1Z0PA

Crystal structure of the protein of unknown function spy1572 from streptococcus pyogenes
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
73
Chain Sequence
MSYEKEFLKDFEDWVKTQIQVNQLAMATSQEVADERAKDAFIRYESKLDAYEFLLGKFDNYKNGKAFHDIPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SPy1572
publication title The 1.7A Crystal structure of the hypothetical protein SPy1572 from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Structural genomics, unknown function
total genus 33
structure length 73
sequence length 77
ec nomenclature
pdb deposition date 2005-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08930 DUF1912 Domain of unknown function (DUF1912)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1z0pA00
4FI5A 2X9WA 2MBGA 4DNDA 2X9YA 3TKLB 1H7CA 3N5LA 2KWHA 3S4UA 1QSDA 3QUJA 2G0UA 3FXEB 2X9XA 2IC9A 1IJ6A 2XTLA 3CKDA 2CA5A 2IC6A 3MXZA 2KWIB 3QK6A 2C5JA 3FXDB 1IJ5A 2C5KT 2C5IT 1LVFA 3L3PA 4EYYR 4L0RA 4J2CA 2K48A 4CQIA 1ZKEA 1Z0PA 1LRZA 3CVRA 3P7IA 4B6XA
chains in the Genus database with same CATH superfamily
2D0UA 1EZ3A 1FEWA 3ANWA 1X9BA 2VWAA 1DU2A 2JQQA 2CXLA 2YK0A 3HI2A 2V5CA 1KNRA 4DR7T 3AA1B 2V7JA 2W4XA 2X51A 2DHRA 2XY8B 4P0AA 4HFBA 3F31A 5AQOB 3GN5A 3FZLB 3AEGA 1YD8G 5AFUL 2Y48B 3WAKA 2UUAT 1D0YA 5FP3A 4F8HA 2V6YA 3FBLA 4IE5A 2H7OA 3CX6B 2NOXA 4H9SE 4E7SA 1SE7A 3ZJ1A 3ZMUB 3SRZA 3NRXA 2Q9QA 4HN9A 2JQKA 2ACXA 2K3WA 4UXNB 2CBIA 2W0GA 4O4JE 5AQIB 1WYCA 3OYZA 5JRCB 2V8SV 2E8IA 2FJDA 4UVAB 4TV9E 5AQGB 1SUMB 2HPJA 4GKKT 3X1DA 3RHWA 2EHOD 2WM9A 3JAFA 4LF5T 1YW0A 2KNDA 4DV3T 4Q25A 2BZBA 2XAJB 1ZKEA 3VKHA 4ISSA 2CRBA 3ZYLA 4IDNA 2A2FX 4QH1A 1J5ET 4TUYE 4O2BE 2QVAA 4DR6T 1KNZA 4ILCA 3IBPA 5AQNB 3C4XA 1G8XA 1BR4A 2J4GA 3AEFA 1MNDA 5AQUB 1D1CA 5EK3A 2X9YA 3VR8A 2VL8A 2K5BB 3S4UA 5L47A 5AQRB 4UV8B 5L4EA 5C2TA 2XAGB 3N2KE 4IT4A 1E7PA 4HFIA 3A7MA 2PTFA 3SS1A 4DR3T 3PJAA 4DNDA 5FXZA 3PUZF 3HL6A 2NP9A 3ETUA 1XMQT 5HXHA 2CXFA 4ZI3C 3ZMZB 2YDQA 2FJBA 3ESLA 1YXRA 4ZHQE 4GYRA 2CXDA 1XNQT 2CLYC 2KLQA 3UU6A 4MBQA 3P50A 4KX6A 3NZPA 2LM2A 3AAAB 4DV6T 2QRXA 3FZHB 3O9XA 1D0ZA 2K24A 2BKPA 4M1PA 4YXDA 5LBQB 3I9YA 4YSYA 3Q2MA 3VU7H 2B1EA 1KEYA 5AQHB 5ABEA 4IE4A 3UQ7A 2JQ9A 3N9LA 5JRCA 2EHOB 4OYKA 3MACA 5F5WA 4TNVA 4GOUA 5DQWA 5FKYA 2YEVC 3I9WA 2XSAA 5EK2A 4YTPA 4YLHA 1J1JA 2IAKA 1T98A 3AXJA 2XQ4A 3CPZA 4KI0F 4X1KE 5CA0E 1GQEA 4ILAA 4WZXA 4H9RC 5LG4A 5L2LA 4HGAA 2V5DA 3AAEB 3CQCB 4IE6A 4NUUA 4DO0A 2IC6A 4NXNT 3CQXC 2Z6EA 4Z8XA 4FI5A 1S94A 5JREA 2WBLA 1OWAA 5AQVB 3GA8A 4IHJE 4GK5E 5H6QB 2NW9A 3ZPOA 4U3CA 4KHPT 3ZMTB 3UU8A 2IIUA 2BDEA 4DUYT 5FVLA 2UUCT 3P4RA 3RIUA 3JADA 5FY0A 4ZXLA 3J9X1 1UK5A 4B6XA 1UCUA 2YU1A 1BR2A 4TWFA 1U4QA 3P4SA 3P4WA 3RRCA 3UUXB 5LB7B 3AEDA 3WI3A 5JQGE 2E9XC 3R6NA 1HNZT 2ES0A 2M6BA 5LA6E 2X68A 3UFEA 1E2AA 3NBXX 2KINB 1D1BA 2DL1A 5DJQC 3RPUA 4FJOA 3NWIA 3ZN0B 4U72A 3LJCA 2XUEA 2NTYA 4ISTA 4TN7B 1WLXA 2CPTA 1OEDB 2E5VA 4L9IA 2DWKA 4MALA 3ABVA 4G63A 2EHOA 3QB5K 3MA9A 4AXPA 4OHFA 4DR4T 3B5MA 3AB3B 2NW7A 2KXPB 4IDZA 3AE7A 4AI6A 2LKHA 5FMNA 3PUVF 4O8SA 3R84B 4EEDA 4AKLA 2V7KA 2I0MA 2KWHA 3EHZA 3FXEB 3BK9A 5F3JA 3UU5A 2DNXA 4P1NA 5J1GA 1OXZA 3U78A 4JBWF 3AAIA 5C8YE 3O4XE 3ONLC 2W00A 2MBGA 3F57A 4IIJE 5LNKA 1IJ6A 4AKRB 2IDOB 5LBMA 4DUZT 4LF4T 3VRAA 2ZM2A 4AKGA 2LM9A 3RQUA 2VL0A 3PTRB 5KX5E 3Q5DA 2XQ5A 1T7SA 4OFZA 4CI3B 3N2OA 1W0AA 4YJ2E 4BJMA 4JEUB 2C5IT 5HEUA 4UF0B 1YKEB 3UU3A 4O4LE 5AQPB 3OTOT 3ZCJA 3PUYF 3RYCE 2V7IA 2RPAA 2WQYA 2VB6A 2NWBA 2V6XA 5KXJA 3J7Yq 1XZYA 2XASB 2BS4A 5CB4E 4P09A 1WR6A 3SOLA 1M7KA 3K1SA 4DV4T 4C90A 4HWDA 2A9UA 4Z90A 3ZYKA 3AE1A 2KSRA 3N9OA 3DJBA 1XDPA 3EVYA 3FBZA 3OVUA 1ZHCA 4DMVA 2W2UA 4LF6T 2F4VT 5LHIB 2E5LT 4JYAT 3BQLA 3MXZA 3AE9A 2C5KT 3ZEFB 5LXTE 4X1IE 3Q5WA 3AE6A 4WYVA 3JC6D 2RA1A 2UXXB 4CXYA 5LHGB 3N9MA 5H6RB 4NIQA 3RI5A 2HPLA 3CWZB 1QUUA 2DWGA 2IC9A 4QKNA 1AJ3A 3ONXA 2IUBA 4B3RT 2D0TA 4U2ZA 4H9NC 5JDQA 5HEGA 4TV8E 5FL1A 1SHZC 4PFOA 2DLRA 4H63H 3CX7B 4TNWA 4QHOA 2LSKA 5F8PA 4DBRA 2Q9QC 1QLBA 4O2AE 4YFSA 2PG8A 2JPFA 2LLYA 5L3EB 1LRZA 1XMOT 5L3CB 1U5PA 3VHLA 4OK0A 1JNZA 3ZYMA 2LOPA 4AQFA 3TLWA 3ZC1A 3IA3A 2JJ9A 4UF0A 3AECA 2W66A 3KVAA 5E0OA 4EYYR 4JI8T 4JLEA 2MTQA 3KINB 4UR9A 3A8YC 2CM0A 2Y6XA 2D2SA 2BS2A 3RIAA 4DR1T 4ZS2A 5HEJA 2X67A 5CFBA 4MFRA 4PJMA 3SFDA 3PJAJ 3Q9DA 4EEBA 3I0QA 2W62A 1JNRA 2LHRA 3N9PA 1J5WA 1HS7A 5HAXA 4BJNA 1D1AA 4ILUA 4YTMA 2BG9B 5JVDE 1KF6A 5LJNA 3C98B 3DTOA 4I50E 1MIVA 3C4WA 5M4YA 1IBKT 2KWIB 2LRLA 2KT9A 1WRDA 4A97A 1HNXT 1N34T 3UUMA 1NEKA 2NR4A 1E1HB 2UXDT 3QOFA 4CN1A 2PFVA 3NVOA 3ZSSA 4ERRA 3IHRA 5TAOA 2YDRA 2FJEA 1UGOA 2QA7A 2X0HA 3RC3A 1T8BA 2NW8A 5LMNT 2BKNA 2WDQA 3JAEA 2WCAA 5JR9B 2L8KA 4KBMB 3HKEE 5JDNA 3V5SA 3CQGB 3KV6A 2MYSA 3ZT6A 4CXWA 5FXXA 2X9XA 2JIWA 3QNUA 2HN1A 4ANJA 5CA1E 3ZKRA 5C3JA 1UX4A 3TLTA 5LOVE 3U3IA 4ZI2C 1NAFA 4TX5A 5L4HA 1MIYA 3DP7A 2LSIA 5EK4A 4LF8T 1YQ3A 3LFMA 3UULA 2W61A 1BR1A 5HXSA 5JTGA 2YN6A 4EAHA 2WB5A 1ZOYA 4AIUA 4UV9B 1T72A 2H89A 1Y64B 4EYUA 5FY7A 4A98A 2G0UA 5FNVE 5L3BB 4HWHA 2LSJA 2XQ6A 4K0UA 4CZZB 1WFDA 3B13A 5L3DB 1FMWA 3CK6A 4AKHA 4B3MT 3LG7A 3FZKB 3RYHE 3N9NA 2BG9A 3CVRA 3B57A 4IREA 2X9WA 4COFA 3RIUC 3AE3A 3AE8A 3P4PA 4JI2T 3HR0A 3H37A 3O1JA 1NENA 4LMLA 1BR0A 3EDUA 2E2AA 4X20E 3UQ4A 2V7LA 2I6HA 4EGWA 4AISA 3PUSA 4YJ3E 4I43B 2M67A 2XQAA 3TLUA 1VCSA 4PNIA 2IHR1 2YDSA 1HFAA 3PUXF 4HWCA 3PDYA 4UVCB 2SPCA 4IE7A 5L3GB 2XZEA 4WW0A 4DMWA 4B3ST 3HKCE 3UT5E 3KBUA 5LG3A 4IL9A 5JR9A 4X1YE 4N78D 2EHOC 1MMNA 2RP4A 4LF9T 1M62A 2CWOA 5LGUB 4P0BA 1YKHB 3CMLA 2LRKA 3ZT7A 4X66T 2M6IA 4DR2T 4AQYT 5DABA 5JDLA 5AQTB 4QXCB 5ADXL 3M65A 5GONE 4BAYB 1S35A 5HWXA 2AXDS 5HXCA 1MNEA 4JV5T 3N9QA 1D0XA 2BVLA 3RKGA 4PJJA 3E22E 1KFYA 2V7MA 2W67A 4QH5A 2ZLYA 4XAXB 3T1HT 2X0LB 5AQQB 2LHNA 1IJ5A 2VK9A 2BBHA 4HTEA 3EUHA 1N33T 2XAQB 1FJGT 2VKHA 5AQJB 3MJXA 2BKOA 4DV2T 2UU9T 2WSSV 4H9OC 3IEEA 5A1LA 2BBJA 3AEEA 5DQVA 1B7TA 4LFBT 3KDSE 4U33A 1H7CA 5KDMC 3EDVA 2V1DB 5J0ZA 5ETWA 4KMCA 2A72A 2XM1A 4PK6A 3QUJA 2L3LA 4ZI3D 2HH7A 3AEBA 4DR5T 2OA5A 4QH4A 1R8IA 4HWFA 3PURA 3KBTA 3AE2A 3L09A 3P7IA 1Z0PA 1VRBA 3TLVA 2OLTA 2X9HA 3AA7B 5FXVA 4ZEYA 2WWUA 1Y01A 3KVBA 2WP9A 2OV9A 3ZSTA 4YHHT 4GIWA 2HHHT 3C51A 1US7B 3H3AA 2J62A 4O4HE 2XJ7A 3KV9A 1OEDA 4CXXA 2I59A 4U74A 4PAGA 3TKLB 2LOSA 4HKAA 1IBMT 1HNWT 1HG2A 1IBLT 3NZQA 1WCRA 1WYBA 4HFEA 4HWIB 4IGUA 2ODVA 4LMKA 4KP3C 2VQFT 3WAJA 4QXHB 1WR0A 2CHOA 3SWHA 4ASKA 4XBFB 3MK7C 2K9AA 3KV5A 2VKDA 1LVFA 2YKSA 4L0RA 4JI1T 3PV0F 4LMJA 2UUBT 2X66A 4HEAA 3BQKA 2N9DA 3PUAA 5JDMA 4V1Av 5ABFB 5LHHB 3K3QC 5BR8T 4I4TE 4YSZA 2JMKA 4JUYA 4O4IE 2WS3A 4IDPA 3CX8B 2XQ7A 4AQFC 1MIWA 4I0UA 4X65T 5FXWA 2ZMAA 4JI7T 5LGNB 4X62T 1VOMA 2UXBT 4UVBB 4QX8B 3UUBA 3LK42 2WU2A 1HF8A 2JMHA 3AA6B 3V5UA 2VKOA 2CLYB 2VASA 4ADZA 2CHNA 3W15B 1W0BA 3PU3A 4MHCA 4HFVA 1KK7A 2E9XD 2N1GA 1XWMA 1HX1B 5LGTB 3T1YT 4KHZF 1HX8A 1UURA 2BVMA 5J2TE 4PFPA 2LJLA 5LCYA 4ZZBA 2C0SA 3EABA 4TWHA 2QYWA 1HG5A 3H3MA 1HR0T 3NKZA 4ZZCA 5IYZE 1CUNA 2LEHA 3I1AA 5CGMA 2J1DG 3JCFA 3AA0B 4C91A 4PK4A 3RF1A 1XNRT 2WMNA 3RC8A 3FXDB 3AXJB 4EB6E 5JH7E 4OX9T 3OJAA 4UELA 3D0TA 4DIDB 4PW8A 5HEOA 2IMLA 5AQFB 5LYJE 4UIGA 1MMAA 4TZ4C 2V26A 4CN4A 4OYJA 3L3PA 4EIWA 2AE9A 4B3TT 5JDFA 5FVKA 3FHNA 4A56A 4DV0T 1OEDE 2XTLA 2H3RA 4WBNE 4BA9A 4CN6A 5ABFA 4EZ4A 5FYMA 2MOZA 3QB5A 2P9BA 4CI2B 2XQYA 3UFGA 2CE7A 4ILBA 5HWYA 2ODUA 2JQHA 1I6ZA 2WZIA 4QX7B 3MZKB 3UU4A 5J2UE 4ZI7E 2VKJA 5JDHA 1YQ4A 1FIOA 2YU2A 4H9QC 4QWNB 5LJMA 3BQIA 4IDQA 2WWVA 2E9XB 3SFEA 2J47A 5ABHA 4MLKA 1LVKA 4IDOA 3RH3A 4X64T 3EI0A 2DCFA 1UUSA 3QC9A 3RIFA 2A3DA 4EXTA 2WAUA 4KUMB 5HCMA 2WU5A 2XPKA 4HFDA 4DVDA 2CA5A 4PJNA 5L3FB 2BS3A 2L9QA 3G06A 2KZ7B 3K3NA 1O3XA 3ZMVB 3OPCA 4IL4A 3JC6C 2BG9C 1N36T 3ONJA 2CCQA 4CI1B 2ZM8A 3PUQA 1LKXA 4LF7T 3VRBA 4U7IA 3UUNA 5JDGA 2LKGA 5IWAT 2XQ9A 1NWMX 2GK9A 2HN2A 4ZS3A 2XAFB 1IAPA 2MAWA 1V9DA 2XQ8A 4K0KT 2YINA 3GWHA 2XHEB 2FUPA 3TLSA 2WZHA 2PBIA 3ZN1B 3O1IA 4H63V 2CEAA 4AKIA 5HEHA 1HTJF 3FB2A 5ABGA 1L0VA 3L8RA 2XSBA 2UXNB 1KNPA 4YT0A 2X0YA 2XM2A 1CHUA 3ZC0A 4JI6T 5HXRA 3LBXB 1W09A 2LT3A 3AE5A 4I55E 2WY2A 4LFCT 3P8CD 4F6RC 5JR9C 3OYXA 1ZV4X 3T8OA 3AVSA 4HFCA 2CBJA 3E0ZA 2Q9QD 3E08A 3LSVA 3RRWA 5BMVE 3HKBE 5AQKB 2VVSA 3Q5EA 3MKDA 3AVRA 1ZP0A 4YHJA 1Z8UA 3FZMB 3ZJ2A 3RKOA 3RYFE 1XDOA 3RYIE 5IUXA 1W9RA 3LK2B 2E9XA 4YTNA 3ZCIA 4G2AA 3AE4A 2UXCT 4HE8A 5KMGP 3NRYA 2ACZA 2K48A 4YSXA 1VCTA 2N2NA 4EZHA 2B76A 1G73A 3RX6A 2QGSA 4EV6A 1HCIA 5AQSB 1SA0E 2JRKA 4A5XA 2XAHB 2FJAA 3C4ZA 2NTXA 3ZLIA 5FL0A 5HXEA 4JI3T 4DBQA 3ZMSB 4U7YA 4JEHB 5HCJA 3FZFB 5IHYA 3UTKA 2R6GF 3ANWB 4L5GA 2DI4A 2D9DA 1X79A 3OKQA 3KV4A 2C5JA 4Z91A 3EAMA 4CQIA 3PUGA 3OBVE 3PU8A 3LDQB 3O1HA 3LK3B 2W63A 4HFHA 3VKGA 2H88A 3GN5B 4NPPA 4H9PC 2FBWA 3P4QA 4IE0A 5EZYE 4XZCA 2V6YB 2VURA 5LMUT 2ZM0A 4WBOA 3RGLA 5AQLB 5HYAA 3C50A 4JI4T 3LBXA 4PJLA 1N32T 2WDRA 3PE0A 2BG9E 3L39A 3N2GE 2Q9QB 3RLFF 3QK6A 3PUWF 4NXMT 5FY1A 4WNKA 4J2CA 4YY3T 2H7VC 1UX5A 3KFWX 3CIRA 5AQMB 3GMIA 4QXBB 2CWYA 3ETVA 1OEDC 1FMVA 3N5LA 3ZT5A 1QSDA 1MMGA 1I94T 2KMFA 3F2EA 4GKJT 3RQWA 5LP6E 3VR9A 3Q5XA 3C64A 2LE8A 2LSYA 2IW5B 1ZEEA 4DV7T 3K3OA 4LFAT 2VVNA 4UEMA 4PK5A 2CMRA 4TWDA 2XQ3A 4E7ZA 2PJQA 4JI5T 2ZM6T 1IZNB 2MPKA 4GK0E 3AEAA 3I0OA 4DV5T 2YOEA 3K8PC 4X5TA 4NUVA 3HKDE 3CKDA 4AQGA 4GYSA 3M3ZB 4U31A 2Y8DA 4U2YA 4EOZB 4ZI2D 4ZOLE 2LSGA 1MMDA 4JI0T 4DV1T 3A5XA 2WMOA 2D5UA 2VQET 2WDVA 3HA4A 5CJ5A 3IF8B
chains in the Genus database with same CATH topology
3AAIA 3B57A 5C8YE 2D0UA 2X9WA 1EZ3A 5JDFA 1FEWA 3O4XE 2W00A 2MBGA 3ANWA 3F57A 3FHNA 2VWAA 3HR0A 4A56A 2JQQA 2CXLA 2YK0A 3H37A 4IIJE 2XTLA 1IJ6A 2H3RA 5LNKA 3O1JA 4AKRB 5LBMA 3HI2A 4WBNE 1BR0A 4BA9A 3EDUA 3AA1B 2V7JA 2X51A 2DHRA 4X20E 2ZM2A 2V7LA 4AKGA 4P0AA 2LM9A 4EZ4A 3F31A 5FYMA 2MOZA 3PTRB 5KX5E 2P9BA 4CI2B 3PUSA 2XQYA 3GN5A 2CE7A 4YJ3E 4I43B 5HWYA 2ODUA 2M67A 1YD8G 4OFZA 5AFUL 2Y48B 3WAKA 4CI3B 3N2OA 1D0YA 5FP3A 4PNIA 4YJ2E 1HFAA 4QX7B 3FBLA 4BJMA 3MZKB 4IE5A 4JEUB 2H7OA 2C5IT 3CX6B 2NOXA 3PDYA 4UVCB 5J2UE 4H9SE 4UF0B 4E7SA 1YKEB 3ZJ1A 2SPCA 4IE7A 4O4LE 5L3GB 4ZI7E 2VKJA 5JDHA 4WW0A 3SRZA 2YU2A 1FIOA 3NRXA 3ZMUB 4DMWA 4H9QC 4QWNB 2Q9QA 4HN9A 3ZCJA 5LJMA 3BQIA 3HKCE 3RYCE 2V7IA 2E9XB 3UT5E 3KBUA 2ACXA 4UXNB 5JR9A 4X1YE 2VB6A 4N78D 2EHOC 2NWBA 3J7Yq 1MMNA 2W0GA 4O4JE 4MLKA 1LVKA 3RH3A 1WYCA 2XASB 3OYZA 5JRCB 2DCFA 5CB4E 4P09A 1WR6A 2RP4A 3QC9A 2E8IA 4UVAB 2A3DA 4EXTA 2WAUA 4TV9E 3SOLA 4KUMB 2CWOA 5LGUB 4P0BA 2HPJA 1YKHB 3CMLA 4C90A 2EHOD 4DVDA 2CA5A 4PJNA 5DABA 5L3FB 3ZYKA 2L9QA 4CXWA 2WM9A 5JDLA 2KZ7B 1YW0A 2KNDA 4QXCB 5ADXL 3N9OA 3M65A 3DJBA 3K3NA 5GONE 3EVYA 1S35A 4BAYB 5HWXA 3FBZA 1O3XA 1ZHCA 2BZBA 2XAJB 1ZKEA 3ZMVB 3VKHA 4ISSA 5HXCA 1MNEA 4DMVA 3N9QA 1D0XA 2BVLA 3ZYLA 3JC6C 2A2FX 4PJJA 5LHIB 2CCQA 3E22E 4CI1B 2ZM8A 3PUQA 2V7MA 4O2BE 1LKXA 4TUYE 2ZLYA 4XAXB 1KNZA 2X0LB 2LHNA 3IBPA 3BQLA 3MXZA 3UUNA 5JDGA 1IJ5A 2VK9A 2C5KT 3ZEFB 3C4XA 1NWMX 2GK9A 4HTEA 4X1IE 3Q5WA 5LXTE 3EUHA 1G8XA 4ZS3A 2XAFB 1BR4A 1IAPA 3JC6D 1MNDA 2RA1A 2XAQB 1D1CA 2UXXB 5EK3A 1V9DA 4CXYA 5LHGB 3N9MA 2X9YA 5H6RB 2VKHA 2VL8A 2K5BB 3S4UA 2HPLA 3MJXA 2YINA 3CWZB 3GWHA 2XHEB 4UV8B 1QUUA 2DWGA 2IC9A 2WSSV 4QKNA 2XAGB 2PBIA 3ZN1B 3O1IA 4H9OC 3IEEA 4H63V 2CEAA 5A1LA 3ONXA 1AJ3A 3N2KE 4AKIA 1HTJF 3FB2A 5DQVA 1B7TA 2D0TA 2UXNB 3KDSE 4H9NC 3SS1A 4DNDA 5JDQA 5FXZA 3HL6A 1H7CA 2NP9A 4TV8E 1SHZC 4PFOA 2DLRA 3ETUA 4H63H 3ZC0A 3CX7B 5KDMC 4QHOA 2LSKA 5F8PA 3LBXB 5HXRA 4DBRA 2LT3A 2Q9QC 5HXHA 3EDVA 2CXFA 4ZI3C 2V1DB 4I55E 4O2AE 4YFSA 5ETWA 3ZMZB 2PG8A 3P8CD 3ESLA 4F6RC 4ZHQE 4GYRA 2JPFA 4KMCA 5JR9C 2CXDA 1LRZA 5L3EB 2CLYC 3OYXA 5L3CB 2KLQA 1U5PA 4MBQA 1ZV4X 3T8OA 3VHLA 3AVSA 4OK0A 2A72A 3ZYMA 2LOPA 4PK6A 3E0ZA 3NZPA 2Q9QD 3E08A 3QUJA 3RRWA 2L3LA 3HKBE 5BMVE 4ZI3D 3AAAB 2HH7A 4AQFA 3O9XA 1D0ZA 2OA5A 3ZC1A 2JJ9A 3MKDA 4UF0A 2K24A 3AVRA 4YHJA 3PURA 3KBTA 3KVAA 3ZJ2A 4M1PA 5E0OA 4EYYR 3RKOA 3L09A 3RYFE 4JLEA 3RYIE 2MTQA 3KINB 5LBQB 3P7IA 1Z0PA 3I9YA 1VRBA 2X9HA 3AA7B 5FXVA 2CM0A 2WWUA 3Q2MA 3KVBA 2Y6XA 2D2SA 3VU7H 3LK2B 2B1EA 2E9XA 4GIWA 4IE4A 3ZCIA 4G2AA 3C51A 4HE8A 1US7B 5KMGP 3N9LA 5JRCA 3H3AA 2EHOB 4O4HE 4OYKA 3KV9A 3MACA 4ZS2A 3NRYA 2K48A 2N2NA 4GOUA 5DQWA 4CXXA 4EZHA 2X67A 2I59A 2YEVC 3I9WA 1G73A 4U74A 4PAGA 3RX6A 3TKLB 2LOSA 2QGSA 4HKAA 4MFRA 4PJMA 1HCIA 1SA0E 5EK2A 2JRKA 1HG2A 4YLHA 2IAKA 3NZQA 1T98A 3Q9DA 1WYBA 3I0QA 2XAHB 2W62A 3C4ZA 2NTXA 2LHRA 3CPZA 4X1KE 3ZLIA 5CA0E 3N9PA 4IGUA 5HXEA 2ODVA 1HS7A 4DBQA 5HAXA 4BJNA 3ZMSB 1D1AA 4ILUA 4KP3C 4JEHB 4H9RC 5LG4A 5JVDE 5IHYA 3WAJA 5L2LA 5LJNA 4HGAA 3C98B 4QXHB 3UTKA 3AAEB 3SWHA 4ASKA 3ANWB 3CQCB 4IE6A 3DTOA 4I50E 4L5GA 1MIVA 2DI4A 4XBFB 3MK7C 1X79A 3OKQA 3C4WA 2K9AA 4NUUA 5M4YA 4DO0A 2IC6A 3KV4A 2KWIB 2C5JA 3KV5A 3CQXC 2KT9A 2VKDA 1LVFA 4L0RA 4CQIA 1WRDA 3PUGA 2Z6EA 3OBVE 3PU8A 4FI5A 4Z8XA 1S94A 5JREA 2WBLA 2X66A 1OWAA 3BQKA 3O1HA 4HEAA 2N9DA 3UUMA 3GA8A 3PUAA 5JDMA 4IHJE 4V1Av 1E1HB 5LHHB 3K3QC 3LK3B 2W63A 4GK5E 5H6QB 2NW9A 3ZPOA 3VKGA 4I4TE 3ZMTB 3GN5B 2BDEA 4H9PC 2JMKA 4JUYA 4O4IE 4IE0A 2PFVA 3CX8B 5EZYE 4XZCA 4AQFC 4ERRA 5FY0A 3IHRA 1MIWA 2ZM0A 4WBOA 5FXWA 2ZMAA 5TAOA 3J9X1 4B6XA 5HYAA 3C50A 1UCUA 2YU1A 5LGNB 1BR2A 1VOMA 3LBXA 2QA7A 1U4QA 4PJLA 4UVBB 3RC3A 3RRCA 3UUXB 2NW8A 4QX8B 3WI3A 3PE0A 3N2GE 5JQGE 3LK42 2Q9QB 2E9XC 3QK6A 3R6NA 1HF8A 2JMHA 5FY1A 2ES0A 4WNKA 4J2CA 5LA6E 2X68A 3AA6B 5JR9B 2H7VC 2L8KA 1UX5A 3KFWX 3UFEA 2VKOA 3V5UA 2CLYB 2VASA 3NBXX 4KBMB 4ADZA 2KINB 3W15B 3GMIA 4QXBB 2CWYA 3HKEE 1D1BA 3PU3A 5JDNA 3V5SA 3CQGB 3ETVA 3KV6A 1FMVA 3N5LA 5DJQC 2MYSA 1QSDA 1MMGA 4MHCA 4HFVA 1KK7A 5FXXA 3RPUA 2E9XD 2KMFA 2N1GA 3F2EA 2X9XA 4FJOA 5LGTB 5LP6E 3Q5XA 3C64A 3ZN0B 4U72A 2LE8A 3LJCA 1HX8A 2XUEA 4ANJA 2BVMA 2LSYA 2NTYA 4PFPA 5CA1E 2LJLA 5LCYA 2IW5B 1ZEEA 3K3OA 5J2TE 2C0SA 4ISTA 1UX4A 4PK5A 4UEMA 1HG5A 2CMRA 4TN7B 4E7ZA 1WLXA 5LOVE 3U3IA 4ZI2C 2PJQA 1IZNB 4L9IA 1CUNA 5IYZE 1NAFA 2LEHA 3I1AA 4GK0E 2DWKA 2J1DG 4TX5A 1MIYA 3I0OA 4MALA 3DP7A 4G63A 2LSIA 2EHOA 3AA0B 3K8PC 3MA9A 5EK4A 4NUVA 4AXPA 4C91A 3HKDE 4OHFA 3CKDA 4PK4A 4AQGA 3LFMA 4GYSA 3UULA 2W61A 1BR1A 2WMNA 3AB3B 3FXDB 3RC8A 2NW7A 4EB6E 5JH7E 2KXPB 4IDZA 5HXSA 2Y8DA 4EAHA 3OJAA 4AI6A 4UELA 4EOZB 4ZI2D 4UV9B 3D0TA 4ZOLE 5FMNA 4O8SA 2LSGA 1Y64B 3R84B 4PW8A 4AKLA 4EYUA 1MMDA 2V7KA 5LYJE 4UIGA 2KWHA 5FY7A 3A5XA 2WMOA 2G0UA 5FNVE 1MMAA 3FXEB 5L3BB 3BK9A 5F3JA 2D5UA 4TZ4C 2DNXA 2LSJA 3HA4A 4K0UA 4CZZB 2V26A 3B13A 4OYJA 5L3DB 1FMWA 4AKHA 5J1GA 1OXZA 3IF8B 3LG7A 3L3PA 3U78A 3RYHE 4EIWA 3N9NA 3CVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FI5 A;  2X9W A;  2MBG A;  4DND A;  2X9Y A;  3TKL B;  1H7C A;  3N5L A;  2KWH A;  3S4U A;  1QSD A;  3QUJ A;  2G0U A;  3FXE B;  2X9X A;  2IC9 A;  1IJ6 A;  2XTL A;  3CKD A;  2CA5 A;  2IC6 A;  3MXZ A;  2KWI B;  3QK6 A;  2C5J A;  3FXD B;  1IJ5 A;  2C5K T;  2C5I T;  1LVF A;  3L3P A;  4EYY R;  4L0R A;  4J2C A;  2K48 A;  4CQI A;  1ZKE A;  1Z0P A;  1LRZ A;  3CVR A;  3P7I A;  4B6X A; 
#chains in the Genus database with same CATH topology
 2D0U A;  1EZ3 A;  1FEW A;  3ANW A;  1X9B A;  2VWA A;  1DU2 A;  2JQQ A;  2CXL A;  2YK0 A;  3HI2 A;  2V5C A;  1KNR A;  4DR7 T;  3AA1 B;  2V7J A;  2W4X A;  2X51 A;  2DHR A;  2XY8 B;  4P0A A;  4HFB A;  3F31 A;  5AQO B;  3GN5 A;  3FZL B;  3AEG A;  1YD8 G;  5AFU L;  2Y48 B;  3WAK A;  2UUA T;  1D0Y A;  5FP3 A;  4F8H A;  2V6Y A;  3FBL A;  4IE5 A;  2H7O A;  3CX6 B;  2NOX A;  4H9S E;  4E7S A;  1SE7 A;  3ZJ1 A;  3ZMU B;  3SRZ A;  3NRX A;  2Q9Q A;  4HN9 A;  2JQK A;  2ACX A;  2K3W A;  4UXN B;  2CBI A;  2W0G A;  4O4J E;  5AQI B;  1WYC A;  3OYZ A;  5JRC B;  2V8S V;  2E8I A;  2FJD A;  4UVA B;  4TV9 E;  5AQG B;  1SUM B;  2HPJ A;  4GKK T;  3X1D A;  3RHW A;  2EHO D;  2WM9 A;  3JAF A;  4LF5 T;  1YW0 A;  2KND A;  4DV3 T;  4Q25 A;  2BZB A;  2XAJ B;  1ZKE A;  3VKH A;  4ISS A;  2CRB A;  3ZYL A;  4IDN A;  2A2F X;  4QH1 A;  1J5E T;  4TUY E;  4O2B E;  2QVA A;  4DR6 T;  1KNZ A;  4ILC A;  3IBP A;  5AQN B;  3C4X A;  1G8X A;  1BR4 A;  2J4G A;  3AEF A;  1MND A;  5AQU B;  1D1C A;  5EK3 A;  2X9Y A;  3VR8 A;  2VL8 A;  2K5B B;  3S4U A;  5L47 A;  5AQR B;  4UV8 B;  5L4E A;  5C2T A;  2XAG B;  3N2K E;  4IT4 A;  1E7P A;  4HFI A;  3A7M A;  2PTF A;  3SS1 A;  4DR3 T;  3PJA A;  4DND A;  5FXZ A;  3PUZ F;  3HL6 A;  2NP9 A;  3ETU A;  1XMQ T;  5HXH A;  2CXF A;  4ZI3 C;  3ZMZ B;  2YDQ A;  2FJB A;  3ESL A;  1YXR A;  4ZHQ E;  4GYR A;  2CXD A;  1XNQ T;  2CLY C;  2KLQ A;  3UU6 A;  4MBQ A;  3P50 A;  4KX6 A;  3NZP A;  2LM2 A;  3AAA B;  4DV6 T;  2QRX A;  3FZH B;  3O9X A;  1D0Z A;  2K24 A;  2BKP A;  4M1P A;  4YXD A;  5LBQ B;  3I9Y A;  4YSY A;  3Q2M A;  3VU7 H;  2B1E A;  1KEY A;  5AQH B;  5ABE A;  4IE4 A;  3UQ7 A;  2JQ9 A;  3N9L A;  5JRC A;  2EHO B;  4OYK A;  3MAC A;  5F5W A;  4TNV A;  4GOU A;  5DQW A;  5FKY A;  2YEV C;  3I9W A;  2XSA A;  5EK2 A;  4YTP A;  4YLH A;  1J1J A;  2IAK A;  1T98 A;  3AXJ A;  2XQ4 A;  3CPZ A;  4KI0 F;  4X1K E;  5CA0 E;  1GQE A;  4ILA A;  4WZX A;  4H9R C;  5LG4 A;  5L2L A;  4HGA A;  2V5D A;  3AAE B;  3CQC B;  4IE6 A;  4NUU A;  4DO0 A;  2IC6 A;  4NXN T;  3CQX C;  2Z6E A;  4Z8X A;  4FI5 A;  1S94 A;  5JRE A;  2WBL A;  1OWA A;  5AQV B;  3GA8 A;  4IHJ E;  4GK5 E;  5H6Q B;  2NW9 A;  3ZPO A;  4U3C A;  4KHP T;  3ZMT B;  3UU8 A;  2IIU A;  2BDE A;  4DUY T;  5FVL A;  2UUC T;  3P4R A;  3RIU A;  3JAD A;  5FY0 A;  4ZXL A;  3J9X 1;  1UK5 A;  4B6X A;  1UCU A;  2YU1 A;  1BR2 A;  4TWF A;  1U4Q A;  3P4S A;  3P4W A;  3RRC A;  3UUX B;  5LB7 B;  3AED A;  3WI3 A;  5JQG E;  2E9X C;  3R6N A;  1HNZ T;  2ES0 A;  2M6B A;  5LA6 E;  2X68 A;  3UFE A;  1E2A A;  3NBX X;  2KIN B;  1D1B A;  2DL1 A;  5DJQ C;  3RPU A;  4FJO A;  3NWI A;  3ZN0 B;  4U72 A;  3LJC A;  2XUE A;  2NTY A;  4IST A;  4TN7 B;  1WLX A;  2CPT A;  1OED B;  2E5V A;  4L9I A;  2DWK A;  4MAL A;  3ABV A;  4G63 A;  2EHO A;  3QB5 K;  3MA9 A;  4AXP A;  4OHF A;  4DR4 T;  3B5M A;  3AB3 B;  2NW7 A;  2KXP B;  4IDZ A;  3AE7 A;  4AI6 A;  2LKH A;  5FMN A;  3PUV F;  4O8S A;  3R84 B;  4EED A;  4AKL A;  2V7K A;  2I0M A;  2KWH A;  3EHZ A;  3FXE B;  3BK9 A;  5F3J A;  3UU5 A;  2DNX A;  4P1N A;  5J1G A;  1OXZ A;  3U78 A;  4JBW F;  3AAI A;  5C8Y E;  3O4X E;  3ONL C;  2W00 A;  2MBG A;  3F57 A;  4IIJ E;  5LNK A;  1IJ6 A;  4AKR B;  2IDO B;  5LBM A;  4DUZ T;  4LF4 T;  3VRA A;  2ZM2 A;  4AKG A;  2LM9 A;  3RQU A;  2VL0 A;  3PTR B;  5KX5 E;  3Q5D A;  2XQ5 A;  1T7S A;  4OFZ A;  4CI3 B;  3N2O A;  1W0A A;  4YJ2 E;  4BJM A;  4JEU B;  2C5I T;  5HEU A;  4UF0 B;  1YKE B;  3UU3 A;  4O4L E;  5AQP B;  3OTO T;  3ZCJ A;  3PUY F;  3RYC E;  2V7I A;  2RPA A;  2WQY A;  2VB6 A;  2NWB A;  2V6X A;  5KXJ A;  3J7Y q;  1XZY A;  2XAS B;  2BS4 A;  5CB4 E;  4P09 A;  1WR6 A;  3SOL A;  1M7K A;  3K1S A;  4DV4 T;  4C90 A;  4HWD A;  2A9U A;  4Z90 A;  3ZYK A;  3AE1 A;  2KSR A;  3N9O A;  3DJB A;  1XDP A;  3EVY A;  3FBZ A;  3OVU A;  1ZHC A;  4DMV A;  2W2U A;  4LF6 T;  2F4V T;  5LHI B;  2E5L T;  4JYA T;  3BQL A;  3MXZ A;  3AE9 A;  2C5K T;  3ZEF B;  5LXT E;  4X1I E;  3Q5W A;  3AE6 A;  4WYV A;  3JC6 D;  2RA1 A;  2UXX B;  4CXY A;  5LHG B;  3N9M A;  5H6R B;  4NIQ A;  3RI5 A;  2HPL A;  3CWZ B;  1QUU A;  2DWG A;  2IC9 A;  4QKN A;  1AJ3 A;  3ONX A;  2IUB A;  4B3R T;  2D0T A;  4U2Z A;  4H9N C;  5JDQ A;  5HEG A;  4TV8 E;  5FL1 A;  1SHZ C;  4PFO A;  2DLR A;  4H63 H;  3CX7 B;  4TNW A;  4QHO A;  2LSK A;  5F8P A;  4DBR A;  2Q9Q C;  1QLB A;  4O2A E;  4YFS A;  2PG8 A;  2JPF A;  2LLY A;  5L3E B;  1LRZ A;  1XMO T;  5L3C B;  1U5P A;  3VHL A;  4OK0 A;  1JNZ A;  3ZYM A;  2LOP A;  4AQF A;  3TLW A;  3ZC1 A;  3IA3 A;  2JJ9 A;  4UF0 A;  3AEC A;  2W66 A;  3KVA A;  5E0O A;  4EYY R;  4JI8 T;  4JLE A;  2MTQ A;  3KIN B;  4UR9 A;  3A8Y C;  2CM0 A;  2Y6X A;  2D2S A;  2BS2 A;  3RIA A;  4DR1 T;  4ZS2 A;  5HEJ A;  2X67 A;  5CFB A;  4MFR A;  4PJM A;  3SFD A;  3PJA J;  3Q9D A;  4EEB A;  3I0Q A;  2W62 A;  1JNR A;  2LHR A;  3N9P A;  1J5W A;  1HS7 A;  5HAX A;  4BJN A;  1D1A A;  4ILU A;  4YTM A;  2BG9 B;  5JVD E;  1KF6 A;  5LJN A;  3C98 B;  3DTO A;  4I50 E;  1MIV A;  3C4W A;  5M4Y A;  1IBK T;  2KWI B;  2LRL A;  2KT9 A;  1WRD A;  4A97 A;  1HNX T;  1N34 T;  3UUM A;  1NEK A;  2NR4 A;  1E1H B;  2UXD T;  3QOF A;  4CN1 A;  2PFV A;  3NVO A;  3ZSS A;  4ERR A;  3IHR A;  5TAO A;  2YDR A;  2FJE A;  1UGO A;  2QA7 A;  2X0H A;  3RC3 A;  1T8B A;  2NW8 A;  5LMN T;  2BKN A;  2WDQ A;  3JAE A;  2WCA A;  5JR9 B;  2L8K A;  4KBM B;  3HKE E;  5JDN A;  3V5S A;  3CQG B;  3KV6 A;  2MYS A;  3ZT6 A;  4CXW A;  5FXX A;  2X9X A;  2JIW A;  3QNU A;  2HN1 A;  4ANJ A;  5CA1 E;  3ZKR A;  5C3J A;  1UX4 A;  3TLT A;  5LOV E;  3U3I A;  4ZI2 C;  1NAF A;  4TX5 A;  5L4H A;  1MIY A;  3DP7 A;  2LSI A;  5EK4 A;  4LF8 T;  1YQ3 A;  3LFM A;  3UUL A;  2W61 A;  1BR1 A;  5HXS A;  5JTG A;  2YN6 A;  4EAH A;  2WB5 A;  1ZOY A;  4AIU A;  4UV9 B;  1T72 A;  2H89 A;  1Y64 B;  4EYU A;  5FY7 A;  4A98 A;  2G0U A;  5FNV E;  5L3B B;  4HWH A;  2LSJ A;  2XQ6 A;  4K0U A;  4CZZ B;  1WFD A;  3B13 A;  5L3D B;  1FMW A;  3CK6 A;  4AKH A;  4B3M T;  3LG7 A;  3FZK B;  3RYH E;  3N9N A;  2BG9 A;  3CVR A;  3B57 A;  4IRE A;  2X9W A;  4COF A;  3RIU C;  3AE3 A;  3AE8 A;  3P4P A;  4JI2 T;  3HR0 A;  3H37 A;  3O1J A;  1NEN A;  4LML A;  1BR0 A;  3EDU A;  2E2A A;  4X20 E;  3UQ4 A;  2V7L A;  2I6H A;  4EGW A;  4AIS A;  3PUS A;  4YJ3 E;  4I43 B;  2M67 A;  2XQA A;  3TLU A;  1VCS A;  4PNI A;  2IHR 1;  2YDS A;  1HFA A;  3PUX F;  4HWC A;  3PDY A;  4UVC B;  2SPC A;  4IE7 A;  5L3G B;  2XZE A;  4WW0 A;  4DMW A;  4B3S T;  3HKC E;  3UT5 E;  3KBU A;  5LG3 A;  4IL9 A;  5JR9 A;  4X1Y E;  4N78 D;  2EHO C;  1MMN A;  2RP4 A;  4LF9 T;  1M62 A;  2CWO A;  5LGU B;  4P0B A;  1YKH B;  3CML A;  2LRK A;  3ZT7 A;  4X66 T;  2M6I A;  4DR2 T;  4AQY T;  5DAB A;  5JDL A;  5AQT B;  4QXC B;  5ADX L;  3M65 A;  5GON E;  4BAY B;  1S35 A;  5HWX A;  2AXD S;  5HXC A;  1MNE A;  4JV5 T;  3N9Q A;  1D0X A;  2BVL A;  3RKG A;  4PJJ A;  3E22 E;  1KFY A;  2V7M A;  2W67 A;  4QH5 A;  2ZLY A;  4XAX B;  3T1H T;  2X0L B;  5AQQ B;  2LHN A;  1IJ5 A;  2VK9 A;  2BBH A;  4HTE A;  3EUH A;  1N33 T;  2XAQ B;  1FJG T;  2VKH A;  5AQJ B;  3MJX A;  2BKO A;  4DV2 T;  2UU9 T;  2WSS V;  4H9O C;  3IEE A;  5A1L A;  2BBJ A;  3AEE A;  5DQV A;  1B7T A;  4LFB T;  3KDS E;  4U33 A;  1H7C A;  5KDM C;  3EDV A;  2V1D B;  5J0Z A;  5ETW A;  4KMC A;  2A72 A;  2XM1 A;  4PK6 A;  3QUJ A;  2L3L A;  4ZI3 D;  2HH7 A;  3AEB A;  4DR5 T;  2OA5 A;  4QH4 A;  1R8I A;  4HWF A;  3PUR A;  3KBT A;  3AE2 A;  3L09 A;  3P7I A;  1Z0P A;  1VRB A;  3TLV A;  2OLT A;  2X9H A;  3AA7 B;  5FXV A;  4ZEY A;  2WWU A;  1Y01 A;  3KVB A;  2WP9 A;  2OV9 A;  3ZST A;  4YHH T;  4GIW A;  2HHH T;  3C51 A;  1US7 B;  3H3A A;  2J62 A;  4O4H E;  2XJ7 A;  3KV9 A;  1OED A;  4CXX A;  2I59 A;  4U74 A;  4PAG A;  3TKL B;  2LOS A;  4HKA A;  1IBM T;  1HNW T;  1HG2 A;  1IBL T;  3NZQ A;  1WCR A;  1WYB A;  4HFE A;  4HWI B;  4IGU A;  2ODV A;  4LMK A;  4KP3 C;  2VQF T;  3WAJ A;  4QXH B;  1WR0 A;  2CHO A;  3SWH A;  4ASK A;  4XBF B;  3MK7 C;  2K9A A;  3KV5 A;  2VKD A;  1LVF A;  2YKS A;  4L0R A;  4JI1 T;  3PV0 F;  4LMJ A;  2UUB T;  2X66 A;  4HEA A;  3BQK A;  2N9D A;  3PUA A;  5JDM A;  4V1A v;  5ABF B;  5LHH B;  3K3Q C;  5BR8 T;  4I4T E;  4YSZ A;  2JMK A;  4JUY A;  4O4I E;  2WS3 A;  4IDP A;  3CX8 B;  2XQ7 A;  4AQF C;  1MIW A;  4I0U A;  4X65 T;  5FXW A;  2ZMA A;  4JI7 T;  5LGN B;  4X62 T;  1VOM A;  2UXB T;  4UVB B;  4QX8 B;  3UUB A;  3LK4 2;  2WU2 A;  1HF8 A;  2JMH A;  3AA6 B;  3V5U A;  2VKO A;  2CLY B;  2VAS A;  4ADZ A;  2CHN A;  3W15 B;  1W0B A;  3PU3 A;  4MHC A;  4HFV A;  1KK7 A;  2E9X D;  2N1G A;  1XWM A;  1HX1 B;  5LGT B;  3T1Y T;  4KHZ F;  1HX8 A;  1UUR A;  2BVM A;  5J2T E;  4PFP A;  2LJL A;  5LCY A;  4ZZB A;  2C0S A;  3EAB A;  4TWH A;  2QYW A;  1HG5 A;  3H3M A;  1HR0 T;  3NKZ A;  4ZZC A;  5IYZ E;  1CUN A;  2LEH A;  3I1A A;  5CGM A;  2J1D G;  3JCF A;  3AA0 B;  4C91 A;  4PK4 A;  3RF1 A;  1XNR T;  2WMN A;  3RC8 A;  3FXD B;  3AXJ B;  4EB6 E;  5JH7 E;  4OX9 T;  3OJA A;  4UEL A;  3D0T A;  4DID B;  4PW8 A;  5HEO A;  2IML A;  5AQF B;  5LYJ E;  4UIG A;  1MMA A;  4TZ4 C;  2V26 A;  4CN4 A;  4OYJ A;  3L3P A;  4EIW A;  2AE9 A;  4B3T T;  5JDF A;  5FVK A;  3FHN A;  4A56 A;  4DV0 T;  1OED E;  2XTL A;  2H3R A;  4WBN E;  4BA9 A;  4CN6 A;  5ABF A;  4EZ4 A;  5FYM A;  2MOZ A;  3QB5 A;  2P9B A;  4CI2 B;  2XQY A;  3UFG A;  2CE7 A;  4ILB A;  5HWY A;  2ODU A;  2JQH A;  1I6Z A;  2WZI A;  4QX7 B;  3MZK B;  3UU4 A;  5J2U E;  4ZI7 E;  2VKJ A;  5JDH A;  1YQ4 A;  1FIO A;  2YU2 A;  4H9Q C;  4QWN B;  5LJM A;  3BQI A;  4IDQ A;  2WWV A;  2E9X B;  3SFE A;  2J47 A;  5ABH A;  4MLK A;  1LVK A;  4IDO A;  3RH3 A;  4X64 T;  3EI0 A;  2DCF A;  1UUS A;  3QC9 A;  3RIF A;  2A3D A;  4EXT A;  2WAU A;  4KUM B;  5HCM A;  2WU5 A;  2XPK A;  4HFD A;  4DVD A;  2CA5 A;  4PJN A;  5L3F B;  2BS3 A;  2L9Q A;  3G06 A;  2KZ7 B;  3K3N A;  1O3X A;  3ZMV B;  3OPC A;  4IL4 A;  3JC6 C;  2BG9 C;  1N36 T;  3ONJ A;  2CCQ A;  4CI1 B;  2ZM8 A;  3PUQ A;  1LKX A;  4LF7 T;  3VRB A;  4U7I A;  3UUN A;  5JDG A;  2LKG A;  5IWA T;  2XQ9 A;  1NWM X;  2GK9 A;  2HN2 A;  4ZS3 A;  2XAF B;  1IAP A;  2MAW A;  1V9D A;  2XQ8 A;  4K0K T;  2YIN A;  3GWH A;  2XHE B;  2FUP A;  3TLS A;  2WZH A;  2PBI A;  3ZN1 B;  3O1I A;  4H63 V;  2CEA A;  4AKI A;  5HEH A;  1HTJ F;  3FB2 A;  5ABG A;  1L0V A;  3L8R A;  2XSB A;  2UXN B;  1KNP A;  4YT0 A;  2X0Y A;  2XM2 A;  1CHU A;  3ZC0 A;  4JI6 T;  5HXR A;  3LBX B;  1W09 A;  2LT3 A;  3AE5 A;  4I55 E;  2WY2 A;  4LFC T;  3P8C D;  4F6R C;  5JR9 C;  3OYX A;  1ZV4 X;  3T8O A;  3AVS A;  4HFC A;  2CBJ A;  3E0Z A;  2Q9Q D;  3E08 A;  3LSV A;  3RRW A;  5BMV E;  3HKB E;  5AQK B;  2VVS A;  3Q5E A;  3MKD A;  3AVR A;  1ZP0 A;  4YHJ A;  1Z8U A;  3FZM B;  3ZJ2 A;  3RKO A;  3RYF E;  1XDO A;  3RYI E;  5IUX A;  1W9R A;  3LK2 B;  2E9X A;  4YTN A;  3ZCI A;  4G2A A;  3AE4 A;  2UXC T;  4HE8 A;  5KMG P;  3NRY A;  2ACZ A;  2K48 A;  4YSX A;  1VCT A;  2N2N A;  4EZH A;  2B76 A;  1G73 A;  3RX6 A;  2QGS A;  4EV6 A;  1HCI A;  5AQS B;  1SA0 E;  2JRK A;  4A5X A;  2XAH B;  2FJA A;  3C4Z A;  2NTX A;  3ZLI A;  5FL0 A;  5HXE A;  4JI3 T;  4DBQ A;  3ZMS B;  4U7Y A;  4JEH B;  5HCJ A;  3FZF B;  5IHY A;  3UTK A;  2R6G F;  3ANW B;  4L5G A;  2DI4 A;  2D9D A;  1X79 A;  3OKQ A;  3KV4 A;  2C5J A;  4Z91 A;  3EAM A;  4CQI A;  3PUG A;  3OBV E;  3PU8 A;  3LDQ B;  3O1H A;  3LK3 B;  2W63 A;  4HFH A;  3VKG A;  2H88 A;  3GN5 B;  4NPP A;  4H9P C;  2FBW A;  3P4Q A;  4IE0 A;  5EZY E;  4XZC A;  2V6Y B;  2VUR A;  5LMU T;  2ZM0 A;  4WBO A;  3RGL A;  5AQL B;  5HYA A;  3C50 A;  4JI4 T;  3LBX A;  4PJL A;  1N32 T;  2WDR A;  3PE0 A;  2BG9 E;  3L39 A;  3N2G E;  2Q9Q B;  3RLF F;  3QK6 A;  3PUW F;  4NXM T;  5FY1 A;  4WNK A;  4J2C A;  4YY3 T;  2H7V C;  1UX5 A;  3KFW X;  3CIR A;  5AQM B;  3GMI A;  4QXB B;  2CWY A;  3ETV A;  1OED C;  1FMV A;  3N5L A;  3ZT5 A;  1QSD A;  1MMG A;  1I94 T;  2KMF A;  3F2E A;  4GKJ T;  3RQW A;  5LP6 E;  3VR9 A;  3Q5X A;  3C64 A;  2LE8 A;  2LSY A;  2IW5 B;  1ZEE A;  4DV7 T;  3K3O A;  4LFA T;  2VVN A;  4UEM A;  4PK5 A;  2CMR A;  4TWD A;  2XQ3 A;  4E7Z A;  2PJQ A;  4JI5 T;  2ZM6 T;  1IZN B;  2MPK A;  4GK0 E;  3AEA A;  3I0O A;  4DV5 T;  2YOE A;  3K8P C;  4X5T A;  4NUV A;  3HKD E;  3CKD A;  4AQG A;  4GYS A;  3M3Z B;  4U31 A;  2Y8D A;  4U2Y A;  4EOZ B;  4ZI2 D;  4ZOL E;  2LSG A;  1MMD A;  4JI0 T;  4DV1 T;  3A5X A;  2WMO A;  2D5U A;  2VQE T;  2WDV A;  3HA4 A;  5CJ5 A;  3IF8 B; 
#chains in the Genus database with same CATH homology
 3AAI A;  3B57 A;  5C8Y E;  2D0U A;  2X9W A;  1EZ3 A;  5JDF A;  1FEW A;  3O4X E;  2W00 A;  2MBG A;  3ANW A;  3F57 A;  3FHN A;  2VWA A;  3HR0 A;  4A56 A;  2JQQ A;  2CXL A;  2YK0 A;  3H37 A;  4IIJ E;  2XTL A;  1IJ6 A;  2H3R A;  5LNK A;  3O1J A;  4AKR B;  5LBM A;  3HI2 A;  4WBN E;  1BR0 A;  4BA9 A;  3EDU A;  3AA1 B;  2V7J A;  2X51 A;  2DHR A;  4X20 E;  2ZM2 A;  2V7L A;  4AKG A;  4P0A A;  2LM9 A;  4EZ4 A;  3F31 A;  5FYM A;  2MOZ A;  3PTR B;  5KX5 E;  2P9B A;  4CI2 B;  3PUS A;  2XQY A;  3GN5 A;  2CE7 A;  4YJ3 E;  4I43 B;  5HWY A;  2ODU A;  2M67 A;  1YD8 G;  4OFZ A;  5AFU L;  2Y48 B;  3WAK A;  4CI3 B;  3N2O A;  1D0Y A;  5FP3 A;  4PNI A;  4YJ2 E;  1HFA A;  4QX7 B;  3FBL A;  4BJM A;  3MZK B;  4IE5 A;  4JEU B;  2H7O A;  2C5I T;  3CX6 B;  2NOX A;  3PDY A;  4UVC B;  5J2U E;  4H9S E;  4UF0 B;  4E7S A;  1YKE B;  3ZJ1 A;  2SPC A;  4IE7 A;  4O4L E;  5L3G B;  4ZI7 E;  2VKJ A;  5JDH A;  4WW0 A;  3SRZ A;  2YU2 A;  1FIO A;  3NRX A;  3ZMU B;  4DMW A;  4H9Q C;  4QWN B;  2Q9Q A;  4HN9 A;  3ZCJ A;  5LJM A;  3BQI A;  3HKC E;  3RYC E;  2V7I A;  2E9X B;  3UT5 E;  3KBU A;  2ACX A;  4UXN B;  5JR9 A;  4X1Y E;  2VB6 A;  4N78 D;  2EHO C;  2NWB A;  3J7Y q;  1MMN A;  2W0G A;  4O4J E;  4MLK A;  1LVK A;  3RH3 A;  1WYC A;  2XAS B;  3OYZ A;  5JRC B;  2DCF A;  5CB4 E;  4P09 A;  1WR6 A;  2RP4 A;  3QC9 A;  2E8I A;  4UVA B;  2A3D A;  4EXT A;  2WAU A;  4TV9 E;  3SOL A;  4KUM B;  2CWO A;  5LGU B;  4P0B A;  2HPJ A;  1YKH B;  3CML A;  4C90 A;  2EHO D;  4DVD A;  2CA5 A;  4PJN A;  5DAB A;  5L3F B;  3ZYK A;  2L9Q A;  4CXW A;  2WM9 A;  5JDL A;  2KZ7 B;  1YW0 A;  2KND A;  4QXC B;  5ADX L;  3N9O A;  3M65 A;  3DJB A;  3K3N A;  5GON E;  3EVY A;  1S35 A;  4BAY B;  5HWX A;  3FBZ A;  1O3X A;  1ZHC A;  2BZB A;  2XAJ B;  1ZKE A;  3ZMV B;  3VKH A;  4ISS A;  5HXC A;  1MNE A;  4DMV A;  3N9Q A;  1D0X A;  2BVL A;  3ZYL A;  3JC6 C;  2A2F X;  4PJJ A;  5LHI B;  2CCQ A;  3E22 E;  4CI1 B;  2ZM8 A;  3PUQ A;  2V7M A;  4O2B E;  1LKX A;  4TUY E;  2ZLY A;  4XAX B;  1KNZ A;  2X0L B;  2LHN A;  3IBP A;  3BQL A;  3MXZ A;  3UUN A;  5JDG A;  1IJ5 A;  2VK9 A;  2C5K T;  3ZEF B;  3C4X A;  1NWM X;  2GK9 A;  4HTE A;  4X1I E;  3Q5W A;  5LXT E;  3EUH A;  1G8X A;  4ZS3 A;  2XAF B;  1BR4 A;  1IAP A;  3JC6 D;  1MND A;  2RA1 A;  2XAQ B;  1D1C A;  2UXX B;  5EK3 A;  1V9D A;  4CXY A;  5LHG B;  3N9M A;  2X9Y A;  5H6R B;  2VKH A;  2VL8 A;  2K5B B;  3S4U A;  2HPL A;  3MJX A;  2YIN A;  3CWZ B;  3GWH A;  2XHE B;  4UV8 B;  1QUU A;  2DWG A;  2IC9 A;  2WSS V;  4QKN A;  2XAG B;  2PBI A;  3ZN1 B;  3O1I A;  4H9O C;  3IEE A;  4H63 V;  2CEA A;  5A1L A;  3ONX A;  1AJ3 A;  3N2K E;  4AKI A;  1HTJ F;  3FB2 A;  5DQV A;  1B7T A;  2D0T A;  2UXN B;  3KDS E;  4H9N C;  3SS1 A;  4DND A;  5JDQ A;  5FXZ A;  3HL6 A;  1H7C A;  2NP9 A;  4TV8 E;  1SHZ C;  4PFO A;  2DLR A;  3ETU A;  4H63 H;  3ZC0 A;  3CX7 B;  5KDM C;  4QHO A;  2LSK A;  5F8P A;  3LBX B;  5HXR A;  4DBR A;  2LT3 A;  2Q9Q C;  5HXH A;  3EDV A;  2CXF A;  4ZI3 C;  2V1D B;  4I55 E;  4O2A E;  4YFS A;  5ETW A;  3ZMZ B;  2PG8 A;  3P8C D;  3ESL A;  4F6R C;  4ZHQ E;  4GYR A;  2JPF A;  4KMC A;  5JR9 C;  2CXD A;  1LRZ A;  5L3E B;  2CLY C;  3OYX A;  5L3C B;  2KLQ A;  1U5P A;  4MBQ A;  1ZV4 X;  3T8O A;  3VHL A;  3AVS A;  4OK0 A;  2A72 A;  3ZYM A;  2LOP A;  4PK6 A;  3E0Z A;  3NZP A;  2Q9Q D;  3E08 A;  3QUJ A;  3RRW A;  2L3L A;  3HKB E;  5BMV E;  4ZI3 D;  3AAA B;  2HH7 A;  4AQF A;  3O9X A;  1D0Z A;  2OA5 A;  3ZC1 A;  2JJ9 A;  3MKD A;  4UF0 A;  2K24 A;  3AVR A;  4YHJ A;  3PUR A;  3KBT A;  3KVA A;  3ZJ2 A;  4M1P A;  5E0O A;  4EYY R;  3RKO A;  3L09 A;  3RYF E;  4JLE A;  3RYI E;  2MTQ A;  3KIN B;  5LBQ B;  3P7I A;  1Z0P A;  3I9Y A;  1VRB A;  2X9H A;  3AA7 B;  5FXV A;  2CM0 A;  2WWU A;  3Q2M A;  3KVB A;  2Y6X A;  2D2S A;  3VU7 H;  3LK2 B;  2B1E A;  2E9X A;  4GIW A;  4IE4 A;  3ZCI A;  4G2A A;  3C51 A;  4HE8 A;  1US7 B;  5KMG P;  3N9L A;  5JRC A;  3H3A A;  2EHO B;  4O4H E;  4OYK A;  3KV9 A;  3MAC A;  4ZS2 A;  3NRY A;  2K48 A;  2N2N A;  4GOU A;  5DQW A;  4CXX A;  4EZH A;  2X67 A;  2I59 A;  2YEV C;  3I9W A;  1G73 A;  4U74 A;  4PAG A;  3RX6 A;  3TKL B;  2LOS A;  2QGS A;  4HKA A;  4MFR A;  4PJM A;  1HCI A;  1SA0 E;  5EK2 A;  2JRK A;  1HG2 A;  4YLH A;  2IAK A;  3NZQ A;  1T98 A;  3Q9D A;  1WYB A;  3I0Q A;  2XAH B;  2W62 A;  3C4Z A;  2NTX A;  2LHR A;  3CPZ A;  4X1K E;  3ZLI A;  5CA0 E;  3N9P A;  4IGU A;  5HXE A;  2ODV A;  1HS7 A;  4DBQ A;  5HAX A;  4BJN A;  3ZMS B;  1D1A A;  4ILU A;  4KP3 C;  4JEH B;  4H9R C;  5LG4 A;  5JVD E;  5IHY A;  3WAJ A;  5L2L A;  5LJN A;  4HGA A;  3C98 B;  4QXH B;  3UTK A;  3AAE B;  3SWH A;  4ASK A;  3ANW B;  3CQC B;  4IE6 A;  3DTO A;  4I50 E;  4L5G A;  1MIV A;  2DI4 A;  4XBF B;  3MK7 C;  1X79 A;  3OKQ A;  3C4W A;  2K9A A;  4NUU A;  5M4Y A;  4DO0 A;  2IC6 A;  3KV4 A;  2KWI B;  2C5J A;  3KV5 A;  3CQX C;  2KT9 A;  2VKD A;  1LVF A;  4L0R A;  4CQI A;  1WRD A;  3PUG A;  2Z6E A;  3OBV E;  3PU8 A;  4FI5 A;  4Z8X A;  1S94 A;  5JRE A;  2WBL A;  2X66 A;  1OWA A;  3BQK A;  3O1H A;  4HEA A;  2N9D A;  3UUM A;  3GA8 A;  3PUA A;  5JDM A;  4IHJ E;  4V1A v;  1E1H B;  5LHH B;  3K3Q C;  3LK3 B;  2W63 A;  4GK5 E;  5H6Q B;  2NW9 A;  3ZPO A;  3VKG A;  4I4T E;  3ZMT B;  3GN5 B;  2BDE A;  4H9P C;  2JMK A;  4JUY A;  4O4I E;  4IE0 A;  2PFV A;  3CX8 B;  5EZY E;  4XZC A;  4AQF C;  4ERR A;  5FY0 A;  3IHR A;  1MIW A;  2ZM0 A;  4WBO A;  5FXW A;  2ZMA A;  5TAO A;  3J9X 1;  4B6X A;  5HYA A;  3C50 A;  1UCU A;  2YU1 A;  5LGN B;  1BR2 A;  1VOM A;  3LBX A;  2QA7 A;  1U4Q A;  4PJL A;  4UVB B;  3RC3 A;  3RRC A;  3UUX B;  2NW8 A;  4QX8 B;  3WI3 A;  3PE0 A;  3N2G E;  5JQG E;  3LK4 2;  2Q9Q B;  2E9X C;  3QK6 A;  3R6N A;  1HF8 A;  2JMH A;  5FY1 A;  2ES0 A;  4WNK A;  4J2C A;  5LA6 E;  2X68 A;  3AA6 B;  5JR9 B;  2H7V C;  2L8K A;  1UX5 A;  3KFW X;  3UFE A;  2VKO A;  3V5U A;  2CLY B;  2VAS A;  3NBX X;  4KBM B;  4ADZ A;  2KIN B;  3W15 B;  3GMI A;  4QXB B;  2CWY A;  3HKE E;  1D1B A;  3PU3 A;  5JDN A;  3V5S A;  3CQG B;  3ETV A;  3KV6 A;  1FMV A;  3N5L A;  5DJQ C;  2MYS A;  1QSD A;  1MMG A;  4MHC A;  4HFV A;  1KK7 A;  5FXX A;  3RPU A;  2E9X D;  2KMF A;  2N1G A;  3F2E A;  2X9X A;  4FJO A;  5LGT B;  5LP6 E;  3Q5X A;  3C64 A;  3ZN0 B;  4U72 A;  2LE8 A;  3LJC A;  1HX8 A;  2XUE A;  4ANJ A;  2BVM A;  2LSY A;  2NTY A;  4PFP A;  5CA1 E;  2LJL A;  5LCY A;  2IW5 B;  1ZEE A;  3K3O A;  5J2T E;  2C0S A;  4IST A;  1UX4 A;  4PK5 A;  4UEM A;  1HG5 A;  2CMR A;  4TN7 B;  4E7Z A;  1WLX A;  5LOV E;  3U3I A;  4ZI2 C;  2PJQ A;  1IZN B;  4L9I A;  1CUN A;  5IYZ E;  1NAF A;  2LEH A;  3I1A A;  4GK0 E;  2DWK A;  2J1D G;  4TX5 A;  1MIY A;  3I0O A;  4MAL A;  3DP7 A;  4G63 A;  2LSI A;  2EHO A;  3AA0 B;  3K8P C;  3MA9 A;  5EK4 A;  4NUV A;  4AXP A;  4C91 A;  3HKD E;  4OHF A;  3CKD A;  4PK4 A;  4AQG A;  3LFM A;  4GYS A;  3UUL A;  2W61 A;  1BR1 A;  2WMN A;  3AB3 B;  3FXD B;  3RC8 A;  2NW7 A;  4EB6 E;  5JH7 E;  2KXP B;  4IDZ A;  5HXS A;  2Y8D A;  4EAH A;  3OJA A;  4AI6 A;  4UEL A;  4EOZ B;  4ZI2 D;  4UV9 B;  3D0T A;  4ZOL E;  5FMN A;  4O8S A;  2LSG A;  1Y64 B;  3R84 B;  4PW8 A;  4AKL A;  4EYU A;  1MMD A;  2V7K A;  5LYJ E;  4UIG A;  2KWH A;  5FY7 A;  3A5X A;  2WMO A;  2G0U A;  5FNV E;  1MMA A;  3FXE B;  5L3B B;  3BK9 A;  5F3J A;  2D5U A;  4TZ4 C;  2DNX A;  2LSJ A;  3HA4 A;  4K0U A;  4CZZ B;  2V26 A;  3B13 A;  4OYJ A;  5L3D B;  1FMW A;  4AKH A;  5J1G A;  1OXZ A;  3IF8 B;  3LG7 A;  3L3P A;  3U78 A;  3RYH E;  4EIW A;  3N9N A;  3CVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...