4GIWA

Crystal structure of the run domain of human nesca
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
179
Chain Sequence
QKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLMYMPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUN and SH3 domain-containing protein 1
publication title Crystal structure and functional implication of the RUN domain of human NESCA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4giwA00
2DWGA 2CXLA 3CWZB 4GIWA 2CXFA 2DWKA
chains in the Genus database with same CATH superfamily
2V5CA 2VKDA 2M67A 3RIFA 2WBLA 4IGUA 5LNKA 4YHHT 3NZQA 1KNRA 1WR0A 1SUMB 5AQMB 3VKHA 4I55E 4B6XA 2Z6EA 3VHLA 2LSIA 2XQ7A 4JLEA 2WS3A 4HFDA 3PJAA 2BDEA 2WWVA 2UXDT 1HFAA 1T7SA 3FZLB 5AQTB 4J2CA 4N78D 3EABA 2E9XB 4JEUB 2W66A 3ZMVB 5L3DB 3AE1A 4JI0T 4AQGA 5F5WA 4U2YA 3RIUC 4X62T 4HE8A 1G8XA 2NW7A 1UK5A 4CI2B 2IC6A 4QKNA 1EZ3A 3NKZA 4LMJA 5L3FB 1YKHB 3C98B 3R6NA 1YQ3A 5DJQC 3ZN1B 1MMNA 3Q5DA 4IDPA 3QUJA 2CA5A 3EDUA 2E9XC 2C5KT 1D1BA 5CA0E 3AAAB 4AKHA 2YDQA 3TLWA 4H9OC 5JRCB 2H89A 3HL6A 4DNDA 4OYKA 2MAWA 4LF7T 2ACXA 2LM9A 3L3PA 4ERRA 2YU1A 4KX6A 4LFBT 2G0UA 2VVNA 3WAKA 2YINA 4BA9A 4UF0B 3MACA 2D2SA 1LVFA 4EAHA 3VR9A 3H37A 3ZMSB 2JIWA 2QYWA 1XDOA 4CN4A 4GOUA 5HAXA 1W0AA 2B1EA 3L8RA 3KV9A 3G06A 3OBVE 3NBXX 3AA7B 4ISSA 2ZLYA 1OWAA 4DR1T 4CXYA 2XAGB 4QH1A 5AQGB 2XQ9A 5E0OA 4DR4T 5L3GB 1XMOT 4QHOA 5ABGA 3MZKB 4UXNB 3RF1A 2E5LT 2XJ7A 4E7ZA 2VB6A 3UTKA 5JDLA 1X9BA 2CBIA 3MXZA 3J9X1 1JNRA 5IYZE 3B13A 4A98A 4XAXB 1WYCA 5LXTE 3AB3B 3F57A 2GK9A 1IBMT 3N9QA 2LKHA 3VRAA 2A2FX 4HFCA 4I50E 4X64T 4QXBB 1LKXA 5M4YA 4DV5T 3ZC1A 1LRZA 1OXZA 3A8YC 2DI4A 3X1DA 2NTYA 4JBWF 4X5TA 5ADXL 4A97A 2BG9B 4DR7T 2XQ6A 2WU2A 1BR2A 2UXCT 2W0GA 2J1DG 1OEDB 2HN1A 4F6RC 2CBJA 2DHRA 5DQVA 4X65T 4WW0A 2ODVA 4GYRA 5LG3A 2JMKA 2KSRA 5HEHA 4CXXA 4OX9T 5L3BB 2XQ4A 2XASB 2MTQA 2UXBT 2CHNA 3EDVA 3BQIA 2H3RA 2BG9C 1UCUA 4CN1A 2OLTA 2Q9QB 2W00A 2EHOB 1OEDC 3RIAA 2VQFT 3KV5A 2X0LB 4HGAA 1YKEB 5HYAA 2YK0A 3O1HA 3ZYKA 1XDPA 1Z8UA 2LSKA 3SRZA 4Q25A 2UXXB 4ILAA 2Q9QC 5CGMA 2EHOC 4PJJA 2V6XA 3LJCA 2QVAA 4B3MT 2W63A 3AAIA 5KMGP 2M6BA 5FNVE 4PFPA 2QA7A 2X0YA 4H9QC 3AE3A 4ILCA 3TKLB 4AKRB 4IL4A 1WFDA 2WCAA 4HFEA 4DV4T 3CQXC 3GN5B 4GKJT 1ZP0A 1HCIA 3ZEFB 3RYIE 3HI2A 2HHHT 4IE7A 3WI3A 2YDRA 5JDFA 3J7Yq 5HXCA 1D0XA 2XQYA 1MIYA 4M1PA 4ZEYA 3LDQB 4PK4A 2BG9E 2X9XA 3PU8A 3F31A 3PUAA 2XQ3A 1UX5A 2ZM6T 1OEDE 5J1GA 3FXDB 2MOZA 4UVBB 1BR1A 5AQVB 2BS2A 2JJ9A 3LK42 5LP6E 3RYFE 3CWZB 1HNXT 3OPCA 2IDOB 4LF5T 2FJBA 4WYVA 3U78A 3MJXA 5ETWA 2AE9A 4F8HA 1YQ4A 5FL1A 4GIWA 1O3XA 4AISA 4AKLA 2WM9A 4MHCA 4I0UA 4O8SA 4Z90A 1FJGT 3FZKB 4XZCA 4MALA 4AQFC 2LT3A 2RPAA 3NRXA 3RKOA 4YJ2E 3JC6D 3EAMA 5JH7E 2L9QA 2WQYA 1NENA 5JDHA 3NVOA 1KFYA 1N32T 3AE6A 4JI4T 1VRBA 3P4PA 4UR9A 5HEGA 2W62A 3ABVA 1M7KA 4MBQA 3UUMA 3DTOA 1QUUA 2JMHA 4DV1T 3SOLA 3UQ7A 3IEEA 4BJNA 4JI6T 3RKGA 3AE4A 2XQ5A 1MMAA 3CVRA 3Q5EA 3BK9A 1DU2A 2LE8A 1FMVA 3C64A 5JDMA 5LGUB 2FJEA 3ZKRA 4JI7T 5JDNA 1E1HB 5JDQA 1HNWT 1UX4A 2LOSA 2RA1A 1VCSA 4KBMB 2MPKA 1N36T 3P7IA 3RYCE 2XM2A 2BKNA 4HN9A 4TZ4C 2LSGA 4B3ST 5FP3A 2CWYA 4P0AA 4LFAT 5C2TA 2VK9A 2YOEA 1E7PA 4PFOA 2QRXA 2N9DA 5KXJA 3Q5WA 3OKQA 5CB4E 5JR9A 2W61A 2XTLA 4IL9A 5LJNA 4NUUA 1HS7A 4P09A 2WWUA 2VVSA 2QGSA 2Y48B 5EK3A 2K48A 1W0BA 4HTEA 4YFSA 2A72A 2VKOA 3UUNA 2LLYA 4OK0A 4P1NA 3O1IA 3U3IA 1Y01A 3I1AA 4EIWA 4YHJA 3BQKA 2PTFA 2JQKA 3RQUA 5LGNB 2K5BB 5AQIB 4KI0F 1WLXA 2LJLA 4JI8T 5H6QB 3PUWF 4HWCA 2SPCA 3C50A 3CIRA 3L09A 5BR8T 2R6GF 3P50A 4YTPA 4ZI3D 5AQNB 4TWFA 3B57A 3ZSSA 1HF8A 1MIVA 3QNUA 5J2UE 2CMRA 3IBPA 4TWHA 3N2GE 1W9RA 3ESLA 3ANWB 3FZMB 5FL0A 3OJAA 2V6YB 4ILUA 2YU2A 3ZN0B 1N33T 3AVRA 3HKDE 5AQJB 2YDSA 1WRDA 4K0UA 4LF4T 2XAHB 2RP4A 3LBXA 4L9IA 2WSSV 3CX6B 5AQRB 2V8SV 3K1SA 3RH3A 3RYHE 4H63V 5FVLA 2VURA 4K0KT 2LHNA 1IBKT 3KBTA 4V1Av 1MNDA 4PW8A 2MYSA 5HEJA 3L39A 2LKGA 2X0HA 4DMVA 2XAFB 2ES0A 4C91A 3ZSTA 2IC9A 2XQ8A 2H88A 4CN6A 4ZI2D 3UUXB 4EEBA 3KV6A 4DMWA 3KVAA 3RX6A 3MK7C 3UT5E 2N2NA 2XHEB 4EOZB 5L3EB 4DV0T 3IHRA 3Q5XA 1HNZT 4QH5A 4YTMA 5LGTB 2BKPA 3KV4A 4UVCB 2DCFA 3I9WA 1ZEEA 3A5XA 3N9LA 3AEDA 3EI0A 3KINB 3HKEE 4IDNA 2CXLA 2X68A 4PJMA 3ZPOA 2CM0A 4GKKT 2IIUA 4JUYA 5FKYA 4OFZA 3RHWA 4BJMA 2LM2A 5HEUA 1D1AA 5AQKB 3W15B 2NW9A 3GWHA 4U2ZA 3QC9A 5LBMA 3SFEA 3HA4A 3E0ZA 3PUVF 2X51A 4FI5A 2KZ7B 4YTNA 1QSDA 3HKCE 4IDQA 3UU8A 1N34T 3KDSE 2X9HA 1SHZC 2CXDA 2HPLA 3AXJB 5FVKA 3E08A 4ZI7E 5AQUB 4UEMA 1X79A 2W2UA 4EZ4A 2NW8A 4H9SE 3OVUA 4HWFA 3VU7H 4C90A 4LMKA 5LYJE 3VRBA 4YSXA 2WU5A 2LHRA 1L0VA 4TUYE 3QK6A 3ZT7A 4CXWA 4IE6A 4QXCB 2H7VC 3ZJ2A 4O2AE 4DVDA 2J62A 5HWXA 5LOVE 4CZZB 3RGLA 2C5JA 5EK4A 2N1GA 4H9RC 1D1CA 3NZPA 3P4SA 5FXXA 4O4LE 3MKDA 5AQLB 2OV9A 1V9DA 2KT9A 1IBLT 4AQYT 3AEBA 1YD8G 4CQIA 4PNIA 3DJBA 3FXEB 2V7JA 2VWAA 5HXEA 1BR4A 2XUEA 3JC6C 2L3LA 5A1LA 2DWGA 1J1JA 3LG7A 3KFWX 1YW0A 2Y8DA 3M65A 3ETUA 2OA5A 3RRCA 2XZEA 3AEGA 1UGOA 5L4EA 2IW5B 3OYZA 4ZOLE 4JI3T 3PUXF 2JQ9A 3JCFA 4MLKA 5ABFA 4FJOA 5KDMC 3RLFF 4U74A 2UUBT 2MBGA 4X20E 1KK7A 2CE7A 5LHHB 2WY2A 5HCJA 3E22E 3ZC0A 4TNVA 4QH4A 1T98A 2K3WA 2E8IA 4HFBA 3K3OA 3N9MA 1KNZA 2VASA 2XSBA 3PURA 3T1YT 2W67A 5LA6E 4GK5E 1W09A 5L4HA 1IAPA 4I4TE 4EV6A 5CJ5A 2IMLA 2XY8B 2ZM2A 3ZCIA 4OYJA 1MNEA 2LSJA 2P9BA 2KLQA 4DBRA 5AQSB 3P4RA 3V5SA 5J2TE 3AE9A 4DUYT 1VCTA 4LF9T 3C51A 2WB5A 4TNWA 1US7B 2DL1A 4ILBA 2L8KA 4DR6T 2M6IA 1ZKEA 5JR9C 1ZV4X 3KVBA 5LMNT 2CEAA 1IJ5A 3AE2A 1XNQT 4EYYR 3I0QA 2HN2A 2VL0A 2I6HA 3ZYMA 2CRBA 1SA0E 2XQAA 5HXHA 2IAKA 3CK6A 4IREA 2C5IT 4U33A 3ZMZB 2D9DA 3AVSA 4ZS2A 3O9XA 1ZOYA 2XM1A 4ZI3C 2CWOA 4PJNA 4AIUA 4EEDA 4ZXLA 2KMFA 2EHOD 3IA3A 3LBXB 3QB5A 5AQHB 1J5WA 5L3CB 3AECA 2UUCT 2DWKA 3K3QC 3T8OA 4NPPA 1JNZA 1MMGA 4TX5A 5JREA 3M3ZB 3O1JA 3CX7B 1I6ZA 4DV3T 5HWYA 4DR5T 1XZYA 5JTGA 2LSYA 2WZHA 3UU3A 3SFDA 2X9YA 4HFHA 4Z8XA 5EZYE 3MA9A 4YLHA 3PJAJ 4X66T 4DR2T 2CLYC 1HX1B 5AQPB 2BKOA 4A56A 5IWAT 4U7IA 3ZLIA 2Y6XA 3SWHA 4G63A 4TWDA 3UFGA 4ZI2C 4YJ3E 5LBQB 1MIWA 4CI3B 2PBIA 2KXPB 2E5VA 2NR4A 4AXPA 2AXDS 2IHR1 1I94T 3P4QA 1ZHCA 1H7CA 4P0BA 1CUNA 2YN6A 4U72A 2V7KA 4O4IE 2I59A 2K9AA 5C3JA 2A3DA 2XAJB 2JQHA 1BR0A 5BMVE 2NWBA 3EVYA 4CI1B 3WAJA 1FIOA 5LHIB 4U31A 3IF8B 2V7MA 3EUHA 4KP3C 4ZS3A 3JAEA 1E2AA 3HKBE 3FB2A 4HEAA 3C4ZA 4COFA 3FBZA 5ABHA 2E2AA 2D5UA 2WAUA 3FZFB 3GMIA 3NWIA 4YSZA 3AEEA 4JEHB 2V7IA 2NOXA 4HWIB 5HEOA 4EB6E 3PU3A 1D0ZA 1U5PA 4L5GA 4U7YA 4I43B 2XSAA 1VOMA 4Z91A 2K24A 3K8PC 1T8BA 3UU5A 4QX7B 2NTXA 2X9WA 5FXWA 3LK3B 3AEFA 3CKDA 3AA1B 3TLSA 2NP9A 1NAFA 3Q9DA 2XPKA 2ACZA 1S35A 4ANJA 4KMCA 4EYUA 5F8PA 3UFEA 4IHJE 5HCMA 2WMNA 4HWHA 4WZXA 5FXZA 4DBQA 2V7LA 5AQOB 4NUVA 4ASKA 4X1KE 3PUZF 4HWDA 4BAYB 2LEHA 3ONJA 4NXNT 4UV8B 4PAGA 1NWMX 2XAQB 2HH7A 4H63H 5ABFB 1Y64B 5CFBA 4NXMT 3ZMTB 1LVKA 4YY3T 3V5UA 3HR0A 3FZHB 3LK2B 3LSVA 2ODUA 3AE5A 4EGWA 1R8IA 4DIDB 3I9YA 1U4QA 4ISTA 4NIQA 5EK2A 3CMLA 3PV0F 4AKGA 4JV5T 3C4WA 4TN7B 1SE7A 2UUAT 4TV8E 3N2OA 2YKSA 2YEVC 4HFVA 1J5ET 3UU4A 4LMLA 2VKHA 3QB5K 2LRKA 3TLTA 4DV6T 2CCQA 2X66A 2I0MA 2FUPA 2WDVA 1D0YA 3PTRB 3RPUA 3N2KE 1HG2A 1XMQT 3RIUA 4A5XA 4IE5A 2W4XA 2LRLA 3JAFA 3PUGA 1S94A 4KHZF 1UUSA 3LFMA 1G73A 3ZYLA 2JPFA 3AE7A 2X67A 1CHUA 2BBJA 4OHFA 4DV7T 4LFCT 3UULA 3T1HT 3JADA 2E9XA 5HXSA 1HR0T 4WBNE 5AQFB 2PG8A 2IUBA 2E9XD 3VR8A 3ANWA 4JI1T 2KWIB 2V6YA 4AKIA 2J47A 1IJ6A 4EXTA 4DUZT 4DV2T 5FY1A 4QXHB 2DLRA 4YXDA 5FY7A 2BZBA 2JRKA 3VKGA 3P8CD 3AE8A 3SS1A 2FBWA 4YT0A 5JRCA 4IDOA 3ONLC 4JYAT 2WZIA 4AI6A 2PFVA 5KX5E 3Q2MA 2CPTA 4UV9B 4QWNB 4IIJE 2KWHA 2H7OA 3N5LA 2WDQA 3RC3A 3N9PA 2DNXA 5LB7B 2FJAA 4U3CA 4IE0A 4QX8B 2CHOA 4KHPT 3O4XE 4UF0A 5DQWA 4DR3T 1T72A 2F4VT 3AA6B 2KNDA 3P4WA 5TAOA 2HPJA 1KEYA 3CPZA 1QLBA 2BVMA 3UU6A 3EHZA 5LHGB 3ZT5A 3ZMUB 5DABA 1WCRA 5LJMA 4O2BE 1XNRT 5AFUL 4GYSA 5LG4A 2JQQA 3KBUA 2VL8A 2CXFA 2V1DB 3FBLA 5C8YE 2WP9A 5JR9B 4LF8T 1GQEA 1XWMA 5CA1E 2BBHA 3H3AA 2D0UA 4PJLA 4H9NC 4IDZA 3BQLA 3F2EA 2BVLA 3CQGB 3N9NA 3RRWA 3OYXA 3UQ4A 5FXVA 4O4JE 3AXJA 4LF6T 3AEAA 4E7SA 2KINB 1YXRA 4PK6A 2BG9A 4JI5T 1HTJF 3ZT6A 5IUXA 1UURA 4WNKA 2ZM8A 1OEDA 3PDYA 2WDRA 3R84B 3C4XA 2VQET 3RI5A 3TLUA 3QOFA 3ZJ1A 2C0SA 3ZCJA 4ZZCA 2VKJA 5F3JA 2FJDA 1KNPA 2UU9T 1M62A 4MFRA 5LCYA 4IE4A 2Q9QA 4JI2T 2ZMAA 3S4UA 2BS4A 2D0TA 1FEWA 2EHOA 4L0RA 1HG5A 2V5DA 2Q9QD 1WYBA 4B3RT 5JVDE 4O4HE 2ZM0A 4ZZBA 3H3MA 2V26A 4UIGA 3B5MA 4G2AA 5J0ZA 4GK0E 2CLYB 3TLVA 5IHYA 2B76A 4IT4A 3PUQA 3PE0A 5H6RB 2LOPA 3UUBA 1WR6A 4XBFB 3OTOT 2BS3A 4KUMB 5AQQB 4EZHA 5L2LA 5JQGE 5FMNA 3CX8B 3D0TA 4UVAB 5L47A 1B7TA 5FYMA 1IZNB 3CQCB 3I0OA 3FHNA 3K3NA 4ZHQE 3AA0B 4YSYA 4HFIA 3GN5A 3NRYA 3RC8A 1Z0PA 5HXRA 1FMWA 4H9PC 3ONXA 1AJ3A 4TV9E 3AAEB 4B3TT 1MMDA 3RQWA 1KF6A 3GA8A 4HKAA 5GONE 2UXNB 3PUYF 2A9UA 1NEKA 5FY0A 5ABEA 3N9OA 4DO0A 3DP7A 4X1IE 5LMUT 3ETVA 4ADZA 2WMOA 4PK5A 4UELA 2J4GA 2PJQA 3PUSA 1HX8A 4X1YE 4AQFA 3A7MA 5JDGA 4WBOA
chains in the Genus database with same CATH topology
3JC6D 3LK2B 2VKDA 2M67A 2ODUA 2Y8DA 2WBLA 4IGUA 5LNKA 3M65A 5JH7E 2L9QA 3ETUA 2OA5A 3I9YA 1U4QA 3NZQA 4ISTA 3RRCA 5EK2A 5JDHA 3CMLA 4AKGA 3C4WA 4TN7B 3VKHA 2IW5B 3OYZA 4ZOLE 1VRBA 4I55E 4TV8E 4B6XA 2Z6EA 3VHLA 2W62A 3N2OA 2YEVC 4HFVA 4MBQA 4MLKA 2LSIA 3UUMA 4JLEA 4FJOA 3DTOA 1QUUA 2JMHA 5KDMC 2VKHA 4U74A 3SOLA 2BDEA 2MBGA 2CCQA 4X20E 1KK7A 2CE7A 1HFAA 5LHHB 3IEEA 4BJNA 4J2CA 4N78D 3E22E 3ZC0A 2E9XB 1T98A 4JEUB 3ZMVB 2X66A 2E8IA 5L3DB 1MMAA 3K3OA 3N9MA 4AQGA 1KNZA 2VASA 3CVRA 1D0YA 3PTRB 3RPUA 3BK9A 1HG2A 3N2KE 3PURA 2LE8A 4IE5A 4HE8A 1G8XA 2NW7A 3PUGA 1S94A 1FMVA 5LA6E 3C64A 4GK5E 4CI2B 2IC6A 5JDMA 5LGUB 3LFMA 4QKNA 1EZ3A 1G73A 5JDNA 3ZYLA 1IAPA 2JPFA 4I4TE 5L3FB 1YKHB 3C98B 3R6NA 1E1HB 5JDQA 2X67A 5DJQC 3ZN1B 1MMNA 4OHFA 1UX4A 2ZM2A 3UULA 3ZCIA 4OYJA 3QUJA 2LOSA 2RA1A 4KBMB 1MNEA 2CA5A 3P7IA 3RYCE 2LSJA 2P9BA 2KLQA 2E9XA 2E9XC 2C5KT 3EDUA 5HXSA 1D1BA 5CA0E 4HN9A 3AAAB 4DBRA 4WBNE 4AKHA 3V5SA 4H9OC 4TZ4C 5JRCB 3HL6A 5J2TE 2LSGA 2PG8A 2E9XD 5FP3A 4DNDA 3ANWA 4OYKA 2ACXA 2LM9A 2CWYA 3L3PA 2KWIB 4P0AA 4ERRA 2VK9A 2YU1A 4AKIA 3C51A 4PFOA 2N9DA 1IJ6A 4EXTA 1US7B 2G0UA 3Q5WA 2L8KA 3WAKA 2YINA 5FY1A 3OKQA 4QXHB 1ZKEA 4BA9A 2DLRA 4UF0B 3MACA 5CB4E 5JR9A 5FY7A 1ZV4X 2BZBA 2D2SA 2JRKA 5JR9C 3VKGA 2W61A 1LVFA 3P8CD 4EAHA 3SS1A 2XTLA 3H37A 3KVBA 5LJNA 3ZMSB 4NUUA 2CEAA 1IJ5A 1HS7A 4P09A 2WWUA 5JRCA 4EYYR 4GOUA 5HAXA 2B1EA 3I0QA 2QGSA 3KV9A 2Y48B 5EK3A 3OBVE 4AI6A 2PFVA 5KX5E 3Q2MA 3NBXX 4UV9B 4QWNB 2K48A 3AA7B 4IIJE 4ISSA 2ZLYA 1OWAA 4HTEA 2KWHA 4YFSA 2H7OA 3ZYMA 3N5LA 2A72A 3RC3A 3N9PA 2DNXA 1SA0E 2VKOA 3UUNA 4CXYA 4OK0A 3O1IA 2XAGB 3U3IA 3I1AA 5HXHA 2IAKA 4EIWA 4YHJA 3BQKA 5E0OA 4IE0A 4QX8B 5L3GB 2C5IT 3O4XE 4UF0A 3ZMZB 3AVSA 4QHOA 5DQWA 5LGNB 4ZS2A 2K5BB 3O9XA 1WLXA 2LJLA 4ZI3C 2CWOA 4PJNA 5H6QB 3MZKB 4UXNB 2SPCA 3C50A 4E7ZA 3AA6B 3L09A 2KMFA 2VB6A 3UTKA 5JDLA 2KNDA 2EHOD 3LBXB 3MXZA 4ZI3D 3B57A 3J9X1 5TAOA 1HF8A 5IYZE 2HPJA 3B13A 3CPZA 4XAXB 1MIVA 1WYCA 2BVMA 5L3CB 5LXTE 5J2UE 3AB3B 2CMRA 3F57A 2DWKA 3K3QC 2GK9A 3IBPA 3T8OA 3N9QA 1MMGA 5LHGB 3ZMUB 2A2FX 4TX5A 5DABA 3N2GE 4I50E 4QXBB 5LJMA 3ESLA 5JREA 3ANWB 4O2BE 1LKXA 3O1JA 5M4YA 3ZC1A 1LRZA 3CX7B 5AFUL 4GYSA 3OJAA 1OXZA 4ILUA 2DI4A 5LG4A 2YU2A 3ZN0B 3AVRA 3HKDE 5HWYA 2JQQA 3KBUA 2VL8A 1WRDA 2NTYA 2LSYA 4K0UA 2CXFA 2XAHB 2RP4A 2V1DB 3FBLA 3LBXA 4L9IA 5ADXL 2WSSV 2X9YA 3CX6B 5C8YE 5JR9B 1BR2A 2W0GA 4Z8XA 3RH3A 2J1DG 5CA1E 5EZYE 3H3AA 2D0UA 4F6RC 3MA9A 3RYHE 4YLHA 2DHRA 4H63V 5DQVA 4WW0A 2ODVA 4GYRA 2CLYC 2JMKA 4PJLA 4H9NC 4IDZA 4CXXA 2LHNA 3BQLA 3F2EA 2BVLA 3CQGB 5L3BB 3N9NA 4A56A 3KBTA 3RRWA 2XASB 3ZLIA 3OYXA 2Y6XA 4V1Av 1MNDA 4PW8A 3SWHA 5FXVA 2MYSA 4O4JE 2MTQA 4G63A 3EDVA 4ZI2C 4E7SA 2KINB 4DMVA 2XAFB 4YJ3E 2ES0A 3BQIA 4C91A 5LBQB 2H3RA 4PK6A 1UCUA 1MIWA 2IC9A 1HTJF 2Q9QB 4CI3B 2PBIA 2W00A 4WNKA 2EHOB 4ZI2D 2KXPB 2ZM8A 3KV5A 3PDYA 2X0LB 3R84B 3C4XA 4HGAA 1YKEB 4AXPA 5HYAA 2YK0A 3O1HA 3ZYKA 3UUXB 3ZJ1A 2C0SA 3KV6A 1ZHCA 1H7CA 4P0BA 3ZCJA 4DMWA 3KVAA 1CUNA 4U72A 2V7KA 4O4IE 2VKJA 3RX6A 2I59A 2K9AA 3MK7C 3UT5E 2LSKA 5F3JA 2N2NA 2A3DA 2XAJB 3SRZA 2XHEB 1BR0A 5BMVE 4EOZB 2NWBA 5L3EB 3EVYA 3IHRA 4MFRA 2UXXB 4CI1B 5LCYA 4IE4A 3WAJA 3Q5XA 1FIOA 2Q9QA 2Q9QC 2ZMAA 3S4UA 5LHIB 2D0TA 1FEWA 2EHOA 2EHOC 3IF8B 4PJJA 2V7MA 3EUHA 4L0RA 4KP3C 3LJCA 5LGTB 4ZS3A 3KV4A 4UVCB 2DCFA 1HG5A 3I9WA 1ZEEA 3A5XA 3HKBE 3N9LA 2Q9QD 2W63A 3KINB 3FB2A 3HKEE 2CXLA 3AAIA 2X68A 4PJMA 1WYBA 5KMGP 4HEAA 3C4ZA 5JVDE 3ZPOA 2CM0A 5FNVE 3FBZA 4O4HE 4JUYA 2ZM0A 2D5UA 2WAUA 4PFPA 2QA7A 3GMIA 4OFZA 4BJMA 4H9QC 2V26A 4UIGA 3TKLB 4AKRB 4G2AA 1D1AA 4JEHB 2NW9A 2V7IA 3GWHA 2NOXA 4GK0E 3W15B 3QC9A 2CLYB 5LBMA 5IHYA 4EB6E 3PU3A 3HA4A 3E0ZA 1D0ZA 3CQXC 2X51A 3GN5B 1U5PA 4L5GA 3PUQA 2KZ7B 1QSDA 2LOPA 3HKCE 1VOMA 3PE0A 4FI5A 4I43B 5H6RB 1WR6A 4XBFB 3KDSE 2X9HA 1SHZC 2CXDA 2HPLA 1HCIA 3ZEFB 3RYIE 3HI2A 2K24A 3K8PC 3E08A 4IE7A 4ZI7E 4QX7B 2NTXA 3WI3A 2X9WA 5JDFA 4KUMB 5FXWA 4EZHA 5L2LA 3J7Yq 5HXCA 1D0XA 2XQYA 4UEMA 1X79A 3LK3B 5FMNA 3CKDA 1MIYA 3AA1B 5JQGE 4EZ4A 2NP9A 3CX8B 1NAFA 3D0TA 4UVAB 2NW8A 4H9SE 4M1PA 1B7TA 5FYMA 3Q9DA 1IZNB 3CQCB 3I0OA 3FHNA 4PK4A 3K3NA 3VU7H 2X9XA 4C90A 5LYJE 3PU8A 3F31A 3PUAA 4ZHQE 1S35A 1UX5A 4ANJA 2LHRA 5J1GA 4TUYE 3AA0B 3FXDB 4KMCA 3GN5A 4EYUA 5F8PA 3UFEA 3NRYA 3RC8A 1Z0PA 3QK6A 2MOZA 4IHJE 2WMNA 4UVBB 5HXRA 1BR1A 1FMWA 4CXWA 4H9PC 4IE6A 2JJ9A 3ONXA 1AJ3A 4QXCB 2H7VC 3LK42 5FXZA 4DBQA 5LP6E 3RYFE 4TV9E 2V7LA 3AAEB 3ZJ2A 3CWZB 4O2AE 4NUVA 4ASKA 4X1KE 4DVDA 1MMDA 5HWXA 5LOVE 4CZZB 3GA8A 4BAYB 2C5JA 5EK4A 2LEHA 2N1GA 4HKAA 5GONE 2UXNB 4UV8B 3MJXA 4H9RC 3U78A 1D1CA 3NZPA 5ETWA 5FXXA 5FY0A 4O4LE 3MKDA 4GIWA 3N9OA 4DO0A 3DP7A 1O3XA 1V9DA 4X1IE 2KT9A 4PAGA 3ETVA 4AKLA 4ADZA 2WMOA 2WM9A 1YD8G 4PK5A 1NWMX 2XAQB 4MHCA 4UELA 4PNIA 2HH7A 4CQIA 3DJBA 3FXEB 2V7JA 4H63H 2VWAA 4O8SA 5HXEA 1BR4A 2PJQA 3PUSA 1Y64B 2XUEA 4XZCA 4MALA 1HX8A 3JC6C 4X1YE 3ZMTB 4AQFA 4AQFC 2LT3A 2L3LA 1LVKA 5A1LA 2DWGA 3V5UA 3NRXA 3RKOA 5JDGA 3LG7A 3HR0A 4WBOA 4YJ2E 3KFWX 1YW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWG A;  2CXL A;  3CWZ B;  4GIW A;  2CXF A;  2DWK A; 
#chains in the Genus database with same CATH topology
 2V5C A;  2VKD A;  2M67 A;  3RIF A;  2WBL A;  4IGU A;  5LNK A;  4YHH T;  3NZQ A;  1KNR A;  1WR0 A;  1SUM B;  5AQM B;  3VKH A;  4I55 E;  4B6X A;  2Z6E A;  3VHL A;  2LSI A;  2XQ7 A;  4JLE A;  2WS3 A;  4HFD A;  3PJA A;  2BDE A;  2WWV A;  2UXD T;  1HFA A;  1T7S A;  3FZL B;  5AQT B;  4J2C A;  4N78 D;  3EAB A;  2E9X B;  4JEU B;  2W66 A;  3ZMV B;  5L3D B;  3AE1 A;  4JI0 T;  4AQG A;  5F5W A;  4U2Y A;  3RIU C;  4X62 T;  4HE8 A;  1G8X A;  2NW7 A;  1UK5 A;  4CI2 B;  2IC6 A;  4QKN A;  1EZ3 A;  3NKZ A;  4LMJ A;  5L3F B;  1YKH B;  3C98 B;  3R6N A;  1YQ3 A;  5DJQ C;  3ZN1 B;  1MMN A;  3Q5D A;  4IDP A;  3QUJ A;  2CA5 A;  3EDU A;  2E9X C;  2C5K T;  1D1B A;  5CA0 E;  3AAA B;  4AKH A;  2YDQ A;  3TLW A;  4H9O C;  5JRC B;  2H89 A;  3HL6 A;  4DND A;  4OYK A;  2MAW A;  4LF7 T;  2ACX A;  2LM9 A;  3L3P A;  4ERR A;  2YU1 A;  4KX6 A;  4LFB T;  2G0U A;  2VVN A;  3WAK A;  2YIN A;  4BA9 A;  4UF0 B;  3MAC A;  2D2S A;  1LVF A;  4EAH A;  3VR9 A;  3H37 A;  3ZMS B;  2JIW A;  2QYW A;  1XDO A;  4CN4 A;  4GOU A;  5HAX A;  1W0A A;  2B1E A;  3L8R A;  3KV9 A;  3G06 A;  3OBV E;  3NBX X;  3AA7 B;  4ISS A;  2ZLY A;  1OWA A;  4DR1 T;  4CXY A;  2XAG B;  4QH1 A;  5AQG B;  2XQ9 A;  5E0O A;  4DR4 T;  5L3G B;  1XMO T;  4QHO A;  5ABG A;  3MZK B;  4UXN B;  3RF1 A;  2E5L T;  2XJ7 A;  4E7Z A;  2VB6 A;  3UTK A;  5JDL A;  1X9B A;  2CBI A;  3MXZ A;  3J9X 1;  1JNR A;  5IYZ E;  3B13 A;  4A98 A;  4XAX B;  1WYC A;  5LXT E;  3AB3 B;  3F57 A;  2GK9 A;  1IBM T;  3N9Q A;  2LKH A;  3VRA A;  2A2F X;  4HFC A;  4I50 E;  4X64 T;  4QXB B;  1LKX A;  5M4Y A;  4DV5 T;  3ZC1 A;  1LRZ A;  1OXZ A;  3A8Y C;  2DI4 A;  3X1D A;  2NTY A;  4JBW F;  4X5T A;  5ADX L;  4A97 A;  2BG9 B;  4DR7 T;  2XQ6 A;  2WU2 A;  1BR2 A;  2UXC T;  2W0G A;  2J1D G;  1OED B;  2HN1 A;  4F6R C;  2CBJ A;  2DHR A;  5DQV A;  4X65 T;  4WW0 A;  2ODV A;  4GYR A;  5LG3 A;  2JMK A;  2KSR A;  5HEH A;  4CXX A;  4OX9 T;  5L3B B;  2XQ4 A;  2XAS B;  2MTQ A;  2UXB T;  2CHN A;  3EDV A;  3BQI A;  2H3R A;  2BG9 C;  1UCU A;  4CN1 A;  2OLT A;  2Q9Q B;  2W00 A;  2EHO B;  1OED C;  3RIA A;  2VQF T;  3KV5 A;  2X0L B;  4HGA A;  1YKE B;  5HYA A;  2YK0 A;  3O1H A;  3ZYK A;  1XDP A;  1Z8U A;  2LSK A;  3SRZ A;  4Q25 A;  2UXX B;  4ILA A;  2Q9Q C;  5CGM A;  2EHO C;  4PJJ A;  2V6X A;  3LJC A;  2QVA A;  4B3M T;  2W63 A;  3AAI A;  5KMG P;  2M6B A;  5FNV E;  4PFP A;  2QA7 A;  2X0Y A;  4H9Q C;  3AE3 A;  4ILC A;  3TKL B;  4AKR B;  4IL4 A;  1WFD A;  2WCA A;  4HFE A;  4DV4 T;  3CQX C;  3GN5 B;  4GKJ T;  1ZP0 A;  1HCI A;  3ZEF B;  3RYI E;  3HI2 A;  2HHH T;  4IE7 A;  3WI3 A;  2YDR A;  5JDF A;  3J7Y q;  5HXC A;  1D0X A;  2XQY A;  1MIY A;  4M1P A;  4ZEY A;  3LDQ B;  4PK4 A;  2BG9 E;  2X9X A;  3PU8 A;  3F31 A;  3PUA A;  2XQ3 A;  1UX5 A;  2ZM6 T;  1OED E;  5J1G A;  3FXD B;  2MOZ A;  4UVB B;  1BR1 A;  5AQV B;  2BS2 A;  2JJ9 A;  3LK4 2;  5LP6 E;  3RYF E;  3CWZ B;  1HNX T;  3OPC A;  2IDO B;  4LF5 T;  2FJB A;  4WYV A;  3U78 A;  3MJX A;  5ETW A;  2AE9 A;  4F8H A;  1YQ4 A;  5FL1 A;  4GIW A;  1O3X A;  4AIS A;  4AKL A;  2WM9 A;  4MHC A;  4I0U A;  4O8S A;  4Z90 A;  1FJG T;  3FZK B;  4XZC A;  4MAL A;  4AQF C;  2LT3 A;  2RPA A;  3NRX A;  3RKO A;  4YJ2 E;  3JC6 D;  3EAM A;  5JH7 E;  2L9Q A;  2WQY A;  1NEN A;  5JDH A;  3NVO A;  1KFY A;  1N32 T;  3AE6 A;  4JI4 T;  1VRB A;  3P4P A;  4UR9 A;  5HEG A;  2W62 A;  3ABV A;  1M7K A;  4MBQ A;  3UUM A;  3DTO A;  1QUU A;  2JMH A;  4DV1 T;  3SOL A;  3UQ7 A;  3IEE A;  4BJN A;  4JI6 T;  3RKG A;  3AE4 A;  2XQ5 A;  1MMA A;  3CVR A;  3Q5E A;  3BK9 A;  1DU2 A;  2LE8 A;  1FMV A;  3C64 A;  5JDM A;  5LGU B;  2FJE A;  3ZKR A;  4JI7 T;  5JDN A;  1E1H B;  5JDQ A;  1HNW T;  1UX4 A;  2LOS A;  2RA1 A;  1VCS A;  4KBM B;  2MPK A;  1N36 T;  3P7I A;  3RYC E;  2XM2 A;  2BKN A;  4HN9 A;  4TZ4 C;  2LSG A;  4B3S T;  5FP3 A;  2CWY A;  4P0A A;  4LFA T;  5C2T A;  2VK9 A;  2YOE A;  1E7P A;  4PFO A;  2QRX A;  2N9D A;  5KXJ A;  3Q5W A;  3OKQ A;  5CB4 E;  5JR9 A;  2W61 A;  2XTL A;  4IL9 A;  5LJN A;  4NUU A;  1HS7 A;  4P09 A;  2WWU A;  2VVS A;  2QGS A;  2Y48 B;  5EK3 A;  2K48 A;  1W0B A;  4HTE A;  4YFS A;  2A72 A;  2VKO A;  3UUN A;  2LLY A;  4OK0 A;  4P1N A;  3O1I A;  3U3I A;  1Y01 A;  3I1A A;  4EIW A;  4YHJ A;  3BQK A;  2PTF A;  2JQK A;  3RQU A;  5LGN B;  2K5B B;  5AQI B;  4KI0 F;  1WLX A;  2LJL A;  4JI8 T;  5H6Q B;  3PUW F;  4HWC A;  2SPC A;  3C50 A;  3CIR A;  3L09 A;  5BR8 T;  2R6G F;  3P50 A;  4YTP A;  4ZI3 D;  5AQN B;  4TWF A;  3B57 A;  3ZSS A;  1HF8 A;  1MIV A;  3QNU A;  5J2U E;  2CMR A;  3IBP A;  4TWH A;  3N2G E;  1W9R A;  3ESL A;  3ANW B;  3FZM B;  5FL0 A;  3OJA A;  2V6Y B;  4ILU A;  2YU2 A;  3ZN0 B;  1N33 T;  3AVR A;  3HKD E;  5AQJ B;  2YDS A;  1WRD A;  4K0U A;  4LF4 T;  2XAH B;  2RP4 A;  3LBX A;  4L9I A;  2WSS V;  3CX6 B;  5AQR B;  2V8S V;  3K1S A;  3RH3 A;  3RYH E;  4H63 V;  5FVL A;  2VUR A;  4K0K T;  2LHN A;  1IBK T;  3KBT A;  4V1A v;  1MND A;  4PW8 A;  2MYS A;  5HEJ A;  3L39 A;  2LKG A;  2X0H A;  4DMV A;  2XAF B;  2ES0 A;  4C91 A;  3ZST A;  2IC9 A;  2XQ8 A;  2H88 A;  4CN6 A;  4ZI2 D;  3UUX B;  4EEB A;  3KV6 A;  4DMW A;  3KVA A;  3RX6 A;  3MK7 C;  3UT5 E;  2N2N A;  2XHE B;  4EOZ B;  5L3E B;  4DV0 T;  3IHR A;  3Q5X A;  1HNZ T;  4QH5 A;  4YTM A;  5LGT B;  2BKP A;  3KV4 A;  4UVC B;  2DCF A;  3I9W A;  1ZEE A;  3A5X A;  3N9L A;  3AED A;  3EI0 A;  3KIN B;  3HKE E;  4IDN A;  2CXL A;  2X68 A;  4PJM A;  3ZPO A;  2CM0 A;  4GKK T;  2IIU A;  4JUY A;  5FKY A;  4OFZ A;  3RHW A;  4BJM A;  2LM2 A;  5HEU A;  1D1A A;  5AQK B;  3W15 B;  2NW9 A;  3GWH A;  4U2Z A;  3QC9 A;  5LBM A;  3SFE A;  3HA4 A;  3E0Z A;  3PUV F;  2X51 A;  4FI5 A;  2KZ7 B;  4YTN A;  1QSD A;  3HKC E;  4IDQ A;  3UU8 A;  1N34 T;  3KDS E;  2X9H A;  1SHZ C;  2CXD A;  2HPL A;  3AXJ B;  5FVK A;  3E08 A;  4ZI7 E;  5AQU B;  4UEM A;  1X79 A;  2W2U A;  4EZ4 A;  2NW8 A;  4H9S E;  3OVU A;  4HWF A;  3VU7 H;  4C90 A;  4LMK A;  5LYJ E;  3VRB A;  4YSX A;  2WU5 A;  2LHR A;  1L0V A;  4TUY E;  3QK6 A;  3ZT7 A;  4CXW A;  4IE6 A;  4QXC B;  2H7V C;  3ZJ2 A;  4O2A E;  4DVD A;  2J62 A;  5HWX A;  5LOV E;  4CZZ B;  3RGL A;  2C5J A;  5EK4 A;  2N1G A;  4H9R C;  1D1C A;  3NZP A;  3P4S A;  5FXX A;  4O4L E;  3MKD A;  5AQL B;  2OV9 A;  1V9D A;  2KT9 A;  1IBL T;  4AQY T;  3AEB A;  1YD8 G;  4CQI A;  4PNI A;  3DJB A;  3FXE B;  2V7J A;  2VWA A;  5HXE A;  1BR4 A;  2XUE A;  3JC6 C;  2L3L A;  5A1L A;  2DWG A;  1J1J A;  3LG7 A;  3KFW X;  1YW0 A;  2Y8D A;  3M65 A;  3ETU A;  2OA5 A;  3RRC A;  2XZE A;  3AEG A;  1UGO A;  5L4E A;  2IW5 B;  3OYZ A;  4ZOL E;  4JI3 T;  3PUX F;  2JQ9 A;  3JCF A;  4MLK A;  5ABF A;  4FJO A;  5KDM C;  3RLF F;  4U74 A;  2UUB T;  2MBG A;  4X20 E;  1KK7 A;  2CE7 A;  5LHH B;  2WY2 A;  5HCJ A;  3E22 E;  3ZC0 A;  4TNV A;  4QH4 A;  1T98 A;  2K3W A;  2E8I A;  4HFB A;  3K3O A;  3N9M A;  1KNZ A;  2VAS A;  2XSB A;  3PUR A;  3T1Y T;  2W67 A;  5LA6 E;  4GK5 E;  1W09 A;  5L4H A;  1IAP A;  4I4T E;  4EV6 A;  5CJ5 A;  2IML A;  2XY8 B;  2ZM2 A;  3ZCI A;  4OYJ A;  1MNE A;  2LSJ A;  2P9B A;  2KLQ A;  4DBR A;  5AQS B;  3P4R A;  3V5S A;  5J2T E;  3AE9 A;  4DUY T;  1VCT A;  4LF9 T;  3C51 A;  2WB5 A;  4TNW A;  1US7 B;  2DL1 A;  4ILB A;  2L8K A;  4DR6 T;  2M6I A;  1ZKE A;  5JR9 C;  1ZV4 X;  3KVB A;  5LMN T;  2CEA A;  1IJ5 A;  3AE2 A;  1XNQ T;  4EYY R;  3I0Q A;  2HN2 A;  2VL0 A;  2I6H A;  3ZYM A;  2CRB A;  1SA0 E;  2XQA A;  5HXH A;  2IAK A;  3CK6 A;  4IRE A;  2C5I T;  4U33 A;  3ZMZ B;  2D9D A;  3AVS A;  4ZS2 A;  3O9X A;  1ZOY A;  2XM1 A;  4ZI3 C;  2CWO A;  4PJN A;  4AIU A;  4EED A;  4ZXL A;  2KMF A;  2EHO D;  3IA3 A;  3LBX B;  3QB5 A;  5AQH B;  1J5W A;  5L3C B;  3AEC A;  2UUC T;  2DWK A;  3K3Q C;  3T8O A;  4NPP A;  1JNZ A;  1MMG A;  4TX5 A;  5JRE A;  3M3Z B;  3O1J A;  3CX7 B;  1I6Z A;  4DV3 T;  5HWY A;  4DR5 T;  1XZY A;  5JTG A;  2LSY A;  2WZH A;  3UU3 A;  3SFD A;  2X9Y A;  4HFH A;  4Z8X A;  5EZY E;  3MA9 A;  4YLH A;  3PJA J;  4X66 T;  4DR2 T;  2CLY C;  1HX1 B;  5AQP B;  2BKO A;  4A56 A;  5IWA T;  4U7I A;  3ZLI A;  2Y6X A;  3SWH A;  4G63 A;  4TWD A;  3UFG A;  4ZI2 C;  4YJ3 E;  5LBQ B;  1MIW A;  4CI3 B;  2PBI A;  2KXP B;  2E5V A;  2NR4 A;  4AXP A;  2AXD S;  2IHR 1;  1I94 T;  3P4Q A;  1ZHC A;  1H7C A;  4P0B A;  1CUN A;  2YN6 A;  4U72 A;  2V7K A;  4O4I E;  2I59 A;  2K9A A;  5C3J A;  2A3D A;  2XAJ B;  2JQH A;  1BR0 A;  5BMV E;  2NWB A;  3EVY A;  4CI1 B;  3WAJ A;  1FIO A;  5LHI B;  4U31 A;  3IF8 B;  2V7M A;  3EUH A;  4KP3 C;  4ZS3 A;  3JAE A;  1E2A A;  3HKB E;  3FB2 A;  4HEA A;  3C4Z A;  4COF A;  3FBZ A;  5ABH A;  2E2A A;  2D5U A;  2WAU A;  3FZF B;  3GMI A;  3NWI A;  4YSZ A;  3AEE A;  4JEH B;  2V7I A;  2NOX A;  4HWI B;  5HEO A;  4EB6 E;  3PU3 A;  1D0Z A;  1U5P A;  4L5G A;  4U7Y A;  4I43 B;  2XSA A;  1VOM A;  4Z91 A;  2K24 A;  3K8P C;  1T8B A;  3UU5 A;  4QX7 B;  2NTX A;  2X9W A;  5FXW A;  3LK3 B;  3AEF A;  3CKD A;  3AA1 B;  3TLS A;  2NP9 A;  1NAF A;  3Q9D A;  2XPK A;  2ACZ A;  1S35 A;  4ANJ A;  4KMC A;  4EYU A;  5F8P A;  3UFE A;  4IHJ E;  5HCM A;  2WMN A;  4HWH A;  4WZX A;  5FXZ A;  4DBQ A;  2V7L A;  5AQO B;  4NUV A;  4ASK A;  4X1K E;  3PUZ F;  4HWD A;  4BAY B;  2LEH A;  3ONJ A;  4NXN T;  4UV8 B;  4PAG A;  1NWM X;  2XAQ B;  2HH7 A;  4H63 H;  5ABF B;  1Y64 B;  5CFB A;  4NXM T;  3ZMT B;  1LVK A;  4YY3 T;  3V5U A;  3HR0 A;  3FZH B;  3LK2 B;  3LSV A;  2ODU A;  3AE5 A;  4EGW A;  1R8I A;  4DID B;  3I9Y A;  1U4Q A;  4IST A;  4NIQ A;  5EK2 A;  3CML A;  3PV0 F;  4AKG A;  4JV5 T;  3C4W A;  4TN7 B;  1SE7 A;  2UUA T;  4TV8 E;  3N2O A;  2YKS A;  2YEV C;  4HFV A;  1J5E T;  3UU4 A;  4LML A;  2VKH A;  3QB5 K;  2LRK A;  3TLT A;  4DV6 T;  2CCQ A;  2X66 A;  2I0M A;  2FUP A;  2WDV A;  1D0Y A;  3PTR B;  3RPU A;  3N2K E;  1HG2 A;  1XMQ T;  3RIU A;  4A5X A;  4IE5 A;  2W4X A;  2LRL A;  3JAF A;  3PUG A;  1S94 A;  4KHZ F;  1UUS A;  3LFM A;  1G73 A;  3ZYL A;  2JPF A;  3AE7 A;  2X67 A;  1CHU A;  2BBJ A;  4OHF A;  4DV7 T;  4LFC T;  3UUL A;  3T1H T;  3JAD A;  2E9X A;  5HXS A;  1HR0 T;  4WBN E;  5AQF B;  2PG8 A;  2IUB A;  2E9X D;  3VR8 A;  3ANW A;  4JI1 T;  2KWI B;  2V6Y A;  4AKI A;  2J47 A;  1IJ6 A;  4EXT A;  4DUZ T;  4DV2 T;  5FY1 A;  4QXH B;  2DLR A;  4YXD A;  5FY7 A;  2BZB A;  2JRK A;  3VKG A;  3P8C D;  3AE8 A;  3SS1 A;  2FBW A;  4YT0 A;  5JRC A;  4IDO A;  3ONL C;  4JYA T;  2WZI A;  4AI6 A;  2PFV A;  5KX5 E;  3Q2M A;  2CPT A;  4UV9 B;  4QWN B;  4IIJ E;  2KWH A;  2H7O A;  3N5L A;  2WDQ A;  3RC3 A;  3N9P A;  2DNX A;  5LB7 B;  2FJA A;  4U3C A;  4IE0 A;  4QX8 B;  2CHO A;  4KHP T;  3O4X E;  4UF0 A;  5DQW A;  4DR3 T;  1T72 A;  2F4V T;  3AA6 B;  2KND A;  3P4W A;  5TAO A;  2HPJ A;  1KEY A;  3CPZ A;  1QLB A;  2BVM A;  3UU6 A;  3EHZ A;  5LHG B;  3ZT5 A;  3ZMU B;  5DAB A;  1WCR A;  5LJM A;  4O2B E;  1XNR T;  5AFU L;  4GYS A;  5LG4 A;  2JQQ A;  3KBU A;  2VL8 A;  2CXF A;  2V1D B;  3FBL A;  5C8Y E;  2WP9 A;  5JR9 B;  4LF8 T;  1GQE A;  1XWM A;  5CA1 E;  2BBH A;  3H3A A;  2D0U A;  4PJL A;  4H9N C;  4IDZ A;  3BQL A;  3F2E A;  2BVL A;  3CQG B;  3N9N A;  3RRW A;  3OYX A;  3UQ4 A;  5FXV A;  4O4J E;  3AXJ A;  4LF6 T;  3AEA A;  4E7S A;  2KIN B;  1YXR A;  4PK6 A;  2BG9 A;  4JI5 T;  1HTJ F;  3ZT6 A;  5IUX A;  1UUR A;  4WNK A;  2ZM8 A;  1OED A;  3PDY A;  2WDR A;  3R84 B;  3C4X A;  2VQE T;  3RI5 A;  3TLU A;  3QOF A;  3ZJ1 A;  2C0S A;  3ZCJ A;  4ZZC A;  2VKJ A;  5F3J A;  2FJD A;  1KNP A;  2UU9 T;  1M62 A;  4MFR A;  5LCY A;  4IE4 A;  2Q9Q A;  4JI2 T;  2ZMA A;  3S4U A;  2BS4 A;  2D0T A;  1FEW A;  2EHO A;  4L0R A;  1HG5 A;  2V5D A;  2Q9Q D;  1WYB A;  4B3R T;  5JVD E;  4O4H E;  2ZM0 A;  4ZZB A;  3H3M A;  2V26 A;  4UIG A;  3B5M A;  4G2A A;  5J0Z A;  4GK0 E;  2CLY B;  3TLV A;  5IHY A;  2B76 A;  4IT4 A;  3PUQ A;  3PE0 A;  5H6R B;  2LOP A;  3UUB A;  1WR6 A;  4XBF B;  3OTO T;  2BS3 A;  4KUM B;  5AQQ B;  4EZH A;  5L2L A;  5JQG E;  5FMN A;  3CX8 B;  3D0T A;  4UVA B;  5L47 A;  1B7T A;  5FYM A;  1IZN B;  3CQC B;  3I0O A;  3FHN A;  3K3N A;  4ZHQ E;  3AA0 B;  4YSY A;  4HFI A;  3GN5 A;  3NRY A;  3RC8 A;  1Z0P A;  5HXR A;  1FMW A;  4H9P C;  3ONX A;  1AJ3 A;  4TV9 E;  3AAE B;  4B3T T;  1MMD A;  3RQW A;  1KF6 A;  3GA8 A;  4HKA A;  5GON E;  2UXN B;  3PUY F;  2A9U A;  1NEK A;  5FY0 A;  5ABE A;  3N9O A;  4DO0 A;  3DP7 A;  4X1I E;  5LMU T;  3ETV A;  4ADZ A;  2WMO A;  4PK5 A;  4UEL A;  2J4G A;  2PJQ A;  3PUS A;  1HX8 A;  4X1Y E;  4AQF A;  3A7M A;  5JDG A;  4WBO A; 
#chains in the Genus database with same CATH homology
 3JC6 D;  3LK2 B;  2VKD A;  2M67 A;  2ODU A;  2Y8D A;  2WBL A;  4IGU A;  5LNK A;  3M65 A;  5JH7 E;  2L9Q A;  3ETU A;  2OA5 A;  3I9Y A;  1U4Q A;  3NZQ A;  4IST A;  3RRC A;  5EK2 A;  5JDH A;  3CML A;  4AKG A;  3C4W A;  4TN7 B;  3VKH A;  2IW5 B;  3OYZ A;  4ZOL E;  1VRB A;  4I55 E;  4TV8 E;  4B6X A;  2Z6E A;  3VHL A;  2W62 A;  3N2O A;  2YEV C;  4HFV A;  4MBQ A;  4MLK A;  2LSI A;  3UUM A;  4JLE A;  4FJO A;  3DTO A;  1QUU A;  2JMH A;  5KDM C;  2VKH A;  4U74 A;  3SOL A;  2BDE A;  2MBG A;  2CCQ A;  4X20 E;  1KK7 A;  2CE7 A;  1HFA A;  5LHH B;  3IEE A;  4BJN A;  4J2C A;  4N78 D;  3E22 E;  3ZC0 A;  2E9X B;  1T98 A;  4JEU B;  3ZMV B;  2X66 A;  2E8I A;  5L3D B;  1MMA A;  3K3O A;  3N9M A;  4AQG A;  1KNZ A;  2VAS A;  3CVR A;  1D0Y A;  3PTR B;  3RPU A;  3BK9 A;  1HG2 A;  3N2K E;  3PUR A;  2LE8 A;  4IE5 A;  4HE8 A;  1G8X A;  2NW7 A;  3PUG A;  1S94 A;  1FMV A;  5LA6 E;  3C64 A;  4GK5 E;  4CI2 B;  2IC6 A;  5JDM A;  5LGU B;  3LFM A;  4QKN A;  1EZ3 A;  1G73 A;  5JDN A;  3ZYL A;  1IAP A;  2JPF A;  4I4T E;  5L3F B;  1YKH B;  3C98 B;  3R6N A;  1E1H B;  5JDQ A;  2X67 A;  5DJQ C;  3ZN1 B;  1MMN A;  4OHF A;  1UX4 A;  2ZM2 A;  3UUL A;  3ZCI A;  4OYJ A;  3QUJ A;  2LOS A;  2RA1 A;  4KBM B;  1MNE A;  2CA5 A;  3P7I A;  3RYC E;  2LSJ A;  2P9B A;  2KLQ A;  2E9X A;  2E9X C;  2C5K T;  3EDU A;  5HXS A;  1D1B A;  5CA0 E;  4HN9 A;  3AAA B;  4DBR A;  4WBN E;  4AKH A;  3V5S A;  4H9O C;  4TZ4 C;  5JRC B;  3HL6 A;  5J2T E;  2LSG A;  2PG8 A;  2E9X D;  5FP3 A;  4DND A;  3ANW A;  4OYK A;  2ACX A;  2LM9 A;  2CWY A;  3L3P A;  2KWI B;  4P0A A;  4ERR A;  2VK9 A;  2YU1 A;  4AKI A;  3C51 A;  4PFO A;  2N9D A;  1IJ6 A;  4EXT A;  1US7 B;  2G0U A;  3Q5W A;  2L8K A;  3WAK A;  2YIN A;  5FY1 A;  3OKQ A;  4QXH B;  1ZKE A;  4BA9 A;  2DLR A;  4UF0 B;  3MAC A;  5CB4 E;  5JR9 A;  5FY7 A;  1ZV4 X;  2BZB A;  2D2S A;  2JRK A;  5JR9 C;  3VKG A;  2W61 A;  1LVF A;  3P8C D;  4EAH A;  3SS1 A;  2XTL A;  3H37 A;  3KVB A;  5LJN A;  3ZMS B;  4NUU A;  2CEA A;  1IJ5 A;  1HS7 A;  4P09 A;  2WWU A;  5JRC A;  4EYY R;  4GOU A;  5HAX A;  2B1E A;  3I0Q A;  2QGS A;  3KV9 A;  2Y48 B;  5EK3 A;  3OBV E;  4AI6 A;  2PFV A;  5KX5 E;  3Q2M A;  3NBX X;  4UV9 B;  4QWN B;  2K48 A;  3AA7 B;  4IIJ E;  4ISS A;  2ZLY A;  1OWA A;  4HTE A;  2KWH A;  4YFS A;  2H7O A;  3ZYM A;  3N5L A;  2A72 A;  3RC3 A;  3N9P A;  2DNX A;  1SA0 E;  2VKO A;  3UUN A;  4CXY A;  4OK0 A;  3O1I A;  2XAG B;  3U3I A;  3I1A A;  5HXH A;  2IAK A;  4EIW A;  4YHJ A;  3BQK A;  5E0O A;  4IE0 A;  4QX8 B;  5L3G B;  2C5I T;  3O4X E;  4UF0 A;  3ZMZ B;  3AVS A;  4QHO A;  5DQW A;  5LGN B;  4ZS2 A;  2K5B B;  3O9X A;  1WLX A;  2LJL A;  4ZI3 C;  2CWO A;  4PJN A;  5H6Q B;  3MZK B;  4UXN B;  2SPC A;  3C50 A;  4E7Z A;  3AA6 B;  3L09 A;  2KMF A;  2VB6 A;  3UTK A;  5JDL A;  2KND A;  2EHO D;  3LBX B;  3MXZ A;  4ZI3 D;  3B57 A;  3J9X 1;  5TAO A;  1HF8 A;  5IYZ E;  2HPJ A;  3B13 A;  3CPZ A;  4XAX B;  1MIV A;  1WYC A;  2BVM A;  5L3C B;  5LXT E;  5J2U E;  3AB3 B;  2CMR A;  3F57 A;  2DWK A;  3K3Q C;  2GK9 A;  3IBP A;  3T8O A;  3N9Q A;  1MMG A;  5LHG B;  3ZMU B;  2A2F X;  4TX5 A;  5DAB A;  3N2G E;  4I50 E;  4QXB B;  5LJM A;  3ESL A;  5JRE A;  3ANW B;  4O2B E;  1LKX A;  3O1J A;  5M4Y A;  3ZC1 A;  1LRZ A;  3CX7 B;  5AFU L;  4GYS A;  3OJA A;  1OXZ A;  4ILU A;  2DI4 A;  5LG4 A;  2YU2 A;  3ZN0 B;  3AVR A;  3HKD E;  5HWY A;  2JQQ A;  3KBU A;  2VL8 A;  1WRD A;  2NTY A;  2LSY A;  4K0U A;  2CXF A;  2XAH B;  2RP4 A;  2V1D B;  3FBL A;  3LBX A;  4L9I A;  5ADX L;  2WSS V;  2X9Y A;  3CX6 B;  5C8Y E;  5JR9 B;  1BR2 A;  2W0G A;  4Z8X A;  3RH3 A;  2J1D G;  5CA1 E;  5EZY E;  3H3A A;  2D0U A;  4F6R C;  3MA9 A;  3RYH E;  4YLH A;  2DHR A;  4H63 V;  5DQV A;  4WW0 A;  2ODV A;  4GYR A;  2CLY C;  2JMK A;  4PJL A;  4H9N C;  4IDZ A;  4CXX A;  2LHN A;  3BQL A;  3F2E A;  2BVL A;  3CQG B;  5L3B B;  3N9N A;  4A56 A;  3KBT A;  3RRW A;  2XAS B;  3ZLI A;  3OYX A;  2Y6X A;  4V1A v;  1MND A;  4PW8 A;  3SWH A;  5FXV A;  2MYS A;  4O4J E;  2MTQ A;  4G63 A;  3EDV A;  4ZI2 C;  4E7S A;  2KIN B;  4DMV A;  2XAF B;  4YJ3 E;  2ES0 A;  3BQI A;  4C91 A;  5LBQ B;  2H3R A;  4PK6 A;  1UCU A;  1MIW A;  2IC9 A;  1HTJ F;  2Q9Q B;  4CI3 B;  2PBI A;  2W00 A;  4WNK A;  2EHO B;  4ZI2 D;  2KXP B;  2ZM8 A;  3KV5 A;  3PDY A;  2X0L B;  3R84 B;  3C4X A;  4HGA A;  1YKE B;  4AXP A;  5HYA A;  2YK0 A;  3O1H A;  3ZYK A;  3UUX B;  3ZJ1 A;  2C0S A;  3KV6 A;  1ZHC A;  1H7C A;  4P0B A;  3ZCJ A;  4DMW A;  3KVA A;  1CUN A;  4U72 A;  2V7K A;  4O4I E;  2VKJ A;  3RX6 A;  2I59 A;  2K9A A;  3MK7 C;  3UT5 E;  2LSK A;  5F3J A;  2N2N A;  2A3D A;  2XAJ B;  3SRZ A;  2XHE B;  1BR0 A;  5BMV E;  4EOZ B;  2NWB A;  5L3E B;  3EVY A;  3IHR A;  4MFR A;  2UXX B;  4CI1 B;  5LCY A;  4IE4 A;  3WAJ A;  3Q5X A;  1FIO A;  2Q9Q A;  2Q9Q C;  2ZMA A;  3S4U A;  5LHI B;  2D0T A;  1FEW A;  2EHO A;  2EHO C;  3IF8 B;  4PJJ A;  2V7M A;  3EUH A;  4L0R A;  4KP3 C;  3LJC A;  5LGT B;  4ZS3 A;  3KV4 A;  4UVC B;  2DCF A;  1HG5 A;  3I9W A;  1ZEE A;  3A5X A;  3HKB E;  3N9L A;  2Q9Q D;  2W63 A;  3KIN B;  3FB2 A;  3HKE E;  2CXL A;  3AAI A;  2X68 A;  4PJM A;  1WYB A;  5KMG P;  4HEA A;  3C4Z A;  5JVD E;  3ZPO A;  2CM0 A;  5FNV E;  3FBZ A;  4O4H E;  4JUY A;  2ZM0 A;  2D5U A;  2WAU A;  4PFP A;  2QA7 A;  3GMI A;  4OFZ A;  4BJM A;  4H9Q C;  2V26 A;  4UIG A;  3TKL B;  4AKR B;  4G2A A;  1D1A A;  4JEH B;  2NW9 A;  2V7I A;  3GWH A;  2NOX A;  4GK0 E;  3W15 B;  3QC9 A;  2CLY B;  5LBM A;  5IHY A;  4EB6 E;  3PU3 A;  3HA4 A;  3E0Z A;  1D0Z A;  3CQX C;  2X51 A;  3GN5 B;  1U5P A;  4L5G A;  3PUQ A;  2KZ7 B;  1QSD A;  2LOP A;  3HKC E;  1VOM A;  3PE0 A;  4FI5 A;  4I43 B;  5H6R B;  1WR6 A;  4XBF B;  3KDS E;  2X9H A;  1SHZ C;  2CXD A;  2HPL A;  1HCI A;  3ZEF B;  3RYI E;  3HI2 A;  2K24 A;  3K8P C;  3E08 A;  4IE7 A;  4ZI7 E;  4QX7 B;  2NTX A;  3WI3 A;  2X9W A;  5JDF A;  4KUM B;  5FXW A;  4EZH A;  5L2L A;  3J7Y q;  5HXC A;  1D0X A;  2XQY A;  4UEM A;  1X79 A;  3LK3 B;  5FMN A;  3CKD A;  1MIY A;  3AA1 B;  5JQG E;  4EZ4 A;  2NP9 A;  3CX8 B;  1NAF A;  3D0T A;  4UVA B;  2NW8 A;  4H9S E;  4M1P A;  1B7T A;  5FYM A;  3Q9D A;  1IZN B;  3CQC B;  3I0O A;  3FHN A;  4PK4 A;  3K3N A;  3VU7 H;  2X9X A;  4C90 A;  5LYJ E;  3PU8 A;  3F31 A;  3PUA A;  4ZHQ E;  1S35 A;  1UX5 A;  4ANJ A;  2LHR A;  5J1G A;  4TUY E;  3AA0 B;  3FXD B;  4KMC A;  3GN5 A;  4EYU A;  5F8P A;  3UFE A;  3NRY A;  3RC8 A;  1Z0P A;  3QK6 A;  2MOZ A;  4IHJ E;  2WMN A;  4UVB B;  5HXR A;  1BR1 A;  1FMW A;  4CXW A;  4H9P C;  4IE6 A;  2JJ9 A;  3ONX A;  1AJ3 A;  4QXC B;  2H7V C;  3LK4 2;  5FXZ A;  4DBQ A;  5LP6 E;  3RYF E;  4TV9 E;  2V7L A;  3AAE B;  3ZJ2 A;  3CWZ B;  4O2A E;  4NUV A;  4ASK A;  4X1K E;  4DVD A;  1MMD A;  5HWX A;  5LOV E;  4CZZ B;  3GA8 A;  4BAY B;  2C5J A;  5EK4 A;  2LEH A;  2N1G A;  4HKA A;  5GON E;  2UXN B;  4UV8 B;  3MJX A;  4H9R C;  3U78 A;  1D1C A;  3NZP A;  5ETW A;  5FXX A;  5FY0 A;  4O4L E;  3MKD A;  4GIW A;  3N9O A;  4DO0 A;  3DP7 A;  1O3X A;  1V9D A;  4X1I E;  2KT9 A;  4PAG A;  3ETV A;  4AKL A;  4ADZ A;  2WMO A;  2WM9 A;  1YD8 G;  4PK5 A;  1NWM X;  2XAQ B;  4MHC A;  4UEL A;  4PNI A;  2HH7 A;  4CQI A;  3DJB A;  3FXE B;  2V7J A;  4H63 H;  2VWA A;  4O8S A;  5HXE A;  1BR4 A;  2PJQ A;  3PUS A;  1Y64 B;  2XUE A;  4XZC A;  4MAL A;  1HX8 A;  3JC6 C;  4X1Y E;  3ZMT B;  4AQF A;  4AQF C;  2LT3 A;  2L3L A;  1LVK A;  5A1L A;  2DWG A;  3V5U A;  3NRX A;  3RKO A;  5JDG A;  3LG7 A;  3HR0 A;  4WBO A;  4YJ2 E;  3KFW X;  1YW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...