1Z0PA

Crystal structure of the protein of unknown function spy1572 from streptococcus pyogenes
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
73
Chain Sequence
MSYEKEFLKDFEDWVKTQIQVNQLAMATSQEVADERAKDAFIRYESKLDAYEFLLGKFDNYKNGKAFHDIPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.7A Crystal structure of the hypothetical protein SPy1572 from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein SPy1572
total genus 33
structure length 73
sequence length 77
ec nomenclature
pdb deposition date 2005-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08930 DUF1912 Domain of unknown function (DUF1912)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1z0pA00
3FXDB 4B6XA 1H7CA 1QSDA 1IJ6A 4J2CA 1LVFA 2KWIB 4FI5A 4DNDA 2X9YA 2IC6A 3S4UA 1ZKEA 2C5IT 4CQIA 2X9XA 2C5KT 1LRZA 2MBGA 4EYYR 2X9WA 3L3PA 2K48A 3P7IA 2G0UA 3FXEB 2C5JA 3QUJA 3CKDA 3TKLB 2CA5A 1Z0PA 2XTLA 3CVRA 2KWHA 1IJ5A 4L0RA 3QK6A 2IC9A 3MXZA 3N5LA
chains in the Genus database with same CATH superfamily
3CMLA 3ZC1A 4BJNA 2P9BA 5AQUB 1KF6A 1LVFA 2KT9A 3A7MA 5ABFA 4AXPA 2XQ3A 3PJAJ 1KEYA 2WY2A 3AEEA 4IE7A 5ETWA 2UXBT 2V7MA 4NPPA 4GIWA 5L3EB 2BBHA 3NRYA 3OKQA 4L5GA 2MOZA 3ZN1B 2YDRA 2CXFA 3P50A 1OWAA 3EUHA 3KINB 4AI6A 2X9XA 3RYIE 2XAHB 4H9PC 4HFDA 3NWIA 3ZT5A 5JDHA 2UUCT 1KNZA 1W09A 2W62A 2UUAT 2JQHA 3ETVA 4ZZBA 3PURA 5HEJA 5JR9B 5C8YE 3TLWA 4U7YA 5HEUA 2Q9QB 5L4HA 4P0AA 3PE0A 3R6NA 3B5MA 2CHNA 4IT4A 5DQWA 1KNRA 1ZP0A 5JTGA 4CN6A 4DV1T 4YTNA 1J5WA 3KV6A 4QX7B 3V5SA 1YD8G 5AQFB 1OEDA 4FJOA 3QC9A 2CEAA 4Z8XA 5KDMC 5JDNA 2XQAA 3F57A 3FXDB 3RF1A 5J2TE 2EHOD 2BVLA 2CM0A 2JQQA 3LFMA 2I59A 2LSKA 5HXRA 5HCMA 2BG9C 4WNKA 2BG9B 3AAEB 5HWYA 4DBRA 2WZHA 3PUGA 4YHHT 3T8OA 4JI6T 5HXCA 4QH1A 2NTXA 2XQYA 4QXCB 4CQIA 2Q9QC 5FL1A 2NTYA 3DTOA 1E7PA 2WDQA 4EEBA 2XQ4A 2ES0A 4X65T 3FZLB 3ZT6A 4YSZA 1X79A 3PUSA 2D0TA 3N9LA 2XJ7A 1ZV4X 4IDZA 4TWFA 3ZYLA 3UQ7A 2BS2A 5L4EA 2XQ6A 2BKOA 4TV8E 2PFVA 2WMOA 3AVSA 2H89A 2RPAA 1HF8A 1LVKA 4CI1B 2H88A 3A5XA 3AE6A 3SS1A 3CVRA 1FMVA 2LJLA 4IIJE 4HN9A 1D0ZA 1W0AA 1Z0PA 5F8PA 4DV0T 1M7KA 2YEVC 4I55E 4IHJE 4UVCB 2VKDA 3LDQB 1IJ6A 4WBOA 2I0MA 2VK9A 5FY0A 4NIQA 1MIVA 5HCJA 3MJXA 2XQ9A 4HFIA 1NEKA 2LLYA 3K1SA 3U78A 4EOZB 4CN4A 4H63H 1QUUA 3EAMA 3FZHB 4YJ2E 4LF9T 5JRCB 1YQ4A 2LOPA 3JAFA 1FIOA 5JDGA 1T8BA 1E2AA 2HN2A 3Q5EA 4A56A 2D2SA 2BKNA 4QH4A 2E8IA 3RRWA 1SHZC 4X20E 5FXXA 3RC8A 3CPZA 4UV9B 4E7ZA 4O4JE 2FJAA 4NUVA 4AQFC 3UQ4A 5JQGE 2XAGB 4JI1T 1YXRA 4YSXA 1SE7A 2VWAA 2WSSV 3O1IA 3BQIA 2N9DA 3N2KE 3PUXF 1FMWA 3I1AA 3ZJ2A 3PUVF 4PAGA 3QOFA 3JCFA 5IYZE 5M4YA 3ANWA 2V7LA 3H37A 2NW7A 2QGSA 3EHZA 2WWUA 2VKJA 2VVNA 5A1LA 1BR1A 2N1GA 4PFOA 3C64A 4UF0A 3HKDE 3AEGA 1MMNA 4P0BA 2LSJA 2NW8A 1UURA 3H3MA 2N2NA 3LBXB 4HWDA 4YLHA 3RKGA 2K24A 3ZMUB 1VCSA 3UUMA 5CFBA 2IDOB 2SPCA 3TLTA 4YY3T 5IWAT 5BR8T 2V7JA 4I0UA 4X66T 1XMQT 2EHOB 4H9NC 2MBGA 2LHNA 3UFGA 1G73A 2CLYC 2YU1A 2RA1A 2ZM0A 2X66A 3C50A 3AEDA 4L9IA 5AQHB 5AQSB 5AQTB 4ANJA 1IBMT 2LT3A 5FMNA 2K3WA 3AA1B 3CX8B 3KV9A 3DP7A 3AXJA 4UIGA 2WWVA 1GQEA 4LFCT 1HS7A 2ZM6T 2H7VC 3FHNA 1MMAA 2IC9A 4QX8B 2JMKA 1KFYA 3FZKB 4CI2B 4B6XA 4PW8A 2H3RA 3ZPOA 3P4PA 2E5VA 4ZI2D 2W00A 2ACZA 1S35A 2J1DG 3O1HA 2CE7A 3C4ZA 1HNXT 3CQXC 2VQET 5LHHB 4AQGA 3P4RA 4X1IE 1X9BA 3MA9A 3N2GE 4YJ3E 4H9QC 4MALA 3MKDA 3OVUA 3PJAA 1L0VA 2W66A 4KMCA 2C5IT 4G2AA 3RIFA 3O4XE 3ZMVB 4CXXA 3R84B 3ZEFB 3HKCE 3J7Yq 1N36T 4DR5T 3LBXA 3V5UA 4QWNB 4WZXA 5C3JA 4OHFA 2B76A 3KVAA 4U7IA 5DQVA 1OEDC 4ZS2A 4QHOA 1W9RA 5AQMB 2JIWA 2VL0A 5JDFA 2XAJB 4HTEA 4DUYT 4CI3B 2Z6EA 5H6QB 4UXNB 3N9MA 3ZC0A 2WQYA 3AEAA 3OJAA 3AEBA 2KXPB 3MXZA 3N5LA 2BS4A 3LJCA 3OBVE 3ZYMA 5C2TA 2CXDA 5JDMA 4BA9A 2F4VT 2CWOA 2LE8A 1SA0E 2I6HA 4HWHA 4DUZT 3AE3A 5CB4E 4JI8T 3J9X1 3LG7A 3OPCA 2XQ8A 4JI3T 3EI0A 3RQWA 3ZYKA 4PJMA 3Q5WA 1N33T 2WDRA 4U2ZA 2FJDA 1FEWA 2HN1A 4LF4T 5EK3A 5LB7B 2J62A 1HFAA 1HG5A 4BAYB 1D1BA 4EYYR 2XQ7A 5LGUB 2X9WA 3UU8A 1XDOA 2M67A 4ZEYA 2WM9A 4ISSA 4AISA 5LG3A 1Y64B 2ACXA 1R8IA 2BBJA 1U4QA 4UF0B 1JNZA 2X51A 2V6YB 4HFHA 5JDLA 2IMLA 4IGUA 4DV3T 2DHRA 5DJQC 2IW5B 4GOUA 5FY1A 1KK7A 4X64T 4H9OC 1QLBA 1NENA 2V26A 2WB5A 3ZMTB 3I9YA 3M65A 4TNWA 3AE7A 1BR4A 4NUUA 5FVLA 2E9XD 5F3JA 1HNWT 5FXVA 3RH3A 2VVSA 1YKHB 2V6XA 3BQLA 4TN7B 5E0OA 4A5XA 4F8HA 1DU2A 4DR6T 4GYSA 4ZS3A 3AE8A 4Z91A 1XDPA 3W15B 4EAHA 1MMGA 3I9WA 2YDQA 4JEUB 1T98A 4HEAA 3KDSE 1LRZA 2XZEA 3UT5E 4B3ST 2BS3A 3PDYA 2A3DA 5KXJA 3O1JA 4PK4A 4JI5T 2KNDA 2VB6A 2CRBA 3E0ZA 3FXEB 5FNVE 3MACA 1VRBA 5IHYA 3TLUA 3NBXX 4JI2T 4ZI2C 4Z90A 4COFA 4K0KT 4HGAA 4JEHB 5FL0A 2DWKA 5IUXA 2KWHA 3IEEA 2XM1A 2JMHA 4DV7T 4ZI3C 1XMOT 2HPLA 4QH5A 2MYSA 5LP6E 3UULA 3FB2A 4KUMB 4CZZB 2VASA 2VL8A 2EHOA 5FYMA 5LA6E 2CBIA 3GN5B 2M6IA 4DR3T 2FUPA 2UXNB 2XQ5A 1UCUA 2OA5A 5HXSA 4NXNT 4MLKA 2RP4A 2W61A 4DV6T 4AKIA 3HR0A 4C91A 4JI4T 4TX5A 5HXHA 5LNKA 2DLRA 3BK9A 4ILAA 4Q25A 5FY7A 3JAEA 2WAUA 4O2AE 5AQPB 2Y6XA 2LRKA 1HCIA 4DVDA 3ESLA 4ISTA 3EVYA 5LOVE 4DR1T 2WP9A 5CA1E 3N9PA 4QXBB 1YQ3A 2CXLA 3F31A 3K8PC 4GK5E 2V8SV 3QUJA 2ODUA 4IDNA 1HR0T 1XWMA 2OV9A 4PK5A 4UV8B 4B3TT 3KV4A 1NAFA 2MTQA 3A8YC 3QK6A 3VKGA 1FJGT 4ILUA 3UFEA 3FBZA 3L09A 4C90A 2H7OA 4IE5A 2V6YA 2LOSA 3KV5A 3VRAA 2QYWA 2IC6A 2Q9QA 3P8CD 1OXZA 1MIWA 3K3OA 4P1NA 2D9DA 3LK3B 3TLVA 2ZLYA 3RPUA 4YSYA 1ZKEA 1M62A 2V5CA 2XM2A 3PU3A 3RYCE 3T1YT 4AKGA 1ZEEA 2W0GA 5EK4A 4JUYA 2CPTA 4LMJA 3NVOA 4O8SA 2WDVA 4HWFA 4ZZCA 4JI7T 4IREA 3PV0F 4WBNE 3RLFF 3K3QC 3KBUA 5J1GA 1NWMX 2W2UA 4KI0F 4ZI3D 1MMDA 3AE5A 4BJMA 2CA5A 4IE0A 2JRKA 4N78D 1YKEB 1MNDA 2XTLA 4KHPT 2AE9A 3G06A 4I43B 3ZCJA 4PJNA 4AKHA 3RIUC 4TWDA 1AJ3A 2CHOA 4LF6T 2M6BA 3ABVA 3N9NA 2MAWA 3PUQA 1IBKT 4J2CA 4FI5A 2YKSA 5L2LA 4B3MT 3LK42 4AQFA 4YHJA 2J4GA 3DJBA 2DWGA 2CBJA 4QKNA 5LHIB 2DL1A 4ILBA 3UU5A 4DR2T 2NR4A 1I6ZA 2JQKA 2BKPA 3ONXA 3UUNA 1SUMB 2E9XB 1S94A 3RQUA 4YXDA 2E9XC 1WYCA 5JRCA 4TV9E 1HTJF 2DCFA 2L9QA 2UXXB 3AB3B 2L3LA 5CA0E 3UU4A 3JADA 4EIWA 2FJBA 2PG8A 2C5JA 4EXTA 5AQNB 4DV2T 4JYAT 4IDOA 3BQKA 3ZMZB 2LM2A 5LXTE 5AQQB 2GK9A 3T1HT 3HL6A 5LBMA 4ADZA 2QA7A 4XAXB 4LFBT 2AXDS 3Q9DA 3RYFE 4DMVA 3PUZF 2UUBT 3AVRA 3IBPA 3P4QA 1Y01A 3WAKA 2LM9A 1XZYA 4JI0T 3PUAA 3FBLA 4HFCA 2XUEA 4PFPA 2CMRA 4DR7T 3GA8A 3ZN0B 3RX6A 1CUNA 3KVBA 2YINA 3RGLA 3O9XA 3CK6A 4LF5T 3PUYF 3Q2MA 3UUXB 3EDUA 4E7SA 4X5TA 5JR9C 3AECA 5FKYA 3AE4A 2VURA 5KMGP 4G63A 4UVAB 2LEHA 3C51A 5AQVB 4YTPA 1WRDA 3RYHE 1CHUA 4GYRA 3AA7B 4P09A 5FXWA 3FZMB 3H3AA 5LBQB 3UUBA 5HYAA 3GN5A 4V1Av 4A97A 3ZT7A 2D5UA 3AAIA 2YN6A 3AAAB 3C4XA 3RKOA 5LGNB 4B3RT 2XY8B 4WW0A 5L47A 3UTKA 2BG9E 3AE2A 1WR0A 2V1DB 1OEDB 2Y8DA 5JH7E 2NWBA 2X68A 5GONE 2PJQA 4KP3C 4XBFB 2DNXA 1OEDE 4KBMB 3LK2B 3X1DA 2YOEA 2WBLA 3NRXA 4ILCA 3SFDA 4ZHQE 2KWIB 2WU2A 1UUSA 5AQOB 4U2YA 2ZMAA 4LF8T 4ZI7E 2LHRA 5EZYE 4AQYT 4CXWA 5EK2A 4ZXLA 4O4LE 4GKJT 5HEGA 4A98A 1Z8UA 2LRLA 1WLXA 2KSRA 2WMNA 2XAFB 3LSVA 5JVDE 2K9AA 4DIDB 3UU3A 2JPFA 3HI2A 4JV5T 5LG4A 2G0UA 2C0SA 2X67A 5AQRB 4F6RC 4YT0A 5ABHA 3QB5A 3ZLIA 2FJEA 3IA3A 2XAQB 2BZBA 4MBQA 4TNVA 2ZM8A 3K3NA 4U3CA 4IL9A 3RC3A 5KX5E 2JQ9A 2ODVA 5AQIB 1WCRA 5LYJE 2Y48B 3AA6B 3ONLC 4PK6A 3IF8B 4L0RA 4ZOLE 3ZMSB 4AKLA 2XHEB 2HPJA 1G8XA 4IE6A 3RIAA 4DBQA 5L3CB 3CX7B 2W4XA 1QSDA 2E9XA 4PJJA 1D0YA 4OYKA 5L3DB 1T72A 2VQFT 4LF7T 3AEFA 4ASKA 2QVAA 5HXEA 3VU7H 2WU5A 3I0OA 4HFBA 4H9RC 1LKXA 1MNEA 5JDQA 1D1AA 3L39A 2PTFA 2A72A 1T7SA 4EYUA 3OYXA 5JREA 1XNQT 4KHZF 3NKZA 4IDPA 5HWXA 5L3GB 1HNZT 2HH7A 2QRXA 3B57A 3RIUA 3SOLA 4EZHA 2W63A 4HKAA 1YW0A 2WZIA 4MHCA 4UEMA 2VKOA 3FZFB 3QB5K 5L3BB 2A9UA 2E2AA 2WCAA 2XASB 2HHHT 2KMFA 4HWCA 5FVKA 2D0UA 4DMWA 1JNRA 2X0LB 4EGWA 5LCYA 4IE4A 2UXCT 2BVMA 2CCQA 2J47A 4H9SE 4M1PA 4U74A 3ZKRA 5LGTB 4O2BE 1UK5A 3GMIA 5LJNA 3ZSTA 3F2EA 3P4WA 3AE1A 3Q5XA 1IAPA 2XSBA 3C4WA 4YTMA 1UX4A 2YK0A 3NZQA 5DABA 1B7TA 3RRCA 3OYZA 5LHGB 4TUYE 1J5ET 4HE8A 4PJLA 2A2FX 3Q5DA 3CWZB 5CJ5A 5L3FB 4DR4T 2IUBA 4WYVA 3KFWX 1VOMA 5HEOA 5HAXA 4MFRA 3RHWA 5BMVE 4GK0E 5LMUT 3P7IA 2B1EA 3ZCIA 5FXZA 3HKEE 3E22E 4NXMT 3AA0B 1UX5A 3PTRB 5TAOA 4O4HE 4X62T 3PUWF 1O3XA 1US7B 3UU6A 4LMKA 3ZJ1A 4IL4A 2XSAA 2ZM2A 4HWIB 3ANWB 3WI3A 1XNRT 1EZ3A 4LFAT 4X1YE 4EB6E 4GKKT 4O4IE 2X0HA 3VKHA 1U5PA 1IBLT 3SFEA 5AQJB 2V5DA 5AQKB 5F5WA 2LSYA 5ADXL 3L8RA 4OFZA 2X9YA 3I0QA 2Q9QD 2PBIA 4AIUA 4H63V 3S4UA 4U72A 4LMLA 2KLQA 2NW9A 4UVBB 2R6GF 2UU9T 3PU8A 3QNUA 4YFSA 3NZPA 1I94T 3N2OA 5AFUL 1WFDA 4CXYA 2C5KT 2X9HA 3U3IA 4AKRB 1J1JA 4K0UA 4I4TE 2CWYA 3TLSA 5CGMA 2EHOC 1N32T 3L3PA 5AQGB 2BG9A 3N9QA 3EABA 3CX6B 2V7KA 3EDVA 3HA4A 3CIRA 4OYJA 5LMNT 1D0XA 2KZ7B 4KX6A 4OK0A 4DV4T 3CKDA 5LJMA 5ABFB 1WYBA 3B13A 4OX9T 1BR0A 2KINB 3M3ZB 5HEHA 3VR9A 2E5LT 4U31A 2IIUA 5J2UE 1ZOYA 5ABEA 1HX1B 2FBWA 2YDSA 1UGOA 2XPKA 2IHR1 2JJ9A 5FP3A 1WR6A 2BDEA 2V7IA 2VKHA 2DI4A 1H7CA 3AXJB 3C98B 3ETUA 4HFEA 1HG2A 1IZNB 2LSIA 4UR9A 3E08A 4HFVA 3SWHA 4DNDA 3HKBE 5H6RB 1N34T 4TWHA 5ABGA 4JLEA 5JR9A 2X0YA 3GWHA 3CQCB 4PNIA 1MIYA 2L8KA 3AE9A 4X1KE 4JBWF 4XZCA 2NOXA 3ONJA 3ZSSA 4TZ4C 2LKGA 4DO0A 4EV6A 2YU2A 4EEDA 4DV5T 2UXDT 2K5BB 3RI5A 1KNPA 2W67A 2K48A 2OLTA 3D0TA 3N9OA 3VR8A 3OTOT 3KBTA 2WS3A 3MZKB 4U33A 3VHLA 1W0BA 5J0ZA 1V9DA 2LSGA 3JC6C 5AQLB 3SRZA 3MK7C 2LKHA 3P4SA 3TKLB 2CLYB 4QXHB 3VRBA 4CN1A 4ERRA 3WAJA 4IDQA 1ZHCA 3JC6D 1BR2A 3IHRA 2IAKA 4I50E 4EZ4A 1IJ5A 1E1HB 1HX8A 1D1CA 1VCTA 2NP9A 2MPKA 4UELA 3CQGB
chains in the Genus database with same CATH topology
3CMLA 3ZC1A 4BJNA 2P9BA 1LVFA 2KT9A 4IE7A 5ETWA 2V7MA 4GIWA 5L3EB 3NRYA 3OKQA 4L5GA 3ZN1B 2MOZA 2CXFA 1OWAA 3EUHA 3KINB 4AI6A 2X9XA 3RYIE 2XAHB 4H9PC 5JDHA 1KNZA 2W62A 3ETVA 3PURA 5JR9B 5C8YE 2Q9QB 3PE0A 3R6NA 5DQWA 3KV6A 4QX7B 3V5SA 1YD8G 4FJOA 3QC9A 2CEAA 4Z8XA 5KDMC 5JDNA 3F57A 3FXDB 5J2TE 2EHOD 2BVLA 2CM0A 2JQQA 3LFMA 2I59A 2LSKA 5HXRA 4WNKA 3AAEB 5HWYA 4DBRA 3PUGA 3T8OA 5HXCA 2NTXA 2XQYA 4QXCB 4CQIA 2Q9QC 2NTYA 3DTOA 2ES0A 1X79A 3PUSA 2D0TA 3N9LA 1ZV4X 4IDZA 3ZYLA 4TV8E 2PFVA 2WMOA 3AVSA 4CI1B 1HF8A 1LVKA 3A5XA 3SS1A 3CVRA 1FMVA 2LJLA 4IIJE 4HN9A 1D0ZA 5F8PA 1Z0PA 4I55E 2YEVC 4UVCB 4IHJE 2VKDA 1IJ6A 4WBOA 5FY0A 2VK9A 1MIVA 3MJXA 3U78A 4EOZB 4H63H 1QUUA 4YJ2E 5JRCB 2LOPA 1FIOA 5JDGA 4A56A 2D2SA 2E8IA 3RRWA 1SHZC 4X20E 5FXXA 3RC8A 3CPZA 4UV9B 4E7ZA 4O4JE 4NUVA 4AQFC 5JQGE 2XAGB 2VWAA 2WSSV 3O1IA 3BQIA 2N9DA 3N2KE 1FMWA 3I1AA 4PAGA 5IYZE 5M4YA 3ANWA 2V7LA 3H37A 2NW7A 2QGSA 5A1LA 2WWUA 2VKJA 1BR1A 2N1GA 4PFOA 3C64A 4UF0A 3HKDE 1MMNA 4P0BA 2LSJA 2NW8A 3ZMUB 3LBXB 2N2NA 4YLHA 2K24A 3UUMA 2SPCA 2V7JA 2EHOB 4H9NC 2MBGA 2LHNA 1G73A 2CLYC 2YU1A 2RA1A 2ZM0A 2X66A 3C50A 4L9IA 4ANJA 2LT3A 5FMNA 3AA1B 3CX8B 4UIGA 3KV9A 3DP7A 1HS7A 2H7VC 3FHNA 1MMAA 2IC9A 4QX8B 2JMKA 4CI2B 4B6XA 4PW8A 2H3RA 3ZPOA 2W00A 1S35A 2J1DG 3O1HA 2CE7A 3C4ZA 3CQXC 4AQGA 4X1IE 3MA9A 3N2GE 4YJ3E 4H9QC 4MALA 3MKDA 4KMCA 2C5IT 4G2AA 4CXXA 3O4XE 3ZMVB 3ZEFB 3R84B 3HKCE 3J7Yq 3LBXA 3V5UA 4QWNB 4OHFA 3KVAA 3ZJ2A 4ZS2A 5DQVA 5J2UE 4QHOA 5JDFA 2XAJB 4HTEA 4CI3B 2Z6EA 5H6QB 4UXNB 3N9MA 3ZC0A 3OJAA 2KXPB 3MXZA 3N5LA 3LJCA 3OBVE 3ZYMA 2CXDA 5JDMA 4BA9A 2CWOA 2LE8A 1SA0E 5CB4E 3J9X1 3LG7A 3ZYKA 4PJMA 3Q5WA 1FEWA 5EK3A 1HFAA 1HG5A 4BAYB 1D1BA 4EYYR 5LGUB 2X9WA 2M67A 2WM9A 4ISSA 1Y64B 2ACXA 4UF0B 1U4QA 2X51A 5JDLA 4IGUA 2DHRA 5DJQC 2IW5B 4GOUA 5FY1A 1KK7A 4H9OC 2V26A 3ZMTB 3I9YA 3M65A 1BR4A 4NUUA 5F3JA 2E9XD 5FXVA 3RH3A 4TN7B 1YKHB 3BQLA 5E0OA 4GYSA 4ZS3A 4EAHA 3W15B 1MMGA 3I9WA 4JEUB 1T98A 4HEAA 3KDSE 1LRZA 3UT5E 3PDYA 2A3DA 3O1JA 4PK4A 2KNDA 2VB6A 3E0ZA 5FNVE 3FXEB 3MACA 1VRBA 5IHYA 3NBXX 4ZI2C 4HGAA 4JEHB 2DWKA 2KWHA 3IEEA 2JMHA 4ZI3C 2HPLA 2MYSA 5LP6E 3UULA 3FB2A 4KUMB 4CZZB 2VASA 2VL8A 2EHOA 5FYMA 5LA6E 3GN5B 2UXNB 1UCUA 2OA5A 5HXSA 4MLKA 2RP4A 2W61A 4AKIA 3HR0A 4C91A 4TX5A 5HXHA 5LNKA 2DLRA 3BK9A 5FY7A 2WAUA 4O2AE 2Y6XA 1HCIA 4DVDA 3ESLA 4ISTA 3EVYA 5LOVE 5CA1E 3N9PA 4QXBB 2CXLA 3F31A 3K8PC 4GK5E 3QUJA 2ODUA 4PK5A 4UV8B 3KV4A 1NAFA 2MTQA 3VKGA 3QK6A 4ILUA 3UFEA 3FBZA 3L09A 4C90A 2H7OA 4IE5A 2LOSA 3KV5A 3P8CD 2IC6A 2Q9QA 1OXZA 1MIWA 3K3OA 5LHHB 5LJMA 3LK3B 2ZLYA 3RPUA 1ZKEA 3PU3A 3RYCE 4AKGA 1ZEEA 2W0GA 5EK4A 4JUYA 4O8SA 4WBNE 3K3QC 3KBUA 5J1GA 1NWMX 4ZI3D 1MMDA 4BJMA 2CA5A 4IE0A 2JRKA 4N78D 1YKEB 1MNDA 2XTLA 4I43B 3ZCJA 4PJNA 4AKHA 1AJ3A 3N9NA 3PUQA 4J2CA 4FI5A 5L2LA 3LK42 4AQFA 4YHJA 3DJBA 5LHIB 2DWGA 4QKNA 3ONXA 3UUNA 2E9XB 1S94A 2E9XC 1WYCA 5JRCA 4TV9E 1HTJF 2DCFA 3AB3B 2L9QA 2UXXB 2L3LA 5CA0E 4EIWA 4EXTA 2PG8A 2C5JA 3BQKA 3ZMZB 5LXTE 2GK9A 3HL6A 5LBMA 4ADZA 2QA7A 4XAXB 3Q9DA 3RYFE 4DMVA 3AVRA 3IBPA 3WAKA 2LM9A 3PUAA 3FBLA 2XUEA 4PFPA 2CMRA 3GA8A 3ZN0B 3RX6A 1CUNA 3KVBA 2YINA 3O9XA 3Q2MA 3UUXB 4E7SA 3EDUA 5JR9C 5KMGP 4G63A 4UVAB 2LEHA 3C51A 1WRDA 3RYHE 4GYRA 3AA7B 4P09A 5FXWA 3H3AA 5LBQB 5HYAA 3GN5A 4V1Av 2D5UA 3AAIA 3C4XA 3AAAB 3RKOA 5LGNB 4WW0A 3UTKA 2V1DB 2Y8DA 5JH7E 2NWBA 2X68A 5GONE 2PJQA 4KP3C 4XBFB 2DNXA 4KBMB 3LK2B 2WBLA 3NRXA 4ZHQE 2KWIB 2ZMAA 4ZI7E 2LHRA 5EZYE 4CXWA 5EK2A 4O4LE 1WLXA 2WMNA 2XAFB 5JVDE 2K9AA 2JPFA 3HI2A 5LG4A 2G0UA 2C0SA 2X67A 4F6RC 3ZLIA 2XAQB 2BZBA 4MBQA 3RC3A 2ZM8A 3K3NA 5KX5E 3VKHA 2ODVA 5LYJE 2Y48B 3AA6B 4PK6A 4ZOLE 3IF8B 4L0RA 3ZMSB 4AKLA 4DBQA 2XHEB 2HPJA 1G8XA 4IE6A 4EYUA 5L3CB 3CX7B 1QSDA 2E9XA 4PJJA 1D0YA 4OYKA 5L3DB 4ASKA 5HXEA 3VU7H 3I0OA 4H9RC 1LKXA 1MNEA 5JDQA 1D1AA 2A72A 3OYXA 5JREA 5HWXA 5L3GB 2HH7A 3B57A 3SOLA 4EZHA 2W63A 4HKAA 1YW0A 4MHCA 4UEMA 2VKOA 5L3BB 2XASB 2KMFA 2D0UA 4DMWA 2X0LB 5LCYA 4IE4A 2BVMA 2CCQA 4H9SE 4M1PA 4U74A 5LGTB 4O2BE 3GMIA 5LJNA 3F2EA 3Q5XA 1IAPA 3C4WA 5DABA 1UX4A 2YK0A 3NZQA 3RRCA 1B7TA 3OYZA 5LHGB 4TUYE 4HE8A 4PJLA 2A2FX 3CWZB 5L3FB 5BMVE 3KFWX 1VOMA 5HAXA 4MFRA 4GK0E 3P7IA 2B1EA 3ZCIA 5FXZA 3HKEE 3E22E 3AA0B 1UX5A 3PTRB 5TAOA 4O4HE 1O3XA 1US7B 3ZJ1A 2ZM2A 3ANWB 3WI3A 1EZ3A 4X1YE 4EB6E 4O4IE 1U5PA 2LSYA 5ADXL 4OFZA 2X9YA 3I0QA 2Q9QD 2PBIA 4H63V 3S4UA 4U72A 2KLQA 2NW9A 4UVBB 3PU8A 4YFSA 3NZPA 3N2OA 5AFUL 4CXYA 2C5KT 2X9HA 3U3IA 4AKRB 4K0UA 4I4TE 2CWYA 2EHOC 3L3PA 3N9QA 3CX6B 3HA4A 2V7KA 3EDVA 4OYJA 1D0XA 2KZ7B 4OK0A 3CKDA 1BR0A 1WYBA 3B13A 2KINB 5FP3A 2JJ9A 3ETUA 1WR6A 2BDEA 3C98B 2V7IA 2DI4A 1H7CA 2VKHA 4ZI2D 1HG2A 1IZNB 2LSIA 3SWHA 3E08A 4HFVA 4DNDA 3HKBE 5H6RB 4JLEA 5JR9A 3GWHA 3CQCB 4PNIA 1MIYA 2L8KA 4X1KE 4XZCA 4DO0A 4P0AA 2NOXA 4TZ4C 2YU2A 2K5BB 2K48A 3D0TA 3N9OA 3KBTA 3MZKB 3VHLA 1V9DA 2LSGA 3JC6C 3SRZA 3TKLB 3MK7C 4AXPA 4ERRA 2CLYB 4QXHB 3WAJA 1ZHCA 3JC6D 1BR2A 3IHRA 2IAKA 4I50E 4EZ4A 1IJ5A 1E1HB 1HX8A 1D1CA 2NP9A 4UELA 3CQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXD B;  4B6X A;  1H7C A;  1QSD A;  1IJ6 A;  4J2C A;  1LVF A;  2KWI B;  4FI5 A;  4DND A;  2X9Y A;  2IC6 A;  3S4U A;  1ZKE A;  2C5I T;  4CQI A;  2X9X A;  2C5K T;  1LRZ A;  2MBG A;  4EYY R;  2X9W A;  3L3P A;  2K48 A;  3P7I A;  2G0U A;  3FXE B;  2C5J A;  3QUJ A;  3CKD A;  3TKL B;  2CA5 A;  1Z0P A;  2XTL A;  3CVR A;  2KWH A;  1IJ5 A;  4L0R A;  3QK6 A;  2IC9 A;  3MXZ A;  3N5L A; 
#chains in the Genus database with same CATH topology
 3CML A;  3ZC1 A;  4BJN A;  2P9B A;  5AQU B;  1KF6 A;  1LVF A;  2KT9 A;  3A7M A;  5ABF A;  4AXP A;  2XQ3 A;  3PJA J;  1KEY A;  2WY2 A;  3AEE A;  4IE7 A;  5ETW A;  2UXB T;  2V7M A;  4NPP A;  4GIW A;  5L3E B;  2BBH A;  3NRY A;  3OKQ A;  4L5G A;  2MOZ A;  3ZN1 B;  2YDR A;  2CXF A;  3P50 A;  1OWA A;  3EUH A;  3KIN B;  4AI6 A;  2X9X A;  3RYI E;  2XAH B;  4H9P C;  4HFD A;  3NWI A;  3ZT5 A;  5JDH A;  2UUC T;  1KNZ A;  1W09 A;  2W62 A;  2UUA T;  2JQH A;  3ETV A;  4ZZB A;  3PUR A;  5HEJ A;  5JR9 B;  5C8Y E;  3TLW A;  4U7Y A;  5HEU A;  2Q9Q B;  5L4H A;  4P0A A;  3PE0 A;  3R6N A;  3B5M A;  2CHN A;  4IT4 A;  5DQW A;  1KNR A;  1ZP0 A;  5JTG A;  4CN6 A;  4DV1 T;  4YTN A;  1J5W A;  3KV6 A;  4QX7 B;  3V5S A;  1YD8 G;  5AQF B;  1OED A;  4FJO A;  3QC9 A;  2CEA A;  4Z8X A;  5KDM C;  5JDN A;  2XQA A;  3F57 A;  3FXD B;  3RF1 A;  5J2T E;  2EHO D;  2BVL A;  2CM0 A;  2JQQ A;  3LFM A;  2I59 A;  2LSK A;  5HXR A;  5HCM A;  2BG9 C;  4WNK A;  2BG9 B;  3AAE B;  5HWY A;  4DBR A;  2WZH A;  3PUG A;  4YHH T;  3T8O A;  4JI6 T;  5HXC A;  4QH1 A;  2NTX A;  2XQY A;  4QXC B;  4CQI A;  2Q9Q C;  5FL1 A;  2NTY A;  3DTO A;  1E7P A;  2WDQ A;  4EEB A;  2XQ4 A;  2ES0 A;  4X65 T;  3FZL B;  3ZT6 A;  4YSZ A;  1X79 A;  3PUS A;  2D0T A;  3N9L A;  2XJ7 A;  1ZV4 X;  4IDZ A;  4TWF A;  3ZYL A;  3UQ7 A;  2BS2 A;  5L4E A;  2XQ6 A;  2BKO A;  4TV8 E;  2PFV A;  2WMO A;  3AVS A;  2H89 A;  2RPA A;  1HF8 A;  1LVK A;  4CI1 B;  2H88 A;  3A5X A;  3AE6 A;  3SS1 A;  3CVR A;  1FMV A;  2LJL A;  4IIJ E;  4HN9 A;  1D0Z A;  1W0A A;  1Z0P A;  5F8P A;  4DV0 T;  1M7K A;  2YEV C;  4I55 E;  4IHJ E;  4UVC B;  2VKD A;  3LDQ B;  1IJ6 A;  4WBO A;  2I0M A;  2VK9 A;  5FY0 A;  4NIQ A;  1MIV A;  5HCJ A;  3MJX A;  2XQ9 A;  4HFI A;  1NEK A;  2LLY A;  3K1S A;  3U78 A;  4EOZ B;  4CN4 A;  4H63 H;  1QUU A;  3EAM A;  3FZH B;  4YJ2 E;  4LF9 T;  5JRC B;  1YQ4 A;  2LOP A;  3JAF A;  1FIO A;  5JDG A;  1T8B A;  1E2A A;  2HN2 A;  3Q5E A;  4A56 A;  2D2S A;  2BKN A;  4QH4 A;  2E8I A;  3RRW A;  1SHZ C;  4X20 E;  5FXX A;  3RC8 A;  3CPZ A;  4UV9 B;  4E7Z A;  4O4J E;  2FJA A;  4NUV A;  4AQF C;  3UQ4 A;  5JQG E;  2XAG B;  4JI1 T;  1YXR A;  4YSX A;  1SE7 A;  2VWA A;  2WSS V;  3O1I A;  3BQI A;  2N9D A;  3N2K E;  3PUX F;  1FMW A;  3I1A A;  3ZJ2 A;  3PUV F;  4PAG A;  3QOF A;  3JCF A;  5IYZ E;  5M4Y A;  3ANW A;  2V7L A;  3H37 A;  2NW7 A;  2QGS A;  3EHZ A;  2WWU A;  2VKJ A;  2VVN A;  5A1L A;  1BR1 A;  2N1G A;  4PFO A;  3C64 A;  4UF0 A;  3HKD E;  3AEG A;  1MMN A;  4P0B A;  2LSJ A;  2NW8 A;  1UUR A;  3H3M A;  2N2N A;  3LBX B;  4HWD A;  4YLH A;  3RKG A;  2K24 A;  3ZMU B;  1VCS A;  3UUM A;  5CFB A;  2IDO B;  2SPC A;  3TLT A;  4YY3 T;  5IWA T;  5BR8 T;  2V7J A;  4I0U A;  4X66 T;  1XMQ T;  2EHO B;  4H9N C;  2MBG A;  2LHN A;  3UFG A;  1G73 A;  2CLY C;  2YU1 A;  2RA1 A;  2ZM0 A;  2X66 A;  3C50 A;  3AED A;  4L9I A;  5AQH B;  5AQS B;  5AQT B;  4ANJ A;  1IBM T;  2LT3 A;  5FMN A;  2K3W A;  3AA1 B;  3CX8 B;  3KV9 A;  3DP7 A;  3AXJ A;  4UIG A;  2WWV A;  1GQE A;  4LFC T;  1HS7 A;  2ZM6 T;  2H7V C;  3FHN A;  1MMA A;  2IC9 A;  4QX8 B;  2JMK A;  1KFY A;  3FZK B;  4CI2 B;  4B6X A;  4PW8 A;  2H3R A;  3ZPO A;  3P4P A;  2E5V A;  4ZI2 D;  2W00 A;  2ACZ A;  1S35 A;  2J1D G;  3O1H A;  2CE7 A;  3C4Z A;  1HNX T;  3CQX C;  2VQE T;  5LHH B;  4AQG A;  3P4R A;  4X1I E;  1X9B A;  3MA9 A;  3N2G E;  4YJ3 E;  4H9Q C;  4MAL A;  3MKD A;  3OVU A;  3PJA A;  1L0V A;  2W66 A;  4KMC A;  2C5I T;  4G2A A;  3RIF A;  3O4X E;  3ZMV B;  4CXX A;  3R84 B;  3ZEF B;  3HKC E;  3J7Y q;  1N36 T;  4DR5 T;  3LBX A;  3V5U A;  4QWN B;  4WZX A;  5C3J A;  4OHF A;  2B76 A;  3KVA A;  4U7I A;  5DQV A;  1OED C;  4ZS2 A;  4QHO A;  1W9R A;  5AQM B;  2JIW A;  2VL0 A;  5JDF A;  2XAJ B;  4HTE A;  4DUY T;  4CI3 B;  2Z6E A;  5H6Q B;  4UXN B;  3N9M A;  3ZC0 A;  2WQY A;  3AEA A;  3OJA A;  3AEB A;  2KXP B;  3MXZ A;  3N5L A;  2BS4 A;  3LJC A;  3OBV E;  3ZYM A;  5C2T A;  2CXD A;  5JDM A;  4BA9 A;  2F4V T;  2CWO A;  2LE8 A;  1SA0 E;  2I6H A;  4HWH A;  4DUZ T;  3AE3 A;  5CB4 E;  4JI8 T;  3J9X 1;  3LG7 A;  3OPC A;  2XQ8 A;  4JI3 T;  3EI0 A;  3RQW A;  3ZYK A;  4PJM A;  3Q5W A;  1N33 T;  2WDR A;  4U2Z A;  2FJD A;  1FEW A;  2HN1 A;  4LF4 T;  5EK3 A;  5LB7 B;  2J62 A;  1HFA A;  1HG5 A;  4BAY B;  1D1B A;  4EYY R;  2XQ7 A;  5LGU B;  2X9W A;  3UU8 A;  1XDO A;  2M67 A;  4ZEY A;  2WM9 A;  4ISS A;  4AIS A;  5LG3 A;  1Y64 B;  2ACX A;  1R8I A;  2BBJ A;  1U4Q A;  4UF0 B;  1JNZ A;  2X51 A;  2V6Y B;  4HFH A;  5JDL A;  2IML A;  4IGU A;  4DV3 T;  2DHR A;  5DJQ C;  2IW5 B;  4GOU A;  5FY1 A;  1KK7 A;  4X64 T;  4H9O C;  1QLB A;  1NEN A;  2V26 A;  2WB5 A;  3ZMT B;  3I9Y A;  3M65 A;  4TNW A;  3AE7 A;  1BR4 A;  4NUU A;  5FVL A;  2E9X D;  5F3J A;  1HNW T;  5FXV A;  3RH3 A;  2VVS A;  1YKH B;  2V6X A;  3BQL A;  4TN7 B;  5E0O A;  4A5X A;  4F8H A;  1DU2 A;  4DR6 T;  4GYS A;  4ZS3 A;  3AE8 A;  4Z91 A;  1XDP A;  3W15 B;  4EAH A;  1MMG A;  3I9W A;  2YDQ A;  4JEU B;  1T98 A;  4HEA A;  3KDS E;  1LRZ A;  2XZE A;  3UT5 E;  4B3S T;  2BS3 A;  3PDY A;  2A3D A;  5KXJ A;  3O1J A;  4PK4 A;  4JI5 T;  2KND A;  2VB6 A;  2CRB A;  3E0Z A;  3FXE B;  5FNV E;  3MAC A;  1VRB A;  5IHY A;  3TLU A;  3NBX X;  4JI2 T;  4ZI2 C;  4Z90 A;  4COF A;  4K0K T;  4HGA A;  4JEH B;  5FL0 A;  2DWK A;  5IUX A;  2KWH A;  3IEE A;  2XM1 A;  2JMH A;  4DV7 T;  4ZI3 C;  1XMO T;  2HPL A;  4QH5 A;  2MYS A;  5LP6 E;  3UUL A;  3FB2 A;  4KUM B;  4CZZ B;  2VAS A;  2VL8 A;  2EHO A;  5FYM A;  5LA6 E;  2CBI A;  3GN5 B;  2M6I A;  4DR3 T;  2FUP A;  2UXN B;  2XQ5 A;  1UCU A;  2OA5 A;  5HXS A;  4NXN T;  4MLK A;  2RP4 A;  2W61 A;  4DV6 T;  4AKI A;  3HR0 A;  4C91 A;  4JI4 T;  4TX5 A;  5HXH A;  5LNK A;  2DLR A;  3BK9 A;  4ILA A;  4Q25 A;  5FY7 A;  3JAE A;  2WAU A;  4O2A E;  5AQP B;  2Y6X A;  2LRK A;  1HCI A;  4DVD A;  3ESL A;  4IST A;  3EVY A;  5LOV E;  4DR1 T;  2WP9 A;  5CA1 E;  3N9P A;  4QXB B;  1YQ3 A;  2CXL A;  3F31 A;  3K8P C;  4GK5 E;  2V8S V;  3QUJ A;  2ODU A;  4IDN A;  1HR0 T;  1XWM A;  2OV9 A;  4PK5 A;  4UV8 B;  4B3T T;  3KV4 A;  1NAF A;  2MTQ A;  3A8Y C;  3QK6 A;  3VKG A;  1FJG T;  4ILU A;  3UFE A;  3FBZ A;  3L09 A;  4C90 A;  2H7O A;  4IE5 A;  2V6Y A;  2LOS A;  3KV5 A;  3VRA A;  2QYW A;  2IC6 A;  2Q9Q A;  3P8C D;  1OXZ A;  1MIW A;  3K3O A;  4P1N A;  2D9D A;  3LK3 B;  3TLV A;  2ZLY A;  3RPU A;  4YSY A;  1ZKE A;  1M62 A;  2V5C A;  2XM2 A;  3PU3 A;  3RYC E;  3T1Y T;  4AKG A;  1ZEE A;  2W0G A;  5EK4 A;  4JUY A;  2CPT A;  4LMJ A;  3NVO A;  4O8S A;  2WDV A;  4HWF A;  4ZZC A;  4JI7 T;  4IRE A;  3PV0 F;  4WBN E;  3RLF F;  3K3Q C;  3KBU A;  5J1G A;  1NWM X;  2W2U A;  4KI0 F;  4ZI3 D;  1MMD A;  3AE5 A;  4BJM A;  2CA5 A;  4IE0 A;  2JRK A;  4N78 D;  1YKE B;  1MND A;  2XTL A;  4KHP T;  2AE9 A;  3G06 A;  4I43 B;  3ZCJ A;  4PJN A;  4AKH A;  3RIU C;  4TWD A;  1AJ3 A;  2CHO A;  4LF6 T;  2M6B A;  3ABV A;  3N9N A;  2MAW A;  3PUQ A;  1IBK T;  4J2C A;  4FI5 A;  2YKS A;  5L2L A;  4B3M T;  3LK4 2;  4AQF A;  4YHJ A;  2J4G A;  3DJB A;  2DWG A;  2CBJ A;  4QKN A;  5LHI B;  2DL1 A;  4ILB A;  3UU5 A;  4DR2 T;  2NR4 A;  1I6Z A;  2JQK A;  2BKP A;  3ONX A;  3UUN A;  1SUM B;  2E9X B;  1S94 A;  3RQU A;  4YXD A;  2E9X C;  1WYC A;  5JRC A;  4TV9 E;  1HTJ F;  2DCF A;  2L9Q A;  2UXX B;  3AB3 B;  2L3L A;  5CA0 E;  3UU4 A;  3JAD A;  4EIW A;  2FJB A;  2PG8 A;  2C5J A;  4EXT A;  5AQN B;  4DV2 T;  4JYA T;  4IDO A;  3BQK A;  3ZMZ B;  2LM2 A;  5LXT E;  5AQQ B;  2GK9 A;  3T1H T;  3HL6 A;  5LBM A;  4ADZ A;  2QA7 A;  4XAX B;  4LFB T;  2AXD S;  3Q9D A;  3RYF E;  4DMV A;  3PUZ F;  2UUB T;  3AVR A;  3IBP A;  3P4Q A;  1Y01 A;  3WAK A;  2LM9 A;  1XZY A;  4JI0 T;  3PUA A;  3FBL A;  4HFC A;  2XUE A;  4PFP A;  2CMR A;  4DR7 T;  3GA8 A;  3ZN0 B;  3RX6 A;  1CUN A;  3KVB A;  2YIN A;  3RGL A;  3O9X A;  3CK6 A;  4LF5 T;  3PUY F;  3Q2M A;  3UUX B;  3EDU A;  4E7S A;  4X5T A;  5JR9 C;  3AEC A;  5FKY A;  3AE4 A;  2VUR A;  5KMG P;  4G63 A;  4UVA B;  2LEH A;  3C51 A;  5AQV B;  4YTP A;  1WRD A;  3RYH E;  1CHU A;  4GYR A;  3AA7 B;  4P09 A;  5FXW A;  3FZM B;  3H3A A;  5LBQ B;  3UUB A;  5HYA A;  3GN5 A;  4V1A v;  4A97 A;  3ZT7 A;  2D5U A;  3AAI A;  2YN6 A;  3AAA B;  3C4X A;  3RKO A;  5LGN B;  4B3R T;  2XY8 B;  4WW0 A;  5L47 A;  3UTK A;  2BG9 E;  3AE2 A;  1WR0 A;  2V1D B;  1OED B;  2Y8D A;  5JH7 E;  2NWB A;  2X68 A;  5GON E;  2PJQ A;  4KP3 C;  4XBF B;  2DNX A;  1OED E;  4KBM B;  3LK2 B;  3X1D A;  2YOE A;  2WBL A;  3NRX A;  4ILC A;  3SFD A;  4ZHQ E;  2KWI B;  2WU2 A;  1UUS A;  5AQO B;  4U2Y A;  2ZMA A;  4LF8 T;  4ZI7 E;  2LHR A;  5EZY E;  4AQY T;  4CXW A;  5EK2 A;  4ZXL A;  4O4L E;  4GKJ T;  5HEG A;  4A98 A;  1Z8U A;  2LRL A;  1WLX A;  2KSR A;  2WMN A;  2XAF B;  3LSV A;  5JVD E;  2K9A A;  4DID B;  3UU3 A;  2JPF A;  3HI2 A;  4JV5 T;  5LG4 A;  2G0U A;  2C0S A;  2X67 A;  5AQR B;  4F6R C;  4YT0 A;  5ABH A;  3QB5 A;  3ZLI A;  2FJE A;  3IA3 A;  2XAQ B;  2BZB A;  4MBQ A;  4TNV A;  2ZM8 A;  3K3N A;  4U3C A;  4IL9 A;  3RC3 A;  5KX5 E;  2JQ9 A;  2ODV A;  5AQI B;  1WCR A;  5LYJ E;  2Y48 B;  3AA6 B;  3ONL C;  4PK6 A;  3IF8 B;  4L0R A;  4ZOL E;  3ZMS B;  4AKL A;  2XHE B;  2HPJ A;  1G8X A;  4IE6 A;  3RIA A;  4DBQ A;  5L3C B;  3CX7 B;  2W4X A;  1QSD A;  2E9X A;  4PJJ A;  1D0Y A;  4OYK A;  5L3D B;  1T72 A;  2VQF T;  4LF7 T;  3AEF A;  4ASK A;  2QVA A;  5HXE A;  3VU7 H;  2WU5 A;  3I0O A;  4HFB A;  4H9R C;  1LKX A;  1MNE A;  5JDQ A;  1D1A A;  3L39 A;  2PTF A;  2A72 A;  1T7S A;  4EYU A;  3OYX A;  5JRE A;  1XNQ T;  4KHZ F;  3NKZ A;  4IDP A;  5HWX A;  5L3G B;  1HNZ T;  2HH7 A;  2QRX A;  3B57 A;  3RIU A;  3SOL A;  4EZH A;  2W63 A;  4HKA A;  1YW0 A;  2WZI A;  4MHC A;  4UEM A;  2VKO A;  3FZF B;  3QB5 K;  5L3B B;  2A9U A;  2E2A A;  2WCA A;  2XAS B;  2HHH T;  2KMF A;  4HWC A;  5FVK A;  2D0U A;  4DMW A;  1JNR A;  2X0L B;  4EGW A;  5LCY A;  4IE4 A;  2UXC T;  2BVM A;  2CCQ A;  2J47 A;  4H9S E;  4M1P A;  4U74 A;  3ZKR A;  5LGT B;  4O2B E;  1UK5 A;  3GMI A;  5LJN A;  3ZST A;  3F2E A;  3P4W A;  3AE1 A;  3Q5X A;  1IAP A;  2XSB A;  3C4W A;  4YTM A;  1UX4 A;  2YK0 A;  3NZQ A;  5DAB A;  1B7T A;  3RRC A;  3OYZ A;  5LHG B;  4TUY E;  1J5E T;  4HE8 A;  4PJL A;  2A2F X;  3Q5D A;  3CWZ B;  5CJ5 A;  5L3F B;  4DR4 T;  2IUB A;  4WYV A;  3KFW X;  1VOM A;  5HEO A;  5HAX A;  4MFR A;  3RHW A;  5BMV E;  4GK0 E;  5LMU T;  3P7I A;  2B1E A;  3ZCI A;  5FXZ A;  3HKE E;  3E22 E;  4NXM T;  3AA0 B;  1UX5 A;  3PTR B;  5TAO A;  4O4H E;  4X62 T;  3PUW F;  1O3X A;  1US7 B;  3UU6 A;  4LMK A;  3ZJ1 A;  4IL4 A;  2XSA A;  2ZM2 A;  4HWI B;  3ANW B;  3WI3 A;  1XNR T;  1EZ3 A;  4LFA T;  4X1Y E;  4EB6 E;  4GKK T;  4O4I E;  2X0H A;  3VKH A;  1U5P A;  1IBL T;  3SFE A;  5AQJ B;  2V5D A;  5AQK B;  5F5W A;  2LSY A;  5ADX L;  3L8R A;  4OFZ A;  2X9Y A;  3I0Q A;  2Q9Q D;  2PBI A;  4AIU A;  4H63 V;  3S4U A;  4U72 A;  4LML A;  2KLQ A;  2NW9 A;  4UVB B;  2R6G F;  2UU9 T;  3PU8 A;  3QNU A;  4YFS A;  3NZP A;  1I94 T;  3N2O A;  5AFU L;  1WFD A;  4CXY A;  2C5K T;  2X9H A;  3U3I A;  4AKR B;  1J1J A;  4K0U A;  4I4T E;  2CWY A;  3TLS A;  5CGM A;  2EHO C;  1N32 T;  3L3P A;  5AQG B;  2BG9 A;  3N9Q A;  3EAB A;  3CX6 B;  2V7K A;  3EDV A;  3HA4 A;  3CIR A;  4OYJ A;  5LMN T;  1D0X A;  2KZ7 B;  4KX6 A;  4OK0 A;  4DV4 T;  3CKD A;  5LJM A;  5ABF B;  1WYB A;  3B13 A;  4OX9 T;  1BR0 A;  2KIN B;  3M3Z B;  5HEH A;  3VR9 A;  2E5L T;  4U31 A;  2IIU A;  5J2U E;  1ZOY A;  5ABE A;  1HX1 B;  2FBW A;  2YDS A;  1UGO A;  2XPK A;  2IHR 1;  2JJ9 A;  5FP3 A;  1WR6 A;  2BDE A;  2V7I A;  2VKH A;  2DI4 A;  1H7C A;  3AXJ B;  3C98 B;  3ETU A;  4HFE A;  1HG2 A;  1IZN B;  2LSI A;  4UR9 A;  3E08 A;  4HFV A;  3SWH A;  4DND A;  3HKB E;  5H6R B;  1N34 T;  4TWH A;  5ABG A;  4JLE A;  5JR9 A;  2X0Y A;  3GWH A;  3CQC B;  4PNI A;  1MIY A;  2L8K A;  3AE9 A;  4X1K E;  4JBW F;  4XZC A;  2NOX A;  3ONJ A;  3ZSS A;  4TZ4 C;  2LKG A;  4DO0 A;  4EV6 A;  2YU2 A;  4EED A;  4DV5 T;  2UXD T;  2K5B B;  3RI5 A;  1KNP A;  2W67 A;  2K48 A;  2OLT A;  3D0T A;  3N9O A;  3VR8 A;  3OTO T;  3KBT A;  2WS3 A;  3MZK B;  4U33 A;  3VHL A;  1W0B A;  5J0Z A;  1V9D A;  2LSG A;  3JC6 C;  5AQL B;  3SRZ A;  3MK7 C;  2LKH A;  3P4S A;  3TKL B;  2CLY B;  4QXH B;  3VRB A;  4CN1 A;  4ERR A;  3WAJ A;  4IDQ A;  1ZHC A;  3JC6 D;  1BR2 A;  3IHR A;  2IAK A;  4I50 E;  4EZ4 A;  1IJ5 A;  1E1H B;  1HX8 A;  1D1C A;  1VCT A;  2NP9 A;  2MPK A;  4UEL A;  3CQG B; 
#chains in the Genus database with same CATH homology
 3CML A;  3ZC1 A;  4BJN A;  2P9B A;  1LVF A;  2KT9 A;  4IE7 A;  5ETW A;  2V7M A;  4GIW A;  5L3E B;  3NRY A;  3OKQ A;  4L5G A;  3ZN1 B;  2MOZ A;  2CXF A;  1OWA A;  3EUH A;  3KIN B;  4AI6 A;  2X9X A;  3RYI E;  2XAH B;  4H9P C;  5JDH A;  1KNZ A;  2W62 A;  3ETV A;  3PUR A;  5JR9 B;  5C8Y E;  2Q9Q B;  3PE0 A;  3R6N A;  5DQW A;  3KV6 A;  4QX7 B;  3V5S A;  1YD8 G;  4FJO A;  3QC9 A;  2CEA A;  4Z8X A;  5KDM C;  5JDN A;  3F57 A;  3FXD B;  5J2T E;  2EHO D;  2BVL A;  2CM0 A;  2JQQ A;  3LFM A;  2I59 A;  2LSK A;  5HXR A;  4WNK A;  3AAE B;  5HWY A;  4DBR A;  3PUG A;  3T8O A;  5HXC A;  2NTX A;  2XQY A;  4QXC B;  4CQI A;  2Q9Q C;  2NTY A;  3DTO A;  2ES0 A;  1X79 A;  3PUS A;  2D0T A;  3N9L A;  1ZV4 X;  4IDZ A;  3ZYL A;  4TV8 E;  2PFV A;  2WMO A;  3AVS A;  4CI1 B;  1HF8 A;  1LVK A;  3A5X A;  3SS1 A;  3CVR A;  1FMV A;  2LJL A;  4IIJ E;  4HN9 A;  1D0Z A;  5F8P A;  1Z0P A;  4I55 E;  2YEV C;  4UVC B;  4IHJ E;  2VKD A;  1IJ6 A;  4WBO A;  5FY0 A;  2VK9 A;  1MIV A;  3MJX A;  3U78 A;  4EOZ B;  4H63 H;  1QUU A;  4YJ2 E;  5JRC B;  2LOP A;  1FIO A;  5JDG A;  4A56 A;  2D2S A;  2E8I A;  3RRW A;  1SHZ C;  4X20 E;  5FXX A;  3RC8 A;  3CPZ A;  4UV9 B;  4E7Z A;  4O4J E;  4NUV A;  4AQF C;  5JQG E;  2XAG B;  2VWA A;  2WSS V;  3O1I A;  3BQI A;  2N9D A;  3N2K E;  1FMW A;  3I1A A;  4PAG A;  5IYZ E;  5M4Y A;  3ANW A;  2V7L A;  3H37 A;  2NW7 A;  2QGS A;  5A1L A;  2WWU A;  2VKJ A;  1BR1 A;  2N1G A;  4PFO A;  3C64 A;  4UF0 A;  3HKD E;  1MMN A;  4P0B A;  2LSJ A;  2NW8 A;  3ZMU B;  3LBX B;  2N2N A;  4YLH A;  2K24 A;  3UUM A;  2SPC A;  2V7J A;  2EHO B;  4H9N C;  2MBG A;  2LHN A;  1G73 A;  2CLY C;  2YU1 A;  2RA1 A;  2ZM0 A;  2X66 A;  3C50 A;  4L9I A;  4ANJ A;  2LT3 A;  5FMN A;  3AA1 B;  3CX8 B;  4UIG A;  3KV9 A;  3DP7 A;  1HS7 A;  2H7V C;  3FHN A;  1MMA A;  2IC9 A;  4QX8 B;  2JMK A;  4CI2 B;  4B6X A;  4PW8 A;  2H3R A;  3ZPO A;  2W00 A;  1S35 A;  2J1D G;  3O1H A;  2CE7 A;  3C4Z A;  3CQX C;  4AQG A;  4X1I E;  3MA9 A;  3N2G E;  4YJ3 E;  4H9Q C;  4MAL A;  3MKD A;  4KMC A;  2C5I T;  4G2A A;  4CXX A;  3O4X E;  3ZMV B;  3ZEF B;  3R84 B;  3HKC E;  3J7Y q;  3LBX A;  3V5U A;  4QWN B;  4OHF A;  3KVA A;  3ZJ2 A;  4ZS2 A;  5DQV A;  5J2U E;  4QHO A;  5JDF A;  2XAJ B;  4HTE A;  4CI3 B;  2Z6E A;  5H6Q B;  4UXN B;  3N9M A;  3ZC0 A;  3OJA A;  2KXP B;  3MXZ A;  3N5L A;  3LJC A;  3OBV E;  3ZYM A;  2CXD A;  5JDM A;  4BA9 A;  2CWO A;  2LE8 A;  1SA0 E;  5CB4 E;  3J9X 1;  3LG7 A;  3ZYK A;  4PJM A;  3Q5W A;  1FEW A;  5EK3 A;  1HFA A;  1HG5 A;  4BAY B;  1D1B A;  4EYY R;  5LGU B;  2X9W A;  2M67 A;  2WM9 A;  4ISS A;  1Y64 B;  2ACX A;  4UF0 B;  1U4Q A;  2X51 A;  5JDL A;  4IGU A;  2DHR A;  5DJQ C;  2IW5 B;  4GOU A;  5FY1 A;  1KK7 A;  4H9O C;  2V26 A;  3ZMT B;  3I9Y A;  3M65 A;  1BR4 A;  4NUU A;  5F3J A;  2E9X D;  5FXV A;  3RH3 A;  4TN7 B;  1YKH B;  3BQL A;  5E0O A;  4GYS A;  4ZS3 A;  4EAH A;  3W15 B;  1MMG A;  3I9W A;  4JEU B;  1T98 A;  4HEA A;  3KDS E;  1LRZ A;  3UT5 E;  3PDY A;  2A3D A;  3O1J A;  4PK4 A;  2KND A;  2VB6 A;  3E0Z A;  5FNV E;  3FXE B;  3MAC A;  1VRB A;  5IHY A;  3NBX X;  4ZI2 C;  4HGA A;  4JEH B;  2DWK A;  2KWH A;  3IEE A;  2JMH A;  4ZI3 C;  2HPL A;  2MYS A;  5LP6 E;  3UUL A;  3FB2 A;  4KUM B;  4CZZ B;  2VAS A;  2VL8 A;  2EHO A;  5FYM A;  5LA6 E;  3GN5 B;  2UXN B;  1UCU A;  2OA5 A;  5HXS A;  4MLK A;  2RP4 A;  2W61 A;  4AKI A;  3HR0 A;  4C91 A;  4TX5 A;  5HXH A;  5LNK A;  2DLR A;  3BK9 A;  5FY7 A;  2WAU A;  4O2A E;  2Y6X A;  1HCI A;  4DVD A;  3ESL A;  4IST A;  3EVY A;  5LOV E;  5CA1 E;  3N9P A;  4QXB B;  2CXL A;  3F31 A;  3K8P C;  4GK5 E;  3QUJ A;  2ODU A;  4PK5 A;  4UV8 B;  3KV4 A;  1NAF A;  2MTQ A;  3VKG A;  3QK6 A;  4ILU A;  3UFE A;  3FBZ A;  3L09 A;  4C90 A;  2H7O A;  4IE5 A;  2LOS A;  3KV5 A;  3P8C D;  2IC6 A;  2Q9Q A;  1OXZ A;  1MIW A;  3K3O A;  5LHH B;  5LJM A;  3LK3 B;  2ZLY A;  3RPU A;  1ZKE A;  3PU3 A;  3RYC E;  4AKG A;  1ZEE A;  2W0G A;  5EK4 A;  4JUY A;  4O8S A;  4WBN E;  3K3Q C;  3KBU A;  5J1G A;  1NWM X;  4ZI3 D;  1MMD A;  4BJM A;  2CA5 A;  4IE0 A;  2JRK A;  4N78 D;  1YKE B;  1MND A;  2XTL A;  4I43 B;  3ZCJ A;  4PJN A;  4AKH A;  1AJ3 A;  3N9N A;  3PUQ A;  4J2C A;  4FI5 A;  5L2L A;  3LK4 2;  4AQF A;  4YHJ A;  3DJB A;  5LHI B;  2DWG A;  4QKN A;  3ONX A;  3UUN A;  2E9X B;  1S94 A;  2E9X C;  1WYC A;  5JRC A;  4TV9 E;  1HTJ F;  2DCF A;  3AB3 B;  2L9Q A;  2UXX B;  2L3L A;  5CA0 E;  4EIW A;  4EXT A;  2PG8 A;  2C5J A;  3BQK A;  3ZMZ B;  5LXT E;  2GK9 A;  3HL6 A;  5LBM A;  4ADZ A;  2QA7 A;  4XAX B;  3Q9D A;  3RYF E;  4DMV A;  3AVR A;  3IBP A;  3WAK A;  2LM9 A;  3PUA A;  3FBL A;  2XUE A;  4PFP A;  2CMR A;  3GA8 A;  3ZN0 B;  3RX6 A;  1CUN A;  3KVB A;  2YIN A;  3O9X A;  3Q2M A;  3UUX B;  4E7S A;  3EDU A;  5JR9 C;  5KMG P;  4G63 A;  4UVA B;  2LEH A;  3C51 A;  1WRD A;  3RYH E;  4GYR A;  3AA7 B;  4P09 A;  5FXW A;  3H3A A;  5LBQ B;  5HYA A;  3GN5 A;  4V1A v;  2D5U A;  3AAI A;  3C4X A;  3AAA B;  3RKO A;  5LGN B;  4WW0 A;  3UTK A;  2V1D B;  2Y8D A;  5JH7 E;  2NWB A;  2X68 A;  5GON E;  2PJQ A;  4KP3 C;  4XBF B;  2DNX A;  4KBM B;  3LK2 B;  2WBL A;  3NRX A;  4ZHQ E;  2KWI B;  2ZMA A;  4ZI7 E;  2LHR A;  5EZY E;  4CXW A;  5EK2 A;  4O4L E;  1WLX A;  2WMN A;  2XAF B;  5JVD E;  2K9A A;  2JPF A;  3HI2 A;  5LG4 A;  2G0U A;  2C0S A;  2X67 A;  4F6R C;  3ZLI A;  2XAQ B;  2BZB A;  4MBQ A;  3RC3 A;  2ZM8 A;  3K3N A;  5KX5 E;  3VKH A;  2ODV A;  5LYJ E;  2Y48 B;  3AA6 B;  4PK6 A;  4ZOL E;  3IF8 B;  4L0R A;  3ZMS B;  4AKL A;  4DBQ A;  2XHE B;  2HPJ A;  1G8X A;  4IE6 A;  4EYU A;  5L3C B;  3CX7 B;  1QSD A;  2E9X A;  4PJJ A;  1D0Y A;  4OYK A;  5L3D B;  4ASK A;  5HXE A;  3VU7 H;  3I0O A;  4H9R C;  1LKX A;  1MNE A;  5JDQ A;  1D1A A;  2A72 A;  3OYX A;  5JRE A;  5HWX A;  5L3G B;  2HH7 A;  3B57 A;  3SOL A;  4EZH A;  2W63 A;  4HKA A;  1YW0 A;  4MHC A;  4UEM A;  2VKO A;  5L3B B;  2XAS B;  2KMF A;  2D0U A;  4DMW A;  2X0L B;  5LCY A;  4IE4 A;  2BVM A;  2CCQ A;  4H9S E;  4M1P A;  4U74 A;  5LGT B;  4O2B E;  3GMI A;  5LJN A;  3F2E A;  3Q5X A;  1IAP A;  3C4W A;  5DAB A;  1UX4 A;  2YK0 A;  3NZQ A;  3RRC A;  1B7T A;  3OYZ A;  5LHG B;  4TUY E;  4HE8 A;  4PJL A;  2A2F X;  3CWZ B;  5L3F B;  5BMV E;  3KFW X;  1VOM A;  5HAX A;  4MFR A;  4GK0 E;  3P7I A;  2B1E A;  3ZCI A;  5FXZ A;  3HKE E;  3E22 E;  3AA0 B;  1UX5 A;  3PTR B;  5TAO A;  4O4H E;  1O3X A;  1US7 B;  3ZJ1 A;  2ZM2 A;  3ANW B;  3WI3 A;  1EZ3 A;  4X1Y E;  4EB6 E;  4O4I E;  1U5P A;  2LSY A;  5ADX L;  4OFZ A;  2X9Y A;  3I0Q A;  2Q9Q D;  2PBI A;  4H63 V;  3S4U A;  4U72 A;  2KLQ A;  2NW9 A;  4UVB B;  3PU8 A;  4YFS A;  3NZP A;  3N2O A;  5AFU L;  4CXY A;  2C5K T;  2X9H A;  3U3I A;  4AKR B;  4K0U A;  4I4T E;  2CWY A;  2EHO C;  3L3P A;  3N9Q A;  3CX6 B;  3HA4 A;  2V7K A;  3EDV A;  4OYJ A;  1D0X A;  2KZ7 B;  4OK0 A;  3CKD A;  1BR0 A;  1WYB A;  3B13 A;  2KIN B;  5FP3 A;  2JJ9 A;  3ETU A;  1WR6 A;  2BDE A;  3C98 B;  2V7I A;  2DI4 A;  1H7C A;  2VKH A;  4ZI2 D;  1HG2 A;  1IZN B;  2LSI A;  3SWH A;  3E08 A;  4HFV A;  4DND A;  3HKB E;  5H6R B;  4JLE A;  5JR9 A;  3GWH A;  3CQC B;  4PNI A;  1MIY A;  2L8K A;  4X1K E;  4XZC A;  4DO0 A;  4P0A A;  2NOX A;  4TZ4 C;  2YU2 A;  2K5B B;  2K48 A;  3D0T A;  3N9O A;  3KBT A;  3MZK B;  3VHL A;  1V9D A;  2LSG A;  3JC6 C;  3SRZ A;  3TKL B;  3MK7 C;  4AXP A;  4ERR A;  2CLY B;  4QXH B;  3WAJ A;  1ZHC A;  3JC6 D;  1BR2 A;  3IHR A;  2IAK A;  4I50 E;  4EZ4 A;  1IJ5 A;  1E1H B;  1HX8 A;  1D1C A;  2NP9 A;  4UEL A;  3CQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...