4GIWA

Crystal structure of the run domain of human nesca
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
179
Chain Sequence
QKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLMYMPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional implication of the RUN domain of human NESCA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RUN and SH3 domain-containing protein 1
total genus 59
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4giwA00
2DWKA 2CXLA 4GIWA 2DWGA 2CXFA 3CWZB
chains in the Genus database with same CATH superfamily
4Z91A 5HCMA 2YINA 2CLYB 2XPKA 4WBNE 2RA1A 5EK3A 3O9XA 2L3LA 1D1AA 4ILUA 1U5PA 2CPTA 5HXCA 2NTYA 3EI0A 5HEUA 3HL6A 3I0OA 2MYSA 3ANWB 3WI3A 1IJ5A 2XQAA 4O4LE 4ILCA 4N78D 1UURA 5AFUL 2YDRA 4GOUA 5AQJB 2AXDS 3MK7C 2JQ9A 2CRBA 4DUYT 1BR1A 3I1AA 3RC8A 2DNXA 5HYAA 2BDEA 2X9YA 1M62A 4L9IA 4UF0B 2NWBA 5J0ZA 5BR8T 1BR0A 3UU4A 3MJXA 4X1KE 5JRCB 3CQXC 3AE6A 2IC6A 3C4WA 3F31A 3JC6C 2WQYA 3RLFF 4PK5A 4Q25A 4LF4T 4WYVA 4ZI2C 4I55E 1OEDC 3OVUA 3PUSA 3H3AA 4AKGA 2LM2A 4C90A 5LNKA 2EHOA 4KHZF 2YOEA 4OHFA 4GKKT 1MMAA 4EAHA 1G8XA 1L0VA 3AVRA 3LDQB 4PJNA 5KMGP 3HKCE 4TV8E 3RKGA 1HNZT 5HCJA 5LBMA 3KBTA 4YXDA 3ABVA 2PG8A 4K0UA 4AI6A 5CA1E 3CX6B 2RPAA 2WY2A 1ZEEA 2K48A 4ZOLE 4ZHQE 2CXDA 4U72A 4UVBB 1VCTA 2XUEA 1OEDB 4DV0T 1IBKT 2W4XA 3AVSA 4PNIA 3QOFA 5LCYA 2BG9A 2A2FX 2FUPA 3O1HA 3Q2MA 3FHNA 4O2BE 5F5WA 3O1JA 3AA1B 4MLKA 4OFZA 3X1DA 5J2TE 5L47A 5FKYA 4WW0A 1D0YA 4HWDA 4EB6E 3AXJA 4TN7B 4H9NC 2KWHA 2V6XA 2VL8A 3KVAA 2XAQB 2X0HA 2N2NA 3FZKB 5L4EA 4O8SA 5LGTB 4DV1T 5AQUB 5FMNA 3VR8A 4XAXB 4CN6A 2LSJA 5CA0E 4B3MT 2ZM8A 1IBMT 2NTXA 2IW5B 2JQQA 2CLYC 2VURA 2X67A 3I9WA 5IHYA 2CWYA 3GN5B 2IMLA 3P4QA 4JI2T 4JV5T 2E5LT 3VKGA 2ZMAA 5AQTB 1U4QA 2EHOB 3KVBA 4OYKA 3O4XE 1S94A 1KNPA 2KZ7B 3EABA 1HCIA 2NW8A 2XQ7A 3FZLB 4X1IE 3VKHA 2JIWA 3AEFA 4O2AE 3N9OA 5FVKA 2LOPA 4TNVA 1HFAA 4TWHA 3UFGA 4Z90A 2IUBA 1N32T 4HEAA 4WNKA 2RP4A 4ANJA 1BR4A 3JCFA 2YDSA 4LMLA 2D9DA 1D0ZA 3ZCJA 2J1DG 4LF6T 2B1EA 2QA7A 4JLEA 2C5KT 3FZFB 4GK5E 3FBZA 4IIJE 1XNRT 2Q9QD 2WM9A 2UXXB 2X9WA 3H37A 4DR7T 5KXJA 2C5JA 3I0QA 2XAHB 3OPCA 4ADZA 1ZV4X 3NZPA 5M4YA 2NP9A 3AEGA 5LMUT 3ZPOA 3LG7A 4TX5A 4UV9B 5ETWA 3P4SA 1G73A 4DV7T 3VHLA 2HH7A 2WWUA 3KINB 5FYMA 4CXXA 3IHRA 2VK9A 2IAKA 3IA3A 2DHRA 3AAEB 4H63V 4UIGA 3AB3B 3AEDA 1O3XA 4GK0E 4ISSA 4U7IA 3UQ4A 3K1SA 3C4ZA 4ZZBA 4DR2T 2A3DA 2IDOB 2ES0A 2M67A 1X9BA 3CVRA 4PW8A 5EK2A 3HKDE 2XQYA 3AE9A 4JI6T 2N9DA 4JEUB 3L09A 4UXNB 3LSVA 3RH3A 2WDRA 3ZMVB 5GONE 5AQPB 5ABFB 2V7JA 3AE5A 3SFEA 3A5XA 1S35A 5H6RB 1QUUA 5LOVE 4C91A 1N34T 1N33T 1JNRA 2W61A 1E7PA 5LXTE 2WP9A 2K9AA 4DIDB 2L9QA 1LVKA 3P50A 2J4GA 5JR9C 3B5MA 1YD8G 2VASA 2K3WA 4IDOA 4X64T 1UUSA 4CQIA 2IIUA 1IZNB 3PDYA 2VB6A 4LF8T 1HTJF 4P1NA 4EYUA 1OXZA 2LE8A 1KF6A 2WWVA 2XJ7A 5LHIB 2EHOC 4DO0A 2JPFA 1YQ4A 2E5VA 3ESLA 3CPZA 3G06A 5LGUB 2BZBA 4FI5A 3KV6A 2CCQA 4MHCA 2X66A 3LBXA 3W15B 4PFPA 3RQUA 4U74A 5AQOB 3EVYA 1Y64B 2V26A 2WB5A 1MIYA 3AXJB 4H9PC 2E9XD 2JMKA 5JREA 3H3MA 3BQIA 4OX9T 3AA0B 3FZMB 5C3JA 1LVFA 4KX6A 5DABA 1J5ET 3UFEA 5LMNT 4NXMT 2D5UA 5FL0A 4ZXLA 2V7LA 3AE2A 2NW9A 4IDZA 3KV5A 1OEDA 4DBRA 5HXRA 3T8OA 4UEMA 3PUZF 4WZXA 2Q9QB 3PUVF 4ZS3A 4MBQA 2DWKA 4AQFA 3TLUA 4UV8B 5JDFA 4HKAA 5BMVE 2FJBA 3RKOA 4BJNA 5JDQA 2BS4A 3CKDA 4IL4A 2FBWA 2XQ9A 4MALA 4B6XA 2UUAT 3U78A 4H9RC 4XBFB 2C0SA 3DTOA 2XY8B 1T8BA 2XTLA 2BBHA 4H9SE 2BVLA 3EDUA 4HE8A 4I50E 4KP3C 4JI8T 4ZI7E 4LFCT 2XQ5A 1YKHB 2VWAA 4ZS2A 4X66T 2WU2A 4ILBA 4PJMA 4QWNB 4KHPT 2WBLA 5JDGA 5JRCA 4O4IE 3ZKRA 4NIQA 5AQVB 3RF1A 4JI4T 4DV5T 2XAFB 3PURA 2W67A 2XAJB 3AE7A 3OBVE 5JR9B 2LM9A 3C98B 1CUNA 4F8HA 1D1CA 2W0GA 3E0ZA 5TAOA 3ZYLA 4DMWA 4G2AA 4JI5T 3R6NA 4JI7T 2UXBT 4NUUA 3EUHA 3PJAA 3VRAA 2NW7A 4L5GA 1HR0T 3UT5E 4KI0F 2QYWA 4IE0A 4Z8XA 2OLTA 3ZLIA 4DNDA 4BA9A 5FP3A 5JH7E 4JEHB 3UUNA 4GIWA 4LMJA 4YTNA 2VQFT 3HA4A 2E9XA 2BKPA 4X1YE 4GYRA 4YTMA 3SRZA 4JI3T 5AQKB 2HPLA 4IHJE 3ZJ1A 2YN6A 3K3NA 3NVOA 4HTEA 3AECA 2OA5A 4DVDA 1QSDA 4EEDA 4YSZA 3PV0F 3PTRB 3C51A 4HFVA 5CFBA 5JDHA 3PJAJ 1ZOYA 2WU5A 4UF0A 5FXZA 1LRZA 2YKSA 2YK0A 3ETUA 4O4HE 1YKEB 2LLYA 3LBXB 3PE0A 4U31A 4YFSA 3I9YA 3TLTA 1JNZA 3GMIA 2X51A 4U3CA 5C8YE 5ADXL 3UU3A 2XSBA 4DV4T 1DU2A 3JAFA 1XWMA 3P4WA 4AKHA 2Q9QC 4DUZT 4PK6A 5JVDE 4PAGA 1HX8A 3MZKB 4CXWA 4LFAT 4LF9T 2XZEA 3ZSSA 3RX6A 4AQFC 5LGNB 1BR2A 2B76A 5LJNA 2MOZA 4IREA 3K8PC 4PFOA 2NR4A 2ACXA 3L8RA 3HKEE 2PBIA 1D1BA 1WLXA 2V7KA 3Q5DA 4U2ZA 2XHEB 3L39A 2L8KA 4LFBT 1WYBA 3EHZA 3ONXA 4QXHB 3ZN0B 4IE4A 4DR6T 5H6QB 2LT3A 5FY7A 4EZ4A 4GKJT 2X9HA 4IDPA 3Q5XA 4EXTA 4IDNA 1M7KA 2J62A 1SA0E 4EOZB 4JYAT 2DCFA 2Y8DA 4YHHT 3RHWA 5DQWA 5L2LA 5IWAT 4HFDA 2X68A 3VRBA 3AEAA 4QXCB 2KLQA 3N2KE 1NAFA 2V7IA 5AQLB 5HEGA 3RIUA 2G0UA 3ZT5A 3CX7B 2VKHA 2CBJA 4TZ4C 5JDLA 2BS2A 3KV9A 3LK2B 1LKXA 3NBXX 1NENA 4WBOA 5LYJE 3ZC0A 4CI3B 3C4XA 2BVMA 3N2OA 1KNZA 3N5LA 4HWIB 3PUXF 2BKOA 2BG9C 2YU2A 4GYSA 4PJJA 2W63A 2LRKA 1HS7A 2I6HA 5LA6E 2ZM0A 5LP6E 1I94T 2X0YA 5FNVE 5JTGA 3ZT7A 2D0TA 2VKOA 2IHR1 3N9LA 2V5DA 4B3RT 4DR4T 4P0BA 5L3DB 2LHRA 5FXVA 3EDVA 4JI1T 5E0OA 1XMOT 4X5TA 4EGWA 1UX4A 1ZHCA 2VKJA 2V7MA 4AQYT 1HNXT 4A97A 3Q5WA 5L3GB 5DJQC 2BG9B 2ZLYA 5HEHA 4TWDA 5AQRB 3UUBA 1HG2A 2H88A 5FVLA 1XMQT 1WYCA 1IBLT 4BJMA 1T98A 4U2YA 3RYIE 2F4VT 4JUYA 3GA8A 3AE4A 3JAEA 4AISA 1CHUA 5HXEA 5DQVA 3ZYKA 2XM2A 5HEJA 2A72A 3ZT6A 2NOXA 4KUMB 5JQGE 4U33A 3B57A 2H3RA 2VKDA 2I0MA 4H9OC 2LSKA 2WAUA 3AE3A 3TLVA 3A8YC 2YEVC 4AQGA 4EEBA 2CXLA 2X9XA 2VQET 3AE1A 4NPPA 1W0BA 1Z0PA 2WZHA 4UELA 4HWHA 2D2SA 4PJLA 4IE5A 3AAAB 4HN9A 4KMCA 4AIUA 4EV6A 4A5XA 5J2UE 1R8IA 3KBUA 1OEDE 4IDQA 1H7CA 3OYXA 3QB5K 4QXBB 3CMLA 1FJGT 2XSAA 2LOSA 5HAXA 2HN2A 2WCAA 5AQMB 3ONJA 2V6YA 5JDNA 2EHOD 4DBQA 1J5WA 1WCRA 3QNUA 3ZCIA 2UXDT 2KNDA 1WR0A 2HHHT 3CQCB 3N9PA 2LHNA 5FY1A 4HWFA 2Q9QA 3JADA 3P4RA 5EK4A 1IJ6A 3MA9A 3AEEA 3HKBE 1MMDA 3LJCA 3IEEA 1FMWA 3P4PA 5J1GA 4B3TT 3OTOT 5HEOA 3RQWA 1D0XA 3CX8B 3UU6A 4YSYA 4EYYR 4ZI3C 3N9QA 3F2EA 1T7SA 3RPUA 3U3IA 4E7SA 5KX5E 1VCSA 1SHZC 2KWIB 1W0AA 3N9NA 1UCUA 5CGMA 1B7TA 3DJBA 3UU8A 2CHNA 4U7YA 2HPJA 2Y48B 2VL0A 3ZMUB 3ZMSB 4H9QC 2VVNA 3LK42 3SFDA 3NWIA 4CZZB 5ABFA 2ACZA 1YW0A 2GK9A 3ANWA 4EZHA 5LHHB 1T72A 2CXFA 3HR0A 4XZCA 2CM0A 4FJOA 1HX1B 4IGUA 2WZIA 4DV2T 5F3JA 1FEWA 2W62A 3ETVA 4ZZCA 1W9RA 4IE7A 3O1IA 4P09A 4O4JE 3S4UA 3ZMZB 2R6GF 2W66A 5AQQB 2J47A 2WDQA 4M1PA 4PK4A 3BQLA 3UUMA 2QGSA 2SPCA 4DV6T 4HWCA 4E7ZA 2X0LB 2YU1A 3AEBA 3TLSA 5FL1A 3T1YT 3RI5A 4I0UA 1AJ3A 1FMVA 2UXCT 3NRXA 2ODUA 3M65A 3Q9DA 4IL9A 3FZHB 3OJAA 1NWMX 1MNDA 2UXNB 1MIVA 3VU7H 3ZYMA 1QLBA 4H63H 4LMKA 3ZMTB 5L3BB 4COFA 1Z8UA 5KDMC 4QH5A 4X62T 2AE9A 2C5IT 5L4HA 2LSIA 3PUQA 5EZYE 3WAJA 5A1LA 3RIFA 1YQ3A 1IAPA 5FXWA 2WMOA 5CJ5A 3UULA 3FXDB 3UQ7A 3WAKA 5LG4A 3T1HT 3V5UA 4JI0T 1E2AA 3QK6A 2DWGA 2FJAA 3GN5A 3GWHA 3N9MA 2WMNA 2CMRA 3PUWF 4ISTA 5AQSB 5HXSA 2QRXA 3QC9A 2XASB 3RC3A 3AE8A 4AKLA 4K0KT 4QH4A 3NRYA 3R84B 3RGLA 1XDPA 3RYCE 3LFMA 3ZN1B 3MACA 1SUMB 1UGOA 4EIWA 1ZKEA 2KT9A 2FJEA 5CB4E 2H7OA 3OKQA 1KFYA 4ZI2D 1WR6A 2JMHA 3Q5EA 3ZSTA 4ZI3D 2W2UA 3A7MA 2D0UA 2JJ9A 2W00A 4IE6A 1YXRA 2E9XB 2MPKA 3L3PA 3TLWA 2FJDA 4A56A 4UVAB 4CN4A 4P0AA 4TNWA 4HFCA 1I6ZA 4B3ST 2XAGB 4J2CA 2N1GA 5LHGB 3AA7B 3ZEFB 3F57A 4NXNT 1WFDA 2LSGA 2XQ4A 1WRDA 2MBGA 2QVAA 3PUGA 4DMVA 3KDSE 4LF7T 3DP7A 3UU5A 4YTPA 2DLRA 1VRBA 1HG5A 4X20E 3RRWA 2IC9A 2V6YB 4BAYB 2E9XC 3QUJA 3IBPA 5HWXA 2PTFA 2E2AA 2V1DB 1OWAA 5LBQB 2VVSA 5ABHA 3PUAA 5JR9A 2Z6EA 3E08A 1MNEA 2XM1A 2CWOA 3FB2A 3RRCA 2A9UA 3RIAA 5HXHA 3QB5A 5HWYA 2CEAA 5FXXA 4MFRA 2CBIA 2P9BA 4NUVA 3ZC1A 2UUBT 4ASKA 2JQKA 3RIUC 2K24A 5FY0A 3SOLA 1W09A 3LK3B 1XDOA 5IUXA 1UX5A 1NEKA 2WS3A 3K3OA 4HGAA 3FBLA 5F8PA 3UTKA 1FIOA 3AA6B 4KBMB 4YLHA 4ERRA 3OYZA 3AAIA 4UVCB 4YT0A 3JC6D 4YY3T 4YHJA 4DR1T 1MIWA 2OV9A 1ZP0A 4F6RC 2CA5A 4OK0A 3RYHE 4V1Av 4DR5T 2V8SV 2BBJA 2WDVA 2UU9T 1HNWT 3BK9A 3NKZA 2ODVA 3CQGB 4ZEYA 2PJQA 4JBWF 2BG9E 4OYJA 4HFIA 4YJ3E 5ABGA 5LB7B 1KK7A 2BKNA 4A98A 5LJMA 2LJLA 3PU8A 4CN1A 3CK6A 5JDMA 3M3ZB 4QX7B 3ZJ2A 5C2TA 1MMNA 4AXPA 2LKHA 3NZQA 4ILAA 2I59A 2KMFA 4I4TE 3N2GE 2ZM2A 3P7IA 4QX8B 5AQNB 3RYFE 3CIRA 2LEHA 5AQIB 3PU3A 3P8CD 4LF5T 3E22E 3SWHA 5LG3A 3CWZB 5L3CB 3MXZA 1EZ3A 2DL1A 4TWFA 4IT4A 4CI1B 2LSYA 2LRLA 1MMGA 2XQ3A 5IYZE 2M6BA 1XNQT 3MKDA 2K5BB 2H89A 3FXEB 3EAMA 2UUCT 1KNRA 3HI2A 3IF8B 3KV4A 4UR9A 3UUXB 4X65T 3J7Yq 4G63A 3ONLC 2YDQA 3C50A 3D0TA 2Y6XA 3KFWX 3SS1A 5L3FB 1UK5A 3J9X1 1N36T 2DI4A 2MAWA 2JRKA 2XQ6A 4CI2B 2BS3A 4YJ2E 3K3QC 4I43B 1X79A 5AQGB 1XZYA 2CHOA 3C64A 2KXPB 4HFHA 4DR3T 5AQFB 4YSXA 2KSRA 5AQHB 2JQHA 5ABEA 4QKNA 4HFEA 2H7VC 4TUYE 2ZM6T 4AKIA 4CXYA 3V5SA 1E1HB 1HF8A 1US7B 2E8IA 1J1JA 2HN1A 2V5CA 3PUYF 2PFVA 2CE7A 4QH1A 1SE7A 4QHOA 1GQEA 1V9DA 1Y01A 4AKRB 5L3EB 4DV3T 4L0RA 1KEYA 2XQ8A 4TV9E 4HFBA 2LKGA 2WSSV 3VR9A 3B13A 3BQKA 2M6IA 3TKLB 2MTQA 2KINB 1VOMA
chains in the Genus database with same CATH topology
2YINA 2CLYB 4WBNE 2RA1A 5EK3A 3O9XA 2L3LA 1D1AA 4ILUA 1U5PA 5HXCA 4CQIA 2NTYA 3ZPOA 3HL6A 3I0OA 2MYSA 3ANWB 3WI3A 1IJ5A 4O4LE 4N78D 5AFUL 4GOUA 3RC8A 3MK7C 1BR1A 3I1AA 2DNXA 5HYAA 2BDEA 2X9YA 4L9IA 4UF0B 1BR0A 2NWBA 3MJXA 4X1KE 5JRCB 3CQXC 2IC6A 3C4WA 3F31A 3JC6C 4PK5A 4ZI2C 4I55E 4AKGA 3PUSA 3H3AA 4C90A 5LNKA 2EHOA 4OHFA 1MMAA 4EAHA 1G8XA 3AVRA 4PJNA 5KMGP 3HKCE 4TV8E 4AI6A 5LBMA 3KBTA 2PG8A 4K0UA 5CA1E 3CX6B 1ZEEA 2K48A 4ZOLE 4ZHQE 2CXDA 4U72A 4UVBB 2XUEA 3AVSA 4PNIA 5LCYA 2A2FX 3O1HA 3Q2MA 3FHNA 4O2BE 3O1JA 3AA1B 4MLKA 4OFZA 5J2TE 4WW0A 1D0YA 4EB6E 4TN7B 4H9NC 2KWHA 3KVAA 2VL8A 2XAQB 2N2NA 4O8SA 5LGTB 5FMNA 4XAXB 2LSJA 5CA0E 2ZM8A 2NTXA 2IW5B 2JQQA 2CLYC 2X67A 3I9WA 5IHYA 2CWYA 3GN5B 3VKGA 2ZMAA 1U4QA 2EHOB 3KVBA 4OYKA 3O4XE 1S94A 2KZ7B 4X1IE 1HCIA 2NW8A 3VKHA 4O2AE 3N9OA 2LOPA 1HFAA 4HEAA 4WNKA 2RP4A 4ANJA 1BR4A 1D0ZA 3ZCJA 2J1DG 2B1EA 2QA7A 4JLEA 2C5KT 4GK5E 3FBZA 4IIJE 2Q9QD 2WM9A 3H37A 2UXXB 2X9WA 2C5JA 3I0QA 2XAHB 4ADZA 1ZV4X 3NZPA 5M4YA 2NP9A 3LG7A 4TX5A 4UV9B 5ETWA 1G73A 3VHLA 2HH7A 2WWUA 3KINB 5FYMA 4CXXA 3IHRA 2VK9A 2IAKA 2DHRA 3AAEB 4H63V 4UIGA 3AB3B 1O3XA 4GK0E 4ISSA 1HS7A 3C4ZA 2A3DA 3CVRA 2ES0A 2M67A 4PW8A 5EK2A 3HKDE 2XQYA 2N9DA 4JEUB 3L09A 4UXNB 3RH3A 3ZMVB 5GONE 2V7JA 3A5XA 1S35A 5H6RB 1QUUA 5LOVE 4C91A 2W61A 5LXTE 2K9AA 2L9QA 1LVKA 5JR9C 1YD8G 2VASA 1IZNB 3PDYA 2VB6A 1HTJF 4EYUA 1OXZA 2LE8A 5LHIB 2EHOC 4DO0A 2JPFA 3ESLA 3CPZA 5LGUB 2BZBA 4FI5A 3KV6A 2CCQA 4MHCA 2X66A 3LBXA 3W15B 4PFPA 4U74A 3EVYA 1Y64B 2V26A 1MIYA 4H9PC 2E9XD 2JMKA 5JREA 3BQIA 3AA0B 1LVFA 5DABA 3UFEA 2D5UA 2NW9A 2V7LA 4IDZA 3KV5A 4DBRA 5HXRA 3T8OA 4UEMA 2Q9QB 4ZS3A 4MBQA 2DWKA 4AQFA 4UV8B 5JDFA 4HKAA 5BMVE 4BJNA 3RKOA 5JDQA 5L3EB 3CKDA 4B6XA 4MALA 3U78A 4H9RC 2C0SA 3DTOA 2XTLA 4I50E 4H9SE 2BVLA 3EDUA 4HE8A 4KP3C 4ZI7E 1YKHB 2VWAA 4ZS2A 4QWNB 4PJMA 2WBLA 5JDGA 5JRCA 4O4IE 2XAFB 3PURA 2XAJB 3OBVE 5JR9B 2LM9A 3C98B 1CUNA 1D1CA 2W0GA 3E0ZA 5TAOA 3ZYLA 4DMWA 4G2AA 3R6NA 4NUUA 3EUHA 2NW7A 4L5GA 3UT5E 4Z8XA 4IE0A 4DNDA 3ZLIA 4BA9A 5FP3A 5JH7E 4JEHB 3UUNA 4GIWA 3HA4A 2E9XA 4X1YE 3SRZA 4GYRA 2HPLA 4IHJE 3ZJ1A 3K3NA 4HTEA 4DVDA 2OA5A 1QSDA 3PTRB 3C51A 4HFVA 5JDHA 4UF0A 5FXZA 1LRZA 3ETUA 2YK0A 4O4HE 4YFSA 1YKEB 3LBXB 3PE0A 3V5UA 5C8YE 3I9YA 5ADXL 3GMIA 2X51A 4AKHA 2Q9QC 4PK6A 5JVDE 4PAGA 1HX8A 3MZKB 4CXWA 3RX6A 4AQFC 5LGNB 1BR2A 5LJNA 2MOZA 3K8PC 4PFOA 2ACXA 3HKEE 2PBIA 1D1BA 1WLXA 2V7KA 2XHEB 2L8KA 1WYBA 3ONXA 4QXHB 3ZN0B 4IE4A 5H6QB 2LT3A 5FY7A 4EZ4A 2X9HA 3Q5XA 4EXTA 1SA0E 4EOZB 2DCFA 2Y8DA 5DQWA 5L2LA 2X68A 4QXCB 2KLQA 3N2KE 1NAFA 2V7IA 5L3GB 2G0UA 3CX7B 2VKHA 4TZ4C 5JDLA 3KV9A 3LK2B 1LKXA 3NBXX 4WBOA 5LYJE 3ZC0A 4CI3B 3C4XA 2BVMA 3N2OA 1KNZA 3N5LA 2YU2A 4GYSA 4PJJA 2W63A 5LA6E 2ZM0A 5LP6E 5FNVE 2D0TA 2VKOA 3N9LA 4P0BA 5L3DB 2LHRA 5FXVA 3EDVA 5E0OA 1UX4A 1ZHCA 2VKJA 2V7MA 3Q5WA 5DJQC 2ZLYA 1HG2A 1WYCA 4BJMA 1T98A 3RYIE 4JUYA 3GA8A 5HXEA 5DQVA 3ZYKA 2A72A 2NOXA 4KUMB 5JQGE 3B57A 2H3RA 2VKDA 4H9OC 2LSKA 2WAUA 4AQGA 2YEVC 2CXLA 2X9XA 1Z0PA 4UELA 2D2SA 4PJLA 4IE5A 3AAAB 4HN9A 4KMCA 3WAJA 5J2UE 3KBUA 1H7CA 3OYXA 4QXBB 3CMLA 2LOSA 5HAXA 5JDNA 2EHOD 4DBQA 3ZCIA 2KNDA 3CQCB 3N9PA 2LHNA 5FY1A 2Q9QA 5EK4A 1IJ6A 3MA9A 3HKBE 4E7ZA 1MMDA 3LJCA 3IEEA 1FMWA 5J1GA 1D0XA 3CX8B 4EYYR 4ZI3C 3N9QA 3F2EA 3RPUA 3U3IA 4E7SA 5KX5E 2KWIB 1SHZC 3N9NA 1UCUA 1B7TA 3DJBA 3ZMUB 2HPJA 2Y48B 5HWXA 3ZMSB 4H9QC 4CZZB 3LK42 1YW0A 2GK9A 3ANWA 4EZHA 5LHHB 2CXFA 3HR0A 4XZCA 2CM0A 4FJOA 4IGUA 5F3JA 1FEWA 2W62A 3ETVA 4IE7A 4P09A 3O1IA 3S4UA 4O4JE 3ZMZB 3UUMA 4M1PA 4PK4A 3BQLA 2QGSA 2SPCA 2X0LB 2YU1A 1AJ3A 1FMVA 3NRXA 2ODUA 3M65A 3Q9DA 3OJAA 1NWMX 1MNDA 2UXNB 1MIVA 3VU7H 3ZYMA 4H63H 5L3BB 3ZMTB 5KDMC 2C5IT 2LSIA 3PUQA 5EZYE 5A1LA 1IAPA 5FXWA 2WMOA 3UULA 3FXDB 3WAKA 5LG4A 3QK6A 2DWGA 3GWHA 3GN5A 3N9MA 4ISTA 2WMNA 2CMRA 5HXSA 4CXYA 3QC9A 2XASB 3RC3A 4AKLA 3NRYA 3R84B 3RYCE 3LFMA 3ZN1B 3MACA 4EIWA 1ZKEA 2KT9A 5CB4E 2H7OA 3OKQA 4ZI2D 1WR6A 2JMHA 4ZI3D 2D0UA 2JJ9A 2W00A 4IE6A 2E9XB 3L3PA 4A56A 4P0AA 4UVAB 2XAGB 4J2CA 2N1GA 5LHGB 3AA7B 3ZEFB 3F57A 2MBGA 2LSGA 1WRDA 3PUGA 4DMVA 3KDSE 3DP7A 2DLRA 1VRBA 1HG5A 4X20E 3RRWA 2IC9A 4BAYB 2E9XC 3QUJA 3IBPA 2V1DB 1OWAA 5LBQB 3PUAA 5JR9A 2Z6EA 3E08A 1MNEA 2CWOA 3FB2A 3RRCA 5HXHA 5HWYA 2CEAA 5FXXA 4MFRA 2P9BA 4NUVA 3ZC1A 4ASKA 2K24A 5FY0A 3SOLA 3LK3B 1UX5A 3K3OA 3UTKA 4HGAA 3FBLA 5F8PA 1FIOA 3AA6B 4KBMB 4YLHA 4ERRA 3OYZA 3AAIA 4UVCB 3JC6D 4YHJA 1MIWA 4F6RC 2CA5A 4OK0A 3RYHE 4V1Av 3BK9A 2ODVA 3CQGB 2PJQA 4OYJA 4YJ3E 1KK7A 5LJMA 2LJLA 3PU8A 5JDMA 4XBFB 4QX7B 3ZJ2A 1MMNA 4AXPA 3NZQA 2I59A 2KMFA 4I4TE 3N2GE 2ZM2A 3P7IA 4QX8B 3RYFE 2LEHA 3PU3A 3P8CD 3E22E 3SWHA 3CWZB 5L3CB 3MXZA 1EZ3A 4CI1B 2LSYA 1MMGA 5IYZE 3MKDA 2K5BB 3FXEB 3HI2A 3IF8B 3KV4A 3UUXB 3J7Yq 4G63A 3C50A 3D0TA 2Y6XA 3KFWX 3SS1A 5L3FB 3J9X1 2DI4A 2JRKA 4CI2B 4YJ2E 3K3QC 4I43B 1X79A 3C64A 2KXPB 4QKNA 2H7VC 4TUYE 4AKIA 3V5SA 1E1HB 1HF8A 1US7B 2E8IA 2PFVA 2CE7A 4QHOA 1V9DA 4AKRB 4L0RA 4TV9E 2WSSV 3B13A 3BQKA 3TKLB 2MTQA 2KINB 1VOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWK A;  2CXL A;  4GIW A;  2DWG A;  2CXF A;  3CWZ B; 
#chains in the Genus database with same CATH topology
 4Z91 A;  5HCM A;  2YIN A;  2CLY B;  2XPK A;  4WBN E;  2RA1 A;  5EK3 A;  3O9X A;  2L3L A;  1D1A A;  4ILU A;  1U5P A;  2CPT A;  5HXC A;  2NTY A;  3EI0 A;  5HEU A;  3HL6 A;  3I0O A;  2MYS A;  3ANW B;  3WI3 A;  1IJ5 A;  2XQA A;  4O4L E;  4ILC A;  4N78 D;  1UUR A;  5AFU L;  2YDR A;  4GOU A;  5AQJ B;  2AXD S;  3MK7 C;  2JQ9 A;  2CRB A;  4DUY T;  1BR1 A;  3I1A A;  3RC8 A;  2DNX A;  5HYA A;  2BDE A;  2X9Y A;  1M62 A;  4L9I A;  4UF0 B;  2NWB A;  5J0Z A;  5BR8 T;  1BR0 A;  3UU4 A;  3MJX A;  4X1K E;  5JRC B;  3CQX C;  3AE6 A;  2IC6 A;  3C4W A;  3F31 A;  3JC6 C;  2WQY A;  3RLF F;  4PK5 A;  4Q25 A;  4LF4 T;  4WYV A;  4ZI2 C;  4I55 E;  1OED C;  3OVU A;  3PUS A;  3H3A A;  4AKG A;  2LM2 A;  4C90 A;  5LNK A;  2EHO A;  4KHZ F;  2YOE A;  4OHF A;  4GKK T;  1MMA A;  4EAH A;  1G8X A;  1L0V A;  3AVR A;  3LDQ B;  4PJN A;  5KMG P;  3HKC E;  4TV8 E;  3RKG A;  1HNZ T;  5HCJ A;  5LBM A;  3KBT A;  4YXD A;  3ABV A;  2PG8 A;  4K0U A;  4AI6 A;  5CA1 E;  3CX6 B;  2RPA A;  2WY2 A;  1ZEE A;  2K48 A;  4ZOL E;  4ZHQ E;  2CXD A;  4U72 A;  4UVB B;  1VCT A;  2XUE A;  1OED B;  4DV0 T;  1IBK T;  2W4X A;  3AVS A;  4PNI A;  3QOF A;  5LCY A;  2BG9 A;  2A2F X;  2FUP A;  3O1H A;  3Q2M A;  3FHN A;  4O2B E;  5F5W A;  3O1J A;  3AA1 B;  4MLK A;  4OFZ A;  3X1D A;  5J2T E;  5L47 A;  5FKY A;  4WW0 A;  1D0Y A;  4HWD A;  4EB6 E;  3AXJ A;  4TN7 B;  4H9N C;  2KWH A;  2V6X A;  2VL8 A;  3KVA A;  2XAQ B;  2X0H A;  2N2N A;  3FZK B;  5L4E A;  4O8S A;  5LGT B;  4DV1 T;  5AQU B;  5FMN A;  3VR8 A;  4XAX B;  4CN6 A;  2LSJ A;  5CA0 E;  4B3M T;  2ZM8 A;  1IBM T;  2NTX A;  2IW5 B;  2JQQ A;  2CLY C;  2VUR A;  2X67 A;  3I9W A;  5IHY A;  2CWY A;  3GN5 B;  2IML A;  3P4Q A;  4JI2 T;  4JV5 T;  2E5L T;  3VKG A;  2ZMA A;  5AQT B;  1U4Q A;  2EHO B;  3KVB A;  4OYK A;  3O4X E;  1S94 A;  1KNP A;  2KZ7 B;  3EAB A;  1HCI A;  2NW8 A;  2XQ7 A;  3FZL B;  4X1I E;  3VKH A;  2JIW A;  3AEF A;  4O2A E;  3N9O A;  5FVK A;  2LOP A;  4TNV A;  1HFA A;  4TWH A;  3UFG A;  4Z90 A;  2IUB A;  1N32 T;  4HEA A;  4WNK A;  2RP4 A;  4ANJ A;  1BR4 A;  3JCF A;  2YDS A;  4LML A;  2D9D A;  1D0Z A;  3ZCJ A;  2J1D G;  4LF6 T;  2B1E A;  2QA7 A;  4JLE A;  2C5K T;  3FZF B;  4GK5 E;  3FBZ A;  4IIJ E;  1XNR T;  2Q9Q D;  2WM9 A;  2UXX B;  2X9W A;  3H37 A;  4DR7 T;  5KXJ A;  2C5J A;  3I0Q A;  2XAH B;  3OPC A;  4ADZ A;  1ZV4 X;  3NZP A;  5M4Y A;  2NP9 A;  3AEG A;  5LMU T;  3ZPO A;  3LG7 A;  4TX5 A;  4UV9 B;  5ETW A;  3P4S A;  1G73 A;  4DV7 T;  3VHL A;  2HH7 A;  2WWU A;  3KIN B;  5FYM A;  4CXX A;  3IHR A;  2VK9 A;  2IAK A;  3IA3 A;  2DHR A;  3AAE B;  4H63 V;  4UIG A;  3AB3 B;  3AED A;  1O3X A;  4GK0 E;  4ISS A;  4U7I A;  3UQ4 A;  3K1S A;  3C4Z A;  4ZZB A;  4DR2 T;  2A3D A;  2IDO B;  2ES0 A;  2M67 A;  1X9B A;  3CVR A;  4PW8 A;  5EK2 A;  3HKD E;  2XQY A;  3AE9 A;  4JI6 T;  2N9D A;  4JEU B;  3L09 A;  4UXN B;  3LSV A;  3RH3 A;  2WDR A;  3ZMV B;  5GON E;  5AQP B;  5ABF B;  2V7J A;  3AE5 A;  3SFE A;  3A5X A;  1S35 A;  5H6R B;  1QUU A;  5LOV E;  4C91 A;  1N34 T;  1N33 T;  1JNR A;  2W61 A;  1E7P A;  5LXT E;  2WP9 A;  2K9A A;  4DID B;  2L9Q A;  1LVK A;  3P50 A;  2J4G A;  5JR9 C;  3B5M A;  1YD8 G;  2VAS A;  2K3W A;  4IDO A;  4X64 T;  1UUS A;  4CQI A;  2IIU A;  1IZN B;  3PDY A;  2VB6 A;  4LF8 T;  1HTJ F;  4P1N A;  4EYU A;  1OXZ A;  2LE8 A;  1KF6 A;  2WWV A;  2XJ7 A;  5LHI B;  2EHO C;  4DO0 A;  2JPF A;  1YQ4 A;  2E5V A;  3ESL A;  3CPZ A;  3G06 A;  5LGU B;  2BZB A;  4FI5 A;  3KV6 A;  2CCQ A;  4MHC A;  2X66 A;  3LBX A;  3W15 B;  4PFP A;  3RQU A;  4U74 A;  5AQO B;  3EVY A;  1Y64 B;  2V26 A;  2WB5 A;  1MIY A;  3AXJ B;  4H9P C;  2E9X D;  2JMK A;  5JRE A;  3H3M A;  3BQI A;  4OX9 T;  3AA0 B;  3FZM B;  5C3J A;  1LVF A;  4KX6 A;  5DAB A;  1J5E T;  3UFE A;  5LMN T;  4NXM T;  2D5U A;  5FL0 A;  4ZXL A;  2V7L A;  3AE2 A;  2NW9 A;  4IDZ A;  3KV5 A;  1OED A;  4DBR A;  5HXR A;  3T8O A;  4UEM A;  3PUZ F;  4WZX A;  2Q9Q B;  3PUV F;  4ZS3 A;  4MBQ A;  2DWK A;  4AQF A;  3TLU A;  4UV8 B;  5JDF A;  4HKA A;  5BMV E;  2FJB A;  3RKO A;  4BJN A;  5JDQ A;  2BS4 A;  3CKD A;  4IL4 A;  2FBW A;  2XQ9 A;  4MAL A;  4B6X A;  2UUA T;  3U78 A;  4H9R C;  4XBF B;  2C0S A;  3DTO A;  2XY8 B;  1T8B A;  2XTL A;  2BBH A;  4H9S E;  2BVL A;  3EDU A;  4HE8 A;  4I50 E;  4KP3 C;  4JI8 T;  4ZI7 E;  4LFC T;  2XQ5 A;  1YKH B;  2VWA A;  4ZS2 A;  4X66 T;  2WU2 A;  4ILB A;  4PJM A;  4QWN B;  4KHP T;  2WBL A;  5JDG A;  5JRC A;  4O4I E;  3ZKR A;  4NIQ A;  5AQV B;  3RF1 A;  4JI4 T;  4DV5 T;  2XAF B;  3PUR A;  2W67 A;  2XAJ B;  3AE7 A;  3OBV E;  5JR9 B;  2LM9 A;  3C98 B;  1CUN A;  4F8H A;  1D1C A;  2W0G A;  3E0Z A;  5TAO A;  3ZYL A;  4DMW A;  4G2A A;  4JI5 T;  3R6N A;  4JI7 T;  2UXB T;  4NUU A;  3EUH A;  3PJA A;  3VRA A;  2NW7 A;  4L5G A;  1HR0 T;  3UT5 E;  4KI0 F;  2QYW A;  4IE0 A;  4Z8X A;  2OLT A;  3ZLI A;  4DND A;  4BA9 A;  5FP3 A;  5JH7 E;  4JEH B;  3UUN A;  4GIW A;  4LMJ A;  4YTN A;  2VQF T;  3HA4 A;  2E9X A;  2BKP A;  4X1Y E;  4GYR A;  4YTM A;  3SRZ A;  4JI3 T;  5AQK B;  2HPL A;  4IHJ E;  3ZJ1 A;  2YN6 A;  3K3N A;  3NVO A;  4HTE A;  3AEC A;  2OA5 A;  4DVD A;  1QSD A;  4EED A;  4YSZ A;  3PV0 F;  3PTR B;  3C51 A;  4HFV A;  5CFB A;  5JDH A;  3PJA J;  1ZOY A;  2WU5 A;  4UF0 A;  5FXZ A;  1LRZ A;  2YKS A;  2YK0 A;  3ETU A;  4O4H E;  1YKE B;  2LLY A;  3LBX B;  3PE0 A;  4U31 A;  4YFS A;  3I9Y A;  3TLT A;  1JNZ A;  3GMI A;  2X51 A;  4U3C A;  5C8Y E;  5ADX L;  3UU3 A;  2XSB A;  4DV4 T;  1DU2 A;  3JAF A;  1XWM A;  3P4W A;  4AKH A;  2Q9Q C;  4DUZ T;  4PK6 A;  5JVD E;  4PAG A;  1HX8 A;  3MZK B;  4CXW A;  4LFA T;  4LF9 T;  2XZE A;  3ZSS A;  3RX6 A;  4AQF C;  5LGN B;  1BR2 A;  2B76 A;  5LJN A;  2MOZ A;  4IRE A;  3K8P C;  4PFO A;  2NR4 A;  2ACX A;  3L8R A;  3HKE E;  2PBI A;  1D1B A;  1WLX A;  2V7K A;  3Q5D A;  4U2Z A;  2XHE B;  3L39 A;  2L8K A;  4LFB T;  1WYB A;  3EHZ A;  3ONX A;  4QXH B;  3ZN0 B;  4IE4 A;  4DR6 T;  5H6Q B;  2LT3 A;  5FY7 A;  4EZ4 A;  4GKJ T;  2X9H A;  4IDP A;  3Q5X A;  4EXT A;  4IDN A;  1M7K A;  2J62 A;  1SA0 E;  4EOZ B;  4JYA T;  2DCF A;  2Y8D A;  4YHH T;  3RHW A;  5DQW A;  5L2L A;  5IWA T;  4HFD A;  2X68 A;  3VRB A;  3AEA A;  4QXC B;  2KLQ A;  3N2K E;  1NAF A;  2V7I A;  5AQL B;  5HEG A;  3RIU A;  2G0U A;  3ZT5 A;  3CX7 B;  2VKH A;  2CBJ A;  4TZ4 C;  5JDL A;  2BS2 A;  3KV9 A;  3LK2 B;  1LKX A;  3NBX X;  1NEN A;  4WBO A;  5LYJ E;  3ZC0 A;  4CI3 B;  3C4X A;  2BVM A;  3N2O A;  1KNZ A;  3N5L A;  4HWI B;  3PUX F;  2BKO A;  2BG9 C;  2YU2 A;  4GYS A;  4PJJ A;  2W63 A;  2LRK A;  1HS7 A;  2I6H A;  5LA6 E;  2ZM0 A;  5LP6 E;  1I94 T;  2X0Y A;  5FNV E;  5JTG A;  3ZT7 A;  2D0T A;  2VKO A;  2IHR 1;  3N9L A;  2V5D A;  4B3R T;  4DR4 T;  4P0B A;  5L3D B;  2LHR A;  5FXV A;  3EDV A;  4JI1 T;  5E0O A;  1XMO T;  4X5T A;  4EGW A;  1UX4 A;  1ZHC A;  2VKJ A;  2V7M A;  4AQY T;  1HNX T;  4A97 A;  3Q5W A;  5L3G B;  5DJQ C;  2BG9 B;  2ZLY A;  5HEH A;  4TWD A;  5AQR B;  3UUB A;  1HG2 A;  2H88 A;  5FVL A;  1XMQ T;  1WYC A;  1IBL T;  4BJM A;  1T98 A;  4U2Y A;  3RYI E;  2F4V T;  4JUY A;  3GA8 A;  3AE4 A;  3JAE A;  4AIS A;  1CHU A;  5HXE A;  5DQV A;  3ZYK A;  2XM2 A;  5HEJ A;  2A72 A;  3ZT6 A;  2NOX A;  4KUM B;  5JQG E;  4U33 A;  3B57 A;  2H3R A;  2VKD A;  2I0M A;  4H9O C;  2LSK A;  2WAU A;  3AE3 A;  3TLV A;  3A8Y C;  2YEV C;  4AQG A;  4EEB A;  2CXL A;  2X9X A;  2VQE T;  3AE1 A;  4NPP A;  1W0B A;  1Z0P A;  2WZH A;  4UEL A;  4HWH A;  2D2S A;  4PJL A;  4IE5 A;  3AAA B;  4HN9 A;  4KMC A;  4AIU A;  4EV6 A;  4A5X A;  5J2U E;  1R8I A;  3KBU A;  1OED E;  4IDQ A;  1H7C A;  3OYX A;  3QB5 K;  4QXB B;  3CML A;  1FJG T;  2XSA A;  2LOS A;  5HAX A;  2HN2 A;  2WCA A;  5AQM B;  3ONJ A;  2V6Y A;  5JDN A;  2EHO D;  4DBQ A;  1J5W A;  1WCR A;  3QNU A;  3ZCI A;  2UXD T;  2KND A;  1WR0 A;  2HHH T;  3CQC B;  3N9P A;  2LHN A;  5FY1 A;  4HWF A;  2Q9Q A;  3JAD A;  3P4R A;  5EK4 A;  1IJ6 A;  3MA9 A;  3AEE A;  3HKB E;  1MMD A;  3LJC A;  3IEE A;  1FMW A;  3P4P A;  5J1G A;  4B3T T;  3OTO T;  5HEO A;  3RQW A;  1D0X A;  3CX8 B;  3UU6 A;  4YSY A;  4EYY R;  4ZI3 C;  3N9Q A;  3F2E A;  1T7S A;  3RPU A;  3U3I A;  4E7S A;  5KX5 E;  1VCS A;  1SHZ C;  2KWI B;  1W0A A;  3N9N A;  1UCU A;  5CGM A;  1B7T A;  3DJB A;  3UU8 A;  2CHN A;  4U7Y A;  2HPJ A;  2Y48 B;  2VL0 A;  3ZMU B;  3ZMS B;  4H9Q C;  2VVN A;  3LK4 2;  3SFD A;  3NWI A;  4CZZ B;  5ABF A;  2ACZ A;  1YW0 A;  2GK9 A;  3ANW A;  4EZH A;  5LHH B;  1T72 A;  2CXF A;  3HR0 A;  4XZC A;  2CM0 A;  4FJO A;  1HX1 B;  4IGU A;  2WZI A;  4DV2 T;  5F3J A;  1FEW A;  2W62 A;  3ETV A;  4ZZC A;  1W9R A;  4IE7 A;  3O1I A;  4P09 A;  4O4J E;  3S4U A;  3ZMZ B;  2R6G F;  2W66 A;  5AQQ B;  2J47 A;  2WDQ A;  4M1P A;  4PK4 A;  3BQL A;  3UUM A;  2QGS A;  2SPC A;  4DV6 T;  4HWC A;  4E7Z A;  2X0L B;  2YU1 A;  3AEB A;  3TLS A;  5FL1 A;  3T1Y T;  3RI5 A;  4I0U A;  1AJ3 A;  1FMV A;  2UXC T;  3NRX A;  2ODU A;  3M65 A;  3Q9D A;  4IL9 A;  3FZH B;  3OJA A;  1NWM X;  1MND A;  2UXN B;  1MIV A;  3VU7 H;  3ZYM A;  1QLB A;  4H63 H;  4LMK A;  3ZMT B;  5L3B B;  4COF A;  1Z8U A;  5KDM C;  4QH5 A;  4X62 T;  2AE9 A;  2C5I T;  5L4H A;  2LSI A;  3PUQ A;  5EZY E;  3WAJ A;  5A1L A;  3RIF A;  1YQ3 A;  1IAP A;  5FXW A;  2WMO A;  5CJ5 A;  3UUL A;  3FXD B;  3UQ7 A;  3WAK A;  5LG4 A;  3T1H T;  3V5U A;  4JI0 T;  1E2A A;  3QK6 A;  2DWG A;  2FJA A;  3GN5 A;  3GWH A;  3N9M A;  2WMN A;  2CMR A;  3PUW F;  4IST A;  5AQS B;  5HXS A;  2QRX A;  3QC9 A;  2XAS B;  3RC3 A;  3AE8 A;  4AKL A;  4K0K T;  4QH4 A;  3NRY A;  3R84 B;  3RGL A;  1XDP A;  3RYC E;  3LFM A;  3ZN1 B;  3MAC A;  1SUM B;  1UGO A;  4EIW A;  1ZKE A;  2KT9 A;  2FJE A;  5CB4 E;  2H7O A;  3OKQ A;  1KFY A;  4ZI2 D;  1WR6 A;  2JMH A;  3Q5E A;  3ZST A;  4ZI3 D;  2W2U A;  3A7M A;  2D0U A;  2JJ9 A;  2W00 A;  4IE6 A;  1YXR A;  2E9X B;  2MPK A;  3L3P A;  3TLW A;  2FJD A;  4A56 A;  4UVA B;  4CN4 A;  4P0A A;  4TNW A;  4HFC A;  1I6Z A;  4B3S T;  2XAG B;  4J2C A;  2N1G A;  5LHG B;  3AA7 B;  3ZEF B;  3F57 A;  4NXN T;  1WFD A;  2LSG A;  2XQ4 A;  1WRD A;  2MBG A;  2QVA A;  3PUG A;  4DMV A;  3KDS E;  4LF7 T;  3DP7 A;  3UU5 A;  4YTP A;  2DLR A;  1VRB A;  1HG5 A;  4X20 E;  3RRW A;  2IC9 A;  2V6Y B;  4BAY B;  2E9X C;  3QUJ A;  3IBP A;  5HWX A;  2PTF A;  2E2A A;  2V1D B;  1OWA A;  5LBQ B;  2VVS A;  5ABH A;  3PUA A;  5JR9 A;  2Z6E A;  3E08 A;  1MNE A;  2XM1 A;  2CWO A;  3FB2 A;  3RRC A;  2A9U A;  3RIA A;  5HXH A;  3QB5 A;  5HWY A;  2CEA A;  5FXX A;  4MFR A;  2CBI A;  2P9B A;  4NUV A;  3ZC1 A;  2UUB T;  4ASK A;  2JQK A;  3RIU C;  2K24 A;  5FY0 A;  3SOL A;  1W09 A;  3LK3 B;  1XDO A;  5IUX A;  1UX5 A;  1NEK A;  2WS3 A;  3K3O A;  4HGA A;  3FBL A;  5F8P A;  3UTK A;  1FIO A;  3AA6 B;  4KBM B;  4YLH A;  4ERR A;  3OYZ A;  3AAI A;  4UVC B;  4YT0 A;  3JC6 D;  4YY3 T;  4YHJ A;  4DR1 T;  1MIW A;  2OV9 A;  1ZP0 A;  4F6R C;  2CA5 A;  4OK0 A;  3RYH E;  4V1A v;  4DR5 T;  2V8S V;  2BBJ A;  2WDV A;  2UU9 T;  1HNW T;  3BK9 A;  3NKZ A;  2ODV A;  3CQG B;  4ZEY A;  2PJQ A;  4JBW F;  2BG9 E;  4OYJ A;  4HFI A;  4YJ3 E;  5ABG A;  5LB7 B;  1KK7 A;  2BKN A;  4A98 A;  5LJM A;  2LJL A;  3PU8 A;  4CN1 A;  3CK6 A;  5JDM A;  3M3Z B;  4QX7 B;  3ZJ2 A;  5C2T A;  1MMN A;  4AXP A;  2LKH A;  3NZQ A;  4ILA A;  2I59 A;  2KMF A;  4I4T E;  3N2G E;  2ZM2 A;  3P7I A;  4QX8 B;  5AQN B;  3RYF E;  3CIR A;  2LEH A;  5AQI B;  3PU3 A;  3P8C D;  4LF5 T;  3E22 E;  3SWH A;  5LG3 A;  3CWZ B;  5L3C B;  3MXZ A;  1EZ3 A;  2DL1 A;  4TWF A;  4IT4 A;  4CI1 B;  2LSY A;  2LRL A;  1MMG A;  2XQ3 A;  5IYZ E;  2M6B A;  1XNQ T;  3MKD A;  2K5B B;  2H89 A;  3FXE B;  3EAM A;  2UUC T;  1KNR A;  3HI2 A;  3IF8 B;  3KV4 A;  4UR9 A;  3UUX B;  4X65 T;  3J7Y q;  4G63 A;  3ONL C;  2YDQ A;  3C50 A;  3D0T A;  2Y6X A;  3KFW X;  3SS1 A;  5L3F B;  1UK5 A;  3J9X 1;  1N36 T;  2DI4 A;  2MAW A;  2JRK A;  2XQ6 A;  4CI2 B;  2BS3 A;  4YJ2 E;  3K3Q C;  4I43 B;  1X79 A;  5AQG B;  1XZY A;  2CHO A;  3C64 A;  2KXP B;  4HFH A;  4DR3 T;  5AQF B;  4YSX A;  2KSR A;  5AQH B;  2JQH A;  5ABE A;  4QKN A;  4HFE A;  2H7V C;  4TUY E;  2ZM6 T;  4AKI A;  4CXY A;  3V5S A;  1E1H B;  1HF8 A;  1US7 B;  2E8I A;  1J1J A;  2HN1 A;  2V5C A;  3PUY F;  2PFV A;  2CE7 A;  4QH1 A;  1SE7 A;  4QHO A;  1GQE A;  1V9D A;  1Y01 A;  4AKR B;  5L3E B;  4DV3 T;  4L0R A;  1KEY A;  2XQ8 A;  4TV9 E;  4HFB A;  2LKG A;  2WSS V;  3VR9 A;  3B13 A;  3BQK A;  2M6I A;  3TKL B;  2MTQ A;  2KIN B;  1VOM A; 
#chains in the Genus database with same CATH homology
 2YIN A;  2CLY B;  4WBN E;  2RA1 A;  5EK3 A;  3O9X A;  2L3L A;  1D1A A;  4ILU A;  1U5P A;  5HXC A;  4CQI A;  2NTY A;  3ZPO A;  3HL6 A;  3I0O A;  2MYS A;  3ANW B;  3WI3 A;  1IJ5 A;  4O4L E;  4N78 D;  5AFU L;  4GOU A;  3RC8 A;  3MK7 C;  1BR1 A;  3I1A A;  2DNX A;  5HYA A;  2BDE A;  2X9Y A;  4L9I A;  4UF0 B;  1BR0 A;  2NWB A;  3MJX A;  4X1K E;  5JRC B;  3CQX C;  2IC6 A;  3C4W A;  3F31 A;  3JC6 C;  4PK5 A;  4ZI2 C;  4I55 E;  4AKG A;  3PUS A;  3H3A A;  4C90 A;  5LNK A;  2EHO A;  4OHF A;  1MMA A;  4EAH A;  1G8X A;  3AVR A;  4PJN A;  5KMG P;  3HKC E;  4TV8 E;  4AI6 A;  5LBM A;  3KBT A;  2PG8 A;  4K0U A;  5CA1 E;  3CX6 B;  1ZEE A;  2K48 A;  4ZOL E;  4ZHQ E;  2CXD A;  4U72 A;  4UVB B;  2XUE A;  3AVS A;  4PNI A;  5LCY A;  2A2F X;  3O1H A;  3Q2M A;  3FHN A;  4O2B E;  3O1J A;  3AA1 B;  4MLK A;  4OFZ A;  5J2T E;  4WW0 A;  1D0Y A;  4EB6 E;  4TN7 B;  4H9N C;  2KWH A;  3KVA A;  2VL8 A;  2XAQ B;  2N2N A;  4O8S A;  5LGT B;  5FMN A;  4XAX B;  2LSJ A;  5CA0 E;  2ZM8 A;  2NTX A;  2IW5 B;  2JQQ A;  2CLY C;  2X67 A;  3I9W A;  5IHY A;  2CWY A;  3GN5 B;  3VKG A;  2ZMA A;  1U4Q A;  2EHO B;  3KVB A;  4OYK A;  3O4X E;  1S94 A;  2KZ7 B;  4X1I E;  1HCI A;  2NW8 A;  3VKH A;  4O2A E;  3N9O A;  2LOP A;  1HFA A;  4HEA A;  4WNK A;  2RP4 A;  4ANJ A;  1BR4 A;  1D0Z A;  3ZCJ A;  2J1D G;  2B1E A;  2QA7 A;  4JLE A;  2C5K T;  4GK5 E;  3FBZ A;  4IIJ E;  2Q9Q D;  2WM9 A;  3H37 A;  2UXX B;  2X9W A;  2C5J A;  3I0Q A;  2XAH B;  4ADZ A;  1ZV4 X;  3NZP A;  5M4Y A;  2NP9 A;  3LG7 A;  4TX5 A;  4UV9 B;  5ETW A;  1G73 A;  3VHL A;  2HH7 A;  2WWU A;  3KIN B;  5FYM A;  4CXX A;  3IHR A;  2VK9 A;  2IAK A;  2DHR A;  3AAE B;  4H63 V;  4UIG A;  3AB3 B;  1O3X A;  4GK0 E;  4ISS A;  1HS7 A;  3C4Z A;  2A3D A;  3CVR A;  2ES0 A;  2M67 A;  4PW8 A;  5EK2 A;  3HKD E;  2XQY A;  2N9D A;  4JEU B;  3L09 A;  4UXN B;  3RH3 A;  3ZMV B;  5GON E;  2V7J A;  3A5X A;  1S35 A;  5H6R B;  1QUU A;  5LOV E;  4C91 A;  2W61 A;  5LXT E;  2K9A A;  2L9Q A;  1LVK A;  5JR9 C;  1YD8 G;  2VAS A;  1IZN B;  3PDY A;  2VB6 A;  1HTJ F;  4EYU A;  1OXZ A;  2LE8 A;  5LHI B;  2EHO C;  4DO0 A;  2JPF A;  3ESL A;  3CPZ A;  5LGU B;  2BZB A;  4FI5 A;  3KV6 A;  2CCQ A;  4MHC A;  2X66 A;  3LBX A;  3W15 B;  4PFP A;  4U74 A;  3EVY A;  1Y64 B;  2V26 A;  1MIY A;  4H9P C;  2E9X D;  2JMK A;  5JRE A;  3BQI A;  3AA0 B;  1LVF A;  5DAB A;  3UFE A;  2D5U A;  2NW9 A;  2V7L A;  4IDZ A;  3KV5 A;  4DBR A;  5HXR A;  3T8O A;  4UEM A;  2Q9Q B;  4ZS3 A;  4MBQ A;  2DWK A;  4AQF A;  4UV8 B;  5JDF A;  4HKA A;  5BMV E;  4BJN A;  3RKO A;  5JDQ A;  5L3E B;  3CKD A;  4B6X A;  4MAL A;  3U78 A;  4H9R C;  2C0S A;  3DTO A;  2XTL A;  4I50 E;  4H9S E;  2BVL A;  3EDU A;  4HE8 A;  4KP3 C;  4ZI7 E;  1YKH B;  2VWA A;  4ZS2 A;  4QWN B;  4PJM A;  2WBL A;  5JDG A;  5JRC A;  4O4I E;  2XAF B;  3PUR A;  2XAJ B;  3OBV E;  5JR9 B;  2LM9 A;  3C98 B;  1CUN A;  1D1C A;  2W0G A;  3E0Z A;  5TAO A;  3ZYL A;  4DMW A;  4G2A A;  3R6N A;  4NUU A;  3EUH A;  2NW7 A;  4L5G A;  3UT5 E;  4Z8X A;  4IE0 A;  4DND A;  3ZLI A;  4BA9 A;  5FP3 A;  5JH7 E;  4JEH B;  3UUN A;  4GIW A;  3HA4 A;  2E9X A;  4X1Y E;  3SRZ A;  4GYR A;  2HPL A;  4IHJ E;  3ZJ1 A;  3K3N A;  4HTE A;  4DVD A;  2OA5 A;  1QSD A;  3PTR B;  3C51 A;  4HFV A;  5JDH A;  4UF0 A;  5FXZ A;  1LRZ A;  3ETU A;  2YK0 A;  4O4H E;  4YFS A;  1YKE B;  3LBX B;  3PE0 A;  3V5U A;  5C8Y E;  3I9Y A;  5ADX L;  3GMI A;  2X51 A;  4AKH A;  2Q9Q C;  4PK6 A;  5JVD E;  4PAG A;  1HX8 A;  3MZK B;  4CXW A;  3RX6 A;  4AQF C;  5LGN B;  1BR2 A;  5LJN A;  2MOZ A;  3K8P C;  4PFO A;  2ACX A;  3HKE E;  2PBI A;  1D1B A;  1WLX A;  2V7K A;  2XHE B;  2L8K A;  1WYB A;  3ONX A;  4QXH B;  3ZN0 B;  4IE4 A;  5H6Q B;  2LT3 A;  5FY7 A;  4EZ4 A;  2X9H A;  3Q5X A;  4EXT A;  1SA0 E;  4EOZ B;  2DCF A;  2Y8D A;  5DQW A;  5L2L A;  2X68 A;  4QXC B;  2KLQ A;  3N2K E;  1NAF A;  2V7I A;  5L3G B;  2G0U A;  3CX7 B;  2VKH A;  4TZ4 C;  5JDL A;  3KV9 A;  3LK2 B;  1LKX A;  3NBX X;  4WBO A;  5LYJ E;  3ZC0 A;  4CI3 B;  3C4X A;  2BVM A;  3N2O A;  1KNZ A;  3N5L A;  2YU2 A;  4GYS A;  4PJJ A;  2W63 A;  5LA6 E;  2ZM0 A;  5LP6 E;  5FNV E;  2D0T A;  2VKO A;  3N9L A;  4P0B A;  5L3D B;  2LHR A;  5FXV A;  3EDV A;  5E0O A;  1UX4 A;  1ZHC A;  2VKJ A;  2V7M A;  3Q5W A;  5DJQ C;  2ZLY A;  1HG2 A;  1WYC A;  4BJM A;  1T98 A;  3RYI E;  4JUY A;  3GA8 A;  5HXE A;  5DQV A;  3ZYK A;  2A72 A;  2NOX A;  4KUM B;  5JQG E;  3B57 A;  2H3R A;  2VKD A;  4H9O C;  2LSK A;  2WAU A;  4AQG A;  2YEV C;  2CXL A;  2X9X A;  1Z0P A;  4UEL A;  2D2S A;  4PJL A;  4IE5 A;  3AAA B;  4HN9 A;  4KMC A;  3WAJ A;  5J2U E;  3KBU A;  1H7C A;  3OYX A;  4QXB B;  3CML A;  2LOS A;  5HAX A;  5JDN A;  2EHO D;  4DBQ A;  3ZCI A;  2KND A;  3CQC B;  3N9P A;  2LHN A;  5FY1 A;  2Q9Q A;  5EK4 A;  1IJ6 A;  3MA9 A;  3HKB E;  4E7Z A;  1MMD A;  3LJC A;  3IEE A;  1FMW A;  5J1G A;  1D0X A;  3CX8 B;  4EYY R;  4ZI3 C;  3N9Q A;  3F2E A;  3RPU A;  3U3I A;  4E7S A;  5KX5 E;  2KWI B;  1SHZ C;  3N9N A;  1UCU A;  1B7T A;  3DJB A;  3ZMU B;  2HPJ A;  2Y48 B;  5HWX A;  3ZMS B;  4H9Q C;  4CZZ B;  3LK4 2;  1YW0 A;  2GK9 A;  3ANW A;  4EZH A;  5LHH B;  2CXF A;  3HR0 A;  4XZC A;  2CM0 A;  4FJO A;  4IGU A;  5F3J A;  1FEW A;  2W62 A;  3ETV A;  4IE7 A;  4P09 A;  3O1I A;  3S4U A;  4O4J E;  3ZMZ B;  3UUM A;  4M1P A;  4PK4 A;  3BQL A;  2QGS A;  2SPC A;  2X0L B;  2YU1 A;  1AJ3 A;  1FMV A;  3NRX A;  2ODU A;  3M65 A;  3Q9D A;  3OJA A;  1NWM X;  1MND A;  2UXN B;  1MIV A;  3VU7 H;  3ZYM A;  4H63 H;  5L3B B;  3ZMT B;  5KDM C;  2C5I T;  2LSI A;  3PUQ A;  5EZY E;  5A1L A;  1IAP A;  5FXW A;  2WMO A;  3UUL A;  3FXD B;  3WAK A;  5LG4 A;  3QK6 A;  2DWG A;  3GWH A;  3GN5 A;  3N9M A;  4IST A;  2WMN A;  2CMR A;  5HXS A;  4CXY A;  3QC9 A;  2XAS B;  3RC3 A;  4AKL A;  3NRY A;  3R84 B;  3RYC E;  3LFM A;  3ZN1 B;  3MAC A;  4EIW A;  1ZKE A;  2KT9 A;  5CB4 E;  2H7O A;  3OKQ A;  4ZI2 D;  1WR6 A;  2JMH A;  4ZI3 D;  2D0U A;  2JJ9 A;  2W00 A;  4IE6 A;  2E9X B;  3L3P A;  4A56 A;  4P0A A;  4UVA B;  2XAG B;  4J2C A;  2N1G A;  5LHG B;  3AA7 B;  3ZEF B;  3F57 A;  2MBG A;  2LSG A;  1WRD A;  3PUG A;  4DMV A;  3KDS E;  3DP7 A;  2DLR A;  1VRB A;  1HG5 A;  4X20 E;  3RRW A;  2IC9 A;  4BAY B;  2E9X C;  3QUJ A;  3IBP A;  2V1D B;  1OWA A;  5LBQ B;  3PUA A;  5JR9 A;  2Z6E A;  3E08 A;  1MNE A;  2CWO A;  3FB2 A;  3RRC A;  5HXH A;  5HWY A;  2CEA A;  5FXX A;  4MFR A;  2P9B A;  4NUV A;  3ZC1 A;  4ASK A;  2K24 A;  5FY0 A;  3SOL A;  3LK3 B;  1UX5 A;  3K3O A;  3UTK A;  4HGA A;  3FBL A;  5F8P A;  1FIO A;  3AA6 B;  4KBM B;  4YLH A;  4ERR A;  3OYZ A;  3AAI A;  4UVC B;  3JC6 D;  4YHJ A;  1MIW A;  4F6R C;  2CA5 A;  4OK0 A;  3RYH E;  4V1A v;  3BK9 A;  2ODV A;  3CQG B;  2PJQ A;  4OYJ A;  4YJ3 E;  1KK7 A;  5LJM A;  2LJL A;  3PU8 A;  5JDM A;  4XBF B;  4QX7 B;  3ZJ2 A;  1MMN A;  4AXP A;  3NZQ A;  2I59 A;  2KMF A;  4I4T E;  3N2G E;  2ZM2 A;  3P7I A;  4QX8 B;  3RYF E;  2LEH A;  3PU3 A;  3P8C D;  3E22 E;  3SWH A;  3CWZ B;  5L3C B;  3MXZ A;  1EZ3 A;  4CI1 B;  2LSY A;  1MMG A;  5IYZ E;  3MKD A;  2K5B B;  3FXE B;  3HI2 A;  3IF8 B;  3KV4 A;  3UUX B;  3J7Y q;  4G63 A;  3C50 A;  3D0T A;  2Y6X A;  3KFW X;  3SS1 A;  5L3F B;  3J9X 1;  2DI4 A;  2JRK A;  4CI2 B;  4YJ2 E;  3K3Q C;  4I43 B;  1X79 A;  3C64 A;  2KXP B;  4QKN A;  2H7V C;  4TUY E;  4AKI A;  3V5S A;  1E1H B;  1HF8 A;  1US7 B;  2E8I A;  2PFV A;  2CE7 A;  4QHO A;  1V9D A;  4AKR B;  4L0R A;  4TV9 E;  2WSS V;  3B13 A;  3BQK A;  3TKL B;  2MTQ A;  2KIN B;  1VOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...