WNK A;  4YFS A;  4AQF C;  3E08 A;  3PUA A;  4XZC A;  5KMG P;  4ADZ A;  4O4L E;  1D0X A;  2IC9 A;  2K5B B;  2KT9 A;  4AKG A;  2Y8D A;  4UVC B;  1ZKE A;  3DJB A;  4IE5 A;  2KWH A;  2WM9 A;  3WAJ A;  3PUR A;  2NWB A;  4HTE A;  5LYJ E;  4AQG A;  2NP9 A;  4ANJ A;  2CE7 A;  4HEA A;  3RX6 A;  4CXY A;  4L9I A;  4ZS2 A;  2C5J A;  3FB2 A;  4PK5 A;  3ZMV B;  3PTR B;  3NRX A;  4KBM B;  5L2L A;  4PJM A;  3N9M A;  3ZMU B;  4TZ4 C;  2PG8 A;  3CQX C;  3BQI A;  4PW8 A;  2K24 A;  1HG5 A;  5CA1 E;  2LHN A;  2OA5 A;  3V5U A;  3FXD B;  2M67 A;  3N2G E;  5IYZ E;  5JDL A;  3NZQ A;  3L3P A;  3QUJ A;  1IZN B;  1WYC A;  2X68 A;  5HXH A;  2CA5 A;  2JRK A;  3TKL B;  2CWO A;  1WRD A;  2CWY A;  4BJM A;  4O4I E;  5F3J A;  5KDM C;  4DMW A;  4I43 B;  1KNZ A;  2HPL A;  1HX8 A;  4WW0 A;  3DP7 A;  3AA0 B;  4IE4 A;  4I4T E;  3N2K E;  3AAA B;  5HXS A;  1MMA A;  2NW7 A;  1WR6 A;  3PUS A;  2L3L A;  1S94 A;  4H9N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...