4GIWA

Crystal structure of the run domain of human nesca
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
179
Chain Sequence
QKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLMYMPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RUN and SH3 domain-containing protein 1
publication title Crystal structure and functional implication of the RUN domain of human NESCA
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4giwA00
2DWKA 2CXLA 2DWGA 4GIWA 3CWZB 2CXFA
chains in the Genus database with same CATH superfamily
2XQ3A 2XM2A 3BQLA 1UCUA 3FB2A 3AAIA 3ZMUB 5LP6E 2IHR1 4TV8E 4O4LE 2W4XA 4GK5E 4HFDA 1VOMA 5JR9C 2Z6EA 2AXDS 1IBMT 4UIGA 1CUNA 5HYAA 3P8CD 1HNZT 4H9NC 3HL6A 1J5ET 1G73A 3L39A 3NKZA 2W00A 3L8RA 1X9BA 3UFGA 2YDSA 4I43B 2CXFA 2Q9QA 2K24A 2DLRA 4YHJA 5JVDE 4FJOA 3PUQA 4O8SA 1FMWA 3C4XA 4YHHT 2WBLA 5LJNA 2W66A 4PK5A 4GOUA 2X9XA 5AQSB 2LSYA 2AE9A 1V9DA 2XQYA 1HCIA 4GKJT 1MIYA 3C50A 2BKOA 3AE3A 1HG5A 2CXLA 3AE4A 3PE0A 3CX8B 3TLTA 4O4JE 3ZT7A 3KFWX 2BBJA 2CPTA 5C8YE 2XUEA 2LRKA 2VK9A 3CX6B 3RKOA 2XJ7A 2JMHA 2YU2A 4CXXA 2CWOA 1KF6A 4A56A 3AB3B 1MMNA 2ACXA 4A98A 2EHOB 4TUYE 5M4YA 2W61A 3PDYA 4AQGA 5H6RB 5F3JA 4DR1T 4IGUA 4U74A 1BR2A 2E2AA 5HEOA 4P09A 4BJMA 5EK3A 2N1GA 1J1JA 4DV2T 3AEDA 5AQNB 2NOXA 2WB5A 2X68A 3IBPA 3B13A 2NW9A 2YKSA 3MJXA 3ZJ1A 1NWMX 2N2NA 3TLWA 3KV4A 2PFVA 2PTFA 4CN4A 2DCFA 3N9NA 2C0SA 4JI8T 5JTGA 4JEHB 4ADZA 4QX7B 1T8BA 2WQYA 5FY7A 3RIUA 4U7IA 3AECA 2DWKA 2V7LA 4IE4A 2LSKA 2CCQA 3N5LA 2X67A 1D0YA 2FJAA 1M62A 2E8IA 3RRCA 4LF5T 3RIAA 2ES0A 2VURA 3CK6A 4UVCB 2JQ9A 5LHHB 2HN2A 2WWUA 3E0ZA 2RP4A 3RRWA 4ZOLE 4QH1A 2Q9QB 3H3MA 2KWHA 4DV0T 3IA3A 3ZYMA 4JI0T 2WM9A 2YOEA 3MKDA 1N36T 5FKYA 1IBLT 5LCYA 1BR1A 1NENA 4JLEA 2JQHA 3VRAA 5LGUB 3F31A 3AE6A 4JBWF 4NXMT 3PJAA 4CXWA 3FXDB 3JAFA 3AAEB 1YD8G 1N33T 3MK7C 4ZI3D 5FY1A 2NWBA 3AEEA 2CMRA 4QXHB 4WW0A 3ZPOA 5HEGA 2XASB 2G0UA 4WNKA 3WAKA 2XAJB 1SHZC 1T72A 2NW8A 2WS3A 1WR6A 4U3CA 4X64T 2J62A 4ISTA 3VKHA 4A97A 1VCTA 4OFZA 3JAEA 5FL1A 3NBXX 4JI4T 5CJ5A 3RGLA 5JDLA 3PV0F 2HPJA 4IDNA 4PJLA 3SWHA 2M67A 2ODVA 3LJCA 3RKGA 1R8IA 3AEGA 4QHOA 4UXNB 2BS4A 1UX5A 4I4TE 3ONXA 2V6XA 4EEBA 4KI0F 2WDVA 3K3NA 3AA6B 5HAXA 3RHWA 3B5MA 4TN7B 1M7KA 2XY8B 3AE5A 4IDOA 4X65T 4ZZBA 1MIWA 1UGOA 5FP3A 3ZSSA 4LF4T 4HN9A 4LFAT 3HA4A 2UUBT 5CGMA 2CLYB 4E7ZA 3K8PC 3ZMTB 1J5WA 2XQAA 2WU5A 3FZFB 4AKLA 3N9PA 4TNWA 2FUPA 5AQMB 5C3JA 4E7SA 5JDQA 4TZ4C 2NR4A 2IAKA 3LBXA 4JI6T 3EVYA 2D5UA 3LDQB 1WCRA 3AEAA 5LOVE 2E9XA 1QUUA 1SA0E 4IE7A 2C5IT 3GMIA 2VKHA 3HR0A 2YDRA 3ESLA 5EK2A 4H9RC 3FZMB 1O3XA 2ZM8A 3OBVE 1E1HB 3N9OA 1MNEA 4ZI2C 3S4UA 2WMOA 4LF8T 4O4HE 3P4RA 4CQIA 2XM1A 4YJ3E 1X79A 4HKAA 4UV8B 4LF7T 1KEYA 5LMNT 3RC3A 3UFEA 4EV6A 2OV9A 3FZLB 4YSZA 2UUAT 2IIUA 4IE6A 4ANJA 2V26A 3AEFA 3R6NA 2HN1A 1N32T 4H9QC 4C90A 4DBQA 1WLXA 2J1DG 3J7Yq 1XMQT 5ABGA 2XTLA 4YSYA 4DR7T 2CXDA 4X1IE 3LK2B 2CHNA 4CI3B 4QXBB 2I6HA 3UULA 1MIVA 4F8HA 2VB6A 5LJMA 2QGSA 4UELA 1ZEEA 3MA9A 3GWHA 4H63V 3T8OA 3FBLA 5AQLB 3CQCB 4ILUA 4PK4A 4PJNA 2XQ6A 5JR9A 2D2SA 2LM2A 4DUYT 2BZBA 2OLTA 5CA1E 3ZT6A 4ZI2D 4UF0A 2WY2A 4EZHA 3RI5A 5ADXL 5FXZA 2ACZA 2YK0A 5ABFA 5F5WA 2QYWA 5AQFB 1US7B 2W0GA 3JADA 4XZCA 3T1HT 2UXXB 2JJ9A 3AXJB 1QLBA 4ISSA 4LF9T 2PJQA 2WAUA 3RLFF 1W0AA 4PK6A 1FEWA 3MZKB 2UXCT 3PU3A 2X9HA 4H63H 4JI7T 4AKGA 1YKHB 2V7KA 5L3EB 5LHIB 2LKHA 3RIFA 3G06A 3KV9A 3NZQA 2YEVC 3VRBA 3O1JA 3RYIE 3J9X1 3M65A 3ZMSB 4HFCA 2WZHA 3LBXB 5L3CB 1WYBA 3WAJA 3V5UA 1T98A 2E9XB 2GK9A 2VL0A 5JDFA 4PJJA 2J47A 2KINB 5JRCA 2Y48B 3C98B 1GQEA 2QVAA 5LB7B 2C5JA 5HCMA 4HFVA 2XQ4A 3AA0B 4DBRA 4HWDA 4M1PA 2KXPB 2XQ7A 4KX6A 3UTKA 4WZXA 5FXXA 2UXDT 4ZI7E 3PTRB 4DV3T 4L9IA 3VKGA 2VKDA 2WDQA 5GONE 3PJAJ 3IF8B 3L3PA 5AQUB 4AQFC 2D9DA 1HX1B 2A9UA 3P4WA 4HFIA 4AKRB 4LFBT 3WI3A 2J4GA 3PUAA 4EXTA 4DV7T 1OXZA 2IUBA 2BG9C 3CQGB 4NPPA 3KINB 3ZSTA 2UUCT 4IE5A 4YTMA 2B1EA 2LSJA 5LMUT 3K3QC 4QWNB 1YW0A 3CX7B 2DWGA 5L2LA 5E0OA 4DR3T 3CQXC 5HXEA 3A5XA 4YLHA 3OVUA 3HKCE 2LOSA 3SOLA 3F2EA 3RYFE 2VKOA 5JR9B 2W63A 2XAHB 4IT4A 3QB5A 2XAFB 3KVBA 2WMNA 2M6IA 2OA5A 2VQFT 4UF0B 2C5KT 2DHRA 2XAGB 5AQTB 1XZYA 1XDOA 5ABFB 1UUSA 3AAAB 2FJDA 2YDQA 3CWZB 5HCJA 2X0HA 4HGAA 3ZC0A 4IL9A 5EK4A 2MOZA 2LT3A 4LMKA 4AXPA 1YQ3A 4ZI3C 3UUBA 3SS1A 5FMNA 4HWFA 1OEDC 5KXJA 2NTXA 3CKDA 2Y6XA 2VQET 3QB5K 4DR2T 3E08A 2VVSA 4G63A 1XWMA 4HFEA 4IE0A 2MAWA 4QXCB 4MFRA 2HH7A 2BKPA 4CZZB 3UT5E 1IZNB 2X0YA 5DABA 5J0ZA 2WZIA 3LFMA 3ZKRA 5BMVE 5AQJB 3UQ4A 3QK6A 5JRCB 3P4PA 3FHNA 1XDPA 1XMOT 4CI2B 2BVLA 2CBIA 5HEJA 2NW7A 1KK7A 2IC6A 2KZ7B 3Q5EA 3PUSA 3TLUA 4TWFA 4KHPT 2PG8A 3OYZA 2BS2A 4PJMA 4NXNT 2E5VA 4DV6T 5AQRB 3RPUA 5AQQB 2L9QA 3FBZA 2ZM0A 4B3TT 4U33A 4KP3C 4YSXA 1FJGT 2H7OA 4DVDA 4YY3T 1W9RA 1IJ5A 2X9YA 2LKGA 2RA1A 4EOZB 2MPKA 3Q2MA 2MBGA 5ABEA 1HTJF 3AE9A 2CE7A 3PURA 2X66A 3NZPA 4IHJE 2XQ9A 4KHZF 5HWXA 4A5XA 3LSVA 2ODUA 5ETWA 1JNZA 4DR6T 2V1DB 2F4VT 4JYAT 1BR0A 5L4HA 4EYUA 1HS7A 4U31A 5LNKA 5LA6E 4IIJE 1KNRA 5FXVA 3GA8A 4GK0E 4TX5A 2BKNA 4PAGA 2XPKA 4GKKT 1KFYA 4PFOA 1VCSA 4MHCA 5IHYA 3ZCJA 2I0MA 3FZKB 5C2TA 3U3IA 3AXJA 2CEAA 4X20E 4J2CA 1VRBA 4ILBA 5KMGP 2KT9A 5BR8T 5AQKB 4NUUA 4IDZA 5TAOA 4YT0A 2A72A 3PUGA 3ZC1A 4AKHA 2K48A 3QUJA 2NTYA 2N9DA 4LMJA 2X0LB 4Z90A 5HWYA 2MTQA 1I94T 4HFHA 4P0AA 2WP9A 3NVOA 4P0BA 3MXZA 1S94A 4EB6E 2X9WA 4X1YE 2M6BA 5L4EA 4ZEYA 4UVAB 3Q9DA 3P50A 4EGWA 3PUVF 3VR8A 2V7JA 4DV5T 4KBMB 5LG3A 3BQKA 4MLKA 1DU2A 3ETUA 5HXRA 1E2AA 4K0UA 1FMVA 3UU6A 2H88A 4OK0A 4OYJA 4O2AE 4HE8A 1YXRA 2KWIB 3K1SA 1H7CA 3OKQA 3O9XA 5JQGE 4ZS2A 1W0BA 3R84B 4UV9B 3AA1B 3AE7A 4PFPA 2IMLA 2LHNA 1SUMB 3QNUA 4X66T 4JI2T 5AFUL 2LSIA 3GN5A 4YTPA 1HF8A 4WYVA 4C91A 1IAPA 4NIQA 4CI1B 4U72A 3KBTA 3HKBE 2VASA 2KMFA 3NWIA 4UR9A 4DV1T 3N9QA 4OX9T 2A2FX 2BBHA 3LK3B 1I6ZA 1Z8UA 3VU7H 1WFDA 3N2OA 3O1HA 5JH7E 5HEUA 4L0RA 1UURA 3AE2A 3W15B 2XAQB 4XAXB 1WYCA 1AJ3A 2LRLA 1LVFA 3H3AA 2DI4A 1HX8A 2W62A 4OYKA 3ZLIA 4DO0A 5FY0A 5HXCA 1MMAA 2WDRA 5L3BB 2UU9T 4O4IE 4ZZCA 3SFDA 1D0XA 3KVAA 3UU3A 2KNDA 3Q5WA 3AE8A 4CXYA 1CHUA 4HWHA 4G2AA 4HWIB 4ILAA 1Y64B 3LK42 3RC8A 3EHZA 4JI5T 3PUXF 4F6RC 1U5PA 2VWAA 1NAFA 1E7PA 4TV9E 2EHOC 4CN1A 3F57A 3OJAA 4EAHA 3BK9A 1ZP0A 3Q5DA 4IDQA 3O4XE 2KSRA 2LJLA 2E9XD 4AQFA 5L3DB 2V5CA 4X62T 4B6XA 3ZMZB 2XQ5A 4JI1T 2BG9A 1FIOA 3PUZF 5CA0E 4BJNA 2JMKA 3HI2A 3LG7A 4U7YA 3P4SA 4Q25A 3UUXB 3B57A 2CRBA 3I9WA 3AEBA 2CBJA 4L5GA 3TLSA 3P7IA 4I0UA 1B7TA 3OYXA 2WU2A 4H9OC 4DUZT 3OTOT 2ZM6T 1YKEB 3K3OA 3CVRA 3KV6A 2IW5B 2P9BA 3P4QA 4JUYA 4YJ2E 4ZS3A 5AQOB 4UVBB 4CN6A 3KV5A 4EZ4A 4I50E 4ZHQE 4B3RT 3GN5B 2PBIA 3RYHE 1D1AA 4WBNE 4LFCT 5AQGB 4V1Av 2EHOD 3ETVA 3DJBA 2BG9E 4P1NA 1JNRA 4H9SE 5J2TE 2V8SV 4I55E 1OEDA 3ZYKA 3RX6A 2K5BB 3AE1A 3C64A 4MALA 5HEHA 4B3MT 2Y8DA 3E22E 2UXNB 3A8YC 2Q9QC 3RH3A 4HWCA 1LRZA 3ZT5A 2CA5A 1ZV4X 4HEAA 2H3RA 5L3FB 2CHOA 5LYJE 5IUXA 2JIWA 1SE7A 5LXTE 3C4ZA 5H6QB 2I59A 3EABA 1T7SA 3HKDE 5JDHA 4QKNA 2CWYA 2H7VC 4ZXLA 1S35A 4DR4T 3AVSA 1UK5A 3CIRA 3BQIA 5EZYE 2BVMA 2VVNA 2L8KA 2L3LA 1LVKA 4KUMB 4Z91A 4NUVA 1OEDE 3ABVA 1Y01A 3ZN0B 2YINA 1MNDA 1QSDA 1WRDA 5AQVB 3KDSE 2ZMAA 5F8PA 2V6YA 2JQKA 3EAMA 3N9LA 2SPCA 2E5LT 3UU5A 4KMCA 3MACA 3VHLA 2BS3A 4ILCA 2Q9QD 3UU4A 2BG9B 4QH5A 3N2KE 2HPLA 4FI5A 2HHHT 4AKIA 1D0ZA 3L09A 3ZMVB 3FZHB 5JREA 5LG4A 3ANWA 2LM9A 4DMWA 5L3GB 4LMLA 1NEKA 3ZCIA 2WCAA 2DNXA 3N9MA 3UQ7A 2K9AA 2CLYC 3OPCA 4AISA 2K3WA 4JI3T 2YN6A 2LHRA 1XNRT 3RQWA 1EZ3A 5DQVA 5FVKA 5FYMA 3RIUC 1D1CA 5FXWA 1BR4A 2QA7A 4Z8XA 5AQIB 4BA9A 3X1DA 4AI6A 4HFBA 4WBOA 1HFAA 4YXDA 3C51A 3TKLB 2FBWA 2LE8A 3I1AA 4IL4A 5LGTB 1KNPA 1L0VA 5KX5E 1OEDB 3T1YT 2CM0A 2WSSV 3ZEFB 5CB4E 2IDOB 1HR0T 2VKJA 2XQ8A 2IC9A 2XSAA 3RYCE 2ZLYA 5KDMC 4DIDB 4COFA 2WWVA 4YTNA 5HXHA 3EI0A 3U78A 3EUHA 1HNWT 5LHGB 3I0OA 3M3ZB 5DQWA 3D0TA 2LSGA 1N34T 3V5SA 3ZJ2A 5FNVE 2JQQA 5DJQC 4JEUB 2V5DA 2W67A 2KLQA 2R6GF 4X1KE 5AQHB 2X51A 2V7IA 1Z0PA 3O1IA 3QOFA 4X5TA 4PW8A 5HXSA 3C4WA 4GYSA 3FXEB 4B3ST 3CPZA 2JPFA 2D0TA 3JC6C 2V6YB 2RPAA 5LBMA 5FL0A 4GYRA 1IBKT 4TWDA 2BDEA 2XZEA 4DV4T 1U4QA 3TLVA 5AQPB 4LF6T 3UU8A 3SFEA 3EDVA 1LKXA 3PUYF 4OHFA 3IEEA 1ZKEA 3ANWB 3EDUA 4ASKA 1UX4A 3N2GE 3NRXA 3QC9A 2B76A 4TWHA 3DP7A 2MYSA 4XBFB 1OWAA 3KBUA 4N78D 4MBQA 1IJ6A 3PUWF 5J1GA 1YQ4A 3AA7B 3I0QA 4HTEA 3RF1A 4U2YA 2QRXA 4ERRA 5L47A 4IREA 4QX8B 4QH4A 3VR9A 3JCFA 4JV5T 3H37A 3IHRA 3NRYA 5LBQB 4DR5T 5IWAT 2E9XC 4UEMA 4GIWA 2V7MA 4EEDA 3ONLC 5ABHA 1W09A 5CFBA 3JC6D 2NP9A 5JDMA 1HNXT 3RQUA 4BAYB 3ZN1B 5JDGA 3ONJA 5FVLA 4U2ZA 5A1LA 5J2UE 2LEHA 1MMGA 2EHOA 4K0KT 3CMLA 2DL1A 4TNVA 2XSBA 1D1BA 2FJBA 1ZHCA 5LGNB 4H9PC 2VL8A 2D0UA 2UXBT 1HG2A 1KNZA 2W2UA 2JRKA 2FJEA 2YU1A 3HKEE 3UUMA 3SRZA 4YFSA 1MMDA 4O2BE 4IDPA 2A3DA 4DMVA 2LLYA 4EYYR 4PNIA 3PU8A 3ZYLA 5IYZE 3DTOA 1G8XA 2LOPA 3A7MA 1XNQT 3AVRA 4EIWA 2ZM2A 1WR0A 3I9YA 1ZOYA 3UUNA 3Q5XA 2XHEB 4AIUA 4AQYT 2H89A 5JDNA 4DNDA
chains in the Genus database with same CATH topology
3NZPA 3OBVE 4IHJE 1E1HB 3N9OA 2I59A 1MNEA 3BQLA 5HWXA 4ZI2C 1UCUA 3S4UA 2ODUA 3FB2A 2WMOA 3AAIA 3HKDE 3ZMUB 5JDHA 4QKNA 2CWYA 2H7VC 5LP6E 4O4HE 4TV8E 1S35A 4CQIA 4O4LE 3AVSA 5ETWA 4GK5E 2V1DB 4YJ3E 1VOMA 1X79A 3BQIA 4HKAA 4UV8B 5EZYE 1BR0A 5JR9C 4EYUA 1HS7A 2BVMA 3RC3A 2Z6EA 5LNKA 2L8KA 3UFEA 2L3LA 4UIGA 1CUNA 1LVKA 5LA6E 3P8CD 5HYAA 4KUMB 4IIJE 4H9NC 4IE6A 5FXVA 4NUVA 3GA8A 4ANJA 3HL6A 2V26A 4GK0E 1G73A 4TX5A 3R6NA 2W00A 3ZN0B 4H9QC 4PAGA 4C90A 2YINA 4I43B 2CXFA 2Q9QA 1WLXA 2K24A 2J1DG 4DBQA 1MNDA 3J7Yq 4PFOA 2DLRA 1QSDA 4YHJA 5JVDE 4FJOA 3PUQA 1WRDA 4MHCA 4O8SA 5IHYA 1FMWA 3ZCJA 3C4XA 2XTLA 2WBLA 3KDSE 3U3IA 2CXDA 2CEAA 5LJNA 4X1IE 3LK2B 4X20E 2ZMAA 5F8PA 4PK5A 4GOUA 4J2CA 2X9XA 3N9LA 4CI3B 2SPCA 4QXBB 4KMCA 1VRBA 3MACA 3VHLA 3UULA 1MIVA 5KMGP 2LSYA 2VB6A 2KT9A 2Q9QD 5LJMA 2QGSA 4UELA 4NUUA 4IDZA 1ZEEA 3N2KE 1V9DA 2XQYA 3MA9A 2HPLA 1HCIA 4FI5A 3GWHA 4H63V 5TAOA 2A72A 3T8OA 1MIYA 3C50A 4AKIA 3FBLA 3PUGA 3CQCB 4ILUA 4PK4A 4PJNA 1HG5A 3ZC1A 1D0ZA 2CXLA 4AKHA 3L09A 2K48A 3PE0A 3QUJA 3CX8B 5JR9A 3ZMVB 2D2SA 4O4JE 5JREA 5LG4A 2NTYA 3KFWX 3ANWA 2BZBA 2LM9A 5C8YE 2XUEA 4DMWA 5CA1E 2VK9A 5L3GB 2N9DA 3CX6B 3RKOA 3ZCIA 2JMHA 4ZI2D 4UF0A 2X0LB 4EZHA 2YU2A 4CXXA 5FXZA 5ADXL 2DNXA 3N9MA 5HWYA 2YK0A 2MTQA 2CWOA 2CLYC 2K9AA 1US7B 2W0GA 4XZCA 4A56A 4P0AA 3AB3B 2UXXB 2JJ9A 1MMNA 4P0BA 2ACXA 3MXZA 2EHOB 1S94A 4TUYE 4EB6E 5M4YA 2X9WA 2W61A 2LHRA 4X1YE 1EZ3A 4ISSA 2PJQA 5DQVA 5FYMA 3PDYA 4AQGA 2WAUA 1D1CA 4PK6A 1FEWA 5H6RB 5FXWA 5F3JA 4UVAB 3Q9DA 1BR4A 3MZKB 2QA7A 4IGUA 4Z8XA 4BA9A 2V7JA 3PU3A 4KBMB 2X9HA 4U74A 4AI6A 4H63H 4WBOA 1BR2A 1YKHB 1HFAA 3BQKA 4AKGA 2V7KA 4P09A 4MLKA 4BJMA 3C51A 5L3EB 3ETUA 5HXRA 5EK3A 5LHIB 4K0UA 1FMVA 3KV9A 3I1AA 2LE8A 4OK0A 2N1GA 4OYJA 3TKLB 4O2AE 5LGTB 3NZQA 2YEVC 3O1JA 4HE8A 5KX5E 2NOXA 3RYIE 2KWIB 3J9X1 1H7CA 3M65A 3ZMSB 2X68A 3IBPA 3B13A 3OKQA 2CM0A 2NW9A 3O9XA 3MJXA 5JQGE 2WSSV 3LBXB 3ZEFB 5CB4E 3ZJ1A 5L3CB 1WYBA 3WAJA 4ZS2A 2VKJA 3V5UA 1NWMX 1T98A 2IC9A 3R84B 2N2NA 4UV9B 3KV4A 2E9XB 3AA1B 2PFVA 4PFPA 2LHNA 2GK9A 2DCFA 5JDFA 3N9NA 4PJJA 2KINB 5JRCA 2Y48B 3C98B 2C0SA 3RYCE 2ZLYA 5AFUL 2LSIA 3GN5A 2C5JA 5KDMC 4JEHB 4ADZA 1HF8A 4HFVA 4QX7B 5HXHA 4C91A 3U78A 1IAPA 4CI1B 3EUHA 4U72A 3KBTA 5FY7A 3HKBE 3AA0B 2VASA 4DBRA 2KMFA 5LHGB 3I0OA 4M1PA 2DWKA 2KXPB 3N9QA 2V7LA 4IE4A 3D0TA 5DQWA 3UTKA 5FXXA 2A2FX 2LSGA 2LSKA 3V5SA 2CCQA 3LK3B 3N5LA 2X67A 1D0YA 3VU7H 4ZI7E 3ZJ2A 3N2OA 5FNVE 3O1HA 2JQQA 2E8IA 5JH7E 3RRCA 3PTRB 5DJQC 4L0RA 2ES0A 4JEUB 4UVCB 4L9IA 3VKGA 2VKDA 5GONE 5LHHB 2KLQA 4X1KE 3IF8B 3L3PA 3W15B 2XAQB 2X51A 1WYCA 2V7IA 1Z0PA 4XAXB 3O1IA 4AQFC 1AJ3A 1LVFA 3H3AA 2DI4A 2WWUA 3E0ZA 4AKRB 2RP4A 3RRWA 4ZOLE 3WI3A 1HX8A 2W62A 4OYKA 3ZLIA 2Q9QB 4DO0A 3PUAA 5FY0A 4EXTA 2KWHA 5HXCA 4PW8A 1MMAA 1OXZA 3CQGB 3ZYMA 5HXSA 3KINB 2WM9A 5L3BB 4O4IE 3MKDA 3C4WA 4GYSA 3FXEB 5H6QB 1D0XA 3CPZA 3KVAA 4IE5A 2JPFA 2D0TA 2KNDA 3JC6C 5LCYA 1BR1A 2B1EA 4JLEA 2LSJA 5LBMA 3Q5WA 4GYRA 5LGUB 3F31A 2BDEA 4CXYA 3K3QC 4G2AA 4QWNB 1YW0A 3CX7B 2DWGA 1Y64B 4CXWA 3LK42 3RC8A 5L2LA 5E0OA 3FXDB 1U4QA 3AAEB 1YD8G 3CQXC 3EDVA 3MK7C 5HXEA 3A5XA 1LKXA 4YLHA 3HKCE 4F6RC 1U5PA 2LOSA 2VWAA 3F2EA 3SOLA 1NAFA 5FY1A 3RYFE 2VKOA 4ZI3D 4OHFA 2NWBA 3IEEA 5JR9B 1ZKEA 2W63A 2XAHB 2CMRA 4TV9E 2EHOC 3ANWB 2XAFB 4QXHB 3KVBA 3EDUA 3F57A 3OJAA 4WW0A 4ASKA 3ZPOA 4EAHA 3BK9A 1UX4A 2WMNA 3N2GE 2OA5A 2XASB 2G0UA 3NRXA 3QC9A 4UF0B 2C5KT 2DHRA 4WNKA 3WAKA 2XAGB 2XAJB 1SHZC 3O4XE 3DP7A 2MYSA 2NW8A 2LJLA 4XBFB 2E9XD 4AQFA 1WR6A 3AAAB 5L3DB 1OWAA 3KBUA 4N78D 4MBQA 1IJ6A 4B6XA 4ISTA 3ZMZB 3VKHA 3CWZB 4HGAA 5J1GA 3ZC0A 4OFZA 5EK4A 2MOZA 2LT3A 3AA7B 3NBXX 4AXPA 3I0QA 4HTEA 1FIOA 4ZI3C 5JDLA 4ERRA 5CA0E 3SS1A 5FMNA 4BJNA 2NTXA 2JMKA 3HI2A 2HPJA 3LG7A 3CKDA 2Y6XA 4QX8B 4PJLA 3UUXB 3SWHA 3B57A 3E08A 3I9WA 2M67A 2ODVA 3LJCA 3H37A 3IHRA 3NRYA 5LBQB 4L5GA 4G63A 2E9XC 4UEMA 4GIWA 4QHOA 4UXNB 2V7MA 3P7IA 1UX5A 4I4TE 3ONXA 4IE0A 4QXCB 1B7TA 3OYXA 4MFRA 4H9OC 3K3NA 2HH7A 1YKEB 3JC6D 3AA6B 3K3OA 2NP9A 5HAXA 5JDMA 3CVRA 4BAYB 3ZN1B 5JDGA 4CZZB 3KV6A 3UT5E 5A1LA 1IZNB 4TN7B 5J2UE 5DABA 2LEHA 1MMGA 2EHOA 2IW5B 2P9BA 3LFMA 4JUYA 3CMLA 4YJ2E 4ZS3A 4UVBB 5BMVE 1MIWA 3QK6A 5JRCB 5FP3A 3KV5A 4EZ4A 1D1BA 3FHNA 4I50E 1ZHCA 4HN9A 4ZHQE 3HA4A 4CI2B 2BVLA 5LGNB 2CLYB 2NW7A 3GN5B 2PBIA 3RYHE 1KK7A 2IC6A 4H9PC 4E7ZA 1D1AA 2VL8A 4WBNE 2D0UA 2KZ7B 1HG2A 3K8PC 1KNZA 3PUSA 4V1Av 3ZMTB 2JRKA 2EHOD 3ETVA 2PG8A 2YU1A 3HKEE 3UUMA 3DJBA 3SRZA 4YFSA 3OYZA 1MMDA 4H9SE 3N9PA 2A3DA 4O2BE 4AKLA 4DMVA 5J2TE 4I55E 4PJMA 4EYYR 4PNIA 4E7SA 5JDQA 4TZ4C 3PU8A 3ZYKA 3ZYLA 5IYZE 3DTOA 1G8XA 2LOPA 2K5BB 3RPUA 3RX6A 3C64A 4MALA 2IAKA 3LBXA 2L9QA 3FBZA 2ZM0A 3AVRA 2Y8DA 3E22E 2UXNB 4EIWA 2Q9QC 2ZM2A 3EVYA 4KP3C 3RH3A 3I9YA 2D5UA 2H7OA 4DVDA 1LRZA 5LOVE 2E9XA 1QUUA 2CA5A 1ZV4X 3UUNA 1IJ5A 2X9YA 1SA0E 4HEAA 3Q5XA 4IE7A 2H3RA 5L3FB 2XHEB 2RA1A 4EOZB 3Q2MA 2C5IT 3GMIA 5LYJE 2VKHA 3HR0A 3ESLA 5EK2A 2MBGA 1HTJF 5JDNA 2CE7A 5LXTE 4H9RC 3C4ZA 4DNDA 1O3XA 3PURA 2ZM8A 2X66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWK A;  2CXL A;  2DWG A;  4GIW A;  3CWZ B;  2CXF A; 
#chains in the Genus database with same CATH topology
 2XQ3 A;  2XM2 A;  3BQL A;  1UCU A;  3FB2 A;  3AAI A;  3ZMU B;  5LP6 E;  2IHR 1;  4TV8 E;  4O4L E;  2W4X A;  4GK5 E;  4HFD A;  1VOM A;  5JR9 C;  2Z6E A;  2AXD S;  1IBM T;  4UIG A;  1CUN A;  5HYA A;  3P8C D;  1HNZ T;  4H9N C;  3HL6 A;  1J5E T;  1G73 A;  3L39 A;  3NKZ A;  2W00 A;  3L8R A;  1X9B A;  3UFG A;  2YDS A;  4I43 B;  2CXF A;  2Q9Q A;  2K24 A;  2DLR A;  4YHJ A;  5JVD E;  4FJO A;  3PUQ A;  4O8S A;  1FMW A;  3C4X A;  4YHH T;  2WBL A;  5LJN A;  2W66 A;  4PK5 A;  4GOU A;  2X9X A;  5AQS B;  2LSY A;  2AE9 A;  1V9D A;  2XQY A;  1HCI A;  4GKJ T;  1MIY A;  3C50 A;  2BKO A;  3AE3 A;  1HG5 A;  2CXL A;  3AE4 A;  3PE0 A;  3CX8 B;  3TLT A;  4O4J E;  3ZT7 A;  3KFW X;  2BBJ A;  2CPT A;  5C8Y E;  2XUE A;  2LRK A;  2VK9 A;  3CX6 B;  3RKO A;  2XJ7 A;  2JMH A;  2YU2 A;  4CXX A;  2CWO A;  1KF6 A;  4A56 A;  3AB3 B;  1MMN A;  2ACX A;  4A98 A;  2EHO B;  4TUY E;  5M4Y A;  2W61 A;  3PDY A;  4AQG A;  5H6R B;  5F3J A;  4DR1 T;  4IGU A;  4U74 A;  1BR2 A;  2E2A A;  5HEO A;  4P09 A;  4BJM A;  5EK3 A;  2N1G A;  1J1J A;  4DV2 T;  3AED A;  5AQN B;  2NOX A;  2WB5 A;  2X68 A;  3IBP A;  3B13 A;  2NW9 A;  2YKS A;  3MJX A;  3ZJ1 A;  1NWM X;  2N2N A;  3TLW A;  3KV4 A;  2PFV A;  2PTF A;  4CN4 A;  2DCF A;  3N9N A;  2C0S A;  4JI8 T;  5JTG A;  4JEH B;  4ADZ A;  4QX7 B;  1T8B A;  2WQY A;  5FY7 A;  3RIU A;  4U7I A;  3AEC A;  2DWK A;  2V7L A;  4IE4 A;  2LSK A;  2CCQ A;  3N5L A;  2X67 A;  1D0Y A;  2FJA A;  1M62 A;  2E8I A;  3RRC A;  4LF5 T;  3RIA A;  2ES0 A;  2VUR A;  3CK6 A;  4UVC B;  2JQ9 A;  5LHH B;  2HN2 A;  2WWU A;  3E0Z A;  2RP4 A;  3RRW A;  4ZOL E;  4QH1 A;  2Q9Q B;  3H3M A;  2KWH A;  4DV0 T;  3IA3 A;  3ZYM A;  4JI0 T;  2WM9 A;  2YOE A;  3MKD A;  1N36 T;  5FKY A;  1IBL T;  5LCY A;  1BR1 A;  1NEN A;  4JLE A;  2JQH A;  3VRA A;  5LGU B;  3F31 A;  3AE6 A;  4JBW F;  4NXM T;  3PJA A;  4CXW A;  3FXD B;  3JAF A;  3AAE B;  1YD8 G;  1N33 T;  3MK7 C;  4ZI3 D;  5FY1 A;  2NWB A;  3AEE A;  2CMR A;  4QXH B;  4WW0 A;  3ZPO A;  5HEG A;  2XAS B;  2G0U A;  4WNK A;  3WAK A;  2XAJ B;  1SHZ C;  1T72 A;  2NW8 A;  2WS3 A;  1WR6 A;  4U3C A;  4X64 T;  2J62 A;  4IST A;  3VKH A;  4A97 A;  1VCT A;  4OFZ A;  3JAE A;  5FL1 A;  3NBX X;  4JI4 T;  5CJ5 A;  3RGL A;  5JDL A;  3PV0 F;  2HPJ A;  4IDN A;  4PJL A;  3SWH A;  2M67 A;  2ODV A;  3LJC A;  3RKG A;  1R8I A;  3AEG A;  4QHO A;  4UXN B;  2BS4 A;  1UX5 A;  4I4T E;  3ONX A;  2V6X A;  4EEB A;  4KI0 F;  2WDV A;  3K3N A;  3AA6 B;  5HAX A;  3RHW A;  3B5M A;  4TN7 B;  1M7K A;  2XY8 B;  3AE5 A;  4IDO A;  4X65 T;  4ZZB A;  1MIW A;  1UGO A;  5FP3 A;  3ZSS A;  4LF4 T;  4HN9 A;  4LFA T;  3HA4 A;  2UUB T;  5CGM A;  2CLY B;  4E7Z A;  3K8P C;  3ZMT B;  1J5W A;  2XQA A;  2WU5 A;  3FZF B;  4AKL A;  3N9P A;  4TNW A;  2FUP A;  5AQM B;  5C3J A;  4E7S A;  5JDQ A;  4TZ4 C;  2NR4 A;  2IAK A;  3LBX A;  4JI6 T;  3EVY A;  2D5U A;  3LDQ B;  1WCR A;  3AEA A;  5LOV E;  2E9X A;  1QUU A;  1SA0 E;  4IE7 A;  2C5I T;  3GMI A;  2VKH A;  3HR0 A;  2YDR A;  3ESL A;  5EK2 A;  4H9R C;  3FZM B;  1O3X A;  2ZM8 A;  3OBV E;  1E1H B;  3N9O A;  1MNE A;  4ZI2 C;  3S4U A;  2WMO A;  4LF8 T;  4O4H E;  3P4R A;  4CQI A;  2XM1 A;  4YJ3 E;  1X79 A;  4HKA A;  4UV8 B;  4LF7 T;  1KEY A;  5LMN T;  3RC3 A;  3UFE A;  4EV6 A;  2OV9 A;  3FZL B;  4YSZ A;  2UUA T;  2IIU A;  4IE6 A;  4ANJ A;  2V26 A;  3AEF A;  3R6N A;  2HN1 A;  1N32 T;  4H9Q C;  4C90 A;  4DBQ A;  1WLX A;  2J1D G;  3J7Y q;  1XMQ T;  5ABG A;  2XTL A;  4YSY A;  4DR7 T;  2CXD A;  4X1I E;  3LK2 B;  2CHN A;  4CI3 B;  4QXB B;  2I6H A;  3UUL A;  1MIV A;  4F8H A;  2VB6 A;  5LJM A;  2QGS A;  4UEL A;  1ZEE A;  3MA9 A;  3GWH A;  4H63 V;  3T8O A;  3FBL A;  5AQL B;  3CQC B;  4ILU A;  4PK4 A;  4PJN A;  2XQ6 A;  5JR9 A;  2D2S A;  2LM2 A;  4DUY T;  2BZB A;  2OLT A;  5CA1 E;  3ZT6 A;  4ZI2 D;  4UF0 A;  2WY2 A;  4EZH A;  3RI5 A;  5ADX L;  5FXZ A;  2ACZ A;  2YK0 A;  5ABF A;  5F5W A;  2QYW A;  5AQF B;  1US7 B;  2W0G A;  3JAD A;  4XZC A;  3T1H T;  2UXX B;  2JJ9 A;  3AXJ B;  1QLB A;  4ISS A;  4LF9 T;  2PJQ A;  2WAU A;  3RLF F;  1W0A A;  4PK6 A;  1FEW A;  3MZK B;  2UXC T;  3PU3 A;  2X9H A;  4H63 H;  4JI7 T;  4AKG A;  1YKH B;  2V7K A;  5L3E B;  5LHI B;  2LKH A;  3RIF A;  3G06 A;  3KV9 A;  3NZQ A;  2YEV C;  3VRB A;  3O1J A;  3RYI E;  3J9X 1;  3M65 A;  3ZMS B;  4HFC A;  2WZH A;  3LBX B;  5L3C B;  1WYB A;  3WAJ A;  3V5U A;  1T98 A;  2E9X B;  2GK9 A;  2VL0 A;  5JDF A;  4PJJ A;  2J47 A;  2KIN B;  5JRC A;  2Y48 B;  3C98 B;  1GQE A;  2QVA A;  5LB7 B;  2C5J A;  5HCM A;  4HFV A;  2XQ4 A;  3AA0 B;  4DBR A;  4HWD A;  4M1P A;  2KXP B;  2XQ7 A;  4KX6 A;  3UTK A;  4WZX A;  5FXX A;  2UXD T;  4ZI7 E;  3PTR B;  4DV3 T;  4L9I A;  3VKG A;  2VKD A;  2WDQ A;  5GON E;  3PJA J;  3IF8 B;  3L3P A;  5AQU B;  4AQF C;  2D9D A;  1HX1 B;  2A9U A;  3P4W A;  4HFI A;  4AKR B;  4LFB T;  3WI3 A;  2J4G A;  3PUA A;  4EXT A;  4DV7 T;  1OXZ A;  2IUB A;  2BG9 C;  3CQG B;  4NPP A;  3KIN B;  3ZST A;  2UUC T;  4IE5 A;  4YTM A;  2B1E A;  2LSJ A;  5LMU T;  3K3Q C;  4QWN B;  1YW0 A;  3CX7 B;  2DWG A;  5L2L A;  5E0O A;  4DR3 T;  3CQX C;  5HXE A;  3A5X A;  4YLH A;  3OVU A;  3HKC E;  2LOS A;  3SOL A;  3F2E A;  3RYF E;  2VKO A;  5JR9 B;  2W63 A;  2XAH B;  4IT4 A;  3QB5 A;  2XAF B;  3KVB A;  2WMN A;  2M6I A;  2OA5 A;  2VQF T;  4UF0 B;  2C5K T;  2DHR A;  2XAG B;  5AQT B;  1XZY A;  1XDO A;  5ABF B;  1UUS A;  3AAA B;  2FJD A;  2YDQ A;  3CWZ B;  5HCJ A;  2X0H A;  4HGA A;  3ZC0 A;  4IL9 A;  5EK4 A;  2MOZ A;  2LT3 A;  4LMK A;  4AXP A;  1YQ3 A;  4ZI3 C;  3UUB A;  3SS1 A;  5FMN A;  4HWF A;  1OED C;  5KXJ A;  2NTX A;  3CKD A;  2Y6X A;  2VQE T;  3QB5 K;  4DR2 T;  3E08 A;  2VVS A;  4G63 A;  1XWM A;  4HFE A;  4IE0 A;  2MAW A;  4QXC B;  4MFR A;  2HH7 A;  2BKP A;  4CZZ B;  3UT5 E;  1IZN B;  2X0Y A;  5DAB A;  5J0Z A;  2WZI A;  3LFM A;  3ZKR A;  5BMV E;  5AQJ B;  3UQ4 A;  3QK6 A;  5JRC B;  3P4P A;  3FHN A;  1XDP A;  1XMO T;  4CI2 B;  2BVL A;  2CBI A;  5HEJ A;  2NW7 A;  1KK7 A;  2IC6 A;  2KZ7 B;  3Q5E A;  3PUS A;  3TLU A;  4TWF A;  4KHP T;  2PG8 A;  3OYZ A;  2BS2 A;  4PJM A;  4NXN T;  2E5V A;  4DV6 T;  5AQR B;  3RPU A;  5AQQ B;  2L9Q A;  3FBZ A;  2ZM0 A;  4B3T T;  4U33 A;  4KP3 C;  4YSX A;  1FJG T;  2H7O A;  4DVD A;  4YY3 T;  1W9R A;  1IJ5 A;  2X9Y A;  2LKG A;  2RA1 A;  4EOZ B;  2MPK A;  3Q2M A;  2MBG A;  5ABE A;  1HTJ F;  3AE9 A;  2CE7 A;  3PUR A;  2X66 A;  3NZP A;  4IHJ E;  2XQ9 A;  4KHZ F;  5HWX A;  4A5X A;  3LSV A;  2ODU A;  5ETW A;  1JNZ A;  4DR6 T;  2V1D B;  2F4V T;  4JYA T;  1BR0 A;  5L4H A;  4EYU A;  1HS7 A;  4U31 A;  5LNK A;  5LA6 E;  4IIJ E;  1KNR A;  5FXV A;  3GA8 A;  4GK0 E;  4TX5 A;  2BKN A;  4PAG A;  2XPK A;  4GKK T;  1KFY A;  4PFO A;  1VCS A;  4MHC A;  5IHY A;  3ZCJ A;  2I0M A;  3FZK B;  5C2T A;  3U3I A;  3AXJ A;  2CEA A;  4X20 E;  4J2C A;  1VRB A;  4ILB A;  5KMG P;  2KT9 A;  5BR8 T;  5AQK B;  4NUU A;  4IDZ A;  5TAO A;  4YT0 A;  2A72 A;  3PUG A;  3ZC1 A;  4AKH A;  2K48 A;  3QUJ A;  2NTY A;  2N9D A;  4LMJ A;  2X0L B;  4Z90 A;  5HWY A;  2MTQ A;  1I94 T;  4HFH A;  4P0A A;  2WP9 A;  3NVO A;  4P0B A;  3MXZ A;  1S94 A;  4EB6 E;  2X9W A;  4X1Y E;  2M6B A;  5L4E A;  4ZEY A;  4UVA B;  3Q9D A;  3P50 A;  4EGW A;  3PUV F;  3VR8 A;  2V7J A;  4DV5 T;  4KBM B;  5LG3 A;  3BQK A;  4MLK A;  1DU2 A;  3ETU A;  5HXR A;  1E2A A;  4K0U A;  1FMV A;  3UU6 A;  2H88 A;  4OK0 A;  4OYJ A;  4O2A E;  4HE8 A;  1YXR A;  2KWI B;  3K1S A;  1H7C A;  3OKQ A;  3O9X A;  5JQG E;  4ZS2 A;  1W0B A;  3R84 B;  4UV9 B;  3AA1 B;  3AE7 A;  4PFP A;  2IML A;  2LHN A;  1SUM B;  3QNU A;  4X66 T;  4JI2 T;  5AFU L;  2LSI A;  3GN5 A;  4YTP A;  1HF8 A;  4WYV A;  4C91 A;  1IAP A;  4NIQ A;  4CI1 B;  4U72 A;  3KBT A;  3HKB E;  2VAS A;  2KMF A;  3NWI A;  4UR9 A;  4DV1 T;  3N9Q A;  4OX9 T;  2A2F X;  2BBH A;  3LK3 B;  1I6Z A;  1Z8U A;  3VU7 H;  1WFD A;  3N2O A;  3O1H A;  5JH7 E;  5HEU A;  4L0R A;  1UUR A;  3AE2 A;  3W15 B;  2XAQ B;  4XAX B;  1WYC A;  1AJ3 A;  2LRL A;  1LVF A;  3H3A A;  2DI4 A;  1HX8 A;  2W62 A;  4OYK A;  3ZLI A;  4DO0 A;  5FY0 A;  5HXC A;  1MMA A;  2WDR A;  5L3B B;  2UU9 T;  4O4I E;  4ZZC A;  3SFD A;  1D0X A;  3KVA A;  3UU3 A;  2KND A;  3Q5W A;  3AE8 A;  4CXY A;  1CHU A;  4HWH A;  4G2A A;  4HWI B;  4ILA A;  1Y64 B;  3LK4 2;  3RC8 A;  3EHZ A;  4JI5 T;  3PUX F;  4F6R C;  1U5P A;  2VWA A;  1NAF A;  1E7P A;  4TV9 E;  2EHO C;  4CN1 A;  3F57 A;  3OJA A;  4EAH A;  3BK9 A;  1ZP0 A;  3Q5D A;  4IDQ A;  3O4X E;  2KSR A;  2LJL A;  2E9X D;  4AQF A;  5L3D B;  2V5C A;  4X62 T;  4B6X A;  3ZMZ B;  2XQ5 A;  4JI1 T;  2BG9 A;  1FIO A;  3PUZ F;  5CA0 E;  4BJN A;  2JMK A;  3HI2 A;  3LG7 A;  4U7Y A;  3P4S A;  4Q25 A;  3UUX B;  3B57 A;  2CRB A;  3I9W A;  3AEB A;  2CBJ A;  4L5G A;  3TLS A;  3P7I A;  4I0U A;  1B7T A;  3OYX A;  2WU2 A;  4H9O C;  4DUZ T;  3OTO T;  2ZM6 T;  1YKE B;  3K3O A;  3CVR A;  3KV6 A;  2IW5 B;  2P9B A;  3P4Q A;  4JUY A;  4YJ2 E;  4ZS3 A;  5AQO B;  4UVB B;  4CN6 A;  3KV5 A;  4EZ4 A;  4I50 E;  4ZHQ E;  4B3R T;  3GN5 B;  2PBI A;  3RYH E;  1D1A A;  4WBN E;  4LFC T;  5AQG B;  4V1A v;  2EHO D;  3ETV A;  3DJB A;  2BG9 E;  4P1N A;  1JNR A;  4H9S E;  5J2T E;  2V8S V;  4I55 E;  1OED A;  3ZYK A;  3RX6 A;  2K5B B;  3AE1 A;  3C64 A;  4MAL A;  5HEH A;  4B3M T;  2Y8D A;  3E22 E;  2UXN B;  3A8Y C;  2Q9Q C;  3RH3 A;  4HWC A;  1LRZ A;  3ZT5 A;  2CA5 A;  1ZV4 X;  4HEA A;  2H3R A;  5L3F B;  2CHO A;  5LYJ E;  5IUX A;  2JIW A;  1SE7 A;  5LXT E;  3C4Z A;  5H6Q B;  2I59 A;  3EAB A;  1T7S A;  3HKD E;  5JDH A;  4QKN A;  2CWY A;  2H7V C;  4ZXL A;  1S35 A;  4DR4 T;  3AVS A;  1UK5 A;  3CIR A;  3BQI A;  5EZY E;  2BVM A;  2VVN A;  2L8K A;  2L3L A;  1LVK A;  4KUM B;  4Z91 A;  4NUV A;  1OED E;  3ABV A;  1Y01 A;  3ZN0 B;  2YIN A;  1MND A;  1QSD A;  1WRD A;  5AQV B;  3KDS E;  2ZMA A;  5F8P A;  2V6Y A;  2JQK A;  3EAM A;  3N9L A;  2SPC A;  2E5L T;  3UU5 A;  4KMC A;  3MAC A;  3VHL A;  2BS3 A;  4ILC A;  2Q9Q D;  3UU4 A;  2BG9 B;  4QH5 A;  3N2K E;  2HPL A;  4FI5 A;  2HHH T;  4AKI A;  1D0Z A;  3L09 A;  3ZMV B;  3FZH B;  5JRE A;  5LG4 A;  3ANW A;  2LM9 A;  4DMW A;  5L3G B;  4LML A;  1NEK A;  3ZCI A;  2WCA A;  2DNX A;  3N9M A;  3UQ7 A;  2K9A A;  2CLY C;  3OPC A;  4AIS A;  2K3W A;  4JI3 T;  2YN6 A;  2LHR A;  1XNR T;  3RQW A;  1EZ3 A;  5DQV A;  5FVK A;  5FYM A;  3RIU C;  1D1C A;  5FXW A;  1BR4 A;  2QA7 A;  4Z8X A;  5AQI B;  4BA9 A;  3X1D A;  4AI6 A;  4HFB A;  4WBO A;  1HFA A;  4YXD A;  3C51 A;  3TKL B;  2FBW A;  2LE8 A;  3I1A A;  4IL4 A;  5LGT B;  1KNP A;  1L0V A;  5KX5 E;  1OED B;  3T1Y T;  2CM0 A;  2WSS V;  3ZEF B;  5CB4 E;  2IDO B;  1HR0 T;  2VKJ A;  2XQ8 A;  2IC9 A;  2XSA A;  3RYC E;  2ZLY A;  5KDM C;  4DID B;  4COF A;  2WWV A;  4YTN A;  5HXH A;  3EI0 A;  3U78 A;  3EUH A;  1HNW T;  5LHG B;  3I0O A;  3M3Z B;  5DQW A;  3D0T A;  2LSG A;  1N34 T;  3V5S A;  3ZJ2 A;  5FNV E;  2JQQ A;  5DJQ C;  4JEU B;  2V5D A;  2W67 A;  2KLQ A;  2R6G F;  4X1K E;  5AQH B;  2X51 A;  2V7I A;  1Z0P A;  3O1I A;  3QOF A;  4X5T A;  4PW8 A;  5HXS A;  3C4W A;  4GYS A;  3FXE B;  4B3S T;  3CPZ A;  2JPF A;  2D0T A;  3JC6 C;  2V6Y B;  2RPA A;  5LBM A;  5FL0 A;  4GYR A;  1IBK T;  4TWD A;  2BDE A;  2XZE A;  4DV4 T;  1U4Q A;  3TLV A;  5AQP B;  4LF6 T;  3UU8 A;  3SFE A;  3EDV A;  1LKX A;  3PUY F;  4OHF A;  3IEE A;  1ZKE A;  3ANW B;  3EDU A;  4ASK A;  1UX4 A;  3N2G E;  3NRX A;  3QC9 A;  2B76 A;  4TWH A;  3DP7 A;  2MYS A;  4XBF B;  1OWA A;  3KBU A;  4N78 D;  4MBQ A;  1IJ6 A;  3PUW F;  5J1G A;  1YQ4 A;  3AA7 B;  3I0Q A;  4HTE A;  3RF1 A;  4U2Y A;  2QRX A;  4ERR A;  5L47 A;  4IRE A;  4QX8 B;  4QH4 A;  3VR9 A;  3JCF A;  4JV5 T;  3H37 A;  3IHR A;  3NRY A;  5LBQ B;  4DR5 T;  5IWA T;  2E9X C;  4UEM A;  4GIW A;  2V7M A;  4EED A;  3ONL C;  5ABH A;  1W09 A;  5CFB A;  3JC6 D;  2NP9 A;  5JDM A;  1HNX T;  3RQU A;  4BAY B;  3ZN1 B;  5JDG A;  3ONJ A;  5FVL A;  4U2Z A;  5A1L A;  5J2U E;  2LEH A;  1MMG A;  2EHO A;  4K0K T;  3CML A;  2DL1 A;  4TNV A;  2XSB A;  1D1B A;  2FJB A;  1ZHC A;  5LGN B;  4H9P C;  2VL8 A;  2D0U A;  2UXB T;  1HG2 A;  1KNZ A;  2W2U A;  2JRK A;  2FJE A;  2YU1 A;  3HKE E;  3UUM A;  3SRZ A;  4YFS A;  1MMD A;  4O2B E;  4IDP A;  2A3D A;  4DMV A;  2LLY A;  4EYY R;  4PNI A;  3PU8 A;  3ZYL A;  5IYZ E;  3DTO A;  1G8X A;  2LOP A;  3A7M A;  1XNQ T;  3AVR A;  4EIW A;  2ZM2 A;  1WR0 A;  3I9Y A;  1ZOY A;  3UUN A;  3Q5X A;  2XHE B;  4AIU A;  4AQY T;  2H89 A;  5JDN A;  4DND A; 
#chains in the Genus database with same CATH homology
 3NZP A;  3OBV E;  4IHJ E;  1E1H B;  3N9O A;  2I59 A;  1MNE A;  3BQL A;  5HWX A;  4ZI2 C;  1UCU A;  3S4U A;  2ODU A;  3FB2 A;  2WMO A;  3AAI A;  3HKD E;  3ZMU B;  5JDH A;  4QKN A;  2CWY A;  2H7V C;  5LP6 E;  4O4H E;  4TV8 E;  1S35 A;  4CQI A;  4O4L E;  3AVS A;  5ETW A;  4GK5 E;  2V1D B;  4YJ3 E;  1VOM A;  1X79 A;  3BQI A;  4HKA A;  4UV8 B;  5EZY E;  1BR0 A;  5JR9 C;  4EYU A;  1HS7 A;  2BVM A;  3RC3 A;  2Z6E A;  5LNK A;  2L8K A;  3UFE A;  2L3L A;  4UIG A;  1CUN A;  1LVK A;  5LA6 E;  3P8C D;  5HYA A;  4KUM B;  4IIJ E;  4H9N C;  4IE6 A;  5FXV A;  4NUV A;  3GA8 A;  4ANJ A;  3HL6 A;  2V26 A;  4GK0 E;  1G73 A;  4TX5 A;  3R6N A;  2W00 A;  3ZN0 B;  4H9Q C;  4PAG A;  4C90 A;  2YIN A;  4I43 B;  2CXF A;  2Q9Q A;  1WLX A;  2K24 A;  2J1D G;  4DBQ A;  1MND A;  3J7Y q;  4PFO A;  2DLR A;  1QSD A;  4YHJ A;  5JVD E;  4FJO A;  3PUQ A;  1WRD A;  4MHC A;  4O8S A;  5IHY A;  1FMW A;  3ZCJ A;  3C4X A;  2XTL A;  2WBL A;  3KDS E;  3U3I A;  2CXD A;  2CEA A;  5LJN A;  4X1I E;  3LK2 B;  4X20 E;  2ZMA A;  5F8P A;  4PK5 A;  4GOU A;  4J2C A;  2X9X A;  3N9L A;  4CI3 B;  2SPC A;  4QXB B;  4KMC A;  1VRB A;  3MAC A;  3VHL A;  3UUL A;  1MIV A;  5KMG P;  2LSY A;  2VB6 A;  2KT9 A;  2Q9Q D;  5LJM A;  2QGS A;  4UEL A;  4NUU A;  4IDZ A;  1ZEE A;  3N2K E;  1V9D A;  2XQY A;  3MA9 A;  2HPL A;  1HCI A;  4FI5 A;  3GWH A;  4H63 V;  5TAO A;  2A72 A;  3T8O A;  1MIY A;  3C50 A;  4AKI A;  3FBL A;  3PUG A;  3CQC B;  4ILU A;  4PK4 A;  4PJN A;  1HG5 A;  3ZC1 A;  1D0Z A;  2CXL A;  4AKH A;  3L09 A;  2K48 A;  3PE0 A;  3QUJ A;  3CX8 B;  5JR9 A;  3ZMV B;  2D2S A;  4O4J E;  5JRE A;  5LG4 A;  2NTY A;  3KFW X;  3ANW A;  2BZB A;  2LM9 A;  5C8Y E;  2XUE A;  4DMW A;  5CA1 E;  2VK9 A;  5L3G B;  2N9D A;  3CX6 B;  3RKO A;  3ZCI A;  2JMH A;  4ZI2 D;  4UF0 A;  2X0L B;  4EZH A;  2YU2 A;  4CXX A;  5FXZ A;  5ADX L;  2DNX A;  3N9M A;  5HWY A;  2YK0 A;  2MTQ A;  2CWO A;  2CLY C;  2K9A A;  1US7 B;  2W0G A;  4XZC A;  4A56 A;  4P0A A;  3AB3 B;  2UXX B;  2JJ9 A;  1MMN A;  4P0B A;  2ACX A;  3MXZ A;  2EHO B;  1S94 A;  4TUY E;  4EB6 E;  5M4Y A;  2X9W A;  2W61 A;  2LHR A;  4X1Y E;  1EZ3 A;  4ISS A;  2PJQ A;  5DQV A;  5FYM A;  3PDY A;  4AQG A;  2WAU A;  1D1C A;  4PK6 A;  1FEW A;  5H6R B;  5FXW A;  5F3J A;  4UVA B;  3Q9D A;  1BR4 A;  3MZK B;  2QA7 A;  4IGU A;  4Z8X A;  4BA9 A;  2V7J A;  3PU3 A;  4KBM B;  2X9H A;  4U74 A;  4AI6 A;  4H63 H;  4WBO A;  1BR2 A;  1YKH B;  1HFA A;  3BQK A;  4AKG A;  2V7K A;  4P09 A;  4MLK A;  4BJM A;  3C51 A;  5L3E B;  3ETU A;  5HXR A;  5EK3 A;  5LHI B;  4K0U A;  1FMV A;  3KV9 A;  3I1A A;  2LE8 A;  4OK0 A;  2N1G A;  4OYJ A;  3TKL B;  4O2A E;  5LGT B;  3NZQ A;  2YEV C;  3O1J A;  4HE8 A;  5KX5 E;  2NOX A;  3RYI E;  2KWI B;  3J9X 1;  1H7C A;  3M65 A;  3ZMS B;  2X68 A;  3IBP A;  3B13 A;  3OKQ A;  2CM0 A;  2NW9 A;  3O9X A;  3MJX A;  5JQG E;  2WSS V;  3LBX B;  3ZEF B;  5CB4 E;  3ZJ1 A;  5L3C B;  1WYB A;  3WAJ A;  4ZS2 A;  2VKJ A;  3V5U A;  1NWM X;  1T98 A;  2IC9 A;  3R84 B;  2N2N A;  4UV9 B;  3KV4 A;  2E9X B;  3AA1 B;  2PFV A;  4PFP A;  2LHN A;  2GK9 A;  2DCF A;  5JDF A;  3N9N A;  4PJJ A;  2KIN B;  5JRC A;  2Y48 B;  3C98 B;  2C0S A;  3RYC E;  2ZLY A;  5AFU L;  2LSI A;  3GN5 A;  2C5J A;  5KDM C;  4JEH B;  4ADZ A;  1HF8 A;  4HFV A;  4QX7 B;  5HXH A;  4C91 A;  3U78 A;  1IAP A;  4CI1 B;  3EUH A;  4U72 A;  3KBT A;  5FY7 A;  3HKB E;  3AA0 B;  2VAS A;  4DBR A;  2KMF A;  5LHG B;  3I0O A;  4M1P A;  2DWK A;  2KXP B;  3N9Q A;  2V7L A;  4IE4 A;  3D0T A;  5DQW A;  3UTK A;  5FXX A;  2A2F X;  2LSG A;  2LSK A;  3V5S A;  2CCQ A;  3LK3 B;  3N5L A;  2X67 A;  1D0Y A;  3VU7 H;  4ZI7 E;  3ZJ2 A;  3N2O A;  5FNV E;  3O1H A;  2JQQ A;  2E8I A;  5JH7 E;  3RRC A;  3PTR B;  5DJQ C;  4L0R A;  2ES0 A;  4JEU B;  4UVC B;  4L9I A;  3VKG A;  2VKD A;  5GON E;  5LHH B;  2KLQ A;  4X1K E;  3IF8 B;  3L3P A;  3W15 B;  2XAQ B;  2X51 A;  1WYC A;  2V7I A;  1Z0P A;  4XAX B;  3O1I A;  4AQF C;  1AJ3 A;  1LVF A;  3H3A A;  2DI4 A;  2WWU A;  3E0Z A;  4AKR B;  2RP4 A;  3RRW A;  4ZOL E;  3WI3 A;  1HX8 A;  2W62 A;  4OYK A;  3ZLI A;  2Q9Q B;  4DO0 A;  3PUA A;  5FY0 A;  4EXT A;  2KWH A;  5HXC A;  4PW8 A;  1MMA A;  1OXZ A;  3CQG B;  3ZYM A;  5HXS A;  3KIN B;  2WM9 A;  5L3B B;  4O4I E;  3MKD A;  3C4W A;  4GYS A;  3FXE B;  5H6Q B;  1D0X A;  3CPZ A;  3KVA A;  4IE5 A;  2JPF A;  2D0T A;  2KND A;  3JC6 C;  5LCY A;  1BR1 A;  2B1E A;  4JLE A;  2LSJ A;  5LBM A;  3Q5W A;  4GYR A;  5LGU B;  3F31 A;  2BDE A;  4CXY A;  3K3Q C;  4G2A A;  4QWN B;  1YW0 A;  3CX7 B;  2DWG A;  1Y64 B;  4CXW A;  3LK4 2;  3RC8 A;  5L2L A;  5E0O A;  3FXD B;  1U4Q A;  3AAE B;  1YD8 G;  3CQX C;  3EDV A;  3MK7 C;  5HXE A;  3A5X A;  1LKX A;  4YLH A;  3HKC E;  4F6R C;  1U5P A;  2LOS A;  2VWA A;  3F2E A;  3SOL A;  1NAF A;  5FY1 A;  3RYF E;  2VKO A;  4ZI3 D;  4OHF A;  2NWB A;  3IEE A;  5JR9 B;  1ZKE A;  2W63 A;  2XAH B;  2CMR A;  4TV9 E;  2EHO C;  3ANW B;  2XAF B;  4QXH B;  3KVB A;  3EDU A;  3F57 A;  3OJA A;  4WW0 A;  4ASK A;  3ZPO A;  4EAH A;  3BK9 A;  1UX4 A;  2WMN A;  3N2G E;  2OA5 A;  2XAS B;  2G0U A;  3NRX A;  3QC9 A;  4UF0 B;  2C5K T;  2DHR A;  4WNK A;  3WAK A;  2XAG B;  2XAJ B;  1SHZ C;  3O4X E;  3DP7 A;  2MYS A;  2NW8 A;  2LJL A;  4XBF B;  2E9X D;  4AQF A;  1WR6 A;  3AAA B;  5L3D B;  1OWA A;  3KBU A;  4N78 D;  4MBQ A;  1IJ6 A;  4B6X A;  4IST A;  3ZMZ B;  3VKH A;  3CWZ B;  4HGA A;  5J1G A;  3ZC0 A;  4OFZ A;  5EK4 A;  2MOZ A;  2LT3 A;  3AA7 B;  3NBX X;  4AXP A;  3I0Q A;  4HTE A;  1FIO A;  4ZI3 C;  5JDL A;  4ERR A;  5CA0 E;  3SS1 A;  5FMN A;  4BJN A;  2NTX A;  2JMK A;  3HI2 A;  2HPJ A;  3LG7 A;  3CKD A;  2Y6X A;  4QX8 B;  4PJL A;  3UUX B;  3SWH A;  3B57 A;  3E08 A;  3I9W A;  2M67 A;  2ODV A;  3LJC A;  3H37 A;  3IHR A;  3NRY A;  5LBQ B;  4L5G A;  4G63 A;  2E9X C;  4UEM A;  4GIW A;  4QHO A;  4UXN B;  2V7M A;  3P7I A;  1UX5 A;  4I4T E;  3ONX A;  4IE0 A;  4QXC B;  1B7T A;  3OYX A;  4MFR A;  4H9O C;  3K3N A;  2HH7 A;  1YKE B;  3JC6 D;  3AA6 B;  3K3O A;  2NP9 A;  5HAX A;  5JDM A;  3CVR A;  4BAY B;  3ZN1 B;  5JDG A;  4CZZ B;  3KV6 A;  3UT5 E;  5A1L A;  1IZN B;  4TN7 B;  5J2U E;  5DAB A;  2LEH A;  1MMG A;  2EHO A;  2IW5 B;  2P9B A;  3LFM A;  4JUY A;  3CML A;  4YJ2 E;  4ZS3 A;  4UVB B;  5BMV E;  1MIW A;  3QK6 A;  5JRC B;  5FP3 A;  3KV5 A;  4EZ4 A;  1D1B A;  3FHN A;  4I50 E;  1ZHC A;  4HN9 A;  4ZHQ E;  3HA4 A;  4CI2 B;  2BVL A;  5LGN B;  2CLY B;  2NW7 A;  3GN5 B;  2PBI A;  3RYH E;  1KK7 A;  2IC6 A;  4H9P C;  4E7Z A;  1D1A A;  2VL8 A;  4WBN E;  2D0U A;  2KZ7 B;  1HG2 A;  3K8P C;  1KNZ A;  3PUS A;  4V1A v;  3ZMT B;  2JRK A;  2EHO D;  3ETV A;  2PG8 A;  2YU1 A;  3HKE E;  3UUM A;  3DJB A;  3SRZ A;  4YFS A;  3OYZ A;  1MMD A;  4H9S E;  3N9P A;  2A3D A;  4O2B E;  4AKL A;  4DMV A;  5J2T E;  4I55 E;  4PJM A;  4EYY R;  4PNI A;  4E7S A;  5JDQ A;  4TZ4 C;  3PU8 A;  3ZYK A;  3ZYL A;  5IYZ E;  3DTO A;  1G8X A;  2LOP A;  2K5B B;  3RPU A;  3RX6 A;  3C64 A;  4MAL A;  2IAK A;  3LBX A;  2L9Q A;  3FBZ A;  2ZM0 A;  3AVR A;  2Y8D A;  3E22 E;  2UXN B;  4EIW A;  2Q9Q C;  2ZM2 A;  3EVY A;  4KP3 C;  3RH3 A;  3I9Y A;  2D5U A;  2H7O A;  4DVD A;  1LRZ A;  5LOV E;  2E9X A;  1QUU A;  2CA5 A;  1ZV4 X;  3UUN A;  1IJ5 A;  2X9Y A;  1SA0 E;  4HEA A;  3Q5X A;  4IE7 A;  2H3R A;  5L3F B;  2XHE B;  2RA1 A;  4EOZ B;  3Q2M A;  2C5I T;  3GMI A;  5LYJ E;  2VKH A;  3HR0 A;  3ESL A;  5EK2 A;  2MBG A;  1HTJ F;  5JDN A;  2CE7 A;  5LXT E;  4H9R C;  3C4Z A;  4DND A;  1O3X A;  3PUR A;  2ZM8 A;  2X66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...