4GIWA

Crystal structure of the run domain of human nesca
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
179
Chain Sequence
QKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLMYMPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUN and SH3 domain-containing protein 1
publication title Crystal structure and functional implication of the RUN domain of human NESCA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4giwA00
2DWGA 2CXFA 3CWZB 4GIWA 2DWKA 2CXLA
chains in the Genus database with same CATH superfamily
1VOMA 4EYUA 2UUAT 3PTRB 3ABVA 4KBMB 2OV9A 4GOUA 5ABHA 3M65A 4WYVA 3C4XA 3ZT5A 2KWIB 1FJGT 3MKDA 3H37A 1D0ZA 1OEDC 5AQMB 2VKJA 2IDOB 1Z8UA 3HKEE 1T98A 2H7VC 3FZFB 2FJBA 1HX8A 2LHNA 4ISSA 4DR4T 2NTYA 3EUHA 1CHUA 3N9MA 4LFBT 5JR9B 5IHYA 5FY0A 2BKNA 1YQ3A 2LSYA 3V5UA 2YU2A 5L47A 1IAPA 5IUXA 3FZHB 4OYJA 5LJMA 1SE7A 1UCUA 2WDVA 2N9DA 2V6XA 5H6RB 1B7TA 2DWKA 1U5PA 1R8IA 5AQSB 3KVBA 5ETWA 4QXBB 2IC6A 4EEDA 3PV0F 4AKRB 3CX6B 2CE7A 2JMHA 2FJDA 3RF1A 3AE3A 3LG7A 2JQQA 5FKYA 5IWAT 2IHR1 4UV8B 3AB3B 3GMIA 5DQVA 1HCIA 5KDMC 4YXDA 1HF8A 3Q2MA 3QC9A 3P4WA 4DR1T 1UX5A 2LOPA 1HG5A 4YSXA 1JNZA 4B3MT 4PJNA 2D0TA 1U4QA 3AAIA 3JCFA 5EK4A 1XWMA 2YKSA 2YDSA 2A2FX 1BR2A 4DV5T 4AXPA 1IJ5A 2YDRA 3ZJ1A 4X64T 3RC3A 3TKLB 4DV1T 3HKDE 5J2TE 4PJMA 5HEHA 3RKGA 1XNQT 1M7KA 4IDZA 3IA3A 5FXWA 5HYAA 4A56A 2D2SA 4AQFA 2KZ7B 3ZMUB 3LJCA 3D0TA 5BMVE 4EZHA 2LSGA 1E1HB 3PUAA 3SS1A 5L3BB 3UT5E 4E7SA 2AXDS 2NR4A 3ANWA 1J5ET 5AQQB 2BG9B 2HN2A 2XAFB 3MJXA 1BR1A 2NWBA 4X1KE 2KNDA 4GYRA 3AECA 1MIWA 3ZMTB 4EXTA 5HWXA 2MBGA 2WCAA 4K0KT 1KFYA 3PJAJ 5JDQA 3ZCJA 3LFMA 3O9XA 4DO0A 2VL8A 4ZZBA 3RHWA 3EDUA 5JDMA 3QNUA 5CA1E 3UQ4A 3AA1B 4BAYB 2WB5A 2H88A 5AQLB 2J4GA 2IUBA 4U72A 3N9NA 4CZZB 4DV2T 2V5DA 2VVNA 1IBLT 4X62T 3N2OA 2LRKA 4ZI2C 3P8CD 3RRCA 3LDQB 4EOZB 4DUYT 4I55E 2FJEA 5C2TA 4DR2T 3ZPOA 4C90A 4U2YA 2CRBA 2WMOA 5HEGA 4PK5A 4LMKA 3N2GE 5F3JA 4AKHA 4QHOA 2CHNA 1V9DA 2V26A 5LBMA 4TNWA 2BVMA 4CN6A 3F2EA 4ILBA 2ZM8A 4O4JE 2Q9QC 4DVDA 2H89A 2W61A 1HS7A 3P4QA 2NTXA 2VQET 3QK6A 5EK2A 4NXMT 1MMNA 5L3EB 2BG9C 3JC6C 3AEAA 1KF6A 3IBPA 4WW0A 4QH5A 4KX6A 4JLEA 3VR8A 2XQ9A 3AA7B 3AE7A 4LF5T 4QWNB 3TLUA 5CB4E 2LEHA 5FY7A 5AQUB 4ZI7E 5FNVE 3KV5A 3FB2A 5F8PA 1JNRA 1OEDE 4DBQA 2VKOA 3NRXA 1IJ6A 2V7MA 2ODVA 3HR0A 2LJLA 4A5XA 3AEEA 5FMNA 1YD8G 4HN9A 1J1JA 4JEUB 3TLWA 2EHOB 5LMNT 3RIUA 4TNVA 2JPFA 1ZP0A 3SRZA 2Z6EA 4WZXA 3L39A 3UQ7A 3HI2A 2XQ7A 2KINB 3C4WA 2G0UA 2LKHA 3OPCA 1WRDA 2PG8A 4BJMA 4UR9A 3OYZA 5HXCA 3NWIA 5FXXA 2W4XA 3GN5B 2QGSA 3UU5A 1Y01A 2LSIA 3FXDB 2XAQB 5HXRA 4PFPA 3P4SA 1VRBA 4DV4T 2H7OA 2W00A 2XQAA 2C5JA 2WZHA 3PU8A 2XQ4A 2ODUA 4B3TT 2Y48B 1YKEB 4F8HA 1EZ3A 2AE9A 1NAFA 4PAGA 1XMOT 4ERRA 2NW9A 1XDPA 3ZC0A 5JRCA 4LFAT 1NENA 4KUMB 3HKBE 2V8SV 5FVKA 1UGOA 4QH4A 3RYCE 3I9WA 2ACZA 4KHZF 4YY3T 1W09A 4PW8A 4ZS2A 2LKGA 2BKOA 3IF8B 3ZT7A 5FY1A 4HWFA 2X9HA 1N34T 4OX9T 2EHOC 3UTKA 3ZEFB 3U3IA 1FEWA 4DMVA 1KNZA 4M1PA 1I94T 3O1IA 4JYAT 3HA4A 3ZSTA 1HX1B 3PE0A 3ZKRA 2BS4A 4IE7A 2WWVA 5DJQC 2KXPB 5LG4A 4IE5A 5LCYA 3CX8B 2UUBT 2I59A 3SFDA 1XDOA 4P1NA 1BR4A 3ONXA 2HH7A 3PURA 3K3NA 3KV4A 4GKKT 5AQJB 3Q5XA 2LOSA 1E7PA 2W66A 5AQIB 3ZC1A 3C50A 2M6IA 3P50A 4YTMA 4H63V 4O4IE 4CI1B 2E5VA 2A9UA 3OYXA 2D0UA 2X67A 2L8KA 4TWFA 4X66T 1LRZA 3K3QC 5LG3A 4HKAA 4UVAB 1XNRT 4DV6T 3ZMVB 4H9QC 1YQ4A 3R6NA 4O4LE 2YINA 2V7JA 2V7KA 3N2KE 1N32T 3ZMSB 4H9SE 4WNKA 2BKPA 2WM9A 4ILCA 2JMKA 5AQPB 4NXNT 2E5LT 1WLXA 4G2AA 2IW5B 3OVUA 5FL0A 2MPKA 5ABGA 1UX4A 2LM9A 3E08A 4KMCA 5AQNB 2YK0A 3FBZA 3J7Yq 5ADXL 1XZYA 3A7MA 4IDPA 2XSAA 3UU6A 4LF7T 2BG9E 4LFCT 4CI3B 5HEJA 4CQIA 1M62A 3ONJA 5F5WA 1KNRA 5HCJA 4BJNA 4XZCA 2PBIA 2RPAA 3ANWB 4EV6A 3QB5A 2VK9A 3KBUA 3PUGA 3RYHE 3JC6D 5LGUB 4AI6A 4DUZT 4HFVA 4PJJA 1UURA 3CQXC 4H9RC 1ZKEA 3AE9A 3AE5A 3NZQA 3UUXB 4JEHB 5FXZA 3MK7C 3LBXB 1SHZC 4GIWA 3FZLB 4AKLA 3U78A 4ZOLE 5J1GA 2B76A 4JV5T 3CVRA 3P4RA 4B6XA 5JTGA 2X0LB 2XZEA 4KI0F 4O2BE 2XQ3A 3WAKA 4JI2T 2XASB 4IE0A 2JIWA 2VKDA 2ZM2A 5CFBA 2W2UA 2HHHT 4DV7T 4MFRA 5FVLA 2B1EA 3EVYA 2CWYA 3IEEA 4KP3C 5CJ5A 5JR9C 2BBHA 5J0ZA 4AQFC 2W0GA 3I9YA 4ISTA 2C0SA 3EI0A 4DMWA 1ZOYA 2JQ9A 4J2CA 2YDQA 3AXJA 3J9X1 4HTEA 3RYIE 4E7ZA 3N9QA 4P0BA 4HEAA 3B57A 1X9BA 5JDLA 4KHPT 3BQLA 4X20E 4ILAA 1Z0PA 2UXXB 2Y8DA 3C98B 3UU4A 2NP9A 4H9NC 1SA0E 1OXZA 2GK9A 2VKHA 2ZLYA 3AE2A 2ZMAA 5H6QB 2I6HA 3ZMZB 4ZI3C 4DBRA 3KBTA 2P9BA 3LBXA 1MIVA 2JQHA 2LT3A 2LLYA 5DQWA 4CI2B 1WCRA 4B3ST 2N1GA 2IIUA 2IAKA 3L3PA 3N9LA 1N36T 3O1JA 2E9XD 2XM2A 1WFDA 2XM1A 4U31A 2UU9T 3PUYF 3VRAA 2X9XA 3ZLIA 5HXEA 4JI4T 3VR9A 3O4XE 5DABA 5AQTB 4UXNB 2WU2A 5JDNA 2VL0A 3EAMA 1HFAA 4DV3T 2CXLA 3NRYA 1FIOA 3I1AA 2X51A 1IBKT 2RP4A 3RH3A 2J47A 3PDYA 3PU3A 2VQFT 1VCSA 5L4HA 4PK4A 2CCQA 2XHEB 2Q9QA 3ESLA 5AQGB 5JRCB 2K24A 3MZKB 4G63A 2C5IT 3EABA 5JH7E 4ASKA 3FXEB 2SPCA 4GK0E 2NOXA 3RRWA 3F57A 2IC9A 2HPLA 3Q9DA 4UELA 1WYBA 4U7YA 2LM2A 2XAJB 3UUBA 3FZMB 5L3FB 3ZCIA 2J1DG 2L3LA 1CUNA 2DLRA 2MOZA 4DR7T 4JUYA 4UIGA 1LVFA 3LK2B 4X5TA 5LOVE 3ZT6A 2R6GF 3CKDA 2ZM6T 4COFA 3KDSE 3RPUA 4FJOA 4MBQA 3PUSA 2KSRA 2WMNA 3NZPA 2E9XB 2V7IA 4X65T 2W62A 3AE6A 4IE4A 4NPPA 3NBXX 2CMRA 5AQRB 2QVAA 2CBJA 2WBLA 3Q5EA 2V7LA 1UK5A 3T1YT 2BVLA 4WBOA 3Q5WA 4IIJE 4LMJA 3KFWX 2FJAA 4UEMA 3AE1A 4FI5A 1DU2A 3UU8A 3MA9A 3LSVA 3ONLC 2YU1A 4HWDA 3I0QA 1AJ3A 2M67A 4TZ4C 2WY2A 4JI5T 4ILUA 3PUZF 1D1AA 4MALA 2MAWA 4JI0T 4HFEA 2CWOA 2CLYB 3AE4A 3W15B 5C8YE 3DTOA 4CXWA 4MHCA 4IDOA 4U74A 3ZYMA 1XMQT 4TWHA 1L0VA 2BBJA 2BZBA 3NVOA 2X0YA 2K9AA 4QX8B 4BA9A 4DR3T 5LGTB 3VKGA 2JRKA 3AAAB 5LJNA 2DI4A 4F6RC 2V1DB 3AAEB 3S4UA 1WR0A 4HWHA 2XTLA 2HN1A 3SFEA 5LHGB 3CMLA 1T7SA 4L0RA 4UV9B 4GK5E 1G8XA 2UXCT 2UUCT 1LVKA 3QB5K 4HFIA 3UU3A 2Y6XA 2E9XA 3EDVA 3CPZA 4Z91A 5E0OA 1Y64B 5HCMA 2X0HA 4AIUA 4YT0A 5IYZE 3ETUA 1WR6A 2K3WA 1HTJF 4Z8XA 3O1HA 3M3ZB 4MLKA 3RYFE 3AE8A 4HWCA 4YTNA 4JI3T 5ABFB 1ZHCA 3T8OA 3HL6A 3ZYLA 3RI5A 5CA0E 3OJAA 3VU7H 4IL4A 5HEUA 3JADA 5AFUL 3RIFA 3RIAA 1X79A 2YOEA 4CXXA 1ZEEA 4YTPA 2D5UA 2XAGB 3EHZA 2LE8A 3C51A 2LHRA 3L09A 3K8PC 1UUSA 4TX5A 2E8IA 4YLHA 1ZV4X 3WI3A 1MMAA 3ETVA 2WQYA 4P09A 3KVAA 4YJ2E 5LNKA 4K0UA 4ADZA 5EZYE 3ZYKA 2XPKA 4ZI2D 3AEBA 4O4HE 4X1YE 2PJQA 5LHIB 5ABEA 2LSJA 3CQCB 2KWHA 1WYCA 2KMFA 2CHOA 1OEDA 5HAXA 1I6ZA 4UF0A 5AQHB 3AXJB 4NIQA 5KXJA 2PFVA 2YEVC 4V1Av 3UUNA 1YW0A 2BDEA 2CBIA 2Q9QD 1BR0A 1OWAA 3GWHA 2V6YA 4TV9E 1MMDA 1HNXT 3RQWA 2W63A 3B5MA 3UFEA 3RGLA 3AEGA 5ABFA 2ZM0A 5L2LA 2XUEA 5GONE 4IDQA 2RA1A 2C5KT 3PJAA 4AQYT 3LK42 3A8YC 1HNWT 4NUVA 2VVSA 3P4PA 2QRXA 4IGUA 1MNEA 4TV8E 3TLTA 3AVRA 2WWUA 4U33A 4H9PC 5L3CB 3VRBA 2VB6A 3AA6B 3K3OA 3LK3B 4ZEYA 2K48A 2WP9A 5LGNB 1D1CA 3OKQA 3OBVE 4X1IE 5LA6E 3C4ZA 1SUMB 3CQGB 2WS3A 4CXYA 1J5WA 2UXNB 4IL9A 4TN7B 4H9OC 4U2ZA 2X9WA 4A98A 5A1LA 2KT9A 2K5BB 2DCFA 4I43B 3FHNA 2X9YA 2X68A 2H3RA 2FBWA 5JDHA 2MYSA 4JBWF 3PUQA 3BQIA 4Z90A 4JI8T 5EK3A 5M4YA 2UXDT 2WSSV 5JR9A 2XSBA 5LBQB 2I0MA 5L4EA 3JAFA 2DNXA 4ZS3A 4TWDA 3QUJA 2CXDA 2VURA 1HNZT 4CN4A 4XAXB 2L9QA 2Q9QB 2A3DA 1HG2A 4Q25A 3BK9A 4OYKA 4TUYE 3CK6A 2UXBT 3TLSA 3H3AA 1NWMX 3H3MA 5AQFB 3A5XA 1FMVA 2XQ6A 5AQOB 3ZJ2A 3PUVF 4H63H 2XQYA 4YSYA 1QLBA 3OTOT 3GA8A 4IT4A 4I0UA 4HWIB 2J62A 2XJ7A 4YFSA 4U3CA 4N78D 4UVBB 4GKJT 3C64A 1GQEA 3FZKB 4DR6T 2VWAA 1MIYA 4AKIA 2FUPA 1N33T 2EHOD 2OLTA 4L9IA 5TAOA 4IDNA 2VASA 3T1HT 3RLFF 4LMLA 2MTQA 5LHHB 1IBMT 4LF8T 1W0AA 4C91A 5L3GB 4HE8A 5HEOA 3MXZA 5CGMA 4OHFA 3QOFA 4QX7B 3PUXF 2HPJA 1G73A 2ES0A 2DWGA 4L5GA 4ANJA 1W0BA 2YN6A 4LF6T 2LRLA 5HWYA 4AISA 4WBNE 1KNPA 3AEDA 5JVDE 4QH1A 3K1SA 4HFCA 2V5CA 3ZN1B 4B3RT 2OA5A 1HR0T 4DIDB 2BS2A 4I50E 2CA5A 3X1DA 5FYMA 2WU5A 2BG9A 1D1BA 3SWHA 2WZIA 4YHJA 4EEBA 4DV0T 4JI6T 4QXHB 3Q5DA 3UFGA 3IHRA 4PNIA 5HXSA 4ZZCA 1US7B 3I0OA 4YSZA 2CPTA 3RC8A 2BS3A 2CM0A 2WAUA 4EIWA 3RIUC 2QYWA 1S35A 3KV6A 4LF9T 1QSDA 4JI1T 4I4TE 1MMGA 3NKZA 5FP3A 5BR8T 1LKXA 5C3JA 5HXHA 3FBLA 2N2NA 4IREA 4HFHA 2XQ5A 5LMUT 4XBFB 2WDQA 3AEFA 1D0YA 3JAEA 5JDFA 3UUMA 4QXCB 2DHRA 3AVSA 3DP7A 1VCTA 3KV9A 1H7CA 1D0XA 4QKNA 2D9DA 3DJBA 2XQ8A 5LP6E 3TLVA 2KLQA 3CWZB 2PTFA 2XAHB 2E2AA 5JDGA 1YKHB 1KEYA 4OFZA 4DR5T 3V5SA 4HFBA 3N5LA 1E2AA 3SOLA 4GYSA 3UULA 5KMGP 2F4VT 4NUUA 2A72A 2M6BA 2LSKA 4EB6E 4PK6A 5FXVA 3ZN0B 1QUUA 4P0AA 4HFDA 4ZXLA 4EZ4A 4AQGA 5LYJE 4O8SA 3CX7B 3MACA 1NEKA 2NW7A 3N9OA 3E22E 1MNDA 3ZSSA 2IMLA 3RX6A 3CIRA 2E9XC 2DL1A 4PFOA 2CEAA 5LXTE 3RKOA 2QA7A 5J2UE 5LB7B 1OEDB 2EHOA 2XY8B 3AA0B 5AQVB 1YXRA 4UF0B 5AQKB 4O2AE 3L8RA 3VHLA 3N9PA 1W9RA 5JREA 2X66A 3HKCE 4HGAA 3G06A 4CN1A 2NW8A 2WDRA 4LF4T 4DNDA 3E0ZA 4EYYR 5FL1A 2V6YB 5JQGE 3WAJA 3BQKA 3B13A 3F31A 4ZHQE 5KX5E 1O3XA 4AKGA 4YHHT 3GN5A 2JQKA 4EAHA 3R84B 3VKHA 3P7IA 4UVCB 2CLYC 4IE6A 2ACXA 2W67A 1FMWA 3PUWF 3RQUA 3KINB 2JJ9A 4A97A 1T8BA 4ZI3D 4JI7T 1T72A 4YJ3E 5L3DB 2CXFA 4U7IA 1IZNB 4EGWA 1S94A 4IHJE 4OK0A 1KK7A 4PJLA
chains in the Genus database with same CATH topology
2K5BB 1VOMA 2DCFA 2Y48B 4I43B 1YKEB 4EYUA 2CXLA 2X9YA 3FHNA 1EZ3A 3NRYA 1NAFA 1FIOA 4PAGA 4ERRA 3I1AA 2NW9A 2X68A 2H3RA 3PTRB 2X51A 4KBMB 5JDHA 2RP4A 2MYSA 4GOUA 3ZC0A 5JRCA 3RH3A 3PUQA 3M65A 3PDYA 3PU3A 3BQIA 3C4XA 5EK3A 5M4YA 4KUMB 2KWIB 3HKBE 2WSSV 4PK4A 5JR9A 2CCQA 3MKDA 3H37A 3I9WA 3RYCE 5LBQB 2XHEB 1D0ZA 2Q9QA 2VKJA 4PW8A 3ESLA 2DNXA 1T98A 3HKEE 4ZS2A 5JRCB 2H7VC 1HX8A 2K24A 2LHNA 4ISSA 2NTYA 3EUHA 4ZS3A 3QUJA 2CXDA 3MZKB 3N9MA 3IF8B 4G63A 4XAXB 5JR9B 5IHYA 2C5IT 5FY1A 5FY0A 5JH7E 4ASKA 2L9QA 3FXEB 2SPCA 2LSYA 2X9HA 2Q9QB 3V5UA 2A3DA 2YU2A 1HG2A 4GK0E 2NOXA 2EHOC 3RRWA 3UTKA 3F57A 3ZEFB 3BK9A 4OYKA 3U3IA 1IAPA 2HPLA 2IC9A 3Q9DA 4TUYE 4UELA 1WYBA 3H3AA 1FEWA 2XAJB 1NWMX 4OYJA 5LJMA 4DMVA 5L3FB 1KNZA 3A5XA 1FMVA 4M1PA 1UCUA 3O1IA 3ZCIA 2J1DG 2L3LA 1CUNA 3HA4A 2N9DA 3ZJ2A 2DLRA 3PE0A 2MOZA 5H6RB 1B7TA 2DWKA 4H63H 1U5PA 2XQYA 4JUYA 4IE7A 5DJQC 3KVBA 4UIGA 5ETWA 2KXPB 5LG4A 4IE5A 3GA8A 1LVFA 3LK2B 5LCYA 5LOVE 3CX8B 4QXBB 2I59A 2IC6A 3CKDA 3KDSE 1BR4A 4YFSA 3RPUA 4N78D 4AKRB 3CX6B 3ONXA 4UVBB 2CE7A 2JMHA 3C64A 4FJOA 2HH7A 4MBQA 3PURA 3K3NA 3PUSA 3KV4A 3Q5XA 2WMNA 2LOSA 3NZPA 2E9XB 2V7IA 2W62A 3LG7A 2JQQA 2VWAA 4IE4A 3NBXX 2CMRA 4UV8B 1MIYA 2WBLA 3AB3B 2V7LA 4AKIA 3GMIA 5DQVA 1HCIA 3ZC1A 2EHOD 3C50A 5KDMC 4L9IA 2BVLA 1HF8A 3Q5WA 4IIJE 4WBOA 5TAOA 3Q2MA 2VASA 4H63V 3QC9A 4O4IE 4CI1B 3KFWX 4UEMA 3OYXA 1UX5A 2LOPA 2MTQA 5LHHB 1HG5A 2D0UA 4FI5A 2X67A 2L8KA 1LRZA 3K3QC 4PJNA 4C91A 2D0TA 3MA9A 4HKAA 1U4QA 4UVAB 5L3GB 3AAIA 5EK4A 2YU1A 4HE8A 3I0QA 1AJ3A 3MXZA 2M67A 4H9QC 2A2FX 1BR2A 4TZ4C 4OHFA 3ZMVB 3R6NA 4O4LE 2YINA 2V7JA 4AXPA 2V7KA 4QX7B 3N2KE 4ILUA 2HPJA 1G73A 1IJ5A 1D1AA 2ES0A 2DWGA 3ZJ1A 4MALA 3RC3A 3ZMSB 4L5GA 4ANJA 4H9SE 3TKLB 4WNKA 2CWOA 2WM9A 3HKDE 2CLYB 5HWYA 5J2TE 4PJMA 2JMKA 4WBNE 5C8YE 3W15B 3DTOA 4CXWA 5JVDE 4MHCA 4U74A 4IDZA 1WLXA 3ZYMA 3ZN1B 4G2AA 2IW5B 5FXWA 2OA5A 5HYAA 4A56A 2D2SA 4AQFA 2KZ7B 2BZBA 3ZMUB 1UX4A 4I50E 2K9AA 3LJCA 4QX8B 4BA9A 2LM9A 3E08A 4KMCA 2CA5A 3D0TA 5BMVE 2YK0A 5LGTB 5FYMA 4EZHA 2LSGA 1D1BA 3SWHA 2JRKA 3AAAB 3FBZA 4YHJA 3VKGA 5LJNA 1E1HB 2DI4A 3PUAA 2V1DB 4F6RC 3AAEB 3SS1A 3S4UA 3J7Yq 5ADXL 5L3BB 3UT5E 4E7SA 4QXHB 2XTLA 5LHGB 3CMLA 4CI3B 3ANWA 4L0RA 4UV9B 3IHRA 4PNIA 5HXSA 3MJXA 2XAFB 1BR1A 4GK5E 2NWBA 1US7B 1G8XA 3I0OA 2KNDA 4GYRA 4X1KE 4CQIA 3RC8A 1MIWA 3ZMTB 2CM0A 4EXTA 1LVKA 2WAUA 2Y6XA 4EIWA 4BJNA 2E9XA 3EDVA 5HWXA 4XZCA 2MBGA 5LXTE 3CPZA 2PBIA 5E0OA 5JDQA 3ZCJA 3LFMA 1Y64B 3ANWB 1S35A 3O9XA 3KV6A 4DO0A 2VL8A 5IYZE 3ETUA 1QSDA 1WR6A 2VK9A 3KBUA 3EDUA 3PUGA 4I4TE 1HTJF 3JC6D 1MMGA 3RYHE 5JDMA 5LGUB 4Z8XA 3O1HA 5CA1E 4AI6A 5FP3A 4MLKA 1LKXA 3RYFE 5HXHA 3AA1B 3FBLA 2N2NA 4BAYB 4HFVA 4PJJA 3CQXC 4H9RC 1ZKEA 3UUXB 3NZQA 4U72A 3N9NA 4XBFB 1ZHCA 4JEHB 3T8OA 3HL6A 5FXZA 4CZZB 3MK7C 3LBXB 3ZYLA 1SHZC 5CA0E 3OJAA 4GIWA 3N2OA 4AKLA 1D0YA 3U78A 3VU7H 4ZOLE 5J1GA 5JDFA 3CVRA 4ZI2C 3UUMA 3P8CD 3RRCA 4B6XA 4QXCB 5AFUL 2X0LB 2DHRA 1X79A 3AVSA 4OK0A 4EOZB 4I55E 4O2BE 3DP7A 4CXXA 3ZPOA 3WAKA 2XASB 1ZEEA 4C90A 4IE0A 2WMOA 2VKDA 3KV9A 2D5UA 1H7CA 1D0XA 2ZM2A 2XAGB 4PK5A 4QKNA 3DJBA 2LE8A 3N2GE 5LP6E 5F3JA 4MFRA 4AKHA 4QHOA 2B1EA 2KLQA 3C51A 2LHRA 3L09A 3EVYA 1V9DA 3K8PC 3CWZB 2E8IA 2CWYA 2V26A 4TX5A 1ZV4X 2XAHB 4YLHA 5LBMA 5JDGA 3WI3A 2BVMA 1MMAA 3ETVA 3IEEA 4KP3C 4P09A 1YKHB 3KVAA 5JR9C 3F2EA 4OFZA 2ZM8A 4YJ2E 4O4JE 3V5SA 5LNKA 2Q9QC 3N5LA 4AQFC 4K0UA 4DVDA 2W0GA 3I9YA 4ISTA 4ADZA 3SOLA 2W61A 5EZYE 1HS7A 4GYSA 2C0SA 3UULA 5KMGP 2NTXA 3QK6A 4NUUA 2A72A 4DMWA 3ZYKA 2LSKA 5EK2A 1MMNA 4EB6E 4PK6A 5FXVA 3ZN0B 5L3EB 4J2CA 3JC6C 4ZI2D 1QUUA 4O4HE 3J9X1 4P0AA 4X1YE 2PJQA 5LHIB 4EZ4A 4HTEA 3RYIE 2LSJA 4AQGA 5LYJE 3CQCB 3IBPA 4E7ZA 4O8SA 3N9QA 3CX7B 4WW0A 2KWHA 4P0BA 1WYCA 4HEAA 3MACA 2KMFA 2NW7A 3AA7B 3B57A 3N9OA 3E22E 5JDLA 5HAXA 4QWNB 3BQLA 4X20E 1MNDA 5CB4E 4UF0A 1Z0PA 2LEHA 5FY7A 2UXXB 4ZI7E 2Y8DA 3RX6A 3C98B 5FNVE 3KV5A 2NP9A 3FB2A 2PFVA 1SA0E 4H9NC 5F8PA 2E9XC 4PFOA 2YEVC 1OXZA 4DBQA 2CEAA 2VKOA 4V1Av 2GK9A 2VKHA 3NRXA 2QA7A 3RKOA 3UUNA 1YW0A 2BDEA 5J2UE 1IJ6A 2Q9QD 1BR0A 2V7MA 2EHOA 1OWAA 2ZLYA 3AA0B 3GWHA 2ZMAA 4TV9E 1MMDA 2ODVA 4UF0B 4O2AE 5H6QB 3HR0A 3VHLA 2LJLA 5FMNA 3UFEA 2W63A 3N9PA 3ZMZB 1YD8G 5JREA 4ZI3C 4DBRA 2X66A 3HKCE 2ZM0A 3KBTA 4HN9A 2P9BA 4HGAA 5L2LA 3LBXA 2NW8A 2XUEA 1MIVA 4JEUB 5GONE 4DNDA 3E0ZA 2EHOB 4EYYR 2LT3A 5JQGE 3WAJA 2RA1A 3BQKA 3B13A 3F31A 5DQWA 2C5KT 4CI2B 2JPFA 4ZHQE 5KX5E 3SRZA 1O3XA 3LK42 4AKGA 2Z6EA 2N1GA 4NUVA 3GN5A 2IAKA 3HI2A 3L3PA 4IGUA 2KINB 1MNEA 3N9LA 3C4WA 4TV8E 4EAHA 3R84B 2G0UA 3VKHA 3O1JA 2E9XD 1WRDA 2PG8A 3AVRA 3P7IA 4UVCB 2WWUA 2CLYC 4BJMA 4IE6A 2ACXA 3OYZA 5HXCA 4H9PC 5L3CB 1FMWA 5FXXA 2X9XA 3GN5B 3ZLIA 2VB6A 3AA6B 3K3OA 3LK3B 2QGSA 3KINB 2JJ9A 2LSIA 5HXEA 3FXDB 2K48A 4ZI3D 2XAQB 5LGNB 3O4XE 5DABA 1D1CA 3OKQA 3OBVE 4X1IE 5HXRA 4YJ3E 5L3DB 4PFPA 4UXNB 2CXFA 5LA6E 1VRBA 5JDNA 2H7OA 1IZNB 3C4ZA 2W00A 3CQGB 2C5JA 4CXYA 2UXNB 3PU8A 1S94A 1HFAA 4TN7B 4H9OC 4IHJE 2ODUA 2X9WA 5A1LA 4PJLA 2KT9A 1KK7A 4JLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWG A;  2CXF A;  3CWZ B;  4GIW A;  2DWK A;  2CXL A; 
#chains in the Genus database with same CATH topology
 1VOM A;  4EYU A;  2UUA T;  3PTR B;  3ABV A;  4KBM B;  2OV9 A;  4GOU A;  5ABH A;  3M65 A;  4WYV A;  3C4X A;  3ZT5 A;  2KWI B;  1FJG T;  3MKD A;  3H37 A;  1D0Z A;  1OED C;  5AQM B;  2VKJ A;  2IDO B;  1Z8U A;  3HKE E;  1T98 A;  2H7V C;  3FZF B;  2FJB A;  1HX8 A;  2LHN A;  4ISS A;  4DR4 T;  2NTY A;  3EUH A;  1CHU A;  3N9M A;  4LFB T;  5JR9 B;  5IHY A;  5FY0 A;  2BKN A;  1YQ3 A;  2LSY A;  3V5U A;  2YU2 A;  5L47 A;  1IAP A;  5IUX A;  3FZH B;  4OYJ A;  5LJM A;  1SE7 A;  1UCU A;  2WDV A;  2N9D A;  2V6X A;  5H6R B;  1B7T A;  2DWK A;  1U5P A;  1R8I A;  5AQS B;  3KVB A;  5ETW A;  4QXB B;  2IC6 A;  4EED A;  3PV0 F;  4AKR B;  3CX6 B;  2CE7 A;  2JMH A;  2FJD A;  3RF1 A;  3AE3 A;  3LG7 A;  2JQQ A;  5FKY A;  5IWA T;  2IHR 1;  4UV8 B;  3AB3 B;  3GMI A;  5DQV A;  1HCI A;  5KDM C;  4YXD A;  1HF8 A;  3Q2M A;  3QC9 A;  3P4W A;  4DR1 T;  1UX5 A;  2LOP A;  1HG5 A;  4YSX A;  1JNZ A;  4B3M T;  4PJN A;  2D0T A;  1U4Q A;  3AAI A;  3JCF A;  5EK4 A;  1XWM A;  2YKS A;  2YDS A;  2A2F X;  1BR2 A;  4DV5 T;  4AXP A;  1IJ5 A;  2YDR A;  3ZJ1 A;  4X64 T;  3RC3 A;  3TKL B;  4DV1 T;  3HKD E;  5J2T E;  4PJM A;  5HEH A;  3RKG A;  1XNQ T;  1M7K A;  4IDZ A;  3IA3 A;  5FXW A;  5HYA A;  4A56 A;  2D2S A;  4AQF A;  2KZ7 B;  3ZMU B;  3LJC A;  3D0T A;  5BMV E;  4EZH A;  2LSG A;  1E1H B;  3PUA A;  3SS1 A;  5L3B B;  3UT5 E;  4E7S A;  2AXD S;  2NR4 A;  3ANW A;  1J5E T;  5AQQ B;  2BG9 B;  2HN2 A;  2XAF B;  3MJX A;  1BR1 A;  2NWB A;  4X1K E;  2KND A;  4GYR A;  3AEC A;  1MIW A;  3ZMT B;  4EXT A;  5HWX A;  2MBG A;  2WCA A;  4K0K T;  1KFY A;  3PJA J;  5JDQ A;  3ZCJ A;  3LFM A;  3O9X A;  4DO0 A;  2VL8 A;  4ZZB A;  3RHW A;  3EDU A;  5JDM A;  3QNU A;  5CA1 E;  3UQ4 A;  3AA1 B;  4BAY B;  2WB5 A;  2H88 A;  5AQL B;  2J4G A;  2IUB A;  4U72 A;  3N9N A;  4CZZ B;  4DV2 T;  2V5D A;  2VVN A;  1IBL T;  4X62 T;  3N2O A;  2LRK A;  4ZI2 C;  3P8C D;  3RRC A;  3LDQ B;  4EOZ B;  4DUY T;  4I55 E;  2FJE A;  5C2T A;  4DR2 T;  3ZPO A;  4C90 A;  4U2Y A;  2CRB A;  2WMO A;  5HEG A;  4PK5 A;  4LMK A;  3N2G E;  5F3J A;  4AKH A;  4QHO A;  2CHN A;  1V9D A;  2V26 A;  5LBM A;  4TNW A;  2BVM A;  4CN6 A;  3F2E A;  4ILB A;  2ZM8 A;  4O4J E;  2Q9Q C;  4DVD A;  2H89 A;  2W61 A;  1HS7 A;  3P4Q A;  2NTX A;  2VQE T;  3QK6 A;  5EK2 A;  4NXM T;  1MMN A;  5L3E B;  2BG9 C;  3JC6 C;  3AEA A;  1KF6 A;  3IBP A;  4WW0 A;  4QH5 A;  4KX6 A;  4JLE A;  3VR8 A;  2XQ9 A;  3AA7 B;  3AE7 A;  4LF5 T;  4QWN B;  3TLU A;  5CB4 E;  2LEH A;  5FY7 A;  5AQU B;  4ZI7 E;  5FNV E;  3KV5 A;  3FB2 A;  5F8P A;  1JNR A;  1OED E;  4DBQ A;  2VKO A;  3NRX A;  1IJ6 A;  2V7M A;  2ODV A;  3HR0 A;  2LJL A;  4A5X A;  3AEE A;  5FMN A;  1YD8 G;  4HN9 A;  1J1J A;  4JEU B;  3TLW A;  2EHO B;  5LMN T;  3RIU A;  4TNV A;  2JPF A;  1ZP0 A;  3SRZ A;  2Z6E A;  4WZX A;  3L39 A;  3UQ7 A;  3HI2 A;  2XQ7 A;  2KIN B;  3C4W A;  2G0U A;  2LKH A;  3OPC A;  1WRD A;  2PG8 A;  4BJM A;  4UR9 A;  3OYZ A;  5HXC A;  3NWI A;  5FXX A;  2W4X A;  3GN5 B;  2QGS A;  3UU5 A;  1Y01 A;  2LSI A;  3FXD B;  2XAQ B;  5HXR A;  4PFP A;  3P4S A;  1VRB A;  4DV4 T;  2H7O A;  2W00 A;  2XQA A;  2C5J A;  2WZH A;  3PU8 A;  2XQ4 A;  2ODU A;  4B3T T;  2Y48 B;  1YKE B;  4F8H A;  1EZ3 A;  2AE9 A;  1NAF A;  4PAG A;  1XMO T;  4ERR A;  2NW9 A;  1XDP A;  3ZC0 A;  5JRC A;  4LFA T;  1NEN A;  4KUM B;  3HKB E;  2V8S V;  5FVK A;  1UGO A;  4QH4 A;  3RYC E;  3I9W A;  2ACZ A;  4KHZ F;  4YY3 T;  1W09 A;  4PW8 A;  4ZS2 A;  2LKG A;  2BKO A;  3IF8 B;  3ZT7 A;  5FY1 A;  4HWF A;  2X9H A;  1N34 T;  4OX9 T;  2EHO C;  3UTK A;  3ZEF B;  3U3I A;  1FEW A;  4DMV A;  1KNZ A;  4M1P A;  1I94 T;  3O1I A;  4JYA T;  3HA4 A;  3ZST A;  1HX1 B;  3PE0 A;  3ZKR A;  2BS4 A;  4IE7 A;  2WWV A;  5DJQ C;  2KXP B;  5LG4 A;  4IE5 A;  5LCY A;  3CX8 B;  2UUB T;  2I59 A;  3SFD A;  1XDO A;  4P1N A;  1BR4 A;  3ONX A;  2HH7 A;  3PUR A;  3K3N A;  3KV4 A;  4GKK T;  5AQJ B;  3Q5X A;  2LOS A;  1E7P A;  2W66 A;  5AQI B;  3ZC1 A;  3C50 A;  2M6I A;  3P50 A;  4YTM A;  4H63 V;  4O4I E;  4CI1 B;  2E5V A;  2A9U A;  3OYX A;  2D0U A;  2X67 A;  2L8K A;  4TWF A;  4X66 T;  1LRZ A;  3K3Q C;  5LG3 A;  4HKA A;  4UVA B;  1XNR T;  4DV6 T;  3ZMV B;  4H9Q C;  1YQ4 A;  3R6N A;  4O4L E;  2YIN A;  2V7J A;  2V7K A;  3N2K E;  1N32 T;  3ZMS B;  4H9S E;  4WNK A;  2BKP A;  2WM9 A;  4ILC A;  2JMK A;  5AQP B;  4NXN T;  2E5L T;  1WLX A;  4G2A A;  2IW5 B;  3OVU A;  5FL0 A;  2MPK A;  5ABG A;  1UX4 A;  2LM9 A;  3E08 A;  4KMC A;  5AQN B;  2YK0 A;  3FBZ A;  3J7Y q;  5ADX L;  1XZY A;  3A7M A;  4IDP A;  2XSA A;  3UU6 A;  4LF7 T;  2BG9 E;  4LFC T;  4CI3 B;  5HEJ A;  4CQI A;  1M62 A;  3ONJ A;  5F5W A;  1KNR A;  5HCJ A;  4BJN A;  4XZC A;  2PBI A;  2RPA A;  3ANW B;  4EV6 A;  3QB5 A;  2VK9 A;  3KBU A;  3PUG A;  3RYH E;  3JC6 D;  5LGU B;  4AI6 A;  4DUZ T;  4HFV A;  4PJJ A;  1UUR A;  3CQX C;  4H9R C;  1ZKE A;  3AE9 A;  3AE5 A;  3NZQ A;  3UUX B;  4JEH B;  5FXZ A;  3MK7 C;  3LBX B;  1SHZ C;  4GIW A;  3FZL B;  4AKL A;  3U78 A;  4ZOL E;  5J1G A;  2B76 A;  4JV5 T;  3CVR A;  3P4R A;  4B6X A;  5JTG A;  2X0L B;  2XZE A;  4KI0 F;  4O2B E;  2XQ3 A;  3WAK A;  4JI2 T;  2XAS B;  4IE0 A;  2JIW A;  2VKD A;  2ZM2 A;  5CFB A;  2W2U A;  2HHH T;  4DV7 T;  4MFR A;  5FVL A;  2B1E A;  3EVY A;  2CWY A;  3IEE A;  4KP3 C;  5CJ5 A;  5JR9 C;  2BBH A;  5J0Z A;  4AQF C;  2W0G A;  3I9Y A;  4IST A;  2C0S A;  3EI0 A;  4DMW A;  1ZOY A;  2JQ9 A;  4J2C A;  2YDQ A;  3AXJ A;  3J9X 1;  4HTE A;  3RYI E;  4E7Z A;  3N9Q A;  4P0B A;  4HEA A;  3B57 A;  1X9B A;  5JDL A;  4KHP T;  3BQL A;  4X20 E;  4ILA A;  1Z0P A;  2UXX B;  2Y8D A;  3C98 B;  3UU4 A;  2NP9 A;  4H9N C;  1SA0 E;  1OXZ A;  2GK9 A;  2VKH A;  2ZLY A;  3AE2 A;  2ZMA A;  5H6Q B;  2I6H A;  3ZMZ B;  4ZI3 C;  4DBR A;  3KBT A;  2P9B A;  3LBX A;  1MIV A;  2JQH A;  2LT3 A;  2LLY A;  5DQW A;  4CI2 B;  1WCR A;  4B3S T;  2N1G A;  2IIU A;  2IAK A;  3L3P A;  3N9L A;  1N36 T;  3O1J A;  2E9X D;  2XM2 A;  1WFD A;  2XM1 A;  4U31 A;  2UU9 T;  3PUY F;  3VRA A;  2X9X A;  3ZLI A;  5HXE A;  4JI4 T;  3VR9 A;  3O4X E;  5DAB A;  5AQT B;  4UXN B;  2WU2 A;  5JDN A;  2VL0 A;  3EAM A;  1HFA A;  4DV3 T;  2CXL A;  3NRY A;  1FIO A;  3I1A A;  2X51 A;  1IBK T;  2RP4 A;  3RH3 A;  2J47 A;  3PDY A;  3PU3 A;  2VQF T;  1VCS A;  5L4H A;  4PK4 A;  2CCQ A;  2XHE B;  2Q9Q A;  3ESL A;  5AQG B;  5JRC B;  2K24 A;  3MZK B;  4G63 A;  2C5I T;  3EAB A;  5JH7 E;  4ASK A;  3FXE B;  2SPC A;  4GK0 E;  2NOX A;  3RRW A;  3F57 A;  2IC9 A;  2HPL A;  3Q9D A;  4UEL A;  1WYB A;  4U7Y A;  2LM2 A;  2XAJ B;  3UUB A;  3FZM B;  5L3F B;  3ZCI A;  2J1D G;  2L3L A;  1CUN A;  2DLR A;  2MOZ A;  4DR7 T;  4JUY A;  4UIG A;  1LVF A;  3LK2 B;  4X5T A;  5LOV E;  3ZT6 A;  2R6G F;  3CKD A;  2ZM6 T;  4COF A;  3KDS E;  3RPU A;  4FJO A;  4MBQ A;  3PUS A;  2KSR A;  2WMN A;  3NZP A;  2E9X B;  2V7I A;  4X65 T;  2W62 A;  3AE6 A;  4IE4 A;  4NPP A;  3NBX X;  2CMR A;  5AQR B;  2QVA A;  2CBJ A;  2WBL A;  3Q5E A;  2V7L A;  1UK5 A;  3T1Y T;  2BVL A;  4WBO A;  3Q5W A;  4IIJ E;  4LMJ A;  3KFW X;  2FJA A;  4UEM A;  3AE1 A;  4FI5 A;  1DU2 A;  3UU8 A;  3MA9 A;  3LSV A;  3ONL C;  2YU1 A;  4HWD A;  3I0Q A;  1AJ3 A;  2M67 A;  4TZ4 C;  2WY2 A;  4JI5 T;  4ILU A;  3PUZ F;  1D1A A;  4MAL A;  2MAW A;  4JI0 T;  4HFE A;  2CWO A;  2CLY B;  3AE4 A;  3W15 B;  5C8Y E;  3DTO A;  4CXW A;  4MHC A;  4IDO A;  4U74 A;  3ZYM A;  1XMQ T;  4TWH A;  1L0V A;  2BBJ A;  2BZB A;  3NVO A;  2X0Y A;  2K9A A;  4QX8 B;  4BA9 A;  4DR3 T;  5LGT B;  3VKG A;  2JRK A;  3AAA B;  5LJN A;  2DI4 A;  4F6R C;  2V1D B;  3AAE B;  3S4U A;  1WR0 A;  4HWH A;  2XTL A;  2HN1 A;  3SFE A;  5LHG B;  3CML A;  1T7S A;  4L0R A;  4UV9 B;  4GK5 E;  1G8X A;  2UXC T;  2UUC T;  1LVK A;  3QB5 K;  4HFI A;  3UU3 A;  2Y6X A;  2E9X A;  3EDV A;  3CPZ A;  4Z91 A;  5E0O A;  1Y64 B;  5HCM A;  2X0H A;  4AIU A;  4YT0 A;  5IYZ E;  3ETU A;  1WR6 A;  2K3W A;  1HTJ F;  4Z8X A;  3O1H A;  3M3Z B;  4MLK A;  3RYF E;  3AE8 A;  4HWC A;  4YTN A;  4JI3 T;  5ABF B;  1ZHC A;  3T8O A;  3HL6 A;  3ZYL A;  3RI5 A;  5CA0 E;  3OJA A;  3VU7 H;  4IL4 A;  5HEU A;  3JAD A;  5AFU L;  3RIF A;  3RIA A;  1X79 A;  2YOE A;  4CXX A;  1ZEE A;  4YTP A;  2D5U A;  2XAG B;  3EHZ A;  2LE8 A;  3C51 A;  2LHR A;  3L09 A;  3K8P C;  1UUS A;  4TX5 A;  2E8I A;  4YLH A;  1ZV4 X;  3WI3 A;  1MMA A;  3ETV A;  2WQY A;  4P09 A;  3KVA A;  4YJ2 E;  5LNK A;  4K0U A;  4ADZ A;  5EZY E;  3ZYK A;  2XPK A;  4ZI2 D;  3AEB A;  4O4H E;  4X1Y E;  2PJQ A;  5LHI B;  5ABE A;  2LSJ A;  3CQC B;  2KWH A;  1WYC A;  2KMF A;  2CHO A;  1OED A;  5HAX A;  1I6Z A;  4UF0 A;  5AQH B;  3AXJ B;  4NIQ A;  5KXJ A;  2PFV A;  2YEV C;  4V1A v;  3UUN A;  1YW0 A;  2BDE A;  2CBI A;  2Q9Q D;  1BR0 A;  1OWA A;  3GWH A;  2V6Y A;  4TV9 E;  1MMD A;  1HNX T;  3RQW A;  2W63 A;  3B5M A;  3UFE A;  3RGL A;  3AEG A;  5ABF A;  2ZM0 A;  5L2L A;  2XUE A;  5GON E;  4IDQ A;  2RA1 A;  2C5K T;  3PJA A;  4AQY T;  3LK4 2;  3A8Y C;  1HNW T;  4NUV A;  2VVS A;  3P4P A;  2QRX A;  4IGU A;  1MNE A;  4TV8 E;  3TLT A;  3AVR A;  2WWU A;  4U33 A;  4H9P C;  5L3C B;  3VRB A;  2VB6 A;  3AA6 B;  3K3O A;  3LK3 B;  4ZEY A;  2K48 A;  2WP9 A;  5LGN B;  1D1C A;  3OKQ A;  3OBV E;  4X1I E;  5LA6 E;  3C4Z A;  1SUM B;  3CQG B;  2WS3 A;  4CXY A;  1J5W A;  2UXN B;  4IL9 A;  4TN7 B;  4H9O C;  4U2Z A;  2X9W A;  4A98 A;  5A1L A;  2KT9 A;  2K5B B;  2DCF A;  4I43 B;  3FHN A;  2X9Y A;  2X68 A;  2H3R A;  2FBW A;  5JDH A;  2MYS A;  4JBW F;  3PUQ A;  3BQI A;  4Z90 A;  4JI8 T;  5EK3 A;  5M4Y A;  2UXD T;  2WSS V;  5JR9 A;  2XSB A;  5LBQ B;  2I0M A;  5L4E A;  3JAF A;  2DNX A;  4ZS3 A;  4TWD A;  3QUJ A;  2CXD A;  2VUR A;  1HNZ T;  4CN4 A;  4XAX B;  2L9Q A;  2Q9Q B;  2A3D A;  1HG2 A;  4Q25 A;  3BK9 A;  4OYK A;  4TUY E;  3CK6 A;  2UXB T;  3TLS A;  3H3A A;  1NWM X;  3H3M A;  5AQF B;  3A5X A;  1FMV A;  2XQ6 A;  5AQO B;  3ZJ2 A;  3PUV F;  4H63 H;  2XQY A;  4YSY A;  1QLB A;  3OTO T;  3GA8 A;  4IT4 A;  4I0U A;  4HWI B;  2J62 A;  2XJ7 A;  4YFS A;  4U3C A;  4N78 D;  4UVB B;  4GKJ T;  3C64 A;  1GQE A;  3FZK B;  4DR6 T;  2VWA A;  1MIY A;  4AKI A;  2FUP A;  1N33 T;  2EHO D;  2OLT A;  4L9I A;  5TAO A;  4IDN A;  2VAS A;  3T1H T;  3RLF F;  4LML A;  2MTQ A;  5LHH B;  1IBM T;  4LF8 T;  1W0A A;  4C91 A;  5L3G B;  4HE8 A;  5HEO A;  3MXZ A;  5CGM A;  4OHF A;  3QOF A;  4QX7 B;  3PUX F;  2HPJ A;  1G73 A;  2ES0 A;  2DWG A;  4L5G A;  4ANJ A;  1W0B A;  2YN6 A;  4LF6 T;  2LRL A;  5HWY A;  4AIS A;  4WBN E;  1KNP A;  3AED A;  5JVD E;  4QH1 A;  3K1S A;  4HFC A;  2V5C A;  3ZN1 B;  4B3R T;  2OA5 A;  1HR0 T;  4DID B;  2BS2 A;  4I50 E;  2CA5 A;  3X1D A;  5FYM A;  2WU5 A;  2BG9 A;  1D1B A;  3SWH A;  2WZI A;  4YHJ A;  4EEB A;  4DV0 T;  4JI6 T;  4QXH B;  3Q5D A;  3UFG A;  3IHR A;  4PNI A;  5HXS A;  4ZZC A;  1US7 B;  3I0O A;  4YSZ A;  2CPT A;  3RC8 A;  2BS3 A;  2CM0 A;  2WAU A;  4EIW A;  3RIU C;  2QYW A;  1S35 A;  3KV6 A;  4LF9 T;  1QSD A;  4JI1 T;  4I4T E;  1MMG A;  3NKZ A;  5FP3 A;  5BR8 T;  1LKX A;  5C3J A;  5HXH A;  3FBL A;  2N2N A;  4IRE A;  4HFH A;  2XQ5 A;  5LMU T;  4XBF B;  2WDQ A;  3AEF A;  1D0Y A;  3JAE A;  5JDF A;  3UUM A;  4QXC B;  2DHR A;  3AVS A;  3DP7 A;  1VCT A;  3KV9 A;  1H7C A;  1D0X A;  4QKN A;  2D9D A;  3DJB A;  2XQ8 A;  5LP6 E;  3TLV A;  2KLQ A;  3CWZ B;  2PTF A;  2XAH B;  2E2A A;  5JDG A;  1YKH B;  1KEY A;  4OFZ A;  4DR5 T;  3V5S A;  4HFB A;  3N5L A;  1E2A A;  3SOL A;  4GYS A;  3UUL A;  5KMG P;  2F4V T;  4NUU A;  2A72 A;  2M6B A;  2LSK A;  4EB6 E;  4PK6 A;  5FXV A;  3ZN0 B;  1QUU A;  4P0A A;  4HFD A;  4ZXL A;  4EZ4 A;  4AQG A;  5LYJ E;  4O8S A;  3CX7 B;  3MAC A;  1NEK A;  2NW7 A;  3N9O A;  3E22 E;  1MND A;  3ZSS A;  2IML A;  3RX6 A;  3CIR A;  2E9X C;  2DL1 A;  4PFO A;  2CEA A;  5LXT E;  3RKO A;  2QA7 A;  5J2U E;  5LB7 B;  1OED B;  2EHO A;  2XY8 B;  3AA0 B;  5AQV B;  1YXR A;  4UF0 B;  5AQK B;  4O2A E;  3L8R A;  3VHL A;  3N9P A;  1W9R A;  5JRE A;  2X66 A;  3HKC E;  4HGA A;  3G06 A;  4CN1 A;  2NW8 A;  2WDR A;  4LF4 T;  4DND A;  3E0Z A;  4EYY R;  5FL1 A;  2V6Y B;  5JQG E;  3WAJ A;  3BQK A;  3B13 A;  3F31 A;  4ZHQ E;  5KX5 E;  1O3X A;  4AKG A;  4YHH T;  3GN5 A;  2JQK A;  4EAH A;  3R84 B;  3VKH A;  3P7I A;  4UVC B;  2CLY C;  4IE6 A;  2ACX A;  2W67 A;  1FMW A;  3PUW F;  3RQU A;  3KIN B;  2JJ9 A;  4A97 A;  1T8B A;  4ZI3 D;  4JI7 T;  1T72 A;  4YJ3 E;  5L3D B;  2CXF A;  4U7I A;  1IZN B;  4EGW A;  1S94 A;  4IHJ E;  4OK0 A;  1KK7 A;  4PJL A; 
#chains in the Genus database with same CATH homology
 2K5B B;  1VOM A;  2DCF A;  2Y48 B;  4I43 B;  1YKE B;  4EYU A;  2CXL A;  2X9Y A;  3FHN A;  1EZ3 A;  3NRY A;  1NAF A;  1FIO A;  4PAG A;  4ERR A;  3I1A A;  2NW9 A;  2X68 A;  2H3R A;  3PTR B;  2X51 A;  4KBM B;  5JDH A;  2RP4 A;  2MYS A;  4GOU A;  3ZC0 A;  5JRC A;  3RH3 A;  3PUQ A;  3M65 A;  3PDY A;  3PU3 A;  3BQI A;  3C4X A;  5EK3 A;  5M4Y A;  4KUM B;  2KWI B;  3HKB E;  2WSS V;  4PK4 A;  5JR9 A;  2CCQ A;  3MKD A;  3H37 A;  3I9W A;  3RYC E;  5LBQ B;  2XHE B;  1D0Z A;  2Q9Q A;  2VKJ A;  4PW8 A;  3ESL A;  2DNX A;  1T98 A;  3HKE E;  4ZS2 A;  5JRC B;  2H7V C;  1HX8 A;  2K24 A;  2LHN A;  4ISS A;  2NTY A;  3EUH A;  4ZS3 A;  3QUJ A;  2CXD A;  3MZK B;  3N9M A;  3IF8 B;  4G63 A;  4XAX B;  5JR9 B;  5IHY A;  2C5I T;  5FY1 A;  5FY0 A;  5JH7 E;  4ASK A;  2L9Q A;  3FXE B;  2SPC A;  2LSY A;  2X9H A;  2Q9Q B;  3V5U A;  2A3D A;  2YU2 A;  1HG2 A;  4GK0 E;  2NOX A;  2EHO C;  3RRW A;  3UTK A;  3F57 A;  3ZEF B;  3BK9 A;  4OYK A;  3U3I A;  1IAP A;  2HPL A;  2IC9 A;  3Q9D A;  4TUY E;  4UEL A;  1WYB A;  3H3A A;  1FEW A;  2XAJ B;  1NWM X;  4OYJ A;  5LJM A;  4DMV A;  5L3F B;  1KNZ A;  3A5X A;  1FMV A;  4M1P A;  1UCU A;  3O1I A;  3ZCI A;  2J1D G;  2L3L A;  1CUN A;  3HA4 A;  2N9D A;  3ZJ2 A;  2DLR A;  3PE0 A;  2MOZ A;  5H6R B;  1B7T A;  2DWK A;  4H63 H;  1U5P A;  2XQY A;  4JUY A;  4IE7 A;  5DJQ C;  3KVB A;  4UIG A;  5ETW A;  2KXP B;  5LG4 A;  4IE5 A;  3GA8 A;  1LVF A;  3LK2 B;  5LCY A;  5LOV E;  3CX8 B;  4QXB B;  2I59 A;  2IC6 A;  3CKD A;  3KDS E;  1BR4 A;  4YFS A;  3RPU A;  4N78 D;  4AKR B;  3CX6 B;  3ONX A;  4UVB B;  2CE7 A;  2JMH A;  3C64 A;  4FJO A;  2HH7 A;  4MBQ A;  3PUR A;  3K3N A;  3PUS A;  3KV4 A;  3Q5X A;  2WMN A;  2LOS A;  3NZP A;  2E9X B;  2V7I A;  2W62 A;  3LG7 A;  2JQQ A;  2VWA A;  4IE4 A;  3NBX X;  2CMR A;  4UV8 B;  1MIY A;  2WBL A;  3AB3 B;  2V7L A;  4AKI A;  3GMI A;  5DQV A;  1HCI A;  3ZC1 A;  2EHO D;  3C50 A;  5KDM C;  4L9I A;  2BVL A;  1HF8 A;  3Q5W A;  4IIJ E;  4WBO A;  5TAO A;  3Q2M A;  2VAS A;  4H63 V;  3QC9 A;  4O4I E;  4CI1 B;  3KFW X;  4UEM A;  3OYX A;  1UX5 A;  2LOP A;  2MTQ A;  5LHH B;  1HG5 A;  2D0U A;  4FI5 A;  2X67 A;  2L8K A;  1LRZ A;  3K3Q C;  4PJN A;  4C91 A;  2D0T A;  3MA9 A;  4HKA A;  1U4Q A;  4UVA B;  5L3G B;  3AAI A;  5EK4 A;  2YU1 A;  4HE8 A;  3I0Q A;  1AJ3 A;  3MXZ A;  2M67 A;  4H9Q C;  2A2F X;  1BR2 A;  4TZ4 C;  4OHF A;  3ZMV B;  3R6N A;  4O4L E;  2YIN A;  2V7J A;  4AXP A;  2V7K A;  4QX7 B;  3N2K E;  4ILU A;  2HPJ A;  1G73 A;  1IJ5 A;  1D1A A;  2ES0 A;  2DWG A;  3ZJ1 A;  4MAL A;  3RC3 A;  3ZMS B;  4L5G A;  4ANJ A;  4H9S E;  3TKL B;  4WNK A;  2CWO A;  2WM9 A;  3HKD E;  2CLY B;  5HWY A;  5J2T E;  4PJM A;  2JMK A;  4WBN E;  5C8Y E;  3W15 B;  3DTO A;  4CXW A;  5JVD E;  4MHC A;  4U74 A;  4IDZ A;  1WLX A;  3ZYM A;  3ZN1 B;  4G2A A;  2IW5 B;  5FXW A;  2OA5 A;  5HYA A;  4A56 A;  2D2S A;  4AQF A;  2KZ7 B;  2BZB A;  3ZMU B;  1UX4 A;  4I50 E;  2K9A A;  3LJC A;  4QX8 B;  4BA9 A;  2LM9 A;  3E08 A;  4KMC A;  2CA5 A;  3D0T A;  5BMV E;  2YK0 A;  5LGT B;  5FYM A;  4EZH A;  2LSG A;  1D1B A;  3SWH A;  2JRK A;  3AAA B;  3FBZ A;  4YHJ A;  3VKG A;  5LJN A;  1E1H B;  2DI4 A;  3PUA A;  2V1D B;  4F6R C;  3AAE B;  3SS1 A;  3S4U A;  3J7Y q;  5ADX L;  5L3B B;  3UT5 E;  4E7S A;  4QXH B;  2XTL A;  5LHG B;  3CML A;  4CI3 B;  3ANW A;  4L0R A;  4UV9 B;  3IHR A;  4PNI A;  5HXS A;  3MJX A;  2XAF B;  1BR1 A;  4GK5 E;  2NWB A;  1US7 B;  1G8X A;  3I0O A;  2KND A;  4GYR A;  4X1K E;  4CQI A;  3RC8 A;  1MIW A;  3ZMT B;  2CM0 A;  4EXT A;  1LVK A;  2WAU A;  2Y6X A;  4EIW A;  4BJN A;  2E9X A;  3EDV A;  5HWX A;  4XZC A;  2MBG A;  5LXT E;  3CPZ A;  2PBI A;  5E0O A;  5JDQ A;  3ZCJ A;  3LFM A;  1Y64 B;  3ANW B;  1S35 A;  3O9X A;  3KV6 A;  4DO0 A;  2VL8 A;  5IYZ E;  3ETU A;  1QSD A;  1WR6 A;  2VK9 A;  3KBU A;  3EDU A;  3PUG A;  4I4T E;  1HTJ F;  3JC6 D;  1MMG A;  3RYH E;  5JDM A;  5LGU B;  4Z8X A;  3O1H A;  5CA1 E;  4AI6 A;  5FP3 A;  4MLK A;  1LKX A;  3RYF E;  5HXH A;  3AA1 B;  3FBL A;  2N2N A;  4BAY B;  4HFV A;  4PJJ A;  3CQX C;  4H9R C;  1ZKE A;  3UUX B;  3NZQ A;  4U72 A;  3N9N A;  4XBF B;  1ZHC A;  4JEH B;  3T8O A;  3HL6 A;  5FXZ A;  4CZZ B;  3MK7 C;  3LBX B;  3ZYL A;  1SHZ C;  5CA0 E;  3OJA A;  4GIW A;  3N2O A;  4AKL A;  1D0Y A;  3U78 A;  3VU7 H;  4ZOL E;  5J1G A;  5JDF A;  3CVR A;  4ZI2 C;  3UUM A;  3P8C D;  3RRC A;  4B6X A;  4QXC B;  5AFU L;  2X0L B;  2DHR A;  1X79 A;  3AVS A;  4OK0 A;  4EOZ B;  4I55 E;  4O2B E;  3DP7 A;  4CXX A;  3ZPO A;  3WAK A;  2XAS B;  1ZEE A;  4C90 A;  4IE0 A;  2WMO A;  2VKD A;  3KV9 A;  2D5U A;  1H7C A;  1D0X A;  2ZM2 A;  2XAG B;  4PK5 A;  4QKN A;  3DJB A;  2LE8 A;  3N2G E;  5LP6 E;  5F3J A;  4MFR A;  4AKH A;  4QHO A;  2B1E A;  2KLQ A;  3C51 A;  2LHR A;  3L09 A;  3EVY A;  1V9D A;  3K8P C;  3CWZ B;  2E8I A;  2CWY A;  2V26 A;  4TX5 A;  1ZV4 X;  2XAH B;  4YLH A;  5LBM A;  5JDG A;  3WI3 A;  2BVM A;  1MMA A;  3ETV A;  3IEE A;  4KP3 C;  4P09 A;  1YKH B;  3KVA A;  5JR9 C;  3F2E A;  4OFZ A;  2ZM8 A;  4YJ2 E;  4O4J E;  3V5S A;  5LNK A;  2Q9Q C;  3N5L A;  4AQF C;  4K0U A;  4DVD A;  2W0G A;  3I9Y A;  4IST A;  4ADZ A;  3SOL A;  2W61 A;  5EZY E;  1HS7 A;  4GYS A;  2C0S A;  3UUL A;  5KMG P;  2NTX A;  3QK6 A;  4NUU A;  2A72 A;  4DMW A;  3ZYK A;  2LSK A;  5EK2 A;  1MMN A;  4EB6 E;  4PK6 A;  5FXV A;  3ZN0 B;  5L3E B;  4J2C A;  3JC6 C;  4ZI2 D;  1QUU A;  4O4H E;  3J9X 1;  4P0A A;  4X1Y E;  2PJQ A;  5LHI B;  4EZ4 A;  4HTE A;  3RYI E;  2LSJ A;  4AQG A;  5LYJ E;  3CQC B;  3IBP A;  4E7Z A;  4O8S A;  3N9Q A;  3CX7 B;  4WW0 A;  2KWH A;  4P0B A;  1WYC A;  4HEA A;  3MAC A;  2KMF A;  2NW7 A;  3AA7 B;  3B57 A;  3N9O A;  3E22 E;  5JDL A;  5HAX A;  4QWN B;  3BQL A;  4X20 E;  1MND A;  5CB4 E;  4UF0 A;  1Z0P A;  2LEH A;  5FY7 A;  2UXX B;  4ZI7 E;  2Y8D A;  3RX6 A;  3C98 B;  5FNV E;  3KV5 A;  2NP9 A;  3FB2 A;  2PFV A;  1SA0 E;  4H9N C;  5F8P A;  2E9X C;  4PFO A;  2YEV C;  1OXZ A;  4DBQ A;  2CEA A;  2VKO A;  4V1A v;  2GK9 A;  2VKH A;  3NRX A;  2QA7 A;  3RKO A;  3UUN A;  1YW0 A;  2BDE A;  5J2U E;  1IJ6 A;  2Q9Q D;  1BR0 A;  2V7M A;  2EHO A;  1OWA A;  2ZLY A;  3AA0 B;  3GWH A;  2ZMA A;  4TV9 E;  1MMD A;  2ODV A;  4UF0 B;  4O2A E;  5H6Q B;  3HR0 A;  3VHL A;  2LJL A;  5FMN A;  3UFE A;  2W63 A;  3N9P A;  3ZMZ B;  1YD8 G;  5JRE A;  4ZI3 C;  4DBR A;  2X66 A;  3HKC E;  2ZM0 A;  3KBT A;  4HN9 A;  2P9B A;  4HGA A;  5L2L A;  3LBX A;  2NW8 A;  2XUE A;  1MIV A;  4JEU B;  5GON E;  4DND A;  3E0Z A;  2EHO B;  4EYY R;  2LT3 A;  5JQG E;  3WAJ A;  2RA1 A;  3BQK A;  3B13 A;  3F31 A;  5DQW A;  2C5K T;  4CI2 B;  2JPF A;  4ZHQ E;  5KX5 E;  3SRZ A;  1O3X A;  3LK4 2;  4AKG A;  2Z6E A;  2N1G A;  4NUV A;  3GN5 A;  2IAK A;  3HI2 A;  3L3P A;  4IGU A;  2KIN B;  1MNE A;  3N9L A;  3C4W A;  4TV8 E;  4EAH A;  3R84 B;  2G0U A;  3VKH A;  3O1J A;  2E9X D;  1WRD A;  2PG8 A;  3AVR A;  3P7I A;  4UVC B;  2WWU A;  2CLY C;  4BJM A;  4IE6 A;  2ACX A;  3OYZ A;  5HXC A;  4H9P C;  5L3C B;  1FMW A;  5FXX A;  2X9X A;  3GN5 B;  3ZLI A;  2VB6 A;  3AA6 B;  3K3O A;  3LK3 B;  2QGS A;  3KIN B;  2JJ9 A;  2LSI A;  5HXE A;  3FXD B;  2K48 A;  4ZI3 D;  2XAQ B;  5LGN B;  3O4X E;  5DAB A;  1D1C A;  3OKQ A;  3OBV E;  4X1I E;  5HXR A;  4YJ3 E;  5L3D B;  4PFP A;  4UXN B;  2CXF A;  5LA6 E;  1VRB A;  5JDN A;  2H7O A;  1IZN B;  3C4Z A;  2W00 A;  3CQG B;  2C5J A;  4CXY A;  2UXN B;  3PU8 A;  1S94 A;  1HFA A;  4TN7 B;  4H9O C;  4IHJ E;  2ODU A;  2X9W A;  5A1L A;  4PJL A;  2KT9 A;  1KK7 A;  4JLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...