4GIWA

Crystal structure of the run domain of human nesca
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
179
Chain Sequence
QKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLMYMPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional implication of the RUN domain of human NESCA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RUN and SH3 domain-containing protein 1
total genus 59
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4giwA00
2CXLA 3CWZB 2DWGA 2DWKA 4GIWA 2CXFA
chains in the Genus database with same CATH superfamily
4HWDA 4IDPA 5JR9C 1CHUA 2EHOB 4QX8B 3RRWA 4ADZA 4L9IA 3UU6A 5L47A 2V1DB 2XHEB 1MMAA 4X65T 2KXPB 2IUBA 2WWUA 3AVRA 3D0TA 4HFVA 2XQYA 3P4SA 2N9DA 4ZS3A 4LF7T 1MMDA 3C51A 4PK4A 3ZC0A 2FJDA 2WAUA 2BG9C 1WYCA 1VOMA 2SPCA 3ZCJA 1N32T 3PUAA 4PJLA 1XWMA 1WLXA 4Z8XA 2PFVA 2QGSA 5LMUT 4JEUB 3T1HT 2DWKA 4UR9A 5AQSB 5LHGB 1JNZA 3E08A 3RC8A 1D0YA 4Z91A 4PJJA 1FJGT 2B1EA 2JQQA 4JI1T 5AQGB 5AQHB 3I0QA 3UUNA 4PFPA 3AEDA 5DQVA 2E9XB 4IGUA 5CA0E 3L39A 1IBKT 2E9XC 4G2AA 4OHFA 3VKHA 2DCFA 4ZXLA 3KV5A 2XQ4A 4LFAT 1T72A 2QRXA 1YQ4A 3P7IA 5FP3A 5LBMA 2H7OA 5JDQA 2J47A 3EAMA 3ZJ2A 2X9YA 2NOXA 4CI2B 5IUXA 1T8BA 4GOUA 5KDMC 1Y01A 1SE7A 3ZMZB 3UUMA 4JI3T 2Q9QC 3PDYA 2W61A 5L4HA 4KX6A 4CZZB 4WYVA 3OPCA 4H9OC 2A2FX 4EZ4A 4ILAA 3QK6A 5IYZE 4XAXB 4LF9T 2J4GA 3UFEA 3UTKA 1MIVA 2WZIA 1OEDE 4IT4A 2XY8B 3ZYLA 1IBLT 3R84B 4LMJA 3V5SA 2C5IT 2JQKA 3P4RA 3EHZA 3PE0A 4DNDA 5DJQC 2EHOC 2DHRA 2HN2A 2LRKA 3RRCA 4ZS2A 3AA6B 2Q9QB 2VB6A 1Z8UA 3S4UA 4A98A 3OTOT 4DV7T 2ACXA 4BA9A 2WB5A 2LKGA 3C50A 3N9QA 4HWIB 3VRAA 1WRDA 3PUZF 2KMFA 3I9WA 3H3MA 4YTNA 2E5VA 4ZI2D 2W2UA 5L3CB 5LGTB 2FBWA 4IL9A 3AB3B 5LGNB 3J7Yq 4O2AE 2BG9A 1HX1B 2QYWA 2BG9E 2LOSA 4X20E 5JDGA 2UXCT 2VASA 2VL0A 2VWAA 4UF0B 2V7MA 1KK7A 4U31A 4IE6A 5FMNA 4KUMB 4CXXA 2NP9A 3MJXA 2H3RA 3MACA 4B6XA 3DTOA 4EYUA 4DR6T 3AE4A 1Z0PA 5FXWA 3IBPA 3A7MA 2N1GA 5JR9A 1WR6A 5AFUL 2X9HA 2CBIA 2N2NA 2YEVC 3JAFA 3RIAA 2LSGA 3V5UA 4ISTA 4JI2T 4CXYA 5AQNB 1MNDA 3NKZA 1ZP0A 4UIGA 4MFRA 3JC6D 5TAOA 2BG9B 1IBMT 2Z6EA 1OEDA 3LK42 3ZT6A 1SA0E 4PK6A 4LF5T 3W15B 4LF4T 2XJ7A 2K3WA 3NWIA 5LBQB 1YXRA 3RLFF 3F57A 1YKEB 4EAHA 2LSKA 2L3LA 3NBXX 3QB5A 3R6NA 2HH7A 1LRZA 2FUPA 4HFHA 3HKBE 4DUYT 1XMQT 4K0UA 5LB7B 1BR1A 3ANWA 4H63H 4TUYE 4TZ4C 1KFYA 5JR9B 3L3PA 1U5PA 2PG8A 1XZYA 4G63A 2CBJA 5HCJA 3RH3A 2CMRA 1OEDC 4H9PC 4IIJE 2CXFA 5H6RB 1UURA 2CM0A 5AQLB 4HFDA 5HWXA 3C98B 2W67A 3N9LA 3UFGA 3ZT5A 2L9QA 2OLTA 2KNDA 2CE7A 2DLRA 3HR0A 4X1KE 3PU8A 2XTLA 3DP7A 5AQMB 4KI0F 4NUUA 5LCYA 2WU5A 3ZMTB 2CCQA 3UT5E 4GYSA 5JREA 1M62A 1B7TA 1Y64B 2HPJA 1FMWA 1LVFA 2I6HA 1KEYA 2A72A 1NWMX 2PJQA 2JQ9A 1OXZA 2W63A 2WMOA 2V7IA 3CQCB 3FZFB 4AI6A 3OBVE 5L2LA 4CXWA 2LJLA 4CI1B 5KXJA 3PUXF 2KWHA 3KBTA 2ODUA 2BZBA 3LJCA 3PUSA 4ASKA 2L8KA 2XAQB 2LHNA 2LSYA 2WU2A 4JYAT 2WZHA 3LSVA 4HFEA 5LJNA 2XSBA 3VR8A 2HHHT 3C4ZA 4YJ2E 1IJ5A 2ZLYA 3CIRA 3SFDA 4JI7T 3AEEA 3NVOA 4TX5A 5JVDE 3F31A 4PAGA 5DABA 2ES0A 2F4VT 3MXZA 3QC9A 2RP4A 2WMNA 4B3ST 3TLTA 4LFBT 1DU2A 2H89A 2IIUA 4QH4A 4DV6T 2V8SV 1N36T 3EI0A 2E5LT 3ZKRA 1W0BA 3C4XA 4J2CA 3AEFA 4L5GA 4YFSA 5JDFA 3N9OA 4JI8T 2XUEA 5LYJE 2XQ8A 3AAIA 4OYKA 2UXBT 3P4QA 1EZ3A 3AE5A 4OFZA 4PNIA 1FEWA 4WNKA 4ZI7E 5JQGE 4DV4T 2K24A 3AE3A 3B57A 3LK3B 3P4WA 1VCSA 2WDVA 4ZI2C 2LT3A 2LM2A 3CWZB 5AQTB 1ZKEA 2KSRA 3CK6A 4E7ZA 2WDRA 4EGWA 4DV1T 1BR4A 4WW0A 4GYRA 3F2EA 4UV9B 3UU3A 5CA1E 4JI5T 5A1LA 2CHOA 4UVBB 2ODVA 2HN1A 5JTGA 1AJ3A 5AQJB 2YOEA 1UX5A 3MKDA 4AKIA 5FL1A 4U74A 5E0OA 4DV2T 2X9XA 4AQYT 4A97A 3UUBA 4O8SA 2E9XA 3AECA 2H7VC 3U3IA 1X79A 4OK0A 2WS3A 4LF8T 4YSXA 3AA1B 5BMVE 3I1AA 3T8OA 3AE8A 3EDVA 4HE8A 2BS2A 1J5ET 2IAKA 2UUBT 4B3MT 1V9DA 4OYJA 2VVSA 2XQ7A 3QNUA 4IDZA 4COFA 5HYAA 2YK0A 2FJBA 2IC9A 5C8YE 3IHRA 5EK3A 2XQ5A 2YU1A 3CKDA 2YU2A 2BBHA 1D0XA 3HKEE 2OV9A 3KFWX 3O9XA 2Q9QD 2V7KA 4EB6E 4LFCT 1IZNB 1O3XA 3KVAA 3AAAB 3RKOA 5J0ZA 5IWAT 2WM9A 2AXDS 2ZM2A 5HEUA 2X0YA 4ANJA 5JRCB 2VVNA 1S94A 1XDPA 2DL1A 2E8IA 3AA0B 4EEBA 2V5DA 4DVDA 3MA9A 4ZHQE 5JDNA 5JH7E 4CQIA 1WR0A 1YKHB 5JDLA 4O4HE 1I94T 2UU9T 1MIYA 4MHCA 4QXCB 4M1PA 5GONE 2VL8A 4UVAB 4P0AA 4DR7T 3PJAJ 5AQQB 3Q5EA 2XAHB 5IHYA 5LG3A 2V5CA 2WY2A 3SS1A 4ERRA 5ABFB 2JJ9A 2W4XA 2KWIB 3AE7A 3EDUA 3N5LA 3N2OA 3O1JA 4I4TE 4L0RA 4QKNA 5J2UE 4FJOA 1HX8A 4TWFA 4DMWA 3FBLA 1WYBA 1E2AA 2KINB 2X67A 4IE7A 5LP6E 5EZYE 1XNRT 3ESLA 3B5MA 4IDQA 1E7PA 3CPZA 4TWHA 1KF6A 2H88A 4HN9A 5AQOB 3WI3A 2E2AA 2XSAA 3CQGB 3GN5A 2RA1A 3N9PA 3H3AA 3QOFA 2JMKA 3FXDB 3AEGA 5HEGA 3LFMA 1G8XA 1VRBA 3VU7H 5EK4A 4EOZB 2IW5B 5HAXA 2W0GA 3RKGA 5FYMA 4CN6A 4ZZBA 1MIWA 2NTXA 3LBXB 1G73A 4HKAA 2XPKA 2I59A 1HFAA 5EK2A 3VKGA 3PJAA 3ZMUB 4FI5A 4JBWF 5HXEA 4XBFB 1ZEEA 2VKDA 3KVBA 3ANWB 3NRYA 5AQIB 2KZ7B 4NXNT 3SRZA 2D0TA 4N78D 2HPLA 4ZI3C 3M65A 4DV3T 4BAYB 2V6YA 4GK5E 2DNXA 4Q25A 4WBNE 2A3DA 5J1GA 3BQIA 5FXVA 3GN5B 2CHNA 4B3TT 4AIUA 1QLBA 2XQAA 1CUNA 3UQ4A 1HNWT 5AQKB 3RF1A 3SFEA 2YDRA 1IAPA 3EVYA 4O2BE 3SOLA 3RQUA 4O4JE 1IJ6A 3H37A 3QB5K 2WBLA 2W00A 5ABFA 2XM2A 2BKOA 4TN7B 3UUXB 2A9UA 3N2GE 4I0UA 2JIWA 3CX7B 3ZSSA 5HXSA 1N33T 3AA7B 4IHJE 1W09A 1HS7A 5AQUB 1R8IA 3CX8B 2NTYA 2D0UA 1NENA 1SHZC 4O4IE 5L3FB 2CLYC 3DJBA 3PURA 3TLWA 3Q5WA 2DI4A 2P9BA 2XZEA 2BS4A 1FIOA 2C0SA 2ZM0A 2WQYA 5DQWA 2V26A 5L3EB 1HNXT 2WDQA 2XQ9A 2V7JA 2JMHA 5LG4A 2UXDT 3RIUC 4A5XA 3TKLB 5LNKA 5J2TE 4ZZCA 4NUVA 1D1BA 4IDOA 4H9RC 2K9AA 4LMLA 2WSSV 3HA4A 4YSZA 2UUCT 2FJEA 4AQFC 3ZPOA 4IL4A 1MMGA 1D1AA 2V6XA 3HKDE 4KP3C 2EHOA 3P4PA 2D2SA 2M6IA 1XMOT 2R6GF 3ZYKA 3LDQB 3ONJA 2X9WA 4TNVA 2MAWA 3TLUA 2ZM6T 4GKKT 5L3GB 4TWDA 3NZPA 4LMKA 3UU8A 2DWGA 2J62A 2M6BA 2PTFA 3AXJB 4XZCA 1JNRA 1MNEA 3PUQA 5LOVE 3ETVA 4YTPA 4H9SE 3Q9DA 4DR4T 3PTRB 5HEOA 3T1YT 3LG7A 2BKPA 3KBUA 4HFIA 2I0MA 3LK2B 1OWAA 3NRXA 2YDQA 3ZN0B 2CWOA 3WAJA 2AE9A 3ZT7A 1XDOA 3VR9A 3K8PC 3C64A 3OKQA 4EV6A 3UU4A 3BQLA 2CA5A 2X51A 3KV4A 3EUHA 5FL0A 4NIQA 1QUUA 4PJNA 2Y48B 4YSYA 1X9BA 4ZEYA 3FZMB 1W0AA 1YQ3A 3LBXA 2CLYB 3QUJA 4QXBB 4TNWA 4ILUA 5FY1A 2MYSA 4UVCB 2VQET 1WCRA 2X0LB 4KHZF 2EHOD 2OA5A 2PBIA 4X62T 4WBOA 2XAFB 2QVAA 4QXHB 3K1SA 5FY0A 3FZHB 4PW8A 1E1HB 2IHR1 3K3NA 4MALA 3PV0F 3RGLA 3RYCE 4KHPT 4P09A 2CXDA 2CWYA 3K3OA 4IE0A 5HCMA 3UU5A 2MPKA 4WZXA 1XNQT 4B3RT 2UXNB 5CB4E 2G0UA 3P8CD 3N9MA 2LKHA 2M67A 5ETWA 4YXDA 2BVMA 3ABVA 3FZLB 3O4XE 3BQKA 4U2ZA 4IDNA 1QSDA 3RC3A 5HXHA 2X66A 2K48A 2CXLA 4UELA 4X5TA 3VHLA 5LMNT 4DR1T 2ZM8A 3AVSA 3KV6A 3Q5XA 5LHIB 4ZI3D 3C4WA 2XAGB 4YLHA 4AKGA 4NXMT 2RPAA 4AKRB 4JEHB 5AQPB 3AAEB 1VCTA 3VRBA 3I0OA 3ZSTA 1ZV4X 4YT0A 2FJAA 4MLKA 4NPPA 5FVLA 3TLSA 4AKLA 3ZMVB 2NR4A 3B13A 3PU3A 5H6QB 4BJMA 1HG2A 1U4QA 2LE8A 1WFDA 4I50E 5CFBA 5ABGA 3ONXA 3K3QC 2CEAA 2CPTA 2VKOA 4PJMA 4LF6T 2Y6XA 5LJMA 1KNZA 4QX7B 3CMLA 2IC6A 3CQXC 2LEHA 4DUZT 4YTMA 4U72A 4H9QC 1HCIA 3KDSE 4QWNB 4TV8E 3GWHA 3PUVF 4GK0E 4DV5T 5AQRB 4EYYR 5HXRA 2D9DA 3ZCIA 5JDMA 3RIFA 2UUAT 3ZN1B 5M4YA 4PK5A 2Y8DA 4AISA 4DR3T 5LHHB 1MMNA 4AQGA 2GK9A 3FHNA 5JRCA 2MTQA 4AQFA 2WP9A 1LKXA 3GMIA 3JAEA 2BS3A 1NEKA 2NW7A 3FB2A 3Q5DA 4UV8B 3ZMSB 3HKCE 5C3JA 2BVLA 4F6RC 1LVKA 1HG5A 4C90A 5AQFB 4GKJT 3RYIE 2E9XD 1US7B 2VK9A 4DR2T 5HXCA 5L3DB 4K0KT 3A8YC 1HNZT 1FMVA 3MK7C 4QHOA 4KMCA 4PFOA 4H9NC 3A5XA 4QH5A 1BR2A 1S35A 3IA3A 4U7YA 1KNPA 4Z90A 3X1DA 4YHJA 5F3JA 4HTEA 2BDEA 4BJNA 2XQ6A 3RI5A 2V6YB 3Q2MA 4DR5T 4YJ3E 2LM9A 5FVKA 3ZLIA 2ACZA 5ABEA 4X66T 3ZC1A 2VQFT 2IDOB 3N9NA 4IREA 2C5JA 1HTJF 4JUYA 3PUYF 4DMVA 3AE1A 4EZHA 4CI3B 4AKHA 4DBQA 4P1NA 3RX6A 1UCUA 4AXPA 3M3ZB 3AE6A 3IEEA 2JRKA 2UXXB 2JPFA 5AQVB 5FY7A 3L09A 4ILBA 4O4LE 4QH1A 4HGAA 3AEAA 4KBMB 3RIUA 2NWBA 5KX5E 4X64T 2ZMAA 2LHRA 3AE9A 2QA7A 3CVRA 3G06A 4UF0A 1J5WA 4JI0T 2XM1A 2W62A 3ETUA 4E7SA 2MOZA 3KV9A 5ADXL 4JLEA 3OYXA 2NW8A 4HEAA 4V1Av 4ZOLE 3TLVA 4CN1A 4OX9T 3ZYMA 4DBRA 3U78A 2VKJA 2LSJA 3AEBA 4HWHA 2JQHA 2W66A 5C2TA 3PUGA 2LOPA 1D1CA 5CJ5A 2YN6A 3KINB 2Q9QA 2BKNA 2J1DG 3N2KE 5LXTE 2XAJB 3EABA 2LSIA 5HEHA 3NZQA 1KNRA 3FXEB 3OJAA 4I43B 2VURA 4YY3T 4HFBA 5HWYA 3RYFE 2VKHA 1ZHCA 1L0VA 4DO0A 5LGUB 1BR0A 1N34T 3HL6A 1W9RA 3RQWA 1SUMB 2XQ3A 3O1IA 5L4EA 5L3BB 4GIWA 4I55E 4P0BA 3FBZA 3WAKA 2B76A 3AXJA 4CN4A 5KMGP 4JI6T 2X68A 2MBGA 2BBJA 3L8RA 3AE2A 1T98A 4JI4T 2YINA 2LRLA 3E22E 3O1HA 3RYHE 1ZOYA 4ILCA 3SWHA 5ABHA 3OYZA 4U7IA 4H63V 5BR8T 4YHHT 1NAFA 2C5KT 3MZKB 2WWVA 3RPUA 3E0ZA 4C91A 3IF8B 2CRBA 3RHWA 4U3CA 5HEJA 1UK5A 2YKSA 4HFCA 5F8PA 4X1YE 4EEDA 1GQEA 3FZKB 4F8HA 3JCFA 2K5BB 1J1JA 3ONLC 2LLYA 3HI2A 4IE5A 3PUWF 5FKYA 1UX4A 1D0ZA 1HF8A 3BK9A 2IMLA 4EXTA 5JDHA 4HWFA 1YD8G 4HWCA 4UEMA 1H7CA 5FXZA 3UULA 5CGMA 1I6ZA 4X1IE 2XASB 3OVUA 5LA6E 1HR0T 4TV9E 2KLQA 4U33A 3J9X1 3JADA 1M7KA 2V7LA 5FNVE 4ISSA 4DV0T 3CX6B 4IE4A 4MBQA 5F5WA 2NW9A 3GA8A 1YW0A 2YDSA 1UUSA 4U2YA 3ZEFB 3UQ7A 2D5UA 4DIDB 4EIWA 4UXNB 1OEDB 3ZJ1A 2WCAA 5FXXA 3P50A 4JV5T 4A56A 3I9YA 2KT9A 2X0HA 1UGOA 1T7SA 3JC6C
chains in the Genus database with same CATH topology
5JR9C 3RRWA 2EHOB 4QX8B 4ADZA 4L9IA 2V1DB 2XHEB 1MMAA 2KXPB 2WWUA 3D0TA 3AVRA 4HFVA 2XQYA 2N9DA 4ZS3A 1MMDA 3C51A 4PK4A 3ZC0A 2WAUA 1WYCA 1VOMA 2SPCA 3ZCJA 3PUAA 4PJLA 1WLXA 4Z8XA 2PFVA 2QGSA 4JEUB 2DWKA 5LHGB 3RC8A 3E08A 1D0YA 4PJJA 2B1EA 2JQQA 3I0QA 3UUNA 4PFPA 5DQVA 2E9XB 4IGUA 5CA0E 2E9XC 4G2AA 4OHFA 3VKHA 2DCFA 3KV5A 3P7IA 5FP3A 5LBMA 5JDQA 2H7OA 3ZJ2A 2X9YA 2NOXA 4CI2B 5KDMC 4GOUA 3ZMZB 3UUMA 2Q9QC 3PDYA 2W61A 4CZZB 4EZ4A 4H9OC 2A2FX 3QK6A 5IYZE 4XAXB 3UTKA 1MIVA 3ZYLA 3R84B 3V5SA 2C5IT 3PE0A 4DNDA 5DJQC 2EHOC 2DHRA 3RRCA 4ZS2A 3AA6B 2Q9QB 2VB6A 3S4UA 2ACXA 4BA9A 3C50A 3N9QA 1WRDA 2KMFA 3I9WA 4ZI2D 5L3CB 3J7Yq 3AB3B 5LGNB 4O2AE 5JDGA 2LOSA 2VASA 4UF0B 2VWAA 4CXXA 2V7MA 1KK7A 5FMNA 4IE6A 4KUMB 2NP9A 3MJXA 2H3RA 3MACA 4B6XA 3DTOA 4EYUA 1Z0PA 5FXWA 3IBPA 2N1GA 5JR9A 1WR6A 5AFUL 2X9HA 2N2NA 2YEVC 2LSGA 3V5UA 4ISTA 4CXYA 1MNDA 4UIGA 4MFRA 3JC6D 5TAOA 2Z6EA 3LK42 1SA0E 4PK6A 3W15B 5LBQB 4YJ2E 3F57A 1YKEB 4EAHA 2LSKA 2L3LA 3NBXX 3R6NA 2HH7A 1LRZA 3HKBE 4K0UA 1BR1A 3ANWA 4H63H 4TUYE 4TZ4C 5JR9B 3L3PA 1U5PA 2PG8A 4G63A 3RH3A 2CMRA 4H9PC 4IIJE 2CXFA 5H6RB 2CM0A 5HWXA 3C98B 3N9LA 3O9XA 2L9QA 4X1KE 2KNDA 2CE7A 2DLRA 3HR0A 3PU8A 2XTLA 3DP7A 4NUUA 5LCYA 3ZMTB 2CCQA 3UT5E 4GYSA 5JREA 2HPJA 1B7TA 1Y64B 2PJQA 1FMWA 1LVFA 2W63A 2A72A 3LJCA 1NWMX 1OXZA 2WMOA 3CQCB 2V7IA 4AI6A 3OBVE 5L2LA 4CXWA 2LJLA 4CI1B 2KWHA 3KBTA 2ODUA 2BZBA 3PUSA 4ASKA 2L8KA 2XAQB 2LHNA 2LSYA 5LJNA 3C4ZA 1IJ5A 2ZLYA 4TX5A 5JVDE 3F31A 4PAGA 5DABA 2ES0A 3MXZA 3QC9A 2RP4A 2WMNA 3C4XA 4J2CA 4L5GA 4YFSA 5JDFA 3N9OA 2XUEA 3AAIA 4OYKA 1EZ3A 4OFZA 5JQGE 4PNIA 1FEWA 4WNKA 4ZI7E 2K24A 3B57A 3LK3B 4ZI2C 2LT3A 3CWZB 1ZKEA 4E7ZA 1BR4A 4WW0A 4GYRA 3F2EA 4UV9B 5CA1E 5A1LA 4UVBB 2ODVA 1AJ3A 4AKIA 1UX5A 3MKDA 4U74A 5E0OA 2X9XA 4O8SA 2E9XA 2H7VC 3U3IA 1X79A 4OK0A 5BMVE 3AA1B 3I1AA 3T8OA 3EDVA 4HE8A 2IAKA 1V9DA 4OYJA 4IDZA 5HYAA 2YK0A 2IC9A 5C8YE 3IHRA 5EK3A 2YU1A 3CKDA 2YU2A 1D0XA 3HKEE 3KFWX 2Q9QD 2V7KA 4EB6E 1IZNB 1O3XA 3KVAA 3AAAB 3RKOA 2WM9A 2ZM2A 4ANJA 5JRCB 1S94A 2E8IA 5JH7E 3AA0B 5LYJE 4DVDA 3MA9A 4ZHQE 5JDNA 4CQIA 1YKHB 5JDLA 4O4HE 1MIYA 4MHCA 4QXCB 4M1PA 5GONE 2VL8A 4UVAB 4P0AA 5IHYA 2XAHB 3SS1A 4ERRA 2JJ9A 3EDUA 2KWIB 3N5LA 3O1JA 3N2OA 4L0RA 4QKNA 4I4TE 3ZLIA 5J2UE 5LGTB 4FJOA 1HX8A 4DMWA 3FBLA 1WYBA 2KINB 2X67A 4IE7A 5LP6E 5EZYE 3ESLA 3CPZA 3WI3A 4HN9A 3GN5A 3CQGB 2RA1A 3N9PA 3H3AA 2JMKA 3FXDB 3LFMA 1G8XA 1VRBA 3VU7H 5EK4A 4EOZB 2IW5B 5HAXA 2W0GA 5FYMA 1MIWA 2NTXA 3LBXB 1G73A 4HKAA 2I59A 1HFAA 5EK2A 3VKGA 3ZMUB 4FI5A 5HXEA 4XBFB 1ZEEA 2VKDA 3KVBA 3ANWB 3NRYA 2KZ7B 3SRZA 2D0TA 4N78D 2HPLA 4ZI3C 3M65A 4BAYB 4GK5E 2DNXA 4WBNE 2A3DA 5J1GA 3BQIA 5FXVA 3GN5B 1CUNA 1IAPA 3EVYA 4O2BE 3SOLA 4O4JE 1IJ6A 3H37A 2WBLA 2W00A 4TN7B 3UUXB 3N2GE 5HXSA 3CX7B 3AA7B 4IHJE 1HS7A 3CX8B 2NTYA 2D0UA 1SHZC 4O4IE 5L3FB 2CLYC 3DJBA 3PURA 3UFEA 3Q5WA 2DI4A 2P9BA 5FY0A 5DQWA 1FIOA 2C0SA 2ZM0A 5L3EB 2V26A 2V7JA 2JMHA 5LG4A 3TKLB 5LNKA 5J2TE 4NUVA 1D1BA 4H9RC 2K9AA 2WSSV 3HA4A 4AQFC 3ZPOA 1MMGA 1D1AA 3HKDE 4KP3C 2EHOA 2D2SA 3ZYKA 2X9WA 5L3GB 3NZPA 2DWGA 4XZCA 1MNEA 3PUQA 5LOVE 3ETVA 4H9SE 3Q9DA 3PTRB 3LG7A 3KBUA 3LK2B 1OWAA 3NRXA 3ZN0B 2CWOA 3WAJA 3K8PC 3C64A 3OKQA 3BQLA 2CA5A 2X51A 3KV4A 3EUHA 4PJNA 1QUUA 2Y48B 3LBXA 4QXBB 2CLYB 3QUJA 4ILUA 5FY1A 2MYSA 4UVCB 2X0LB 2EHOD 2OA5A 2PBIA 4WBOA 2XAFB 4QXHB 4PW8A 1E1HB 3K3NA 4MALA 3RYCE 4P09A 2CXDA 2CWYA 3K3OA 4IE0A 2UXNB 5CB4E 2G0UA 3P8CD 3N9MA 2M67A 5ETWA 2BVMA 3O4XE 3BQKA 1QSDA 3RC3A 5HXHA 2X66A 2K48A 2CXLA 4UELA 3VHLA 2ZM8A 3AVSA 3KV6A 3Q5XA 5LHIB 4ZI3D 3C4WA 2XAGB 4AKGA 4AKRB 4JEHB 3AAEB 3I0OA 1ZV4X 4MLKA 4AKLA 4BJMA 3ZMVB 3PU3A 3B13A 5H6QB 1HG2A 1U4QA 2LE8A 4I50E 3ONXA 3K3QC 2CEAA 2VKOA 4PJMA 2Y6XA 5LJMA 1KNZA 4QX7B 3CMLA 2IC6A 3CQXC 2LEHA 4U72A 4H9QC 1HCIA 3KDSE 4QWNB 4TV8E 3GWHA 4GK0E 4EYYR 5HXRA 5JDMA 3ZCIA 3ZN1B 5M4YA 4PK5A 2Y8DA 5LHHB 1MMNA 4AQGA 2GK9A 3FHNA 5JRCA 2MTQA 4AQFA 1LKXA 3GMIA 2NW7A 3FB2A 4UV8B 3ZMSB 3HKCE 2BVLA 4F6RC 1LVKA 1HG5A 4C90A 3RYIE 2E9XD 1US7B 2VK9A 5HXCA 5L3DB 1FMVA 3MK7C 4QHOA 4KMCA 4PFOA 4H9NC 3A5XA 4X20E 1BR2A 1S35A 5F3JA 4YHJA 4HTEA 2BDEA 4BJNA 3Q2MA 4YJ3E 2LM9A 3ZC1A 3N9NA 2C5JA 1HTJF 4JUYA 4DMVA 4EZHA 4CI3B 4AKHA 4DBQA 3RX6A 1UCUA 4AXPA 3IEEA 2JRKA 2UXXB 2JPFA 5FY7A 3L09A 4O4LE 4HGAA 4KBMB 2NWBA 5KX5E 2ZMAA 2LHRA 2QA7A 3CVRA 4UF0A 3ETUA 2W62A 4E7SA 2MOZA 3KV9A 5ADXL 4JLEA 3OYXA 2NW8A 4HEAA 4V1Av 4ZOLE 3ZYMA 4DBRA 3U78A 2VKJA 2LSJA 3PUGA 2LOPA 1D1CA 3KINB 2Q9QA 2J1DG 3N2KE 5LXTE 2XAJB 2LSIA 3NZQA 3FXEB 3OJAA 4I43B 5HWYA 3RYFE 2VKHA 1ZHCA 4DO0A 5LGUB 1BR0A 3HL6A 3O1IA 5L3BB 4GIWA 4I55E 4P0BA 3FBZA 3WAKA 5KMGP 2X68A 2MBGA 1T98A 2YINA 3E22E 3O1HA 3RYHE 3SWHA 3OYZA 4H63V 1NAFA 2C5KT 3MZKB 3RPUA 3E0ZA 4C91A 3IF8B 5F8PA 4X1YE 2K5BB 3HI2A 4IE5A 4EXTA 1UX4A 1D0ZA 1HF8A 3BK9A 5JDHA 1YD8G 4UEMA 1H7CA 5FXZA 3UULA 4X1IE 2XASB 5LA6E 4TV9E 2KLQA 3J9X1 2V7LA 5FNVE 4ISSA 3CX6B 4IE4A 4MBQA 2NW9A 3GA8A 1YW0A 3ZEFB 2D5UA 4EIWA 4UXNB 3ZJ1A 5FXXA 4A56A 3I9YA 2KT9A 4YLHA 3JC6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXL A;  3CWZ B;  2DWG A;  2DWK A;  4GIW A;  2CXF A; 
#chains in the Genus database with same CATH topology
 4HWD A;  4IDP A;  5JR9 C;  1CHU A;  2EHO B;  4QX8 B;  3RRW A;  4ADZ A;  4L9I A;  3UU6 A;  5L47 A;  2V1D B;  2XHE B;  1MMA A;  4X65 T;  2KXP B;  2IUB A;  2WWU A;  3AVR A;  3D0T A;  4HFV A;  2XQY A;  3P4S A;  2N9D A;  4ZS3 A;  4LF7 T;  1MMD A;  3C51 A;  4PK4 A;  3ZC0 A;  2FJD A;  2WAU A;  2BG9 C;  1WYC A;  1VOM A;  2SPC A;  3ZCJ A;  1N32 T;  3PUA A;  4PJL A;  1XWM A;  1WLX A;  4Z8X A;  2PFV A;  2QGS A;  5LMU T;  4JEU B;  3T1H T;  2DWK A;  4UR9 A;  5AQS B;  5LHG B;  1JNZ A;  3E08 A;  3RC8 A;  1D0Y A;  4Z91 A;  4PJJ A;  1FJG T;  2B1E A;  2JQQ A;  4JI1 T;  5AQG B;  5AQH B;  3I0Q A;  3UUN A;  4PFP A;  3AED A;  5DQV A;  2E9X B;  4IGU A;  5CA0 E;  3L39 A;  1IBK T;  2E9X C;  4G2A A;  4OHF A;  3VKH A;  2DCF A;  4ZXL A;  3KV5 A;  2XQ4 A;  4LFA T;  1T72 A;  2QRX A;  1YQ4 A;  3P7I A;  5FP3 A;  5LBM A;  2H7O A;  5JDQ A;  2J47 A;  3EAM A;  3ZJ2 A;  2X9Y A;  2NOX A;  4CI2 B;  5IUX A;  1T8B A;  4GOU A;  5KDM C;  1Y01 A;  1SE7 A;  3ZMZ B;  3UUM A;  4JI3 T;  2Q9Q C;  3PDY A;  2W61 A;  5L4H A;  4KX6 A;  4CZZ B;  4WYV A;  3OPC A;  4H9O C;  2A2F X;  4EZ4 A;  4ILA A;  3QK6 A;  5IYZ E;  4XAX B;  4LF9 T;  2J4G A;  3UFE A;  3UTK A;  1MIV A;  2WZI A;  1OED E;  4IT4 A;  2XY8 B;  3ZYL A;  1IBL T;  3R84 B;  4LMJ A;  3V5S A;  2C5I T;  2JQK A;  3P4R A;  3EHZ A;  3PE0 A;  4DND A;  5DJQ C;  2EHO C;  2DHR A;  2HN2 A;  2LRK A;  3RRC A;  4ZS2 A;  3AA6 B;  2Q9Q B;  2VB6 A;  1Z8U A;  3S4U A;  4A98 A;  3OTO T;  4DV7 T;  2ACX A;  4BA9 A;  2WB5 A;  2LKG A;  3C50 A;  3N9Q A;  4HWI B;  3VRA A;  1WRD A;  3PUZ F;  2KMF A;  3I9W A;  3H3M A;  4YTN A;  2E5V A;  4ZI2 D;  2W2U A;  5L3C B;  5LGT B;  2FBW A;  4IL9 A;  3AB3 B;  5LGN B;  3J7Y q;  4O2A E;  2BG9 A;  1HX1 B;  2QYW A;  2BG9 E;  2LOS A;  4X20 E;  5JDG A;  2UXC T;  2VAS A;  2VL0 A;  2VWA A;  4UF0 B;  2V7M A;  1KK7 A;  4U31 A;  4IE6 A;  5FMN A;  4KUM B;  4CXX A;  2NP9 A;  3MJX A;  2H3R A;  3MAC A;  4B6X A;  3DTO A;  4EYU A;  4DR6 T;  3AE4 A;  1Z0P A;  5FXW A;  3IBP A;  3A7M A;  2N1G A;  5JR9 A;  1WR6 A;  5AFU L;  2X9H A;  2CBI A;  2N2N A;  2YEV C;  3JAF A;  3RIA A;  2LSG A;  3V5U A;  4IST A;  4JI2 T;  4CXY A;  5AQN B;  1MND A;  3NKZ A;  1ZP0 A;  4UIG A;  4MFR A;  3JC6 D;  5TAO A;  2BG9 B;  1IBM T;  2Z6E A;  1OED A;  3LK4 2;  3ZT6 A;  1SA0 E;  4PK6 A;  4LF5 T;  3W15 B;  4LF4 T;  2XJ7 A;  2K3W A;  3NWI A;  5LBQ B;  1YXR A;  3RLF F;  3F57 A;  1YKE B;  4EAH A;  2LSK A;  2L3L A;  3NBX X;  3QB5 A;  3R6N A;  2HH7 A;  1LRZ A;  2FUP A;  4HFH A;  3HKB E;  4DUY T;  1XMQ T;  4K0U A;  5LB7 B;  1BR1 A;  3ANW A;  4H63 H;  4TUY E;  4TZ4 C;  1KFY A;  5JR9 B;  3L3P A;  1U5P A;  2PG8 A;  1XZY A;  4G63 A;  2CBJ A;  5HCJ A;  3RH3 A;  2CMR A;  1OED C;  4H9P C;  4IIJ E;  2CXF A;  5H6R B;  1UUR A;  2CM0 A;  5AQL B;  4HFD A;  5HWX A;  3C98 B;  2W67 A;  3N9L A;  3UFG A;  3ZT5 A;  2L9Q A;  2OLT A;  2KND A;  2CE7 A;  2DLR A;  3HR0 A;  4X1K E;  3PU8 A;  2XTL A;  3DP7 A;  5AQM B;  4KI0 F;  4NUU A;  5LCY A;  2WU5 A;  3ZMT B;  2CCQ A;  3UT5 E;  4GYS A;  5JRE A;  1M62 A;  1B7T A;  1Y64 B;  2HPJ A;  1FMW A;  1LVF A;  2I6H A;  1KEY A;  2A72 A;  1NWM X;  2PJQ A;  2JQ9 A;  1OXZ A;  2W63 A;  2WMO A;  2V7I A;  3CQC B;  3FZF B;  4AI6 A;  3OBV E;  5L2L A;  4CXW A;  2LJL A;  4CI1 B;  5KXJ A;  3PUX F;  2KWH A;  3KBT A;  2ODU A;  2BZB A;  3LJC A;  3PUS A;  4ASK A;  2L8K A;  2XAQ B;  2LHN A;  2LSY A;  2WU2 A;  4JYA T;  2WZH A;  3LSV A;  4HFE A;  5LJN A;  2XSB A;  3VR8 A;  2HHH T;  3C4Z A;  4YJ2 E;  1IJ5 A;  2ZLY A;  3CIR A;  3SFD A;  4JI7 T;  3AEE A;  3NVO A;  4TX5 A;  5JVD E;  3F31 A;  4PAG A;  5DAB A;  2ES0 A;  2F4V T;  3MXZ A;  3QC9 A;  2RP4 A;  2WMN A;  4B3S T;  3TLT A;  4LFB T;  1DU2 A;  2H89 A;  2IIU A;  4QH4 A;  4DV6 T;  2V8S V;  1N36 T;  3EI0 A;  2E5L T;  3ZKR A;  1W0B A;  3C4X A;  4J2C A;  3AEF A;  4L5G A;  4YFS A;  5JDF A;  3N9O A;  4JI8 T;  2XUE A;  5LYJ E;  2XQ8 A;  3AAI A;  4OYK A;  2UXB T;  3P4Q A;  1EZ3 A;  3AE5 A;  4OFZ A;  4PNI A;  1FEW A;  4WNK A;  4ZI7 E;  5JQG E;  4DV4 T;  2K24 A;  3AE3 A;  3B57 A;  3LK3 B;  3P4W A;  1VCS A;  2WDV A;  4ZI2 C;  2LT3 A;  2LM2 A;  3CWZ B;  5AQT B;  1ZKE A;  2KSR A;  3CK6 A;  4E7Z A;  2WDR A;  4EGW A;  4DV1 T;  1BR4 A;  4WW0 A;  4GYR A;  3F2E A;  4UV9 B;  3UU3 A;  5CA1 E;  4JI5 T;  5A1L A;  2CHO A;  4UVB B;  2ODV A;  2HN1 A;  5JTG A;  1AJ3 A;  5AQJ B;  2YOE A;  1UX5 A;  3MKD A;  4AKI A;  5FL1 A;  4U74 A;  5E0O A;  4DV2 T;  2X9X A;  4AQY T;  4A97 A;  3UUB A;  4O8S A;  2E9X A;  3AEC A;  2H7V C;  3U3I A;  1X79 A;  4OK0 A;  2WS3 A;  4LF8 T;  4YSX A;  3AA1 B;  5BMV E;  3I1A A;  3T8O A;  3AE8 A;  3EDV A;  4HE8 A;  2BS2 A;  1J5E T;  2IAK A;  2UUB T;  4B3M T;  1V9D A;  4OYJ A;  2VVS A;  2XQ7 A;  3QNU A;  4IDZ A;  4COF A;  5HYA A;  2YK0 A;  2FJB A;  2IC9 A;  5C8Y E;  3IHR A;  5EK3 A;  2XQ5 A;  2YU1 A;  3CKD A;  2YU2 A;  2BBH A;  1D0X A;  3HKE E;  2OV9 A;  3KFW X;  3O9X A;  2Q9Q D;  2V7K A;  4EB6 E;  4LFC T;  1IZN B;  1O3X A;  3KVA A;  3AAA B;  3RKO A;  5J0Z A;  5IWA T;  2WM9 A;  2AXD S;  2ZM2 A;  5HEU A;  2X0Y A;  4ANJ A;  5JRC B;  2VVN A;  1S94 A;  1XDP A;  2DL1 A;  2E8I A;  3AA0 B;  4EEB A;  2V5D A;  4DVD A;  3MA9 A;  4ZHQ E;  5JDN A;  5JH7 E;  4CQI A;  1WR0 A;  1YKH B;  5JDL A;  4O4H E;  1I94 T;  2UU9 T;  1MIY A;  4MHC A;  4QXC B;  4M1P A;  5GON E;  2VL8 A;  4UVA B;  4P0A A;  4DR7 T;  3PJA J;  5AQQ B;  3Q5E A;  2XAH B;  5IHY A;  5LG3 A;  2V5C A;  2WY2 A;  3SS1 A;  4ERR A;  5ABF B;  2JJ9 A;  2W4X A;  2KWI B;  3AE7 A;  3EDU A;  3N5L A;  3N2O A;  3O1J A;  4I4T E;  4L0R A;  4QKN A;  5J2U E;  4FJO A;  1HX8 A;  4TWF A;  4DMW A;  3FBL A;  1WYB A;  1E2A A;  2KIN B;  2X67 A;  4IE7 A;  5LP6 E;  5EZY E;  1XNR T;  3ESL A;  3B5M A;  4IDQ A;  1E7P A;  3CPZ A;  4TWH A;  1KF6 A;  2H88 A;  4HN9 A;  5AQO B;  3WI3 A;  2E2A A;  2XSA A;  3CQG B;  3GN5 A;  2RA1 A;  3N9P A;  3H3A A;  3QOF A;  2JMK A;  3FXD B;  3AEG A;  5HEG A;  3LFM A;  1G8X A;  1VRB A;  3VU7 H;  5EK4 A;  4EOZ B;  2IW5 B;  5HAX A;  2W0G A;  3RKG A;  5FYM A;  4CN6 A;  4ZZB A;  1MIW A;  2NTX A;  3LBX B;  1G73 A;  4HKA A;  2XPK A;  2I59 A;  1HFA A;  5EK2 A;  3VKG A;  3PJA A;  3ZMU B;  4FI5 A;  4JBW F;  5HXE A;  4XBF B;  1ZEE A;  2VKD A;  3KVB A;  3ANW B;  3NRY A;  5AQI B;  2KZ7 B;  4NXN T;  3SRZ A;  2D0T A;  4N78 D;  2HPL A;  4ZI3 C;  3M65 A;  4DV3 T;  4BAY B;  2V6Y A;  4GK5 E;  2DNX A;  4Q25 A;  4WBN E;  2A3D A;  5J1G A;  3BQI A;  5FXV A;  3GN5 B;  2CHN A;  4B3T T;  4AIU A;  1QLB A;  2XQA A;  1CUN A;  3UQ4 A;  1HNW T;  5AQK B;  3RF1 A;  3SFE A;  2YDR A;  1IAP A;  3EVY A;  4O2B E;  3SOL A;  3RQU A;  4O4J E;  1IJ6 A;  3H37 A;  3QB5 K;  2WBL A;  2W00 A;  5ABF A;  2XM2 A;  2BKO A;  4TN7 B;  3UUX B;  2A9U A;  3N2G E;  4I0U A;  2JIW A;  3CX7 B;  3ZSS A;  5HXS A;  1N33 T;  3AA7 B;  4IHJ E;  1W09 A;  1HS7 A;  5AQU B;  1R8I A;  3CX8 B;  2NTY A;  2D0U A;  1NEN A;  1SHZ C;  4O4I E;  5L3F B;  2CLY C;  3DJB A;  3PUR A;  3TLW A;  3Q5W A;  2DI4 A;  2P9B A;  2XZE A;  2BS4 A;  1FIO A;  2C0S A;  2ZM0 A;  2WQY A;  5DQW A;  2V26 A;  5L3E B;  1HNX T;  2WDQ A;  2XQ9 A;  2V7J A;  2JMH A;  5LG4 A;  2UXD T;  3RIU C;  4A5X A;  3TKL B;  5LNK A;  5J2T E;  4ZZC A;  4NUV A;  1D1B A;  4IDO A;  4H9R C;  2K9A A;  4LML A;  2WSS V;  3HA4 A;  4YSZ A;  2UUC T;  2FJE A;  4AQF C;  3ZPO A;  4IL4 A;  1MMG A;  1D1A A;  2V6X A;  3HKD E;  4KP3 C;  2EHO A;  3P4P A;  2D2S A;  2M6I A;  1XMO T;  2R6G F;  3ZYK A;  3LDQ B;  3ONJ A;  2X9W A;  4TNV A;  2MAW A;  3TLU A;  2ZM6 T;  4GKK T;  5L3G B;  4TWD A;  3NZP A;  4LMK A;  3UU8 A;  2DWG A;  2J62 A;  2M6B A;  2PTF A;  3AXJ B;  4XZC A;  1JNR A;  1MNE A;  3PUQ A;  5LOV E;  3ETV A;  4YTP A;  4H9S E;  3Q9D A;  4DR4 T;  3PTR B;  5HEO A;  3T1Y T;  3LG7 A;  2BKP A;  3KBU A;  4HFI A;  2I0M A;  3LK2 B;  1OWA A;  3NRX A;  2YDQ A;  3ZN0 B;  2CWO A;  3WAJ A;  2AE9 A;  3ZT7 A;  1XDO A;  3VR9 A;  3K8P C;  3C64 A;  3OKQ A;  4EV6 A;  3UU4 A;  3BQL A;  2CA5 A;  2X51 A;  3KV4 A;  3EUH A;  5FL0 A;  4NIQ A;  1QUU A;  4PJN A;  2Y48 B;  4YSY A;  1X9B A;  4ZEY A;  3FZM B;  1W0A A;  1YQ3 A;  3LBX A;  2CLY B;  3QUJ A;  4QXB B;  4TNW A;  4ILU A;  5FY1 A;  2MYS A;  4UVC B;  2VQE T;  1WCR A;  2X0L B;  4KHZ F;  2EHO D;  2OA5 A;  2PBI A;  4X62 T;  4WBO A;  2XAF B;  2QVA A;  4QXH B;  3K1S A;  5FY0 A;  3FZH B;  4PW8 A;  1E1H B;  2IHR 1;  3K3N A;  4MAL A;  3PV0 F;  3RGL A;  3RYC E;  4KHP T;  4P09 A;  2CXD A;  2CWY A;  3K3O A;  4IE0 A;  5HCM A;  3UU5 A;  2MPK A;  4WZX A;  1XNQ T;  4B3R T;  2UXN B;  5CB4 E;  2G0U A;  3P8C D;  3N9M A;  2LKH A;  2M67 A;  5ETW A;  4YXD A;  2BVM A;  3ABV A;  3FZL B;  3O4X E;  3BQK A;  4U2Z A;  4IDN A;  1QSD A;  3RC3 A;  5HXH A;  2X66 A;  2K48 A;  2CXL A;  4UEL A;  4X5T A;  3VHL A;  5LMN T;  4DR1 T;  2ZM8 A;  3AVS A;  3KV6 A;  3Q5X A;  5LHI B;  4ZI3 D;  3C4W A;  2XAG B;  4YLH A;  4AKG A;  4NXM T;  2RPA A;  4AKR B;  4JEH B;  5AQP B;  3AAE B;  1VCT A;  3VRB A;  3I0O A;  3ZST A;  1ZV4 X;  4YT0 A;  2FJA A;  4MLK A;  4NPP A;  5FVL A;  3TLS A;  4AKL A;  3ZMV B;  2NR4 A;  3B13 A;  3PU3 A;  5H6Q B;  4BJM A;  1HG2 A;  1U4Q A;  2LE8 A;  1WFD A;  4I50 E;  5CFB A;  5ABG A;  3ONX A;  3K3Q C;  2CEA A;  2CPT A;  2VKO A;  4PJM A;  4LF6 T;  2Y6X A;  5LJM A;  1KNZ A;  4QX7 B;  3CML A;  2IC6 A;  3CQX C;  2LEH A;  4DUZ T;  4YTM A;  4U72 A;  4H9Q C;  1HCI A;  3KDS E;  4QWN B;  4TV8 E;  3GWH A;  3PUV F;  4GK0 E;  4DV5 T;  5AQR B;  4EYY R;  5HXR A;  2D9D A;  3ZCI A;  5JDM A;  3RIF A;  2UUA T;  3ZN1 B;  5M4Y A;  4PK5 A;  2Y8D A;  4AIS A;  4DR3 T;  5LHH B;  1MMN A;  4AQG A;  2GK9 A;  3FHN A;  5JRC A;  2MTQ A;  4AQF A;  2WP9 A;  1LKX A;  3GMI A;  3JAE A;  2BS3 A;  1NEK A;  2NW7 A;  3FB2 A;  3Q5D A;  4UV8 B;  3ZMS B;  3HKC E;  5C3J A;  2BVL A;  4F6R C;  1LVK A;  1HG5 A;  4C90 A;  5AQF B;  4GKJ T;  3RYI E;  2E9X D;  1US7 B;  2VK9 A;  4DR2 T;  5HXC A;  5L3D B;  4K0K T;  3A8Y C;  1HNZ T;  1FMV A;  3MK7 C;  4QHO A;  4KMC A;  4PFO A;  4H9N C;  3A5X A;  4QH5 A;  1BR2 A;  1S35 A;  3IA3 A;  4U7Y A;  1KNP A;  4Z90 A;  3X1D A;  4YHJ A;  5F3J A;  4HTE A;  2BDE A;  4BJN A;  2XQ6 A;  3RI5 A;  2V6Y B;  3Q2M A;  4DR5 T;  4YJ3 E;  2LM9 A;  5FVK A;  3ZLI A;  2ACZ A;  5ABE A;  4X66 T;  3ZC1 A;  2VQF T;  2IDO B;  3N9N A;  4IRE A;  2C5J A;  1HTJ F;  4JUY A;  3PUY F;  4DMV A;  3AE1 A;  4EZH A;  4CI3 B;  4AKH A;  4DBQ A;  4P1N A;  3RX6 A;  1UCU A;  4AXP A;  3M3Z B;  3AE6 A;  3IEE A;  2JRK A;  2UXX B;  2JPF A;  5AQV B;  5FY7 A;  3L09 A;  4ILB A;  4O4L E;  4QH1 A;  4HGA A;  3AEA A;  4KBM B;  3RIU A;  2NWB A;  5KX5 E;  4X64 T;  2ZMA A;  2LHR A;  3AE9 A;  2QA7 A;  3CVR A;  3G06 A;  4UF0 A;  1J5W A;  4JI0 T;  2XM1 A;  2W62 A;  3ETU A;  4E7S A;  2MOZ A;  3KV9 A;  5ADX L;  4JLE A;  3OYX A;  2NW8 A;  4HEA A;  4V1A v;  4ZOL E;  3TLV A;  4CN1 A;  4OX9 T;  3ZYM A;  4DBR A;  3U78 A;  2VKJ A;  2LSJ A;  3AEB A;  4HWH A;  2JQH A;  2W66 A;  5C2T A;  3PUG A;  2LOP A;  1D1C A;  5CJ5 A;  2YN6 A;  3KIN B;  2Q9Q A;  2BKN A;  2J1D G;  3N2K E;  5LXT E;  2XAJ B;  3EAB A;  2LSI A;  5HEH A;  3NZQ A;  1KNR A;  3FXE B;  3OJA A;  4I43 B;  2VUR A;  4YY3 T;  4HFB A;  5HWY A;  3RYF E;  2VKH A;  1ZHC A;  1L0V A;  4DO0 A;  5LGU B;  1BR0 A;  1N34 T;  3HL6 A;  1W9R A;  3RQW A;  1SUM B;  2XQ3 A;  3O1I A;  5L4E A;  5L3B B;  4GIW A;  4I55 E;  4P0B A;  3FBZ A;  3WAK A;  2B76 A;  3AXJ A;  4CN4 A;  5KMG P;  4JI6 T;  2X68 A;  2MBG A;  2BBJ A;  3L8R A;  3AE2 A;  1T98 A;  4JI4 T;  2YIN A;  2LRL A;  3E22 E;  3O1H A;  3RYH E;  1ZOY A;  4ILC A;  3SWH A;  5ABH A;  3OYZ A;  4U7I A;  4H63 V;  5BR8 T;  4YHH T;  1NAF A;  2C5K T;  3MZK B;  2WWV A;  3RPU A;  3E0Z A;  4C91 A;  3IF8 B;  2CRB A;  3RHW A;  4U3C A;  5HEJ A;  1UK5 A;  2YKS A;  4HFC A;  5F8P A;  4X1Y E;  4EED A;  1GQE A;  3FZK B;  4F8H A;  3JCF A;  2K5B B;  1J1J A;  3ONL C;  2LLY A;  3HI2 A;  4IE5 A;  3PUW F;  5FKY A;  1UX4 A;  1D0Z A;  1HF8 A;  3BK9 A;  2IML A;  4EXT A;  5JDH A;  4HWF A;  1YD8 G;  4HWC A;  4UEM A;  1H7C A;  5FXZ A;  3UUL A;  5CGM A;  1I6Z A;  4X1I E;  2XAS B;  3OVU A;  5LA6 E;  1HR0 T;  4TV9 E;  2KLQ A;  4U33 A;  3J9X 1;  3JAD A;  1M7K A;  2V7L A;  5FNV E;  4ISS A;  4DV0 T;  3CX6 B;  4IE4 A;  4MBQ A;  5F5W A;  2NW9 A;  3GA8 A;  1YW0 A;  2YDS A;  1UUS A;  4U2Y A;  3ZEF B;  3UQ7 A;  2D5U A;  4DID B;  4EIW A;  4UXN B;  1OED B;  3ZJ1 A;  2WCA A;  5FXX A;  3P50 A;  4JV5 T;  4A56 A;  3I9Y A;  2KT9 A;  2X0H A;  1UGO A;  1T7S A;  3JC6 C; 
#chains in the Genus database with same CATH homology
 5JR9 C;  3RRW A;  2EHO B;  4QX8 B;  4ADZ A;  4L9I A;  2V1D B;  2XHE B;  1MMA A;  2KXP B;  2WWU A;  3D0T A;  3AVR A;  4HFV A;  2XQY A;  2N9D A;  4ZS3 A;  1MMD A;  3C51 A;  4PK4 A;  3ZC0 A;  2WAU A;  1WYC A;  1VOM A;  2SPC A;  3ZCJ A;  3PUA A;  4PJL A;  1WLX A;  4Z8X A;  2PFV A;  2QGS A;  4JEU B;  2DWK A;  5LHG B;  3RC8 A;  3E08 A;  1D0Y A;  4PJJ A;  2B1E A;  2JQQ A;  3I0Q A;  3UUN A;  4PFP A;  5DQV A;  2E9X B;  4IGU A;  5CA0 E;  2E9X C;  4G2A A;  4OHF A;  3VKH A;  2DCF A;  3KV5 A;  3P7I A;  5FP3 A;  5LBM A;  5JDQ A;  2H7O A;  3ZJ2 A;  2X9Y A;  2NOX A;  4CI2 B;  5KDM C;  4GOU A;  3ZMZ B;  3UUM A;  2Q9Q C;  3PDY A;  2W61 A;  4CZZ B;  4EZ4 A;  4H9O C;  2A2F X;  3QK6 A;  5IYZ E;  4XAX B;  3UTK A;  1MIV A;  3ZYL A;  3R84 B;  3V5S A;  2C5I T;  3PE0 A;  4DND A;  5DJQ C;  2EHO C;  2DHR A;  3RRC A;  4ZS2 A;  3AA6 B;  2Q9Q B;  2VB6 A;  3S4U A;  2ACX A;  4BA9 A;  3C50 A;  3N9Q A;  1WRD A;  2KMF A;  3I9W A;  4ZI2 D;  5L3C B;  3J7Y q;  3AB3 B;  5LGN B;  4O2A E;  5JDG A;  2LOS A;  2VAS A;  4UF0 B;  2VWA A;  4CXX A;  2V7M A;  1KK7 A;  5FMN A;  4IE6 A;  4KUM B;  2NP9 A;  3MJX A;  2H3R A;  3MAC A;  4B6X A;  3DTO A;  4EYU A;  1Z0P A;  5FXW A;  3IBP A;  2N1G A;  5JR9 A;  1WR6 A;  5AFU L;  2X9H A;  2N2N A;  2YEV C;  2LSG A;  3V5U A;  4IST A;  4CXY A;  1MND A;  4UIG A;  4MFR A;  3JC6 D;  5TAO A;  2Z6E A;  3LK4 2;  1SA0 E;  4PK6 A;  3W15 B;  5LBQ B;  4YJ2 E;  3F57 A;  1YKE B;  4EAH A;  2LSK A;  2L3L A;  3NBX X;  3R6N A;  2HH7 A;  1LRZ A;  3HKB E;  4K0U A;  1BR1 A;  3ANW A;  4H63 H;  4TUY E;  4TZ4 C;  5JR9 B;  3L3P A;  1U5P A;  2PG8 A;  4G63 A;  3RH3 A;  2CMR A;  4H9P C;  4IIJ E;  2CXF A;  5H6R B;  2CM0 A;  5HWX A;  3C98 B;  3N9L A;  3O9X A;  2L9Q A;  4X1K E;  2KND A;  2CE7 A;  2DLR A;  3HR0 A;  3PU8 A;  2XTL A;  3DP7 A;  4NUU A;  5LCY A;  3ZMT B;  2CCQ A;  3UT5 E;  4GYS A;  5JRE A;  2HPJ A;  1B7T A;  1Y64 B;  2PJQ A;  1FMW A;  1LVF A;  2W63 A;  2A72 A;  3LJC A;  1NWM X;  1OXZ A;  2WMO A;  3CQC B;  2V7I A;  4AI6 A;  3OBV E;  5L2L A;  4CXW A;  2LJL A;  4CI1 B;  2KWH A;  3KBT A;  2ODU A;  2BZB A;  3PUS A;  4ASK A;  2L8K A;  2XAQ B;  2LHN A;  2LSY A;  5LJN A;  3C4Z A;  1IJ5 A;  2ZLY A;  4TX5 A;  5JVD E;  3F31 A;  4PAG A;  5DAB A;  2ES0 A;  3MXZ A;  3QC9 A;  2RP4 A;  2WMN A;  3C4X A;  4J2C A;  4L5G A;  4YFS A;  5JDF A;  3N9O A;  2XUE A;  3AAI A;  4OYK A;  1EZ3 A;  4OFZ A;  5JQG E;  4PNI A;  1FEW A;  4WNK A;  4ZI7 E;  2K24 A;  3B57 A;  3LK3 B;  4ZI2 C;  2LT3 A;  3CWZ B;  1ZKE A;  4E7Z A;  1BR4 A;  4WW0 A;  4GYR A;  3F2E A;  4UV9 B;  5CA1 E;  5A1L A;  4UVB B;  2ODV A;  1AJ3 A;  4AKI A;  1UX5 A;  3MKD A;  4U74 A;  5E0O A;  2X9X A;  4O8S A;  2E9X A;  2H7V C;  3U3I A;  1X79 A;  4OK0 A;  5BMV E;  3AA1 B;  3I1A A;  3T8O A;  3EDV A;  4HE8 A;  2IAK A;  1V9D A;  4OYJ A;  4IDZ A;  5HYA A;  2YK0 A;  2IC9 A;  5C8Y E;  3IHR A;  5EK3 A;  2YU1 A;  3CKD A;  2YU2 A;  1D0X A;  3HKE E;  3KFW X;  2Q9Q D;  2V7K A;  4EB6 E;  1IZN B;  1O3X A;  3KVA A;  3AAA B;  3RKO A;  2WM9 A;  2ZM2 A;  4ANJ A;  5JRC B;  1S94 A;  2E8I A;  5JH7 E;  3AA0 B;  5LYJ E;  4DVD A;  3MA9 A;  4ZHQ E;  5JDN A;  4CQI A;  1YKH B;  5JDL A;  4O4H E;  1MIY A;  4MHC A;  4QXC B;  4M1P A;  5GON E;  2VL8 A;  4UVA B;  4P0A A;  5IHY A;  2XAH B;  3SS1 A;  4ERR A;  2JJ9 A;  3EDU A;  2KWI B;  3N5L A;  3O1J A;  3N2O A;  4L0R A;  4QKN A;  4I4T E;  3ZLI A;  5J2U E;  5LGT B;  4FJO A;  1HX8 A;  4DMW A;  3FBL A;  1WYB A;  2KIN B;  2X67 A;  4IE7 A;  5LP6 E;  5EZY E;  3ESL A;  3CPZ A;  3WI3 A;  4HN9 A;  3GN5 A;  3CQG B;  2RA1 A;  3N9P A;  3H3A A;  2JMK A;  3FXD B;  3LFM A;  1G8X A;  1VRB A;  3VU7 H;  5EK4 A;  4EOZ B;  2IW5 B;  5HAX A;  2W0G A;  5FYM A;  1MIW A;  2NTX A;  3LBX B;  1G73 A;  4HKA A;  2I59 A;  1HFA A;  5EK2 A;  3VKG A;  3ZMU B;  4FI5 A;  5HXE A;  4XBF B;  1ZEE A;  2VKD A;  3KVB A;  3ANW B;  3NRY A;  2KZ7 B;  3SRZ A;  2D0T A;  4N78 D;  2HPL A;  4ZI3 C;  3M65 A;  4BAY B;  4GK5 E;  2DNX A;  4WBN E;  2A3D A;  5J1G A;  3BQI A;  5FXV A;  3GN5 B;  1CUN A;  1IAP A;  3EVY A;  4O2B E;  3SOL A;  4O4J E;  1IJ6 A;  3H37 A;  2WBL A;  2W00 A;  4TN7 B;  3UUX B;  3N2G E;  5HXS A;  3CX7 B;  3AA7 B;  4IHJ E;  1HS7 A;  3CX8 B;  2NTY A;  2D0U A;  1SHZ C;  4O4I E;  5L3F B;  2CLY C;  3DJB A;  3PUR A;  3UFE A;  3Q5W A;  2DI4 A;  2P9B A;  5FY0 A;  5DQW A;  1FIO A;  2C0S A;  2ZM0 A;  5L3E B;  2V26 A;  2V7J A;  2JMH A;  5LG4 A;  3TKL B;  5LNK A;  5J2T E;  4NUV A;  1D1B A;  4H9R C;  2K9A A;  2WSS V;  3HA4 A;  4AQF C;  3ZPO A;  1MMG A;  1D1A A;  3HKD E;  4KP3 C;  2EHO A;  2D2S A;  3ZYK A;  2X9W A;  5L3G B;  3NZP A;  2DWG A;  4XZC A;  1MNE A;  3PUQ A;  5LOV E;  3ETV A;  4H9S E;  3Q9D A;  3PTR B;  3LG7 A;  3KBU A;  3LK2 B;  1OWA A;  3NRX A;  3ZN0 B;  2CWO A;  3WAJ A;  3K8P C;  3C64 A;  3OKQ A;  3BQL A;  2CA5 A;  2X51 A;  3KV4 A;  3EUH A;  4PJN A;  1QUU A;  2Y48 B;  3LBX A;  4QXB B;  2CLY B;  3QUJ A;  4ILU A;  5FY1 A;  2MYS A;  4UVC B;  2X0L B;  2EHO D;  2OA5 A;  2PBI A;  4WBO A;  2XAF B;  4QXH B;  4PW8 A;  1E1H B;  3K3N A;  4MAL A;  3RYC E;  4P09 A;  2CXD A;  2CWY A;  3K3O A;  4IE0 A;  2UXN B;  5CB4 E;  2G0U A;  3P8C D;  3N9M A;  2M67 A;  5ETW A;  2BVM A;  3O4X E;  3BQK A;  1QSD A;  3RC3 A;  5HXH A;  2X66 A;  2K48 A;  2CXL A;  4UEL A;  3VHL A;  2ZM8 A;  3AVS A;  3KV6 A;  3Q5X A;  5LHI B;  4ZI3 D;  3C4W A;  2XAG B;  4AKG A;  4AKR B;  4JEH B;  3AAE B;  3I0O A;  1ZV4 X;  4MLK A;  4AKL A;  4BJM A;  3ZMV B;  3PU3 A;  3B13 A;  5H6Q B;  1HG2 A;  1U4Q A;  2LE8 A;  4I50 E;  3ONX A;  3K3Q C;  2CEA A;  2VKO A;  4PJM A;  2Y6X A;  5LJM A;  1KNZ A;  4QX7 B;  3CML A;  2IC6 A;  3CQX C;  2LEH A;  4U72 A;  4H9Q C;  1HCI A;  3KDS E;  4QWN B;  4TV8 E;  3GWH A;  4GK0 E;  4EYY R;  5HXR A;  5JDM A;  3ZCI A;  3ZN1 B;  5M4Y A;  4PK5 A;  2Y8D A;  5LHH B;  1MMN A;  4AQG A;  2GK9 A;  3FHN A;  5JRC A;  2MTQ A;  4AQF A;  1LKX A;  3GMI A;  2NW7 A;  3FB2 A;  4UV8 B;  3ZMS B;  3HKC E;  2BVL A;  4F6R C;  1LVK A;  1HG5 A;  4C90 A;  3RYI E;  2E9X D;  1US7 B;  2VK9 A;  5HXC A;  5L3D B;  1FMV A;  3MK7 C;  4QHO A;  4KMC A;  4PFO A;  4H9N C;  3A5X A;  4X20 E;  1BR2 A;  1S35 A;  5F3J A;  4YHJ A;  4HTE A;  2BDE A;  4BJN A;  3Q2M A;  4YJ3 E;  2LM9 A;  3ZC1 A;  3N9N A;  2C5J A;  1HTJ F;  4JUY A;  4DMV A;  4EZH A;  4CI3 B;  4AKH A;  4DBQ A;  3RX6 A;  1UCU A;  4AXP A;  3IEE A;  2JRK A;  2UXX B;  2JPF A;  5FY7 A;  3L09 A;  4O4L E;  4HGA A;  4KBM B;  2NWB A;  5KX5 E;  2ZMA A;  2LHR A;  2QA7 A;  3CVR A;  4UF0 A;  3ETU A;  2W62 A;  4E7S A;  2MOZ A;  3KV9 A;  5ADX L;  4JLE A;  3OYX A;  2NW8 A;  4HEA A;  4V1A v;  4ZOL E;  3ZYM A;  4DBR A;  3U78 A;  2VKJ A;  2LSJ A;  3PUG A;  2LOP A;  1D1C A;  3KIN B;  2Q9Q A;  2J1D G;  3N2K E;  5LXT E;  2XAJ B;  2LSI A;  3NZQ A;  3FXE B;  3OJA A;  4I43 B;  5HWY A;  3RYF E;  2VKH A;  1ZHC A;  4DO0 A;  5LGU B;  1BR0 A;  3HL6 A;  3O1I A;  5L3B B;  4GIW A;  4I55 E;  4P0B A;  3FBZ A;  3WAK A;  5KMG P;  2X68 A;  2MBG A;  1T98 A;  2YIN A;  3E22 E;  3O1H A;  3RYH E;  3SWH A;  3OYZ A;  4H63 V;  1NAF A;  2C5K T;  3MZK B;  3RPU A;  3E0Z A;  4C91 A;  3IF8 B;  5F8P A;  4X1Y E;  2K5B B;  3HI2 A;  4IE5 A;  4EXT A;  1UX4 A;  1D0Z A;  1HF8 A;  3BK9 A;  5JDH A;  1YD8 G;  4UEM A;  1H7C A;  5FXZ A;  3UUL A;  4X1I E;  2XAS B;  5LA6 E;  4TV9 E;  2KLQ A;  3J9X 1;  2V7L A;  5FNV E;  4ISS A;  3CX6 B;  4IE4 A;  4MBQ A;  2NW9 A;  3GA8 A;  1YW0 A;  3ZEF B;  2D5U A;  4EIW A;  4UXN B;  3ZJ1 A;  5FXX A;  4A56 A;  3I9Y A;  2KT9 A;  4YLH A;  3JC6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...