1Z0PA

Crystal structure of the protein of unknown function spy1572 from streptococcus pyogenes
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
77
structure length
73
Chain Sequence
MSYEKEFLKDFEDWVKTQIQVNQLAMATSQEVADERAKDAFIRYESKLDAYEFLLGKFDNYKNGKAFHDIPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SPy1572
publication title The 1.7A Crystal structure of the hypothetical protein SPy1572 from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Structural genomics, unknown function
total genus 33
structure length 73
sequence length 77
ec nomenclature
pdb deposition date 2005-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08930 DUF1912 Domain of unknown function (DUF1912)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1z0pA00
2G0UA 4J2CA 1Z0PA 3QUJA 3N5LA 4FI5A 1H7CA 2X9YA 3S4UA 1QSDA 4B6XA 2C5IT 2KWIB 1LRZA 3MXZA 2CA5A 3TKLB 2IC9A 2C5JA 2XTLA 3FXDB 1IJ6A 4L0RA 1IJ5A 2MBGA 2K48A 2IC6A 4DNDA 1ZKEA 4EYYR 3CKDA 3CVRA 3P7IA 3FXEB 1LVFA 3QK6A 4CQIA 2KWHA 3L3PA 2C5KT 2X9XA 2X9WA
chains in the Genus database with same CATH superfamily
3AE1A 3E0ZA 5FXXA 2MTQA 1YKHB 3K3NA 2DLRA 3FB2A 2WS3A 4X20E 1W0AA 2V5DA 4IDPA 4GKJT 2V7IA 2VKHA 2W63A 1E7PA 1YXRA 4UIGA 5LG3A 2XAHB 2ZM0A 3ZMVB 3QUJA 5KMGP 2ACXA 4QWNB 2YOEA 2KSRA 1I6ZA 4YHJA 4JI8T 2HPLA 3JC6D 1I94T 1UK5A 1U4QA 2ZMAA 2UU9T 4TV8E 5EZYE 3OYZA 2YDSA 4WNKA 5M4YA 2Y48B 4M1PA 2IC9A 4Z8XA 4HEAA 1W09A 3CVRA 4YY3T 4QH4A 5J0ZA 2LLYA 3SFEA 3AE6A 2BKPA 5FP3A 2LRKA 3UU6A 1UCUA 3EDVA 1YQ4A 2X66A 2XSAA 1QSDA 2DHRA 2SPCA 2CLYC 4IL4A 4ILUA 2NW7A 4ERRA 4ISTA 3FZKB 3PTRB 2E9XC 5GONE 3QB5K 4EZ4A 2DWKA 4X1KE 2OA5A 4CZZB 2CE7A 5L2LA 2WBLA 1US7B 2PJQA 5AQFB 4JI5T 4MHCA 3OKQA 3RX6A 4UF0B 3LK2B 1T72A 3GA8A 3R84B 3ZSTA 1S94A 4Z91A 4PAGA 3P50A 2WQYA 4C91A 1FJGT 3SFDA 4NIQA 3FZHB 5AQHB 2BG9A 4JYAT 4NPPA 3UUXB 1HG5A 5JR9B 3ZJ2A 5HEOA 4DR3T 4AI6A 3RIAA 2M6BA 5LBMA 2WWUA 3LBXB 2LHNA 3G06A 4UVAB 4H63V 5JDMA 2OLTA 2PTFA 5EK4A 5HAXA 1HNWT 4B3TT 4CXWA 3I1AA 5HEUA 1JNZA 5AQQB 4HWFA 1VCTA 5KX5E 2EHOD 5FVKA 3O4XE 4JEUB 2AE9A 3VHLA 3AVSA 3HL6A 4YJ2E 1IBLT 4JEHB 2KINB 2UUAT 2CXFA 2XM2A 4DR2T 1UURA 2I59A 5LMNT 5JDNA 4G2AA 2EHOB 4ZZCA 2FJAA 4U2YA 4YFSA 4LF4T 5FXWA 4DMWA 4FJOA 2BDEA 3LG7A 2E5VA 3AAIA 2LSJA 1BR1A 3B57A 4FI5A 3ZN0B 3K8PC 4UELA 3F31A 1EZ3A 5FL0A 5EK3A 3E22E 4QXBB 4WYVA 4ASKA 3KBUA 4UV9B 5IHYA 4BA9A 2B1EA 4WBNE 4CI2B 4DBQA 3W15B 4UV8B 2V6YA 3AA7B 3UTKA 5JQGE 1MMNA 2K9AA 4ZHQE 3AE8A 4QXCB 1ZHCA 2CWYA 5JDHA 1MNEA 1KNZA 4DV0T 2X0LB 2YU2A 3FXDB 3M3ZB 1O3XA 3RKGA 4DR7T 2PBIA 1SHZC 4HE8A 1T8BA 4O4JE 3K3QC 1UGOA 3L3PA 2MYSA 3ZC0A 3AE3A 4HWCA 1XDPA 2LT3A 4O2AE 3WI3A 5L4EA 5CB4E 3JAEA 4EEDA 2N2NA 3EVYA 2C5JA 2UXBT 2V26A 1N32T 4CI1B 3V5UA 2K48A 3N9MA 3PUAA 5LOVE 5JH7E 2R6GF 5BMVE 3P4RA 2NR4A 4ZOLE 4UEMA 4LMLA 2NOXA 4K0UA 4JI0T 3ONXA 1ZP0A 1WR6A 3SOLA 1NEKA 2X9HA 3RC3A 2XQYA 3ZMUB 2D5UA 4OYJA 3AXJB 2FJBA 5LNKA 5H6RB 4IE5A 3PUVF 4IGUA 4QHOA 5A1LA 1IJ6A 3NRXA 4EYYR 1ZV4X 1G73A 5AQTB 4DV5T 1HNZT 4LF9T 2XQ8A 3KBTA 2IMLA 2XHEB 3GWHA 4GYRA 4X1IE 5BR8T 4LFBT 4TNWA 3TKLB 5IYZE 1WYBA 3U3IA 2N1GA 4TN7B 4DV4T 3LSVA 2LOSA 2V7LA 3JADA 4NXMT 2WU5A 2CBIA 4YJ3E 5ABFB 3KV6A 1UX5A 4J2CA 4U7IA 1FMVA 3LK42 3UFEA 3N9LA 2UXCT 3B13A 4O4IE 3IEEA 1MMGA 2D0TA 2EHOC 1FMWA 4YTNA 3A8YC 4KHZF 5JVDE 1UUSA 2V6XA 2JQHA 2BKOA 5LGUB 1XNQT 2V1DB 3NKZA 3ZYLA 4H9NC 4JI3T 1GQEA 1OEDB 1V9DA 3ESLA 3I0QA 1AJ3A 2YK0A 3T1HT 4AKGA 5IWAT 5DQWA 2IHR1 4PK6A 3I9WA 3PU3A 2C5IT 3FZLB 1MMDA 2QYWA 4DV3T 2LM9A 3K3OA 3VRAA 3ZJ1A 2J62A 3HKBE 4JLEA 4U31A 1KF6A 3RRWA 3TLWA 1J5ET 3RHWA 5HXEA 2BBHA 3C51A 4U2ZA 3EI0A 4AQFA 3IBPA 1J5WA 4ADZA 1KFYA 4PK4A 4AXPA 5FXVA 2YN6A 4L9IA 2FUPA 3AEBA 1N33T 4ZI3D 2J47A 4PJLA 3ONJA 4WW0A 1BR2A 3MXZA 3WAJA 3N9NA 4JI7T 4TX5A 5LXTE 2C0SA 3AE7A 1LVFA 2WDRA 1LKXA 4LF6T 2QRXA 3GN5A 2KT9A 2ES0A 3PDYA 3VR9A 4YHHT 2JJ9A 4KX6A 2HPJA 1XNRT 2JMHA 3L8RA 1HFAA 5FVLA 2A2FX 5H6QB 2WMNA 3ETUA 2A3DA 1D1BA 2HN1A 1HX1B 3MJXA 5EK2A 3EABA 3AA1B 3HA4A 3RQWA 3ANWA 1KNPA 4BJNA 4IE6A 3N9QA 5HYAA 2GK9A 3MACA 3ETVA 4A98A 1SUMB 2CXDA 4YTMA 2WCAA 2XQ5A 5ETWA 4QXHB 3C98B 4IDQA 5L3FB 3NWIA 1T7SA 2DCFA 4HFEA 2CHNA 5FNVE 2LSYA 5FY0A 3TLSA 2BG9B 3LFMA 3P4SA 3UQ7A 1IZNB 2VVSA 4GK5E 5CA1E 3LDQB 1WFDA 4F8HA 2CEAA 4ZEYA 2HHHT 3HI2A 1VOMA 2DI4A 4XBFB 1MNDA 4PK5A 4E7ZA 5LA6E 2WY2A 3VU7H 4DUZT 3RC8A 2CHOA 2UUBT 4O8SA 5AQRB 1N36T 2PFVA 3RYHE 3ZC1A 3Q5DA 3C4WA 2XZEA 2M6IA 5FY1A 3V5SA 3O1HA 3PJAA 3AEFA 3CQCB 4LFCT 3AEEA 5LBQB 2JQ9A 1NWMX 2JIWA 3CX7B 3RIFA 3AEDA 4EXTA 1QLBA 2M67A 1D1CA 2KZ7B 2ACZA 5HCJA 3O1JA 2W2UA 1OEDC 2V7JA 3TLVA 1MMAA 2VK9A 2XQ9A 2G0UA 3BQKA 3QC9A 4B3RT 1D1AA 3UU3A 3ZLIA 4P09A 3UQ4A 1HTJF 3C4ZA 3EHZA 4IREA 4AKIA 1HCIA 1KEYA 2X67A 3P8CD 2IIUA 4ILBA 2Y8DA 3N9OA 3PUXF 4JV5T 1T98A 3RGLA 2D2SA 3P4PA 5IUXA 5AQPB 4JI1T 3PV0F 5FKYA 2V6YB 2DNXA 3UUBA 4PFPA 1R8IA 3PE0A 5L3BB 3AE4A 1ZEEA 5ABHA 2RP4A 3U78A 5AQOB 3J7Yq 5AFUL 4HFIA 4AKLA 3DP7A 2BS4A 3N2KE 4EIWA 4X65T 2XQ3A 4IE7A 4YTPA 5DJQC 5FY7A 4NXNT 2HH7A 1DU2A 1Y64B 4NUUA 3TLUA 5TAOA 4LF8T 3RI5A 2UUCT 4U74A 4ZI3C 2NWBA 4UVBB 3N9PA 1HX8A 4EV6A 4WZXA 2WZIA 3HR0A 4TV9E 4ISSA 3BK9A 2CBJA 2WB5A 2N9DA 4LFAT 3AE2A 3ZYMA 4TWFA 4NUVA 5KXJA 4HKAA 5AQKB 3NVOA 4DNDA 2A72A 2BG9C 1WCRA 4YSXA 2VQET 2X0HA 2XSBA 3UU5A 4CXXA 4COFA 3KDSE 2XQAA 1Z0PA 4IDOA 1JNRA 5AQGB 3JC6C 3RRCA 3RLFF 4OYKA 4ZI2D 3D0TA 4GIWA 4X1YE 5HXHA 3UFGA 2X9WA 3IF8B 3JAFA 3RIUC 5J2UE 5HEJA 2RPAA 3UUMA 4KMCA 3LJCA 5J2TE 4WBOA 1U5PA 3JCFA 3PUSA 2CMRA 4JUYA 4A5XA 3ZN1B 5AQIB 3DTOA 4F6RC 2I6HA 1G8XA 1HS7A 5L3CB 2YKSA 5FMNA 2X51A 2AXDS 2BKNA 3OBVE 3HKDE 4MLKA 1MIYA 4CN6A 3KFWX 5ADXL 5JREA 3UUNA 3AEGA 5JR9C 2CPTA 1IAPA 4EZHA 4O2BE 1MIVA 5LP6E 3Q5EA 3X1DA 1ZOYA 2LKGA 4DIDB 2MBGA 1UX4A 2XQ4A 2VQFT 5HXRA 1HNXT 3PUYF 2Q9QA 3FXEB 2WMOA 4DV1T 4DUYT 3T1YT 4PFOA 4X64T 5DQVA 4YT0A 2KXPB 2KWIB 4TNVA 1IBKT 5CA0E 3QNUA 5JDQA 3CX6B 4O4HE 4XAXB 4ZI7E 3ONLC 5HCMA 2VKDA 3CPZA 4HFCA 1J1JA 2ZLYA 2NW8A 4YXDA 4IDNA 4OFZA 2LSKA 5CGMA 2LEHA 1VRBA 4QX8B 2F4VT 4I4TE 1XMQT 3RYIE 3AA0B 4TUYE 2IAKA 3QK6A 5LHHB 2L9QA 4YSZA 2XQ7A 2CLYB 4H9SE 2CWOA 1HF8A 2DL1A 3M65A 2PG8A 3KV9A 1BR0A 4X66T 1L0VA 4JI6T 1WLXA 3AE9A 4GKKT 3AAAB 3AECA 2IDOB 3GN5B 4DR4T 5HEGA 3AVRA 5LJNA 5L47A 3P4QA 2E8IA 3T8OA 5LHGB 4ANJA 4KP3C 3RYCE 3AE5A 2X9XA 3ZPOA 3ZMTB 2W4XA 2XQ6A 1OWAA 3CMLA 4AKRB 1B7TA 4IL9A 2LSIA 5C3JA 3ANWB 3HKEE 3UU8A 5L3EB 2VASA 2OV9A 3UU4A 4KHPT 3OTOT 4C90A 3O9XA 1NAFA 4QX7B 3PU8A 3PUZF 3VKHA 4BJMA 2VB6A 3TLTA 3B5MA 2YINA 2E9XA 1Y01A 1SA0E 2H7VC 2QA7A 3RPUA 1LVKA 2KLQA 4ZS3A 2D0UA 2V7MA 4ZI2C 3QOFA 3KVAA 2XAFB 3ZMZB 4PJJA 2BZBA 2HN2A 2YEVC 4MBQA 3ZMSB 3CQGB 3I9YA 3PJAJ 3OPCA 5JRCA 5HXCA 2P9BA 2H3RA 4Z90A 2FJDA 2W66A 5JDGA 3MKDA 4CXYA 5KDMC 4AKHA 3GMIA 4LF5T 2K3WA 2IW5B 3RQUA 4H9RC 4EOZB 2XY8B 2J4GA 4DR6T 1YW0A 3PUGA 2KMFA 2MPKA 2NTXA 4ZXLA 1X9BA 2MAWA 4IIJE 4LMJA 4UXNB 5FXZA 4HN9A 3ZT7A 4YSYA 4CQIA 4MFRA 2L3LA 2XPKA 2L8KA 3VR8A 4U3CA 3CWZB 5L4HA 4EAHA 4IHJE 2XTLA 5F3JA 2XASB 3NZQA 4LMKA 2E5LT 3RKOA 2J1DG 4JBWF 4GK0E 2JQKA 4GOUA 4B3ST 5FYMA 3WAKA 4AQFC 3Q9DA 4I43B 3OVUA 3SRZA 4JI2T 5LGTB 4PNIA 4U33A 2NW9A 2VL0A 4ILCA 1SE7A 2W67A 4PJMA 2H7OA 4HTEA 3P7IA 4CI3B 2B76A 3HKCE 2LOPA 1E1HB 5E0OA 4UVCB 2JPFA 5J1GA 3L39A 3AA6B 2UXNB 5JDLA 3PURA 3ZEFB 4H9OC 4YLHA 4DR5T 3EAMA 3OJAA 4A56A 5AQNB 3C64A 4X62T 4A97A 2W0GA 3ZYKA 4E7SA 2BS2A 4KUMB 5AQMB 3CKDA 3EDUA 2LJLA 2X0YA 3ZKRA 4AISA 3J9X1 3N5LA 3F2EA 3UULA 2YU1A 3AEAA 5ABGA 2XJ7A 2H88A 3RIUA 3NRYA 2DWGA 4L0RA 3IHRA 2KNDA 1YQ3A 1FIOA 5AQJB 3A7MA 2A9UA 1W9RA 1BR4A 2NTYA 2WM9A 3DJBA 1MIWA 3KINB 4DO0A 2FBWA 4JI4T 2VURA 4UF0A 3RF1A 4GYSA 3Q2MA 4I0UA 1XZYA 4HGAA 4MALA 2WSSV 2JQQA 4AQGA 5CJ5A 4EEBA 2XAJB 3L09A 2W61A 2UXDT 4B6XA 2H89A 5L3DB 5JR9A 4PJNA 1W0BA 3LBXA 5HWXA 1D0YA 3CX8B 2W62A 3FHNA 4QH5A 2KWHA 2WU2A 4V1Av 4EGWA 1D0ZA 5CFBA 5F5WA 1XDOA 4EB6E 3FZFB 2BVLA 1CHUA 3ZT6A 3A5XA 3LK3B 2Q9QD 3KV4A 1Z8UA 2VVNA 4DBRA 3H37A 2WWVA 2CM0A 4HFHA 5LCYA 2IUBA 2V8SV 1OEDE 2W00A 4UR9A 3PUQA 4H9PC 1M7KA 2LRLA 4ZS2A 2ODVA 3ZSSA 2RA1A 5LMUT 4QH1A 5LJMA 4HWIB 3F57A 4HWHA 5AQLB 4OK0A 3R6NA 2YDRA 5HEHA 2Q9QB 5JTGA 2EHOA 4HFBA 2VL8A 3S4UA 4U72A 3EUHA 3CIRA 3AB3B 4XZCA 4Q25A 3BQIA 2V7KA 5FL1A 4B3MT 3FBZA 3MK7C 2ZM8A 4CN1A 4P0AA 2XAQB 1X79A 3N2OA 3VKGA 4H9QC 1HR0T 3K1SA 3C4XA 3C50A 3RYFE 3FBLA 1N34T 4DV7T 2Z6EA 5DABA 3SS1A 4TZ4C 5LB7B 2XM1A 1IBMT 4TWDA 3IA3A 5LYJE 4P0BA 3VRBA 1KK7A 1HG2A 4I50E 3P4WA 4TWHA 3UT5E 2YDQA 3KV5A 4AQYT 3ZT5A 2XUEA 3MZKB 1QUUA 3Q5XA 2VKJA 4X5TA 3CQXC 4DVDA 2XAGB 2D9DA 2BVMA 4I55E 4LF7T 2ODUA 5AQSB 1WR0A 2LSGA 4DV6T 3CK6A 2E9XD 2WP9A 3BQLA 5ABEA 4DMVA 3SWHA 2FJEA 4CN4A 5HWYA 4U7YA 4DV2T 3Q5WA 1XWMA 2MOZA 1IJ5A 3RH3A 4K0KT 4ILAA 4AIUA 3AAEB 2BG9E 2C5KT 2QGSA 2WDVA 2ZM2A 1XMOT 5LG4A 2Y6XA 1KNRA 1M62A 2K5BB 4IE0A 4ZZBA 2I0MA 3I0OA 2WAUA 3E08A 1D0XA 2CA5A 2E9XB 3O1IA 2X68A 3AXJA 2WZHA 2LE8A 5F8PA 1S35A 1H7CA 5C2TA 3FZMB 3PUWF 2QVAA 5AQUB 2V5CA 2LM2A 3ZCIA 3H3AA 1FEWA 2VWAA 2JRKA 2UXXB 3NZPA 2LHRA 1E2AA 2K24A 4DR1T 3KVBA 5JRCB 3ABVA 5L3GB 2E2AA 4HFDA 5HXSA 3ZCJA 3MA9A 1YD8G 4EYUA 5ABFA 4N78D 5LGNB 1CUNA 1OXZA 2CCQA 2JMKA 4PW8A 4H63H 2ZM6T 1LRZA 5LHIB 2Q9QC 4OX9T 5C8YE 3OYXA 4QKNA 3QB5A 4L5GA 2LKHA 2WDQA 4G63A 3H3MA 5AQVB 4P1NA 4IE4A 2BS3A 4KI0F 4O4LE 1VCSA 1YKEB 3NBXX 1WYCA 2CXLA 4IDZA 1WRDA 2X9YA 4HFVA 4IT4A 4OHFA 1OEDA 4BAYB 2NP9A 2CRBA 1NENA 4HWDA 3N2GE 4KBMB 2IC6A 2BBJA 1ZKEA 2VKOA 5JDFA
chains in the Genus database with same CATH topology
3C64A 4CXXA 3E0ZA 4YJ3E 3KV6A 1UX5A 3KDSE 4J2CA 5FXXA 1Z0PA 2MTQA 1FMVA 1YKHB 3K3NA 2DLRA 3FB2A 3JC6C 3LK42 3UFEA 3N9LA 4X20E 3RRCA 4OYKA 4ZI2D 3B13A 4O4IE 2V7IA 2VKHA 2W0GA 3D0TA 3ZYKA 4E7SA 2W63A 3IEEA 4GIWA 4KUMB 1MMGA 2D0TA 2EHOC 1FMWA 3CKDA 4UIGA 4X1YE 3EDUA 5HXHA 2LJLA 5JVDE 2X9WA 3IF8B 5J2UE 2XAHB 2ZM0A 3ZMVB 3J9X1 3QUJA 3N5LA 5LGUB 5KMGP 2ACXA 2V1DB 3F2EA 3UUMA 3UULA 2YU1A 4QWNB 4KMCA 3LJCA 4YHJA 2HPLA 3JC6D 4WBOA 3ZYLA 5J2TE 1U5PA 3NRYA 4H9NC 2DWGA 4L0RA 1V9DA 3ESLA 3PUSA 2CMRA 3IHRA 3I0QA 4JUYA 2KNDA 1AJ3A 3ZN1B 2YK0A 1U4QA 2ZMAA 1FIOA 4AKGA 4TV8E 1BR4A 2NTYA 2WM9A 3DTOA 3DJBA 5EZYE 4F6RC 1MIWA 3OYZA 3KINB 4DO0A 1G8XA 5DQWA 4PK6A 3I9WA 1HS7A 4UF0A 3PU3A 2C5IT 4WNKA 5L3CB 5M4YA 2Y48B 1MMDA 5FMNA 4M1PA 4GYSA 2X51A 3Q2MA 2IC9A 2LM9A 4HGAA 3OBVE 4MALA 3K3OA 2WSSV 3HKDE 4MLKA 2JQQA 4Z8XA 4AQGA 4HEAA 1MIYA 3CVRA 3KFWX 5ADXL 5JREA 3UUNA 2XAJB 3L09A 5JR9C 3ZJ1A 2W61A 5FP3A 1IAPA 4EZHA 3HKBE 4O2BE 1UCUA 4JLEA 3EDVA 2X66A 1MIVA 5LP6E 1QSDA 4B6XA 3RRWA 2DHRA 2SPCA 5L3DB 5JR9A 2CLYC 4ILUA 4PJNA 5HXEA 2NW7A 3C51A 4ERRA 4ISTA 3LBXA 4AQFA 5HWXA 2MBGA 1D0YA 3CX8B 1UX4A 3IBPA 2W62A 3FHNA 3PTRB 5HXRA 2E9XC 5GONE 4ADZA 2KWHA 4PK4A 4AXPA 4V1Av 5FXVA 2Q9QA 3FXEB 2WMOA 4EZ4A 1D0ZA 2DWKA 4L9IA 4X1KE 2OA5A 4CZZB 2CE7A 5L2LA 4EB6E 4PFOA 2WBLA 4ZI3D 4PJLA 5DQVA 1US7B 2PJQA 2KXPB 2KWIB 2BVLA 4WW0A 1BR2A 4MHCA 3OKQA 3MXZA 5CA0E 3RX6A 5JDQA 3CX6B 4UF0B 3LK2B 3A5XA 3WAJA 3N9NA 3LK3B 4O4HE 2Q9QD 3KV4A 4XAXB 3GA8A 4TX5A 3R84B 4ZI7E 5LXTE 4DBRA 1S94A 2C0SA 3H37A 4PAGA 2VKDA 1LVFA 2CM0A 3CPZA 1LKXA 5LCYA 2ZLYA 2W00A 4C91A 3GN5A 3PUQA 2KT9A 4H9PC 2NW8A 4ZS2A 2ODVA 2ES0A 4OFZA 3PDYA 2RA1A 2JJ9A 2LSKA 2HPJA 2JMHA 5LJMA 2LEHA 1HFAA 3F57A 2A2FX 1VRBA 5H6QB 4QX8B 3UUXB 4I4TE 2WMNA 1HG5A 3ETUA 5JR9B 3ZJ2A 4OK0A 3R6NA 3RYIE 4AI6A 3AA0B 4TUYE 5LBMA 2A3DA 2WWUA 2IAKA 3LBXB 3QK6A 5LHHB 2LHNA 2L9QA 4UVAB 1D1BA 4H63V 3MJXA 2CLYB 4H9SE 5JDMA 5EK2A 2Q9QB 2CWOA 1HF8A 3M65A 2EHOA 3AA1B 5EK4A 2VL8A 3S4UA 3HA4A 3ANWA 4U72A 4BJNA 4IE6A 2PG8A 3KV9A 3N9QA 5HYAA 5HAXA 3EUHA 2GK9A 3MACA 3AB3B 1BR0A 3ETVA 4CXWA 3I1AA 4XZCA 2CXDA 3BQIA 1WLXA 2V7KA 5KX5E 2EHOD 3FBZA 3MK7C 3AAAB 2ZM8A 3O4XE 5ETWA 4QXHB 4P0AA 3C98B 4JEUB 5L3FB 2XAQB 3GN5B 1X79A 3N2OA 3VKGA 4H9QC 2DCFA 3VHLA 3C4XA 5FNVE 3C50A 3AVSA 3AVRA 3HL6A 3RYFE 4YJ2E 5LJNA 2LSYA 5FY0A 3FBLA 3LFMA 1IZNB 2E8IA 4GK5E 3T8OA 5LHGB 4ANJA 5CA1E 4JEHB 2Z6EA 4KP3C 3RYCE 2KINB 2CEAA 5DABA 2X9XA 3SS1A 4TZ4C 3HI2A 3ZPOA 2CXFA 3ZMTB 1VOMA 2DI4A 4XBFB 1OWAA 1MNDA 4PK5A 4E7ZA 3CMLA 5LA6E 2I59A 4AKRB 1B7TA 3VU7H 2LSIA 5JDNA 4G2AA 3RC8A 5LYJE 2EHOB 4YFSA 4O8SA 2PFVA 3ANWB 5FXWA 3RYHE 3HKEE 3ZC1A 4DMWA 5L3EB 2VASA 3C4WA 4P0BA 1KK7A 5FY1A 4FJOA 1HG2A 2BDEA 3LG7A 3V5SA 3O1HA 4C90A 3O9XA 1NAFA 4I50E 3CQCB 4QX7B 3AAIA 2LSJA 5LBQB 1NWMX 3PU8A 3VKHA 3CX7B 1BR1A 4BJMA 3B57A 3UT5E 2VB6A 3KV5A 4FI5A 4EXTA 3ZN0B 2XUEA 2YINA 3K8PC 4UELA 2E9XA 3F31A 1EZ3A 5EK3A 3MZKB 3E22E 4QXBB 4ASKA 1SA0E 2H7VC 3KBUA 4UV9B 2QA7A 5IHYA 1QUUA 2M67A 3Q5XA 4BA9A 2B1EA 1D1CA 2KZ7B 4WBNE 3O1JA 2VKJA 4CI2B 4DBQA 3W15B 4UV8B 3RPUA 1LVKA 3CQXC 4DVDA 2KLQA 2XAGB 2BVMA 2V7JA 4I55E 1MMAA 2ODUA 4ZS3A 2LSGA 2VK9A 3AA7B 2G0UA 3BQKA 2D0UA 2E9XD 3UTKA 3QC9A 5JQGE 1MMNA 2V7MA 3BQLA 2K9AA 4DMVA 1D1AA 3ZLIA 4ZI2C 4ZHQE 3SWHA 3KVAA 4QXCB 4P09A 1ZHCA 2XAFB 2CWYA 1HTJF 3C4ZA 5HWYA 3ZMZB 5JDHA 4PJJA 1MNEA 3Q5WA 2BZBA 2MOZA 3RH3A 1IJ5A 4AKIA 2YEVC 4MBQA 1HCIA 3AAEB 1KNZA 3ZMSB 2C5KT 2X67A 2QGSA 2ZM2A 3CQGB 3I9YA 5LG4A 2Y6XA 3P8CD 2K5BB 4IE0A 2X0LB 5JRCA 3I0OA 2Y8DA 5HXCA 2P9BA 2H3RA 2WAUA 3N9OA 5JDGA 3E08A 1D0XA 3MKDA 2CA5A 4CXYA 5KDMC 2YU2A 3FXDB 2E9XB 4AKHA 3GMIA 1O3XA 3O1IA 1T98A 2PBIA 1SHZC 4HE8A 2D2SA 4O4JE 3K3QC 3L3PA 2IW5B 2MYSA 3ZC0A 4H9RC 2X68A 2LT3A 4EOZB 4O2AE 3WI3A 5CB4E 1YW0A 2DNXA 2LE8A 4PFPA 5F8PA 3PE0A 5L3BB 1S35A 1H7CA 3PUGA 1ZEEA 2KMFA 2N2NA 3EVYA 2NTXA 2C5JA 2RP4A 2V26A 3U78A 4CI1B 3V5UA 2K48A 4IIJE 3J7Yq 3N9MA 4UXNB 5FXZA 4HN9A 3PUAA 5AFUL 5LOVE 4CQIA 2L3LA 4MFRA 3ZCIA 3DP7A 2L8KA 3H3AA 3N2KE 4AKLA 1FEWA 2VWAA 5JH7E 4EIWA 2JRKA 2UXXB 3NZPA 2LHRA 3CWZB 4IE7A 5BMVE 2K24A 4EAHA 3KVBA 5DJQC 4ZOLE 4IHJE 5JRCB 5FY7A 2HH7A 2XTLA 4UEMA 5F3JA 5L3GB 2NOXA 4K0UA 3ONXA 1WR6A 2XASB 3NZQA 1Y64B 4NUUA 3RKOA 5TAOA 3SOLA 3MA9A 3ZCJA 5HXSA 1YD8G 2J1DG 4EYUA 4GK0E 2X9HA 3RC3A 4N78D 5LGNB 4GOUA 2XQYA 4U74A 4ZI3C 1CUNA 1OXZA 2NWBA 3ZMUB 5FYMA 2CCQA 2JMKA 3WAKA 3Q9DA 4AQFC 4UVBB 3N9PA 2D5UA 4OYJA 4I43B 4PW8A 1HX8A 3SRZA 5LNKA 5H6RB 4H63H 5LGTB 4PNIA 2NW9A 1LRZA 4IE5A 5LHIB 2Q9QC 5C8YE 3OYXA 4PJMA 4IGUA 4QKNA 4QHOA 5A1LA 1IJ6A 3HR0A 3NRXA 4L5GA 2H7OA 4EYYR 1ZV4X 4HTEA 4G63A 1G73A 3P7IA 4TV9E 4CI3B 3HKCE 4ISSA 2LOPA 4IE4A 1E1HB 5E0OA 4O4LE 1YKEB 3KBTA 3NBXX 3BK9A 2XHEB 3GWHA 1WYCA 4UVCB 4GYRA 2CXLA 2JPFA 5J1GA 4IDZA 1WRDA 2X9YA 4HFVA 4X1IE 2N9DA 4OHFA 3AA6B 4BAYB 3TKLB 5IYZE 2NP9A 3ZYMA 2UXNB 1WYBA 4NUVA 5JDLA 4HKAA 3U3IA 3N2GE 2N1GA 3PURA 4TN7B 4H9OC 3ZEFB 4KBMB 2IC6A 4DNDA 1ZKEA 4YLHA 2A72A 2LOSA 2V7LA 2VKOA 5JDFA 3OJAA 4A56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0U A;  4J2C A;  1Z0P A;  3QUJ A;  3N5L A;  4FI5 A;  1H7C A;  2X9Y A;  3S4U A;  1QSD A;  4B6X A;  2C5I T;  2KWI B;  1LRZ A;  3MXZ A;  2CA5 A;  3TKL B;  2IC9 A;  2C5J A;  2XTL A;  3FXD B;  1IJ6 A;  4L0R A;  1IJ5 A;  2MBG A;  2K48 A;  2IC6 A;  4DND A;  1ZKE A;  4EYY R;  3CKD A;  3CVR A;  3P7I A;  3FXE B;  1LVF A;  3QK6 A;  4CQI A;  2KWH A;  3L3P A;  2C5K T;  2X9X A;  2X9W A; 
#chains in the Genus database with same CATH topology
 3AE1 A;  3E0Z A;  5FXX A;  2MTQ A;  1YKH B;  3K3N A;  2DLR A;  3FB2 A;  2WS3 A;  4X20 E;  1W0A A;  2V5D A;  4IDP A;  4GKJ T;  2V7I A;  2VKH A;  2W63 A;  1E7P A;  1YXR A;  4UIG A;  5LG3 A;  2XAH B;  2ZM0 A;  3ZMV B;  3QUJ A;  5KMG P;  2ACX A;  4QWN B;  2YOE A;  2KSR A;  1I6Z A;  4YHJ A;  4JI8 T;  2HPL A;  3JC6 D;  1I94 T;  1UK5 A;  1U4Q A;  2ZMA A;  2UU9 T;  4TV8 E;  5EZY E;  3OYZ A;  2YDS A;  4WNK A;  5M4Y A;  2Y48 B;  4M1P A;  2IC9 A;  4Z8X A;  4HEA A;  1W09 A;  3CVR A;  4YY3 T;  4QH4 A;  5J0Z A;  2LLY A;  3SFE A;  3AE6 A;  2BKP A;  5FP3 A;  2LRK A;  3UU6 A;  1UCU A;  3EDV A;  1YQ4 A;  2X66 A;  2XSA A;  1QSD A;  2DHR A;  2SPC A;  2CLY C;  4IL4 A;  4ILU A;  2NW7 A;  4ERR A;  4IST A;  3FZK B;  3PTR B;  2E9X C;  5GON E;  3QB5 K;  4EZ4 A;  2DWK A;  4X1K E;  2OA5 A;  4CZZ B;  2CE7 A;  5L2L A;  2WBL A;  1US7 B;  2PJQ A;  5AQF B;  4JI5 T;  4MHC A;  3OKQ A;  3RX6 A;  4UF0 B;  3LK2 B;  1T72 A;  3GA8 A;  3R84 B;  3ZST A;  1S94 A;  4Z91 A;  4PAG A;  3P50 A;  2WQY A;  4C91 A;  1FJG T;  3SFD A;  4NIQ A;  3FZH B;  5AQH B;  2BG9 A;  4JYA T;  4NPP A;  3UUX B;  1HG5 A;  5JR9 B;  3ZJ2 A;  5HEO A;  4DR3 T;  4AI6 A;  3RIA A;  2M6B A;  5LBM A;  2WWU A;  3LBX B;  2LHN A;  3G06 A;  4UVA B;  4H63 V;  5JDM A;  2OLT A;  2PTF A;  5EK4 A;  5HAX A;  1HNW T;  4B3T T;  4CXW A;  3I1A A;  5HEU A;  1JNZ A;  5AQQ B;  4HWF A;  1VCT A;  5KX5 E;  2EHO D;  5FVK A;  3O4X E;  4JEU B;  2AE9 A;  3VHL A;  3AVS A;  3HL6 A;  4YJ2 E;  1IBL T;  4JEH B;  2KIN B;  2UUA T;  2CXF A;  2XM2 A;  4DR2 T;  1UUR A;  2I59 A;  5LMN T;  5JDN A;  4G2A A;  2EHO B;  4ZZC A;  2FJA A;  4U2Y A;  4YFS A;  4LF4 T;  5FXW A;  4DMW A;  4FJO A;  2BDE A;  3LG7 A;  2E5V A;  3AAI A;  2LSJ A;  1BR1 A;  3B57 A;  4FI5 A;  3ZN0 B;  3K8P C;  4UEL A;  3F31 A;  1EZ3 A;  5FL0 A;  5EK3 A;  3E22 E;  4QXB B;  4WYV A;  4ASK A;  3KBU A;  4UV9 B;  5IHY A;  4BA9 A;  2B1E A;  4WBN E;  4CI2 B;  4DBQ A;  3W15 B;  4UV8 B;  2V6Y A;  3AA7 B;  3UTK A;  5JQG E;  1MMN A;  2K9A A;  4ZHQ E;  3AE8 A;  4QXC B;  1ZHC A;  2CWY A;  5JDH A;  1MNE A;  1KNZ A;  4DV0 T;  2X0L B;  2YU2 A;  3FXD B;  3M3Z B;  1O3X A;  3RKG A;  4DR7 T;  2PBI A;  1SHZ C;  4HE8 A;  1T8B A;  4O4J E;  3K3Q C;  1UGO A;  3L3P A;  2MYS A;  3ZC0 A;  3AE3 A;  4HWC A;  1XDP A;  2LT3 A;  4O2A E;  3WI3 A;  5L4E A;  5CB4 E;  3JAE A;  4EED A;  2N2N A;  3EVY A;  2C5J A;  2UXB T;  2V26 A;  1N32 T;  4CI1 B;  3V5U A;  2K48 A;  3N9M A;  3PUA A;  5LOV E;  5JH7 E;  2R6G F;  5BMV E;  3P4R A;  2NR4 A;  4ZOL E;  4UEM A;  4LML A;  2NOX A;  4K0U A;  4JI0 T;  3ONX A;  1ZP0 A;  1WR6 A;  3SOL A;  1NEK A;  2X9H A;  3RC3 A;  2XQY A;  3ZMU B;  2D5U A;  4OYJ A;  3AXJ B;  2FJB A;  5LNK A;  5H6R B;  4IE5 A;  3PUV F;  4IGU A;  4QHO A;  5A1L A;  1IJ6 A;  3NRX A;  4EYY R;  1ZV4 X;  1G73 A;  5AQT B;  4DV5 T;  1HNZ T;  4LF9 T;  2XQ8 A;  3KBT A;  2IML A;  2XHE B;  3GWH A;  4GYR A;  4X1I E;  5BR8 T;  4LFB T;  4TNW A;  3TKL B;  5IYZ E;  1WYB A;  3U3I A;  2N1G A;  4TN7 B;  4DV4 T;  3LSV A;  2LOS A;  2V7L A;  3JAD A;  4NXM T;  2WU5 A;  2CBI A;  4YJ3 E;  5ABF B;  3KV6 A;  1UX5 A;  4J2C A;  4U7I A;  1FMV A;  3LK4 2;  3UFE A;  3N9L A;  2UXC T;  3B13 A;  4O4I E;  3IEE A;  1MMG A;  2D0T A;  2EHO C;  1FMW A;  4YTN A;  3A8Y C;  4KHZ F;  5JVD E;  1UUS A;  2V6X A;  2JQH A;  2BKO A;  5LGU B;  1XNQ T;  2V1D B;  3NKZ A;  3ZYL A;  4H9N C;  4JI3 T;  1GQE A;  1OED B;  1V9D A;  3ESL A;  3I0Q A;  1AJ3 A;  2YK0 A;  3T1H T;  4AKG A;  5IWA T;  5DQW A;  2IHR 1;  4PK6 A;  3I9W A;  3PU3 A;  2C5I T;  3FZL B;  1MMD A;  2QYW A;  4DV3 T;  2LM9 A;  3K3O A;  3VRA A;  3ZJ1 A;  2J62 A;  3HKB E;  4JLE A;  4U31 A;  1KF6 A;  3RRW A;  3TLW A;  1J5E T;  3RHW A;  5HXE A;  2BBH A;  3C51 A;  4U2Z A;  3EI0 A;  4AQF A;  3IBP A;  1J5W A;  4ADZ A;  1KFY A;  4PK4 A;  4AXP A;  5FXV A;  2YN6 A;  4L9I A;  2FUP A;  3AEB A;  1N33 T;  4ZI3 D;  2J47 A;  4PJL A;  3ONJ A;  4WW0 A;  1BR2 A;  3MXZ A;  3WAJ A;  3N9N A;  4JI7 T;  4TX5 A;  5LXT E;  2C0S A;  3AE7 A;  1LVF A;  2WDR A;  1LKX A;  4LF6 T;  2QRX A;  3GN5 A;  2KT9 A;  2ES0 A;  3PDY A;  3VR9 A;  4YHH T;  2JJ9 A;  4KX6 A;  2HPJ A;  1XNR T;  2JMH A;  3L8R A;  1HFA A;  5FVL A;  2A2F X;  5H6Q B;  2WMN A;  3ETU A;  2A3D A;  1D1B A;  2HN1 A;  1HX1 B;  3MJX A;  5EK2 A;  3EAB A;  3AA1 B;  3HA4 A;  3RQW A;  3ANW A;  1KNP A;  4BJN A;  4IE6 A;  3N9Q A;  5HYA A;  2GK9 A;  3MAC A;  3ETV A;  4A98 A;  1SUM B;  2CXD A;  4YTM A;  2WCA A;  2XQ5 A;  5ETW A;  4QXH B;  3C98 B;  4IDQ A;  5L3F B;  3NWI A;  1T7S A;  2DCF A;  4HFE A;  2CHN A;  5FNV E;  2LSY A;  5FY0 A;  3TLS A;  2BG9 B;  3LFM A;  3P4S A;  3UQ7 A;  1IZN B;  2VVS A;  4GK5 E;  5CA1 E;  3LDQ B;  1WFD A;  4F8H A;  2CEA A;  4ZEY A;  2HHH T;  3HI2 A;  1VOM A;  2DI4 A;  4XBF B;  1MND A;  4PK5 A;  4E7Z A;  5LA6 E;  2WY2 A;  3VU7 H;  4DUZ T;  3RC8 A;  2CHO A;  2UUB T;  4O8S A;  5AQR B;  1N36 T;  2PFV A;  3RYH E;  3ZC1 A;  3Q5D A;  3C4W A;  2XZE A;  2M6I A;  5FY1 A;  3V5S A;  3O1H A;  3PJA A;  3AEF A;  3CQC B;  4LFC T;  3AEE A;  5LBQ B;  2JQ9 A;  1NWM X;  2JIW A;  3CX7 B;  3RIF A;  3AED A;  4EXT A;  1QLB A;  2M67 A;  1D1C A;  2KZ7 B;  2ACZ A;  5HCJ A;  3O1J A;  2W2U A;  1OED C;  2V7J A;  3TLV A;  1MMA A;  2VK9 A;  2XQ9 A;  2G0U A;  3BQK A;  3QC9 A;  4B3R T;  1D1A A;  3UU3 A;  3ZLI A;  4P09 A;  3UQ4 A;  1HTJ F;  3C4Z A;  3EHZ A;  4IRE A;  4AKI A;  1HCI A;  1KEY A;  2X67 A;  3P8C D;  2IIU A;  4ILB A;  2Y8D A;  3N9O A;  3PUX F;  4JV5 T;  1T98 A;  3RGL A;  2D2S A;  3P4P A;  5IUX A;  5AQP B;  4JI1 T;  3PV0 F;  5FKY A;  2V6Y B;  2DNX A;  3UUB A;  4PFP A;  1R8I A;  3PE0 A;  5L3B B;  3AE4 A;  1ZEE A;  5ABH A;  2RP4 A;  3U78 A;  5AQO B;  3J7Y q;  5AFU L;  4HFI A;  4AKL A;  3DP7 A;  2BS4 A;  3N2K E;  4EIW A;  4X65 T;  2XQ3 A;  4IE7 A;  4YTP A;  5DJQ C;  5FY7 A;  4NXN T;  2HH7 A;  1DU2 A;  1Y64 B;  4NUU A;  3TLU A;  5TAO A;  4LF8 T;  3RI5 A;  2UUC T;  4U74 A;  4ZI3 C;  2NWB A;  4UVB B;  3N9P A;  1HX8 A;  4EV6 A;  4WZX A;  2WZI A;  3HR0 A;  4TV9 E;  4ISS A;  3BK9 A;  2CBJ A;  2WB5 A;  2N9D A;  4LFA T;  3AE2 A;  3ZYM A;  4TWF A;  4NUV A;  5KXJ A;  4HKA A;  5AQK B;  3NVO A;  4DND A;  2A72 A;  2BG9 C;  1WCR A;  4YSX A;  2VQE T;  2X0H A;  2XSB A;  3UU5 A;  4CXX A;  4COF A;  3KDS E;  2XQA A;  1Z0P A;  4IDO A;  1JNR A;  5AQG B;  3JC6 C;  3RRC A;  3RLF F;  4OYK A;  4ZI2 D;  3D0T A;  4GIW A;  4X1Y E;  5HXH A;  3UFG A;  2X9W A;  3IF8 B;  3JAF A;  3RIU C;  5J2U E;  5HEJ A;  2RPA A;  3UUM A;  4KMC A;  3LJC A;  5J2T E;  4WBO A;  1U5P A;  3JCF A;  3PUS A;  2CMR A;  4JUY A;  4A5X A;  3ZN1 B;  5AQI B;  3DTO A;  4F6R C;  2I6H A;  1G8X A;  1HS7 A;  5L3C B;  2YKS A;  5FMN A;  2X51 A;  2AXD S;  2BKN A;  3OBV E;  3HKD E;  4MLK A;  1MIY A;  4CN6 A;  3KFW X;  5ADX L;  5JRE A;  3UUN A;  3AEG A;  5JR9 C;  2CPT A;  1IAP A;  4EZH A;  4O2B E;  1MIV A;  5LP6 E;  3Q5E A;  3X1D A;  1ZOY A;  2LKG A;  4DID B;  2MBG A;  1UX4 A;  2XQ4 A;  2VQF T;  5HXR A;  1HNX T;  3PUY F;  2Q9Q A;  3FXE B;  2WMO A;  4DV1 T;  4DUY T;  3T1Y T;  4PFO A;  4X64 T;  5DQV A;  4YT0 A;  2KXP B;  2KWI B;  4TNV A;  1IBK T;  5CA0 E;  3QNU A;  5JDQ A;  3CX6 B;  4O4H E;  4XAX B;  4ZI7 E;  3ONL C;  5HCM A;  2VKD A;  3CPZ A;  4HFC A;  1J1J A;  2ZLY A;  2NW8 A;  4YXD A;  4IDN A;  4OFZ A;  2LSK A;  5CGM A;  2LEH A;  1VRB A;  4QX8 B;  2F4V T;  4I4T E;  1XMQ T;  3RYI E;  3AA0 B;  4TUY E;  2IAK A;  3QK6 A;  5LHH B;  2L9Q A;  4YSZ A;  2XQ7 A;  2CLY B;  4H9S E;  2CWO A;  1HF8 A;  2DL1 A;  3M65 A;  2PG8 A;  3KV9 A;  1BR0 A;  4X66 T;  1L0V A;  4JI6 T;  1WLX A;  3AE9 A;  4GKK T;  3AAA B;  3AEC A;  2IDO B;  3GN5 B;  4DR4 T;  5HEG A;  3AVR A;  5LJN A;  5L47 A;  3P4Q A;  2E8I A;  3T8O A;  5LHG B;  4ANJ A;  4KP3 C;  3RYC E;  3AE5 A;  2X9X A;  3ZPO A;  3ZMT B;  2W4X A;  2XQ6 A;  1OWA A;  3CML A;  4AKR B;  1B7T A;  4IL9 A;  2LSI A;  5C3J A;  3ANW B;  3HKE E;  3UU8 A;  5L3E B;  2VAS A;  2OV9 A;  3UU4 A;  4KHP T;  3OTO T;  4C90 A;  3O9X A;  1NAF A;  4QX7 B;  3PU8 A;  3PUZ F;  3VKH A;  4BJM A;  2VB6 A;  3TLT A;  3B5M A;  2YIN A;  2E9X A;  1Y01 A;  1SA0 E;  2H7V C;  2QA7 A;  3RPU A;  1LVK A;  2KLQ A;  4ZS3 A;  2D0U A;  2V7M A;  4ZI2 C;  3QOF A;  3KVA A;  2XAF B;  3ZMZ B;  4PJJ A;  2BZB A;  2HN2 A;  2YEV C;  4MBQ A;  3ZMS B;  3CQG B;  3I9Y A;  3PJA J;  3OPC A;  5JRC A;  5HXC A;  2P9B A;  2H3R A;  4Z90 A;  2FJD A;  2W66 A;  5JDG A;  3MKD A;  4CXY A;  5KDM C;  4AKH A;  3GMI A;  4LF5 T;  2K3W A;  2IW5 B;  3RQU A;  4H9R C;  4EOZ B;  2XY8 B;  2J4G A;  4DR6 T;  1YW0 A;  3PUG A;  2KMF A;  2MPK A;  2NTX A;  4ZXL A;  1X9B A;  2MAW A;  4IIJ E;  4LMJ A;  4UXN B;  5FXZ A;  4HN9 A;  3ZT7 A;  4YSY A;  4CQI A;  4MFR A;  2L3L A;  2XPK A;  2L8K A;  3VR8 A;  4U3C A;  3CWZ B;  5L4H A;  4EAH A;  4IHJ E;  2XTL A;  5F3J A;  2XAS B;  3NZQ A;  4LMK A;  2E5L T;  3RKO A;  2J1D G;  4JBW F;  4GK0 E;  2JQK A;  4GOU A;  4B3S T;  5FYM A;  3WAK A;  4AQF C;  3Q9D A;  4I43 B;  3OVU A;  3SRZ A;  4JI2 T;  5LGT B;  4PNI A;  4U33 A;  2NW9 A;  2VL0 A;  4ILC A;  1SE7 A;  2W67 A;  4PJM A;  2H7O A;  4HTE A;  3P7I A;  4CI3 B;  2B76 A;  3HKC E;  2LOP A;  1E1H B;  5E0O A;  4UVC B;  2JPF A;  5J1G A;  3L39 A;  3AA6 B;  2UXN B;  5JDL A;  3PUR A;  3ZEF B;  4H9O C;  4YLH A;  4DR5 T;  3EAM A;  3OJA A;  4A56 A;  5AQN B;  3C64 A;  4X62 T;  4A97 A;  2W0G A;  3ZYK A;  4E7S A;  2BS2 A;  4KUM B;  5AQM B;  3CKD A;  3EDU A;  2LJL A;  2X0Y A;  3ZKR A;  4AIS A;  3J9X 1;  3N5L A;  3F2E A;  3UUL A;  2YU1 A;  3AEA A;  5ABG A;  2XJ7 A;  2H88 A;  3RIU A;  3NRY A;  2DWG A;  4L0R A;  3IHR A;  2KND A;  1YQ3 A;  1FIO A;  5AQJ B;  3A7M A;  2A9U A;  1W9R A;  1BR4 A;  2NTY A;  2WM9 A;  3DJB A;  1MIW A;  3KIN B;  4DO0 A;  2FBW A;  4JI4 T;  2VUR A;  4UF0 A;  3RF1 A;  4GYS A;  3Q2M A;  4I0U A;  1XZY A;  4HGA A;  4MAL A;  2WSS V;  2JQQ A;  4AQG A;  5CJ5 A;  4EEB A;  2XAJ B;  3L09 A;  2W61 A;  2UXD T;  4B6X A;  2H89 A;  5L3D B;  5JR9 A;  4PJN A;  1W0B A;  3LBX A;  5HWX A;  1D0Y A;  3CX8 B;  2W62 A;  3FHN A;  4QH5 A;  2KWH A;  2WU2 A;  4V1A v;  4EGW A;  1D0Z A;  5CFB A;  5F5W A;  1XDO A;  4EB6 E;  3FZF B;  2BVL A;  1CHU A;  3ZT6 A;  3A5X A;  3LK3 B;  2Q9Q D;  3KV4 A;  1Z8U A;  2VVN A;  4DBR A;  3H37 A;  2WWV A;  2CM0 A;  4HFH A;  5LCY A;  2IUB A;  2V8S V;  1OED E;  2W00 A;  4UR9 A;  3PUQ A;  4H9P C;  1M7K A;  2LRL A;  4ZS2 A;  2ODV A;  3ZSS A;  2RA1 A;  5LMU T;  4QH1 A;  5LJM A;  4HWI B;  3F57 A;  4HWH A;  5AQL B;  4OK0 A;  3R6N A;  2YDR A;  5HEH A;  2Q9Q B;  5JTG A;  2EHO A;  4HFB A;  2VL8 A;  3S4U A;  4U72 A;  3EUH A;  3CIR A;  3AB3 B;  4XZC A;  4Q25 A;  3BQI A;  2V7K A;  5FL1 A;  4B3M T;  3FBZ A;  3MK7 C;  2ZM8 A;  4CN1 A;  4P0A A;  2XAQ B;  1X79 A;  3N2O A;  3VKG A;  4H9Q C;  1HR0 T;  3K1S A;  3C4X A;  3C50 A;  3RYF E;  3FBL A;  1N34 T;  4DV7 T;  2Z6E A;  5DAB A;  3SS1 A;  4TZ4 C;  5LB7 B;  2XM1 A;  1IBM T;  4TWD A;  3IA3 A;  5LYJ E;  4P0B A;  3VRB A;  1KK7 A;  1HG2 A;  4I50 E;  3P4W A;  4TWH A;  3UT5 E;  2YDQ A;  3KV5 A;  4AQY T;  3ZT5 A;  2XUE A;  3MZK B;  1QUU A;  3Q5X A;  2VKJ A;  4X5T A;  3CQX C;  4DVD A;  2XAG B;  2D9D A;  2BVM A;  4I55 E;  4LF7 T;  2ODU A;  5AQS B;  1WR0 A;  2LSG A;  4DV6 T;  3CK6 A;  2E9X D;  2WP9 A;  3BQL A;  5ABE A;  4DMV A;  3SWH A;  2FJE A;  4CN4 A;  5HWY A;  4U7Y A;  4DV2 T;  3Q5W A;  1XWM A;  2MOZ A;  1IJ5 A;  3RH3 A;  4K0K T;  4ILA A;  4AIU A;  3AAE B;  2BG9 E;  2C5K T;  2QGS A;  2WDV A;  2ZM2 A;  1XMO T;  5LG4 A;  2Y6X A;  1KNR A;  1M62 A;  2K5B B;  4IE0 A;  4ZZB A;  2I0M A;  3I0O A;  2WAU A;  3E08 A;  1D0X A;  2CA5 A;  2E9X B;  3O1I A;  2X68 A;  3AXJ A;  2WZH A;  2LE8 A;  5F8P A;  1S35 A;  1H7C A;  5C2T A;  3FZM B;  3PUW F;  2QVA A;  5AQU B;  2V5C A;  2LM2 A;  3ZCI A;  3H3A A;  1FEW A;  2VWA A;  2JRK A;  2UXX B;  3NZP A;  2LHR A;  1E2A A;  2K24 A;  4DR1 T;  3KVB A;  5JRC B;  3ABV A;  5L3G B;  2E2A A;  4HFD A;  5HXS A;  3ZCJ A;  3MA9 A;  1YD8 G;  4EYU A;  5ABF A;  4N78 D;  5LGN B;  1CUN A;  1OXZ A;  2CCQ A;  2JMK A;  4PW8 A;  4H63 H;  2ZM6 T;  1LRZ A;  5LHI B;  2Q9Q C;  4OX9 T;  5C8Y E;  3OYX A;  4QKN A;  3QB5 A;  4L5G A;  2LKH A;  2WDQ A;  4G63 A;  3H3M A;  5AQV B;  4P1N A;  4IE4 A;  2BS3 A;  4KI0 F;  4O4L E;  1VCS A;  1YKE B;  3NBX X;  1WYC A;  2CXL A;  4IDZ A;  1WRD A;  2X9Y A;  4HFV A;  4IT4 A;  4OHF A;  1OED A;  4BAY B;  2NP9 A;  2CRB A;  1NEN A;  4HWD A;  3N2G E;  4KBM B;  2IC6 A;  2BBJ A;  1ZKE A;  2VKO A;  5JDF A; 
#chains in the Genus database with same CATH homology
 3C64 A;  4CXX A;  3E0Z A;  4YJ3 E;  3KV6 A;  1UX5 A;  3KDS E;  4J2C A;  5FXX A;  1Z0P A;  2MTQ A;  1FMV A;  1YKH B;  3K3N A;  2DLR A;  3FB2 A;  3JC6 C;  3LK4 2;  3UFE A;  3N9L A;  4X20 E;  3RRC A;  4OYK A;  4ZI2 D;  3B13 A;  4O4I E;  2V7I A;  2VKH A;  2W0G A;  3D0T A;  3ZYK A;  4E7S A;  2W63 A;  3IEE A;  4GIW A;  4KUM B;  1MMG A;  2D0T A;  2EHO C;  1FMW A;  3CKD A;  4UIG A;  4X1Y E;  3EDU A;  5HXH A;  2LJL A;  5JVD E;  2X9W A;  3IF8 B;  5J2U E;  2XAH B;  2ZM0 A;  3ZMV B;  3J9X 1;  3QUJ A;  3N5L A;  5LGU B;  5KMG P;  2ACX A;  2V1D B;  3F2E A;  3UUM A;  3UUL A;  2YU1 A;  4QWN B;  4KMC A;  3LJC A;  4YHJ A;  2HPL A;  3JC6 D;  4WBO A;  3ZYL A;  5J2T E;  1U5P A;  3NRY A;  4H9N C;  2DWG A;  4L0R A;  1V9D A;  3ESL A;  3PUS A;  2CMR A;  3IHR A;  3I0Q A;  4JUY A;  2KND A;  1AJ3 A;  3ZN1 B;  2YK0 A;  1U4Q A;  2ZMA A;  1FIO A;  4AKG A;  4TV8 E;  1BR4 A;  2NTY A;  2WM9 A;  3DTO A;  3DJB A;  5EZY E;  4F6R C;  1MIW A;  3OYZ A;  3KIN B;  4DO0 A;  1G8X A;  5DQW A;  4PK6 A;  3I9W A;  1HS7 A;  4UF0 A;  3PU3 A;  2C5I T;  4WNK A;  5L3C B;  5M4Y A;  2Y48 B;  1MMD A;  5FMN A;  4M1P A;  4GYS A;  2X51 A;  3Q2M A;  2IC9 A;  2LM9 A;  4HGA A;  3OBV E;  4MAL A;  3K3O A;  2WSS V;  3HKD E;  4MLK A;  2JQQ A;  4Z8X A;  4AQG A;  4HEA A;  1MIY A;  3CVR A;  3KFW X;  5ADX L;  5JRE A;  3UUN A;  2XAJ B;  3L09 A;  5JR9 C;  3ZJ1 A;  2W61 A;  5FP3 A;  1IAP A;  4EZH A;  3HKB E;  4O2B E;  1UCU A;  4JLE A;  3EDV A;  2X66 A;  1MIV A;  5LP6 E;  1QSD A;  4B6X A;  3RRW A;  2DHR A;  2SPC A;  5L3D B;  5JR9 A;  2CLY C;  4ILU A;  4PJN A;  5HXE A;  2NW7 A;  3C51 A;  4ERR A;  4IST A;  3LBX A;  4AQF A;  5HWX A;  2MBG A;  1D0Y A;  3CX8 B;  1UX4 A;  3IBP A;  2W62 A;  3FHN A;  3PTR B;  5HXR A;  2E9X C;  5GON E;  4ADZ A;  2KWH A;  4PK4 A;  4AXP A;  4V1A v;  5FXV A;  2Q9Q A;  3FXE B;  2WMO A;  4EZ4 A;  1D0Z A;  2DWK A;  4L9I A;  4X1K E;  2OA5 A;  4CZZ B;  2CE7 A;  5L2L A;  4EB6 E;  4PFO A;  2WBL A;  4ZI3 D;  4PJL A;  5DQV A;  1US7 B;  2PJQ A;  2KXP B;  2KWI B;  2BVL A;  4WW0 A;  1BR2 A;  4MHC A;  3OKQ A;  3MXZ A;  5CA0 E;  3RX6 A;  5JDQ A;  3CX6 B;  4UF0 B;  3LK2 B;  3A5X A;  3WAJ A;  3N9N A;  3LK3 B;  4O4H E;  2Q9Q D;  3KV4 A;  4XAX B;  3GA8 A;  4TX5 A;  3R84 B;  4ZI7 E;  5LXT E;  4DBR A;  1S94 A;  2C0S A;  3H37 A;  4PAG A;  2VKD A;  1LVF A;  2CM0 A;  3CPZ A;  1LKX A;  5LCY A;  2ZLY A;  2W00 A;  4C91 A;  3GN5 A;  3PUQ A;  2KT9 A;  4H9P C;  2NW8 A;  4ZS2 A;  2ODV A;  2ES0 A;  4OFZ A;  3PDY A;  2RA1 A;  2JJ9 A;  2LSK A;  2HPJ A;  2JMH A;  5LJM A;  2LEH A;  1HFA A;  3F57 A;  2A2F X;  1VRB A;  5H6Q B;  4QX8 B;  3UUX B;  4I4T E;  2WMN A;  1HG5 A;  3ETU A;  5JR9 B;  3ZJ2 A;  4OK0 A;  3R6N A;  3RYI E;  4AI6 A;  3AA0 B;  4TUY E;  5LBM A;  2A3D A;  2WWU A;  2IAK A;  3LBX B;  3QK6 A;  5LHH B;  2LHN A;  2L9Q A;  4UVA B;  1D1B A;  4H63 V;  3MJX A;  2CLY B;  4H9S E;  5JDM A;  5EK2 A;  2Q9Q B;  2CWO A;  1HF8 A;  3M65 A;  2EHO A;  3AA1 B;  5EK4 A;  2VL8 A;  3S4U A;  3HA4 A;  3ANW A;  4U72 A;  4BJN A;  4IE6 A;  2PG8 A;  3KV9 A;  3N9Q A;  5HYA A;  5HAX A;  3EUH A;  2GK9 A;  3MAC A;  3AB3 B;  1BR0 A;  3ETV A;  4CXW A;  3I1A A;  4XZC A;  2CXD A;  3BQI A;  1WLX A;  2V7K A;  5KX5 E;  2EHO D;  3FBZ A;  3MK7 C;  3AAA B;  2ZM8 A;  3O4X E;  5ETW A;  4QXH B;  4P0A A;  3C98 B;  4JEU B;  5L3F B;  2XAQ B;  3GN5 B;  1X79 A;  3N2O A;  3VKG A;  4H9Q C;  2DCF A;  3VHL A;  3C4X A;  5FNV E;  3C50 A;  3AVS A;  3AVR A;  3HL6 A;  3RYF E;  4YJ2 E;  5LJN A;  2LSY A;  5FY0 A;  3FBL A;  3LFM A;  1IZN B;  2E8I A;  4GK5 E;  3T8O A;  5LHG B;  4ANJ A;  5CA1 E;  4JEH B;  2Z6E A;  4KP3 C;  3RYC E;  2KIN B;  2CEA A;  5DAB A;  2X9X A;  3SS1 A;  4TZ4 C;  3HI2 A;  3ZPO A;  2CXF A;  3ZMT B;  1VOM A;  2DI4 A;  4XBF B;  1OWA A;  1MND A;  4PK5 A;  4E7Z A;  3CML A;  5LA6 E;  2I59 A;  4AKR B;  1B7T A;  3VU7 H;  2LSI A;  5JDN A;  4G2A A;  3RC8 A;  5LYJ E;  2EHO B;  4YFS A;  4O8S A;  2PFV A;  3ANW B;  5FXW A;  3RYH E;  3HKE E;  3ZC1 A;  4DMW A;  5L3E B;  2VAS A;  3C4W A;  4P0B A;  1KK7 A;  5FY1 A;  4FJO A;  1HG2 A;  2BDE A;  3LG7 A;  3V5S A;  3O1H A;  4C90 A;  3O9X A;  1NAF A;  4I50 E;  3CQC B;  4QX7 B;  3AAI A;  2LSJ A;  5LBQ B;  1NWM X;  3PU8 A;  3VKH A;  3CX7 B;  1BR1 A;  4BJM A;  3B57 A;  3UT5 E;  2VB6 A;  3KV5 A;  4FI5 A;  4EXT A;  3ZN0 B;  2XUE A;  2YIN A;  3K8P C;  4UEL A;  2E9X A;  3F31 A;  1EZ3 A;  5EK3 A;  3MZK B;  3E22 E;  4QXB B;  4ASK A;  1SA0 E;  2H7V C;  3KBU A;  4UV9 B;  2QA7 A;  5IHY A;  1QUU A;  2M67 A;  3Q5X A;  4BA9 A;  2B1E A;  1D1C A;  2KZ7 B;  4WBN E;  3O1J A;  2VKJ A;  4CI2 B;  4DBQ A;  3W15 B;  4UV8 B;  3RPU A;  1LVK A;  3CQX C;  4DVD A;  2KLQ A;  2XAG B;  2BVM A;  2V7J A;  4I55 E;  1MMA A;  2ODU A;  4ZS3 A;  2LSG A;  2VK9 A;  3AA7 B;  2G0U A;  3BQK A;  2D0U A;  2E9X D;  3UTK A;  3QC9 A;  5JQG E;  1MMN A;  2V7M A;  3BQL A;  2K9A A;  4DMV A;  1D1A A;  3ZLI A;  4ZI2 C;  4ZHQ E;  3SWH A;  3KVA A;  4QXC B;  4P09 A;  1ZHC A;  2XAF B;  2CWY A;  1HTJ F;  3C4Z A;  5HWY A;  3ZMZ B;  5JDH A;  4PJJ A;  1MNE A;  3Q5W A;  2BZB A;  2MOZ A;  3RH3 A;  1IJ5 A;  4AKI A;  2YEV C;  4MBQ A;  1HCI A;  3AAE B;  1KNZ A;  3ZMS B;  2C5K T;  2X67 A;  2QGS A;  2ZM2 A;  3CQG B;  3I9Y A;  5LG4 A;  2Y6X A;  3P8C D;  2K5B B;  4IE0 A;  2X0L B;  5JRC A;  3I0O A;  2Y8D A;  5HXC A;  2P9B A;  2H3R A;  2WAU A;  3N9O A;  5JDG A;  3E08 A;  1D0X A;  3MKD A;  2CA5 A;  4CXY A;  5KDM C;  2YU2 A;  3FXD B;  2E9X B;  4AKH A;  3GMI A;  1O3X A;  3O1I A;  1T98 A;  2PBI A;  1SHZ C;  4HE8 A;  2D2S A;  4O4J E;  3K3Q C;  3L3P A;  2IW5 B;  2MYS A;  3ZC0 A;  4H9R C;  2X68 A;  2LT3 A;  4EOZ B;  4O2A E;  3WI3 A;  5CB4 E;  1YW0 A;  2DNX A;  2LE8 A;  4PFP A;  5F8P A;  3PE0 A;  5L3B B;  1S35 A;  1H7C A;  3PUG A;  1ZEE A;  2KMF A;  2N2N A;  3EVY A;  2NTX A;  2C5J A;  2RP4 A;  2V26 A;  3U78 A;  4CI1 B;  3V5U A;  2K48 A;  4IIJ E;  3J7Y q;  3N9M A;  4UXN B;  5FXZ A;  4HN9 A;  3PUA A;  5AFU L;  5LOV E;  4CQI A;  2L3L A;  4MFR A;  3ZCI A;  3DP7 A;  2L8K A;  3H3A A;  3N2K E;  4AKL A;  1FEW A;  2VWA A;  5JH7 E;  4EIW A;  2JRK A;  2UXX B;  3NZP A;  2LHR A;  3CWZ B;  4IE7 A;  5BMV E;  2K24 A;  4EAH A;  3KVB A;  5DJQ C;  4ZOL E;  4IHJ E;  5JRC B;  5FY7 A;  2HH7 A;  2XTL A;  4UEM A;  5F3J A;  5L3G B;  2NOX A;  4K0U A;  3ONX A;  1WR6 A;  2XAS B;  3NZQ A;  1Y64 B;  4NUU A;  3RKO A;  5TAO A;  3SOL A;  3MA9 A;  3ZCJ A;  5HXS A;  1YD8 G;  2J1D G;  4EYU A;  4GK0 E;  2X9H A;  3RC3 A;  4N78 D;  5LGN B;  4GOU A;  2XQY A;  4U74 A;  4ZI3 C;  1CUN A;  1OXZ A;  2NWB A;  3ZMU B;  5FYM A;  2CCQ A;  2JMK A;  3WAK A;  3Q9D A;  4AQF C;  4UVB B;  3N9P A;  2D5U A;  4OYJ A;  4I43 B;  4PW8 A;  1HX8 A;  3SRZ A;  5LNK A;  5H6R B;  4H63 H;  5LGT B;  4PNI A;  2NW9 A;  1LRZ A;  4IE5 A;  5LHI B;  2Q9Q C;  5C8Y E;  3OYX A;  4PJM A;  4IGU A;  4QKN A;  4QHO A;  5A1L A;  1IJ6 A;  3HR0 A;  3NRX A;  4L5G A;  2H7O A;  4EYY R;  1ZV4 X;  4HTE A;  4G63 A;  1G73 A;  3P7I A;  4TV9 E;  4CI3 B;  3HKC E;  4ISS A;  2LOP A;  4IE4 A;  1E1H B;  5E0O A;  4O4L E;  1YKE B;  3KBT A;  3NBX X;  3BK9 A;  2XHE B;  3GWH A;  1WYC A;  4UVC B;  4GYR A;  2CXL A;  2JPF A;  5J1G A;  4IDZ A;  1WRD A;  2X9Y A;  4HFV A;  4X1I E;  2N9D A;  4OHF A;  3AA6 B;  4BAY B;  3TKL B;  5IYZ E;  2NP9 A;  3ZYM A;  2UXN B;  1WYB A;  4NUV A;  5JDL A;  4HKA A;  3U3I A;  3N2G E;  2N1G A;  3PUR A;  4TN7 B;  4H9O C;  3ZEF B;  4KBM B;  2IC6 A;  4DND A;  1ZKE A;  4YLH A;  2A72 A;  2LOS A;  2V7L A;  2VKO A;  5JDF A;  3OJA A;  4A56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...