1Z0PA

Crystal structure of the protein of unknown function spy1572 from streptococcus pyogenes
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
73
Chain Sequence
b'MSYEKEFLKDFEDWVKTQIQVNQLAMATSQEVADERAKDAFIRYESKLDAYEFLLGKFDNYKNGKAFHDIPDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SPy1572
molecule tags Structural genomics, unknown function
source organism Streptococcus pyogenes
publication title The 1.7A Crystal structure of the hypothetical protein SPy1572 from Streptococcus pyogenes
rcsb
total genus 33
structure length 73
sequence length 77
ec nomenclature
pdb deposition date 2005-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08930 DUF1912 Domain of unknown function (DUF1912)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1z0pA00
2X9XA 2C5JA 3FXDB 3L3PA 4EYYR 4DNDA 3N5LA 1H7CA 3CVRA 2MBGA 3MXZA 2X9WA 1Z0PA 1IJ6A 2G0UA 2C5KT 3TKLB 2X9YA 1IJ5A 3P7IA 2IC9A 3CKDA 2XTLA 4FI5A 3S4UA 1LVFA 4J2CA 1LRZA 4CQIA 1QSDA 2KWIB 2CA5A 1ZKEA 4L0RA 2IC6A 3QK6A 2C5IT 2KWHA 3FXEB 2K48A 3QUJA 4B6XA
chains in the Genus database with same CATH superfamily
2YEVC 3PUYF 1HS7A 3Q5XA 3NWIA 3QC9A 2H88A 4IHJE 2L3LA 3ZJ1A 4L9IA 4JI6T 2LHRA 4LF4T 2YDRA 1Y01A 3BQKA 1KNZA 3FB2A 3O1HA 3MK7C 2H89A 4WYVA 1YQ3A 5LHGB 3ONLC 4DV3T 1XNRT 4TNWA 3NKZA 3UU5A 4AQYT 1J1JA 3NZQA 2WY2A 2LHNA 3LBXA 3UU3A 4DVDA 2ES0A 4HE8A 4YFSA 3ABVA 5AQFB 1EZ3A 2XQAA 2CM0A 5L2LA 3NRXA 2HN1A 2KWIB 2CA5A 2CLYC 1ZKEA 4ILAA 4QH5A 2X0YA 2UXNB 4I4TE 2LLYA 2HN2A 2YDSA 3K8PC 4MBQA 1WR0A 1KNRA 2W00A 1BR4A 2WSSV 2XAQB 3AEBA 2FJEA 2BS3A 3LG7A 4LMKA 2H3RA 4JI7T 3ZLIA 2J47A 4H63H 3C4WA 3ZSSA 3HI2A 3N9QA 2LSIA 3GN5B 3X1DA 2K3WA 3OVUA 3P8CD 4AISA 5FY7A 4ZI7E 3AA7B 4KHPT 5LB7B 3TLUA 2IIUA 4QX8B 2F4VT 2QRXA 5AQOB 3WI3A 1AJ3A 2BVLA 4I55E 4IGUA 3SRZA 5ABEA 4QXBB 3C98B 1I6ZA 1VRBA 3N9PA 1IJ6A 3P4QA 3ZYKA 4YTNA 2FBWA 2BS2A 3TKLB 4LFCT 3AXJB 3B5MA 2X9YA 4DR4T 1YD8G 2GK9A 2MTQA 3HL6A 5ABGA 1FJGT 3ZT7A 4FI5A 3S4UA 4LF5T 3QB5K 2ACXA 2LM9A 4H9SE 4QXCB 2BKOA 4BJMA 2XSAA 2J1DG 3I0OA 4IDQA 3IF8B 2JRKA 3ZSTA 3UUXB 3VKGA 2V8SV 5DABA 1M7KA 3J7Yq 2W63A 2X51A 3VHLA 1D1CA 2IUBA 2ODVA 4AKLA 5HEGA 4ZS2A 4JI4T 4B3TT 2Y8DA 2V6YA 4C90A 4UV9B 2QA7A 2CRBA 2LOSA 4IL4A 2BKNA 5LMUT 4A98A 4DMVA 2FJBA 3ONXA 4GYRA 2ZLYA 3M3ZB 3UTKA 1U4QA 2PTFA 5KMGP 1HFAA 1KNPA 3CQGB 3CX8B 4HFCA 4UELA 1UX5A 3TLWA 3FZKB 3PU8A 2MYSA 3FBZA 4EGWA 4LFBT 2W2UA 5AFUL 2NW7A 4LF7T 1NAFA 2XAJB 5FL1A 1WFDA 3BK9A 3ZYMA 3TLTA 1L0VA 1MIVA 2BG9C 4YHHT 4ZS3A 2UXDT 3P7IA 2LM2A 2XAHB 3DTOA 4CI3B 1OEDB 5L3DB 2LSYA 5LGTB 2JQQA 4A5XA 3HA4A 3AE2A 3EVYA 5JTGA 5AQSB 4CZZB 4YTPA 2LSJA 4IDPA 2BG9E 3UUMA 4COFA 2VWAA 2VL8A 2B76A 2VURA 4ZI3C 3U78A 2UUCT 4ERRA 3RIFA 3AAIA 5IYZE 3RYHE 3PUWF 3VKHA 3AE1A 4DR2T 4F6RC 4O4HE 3LBXB 1CHUA 5HEUA 4U2YA 5FMNA 4ZI2C 3CMLA 4X5TA 1JNRA 2CE7A 4O4LE 3L39A 3Q2MA 5L4HA 3AAAB 2J62A 2JIWA 4PJNA 1NEKA 1JNZA 1Z0PA 2VQFT 2NW9A 3N2KE 2CEAA 4IE0A 1D0ZA 5AQRB 4IREA 3ZYLA 4GKKT 1HG5A 2XM1A 5HEJA 1WR6A 1UCUA 3CKDA 3RQWA 3RYCE 3LK3B 1HG2A 4WBOA 5HXSA 2QGSA 4WBNE 4UVCB 4YY3T 4DV0T 4PK5A 4HFEA 2RA1A 4NPPA 1X9BA 4KHZF 4ANJA 2WU2A 4HTEA 3VRAA 3CWZB 3PUZF 2CXFA 4QKNA 3AE4A 5FYMA 2OA5A 4JYAT 3FXEB 3H3MA 3QUJA 2VK9A 3K3QC 2VVNA 3PUAA 4O4JE 1HNXT 3O4XE 2WB5A 3DJBA 3A8YC 4PFPA 5L3CB 4DV2T 5CJ5A 1OWAA 1QUUA 5CA0E 5LBMA 4DR5T 5JRCA 2EHOC 1W0BA 1GQEA 1XWMA 2V1DB 2E2AA 2VL0A 2WWUA 5JR9A 5JRCB 3LK42 5IWAT 4TV9E 3A5XA 5AQMB 2X66A 2LRKA 2Q9QD 3IEEA 3KINB 3KV6A 1HX8A 4H9RC 4IDNA 2WU5A 3AVRA 4K0KT 4HN9A 2WQYA 3FZMB 3I9YA 3UT5E 4AXPA 4AQGA 4DO0A 3LJCA 3N9NA 3CK6A 4EXTA 2IAKA 1MIYA 5C8YE 5L47A 5J2TE 3ZC0A 2D2SA 4QWNB 5FVLA 3RLFF 2KWHA 2V26A 3L8RA 2W61A 3R84B 5BMVE 2YU1A 4B6XA 4JEHB 5L4EA 3K3NA 4A97A 5C3JA 1KF6A 3N5LA 1BR2A 3AE6A 1MIWA 1HTJF 3PU3A 3RRWA 5KXJA 5EK4A 4X66T 2WMOA 2XASB 4HFDA 2CBJA 3UUBA 1FEWA 2EHOA 2RP4A 3AA1B 2MAWA 1G8XA 2CXLA 4H9NC 3PUXF 4UVBB 2KNDA 2WM9A 5HXRA 2D9DA 4EB6E 5FXVA 4DBRA 4DR1T 4OYKA 4UVAB 2VB6A 2E5VA 1YXRA 4U3CA 3ZJ2A 1W0AA 4TWHA 4KI0F 4AKRB 2I6HA 4YSZA 2OLTA 4FJOA 2D5UA 3HKCE 3F2EA 3QK6A 1UURA 4LMLA 4NUUA 5F5WA 4CI2B 4DIDB 5LJMA 1XMOT 2C5IT 4HWFA 2EHOB 2NW8A 4PK4A 3RIAA 3JADA 2LJLA 1IZNB 2I0MA 3LFMA 4IIJE 1YKEB 4YSXA 2NP9A 3KV5A 2C5JA 4CN1A 2LT3A 4ZZCA 4U31A 3VRBA 1V9DA 3Q5WA 2WDRA 1OEDA 2Q9QB 2WCAA 2Y48B 5F8PA 2K9AA 3CPZA 2UUAT 5FVKA 3CVRA 4QX7B 5DJQC 3OTOT 3AE7A 2VQET 1US7B 1X79A 2JPFA 2E5LT 2IMLA 2WDVA 5GONE 2DWKA 3P4RA 4YLHA 2LEHA 3AEFA 4Q25A 5LP6E 3WAJA 4KMCA 3SS1A 1N33T 2CHNA 4JI3T 3FZLB 5FY0A 4ZHQE 4OHFA 4IL9A 4JUYA 1MMDA 2A72A 3MKDA 3SWHA 4QH1A 3R6NA 3RYIE 5LCYA 1T8BA 2K24A 2XAGB 1HNWT 5LHIB 3UU8A 2KMFA 5E0OA 4DUZT 2R6GF 3KBUA 4ILBA 3MZKB 4PJMA 3KVBA 5HCJA 5JDFA 1Z8UA 2V6YB 3AEGA 3I1AA 4LMJA 4ZXLA 4Z91A 5TAOA 2ZM6T 2UUBT 4DBQA 3B13A 5KX5E 3VR9A 2B1EA 4BJNA 2V7JA 1WYBA 4AKIA 3JCFA 2AXDS 2X9HA 5C2TA 2BG9A 5JDMA 2X9WA 1D0YA 2CMRA 2JMKA 2XSBA 2CCQA 3F31A 3RQUA 4EZHA 2VKJA 4YSYA 5ABHA 1J5ET 4H63V 3LDQB 3A7MA 1W9RA 1MMNA 1WYCA 2VASA 2HHHT 2WS3A 4O8SA 1NWMX 3QNUA 4IE6A 1SHZC 4WNKA 3KBTA 1D1BA 4DUYT 4TV8E 1QSDA 4EYUA 2W66A 3IA3A 4KP3C 2BG9B 2HPJA 3JC6D 3C51A 3PJAA 3N9MA 2PFVA 4HFHA 2M6IA 5LG4A 4BA9A 4HFBA 4V1Av 1E1HB 2WBLA 2PG8A 3FHNA 4TWDA 3K3OA 2DNXA 2CLYB 2Q9QC 3OYXA 1ZP0A 2CWYA 2KT9A 2E8IA 2V6XA 3L3PA 4MLKA 4DR7T 1FIOA 3ZPOA 4OFZA 3TLSA 5HAXA 1Y64B 1N34T 2N9DA 3FBLA 4OK0A 3NVOA 4PFOA 3T8OA 3CIRA 3ONJA 2IHR1 2MBGA 4DV7T 3AE3A 4WW0A 3ZN0B 3WAKA 2I59A 5AQQB 1XMQT 3G06A 1HR0T 5A1LA 3RIUC 4CXXA 4TX5A 2V7LA 1VCTA 2XQ7A 4YJ3E 3NRYA 3ZT6A 2IC9A 3O9XA 5J0ZA 3T1HT 5JH7E 3IHRA 3ZMUB 5JDHA 4LF6T 2HH7A 1O3XA 3PDYA 1KFYA 2C0SA 1M62A 3KV4A 4DR3T 5CFBA 1UGOA 2W0GA 3NBXX 2XQ4A 5AQIB 3ZMSB 4B3RT 4P0BA 3V5UA 4EAHA 2E9XA 2Y6XA 2VKHA 3P4WA 2E9XC 4Z90A 4CN6A 4HWHA 5AQLB 2A3DA 2WDQA 2YU2A 2X9XA 4PK6A 5AQGB 3KV9A 4QXHB 3GWHA 4HGAA 5IHYA 3P50A 4UIGA 3RH3A 4EYYR 2D0TA 3UU4A 2UXBT 1CUNA 4MHCA 4KUMB 2D0UA 3BQLA 2X68A 2CHOA 4KBMB 3N2GE 3U3IA 2FJAA 4E7SA 1WCRA 4U7IA 3RIUA 5LGUB 4JI0T 2BZBA 1XDOA 5JR9B 2LE8A 4GIWA 1KEYA 4HWIB 2KSRA 4H9OC 1I94T 3ZEFB 4TZ4C 1G73A 1KK7A 4JEUB 2VKOA 5AQHB 2ODUA 4ZI3D 5CGMA 3P4PA 3JC6C 1J5WA 2Q9QA 3QB5A 2DL1A 4JI2T 4DR6T 3PJAJ 4IDOA 4YT0A 5JDLA 2NR4A 5CB4E 1E7PA 4O4IE 3Q5DA 3D0TA 5AQNB 1NENA 4PJLA 5FXWA 1WRDA 3EABA 2CXDA 5JDQA 2BDEA 2LOPA 5JREA 3P4SA 4P1NA 5LG3A 2KZ7B 1MMAA 5HEHA 5AQPB 4UV8B 4DNDA 4ZZBA 5HYAA 4I0UA 3JAFA 2A2FX 4P0AA 2YDQA 1IBLT 3HR0A 5JQGE 3ZN1B 4B3ST 1XNQT 4DV5T 1QLBA 4U72A 4JI5T 3RRCA 3VU7H 2UXCT 3DP7A 5J1GA 3RC3A 3ZCIA 2XUEA 5EK2A 5L3EB 3J9X1 3T1YT 3RC8A 3B57A 2LRLA 4M1PA 2XTLA 5LHHB 3HKBE 3RX6A 4J2CA 1BR0A 1E2AA 1WLXA 2JMHA 3IBPA 5HXEA 4L0RA 2A9UA 3EDVA 4QHOA 3MA9A 5AQVB 3RI5A 2MOZA 2SPCA 4CI1B 3HKDE 3AA6B 5ETWA 4ISSA 3Q5EA 4LFAT 4U7YA 4XBFB 5AQTB 5EZYE 5HWYA 5LOVE 1ZOYA 4KX6A 5ABFA 4DV6T 4EOZB 2FUPA 3N9OA 4EIWA 3K1SA 1B7TA 2YINA 2PJQA 2KINB 2JQHA 2IDOB 2DI4A 1D1AA 2V5DA 3MXZA 4H9QC 2LSGA 2X67A 4XAXB 4ZOLE 4EZ4A 4YJ2E 4YXDA 4X62T 2UU9T 1R8IA 2XZEA 4PNIA 3UUNA 4IDZA 4HFIA 3ESLA 5FNVE 5LBQB 5F3JA 1OXZA 4HFVA 2V7IA 2ZMAA 1UK5A 3AEDA 4O2BE 2NOXA 4U74A 4Z8XA 4DMWA 1FMVA 1OEDC 4GOUA 3GN5A 4X64T 4ILCA 2CBIA 2V5CA 4GK0E 4TNVA 5HCMA 4ZEYA 4JLEA 5IUXA 3NZPA 2YKSA 3ZMVB 2QVAA 5JDNA 4YTMA 3C64A 3PUQA 4X20E 5CA1E 4NXMT 1YKHB 4UR9A 2NTXA 2VKDA 2XPKA 3UQ4A 2V7KA 1HF8A 5FKYA 1MNEA 3FXDB 4HWDA 4UXNB 2UXXB 5DQVA 3V5SA 4GYSA 2WWVA 3RHWA 3SOLA 2BBJA 5BR8T 1DU2A 1LKXA 3PUGA 3I0QA 2Z6EA 2XQ6A 3FZHB 4JI1T 2XJ7A 4UF0A 3KVAA 4JV5T 3E22E 2AE9A 1HCIA 3RKGA 3UFGA 3H37A 3ZMZB 3EUHA 5KDMC 3OKQA 4G2AA 1U5PA 1VOMA 2XQ5A 3UQ7A 1SA0E 2LKHA 4HEAA 1IBMT 3AE8A 3W15B 2CPTA 4AIUA 4GK5E 4O2AE 1LVFA 2W4XA 4AQFA 4X1KE 1ZEEA 2YN6A 2NTYA 2WZIA 3AE9A 1IAPA 1T98A 2XAFB 3O1JA 2X0HA 2RPAA 3PV0F 2N2NA 4TUYE 2ZM8A 4JBWF 4X1YE 3LK2B 2J4GA 2WP9A 1UUSA 3C4ZA 4IE7A 2YOEA 4I43B 2K48A 2WAUA 2WMNA 3UFEA 3N2OA 5LYJE 1SE7A 1N32T 4CXWA 3ANWA 5L3GB 2BBHA 4MALA 4EEBA 5LA6E 4AQFC 4ILUA 3RKOA 1XZYA 3KFWX 4NUVA 4TWFA 4NIQA 1S94A 3AA0B 3FZFB 2JJ9A 3C4XA 4PJJA 5FXXA 1T72A 2G0UA 5LMNT 2ACZA 2BKPA 2HPLA 4IE5A 3CX7B 3BQIA 3ETUA 4F8HA 3RPUA 3AEEA 1W09A 5FP3A 4AI6A 5FL0A 2MPKA 2DHRA 2NWBA 1OEDE 2XQ8A 4UF0B 3AECA 3L09A 5M4YA 2DWGA 2M67A 2EHOD 1HNZT 5L3BB 3TLVA 4HKAA 3E08A 4NXNT 4U2ZA 5J2UE 1N36T 2QYWA 2JQKA 2X0LB 3E0ZA 3RGLA 3UU6A 5LJNA 4AKHA 5ABFB 4CXYA 3AE5A 2BS4A 5LGNB 4X1IE 1D0XA 4ASKA 4TN7B 4ISTA 4QH4A 5DQWA 1FMWA 5H6QB 3RF1A 4E7ZA 3EI0A 1LVKA 2CWOA 2V7MA 2E9XD 3O1IA 1HX1B 3ETVA 2P9BA 1H7CA 2FJDA 2LKGA 3HKEE 2H7OA 3SFEA 2KXPB 2VVSA 4ADZA 5LXTE 1XDPA 1YW0A 3M65A 3EHZA 2JQ9A 3ZKRA 1IBKT 3AEAA 2N1GA 4ZI2D 2PBIA 2C5KT 4N78D 5HWXA 1BR1A 1T7SA 5FXZA 1YQ4A 3EAMA 4U33A 4YHJA 2XHEB 1LRZA 1ZHCA 2ZM0A 1MNDA 2LSKA 4OX9T 2L8KA 3RYFE 4X65T 2BVMA 3ZT5A 2IC6A 5FY1A 4G63A 1ZV4X 2ZM2A 3UULA 4BAYB 3AXJA 2W62A 4CN4A 3PE0A 2KLQA 2H7VC 3ZCJA 3LSVA 3QOFA 2WZHA 5ADXL 3AB3B 3MJXA 5EK3A 3N9LA 2K5BB 2DLRA 4K0UA 4PAGA 1UX4A 3F57A 3ZC1A 4AKGA 2XQYA 4C91A 2M6BA 2OV9A 2XQ3A 2XM2A 3AVSA 3I9WA 3AAEB 2XQ9A 3PURA 5AQUB 2XY8B 3CQXC 3CQCB 4A56A 3OYZA 5JDGA 4L5GA 3JAEA 4H9PC 4IE4A 5AQKB 2DCFA 3PUVF 5JR9C 3PUSA 4I50E 4IT4A 5H6RB 5LNKA 3CX6B 1VCSA 1S35A 3OBVE 4DV4T 3MACA 5HXHA 5HEOA 4UEMA 2IW5B 1IJ5A 3C50A 4GKJT 4B3MT 4LF8T 4DV1T 3GMIA 4WZXA 3ANWB 4MFRA 1MMGA 3SFDA 4EEDA 3KDSE 3OPCA 4LF9T 4PW8A 3PTRB 4XZCA 5AQJB 3ZMTB 4JI8T 3GA8A 1SUMB 3OJAA 3VR8A 4EV6A 2YK0A 2L9QA 2E9XB 5JVDE 4OYJA 3EDUA 4CQIA 4HWCA 5HXCA 3H3AA 5L3FB 2W67A 4P09A 3Q9DA
chains in the Genus database with same CATH topology
2YEVC 3Q5XA 3QC9A 4IHJE 2L3LA 3ZJ1A 4L9IA 2LHRA 1KNZA 3BQKA 3FB2A 3O1HA 3MK7C 5LHGB 3NZQA 2LHNA 3LBXA 4DVDA 2ES0A 4HE8A 4YFSA 1EZ3A 5L2LA 2CM0A 3NRXA 2KWIB 2CA5A 2CLYC 1ZKEA 2UXNB 4I4TE 3K8PC 4MBQA 2WSSV 2XAQB 2W00A 1BR4A 3LG7A 2H3RA 3ZLIA 4H63H 3C4WA 3HI2A 3N9QA 2LSIA 3GN5B 3P8CD 5FY7A 4ZI7E 3AA7B 4QX8B 3WI3A 2BVLA 4I55E 4IGUA 3SRZA 4QXBB 3C98B 1VRBA 3N9PA 1IJ6A 3ZYKA 3TKLB 2X9YA 1YD8G 2GK9A 2MTQA 3HL6A 4FI5A 3S4UA 2ACXA 2LM9A 4H9SE 4QXCB 4BJMA 4CQIA 4AKHA 2J1DG 3I0OA 3IF8B 2JRKA 3UUXB 3VKGA 5DABA 3J7Yq 2W63A 2X51A 3VHLA 1D1CA 2ODVA 4AKLA 4ZS2A 2Y8DA 4C90A 4UV9B 2LOSA 2QA7A 4DMVA 3ONXA 4GYRA 5KMGP 2ZLYA 3UTKA 1U4QA 1HFAA 3CQGB 3CX8B 4UELA 1UX5A 3PU8A 2MYSA 3FBZA 5AFUL 2NW7A 1NAFA 2XAJB 3BK9A 3ZYMA 1MIVA 4ZS3A 3P7IA 4CI3B 2XAHB 3DTOA 5L3DB 2LSYA 5LGTB 2JQQA 3HA4A 3EVYA 4CZZB 2LSJA 3UUMA 2VWAA 2VL8A 4ZI3C 3U78A 4ERRA 3AAIA 5IYZE 3RYHE 3VKHA 4F6RC 4O4HE 3LBXB 5FMNA 4ZI2C 3CMLA 2CE7A 4O4LE 3Q2MA 3AAAB 4PJNA 1Z0PA 2NW9A 3N2KE 2CEAA 4IE0A 1D0ZA 3ZYLA 1HG5A 1WR6A 1UCUA 3CKDA 3RYCE 3LK3B 1HG2A 4WBOA 5HXSA 2QGSA 4WBNE 4UVCB 4PK5A 2RA1A 4ANJA 4HTEA 3CWZB 2CXFA 4QKNA 5FYMA 2OA5A 3FXEB 3QUJA 2VK9A 3K3QC 3PUAA 4O4JE 3O4XE 3DJBA 4PFPA 5L3CB 1OWAA 1QUUA 5CA0E 5LBMA 5JRCA 2EHOC 2V1DB 2WWUA 5JR9A 5JRCB 3LK42 4TV9E 3A5XA 2X66A 2Q9QD 3IEEA 3KINB 3KV6A 1HX8A 4H9RC 3AVRA 4HN9A 3I9YA 3UT5E 4AXPA 4AQGA 4DO0A 3LJCA 3N9NA 4EXTA 5C8YE 2IAKA 1MIYA 5J2TE 3ZC0A 2D2SA 4QWNB 2KWHA 2V26A 2W61A 3R84B 5BMVE 2YU1A 4B6XA 4JEHB 3K3NA 3N5LA 1BR2A 1MIWA 1HTJF 3PU3A 3RRWA 5EK4A 2WMOA 2XASB 1FEWA 2EHOA 2RP4A 3AA1B 4H9NC 1G8XA 2CXLA 1AJ3A 4EB6E 4UVBB 2KNDA 2WM9A 5HXRA 4DBRA 5FXVA 4OYKA 4UVAB 2VB6A 4AKRB 3ZJ2A 4FJOA 2D5UA 3HKCE 3F2EA 3QK6A 5LJMA 4NUUA 4CI2B 2C5IT 2EHOB 2NW8A 4PK4A 1IZNB 2LJLA 3LFMA 4IIJE 1YKEB 2NP9A 3KV5A 2C5JA 2LT3A 1V9DA 3Q5WA 5F8PA 2Y48B 2Q9QB 2K9AA 3CPZA 3CVRA 4QX7B 5DJQC 1US7B 1X79A 2JPFA 5GONE 2DWKA 4YLHA 2LEHA 5LP6E 3WAJA 4KMCA 3SS1A 4ZHQE 5FY0A 4OHFA 4JUYA 1MMDA 2A72A 3MKDA 3SWHA 3R6NA 3RYIE 5LCYA 2K24A 2XAGB 5LHIB 2KMFA 5E0OA 4PJMA 3KBUA 3MZKB 3KVBA 5JDFA 5TAOA 3I1AA 4DBQA 3B13A 5KX5E 2B1EA 4BJNA 2V7JA 1WYBA 4AKIA 2X9HA 5JDMA 2X9WA 1D0YA 2CMRA 2JMKA 2CCQA 3F31A 4EZHA 2VKJA 4H63V 1MMNA 1WYCA 2VASA 4O8SA 1NWMX 4IE6A 4WNKA 1SHZC 3KBTA 1D1BA 4TV8E 1QSDA 4EYUA 4KP3C 2HPJA 3JC6D 3C51A 3N9MA 2PFVA 5LG4A 4BA9A 4V1Av 1E1HB 2WBLA 3FHNA 2PG8A 3K3OA 2DNXA 2CLYB 2Q9QC 3OYXA 2CWYA 2KT9A 2E8IA 3L3PA 4MLKA 1FIOA 3ZPOA 4OFZA 5HAXA 1Y64B 2N9DA 3FBLA 4OK0A 4PFOA 2MBGA 4WW0A 3ZN0B 3WAKA 2I59A 5A1LA 4CXXA 4TX5A 2V7LA 3O9XA 4YJ3E 3NRYA 2IC9A 5JH7E 3IHRA 3ZMUB 5JDHA 2HH7A 1O3XA 3PDYA 2C0SA 3KV4A 2W0GA 3NBXX 3ZMSB 4P0BA 3V5UA 4EAHA 2E9XA 2Y6XA 2VKHA 2E9XC 2A3DA 2YU2A 2X9XA 4PK6A 5IHYA 3KV9A 4QXHB 3GWHA 4HGAA 3RH3A 4UIGA 4EYYR 5LGNB 2D0TA 1CUNA 4MHCA 4KUMB 2D0UA 3BQLA 2X68A 4KBMB 3N2GE 3U3IA 4E7SA 5LGUB 2BZBA 5JR9B 2LE8A 4GIWA 4H9OC 3ZEFB 4TZ4C 1G73A 1KK7A 4JEUB 2VKOA 4ZI3D 2ODUA 3JC6C 2Q9QA 5JDLA 5CB4E 4O4IE 3D0TA 4PJLA 5FXWA 1WRDA 5JDQA 2CXDA 2BDEA 2LOPA 5JREA 2KZ7B 1MMAA 4UV8B 4DNDA 5HYAA 4P0AA 2A2FX 3HR0A 5JQGE 4U72A 3RRCA 3VU7H 3DP7A 5J1GA 3RC3A 3ZCIA 2XUEA 5EK2A 5L3EB 3J9X1 3RC8A 3B57A 4M1PA 2XTLA 5LHHB 3HKBE 3RX6A 4J2CA 1BR0A 1WLXA 2JMHA 3IBPA 5HXEA 4L0RA 3EDVA 4QHOA 3MA9A 2MOZA 2SPCA 4CI1B 3HKDE 3AA6B 5ETWA 4ISSA 4XBFB 5EZYE 5HWYA 5LOVE 4EOZB 3N9OA 4EIWA 1B7TA 2YINA 2PJQA 2KINB 3V5SA 2DI4A 1D1AA 3MXZA 4H9QC 3T8OA 4YJ2E 2LSGA 2X67A 4XAXB 4ZOLE 4EZ4A 4PNIA 3UUNA 4IDZA 3ESLA 5FNVE 5LBQB 5F3JA 1OXZA 4HFVA 2V7IA 2ZMAA 4O2BE 4U74A 4Z8XA 2NOXA 4DMWA 1FMVA 4GOUA 3GN5A 4GK0E 4JLEA 3NZPA 3ZMVB 5JDNA 5CA1E 3C64A 3PUQA 4X20E 1YKHB 2NTXA 2VKDA 2V7KA 1HF8A 1MNEA 3FXDB 4UXNB 5DQVA 2UXXB 4GYSA 3SOLA 1LKXA 3PUGA 3I0QA 2Z6EA 4UF0A 3KVAA 3E22E 1HCIA 3ZMZB 3H37A 3EUHA 5KDMC 3OKQA 4G2AA 1U5PA 1VOMA 1SA0E 4HEAA 3W15B 4GK5E 4O2AE 1LVFA 4AQFA 4X1KE 1ZEEA 2NTYA 1IAPA 1T98A 2XAFB 3O1JA 4TUYE 2N2NA 2ZM8A 4X1YE 3LK2B 4IE7A 3C4ZA 4I43B 2K48A 2WAUA 2WMNA 3UFEA 3N2OA 5LYJE 4CXWA 3ANWA 5L3GB 4MALA 5LA6E 4AQFC 4ILUA 3RKOA 3KFWX 4NUVA 1S94A 3AA0B 2JJ9A 3C4XA 4PJJA 5FXXA 2G0UA 2HPLA 4IE5A 3CX7B 3BQIA 3ETUA 3RPUA 5FP3A 4AI6A 2DHRA 2NWBA 4UF0B 3L09A 5M4YA 2DWGA 2M67A 2EHOD 5L3BB 4HKAA 3E08A 5J2UE 2X0LB 3E0ZA 5LJNA 4CXYA 4X1IE 1D0XA 4ASKA 4TN7B 4ISTA 5DQWA 5H6QB 1FMWA 4E7ZA 1LVKA 2V7MA 2CWOA 2E9XD 3O1IA 3ETVA 1H7CA 2P9BA 3HKEE 2H7OA 4ADZA 2KXPB 5LXTE 1YW0A 3M65A 4ZI2D 2N1GA 2PBIA 2C5KT 4N78D 5HWXA 1BR1A 5FXZA 4YHJA 2XHEB 1LRZA 1ZHCA 2ZM0A 1MNDA 2LSKA 2L8KA 3RYFE 2BVMA 2IC6A 5FY1A 4G63A 2ZM2A 1ZV4X 3UULA 4BAYB 2W62A 3PE0A 2KLQA 2H7VC 3ZCJA 5ADXL 3AB3B 3MJXA 5EK3A 3N9LA 2K5BB 2DLRA 4K0UA 4PAGA 1UX4A 3F57A 3ZC1A 4AKGA 2XQYA 4C91A 3I9WA 3PURA 3AVSA 3ZN1B 3AAEB 5JDGA 3CQXC 3CQCB 4A56A 3OYZA 5JR9C 4L5GA 4H9PC 4IE4A 2DCFA 3PUSA 4I50E 5H6RB 5LNKA 3CX6B 1S35A 3OBVE 3MACA 5HXHA 4UEMA 2IW5B 1IJ5A 3C50A 3GMIA 3ANWB 4MFRA 1MMGA 3KDSE 4PW8A 3PTRB 4XZCA 1HS7A 3ZMTB 3GA8A 3OJAA 2YK0A 2L9QA 2E9XB 5JVDE 4OYJA 3EDUA 5HXCA 3H3AA 5L3FB 4P09A 3Q9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9X A;  2C5J A;  3FXD B;  3L3P A;  4EYY R;  4DND A;  3N5L A;  1H7C A;  3CVR A;  2MBG A;  3MXZ A;  2X9W A;  1Z0P A;  1IJ6 A;  2G0U A;  2C5K T;  3TKL B;  2X9Y A;  1IJ5 A;  3P7I A;  2IC9 A;  3CKD A;  2XTL A;  4FI5 A;  3S4U A;  1LVF A;  4J2C A;  1LRZ A;  4CQI A;  1QSD A;  2KWI B;  2CA5 A;  1ZKE A;  4L0R A;  2IC6 A;  3QK6 A;  2C5I T;  2KWH A;  3FXE B;  2K48 A;  3QUJ A;  4B6X A; 
#chains in the Genus database with same CATH topology
 2YEV C;  3PUY F;  1HS7 A;  3Q5X A;  3NWI A;  3QC9 A;  2H88 A;  4IHJ E;  2L3L A;  3ZJ1 A;  4L9I A;  4JI6 T;  2LHR A;  4LF4 T;  2YDR A;  1Y01 A;  3BQK A;  1KNZ A;  3FB2 A;  3O1H A;  3MK7 C;  2H89 A;  4WYV A;  1YQ3 A;  5LHG B;  3ONL C;  4DV3 T;  1XNR T;  4TNW A;  3NKZ A;  3UU5 A;  4AQY T;  1J1J A;  3NZQ A;  2WY2 A;  2LHN A;  3LBX A;  3UU3 A;  4DVD A;  2ES0 A;  4HE8 A;  4YFS A;  3ABV A;  5AQF B;  1EZ3 A;  2XQA A;  2CM0 A;  5L2L A;  3NRX A;  2HN1 A;  2KWI B;  2CA5 A;  2CLY C;  1ZKE A;  4ILA A;  4QH5 A;  2X0Y A;  2UXN B;  4I4T E;  2LLY A;  2HN2 A;  2YDS A;  3K8P C;  4MBQ A;  1WR0 A;  1KNR A;  2W00 A;  1BR4 A;  2WSS V;  2XAQ B;  3AEB A;  2FJE A;  2BS3 A;  3LG7 A;  4LMK A;  2H3R A;  4JI7 T;  3ZLI A;  2J47 A;  4H63 H;  3C4W A;  3ZSS A;  3HI2 A;  3N9Q A;  2LSI A;  3GN5 B;  3X1D A;  2K3W A;  3OVU A;  3P8C D;  4AIS A;  5FY7 A;  4ZI7 E;  3AA7 B;  4KHP T;  5LB7 B;  3TLU A;  2IIU A;  4QX8 B;  2F4V T;  2QRX A;  5AQO B;  3WI3 A;  1AJ3 A;  2BVL A;  4I55 E;  4IGU A;  3SRZ A;  5ABE A;  4QXB B;  3C98 B;  1I6Z A;  1VRB A;  3N9P A;  1IJ6 A;  3P4Q A;  3ZYK A;  4YTN A;  2FBW A;  2BS2 A;  3TKL B;  4LFC T;  3AXJ B;  3B5M A;  2X9Y A;  4DR4 T;  1YD8 G;  2GK9 A;  2MTQ A;  3HL6 A;  5ABG A;  1FJG T;  3ZT7 A;  4FI5 A;  3S4U A;  4LF5 T;  3QB5 K;  2ACX A;  2LM9 A;  4H9S E;  4QXC B;  2BKO A;  4BJM A;  2XSA A;  2J1D G;  3I0O A;  4IDQ A;  3IF8 B;  2JRK A;  3ZST A;  3UUX B;  3VKG A;  2V8S V;  5DAB A;  1M7K A;  3J7Y q;  2W63 A;  2X51 A;  3VHL A;  1D1C A;  2IUB A;  2ODV A;  4AKL A;  5HEG A;  4ZS2 A;  4JI4 T;  4B3T T;  2Y8D A;  2V6Y A;  4C90 A;  4UV9 B;  2QA7 A;  2CRB A;  2LOS A;  4IL4 A;  2BKN A;  5LMU T;  4A98 A;  4DMV A;  2FJB A;  3ONX A;  4GYR A;  2ZLY A;  3M3Z B;  3UTK A;  1U4Q A;  2PTF A;  5KMG P;  1HFA A;  1KNP A;  3CQG B;  3CX8 B;  4HFC A;  4UEL A;  1UX5 A;  3TLW A;  3FZK B;  3PU8 A;  2MYS A;  3FBZ A;  4EGW A;  4LFB T;  2W2U A;  5AFU L;  2NW7 A;  4LF7 T;  1NAF A;  2XAJ B;  5FL1 A;  1WFD A;  3BK9 A;  3ZYM A;  3TLT A;  1L0V A;  1MIV A;  2BG9 C;  4YHH T;  4ZS3 A;  2UXD T;  3P7I A;  2LM2 A;  2XAH B;  3DTO A;  4CI3 B;  1OED B;  5L3D B;  2LSY A;  5LGT B;  2JQQ A;  4A5X A;  3HA4 A;  3AE2 A;  3EVY A;  5JTG A;  5AQS B;  4CZZ B;  4YTP A;  2LSJ A;  4IDP A;  2BG9 E;  3UUM A;  4COF A;  2VWA A;  2VL8 A;  2B76 A;  2VUR A;  4ZI3 C;  3U78 A;  2UUC T;  4ERR A;  3RIF A;  3AAI A;  5IYZ E;  3RYH E;  3PUW F;  3VKH A;  3AE1 A;  4DR2 T;  4F6R C;  4O4H E;  3LBX B;  1CHU A;  5HEU A;  4U2Y A;  5FMN A;  4ZI2 C;  3CML A;  4X5T A;  1JNR A;  2CE7 A;  4O4L E;  3L39 A;  3Q2M A;  5L4H A;  3AAA B;  2J62 A;  2JIW A;  4PJN A;  1NEK A;  1JNZ A;  1Z0P A;  2VQF T;  2NW9 A;  3N2K E;  2CEA A;  4IE0 A;  1D0Z A;  5AQR B;  4IRE A;  3ZYL A;  4GKK T;  1HG5 A;  2XM1 A;  5HEJ A;  1WR6 A;  1UCU A;  3CKD A;  3RQW A;  3RYC E;  3LK3 B;  1HG2 A;  4WBO A;  5HXS A;  2QGS A;  4WBN E;  4UVC B;  4YY3 T;  4DV0 T;  4PK5 A;  4HFE A;  2RA1 A;  4NPP A;  1X9B A;  4KHZ F;  4ANJ A;  2WU2 A;  4HTE A;  3VRA A;  3CWZ B;  3PUZ F;  2CXF A;  4QKN A;  3AE4 A;  5FYM A;  2OA5 A;  4JYA T;  3FXE B;  3H3M A;  3QUJ A;  2VK9 A;  3K3Q C;  2VVN A;  3PUA A;  4O4J E;  1HNX T;  3O4X E;  2WB5 A;  3DJB A;  3A8Y C;  4PFP A;  5L3C B;  4DV2 T;  5CJ5 A;  1OWA A;  1QUU A;  5CA0 E;  5LBM A;  4DR5 T;  5JRC A;  2EHO C;  1W0B A;  1GQE A;  1XWM A;  2V1D B;  2E2A A;  2VL0 A;  2WWU A;  5JR9 A;  5JRC B;  3LK4 2;  5IWA T;  4TV9 E;  3A5X A;  5AQM B;  2X66 A;  2LRK A;  2Q9Q D;  3IEE A;  3KIN B;  3KV6 A;  1HX8 A;  4H9R C;  4IDN A;  2WU5 A;  3AVR A;  4K0K T;  4HN9 A;  2WQY A;  3FZM B;  3I9Y A;  3UT5 E;  4AXP A;  4AQG A;  4DO0 A;  3LJC A;  3N9N A;  3CK6 A;  4EXT A;  2IAK A;  1MIY A;  5C8Y E;  5L47 A;  5J2T E;  3ZC0 A;  2D2S A;  4QWN B;  5FVL A;  3RLF F;  2KWH A;  2V26 A;  3L8R A;  2W61 A;  3R84 B;  5BMV E;  2YU1 A;  4B6X A;  4JEH B;  5L4E A;  3K3N A;  4A97 A;  5C3J A;  1KF6 A;  3N5L A;  1BR2 A;  3AE6 A;  1MIW A;  1HTJ F;  3PU3 A;  3RRW A;  5KXJ A;  5EK4 A;  4X66 T;  2WMO A;  2XAS B;  4HFD A;  2CBJ A;  3UUB A;  1FEW A;  2EHO A;  2RP4 A;  3AA1 B;  2MAW A;  1G8X A;  2CXL A;  4H9N C;  3PUX F;  4UVB B;  2KND A;  2WM9 A;  5HXR A;  2D9D A;  4EB6 E;  5FXV A;  4DBR A;  4DR1 T;  4OYK A;  4UVA B;  2VB6 A;  2E5V A;  1YXR A;  4U3C A;  3ZJ2 A;  1W0A A;  4TWH A;  4KI0 F;  4AKR B;  2I6H A;  4YSZ A;  2OLT A;  4FJO A;  2D5U A;  3HKC E;  3F2E A;  3QK6 A;  1UUR A;  4LML A;  4NUU A;  5F5W A;  4CI2 B;  4DID B;  5LJM A;  1XMO T;  2C5I T;  4HWF A;  2EHO B;  2NW8 A;  4PK4 A;  3RIA A;  3JAD A;  2LJL A;  1IZN B;  2I0M A;  3LFM A;  4IIJ E;  1YKE B;  4YSX A;  2NP9 A;  3KV5 A;  2C5J A;  4CN1 A;  2LT3 A;  4ZZC A;  4U31 A;  3VRB A;  1V9D A;  3Q5W A;  2WDR A;  1OED A;  2Q9Q B;  2WCA A;  2Y48 B;  5F8P A;  2K9A A;  3CPZ A;  2UUA T;  5FVK A;  3CVR A;  4QX7 B;  5DJQ C;  3OTO T;  3AE7 A;  2VQE T;  1US7 B;  1X79 A;  2JPF A;  2E5L T;  2IML A;  2WDV A;  5GON E;  2DWK A;  3P4R A;  4YLH A;  2LEH A;  3AEF A;  4Q25 A;  5LP6 E;  3WAJ A;  4KMC A;  3SS1 A;  1N33 T;  2CHN A;  4JI3 T;  3FZL B;  5FY0 A;  4ZHQ E;  4OHF A;  4IL9 A;  4JUY A;  1MMD A;  2A72 A;  3MKD A;  3SWH A;  4QH1 A;  3R6N A;  3RYI E;  5LCY A;  1T8B A;  2K24 A;  2XAG B;  1HNW T;  5LHI B;  3UU8 A;  2KMF A;  5E0O A;  4DUZ T;  2R6G F;  3KBU A;  4ILB A;  3MZK B;  4PJM A;  3KVB A;  5HCJ A;  5JDF A;  1Z8U A;  2V6Y B;  3AEG A;  3I1A A;  4LMJ A;  4ZXL A;  4Z91 A;  5TAO A;  2ZM6 T;  2UUB T;  4DBQ A;  3B13 A;  5KX5 E;  3VR9 A;  2B1E A;  4BJN A;  2V7J A;  1WYB A;  4AKI A;  3JCF A;  2AXD S;  2X9H A;  5C2T A;  2BG9 A;  5JDM A;  2X9W A;  1D0Y A;  2CMR A;  2JMK A;  2XSB A;  2CCQ A;  3F31 A;  3RQU A;  4EZH A;  2VKJ A;  4YSY A;  5ABH A;  1J5E T;  4H63 V;  3LDQ B;  3A7M A;  1W9R A;  1MMN A;  1WYC A;  2VAS A;  2HHH T;  2WS3 A;  4O8S A;  1NWM X;  3QNU A;  4IE6 A;  1SHZ C;  4WNK A;  3KBT A;  1D1B A;  4DUY T;  4TV8 E;  1QSD A;  4EYU A;  2W66 A;  3IA3 A;  4KP3 C;  2BG9 B;  2HPJ A;  3JC6 D;  3C51 A;  3PJA A;  3N9M A;  2PFV A;  4HFH A;  2M6I A;  5LG4 A;  4BA9 A;  4HFB A;  4V1A v;  1E1H B;  2WBL A;  2PG8 A;  3FHN A;  4TWD A;  3K3O A;  2DNX A;  2CLY B;  2Q9Q C;  3OYX A;  1ZP0 A;  2CWY A;  2KT9 A;  2E8I A;  2V6X A;  3L3P A;  4MLK A;  4DR7 T;  1FIO A;  3ZPO A;  4OFZ A;  3TLS A;  5HAX A;  1Y64 B;  1N34 T;  2N9D A;  3FBL A;  4OK0 A;  3NVO A;  4PFO A;  3T8O A;  3CIR A;  3ONJ A;  2IHR 1;  2MBG A;  4DV7 T;  3AE3 A;  4WW0 A;  3ZN0 B;  3WAK A;  2I59 A;  5AQQ B;  1XMQ T;  3G06 A;  1HR0 T;  5A1L A;  3RIU C;  4CXX A;  4TX5 A;  2V7L A;  1VCT A;  2XQ7 A;  4YJ3 E;  3NRY A;  3ZT6 A;  2IC9 A;  3O9X A;  5J0Z A;  3T1H T;  5JH7 E;  3IHR A;  3ZMU B;  5JDH A;  4LF6 T;  2HH7 A;  1O3X A;  3PDY A;  1KFY A;  2C0S A;  1M62 A;  3KV4 A;  4DR3 T;  5CFB A;  1UGO A;  2W0G A;  3NBX X;  2XQ4 A;  5AQI B;  3ZMS B;  4B3R T;  4P0B A;  3V5U A;  4EAH A;  2E9X A;  2Y6X A;  2VKH A;  3P4W A;  2E9X C;  4Z90 A;  4CN6 A;  4HWH A;  5AQL B;  2A3D A;  2WDQ A;  2YU2 A;  2X9X A;  4PK6 A;  5AQG B;  3KV9 A;  4QXH B;  3GWH A;  4HGA A;  5IHY A;  3P50 A;  4UIG A;  3RH3 A;  4EYY R;  2D0T A;  3UU4 A;  2UXB T;  1CUN A;  4MHC A;  4KUM B;  2D0U A;  3BQL A;  2X68 A;  2CHO A;  4KBM B;  3N2G E;  3U3I A;  2FJA A;  4E7S A;  1WCR A;  4U7I A;  3RIU A;  5LGU B;  4JI0 T;  2BZB A;  1XDO A;  5JR9 B;  2LE8 A;  4GIW A;  1KEY A;  4HWI B;  2KSR A;  4H9O C;  1I94 T;  3ZEF B;  4TZ4 C;  1G73 A;  1KK7 A;  4JEU B;  2VKO A;  5AQH B;  2ODU A;  4ZI3 D;  5CGM A;  3P4P A;  3JC6 C;  1J5W A;  2Q9Q A;  3QB5 A;  2DL1 A;  4JI2 T;  4DR6 T;  3PJA J;  4IDO A;  4YT0 A;  5JDL A;  2NR4 A;  5CB4 E;  1E7P A;  4O4I E;  3Q5D A;  3D0T A;  5AQN B;  1NEN A;  4PJL A;  5FXW A;  1WRD A;  3EAB A;  2CXD A;  5JDQ A;  2BDE A;  2LOP A;  5JRE A;  3P4S A;  4P1N A;  5LG3 A;  2KZ7 B;  1MMA A;  5HEH A;  5AQP B;  4UV8 B;  4DND A;  4ZZB A;  5HYA A;  4I0U A;  3JAF A;  2A2F X;  4P0A A;  2YDQ A;  1IBL T;  3HR0 A;  5JQG E;  3ZN1 B;  4B3S T;  1XNQ T;  4DV5 T;  1QLB A;  4U72 A;  4JI5 T;  3RRC A;  3VU7 H;  2UXC T;  3DP7 A;  5J1G A;  3RC3 A;  3ZCI A;  2XUE A;  5EK2 A;  5L3E B;  3J9X 1;  3T1Y T;  3RC8 A;  3B57 A;  2LRL A;  4M1P A;  2XTL A;  5LHH B;  3HKB E;  3RX6 A;  4J2C A;  1BR0 A;  1E2A A;  1WLX A;  2JMH A;  3IBP A;  5HXE A;  4L0R A;  2A9U A;  3EDV A;  4QHO A;  3MA9 A;  5AQV B;  3RI5 A;  2MOZ A;  2SPC A;  4CI1 B;  3HKD E;  3AA6 B;  5ETW A;  4ISS A;  3Q5E A;  4LFA T;  4U7Y A;  4XBF B;  5AQT B;  5EZY E;  5HWY A;  5LOV E;  1ZOY A;  4KX6 A;  5ABF A;  4DV6 T;  4EOZ B;  2FUP A;  3N9O A;  4EIW A;  3K1S A;  1B7T A;  2YIN A;  2PJQ A;  2KIN B;  2JQH A;  2IDO B;  2DI4 A;  1D1A A;  2V5D A;  3MXZ A;  4H9Q C;  2LSG A;  2X67 A;  4XAX B;  4ZOL E;  4EZ4 A;  4YJ2 E;  4YXD A;  4X62 T;  2UU9 T;  1R8I A;  2XZE A;  4PNI A;  3UUN A;  4IDZ A;  4HFI A;  3ESL A;  5FNV E;  5LBQ B;  5F3J A;  1OXZ A;  4HFV A;  2V7I A;  2ZMA A;  1UK5 A;  3AED A;  4O2B E;  2NOX A;  4U74 A;  4Z8X A;  4DMW A;  1FMV A;  1OED C;  4GOU A;  3GN5 A;  4X64 T;  4ILC A;  2CBI A;  2V5C A;  4GK0 E;  4TNV A;  5HCM A;  4ZEY A;  4JLE A;  5IUX A;  3NZP A;  2YKS A;  3ZMV B;  2QVA A;  5JDN A;  4YTM A;  3C64 A;  3PUQ A;  4X20 E;  5CA1 E;  4NXM T;  1YKH B;  4UR9 A;  2NTX A;  2VKD A;  2XPK A;  3UQ4 A;  2V7K A;  1HF8 A;  5FKY A;  1MNE A;  3FXD B;  4HWD A;  4UXN B;  2UXX B;  5DQV A;  3V5S A;  4GYS A;  2WWV A;  3RHW A;  3SOL A;  2BBJ A;  5BR8 T;  1DU2 A;  1LKX A;  3PUG A;  3I0Q A;  2Z6E A;  2XQ6 A;  3FZH B;  4JI1 T;  2XJ7 A;  4UF0 A;  3KVA A;  4JV5 T;  3E22 E;  2AE9 A;  1HCI A;  3RKG A;  3UFG A;  3H37 A;  3ZMZ B;  3EUH A;  5KDM C;  3OKQ A;  4G2A A;  1U5P A;  1VOM A;  2XQ5 A;  3UQ7 A;  1SA0 E;  2LKH A;  4HEA A;  1IBM T;  3AE8 A;  3W15 B;  2CPT A;  4AIU A;  4GK5 E;  4O2A E;  1LVF A;  2W4X A;  4AQF A;  4X1K E;  1ZEE A;  2YN6 A;  2NTY A;  2WZI A;  3AE9 A;  1IAP A;  1T98 A;  2XAF B;  3O1J A;  2X0H A;  2RPA A;  3PV0 F;  2N2N A;  4TUY E;  2ZM8 A;  4JBW F;  4X1Y E;  3LK2 B;  2J4G A;  2WP9 A;  1UUS A;  3C4Z A;  4IE7 A;  2YOE A;  4I43 B;  2K48 A;  2WAU A;  2WMN A;  3UFE A;  3N2O A;  5LYJ E;  1SE7 A;  1N32 T;  4CXW A;  3ANW A;  5L3G B;  2BBH A;  4MAL A;  4EEB A;  5LA6 E;  4AQF C;  4ILU A;  3RKO A;  1XZY A;  3KFW X;  4NUV A;  4TWF A;  4NIQ A;  1S94 A;  3AA0 B;  3FZF B;  2JJ9 A;  3C4X A;  4PJJ A;  5FXX A;  1T72 A;  2G0U A;  5LMN T;  2ACZ A;  2BKP A;  2HPL A;  4IE5 A;  3CX7 B;  3BQI A;  3ETU A;  4F8H A;  3RPU A;  3AEE A;  1W09 A;  5FP3 A;  4AI6 A;  5FL0 A;  2MPK A;  2DHR A;  2NWB A;  1OED E;  2XQ8 A;  4UF0 B;  3AEC A;  3L09 A;  5M4Y A;  2DWG A;  2M67 A;  2EHO D;  1HNZ T;  5L3B B;  3TLV A;  4HKA A;  3E08 A;  4NXN T;  4U2Z A;  5J2U E;  1N36 T;  2QYW A;  2JQK A;  2X0L B;  3E0Z A;  3RGL A;  3UU6 A;  5LJN A;  4AKH A;  5ABF B;  4CXY A;  3AE5 A;  2BS4 A;  5LGN B;  4X1I E;  1D0X A;  4ASK A;  4TN7 B;  4IST A;  4QH4 A;  5DQW A;  1FMW A;  5H6Q B;  3RF1 A;  4E7Z A;  3EI0 A;  1LVK A;  2CWO A;  2V7M A;  2E9X D;  3O1I A;  1HX1 B;  3ETV A;  2P9B A;  1H7C A;  2FJD A;  2LKG A;  3HKE E;  2H7O A;  3SFE A;  2KXP B;  2VVS A;  4ADZ A;  5LXT E;  1XDP A;  1YW0 A;  3M65 A;  3EHZ A;  2JQ9 A;  3ZKR A;  1IBK T;  3AEA A;  2N1G A;  4ZI2 D;  2PBI A;  2C5K T;  4N78 D;  5HWX A;  1BR1 A;  1T7S A;  5FXZ A;  1YQ4 A;  3EAM A;  4U33 A;  4YHJ A;  2XHE B;  1LRZ A;  1ZHC A;  2ZM0 A;  1MND A;  2LSK A;  4OX9 T;  2L8K A;  3RYF E;  4X65 T;  2BVM A;  3ZT5 A;  2IC6 A;  5FY1 A;  4G63 A;  1ZV4 X;  2ZM2 A;  3UUL A;  4BAY B;  3AXJ A;  2W62 A;  4CN4 A;  3PE0 A;  2KLQ A;  2H7V C;  3ZCJ A;  3LSV A;  3QOF A;  2WZH A;  5ADX L;  3AB3 B;  3MJX A;  5EK3 A;  3N9L A;  2K5B B;  2DLR A;  4K0U A;  4PAG A;  1UX4 A;  3F57 A;  3ZC1 A;  4AKG A;  2XQY A;  4C91 A;  2M6B A;  2OV9 A;  2XQ3 A;  2XM2 A;  3AVS A;  3I9W A;  3AAE B;  2XQ9 A;  3PUR A;  5AQU B;  2XY8 B;  3CQX C;  3CQC B;  4A56 A;  3OYZ A;  5JDG A;  4L5G A;  3JAE A;  4H9P C;  4IE4 A;  5AQK B;  2DCF A;  3PUV F;  5JR9 C;  3PUS A;  4I50 E;  4IT4 A;  5H6R B;  5LNK A;  3CX6 B;  1VCS A;  1S35 A;  3OBV E;  4DV4 T;  3MAC A;  5HXH A;  5HEO A;  4UEM A;  2IW5 B;  1IJ5 A;  3C50 A;  4GKJ T;  4B3M T;  4LF8 T;  4DV1 T;  3GMI A;  4WZX A;  3ANW B;  4MFR A;  1MMG A;  3SFD A;  4EED A;  3KDS E;  3OPC A;  4LF9 T;  4PW8 A;  3PTR B;  4XZC A;  5AQJ B;  3ZMT B;  4JI8 T;  3GA8 A;  1SUM B;  3OJA A;  3VR8 A;  4EV6 A;  2YK0 A;  2L9Q A;  2E9X B;  5JVD E;  4OYJ A;  3EDU A;  4CQI A;  4HWC A;  5HXC A;  3H3A A;  5L3F B;  2W67 A;  4P09 A;  3Q9D A; 
#chains in the Genus database with same CATH homology
 2YEV C;  3Q5X A;  3QC9 A;  4IHJ E;  2L3L A;  3ZJ1 A;  4L9I A;  2LHR A;  1KNZ A;  3BQK A;  3FB2 A;  3O1H A;  3MK7 C;  5LHG B;  3NZQ A;  2LHN A;  3LBX A;  4DVD A;  2ES0 A;  4HE8 A;  4YFS A;  1EZ3 A;  5L2L A;  2CM0 A;  3NRX A;  2KWI B;  2CA5 A;  2CLY C;  1ZKE A;  2UXN B;  4I4T E;  3K8P C;  4MBQ A;  2WSS V;  2XAQ B;  2W00 A;  1BR4 A;  3LG7 A;  2H3R A;  3ZLI A;  4H63 H;  3C4W A;  3HI2 A;  3N9Q A;  2LSI A;  3GN5 B;  3P8C D;  5FY7 A;  4ZI7 E;  3AA7 B;  4QX8 B;  3WI3 A;  2BVL A;  4I55 E;  4IGU A;  3SRZ A;  4QXB B;  3C98 B;  1VRB A;  3N9P A;  1IJ6 A;  3ZYK A;  3TKL B;  2X9Y A;  1YD8 G;  2GK9 A;  2MTQ A;  3HL6 A;  4FI5 A;  3S4U A;  2ACX A;  2LM9 A;  4H9S E;  4QXC B;  4BJM A;  4CQI A;  4AKH A;  2J1D G;  3I0O A;  3IF8 B;  2JRK A;  3UUX B;  3VKG A;  5DAB A;  3J7Y q;  2W63 A;  2X51 A;  3VHL A;  1D1C A;  2ODV A;  4AKL A;  4ZS2 A;  2Y8D A;  4C90 A;  4UV9 B;  2LOS A;  2QA7 A;  4DMV A;  3ONX A;  4GYR A;  5KMG P;  2ZLY A;  3UTK A;  1U4Q A;  1HFA A;  3CQG B;  3CX8 B;  4UEL A;  1UX5 A;  3PU8 A;  2MYS A;  3FBZ A;  5AFU L;  2NW7 A;  1NAF A;  2XAJ B;  3BK9 A;  3ZYM A;  1MIV A;  4ZS3 A;  3P7I A;  4CI3 B;  2XAH B;  3DTO A;  5L3D B;  2LSY A;  5LGT B;  2JQQ A;  3HA4 A;  3EVY A;  4CZZ B;  2LSJ A;  3UUM A;  2VWA A;  2VL8 A;  4ZI3 C;  3U78 A;  4ERR A;  3AAI A;  5IYZ E;  3RYH E;  3VKH A;  4F6R C;  4O4H E;  3LBX B;  5FMN A;  4ZI2 C;  3CML A;  2CE7 A;  4O4L E;  3Q2M A;  3AAA B;  4PJN A;  1Z0P A;  2NW9 A;  3N2K E;  2CEA A;  4IE0 A;  1D0Z A;  3ZYL A;  1HG5 A;  1WR6 A;  1UCU A;  3CKD A;  3RYC E;  3LK3 B;  1HG2 A;  4WBO A;  5HXS A;  2QGS A;  4WBN E;  4UVC B;  4PK5 A;  2RA1 A;  4ANJ A;  4HTE A;  3CWZ B;  2CXF A;  4QKN A;  5FYM A;  2OA5 A;  3FXE B;  3QUJ A;  2VK9 A;  3K3Q C;  3PUA A;  4O4J E;  3O4X E;  3DJB A;  4PFP A;  5L3C B;  1OWA A;  1QUU A;  5CA0 E;  5LBM A;  5JRC A;  2EHO C;  2V1D B;  2WWU A;  5JR9 A;  5JRC B;  3LK4 2;  4TV9 E;  3A5X A;  2X66 A;  2Q9Q D;  3IEE A;  3KIN B;  3KV6 A;  1HX8 A;  4H9R C;  3AVR A;  4HN9 A;  3I9Y A;  3UT5 E;  4AXP A;  4AQG A;  4DO0 A;  3LJC A;  3N9N A;  4EXT A;  5C8Y E;  2IAK A;  1MIY A;  5J2T E;  3ZC0 A;  2D2S A;  4QWN B;  2KWH A;  2V26 A;  2W61 A;  3R84 B;  5BMV E;  2YU1 A;  4B6X A;  4JEH B;  3K3N A;  3N5L A;  1BR2 A;  1MIW A;  1HTJ F;  3PU3 A;  3RRW A;  5EK4 A;  2WMO A;  2XAS B;  1FEW A;  2EHO A;  2RP4 A;  3AA1 B;  4H9N C;  1G8X A;  2CXL A;  1AJ3 A;  4EB6 E;  4UVB B;  2KND A;  2WM9 A;  5HXR A;  4DBR A;  5FXV A;  4OYK A;  4UVA B;  2VB6 A;  4AKR B;  3ZJ2 A;  4FJO A;  2D5U A;  3HKC E;  3F2E A;  3QK6 A;  5LJM A;  4NUU A;  4CI2 B;  2C5I T;  2EHO B;  2NW8 A;  4PK4 A;  1IZN B;  2LJL A;  3LFM A;  4IIJ E;  1YKE B;  2NP9 A;  3KV5 A;  2C5J A;  2LT3 A;  1V9D A;  3Q5W A;  5F8P A;  2Y48 B;  2Q9Q B;  2K9A A;  3CPZ A;  3CVR A;  4QX7 B;  5DJQ C;  1US7 B;  1X79 A;  2JPF A;  5GON E;  2DWK A;  4YLH A;  2LEH A;  5LP6 E;  3WAJ A;  4KMC A;  3SS1 A;  4ZHQ E;  5FY0 A;  4OHF A;  4JUY A;  1MMD A;  2A72 A;  3MKD A;  3SWH A;  3R6N A;  3RYI E;  5LCY A;  2K24 A;  2XAG B;  5LHI B;  2KMF A;  5E0O A;  4PJM A;  3KBU A;  3MZK B;  3KVB A;  5JDF A;  5TAO A;  3I1A A;  4DBQ A;  3B13 A;  5KX5 E;  2B1E A;  4BJN A;  2V7J A;  1WYB A;  4AKI A;  2X9H A;  5JDM A;  2X9W A;  1D0Y A;  2CMR A;  2JMK A;  2CCQ A;  3F31 A;  4EZH A;  2VKJ A;  4H63 V;  1MMN A;  1WYC A;  2VAS A;  4O8S A;  1NWM X;  4IE6 A;  4WNK A;  1SHZ C;  3KBT A;  1D1B A;  4TV8 E;  1QSD A;  4EYU A;  4KP3 C;  2HPJ A;  3JC6 D;  3C51 A;  3N9M A;  2PFV A;  5LG4 A;  4BA9 A;  4V1A v;  1E1H B;  2WBL A;  3FHN A;  2PG8 A;  3K3O A;  2DNX A;  2CLY B;  2Q9Q C;  3OYX A;  2CWY A;  2KT9 A;  2E8I A;  3L3P A;  4MLK A;  1FIO A;  3ZPO A;  4OFZ A;  5HAX A;  1Y64 B;  2N9D A;  3FBL A;  4OK0 A;  4PFO A;  2MBG A;  4WW0 A;  3ZN0 B;  3WAK A;  2I59 A;  5A1L A;  4CXX A;  4TX5 A;  2V7L A;  3O9X A;  4YJ3 E;  3NRY A;  2IC9 A;  5JH7 E;  3IHR A;  3ZMU B;  5JDH A;  2HH7 A;  1O3X A;  3PDY A;  2C0S A;  3KV4 A;  2W0G A;  3NBX X;  3ZMS B;  4P0B A;  3V5U A;  4EAH A;  2E9X A;  2Y6X A;  2VKH A;  2E9X C;  2A3D A;  2YU2 A;  2X9X A;  4PK6 A;  5IHY A;  3KV9 A;  4QXH B;  3GWH A;  4HGA A;  3RH3 A;  4UIG A;  4EYY R;  5LGN B;  2D0T A;  1CUN A;  4MHC A;  4KUM B;  2D0U A;  3BQL A;  2X68 A;  4KBM B;  3N2G E;  3U3I A;  4E7S A;  5LGU B;  2BZB A;  5JR9 B;  2LE8 A;  4GIW A;  4H9O C;  3ZEF B;  4TZ4 C;  1G73 A;  1KK7 A;  4JEU B;  2VKO A;  4ZI3 D;  2ODU A;  3JC6 C;  2Q9Q A;  5JDL A;  5CB4 E;  4O4I E;  3D0T A;  4PJL A;  5FXW A;  1WRD A;  5JDQ A;  2CXD A;  2BDE A;  2LOP A;  5JRE A;  2KZ7 B;  1MMA A;  4UV8 B;  4DND A;  5HYA A;  4P0A A;  2A2F X;  3HR0 A;  5JQG E;  4U72 A;  3RRC A;  3VU7 H;  3DP7 A;  5J1G A;  3RC3 A;  3ZCI A;  2XUE A;  5EK2 A;  5L3E B;  3J9X 1;  3RC8 A;  3B57 A;  4M1P A;  2XTL A;  5LHH B;  3HKB E;  3RX6 A;  4J2C A;  1BR0 A;  1WLX A;  2JMH A;  3IBP A;  5HXE A;  4L0R A;  3EDV A;  4QHO A;  3MA9 A;  2MOZ A;  2SPC A;  4CI1 B;  3HKD E;  3AA6 B;  5ETW A;  4ISS A;  4XBF B;  5EZY E;  5HWY A;  5LOV E;  4EOZ B;  3N9O A;  4EIW A;  1B7T A;  2YIN A;  2PJQ A;  2KIN B;  3V5S A;  2DI4 A;  1D1A A;  3MXZ A;  4H9Q C;  3T8O A;  4YJ2 E;  2LSG A;  2X67 A;  4XAX B;  4ZOL E;  4EZ4 A;  4PNI A;  3UUN A;  4IDZ A;  3ESL A;  5FNV E;  5LBQ B;  5F3J A;  1OXZ A;  4HFV A;  2V7I A;  2ZMA A;  4O2B E;  4U74 A;  4Z8X A;  2NOX A;  4DMW A;  1FMV A;  4GOU A;  3GN5 A;  4GK0 E;  4JLE A;  3NZP A;  3ZMV B;  5JDN A;  5CA1 E;  3C64 A;  3PUQ A;  4X20 E;  1YKH B;  2NTX A;  2VKD A;  2V7K A;  1HF8 A;  1MNE A;  3FXD B;  4UXN B;  5DQV A;  2UXX B;  4GYS A;  3SOL A;  1LKX A;  3PUG A;  3I0Q A;  2Z6E A;  4UF0 A;  3KVA A;  3E22 E;  1HCI A;  3ZMZ B;  3H37 A;  3EUH A;  5KDM C;  3OKQ A;  4G2A A;  1U5P A;  1VOM A;  1SA0 E;  4HEA A;  3W15 B;  4GK5 E;  4O2A E;  1LVF A;  4AQF A;  4X1K E;  1ZEE A;  2NTY A;  1IAP A;  1T98 A;  2XAF B;  3O1J A;  4TUY E;  2N2N A;  2ZM8 A;  4X1Y E;  3LK2 B;  4IE7 A;  3C4Z A;  4I43 B;  2K48 A;  2WAU A;  2WMN A;  3UFE A;  3N2O A;  5LYJ E;  4CXW A;  3ANW A;  5L3G B;  4MAL A;  5LA6 E;  4AQF C;  4ILU A;  3RKO A;  3KFW X;  4NUV A;  1S94 A;  3AA0 B;  2JJ9 A;  3C4X A;  4PJJ A;  5FXX A;  2G0U A;  2HPL A;  4IE5 A;  3CX7 B;  3BQI A;  3ETU A;  3RPU A;  5FP3 A;  4AI6 A;  2DHR A;  2NWB A;  4UF0 B;  3L09 A;  5M4Y A;  2DWG A;  2M67 A;  2EHO D;  5L3B B;  4HKA A;  3E08 A;  5J2U E;  2X0L B;  3E0Z A;  5LJN A;  4CXY A;  4X1I E;  1D0X A;  4ASK A;  4TN7 B;  4IST A;  5DQW A;  5H6Q B;  1FMW A;  4E7Z A;  1LVK A;  2V7M A;  2CWO A;  2E9X D;  3O1I A;  3ETV A;  1H7C A;  2P9B A;  3HKE E;  2H7O A;  4ADZ A;  2KXP B;  5LXT E;  1YW0 A;  3M65 A;  4ZI2 D;  2N1G A;  2PBI A;  2C5K T;  4N78 D;  5HWX A;  1BR1 A;  5FXZ A;  4YHJ A;  2XHE B;  1LRZ A;  1ZHC A;  2ZM0 A;  1MND A;  2LSK A;  2L8K A;  3RYF E;  2BVM A;  2IC6 A;  5FY1 A;  4G63 A;  2ZM2 A;  1ZV4 X;  3UUL A;  4BAY B;  2W62 A;  3PE0 A;  2KLQ A;  2H7V C;  3ZCJ A;  5ADX L;  3AB3 B;  3MJX A;  5EK3 A;  3N9L A;  2K5B B;  2DLR A;  4K0U A;  4PAG A;  1UX4 A;  3F57 A;  3ZC1 A;  4AKG A;  2XQY A;  4C91 A;  3I9W A;  3PUR A;  3AVS A;  3ZN1 B;  3AAE B;  5JDG A;  3CQX C;  3CQC B;  4A56 A;  3OYZ A;  5JR9 C;  4L5G A;  4H9P C;  4IE4 A;  2DCF A;  3PUS A;  4I50 E;  5H6R B;  5LNK A;  3CX6 B;  1S35 A;  3OBV E;  3MAC A;  5HXH A;  4UEM A;  2IW5 B;  1IJ5 A;  3C50 A;  3GMI A;  3ANW B;  4MFR A;  1MMG A;  3KDS E;  4PW8 A;  3PTR B;  4XZC A;  1HS7 A;  3ZMT B;  3GA8 A;  3OJA A;  2YK0 A;  2L9Q A;  2E9X B;  5JVD E;  4OYJ A;  3EDU A;  5HXC A;  3H3A A;  5L3F B;  4P09 A;  3Q9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...