2LSIA

Solution structure of polymerase-interacting domain of human rev1 in complex with translesional synthesis polymerase kappa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
GHMAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DNA repair protein REV1
publication title Insights into the scaffold mechanism of human Rev1 in translesional synthesis revealed by the structural studies on its polymerase-interacting domain
rcsb
source organism Homo sapiens
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsiA00
2LSKA 4BA9A 2LSIA 2LSGA 4GK5E 4FJOA 2LSYA 2N1GA 3VU7H 4EXTA 4GK0E 2LSJA
chains in the Genus database with same CATH superfamily
1ZV4X 5L3GB 3NBXX 3ZMTB 4TX5A 4H9SE 4ZEYA 4YTNA 4HWHA 2LJLA 2BKOA 3C50A 4HWCA 5L3CB 1ZEEA 3ZC0A 2WS3A 4LF6T 3AEAA 3AE6A 5L3DB 2AXDS 2N2NA 5DABA 1KNZA 2C5IT 4LMJA 2KT9A 4N78D 5HXEA 3RF1A 4X1IE 2KWHA 1ZOYA 2XQAA 2P9BA 1OEDA 4PAGA 3IF8B 2M6BA 4YY3T 5AQIB 4UEMA 3WI3A 5L4EA 2VL0A 5HEGA 2LLYA 2IC9A 4IREA 3C4ZA 4X66T 4U33A 4CI1B 2ZM0A 4HFEA 2L8KA 2XM2A 5HCJA 4AKLA 4DR3T 4QX7B 1WR6A 4HE8A 4EZ4A 3AAIA 2V5DA 1I6ZA 2VASA 5FVKA 1BR0A 5ABFA 5ABFB 3UQ7A 2QRXA 4IT4A 4IE6A 3PE0A 4AQGA 2FJBA 2QGSA 4KHZF 3N2OA 4KBMB 4WZXA 2ZMAA 5JQGE 4NXNT 1IJ5A 1J5WA 3Q9DA 4YSYA 3FBZA 3P7IA 4IDPA 3AE7A 3JAFA 2HN2A 3C51A 3EDUA 3CIRA 4PW8A 2BG9E 4GK0E 2CCQA 4HN9A 3VR8A 5JDGA 1O3XA 4H9OC 3Q5EA 4JYAT 1J1JA 4ZOLE 5LMUT 1D0ZA 3QOFA 2W00A 2AE9A 4A5XA 5EK3A 3ZT5A 1MIVA 5IWAT 1VCTA 2XSBA 3F2EA 1D0XA 4U31A 3M65A 4B3TT 2QYWA 2VWAA 2PFVA 2QVAA 4HWFA 4B3ST 3ZMZB 4HFBA 1HF8A 1HG2A 5JR9A 3WAKA 4QX8B 2E9XA 2W67A 2E9XB 3KV9A 4G63A 3WAJA 1W0BA 1KF6A 3K1SA 3MJXA 4DV6T 3L09A 3AAEB 3Q5WA 3AEBA 3FBLA 4HTEA 3D0TA 5AFUL 2W2UA 1WYCA 3QB5K 5FP3A 3R6NA 1U5PA 4DR5T 3RC8A 3N2KE 4DBQA 4LF9T 3K8PC 1Y64B 3LFMA 3TLTA 3K3OA 2F4VT 2JRKA 4E7SA 2WDQA 2FJDA 2E2AA 3E22E 4QKNA 4JLEA 1Y01A 2X9WA 1N33T 4UVBB 1Z0PA 3UUXB 3MA9A 2IUBA 5AQLB 5AQVB 2ODUA 3RHWA 2XQ9A 1BR1A 4JI8T 4JI7T 4PJLA 5LCYA 2DLRA 4IL9A 1WR0A 3P4PA 1W9RA 2UXDT 2XQ8A 1AJ3A 4IE7A 4OK0A 3CQCB 4HEAA 2CE7A 5C3JA 4H63H 2MOZA 3N9NA 4DVDA 5JDFA 2EHOA 5CFBA 2LSYA 4E7ZA 4XAXB 5AQFB 4O4LE 2HPJA 2DL1A 3QK6A 3RRCA 3I0OA 5JVDE 3RYFE 3RIAA 1HCIA 5CA1E 1NAFA 3ZSTA 3UU6A 2FBWA 4EIWA 2UU9T 4JEUB 3VRAA 2BS4A 3ZC1A 1V9DA 3B57A 1NEKA 2I6HA 1LKXA 3SFDA 5FYMA 4X1KE 2ZM6T 1WCRA 4ISSA 4H9NC 4I4TE 1N36T 3O9XA 2LSKA 3BQKA 3EUHA 3UUMA 1LRZA 4JUYA 2XTLA 4AXPA 4HWDA 4CXXA 4JI5T 3TLVA 2NP9A 1UGOA 3M3ZB 3N9OA 3ZT7A 2WDRA 3AEEA 1D0YA 4BJNA 1UCUA 1X9BA 5KDMC 4ILUA 4IE0A 3C4WA 3HA4A 5FKYA 2OA5A 3KV4A 1HNWT 2V7LA 2XAFB 5E0OA 4LFBT 2W0GA 4DR2T 2V1DB 5ETWA 5ADXL 2XQ4A 3H3AA 4ZS3A 2VVNA 3NZQA 4JI3T 4JI2T 2LOSA 4CI3B 1W09A 4HFIA 2YDSA 4O4IE 2FJAA 1R8IA 5L4HA 3CK6A 1DU2A 4JEHB 3PTRB 3OYZA 3CX7B 3O4XE 3U78A 4TN7B 5LHHB 3K3NA 3O1IA 3ZCJA 2LEHA 3AVRA 4CN6A 1HTJF 1YKHB 1LVKA 2NR4A 2V6YA 5LNKA 2V6YB 2X9YA 3T1HT 1VRBA 3AEFA 1XNQT 2OV9A 5HYAA 3OTOT 2XQYA 4UV8B 4Z91A 3UULA 4EYYR 2Y6XA 3AE8A 5AQKB 4AISA 3ANWB 4AI6A 3LK2B 4EGWA 2H7OA 5L3EB 2V7IA 3ONLC 5DQVA 3HKDE 2MYSA 2WU5A 1FIOA 1KEYA 3N2GE 2D5UA 1M62A 4J2CA 5FY7A 4QHOA 3P4SA 2YN6A 4JV5T 5HXCA 3PDYA 1WFDA 5ABGA 1FEWA 1JNZA 5CJ5A 3N9MA 4ASKA 2CWYA 2PBIA 5IYZE 3RPUA 2YU2A 3TKLB 4ILCA 3DTOA 2PTFA 5BMVE 3MZKB 1UX4A 5JDQA 4A56A 2XHEB 3I9WA 5JTGA 2FUPA 5LA6E 3KBTA 3UUBA 1FMWA 3AECA 4NUUA 4BA9A 1QLBA 4DV3T 3HI2A 4YHHT 3EDVA 2X0LB 5KXJA 4ADZA 3T8OA 1KNRA 5FY1A 3PV0F 4O4JE 1MNEA 3NKZA 3OPCA 4CQIA 2D0UA 2GK9A 2V7JA 3PUXF 2KWIB 4X20E 5DQWA 1M7KA 4MHCA 4KP3C 3QNUA 2K48A 4FJOA 4O2AE 1H7CA 1L0VA 2L3LA 1OWAA 3ZMSB 5LMNT 2V8SV 5LB7B 2B76A 1YQ4A 4ILBA 1Z8UA 4QWNB 3HR0A 3RRWA 4IIJE 2CBJA 1YD8G 3ZKRA 5AQUB 4YJ2E 3ZJ2A 3HL6A 4GYRA 5FL0A 3C64A 2IW5B 1ZKEA 1BR4A 3J9X1 2XAJB 1OEDB 4JBWF 5FMNA 3FXDB 3UQ4A 3PU3A 4GYSA 4PFOA 1CHUA 2IIUA 2WMOA 4QXCB 2Q9QA 2Q9QB 3ONXA 4TWFA 3ZT6A 5LYJE 3I1AA 3BK9A 2CMRA 4IDZA 4YXDA 2LKGA 4ZI2C 3KFWX 1UURA 4U74A 2W4XA 2IHR1 4KHPT 3FXEB 2KXPB 3ZPOA 4COFA 2XAQB 1YKEB 1G8XA 4F8HA 3L3PA 3T1YT 2XPKA 3OVUA 2MAWA 2UXBT 2LRLA 4YHJA 3R84B 4ZI2D 3N9QA 5EK2A 1QUUA 4G2AA 3E0ZA 1ZP0A 5LHGB 1XDOA 4HFCA 2WSSV 2CM0A 3IEEA 3P50A 4GKJT 3BQIA 4ERRA 3FZFB 3RI5A 4MFRA 4UR9A 2K5BB 2BKNA 3KINB 3UU8A 4HWIB 3RIUC 2WCAA 2BG9A 4BJMA 2XASB 3AE9A 1FMVA 2BBJA 5LXTE 3UU3A 3KDSE 3RKOA 2K24A 4XZCA 4PNIA 5JR9B 4DNDA 2LKHA 4U3CA 3F57A 4OYKA 4EZHA 4LFCT 2VK9A 2M6IA 4WW0A 3CQGB 3KV5A 1T72A 3ZCIA 4HGAA 2I59A 2X9XA 2MBGA 4MALA 5FY0A 2CBIA 5LG3A 2VKOA 2DCFA 1HR0T 4ISTA 4PK4A 3FB2A 1XMOT 3CVRA 4TV9E 2A72A 4MLKA 4X5TA 4AQFA 2V7KA 4LFAT 4M1PA 1B7TA 2DHRA 2CPTA 4OFZA 3IHRA 3ZMVB 2X68A 2XAGB 2M67A 4I0UA 4QH1A 2LHRA 4NXMT 5BR8T 3P4RA 2E8IA 5JDLA 4F6RC 2BVLA 2X67A 1YW0A 5CB4E 3X1DA 3B5MA 2IMLA 1FJGT 2RP4A 4PFPA 4QXBB 4AKRB 3PUGA 4LF4T 3JAEA 4U7IA 3PUZF 3SS1A 2EHOB 3SFEA 3LBXA 3LBXB 2XZEA 2XQ3A 1IJ6A 2L9QA 4LMKA 3VRBA 2LSGA 1VOMA 2VKJA 3ESLA 5AQGB 3GMIA 4DV0T 3E08A 1MIWA 2JQKA 3NVOA 2ACZA 3NZPA 3QC9A 2MPKA 3QUJA 4GOUA 2W61A 3KVAA 1BR2A 2C5JA 2PJQA 3AE5A 1XZYA 1OEDC 5L3BB 5TAOA 3DP7A 5FXVA 3PUAA 4UXNB 4AKIA 4WBOA 2J62A 2C0SA 5LOVE 2NW7A 4I50E 5ABEA 3N9LA 2PG8A 2A2FX 4ZI3C 3MKDA 5LJNA 3ONJA 4IGUA 3RLFF 3EABA 4TWDA 5F8PA 5C2TA 4ZZCA 2Y8DA 2KINB 3SOLA 3JADA 1SHZC 1LVFA 3V5SA 3CX6B 2ACXA 5A1LA 4H9RC 2ZM2A 2YOEA 4ZI3D 4FI5A 4A98A 1WYBA 3CMLA 2X9HA 2WDVA 3NRYA 3RX6A 4NIQA 2VKDA 3TLUA 1N32T 2V5CA 5L47A 2CLYB 3JCFA 3AAAB 2WU2A 3GA8A 3FHNA 1CUNA 3L8RA 5FVLA 2G0UA 3EAMA 1IBMT 1XDPA 2X66A 5ABHA 2E5LT 2A9UA 4IL4A 3PJAA 4X64T 5JR9C 4ZZBA 3P4WA 2E9XC 1XWMA 4EB6E 5LJMA 3AA7B 2VKHA 1U4QA 1IZNB 3A8YC 2WQYA 4C91A 3AE2A 4BAYB 2X0YA 5J2UE 4HFHA 1I94T 5HAXA 5FXXA 4DV2T 2XSAA 4UIGA 2JJ9A 1VCSA 4DUZT 4DV4T 3MK7C 2CXLA 2I0MA 2IC6A 2FJEA 3IBPA 5JH7E 5LBQB 3UU5A 2OLTA 2E9XD 3CPZA 2CHNA 4AKGA 2Z6EA 4HKAA 4AKHA 3AE1A 3GN5A 3SWHA 2KNDA 2D9DA 2HH7A 2WB5A 2IAKA 1UX5A 2UUCT 4KX6A 1GQEA 2E5VA 4YJ3E 5HCMA 3W15B 5LP6E 3JC6C 2WY2A 3GWHA 4CZZB 1OXZA 1KNPA 5FXZA 2J1DG 4P1NA 3OKQA 2EHOC 3ZMUB 5JDHA 5JRCA 5JRCB 2C5KT 5KMGP 3N5LA 5JREA 3LJCA 4DBRA 5FXWA 3AEGA 2YK0A 2J4GA 4QH4A 3ZLIA 3IA3A 3EVYA 3JC6D 3VKHA 2WM9A 3F31A 1KK7A 4GK5E 2CA5A 2N9DA 3TLSA 3VKGA 2BS2A 2XY8B 3VR9A 4KI0F 1MIYA 5AQRB 3SRZA 1JNRA 3VHLA 4CN4A 2RA1A 3OBVE 1J5ET 5AQMB 2DWKA 4JI1T 1T7SA 4DO0A 3FZLB 2B1EA 2NOXA 1S35A 4EEBA 3O1HA 2J47A 4LMLA 2VURA 4H9PC 4DR6T 1SA0E 5KX5E 4U2YA 3H37A 3J7Yq 1UK5A 2DWGA 2MTQA 2KZ7B 4L0RA 3UUNA 1HG5A 4UF0A 4UF0B 2BDEA 1OEDE 3A7MA 4UVAB 4LF8T 2XQ5A 4WNKA 2YDQA 2WBLA 3I9YA 2YEVC 5HXHA 2UXXB 4DR1T 3ZN1B 3KVBA 2CLYC 3FZHB 1KFYA 3K3QC 2DI4A 3ETUA 4ANJA 3UFGA 2JMHA 3RYCE 5HEUA 1E7PA 4GIWA 4WBNE 5IHYA 4TWHA 3OJAA 4DV1T 2NW8A 5IUXA 1G73A 3AA6B 2V7MA 4WYVA 3N9PA 5AQNB 4DR4T 2N1GA 2UXNB 1IAPA 3HKCE 3AA1B 5GONE 3S4UA 4EOZB 4EAHA 3NWIA 2X51A 5HXSA 4MBQA 1EZ3A 4LF5T 2W66A 3UT5E 5J2TE 2BVMA 5HXRA 3Q5DA 3MXZA 3QB5A 4Q25A 2BG9B 3ZYMA 1X79A 3RQUA 2VQET 3LSVA 3ZJ1A 1HFAA 1ZHCA 2ZLYA 4TZ4C 3PU8A 4PJNA 4NUVA 4U72A 2QA7A 4B6XA 1SUMB 3I0QA 3AXJA 3AXJB 3PUYF 2JQHA 1WRDA 4ZHQE 4PK5A 2K3WA 2KLQA 3EHZA 2YU1A 3A5XA 3PJAJ 4UELA 2HPLA 3AB3B 4ZI7E 2V6XA 1NWMX 1W0AA 5LBMA 2UUBT 4ZXLA 1HNXT 4X1YE 2HHHT 4DMVA 3KV6A 4H9QC 2YINA 5HEHA 4OHFA 4O4HE 4YTMA 5HEOA 3ZSSA 2XAHB 3C4XA 5LHIB 4KUMB 3UTKA 3PUWF 5M4YA 4DIDB 4CI2B 3BQLA 3AA0B 4U7YA 4ZS2A 2XJ7A 1D1AA 2W62A 1MMAA 5AQOB 4DV7T 2ES0A 5J1GA 5FNVE 3CKDA 4DV5T 2WAUA 4K0UA 3RQWA 4TUYE 5L2LA 4P0AA 2YDRA 3PURA 3HKBE 1UUSA 2H89A 3AE3A 2ODVA 3MACA 1S94A 2LT3A 5HEJA 3VU7H 4AIUA 5JDNA 2UXCT 3AE4A 1HX1B 4TNVA 4EYUA 1IBKT 1D1BA 2CHOA 2VQFT 4EXTA 2SPCA 4PK6A 4CN1A 4JI6T 5F5WA 3ZEFB 3P4QA 2NTYA 2XM1A 2Q9QC 4DR7T 3LG7A 4Z90A 5DJQC 3RGLA 2LHNA 2H7VC 4V1Av 4IHJE 1US7B 4YSZA 3TLWA 1E2AA 4HFDA 2ZM8A 3L39A 2H88A 3G06A 4UVCB 2UUAT 2LSJA 3RH3A 2VL8A 2NW9A 4IDQA 2Q9QD 3AEDA 4I55E 3OYXA 3ABVA 4YLHA 2JMKA 1HS7A 4C90A 4NPPA 3V5UA 2CWOA 4X62T 4B3MT 5AQPB 2LRKA 5HWXA 1XNRT 4P0BA 4K0KT 4GKKT 3ZN0B 4PJJA 1T98A 2IDOB 3LK3B 3ETVA 3EI0A 2WZIA 5AQQB 4O8SA 4PJMA 2LM2A 2LSIA 3CX8B 3FZMB 2A3DA 1YQ3A 3FZKB 1T8BA 2BG9C 4TNWA 2JQQA 4YTPA 2XQ6A 2RPAA 4L5GA 2LOPA 4ILAA 2WWVA 3Q2MA 5CA0E 2VVSA 2XUEA 3CQXC 5LGTB 4EV6A 4OX9T 3C98B 4H63V 1MNDA 2R6GF 2WP9A 5CGMA 1SE7A 2NTXA 5H6RB 3UU4A 4Z8XA 4IE4A 4U2ZA 4EEDA 1D1CA 2JQ9A 2WMNA 1E1HB 4JI4T 2K9AA 2D0TA 3RC3A 5C8YE 1HX8A 1HNZT 4CXWA 5AQJB 5FL1A 4IE5A 4A97A 3PUSA 3PUVF 5LG4A 3PUQA 2XQ7A 2LM9A 2CEAA 4QXHB 5F3JA 2BZBA 2WZHA 4JI0T 3ANWA 2WWUA 4XBFB 4AQFC 2Y48B 3GN5B 3HKEE 3O1JA 5EK4A 3RIUA 5J0ZA 5L3FB 2JIWA 3LK42 1IBLT 5LGNB 4YT0A 2YKSA 4X65T 4IDOA 2CRBA 4I43B 5AQSB 5EZYE 4DUYT 4YFSA 4KMCA 3RIFA 3P8CD 4IDNA 4HFVA 3NRXA 2X0HA 5AQHB 5AQTB 3Q5XA 5LGUB 4TV8E 4O2BE 3LDQB 3H3MA 5JDMA 4L9IA 1MMNA 5HWYA 4LF7T 4OYJA 2CXFA 1WLXA 2CXDA 1MMGA 3UFEA 2H3RA 5H6QB 2BS3A 2VB6A 3RKGA 1QSDA 3CWZB 3DJBA 4YSXA 4B3RT 3B13A 3RYIE 1MMDA 1XMQT 4UV9B 3RYHE 2HN1A 2NWBA 2KMFA 4P09A 3ZYKA 2EHOD 3KBUA 1NENA 2JPFA 2DNXA 2BBHA 2V26A 1N34T 4CXYA 2D2SA 2W63A 4AQYT 2KSRA 3U3IA 4DMWA 2BKPA 1YXRA 3AVSA 2LE8A 4QH5A 3ZYLA
chains in the Genus database with same CATH topology
1BR2A 1ZV4X 2C5JA 2PJQA 3NBXX 5L3GB 3ZMTB 5LNKA 1HFAA 4TX5A 1ZHCA 2X9YA 5L3BB 5TAOA 2ZLYA 1VRBA 4H9SE 3DP7A 5HYAA 4TZ4C 3PU8A 2XQYA 5FXVA 4UV8B 2LJLA 3PUAA 4UXNB 3UULA 4WBOA 4EYYR 4AKIA 4PJNA 2Y6XA 2C0SA 5LOVE 2NW7A 3C50A 4NUVA 5L3CB 4I50E 4U72A 1ZEEA 2QA7A 3ANWB 4B6XA 3ZC0A 3I0QA 4AI6A 3LK2B 2PG8A 3N9LA 5L3DB 2N2NA 5DABA 2H7OA 2A2FX 4ZI3C 3MKDA 5LJNA 1KNZA 2C5IT 2KT9A 4N78D 4IGUA 5HXEA 5L3EB 1WRDA 2V7IA 5DQVA 4X1IE 3HKDE 2KWHA 5F8PA 2MYSA 4ZHQE 4PK5A 1FIOA 2KLQA 2Y8DA 3N2GE 2KINB 2P9BA 2D5UA 4J2CA 2YU1A 3A5XA 4PAGA 3IF8B 5FY7A 4QHOA 3SOLA 1SHZC 5HXCA 3PDYA 4UEMA 4UELA 1LVFA 2HPLA 3AB3B 3V5SA 3WI3A 4ZI7E 3CX6B 1NWMX 2IC9A 1FEWA 2ACXA 3C4ZA 5A1LA 3N9MA 5LBMA 4H9RC 2ZM2A 4ASKA 2CWYA 2PBIA 4X1YE 5IYZE 3RPUA 4ZI3D 4CI1B 4FI5A 2YU2A 2ZM0A 3TKLB 1WYBA 3DTOA 4DMVA 3CMLA 3KV6A 2X9HA 4H9QC 2YINA 2L8KA 5BMVE 4OHFA 4O4HE 2XAHB 3MZKB 1UX4A 5JDQA 3NRYA 3RX6A 3C4XA 4A56A 5LHIB 2VKDA 2XHEB 3I9WA 4AKLA 4KUMB 4QX7B 1WR6A 3UTKA 5M4YA 5LA6E 4CI2B 4HE8A 3KBTA 1FMWA 3BQLA 4EZ4A 3AAIA 2CLYB 4NUUA 3AAAB 3AA0B 4BA9A 3GA8A 2VASA 3FHNA 1BR0A 4ZS2A 1D1AA 3HI2A 2W62A 1MMAA 3EDVA 2X0LB 1CUNA 2ES0A 5J1GA 5FNVE 4ADZA 3T8OA 4IE6A 3CKDA 2G0UA 3PE0A 4AQGA 2WAUA 5FY1A 4O4JE 2QGSA 4K0UA 3N2OA 4KBMB 1MNEA 2ZMAA 5JQGE 1IJ5A 3Q9DA 3FBZA 3P7IA 4CQIA 2X66A 2D0UA 3C51A 2GK9A 4TUYE 5L2LA 4P0AA 3PURA 3EDUA 3HKBE 2V7JA 2KWIB 4X20E 5DQWA 4PW8A 4MHCA 4KP3C 2ODVA 3MACA 4GK0E 2CCQA 5JR9C 1S94A 2K48A 4HN9A 2LT3A 2E9XC 4FJOA 3VU7H 4O2AE 4EB6E 5JDNA 5JDGA 1O3XA 5LJMA 4H9OC 1H7CA 3AA7B 2VKHA 1U4QA 1IZNB 4EYUA 4C91A 4ZOLE 2L3LA 4BAYB 1D0ZA 1D1BA 1OWAA 3ZMSB 5J2UE 2W00A 4EXTA 2SPCA 4PK6A 5EK3A 5HAXA 1MIVA 5FXXA 3ZEFB 4UIGA 4QWNB 2JJ9A 2NTYA 3F2EA 3HR0A 3RRWA 1D0XA 3MK7C 4IIJE 2Q9QC 2CXLA 2IC6A 3M65A 1YD8G 2VWAA 3LG7A 3IBPA 5JH7E 2PFVA 5DJQC 5LBQB 4YJ2E 3ZMZB 3ZJ2A 2LHNA 3HL6A 1HF8A 4GYRA 2E9XD 2H7VC 3CPZA 4V1Av 1HG2A 5JR9A 3WAKA 4IHJE 1US7B 3C64A 4QX8B 2E9XA 2IW5B 1ZKEA 2E9XB 3KV9A 4G63A 3WAJA 1BR4A 3J9X1 4AKGA 2Z6EA 4HKAA 4AKHA 3MJXA 2ZM8A 2XAJB 3GN5A 3L09A 3SWHA 4UVCB 2KNDA 3AAEB 3Q5WA 5FMNA 3FBLA 2LSJA 3FXDB 4HTEA 3RH3A 3D0TA 2VL8A 3PU3A 1WYCA 4GYSA 4PFOA 2HH7A 2NW9A 5AFUL 2Q9QD 4I55E 5FP3A 2WMOA 3R6NA 3OYXA 2IAKA 1U5PA 4QXCB 2Q9QA 2Q9QB 3ONXA 5LYJE 3RC8A 4YLHA 3N2KE 1UX5A 3I1AA 4DBQA 3BK9A 3K8PC 2CMRA 2JMKA 1Y64B 3LFMA 1HS7A 4C90A 3K3OA 4IDZA 4YJ3E 4ZI2C 2JRKA 4E7SA 3W15B 3KFWX 5LP6E 3JC6C 3V5UA 2CWOA 3GWHA 3E22E 5HWXA 4QKNA 4P0BA 4JLEA 4CZZB 4U74A 2X9WA 1OXZA 5FXZA 2J1DG 4UVBB 3OKQA 3ZN0B 2EHOC 3ZMUB 1Z0PA 3FXEB 3UUXB 3MA9A 5JDHA 5JRCA 4PJJA 2KXPB 3ZPOA 5JRCB 1T98A 2XAQB 2C5KT 3LK3B 1YKEB 3N5LA 5KMGP 5JREA 3LJCA 2ODUA 3ETVA 1G8XA 4DBRA 1BR1A 4O8SA 5FXWA 3L3PA 2YK0A 4PJMA 2LSIA 3CX8B 4PJLA 5LCYA 2A3DA 2DLRA 4YHJA 3R84B 3ZLIA 4ZI2D 3EVYA 3N9QA 5EK2A 2JQQA 3JC6D 4L5GA 2LOPA 1QUUA 3VKHA 2WM9A 3F31A 4G2AA 1KK7A 3Q2MA 3E0ZA 4GK5E 2CA5A 2N9DA 5CA0E 3VKGA 1AJ3A 5LHGB 2XUEA 4IE7A 3CQXC 4OK0A 5LGTB 3CQCB 2WSSV 2CM0A 3C98B 4HEAA 2CE7A 4H63V 1MNDA 3IEEA 4H63H 2MOZA 3N9NA 1MIYA 3SRZA 2NTXA 5H6RB 4DVDA 5JDFA 3VHLA 2EHOA 3BQIA 4ERRA 2LSYA 4E7ZA 4Z8XA 4IE4A 4XAXB 2RA1A 3OBVE 4MFRA 1D1CA 2DWKA 2K5BB 4O4LE 2HPJA 4DO0A 3KINB 3QK6A 2WMNA 3RRCA 3I0OA 1E1HB 5JVDE 3RYFE 2B1EA 4BJMA 2NOXA 1HCIA 1S35A 2XASB 5CA1E 2K9AA 2D0TA 1NAFA 1FMVA 3RC3A 5C8YE 5LXTE 3O1HA 1HX8A 4EIWA 4CXWA 3KDSE 3RKOA 4H9PC 4JEUB 2K24A 1SA0E 4XZCA 4PNIA 3ZC1A 1V9DA 4IE5A 3B57A 3PUSA 5KX5E 5LG4A 3PUQA 1LKXA 2LM9A 5FYMA 4X1KE 2CEAA 3H37A 5JR9B 3J7Yq 2DWGA 2MTQA 2KZ7B 4L0RA 4QXHB 5F3JA 4ISSA 2BZBA 3UUNA 4DNDA 4H9NC 4I4TE 1HG5A 3F57A 4OYKA 3ANWA 4UF0A 4UF0B 2BDEA 3O9XA 4EZHA 2WWUA 4XBFB 4AQFC 2LSKA 3BQKA 2VK9A 2Y48B 3EUHA 3GN5B 3HKEE 3O1JA 5EK4A 4UVAB 3UUMA 1LRZA 4WW0A 3CQGB 3KV5A 4WNKA 5L3FB 3ZCIA 4JUYA 3LK42 2WBLA 2XTLA 5LGNB 3I9YA 2YEVC 4HGAA 4AXPA 5HXHA 2I59A 2UXXB 4CXXA 2X9XA 2MBGA 4I43B 4MALA 3ZN1B 2NP9A 3KVBA 5EZYE 5FY0A 2CLYC 4YFSA 4KMCA 2VKOA 2DCFA 3N9OA 3P8CD 4HFVA 4ISTA 4PK4A 3NRXA 1D0YA 3K3QC 3Q5XA 2DI4A 4BJNA 1UCUA 3ETUA 4ANJA 3FB2A 5LGUB 5KDMC 3CVRA 4TV8E 4O2BE 4TV9E 2JMHA 2A72A 3RYCE 4ILUA 4MLKA 4IE0A 3C4WA 3HA4A 4AQFA 2V7KA 4GIWA 5JDMA 4WBNE 4L9IA 4M1PA 1B7TA 1MMNA 5HWYA 2DHRA 4OFZA 2OA5A 3KV4A 3IHRA 3ZMVB 4OYJA 2CXFA 2V7LA 2X68A 5IHYA 2XAFB 3OJAA 2XAGB 1WLXA 2CXDA 2M67A 5E0OA 2NW8A 1MMGA 2LHRA 3UFEA 2H3RA 5H6QB 1G73A 3AA6B 2E8IA 2W0GA 2V1DB 2V7MA 2VB6A 5JDLA 3N9PA 4F6RC 2BVLA 2N1GA 5ETWA 2X67A 1QSDA 5ADXL 3CWZB 3DJBA 3H3AA 1YW0A 4ZS3A 5CB4E 3NZQA 2LOSA 2RP4A 2UXNB 3B13A 4PFPA 1MMDA 1IAPA 3RYIE 3HKCE 4CI3B 4QXBB 4UV9B 3RYHE 2NWBA 3AA1B 4O4IE 4AKRB 3PUGA 2KMFA 4P09A 5GONE 3S4UA 3ZYKA 2EHOD 3KBUA 4EOZB 3SS1A 4EAHA 2EHOB 4JEHB 2X51A 3PTRB 3OYZA 3CX7B 2JPFA 5HXSA 2DNXA 3LBXA 4MBQA 1EZ3A 3LBXB 3O4XE 2V26A 3U78A 3UT5E 1IJ6A 2L9QA 4TN7B 5LHHB 4CXYA 2D2SA 5J2TE 3K3NA 2LSGA 1VOMA 2W63A 2BVMA 5HXRA 3O1IA 2VKJA 3ESLA 3ZCJA 2LEHA 3MXZA 3AVRA 3GMIA 3E08A 1MIWA 3U3IA 1HTJF 4DMWA 1YKHB 1LVKA 3ZYMA 1X79A 3NZPA 3QC9A 3QUJA 3AVSA 2LE8A 4GOUA 3ZYLA 2W61A 3ZJ1A 3KVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSK A;  4BA9 A;  2LSI A;  2LSG A;  4GK5 E;  4FJO A;  2LSY A;  2N1G A;  3VU7 H;  4EXT A;  4GK0 E;  2LSJ A; 
#chains in the Genus database with same CATH topology
 1ZV4 X;  5L3G B;  3NBX X;  3ZMT B;  4TX5 A;  4H9S E;  4ZEY A;  4YTN A;  4HWH A;  2LJL A;  2BKO A;  3C50 A;  4HWC A;  5L3C B;  1ZEE A;  3ZC0 A;  2WS3 A;  4LF6 T;  3AEA A;  3AE6 A;  5L3D B;  2AXD S;  2N2N A;  5DAB A;  1KNZ A;  2C5I T;  4LMJ A;  2KT9 A;  4N78 D;  5HXE A;  3RF1 A;  4X1I E;  2KWH A;  1ZOY A;  2XQA A;  2P9B A;  1OED A;  4PAG A;  3IF8 B;  2M6B A;  4YY3 T;  5AQI B;  4UEM A;  3WI3 A;  5L4E A;  2VL0 A;  5HEG A;  2LLY A;  2IC9 A;  4IRE A;  3C4Z A;  4X66 T;  4U33 A;  4CI1 B;  2ZM0 A;  4HFE A;  2L8K A;  2XM2 A;  5HCJ A;  4AKL A;  4DR3 T;  4QX7 B;  1WR6 A;  4HE8 A;  4EZ4 A;  3AAI A;  2V5D A;  1I6Z A;  2VAS A;  5FVK A;  1BR0 A;  5ABF A;  5ABF B;  3UQ7 A;  2QRX A;  4IT4 A;  4IE6 A;  3PE0 A;  4AQG A;  2FJB A;  2QGS A;  4KHZ F;  3N2O A;  4KBM B;  4WZX A;  2ZMA A;  5JQG E;  4NXN T;  1IJ5 A;  1J5W A;  3Q9D A;  4YSY A;  3FBZ A;  3P7I A;  4IDP A;  3AE7 A;  3JAF A;  2HN2 A;  3C51 A;  3EDU A;  3CIR A;  4PW8 A;  2BG9 E;  4GK0 E;  2CCQ A;  4HN9 A;  3VR8 A;  5JDG A;  1O3X A;  4H9O C;  3Q5E A;  4JYA T;  1J1J A;  4ZOL E;  5LMU T;  1D0Z A;  3QOF A;  2W00 A;  2AE9 A;  4A5X A;  5EK3 A;  3ZT5 A;  1MIV A;  5IWA T;  1VCT A;  2XSB A;  3F2E A;  1D0X A;  4U31 A;  3M65 A;  4B3T T;  2QYW A;  2VWA A;  2PFV A;  2QVA A;  4HWF A;  4B3S T;  3ZMZ B;  4HFB A;  1HF8 A;  1HG2 A;  5JR9 A;  3WAK A;  4QX8 B;  2E9X A;  2W67 A;  2E9X B;  3KV9 A;  4G63 A;  3WAJ A;  1W0B A;  1KF6 A;  3K1S A;  3MJX A;  4DV6 T;  3L09 A;  3AAE B;  3Q5W A;  3AEB A;  3FBL A;  4HTE A;  3D0T A;  5AFU L;  2W2U A;  1WYC A;  3QB5 K;  5FP3 A;  3R6N A;  1U5P A;  4DR5 T;  3RC8 A;  3N2K E;  4DBQ A;  4LF9 T;  3K8P C;  1Y64 B;  3LFM A;  3TLT A;  3K3O A;  2F4V T;  2JRK A;  4E7S A;  2WDQ A;  2FJD A;  2E2A A;  3E22 E;  4QKN A;  4JLE A;  1Y01 A;  2X9W A;  1N33 T;  4UVB B;  1Z0P A;  3UUX B;  3MA9 A;  2IUB A;  5AQL B;  5AQV B;  2ODU A;  3RHW A;  2XQ9 A;  1BR1 A;  4JI8 T;  4JI7 T;  4PJL A;  5LCY A;  2DLR A;  4IL9 A;  1WR0 A;  3P4P A;  1W9R A;  2UXD T;  2XQ8 A;  1AJ3 A;  4IE7 A;  4OK0 A;  3CQC B;  4HEA A;  2CE7 A;  5C3J A;  4H63 H;  2MOZ A;  3N9N A;  4DVD A;  5JDF A;  2EHO A;  5CFB A;  2LSY A;  4E7Z A;  4XAX B;  5AQF B;  4O4L E;  2HPJ A;  2DL1 A;  3QK6 A;  3RRC A;  3I0O A;  5JVD E;  3RYF E;  3RIA A;  1HCI A;  5CA1 E;  1NAF A;  3ZST A;  3UU6 A;  2FBW A;  4EIW A;  2UU9 T;  4JEU B;  3VRA A;  2BS4 A;  3ZC1 A;  1V9D A;  3B57 A;  1NEK A;  2I6H A;  1LKX A;  3SFD A;  5FYM A;  4X1K E;  2ZM6 T;  1WCR A;  4ISS A;  4H9N C;  4I4T E;  1N36 T;  3O9X A;  2LSK A;  3BQK A;  3EUH A;  3UUM A;  1LRZ A;  4JUY A;  2XTL A;  4AXP A;  4HWD A;  4CXX A;  4JI5 T;  3TLV A;  2NP9 A;  1UGO A;  3M3Z B;  3N9O A;  3ZT7 A;  2WDR A;  3AEE A;  1D0Y A;  4BJN A;  1UCU A;  1X9B A;  5KDM C;  4ILU A;  4IE0 A;  3C4W A;  3HA4 A;  5FKY A;  2OA5 A;  3KV4 A;  1HNW T;  2V7L A;  2XAF B;  5E0O A;  4LFB T;  2W0G A;  4DR2 T;  2V1D B;  5ETW A;  5ADX L;  2XQ4 A;  3H3A A;  4ZS3 A;  2VVN A;  3NZQ A;  4JI3 T;  4JI2 T;  2LOS A;  4CI3 B;  1W09 A;  4HFI A;  2YDS A;  4O4I E;  2FJA A;  1R8I A;  5L4H A;  3CK6 A;  1DU2 A;  4JEH B;  3PTR B;  3OYZ A;  3CX7 B;  3O4X E;  3U78 A;  4TN7 B;  5LHH B;  3K3N A;  3O1I A;  3ZCJ A;  2LEH A;  3AVR A;  4CN6 A;  1HTJ F;  1YKH B;  1LVK A;  2NR4 A;  2V6Y A;  5LNK A;  2V6Y B;  2X9Y A;  3T1H T;  1VRB A;  3AEF A;  1XNQ T;  2OV9 A;  5HYA A;  3OTO T;  2XQY A;  4UV8 B;  4Z91 A;  3UUL A;  4EYY R;  2Y6X A;  3AE8 A;  5AQK B;  4AIS A;  3ANW B;  4AI6 A;  3LK2 B;  4EGW A;  2H7O A;  5L3E B;  2V7I A;  3ONL C;  5DQV A;  3HKD E;  2MYS A;  2WU5 A;  1FIO A;  1KEY A;  3N2G E;  2D5U A;  1M62 A;  4J2C A;  5FY7 A;  4QHO A;  3P4S A;  2YN6 A;  4JV5 T;  5HXC A;  3PDY A;  1WFD A;  5ABG A;  1FEW A;  1JNZ A;  5CJ5 A;  3N9M A;  4ASK A;  2CWY A;  2PBI A;  5IYZ E;  3RPU A;  2YU2 A;  3TKL B;  4ILC A;  3DTO A;  2PTF A;  5BMV E;  3MZK B;  1UX4 A;  5JDQ A;  4A56 A;  2XHE B;  3I9W A;  5JTG A;  2FUP A;  5LA6 E;  3KBT A;  3UUB A;  1FMW A;  3AEC A;  4NUU A;  4BA9 A;  1QLB A;  4DV3 T;  3HI2 A;  4YHH T;  3EDV A;  2X0L B;  5KXJ A;  4ADZ A;  3T8O A;  1KNR A;  5FY1 A;  3PV0 F;  4O4J E;  1MNE A;  3NKZ A;  3OPC A;  4CQI A;  2D0U A;  2GK9 A;  2V7J A;  3PUX F;  2KWI B;  4X20 E;  5DQW A;  1M7K A;  4MHC A;  4KP3 C;  3QNU A;  2K48 A;  4FJO A;  4O2A E;  1H7C A;  1L0V A;  2L3L A;  1OWA A;  3ZMS B;  5LMN T;  2V8S V;  5LB7 B;  2B76 A;  1YQ4 A;  4ILB A;  1Z8U A;  4QWN B;  3HR0 A;  3RRW A;  4IIJ E;  2CBJ A;  1YD8 G;  3ZKR A;  5AQU B;  4YJ2 E;  3ZJ2 A;  3HL6 A;  4GYR A;  5FL0 A;  3C64 A;  2IW5 B;  1ZKE A;  1BR4 A;  3J9X 1;  2XAJ B;  1OED B;  4JBW F;  5FMN A;  3FXD B;  3UQ4 A;  3PU3 A;  4GYS A;  4PFO A;  1CHU A;  2IIU A;  2WMO A;  4QXC B;  2Q9Q A;  2Q9Q B;  3ONX A;  4TWF A;  3ZT6 A;  5LYJ E;  3I1A A;  3BK9 A;  2CMR A;  4IDZ A;  4YXD A;  2LKG A;  4ZI2 C;  3KFW X;  1UUR A;  4U74 A;  2W4X A;  2IHR 1;  4KHP T;  3FXE B;  2KXP B;  3ZPO A;  4COF A;  2XAQ B;  1YKE B;  1G8X A;  4F8H A;  3L3P A;  3T1Y T;  2XPK A;  3OVU A;  2MAW A;  2UXB T;  2LRL A;  4YHJ A;  3R84 B;  4ZI2 D;  3N9Q A;  5EK2 A;  1QUU A;  4G2A A;  3E0Z A;  1ZP0 A;  5LHG B;  1XDO A;  4HFC A;  2WSS V;  2CM0 A;  3IEE A;  3P50 A;  4GKJ T;  3BQI A;  4ERR A;  3FZF B;  3RI5 A;  4MFR A;  4UR9 A;  2K5B B;  2BKN A;  3KIN B;  3UU8 A;  4HWI B;  3RIU C;  2WCA A;  2BG9 A;  4BJM A;  2XAS B;  3AE9 A;  1FMV A;  2BBJ A;  5LXT E;  3UU3 A;  3KDS E;  3RKO A;  2K24 A;  4XZC A;  4PNI A;  5JR9 B;  4DND A;  2LKH A;  4U3C A;  3F57 A;  4OYK A;  4EZH A;  4LFC T;  2VK9 A;  2M6I A;  4WW0 A;  3CQG B;  3KV5 A;  1T72 A;  3ZCI A;  4HGA A;  2I59 A;  2X9X A;  2MBG A;  4MAL A;  5FY0 A;  2CBI A;  5LG3 A;  2VKO A;  2DCF A;  1HR0 T;  4IST A;  4PK4 A;  3FB2 A;  1XMO T;  3CVR A;  4TV9 E;  2A72 A;  4MLK A;  4X5T A;  4AQF A;  2V7K A;  4LFA T;  4M1P A;  1B7T A;  2DHR A;  2CPT A;  4OFZ A;  3IHR A;  3ZMV B;  2X68 A;  2XAG B;  2M67 A;  4I0U A;  4QH1 A;  2LHR A;  4NXM T;  5BR8 T;  3P4R A;  2E8I A;  5JDL A;  4F6R C;  2BVL A;  2X67 A;  1YW0 A;  5CB4 E;  3X1D A;  3B5M A;  2IML A;  1FJG T;  2RP4 A;  4PFP A;  4QXB B;  4AKR B;  3PUG A;  4LF4 T;  3JAE A;  4U7I A;  3PUZ F;  3SS1 A;  2EHO B;  3SFE A;  3LBX A;  3LBX B;  2XZE A;  2XQ3 A;  1IJ6 A;  2L9Q A;  4LMK A;  3VRB A;  2LSG A;  1VOM A;  2VKJ A;  3ESL A;  5AQG B;  3GMI A;  4DV0 T;  3E08 A;  1MIW A;  2JQK A;  3NVO A;  2ACZ A;  3NZP A;  3QC9 A;  2MPK A;  3QUJ A;  4GOU A;  2W61 A;  3KVA A;  1BR2 A;  2C5J A;  2PJQ A;  3AE5 A;  1XZY A;  1OED C;  5L3B B;  5TAO A;  3DP7 A;  5FXV A;  3PUA A;  4UXN B;  4AKI A;  4WBO A;  2J62 A;  2C0S A;  5LOV E;  2NW7 A;  4I50 E;  5ABE A;  3N9L A;  2PG8 A;  2A2F X;  4ZI3 C;  3MKD A;  5LJN A;  3ONJ A;  4IGU A;  3RLF F;  3EAB A;  4TWD A;  5F8P A;  5C2T A;  4ZZC A;  2Y8D A;  2KIN B;  3SOL A;  3JAD A;  1SHZ C;  1LVF A;  3V5S A;  3CX6 B;  2ACX A;  5A1L A;  4H9R C;  2ZM2 A;  2YOE A;  4ZI3 D;  4FI5 A;  4A98 A;  1WYB A;  3CML A;  2X9H A;  2WDV A;  3NRY A;  3RX6 A;  4NIQ A;  2VKD A;  3TLU A;  1N32 T;  2V5C A;  5L47 A;  2CLY B;  3JCF A;  3AAA B;  2WU2 A;  3GA8 A;  3FHN A;  1CUN A;  3L8R A;  5FVL A;  2G0U A;  3EAM A;  1IBM T;  1XDP A;  2X66 A;  5ABH A;  2E5L T;  2A9U A;  4IL4 A;  3PJA A;  4X64 T;  5JR9 C;  4ZZB A;  3P4W A;  2E9X C;  1XWM A;  4EB6 E;  5LJM A;  3AA7 B;  2VKH A;  1U4Q A;  1IZN B;  3A8Y C;  2WQY A;  4C91 A;  3AE2 A;  4BAY B;  2X0Y A;  5J2U E;  4HFH A;  1I94 T;  5HAX A;  5FXX A;  4DV2 T;  2XSA A;  4UIG A;  2JJ9 A;  1VCS A;  4DUZ T;  4DV4 T;  3MK7 C;  2CXL A;  2I0M A;  2IC6 A;  2FJE A;  3IBP A;  5JH7 E;  5LBQ B;  3UU5 A;  2OLT A;  2E9X D;  3CPZ A;  2CHN A;  4AKG A;  2Z6E A;  4HKA A;  4AKH A;  3AE1 A;  3GN5 A;  3SWH A;  2KND A;  2D9D A;  2HH7 A;  2WB5 A;  2IAK A;  1UX5 A;  2UUC T;  4KX6 A;  1GQE A;  2E5V A;  4YJ3 E;  5HCM A;  3W15 B;  5LP6 E;  3JC6 C;  2WY2 A;  3GWH A;  4CZZ B;  1OXZ A;  1KNP A;  5FXZ A;  2J1D G;  4P1N A;  3OKQ A;  2EHO C;  3ZMU B;  5JDH A;  5JRC A;  5JRC B;  2C5K T;  5KMG P;  3N5L A;  5JRE A;  3LJC A;  4DBR A;  5FXW A;  3AEG A;  2YK0 A;  2J4G A;  4QH4 A;  3ZLI A;  3IA3 A;  3EVY A;  3JC6 D;  3VKH A;  2WM9 A;  3F31 A;  1KK7 A;  4GK5 E;  2CA5 A;  2N9D A;  3TLS A;  3VKG A;  2BS2 A;  2XY8 B;  3VR9 A;  4KI0 F;  1MIY A;  5AQR B;  3SRZ A;  1JNR A;  3VHL A;  4CN4 A;  2RA1 A;  3OBV E;  1J5E T;  5AQM B;  2DWK A;  4JI1 T;  1T7S A;  4DO0 A;  3FZL B;  2B1E A;  2NOX A;  1S35 A;  4EEB A;  3O1H A;  2J47 A;  4LML A;  2VUR A;  4H9P C;  4DR6 T;  1SA0 E;  5KX5 E;  4U2Y A;  3H37 A;  3J7Y q;  1UK5 A;  2DWG A;  2MTQ A;  2KZ7 B;  4L0R A;  3UUN A;  1HG5 A;  4UF0 A;  4UF0 B;  2BDE A;  1OED E;  3A7M A;  4UVA B;  4LF8 T;  2XQ5 A;  4WNK A;  2YDQ A;  2WBL A;  3I9Y A;  2YEV C;  5HXH A;  2UXX B;  4DR1 T;  3ZN1 B;  3KVB A;  2CLY C;  3FZH B;  1KFY A;  3K3Q C;  2DI4 A;  3ETU A;  4ANJ A;  3UFG A;  2JMH A;  3RYC E;  5HEU A;  1E7P A;  4GIW A;  4WBN E;  5IHY A;  4TWH A;  3OJA A;  4DV1 T;  2NW8 A;  5IUX A;  1G73 A;  3AA6 B;  2V7M A;  4WYV A;  3N9P A;  5AQN B;  4DR4 T;  2N1G A;  2UXN B;  1IAP A;  3HKC E;  3AA1 B;  5GON E;  3S4U A;  4EOZ B;  4EAH A;  3NWI A;  2X51 A;  5HXS A;  4MBQ A;  1EZ3 A;  4LF5 T;  2W66 A;  3UT5 E;  5J2T E;  2BVM A;  5HXR A;  3Q5D A;  3MXZ A;  3QB5 A;  4Q25 A;  2BG9 B;  3ZYM A;  1X79 A;  3RQU A;  2VQE T;  3LSV A;  3ZJ1 A;  1HFA A;  1ZHC A;  2ZLY A;  4TZ4 C;  3PU8 A;  4PJN A;  4NUV A;  4U72 A;  2QA7 A;  4B6X A;  1SUM B;  3I0Q A;  3AXJ A;  3AXJ B;  3PUY F;  2JQH A;  1WRD A;  4ZHQ E;  4PK5 A;  2K3W A;  2KLQ A;  3EHZ A;  2YU1 A;  3A5X A;  3PJA J;  4UEL A;  2HPL A;  3AB3 B;  4ZI7 E;  2V6X A;  1NWM X;  1W0A A;  5LBM A;  2UUB T;  4ZXL A;  1HNX T;  4X1Y E;  2HHH T;  4DMV A;  3KV6 A;  4H9Q C;  2YIN A;  5HEH A;  4OHF A;  4O4H E;  4YTM A;  5HEO A;  3ZSS A;  2XAH B;  3C4X A;  5LHI B;  4KUM B;  3UTK A;  3PUW F;  5M4Y A;  4DID B;  4CI2 B;  3BQL A;  3AA0 B;  4U7Y A;  4ZS2 A;  2XJ7 A;  1D1A A;  2W62 A;  1MMA A;  5AQO B;  4DV7 T;  2ES0 A;  5J1G A;  5FNV E;  3CKD A;  4DV5 T;  2WAU A;  4K0U A;  3RQW A;  4TUY E;  5L2L A;  4P0A A;  2YDR A;  3PUR A;  3HKB E;  1UUS A;  2H89 A;  3AE3 A;  2ODV A;  3MAC A;  1S94 A;  2LT3 A;  5HEJ A;  3VU7 H;  4AIU A;  5JDN A;  2UXC T;  3AE4 A;  1HX1 B;  4TNV A;  4EYU A;  1IBK T;  1D1B A;  2CHO A;  2VQF T;  4EXT A;  2SPC A;  4PK6 A;  4CN1 A;  4JI6 T;  5F5W A;  3ZEF B;  3P4Q A;  2NTY A;  2XM1 A;  2Q9Q C;  4DR7 T;  3LG7 A;  4Z90 A;  5DJQ C;  3RGL A;  2LHN A;  2H7V C;  4V1A v;  4IHJ E;  1US7 B;  4YSZ A;  3TLW A;  1E2A A;  4HFD A;  2ZM8 A;  3L39 A;  2H88 A;  3G06 A;  4UVC B;  2UUA T;  2LSJ A;  3RH3 A;  2VL8 A;  2NW9 A;  4IDQ A;  2Q9Q D;  3AED A;  4I55 E;  3OYX A;  3ABV A;  4YLH A;  2JMK A;  1HS7 A;  4C90 A;  4NPP A;  3V5U A;  2CWO A;  4X62 T;  4B3M T;  5AQP B;  2LRK A;  5HWX A;  1XNR T;  4P0B A;  4K0K T;  4GKK T;  3ZN0 B;  4PJJ A;  1T98 A;  2IDO B;  3LK3 B;  3ETV A;  3EI0 A;  2WZI A;  5AQQ B;  4O8S A;  4PJM A;  2LM2 A;  2LSI A;  3CX8 B;  3FZM B;  2A3D A;  1YQ3 A;  3FZK B;  1T8B A;  2BG9 C;  4TNW A;  2JQQ A;  4YTP A;  2XQ6 A;  2RPA A;  4L5G A;  2LOP A;  4ILA A;  2WWV A;  3Q2M A;  5CA0 E;  2VVS A;  2XUE A;  3CQX C;  5LGT B;  4EV6 A;  4OX9 T;  3C98 B;  4H63 V;  1MND A;  2R6G F;  2WP9 A;  5CGM A;  1SE7 A;  2NTX A;  5H6R B;  3UU4 A;  4Z8X A;  4IE4 A;  4U2Z A;  4EED A;  1D1C A;  2JQ9 A;  2WMN A;  1E1H B;  4JI4 T;  2K9A A;  2D0T A;  3RC3 A;  5C8Y E;  1HX8 A;  1HNZ T;  4CXW A;  5AQJ B;  5FL1 A;  4IE5 A;  4A97 A;  3PUS A;  3PUV F;  5LG4 A;  3PUQ A;  2XQ7 A;  2LM9 A;  2CEA A;  4QXH B;  5F3J A;  2BZB A;  2WZH A;  4JI0 T;  3ANW A;  2WWU A;  4XBF B;  4AQF C;  2Y48 B;  3GN5 B;  3HKE E;  3O1J A;  5EK4 A;  3RIU A;  5J0Z A;  5L3F B;  2JIW A;  3LK4 2;  1IBL T;  5LGN B;  4YT0 A;  2YKS A;  4X65 T;  4IDO A;  2CRB A;  4I43 B;  5AQS B;  5EZY E;  4DUY T;  4YFS A;  4KMC A;  3RIF A;  3P8C D;  4IDN A;  4HFV A;  3NRX A;  2X0H A;  5AQH B;  5AQT B;  3Q5X A;  5LGU B;  4TV8 E;  4O2B E;  3LDQ B;  3H3M A;  5JDM A;  4L9I A;  1MMN A;  5HWY A;  4LF7 T;  4OYJ A;  2CXF A;  1WLX A;  2CXD A;  1MMG A;  3UFE A;  2H3R A;  5H6Q B;  2BS3 A;  2VB6 A;  3RKG A;  1QSD A;  3CWZ B;  3DJB A;  4YSX A;  4B3R T;  3B13 A;  3RYI E;  1MMD A;  1XMQ T;  4UV9 B;  3RYH E;  2HN1 A;  2NWB A;  2KMF A;  4P09 A;  3ZYK A;  2EHO D;  3KBU A;  1NEN A;  2JPF A;  2DNX A;  2BBH A;  2V26 A;  1N34 T;  4CXY A;  2D2S A;  2W63 A;  4AQY T;  2KSR A;  3U3I A;  4DMW A;  2BKP A;  1YXR A;  3AVS A;  2LE8 A;  4QH5 A;  3ZYL A; 
#chains in the Genus database with same CATH homology
 1BR2 A;  1ZV4 X;  2C5J A;  2PJQ A;  3NBX X;  5L3G B;  3ZMT B;  5LNK A;  1HFA A;  4TX5 A;  1ZHC A;  2X9Y A;  5L3B B;  5TAO A;  2ZLY A;  1VRB A;  4H9S E;  3DP7 A;  5HYA A;  4TZ4 C;  3PU8 A;  2XQY A;  5FXV A;  4UV8 B;  2LJL A;  3PUA A;  4UXN B;  3UUL A;  4WBO A;  4EYY R;  4AKI A;  4PJN A;  2Y6X A;  2C0S A;  5LOV E;  2NW7 A;  3C50 A;  4NUV A;  5L3C B;  4I50 E;  4U72 A;  1ZEE A;  2QA7 A;  3ANW B;  4B6X A;  3ZC0 A;  3I0Q A;  4AI6 A;  3LK2 B;  2PG8 A;  3N9L A;  5L3D B;  2N2N A;  5DAB A;  2H7O A;  2A2F X;  4ZI3 C;  3MKD A;  5LJN A;  1KNZ A;  2C5I T;  2KT9 A;  4N78 D;  4IGU A;  5HXE A;  5L3E B;  1WRD A;  2V7I A;  5DQV A;  4X1I E;  3HKD E;  2KWH A;  5F8P A;  2MYS A;  4ZHQ E;  4PK5 A;  1FIO A;  2KLQ A;  2Y8D A;  3N2G E;  2KIN B;  2P9B A;  2D5U A;  4J2C A;  2YU1 A;  3A5X A;  4PAG A;  3IF8 B;  5FY7 A;  4QHO A;  3SOL A;  1SHZ C;  5HXC A;  3PDY A;  4UEM A;  4UEL A;  1LVF A;  2HPL A;  3AB3 B;  3V5S A;  3WI3 A;  4ZI7 E;  3CX6 B;  1NWM X;  2IC9 A;  1FEW A;  2ACX A;  3C4Z A;  5A1L A;  3N9M A;  5LBM A;  4H9R C;  2ZM2 A;  4ASK A;  2CWY A;  2PBI A;  4X1Y E;  5IYZ E;  3RPU A;  4ZI3 D;  4CI1 B;  4FI5 A;  2YU2 A;  2ZM0 A;  3TKL B;  1WYB A;  3DTO A;  4DMV A;  3CML A;  3KV6 A;  2X9H A;  4H9Q C;  2YIN A;  2L8K A;  5BMV E;  4OHF A;  4O4H E;  2XAH B;  3MZK B;  1UX4 A;  5JDQ A;  3NRY A;  3RX6 A;  3C4X A;  4A56 A;  5LHI B;  2VKD A;  2XHE B;  3I9W A;  4AKL A;  4KUM B;  4QX7 B;  1WR6 A;  3UTK A;  5M4Y A;  5LA6 E;  4CI2 B;  4HE8 A;  3KBT A;  1FMW A;  3BQL A;  4EZ4 A;  3AAI A;  2CLY B;  4NUU A;  3AAA B;  3AA0 B;  4BA9 A;  3GA8 A;  2VAS A;  3FHN A;  1BR0 A;  4ZS2 A;  1D1A A;  3HI2 A;  2W62 A;  1MMA A;  3EDV A;  2X0L B;  1CUN A;  2ES0 A;  5J1G A;  5FNV E;  4ADZ A;  3T8O A;  4IE6 A;  3CKD A;  2G0U A;  3PE0 A;  4AQG A;  2WAU A;  5FY1 A;  4O4J E;  2QGS A;  4K0U A;  3N2O A;  4KBM B;  1MNE A;  2ZMA A;  5JQG E;  1IJ5 A;  3Q9D A;  3FBZ A;  3P7I A;  4CQI A;  2X66 A;  2D0U A;  3C51 A;  2GK9 A;  4TUY E;  5L2L A;  4P0A A;  3PUR A;  3EDU A;  3HKB E;  2V7J A;  2KWI B;  4X20 E;  5DQW A;  4PW8 A;  4MHC A;  4KP3 C;  2ODV A;  3MAC A;  4GK0 E;  2CCQ A;  5JR9 C;  1S94 A;  2K48 A;  4HN9 A;  2LT3 A;  2E9X C;  4FJO A;  3VU7 H;  4O2A E;  4EB6 E;  5JDN A;  5JDG A;  1O3X A;  5LJM A;  4H9O C;  1H7C A;  3AA7 B;  2VKH A;  1U4Q A;  1IZN B;  4EYU A;  4C91 A;  4ZOL E;  2L3L A;  4BAY B;  1D0Z A;  1D1B A;  1OWA A;  3ZMS B;  5J2U E;  2W00 A;  4EXT A;  2SPC A;  4PK6 A;  5EK3 A;  5HAX A;  1MIV A;  5FXX A;  3ZEF B;  4UIG A;  4QWN B;  2JJ9 A;  2NTY A;  3F2E A;  3HR0 A;  3RRW A;  1D0X A;  3MK7 C;  4IIJ E;  2Q9Q C;  2CXL A;  2IC6 A;  3M65 A;  1YD8 G;  2VWA A;  3LG7 A;  3IBP A;  5JH7 E;  2PFV A;  5DJQ C;  5LBQ B;  4YJ2 E;  3ZMZ B;  3ZJ2 A;  2LHN A;  3HL6 A;  1HF8 A;  4GYR A;  2E9X D;  2H7V C;  3CPZ A;  4V1A v;  1HG2 A;  5JR9 A;  3WAK A;  4IHJ E;  1US7 B;  3C64 A;  4QX8 B;  2E9X A;  2IW5 B;  1ZKE A;  2E9X B;  3KV9 A;  4G63 A;  3WAJ A;  1BR4 A;  3J9X 1;  4AKG A;  2Z6E A;  4HKA A;  4AKH A;  3MJX A;  2ZM8 A;  2XAJ B;  3GN5 A;  3L09 A;  3SWH A;  4UVC B;  2KND A;  3AAE B;  3Q5W A;  5FMN A;  3FBL A;  2LSJ A;  3FXD B;  4HTE A;  3RH3 A;  3D0T A;  2VL8 A;  3PU3 A;  1WYC A;  4GYS A;  4PFO A;  2HH7 A;  2NW9 A;  5AFU L;  2Q9Q D;  4I55 E;  5FP3 A;  2WMO A;  3R6N A;  3OYX A;  2IAK A;  1U5P A;  4QXC B;  2Q9Q A;  2Q9Q B;  3ONX A;  5LYJ E;  3RC8 A;  4YLH A;  3N2K E;  1UX5 A;  3I1A A;  4DBQ A;  3BK9 A;  3K8P C;  2CMR A;  2JMK A;  1Y64 B;  3LFM A;  1HS7 A;  4C90 A;  3K3O A;  4IDZ A;  4YJ3 E;  4ZI2 C;  2JRK A;  4E7S A;  3W15 B;  3KFW X;  5LP6 E;  3JC6 C;  3V5U A;  2CWO A;  3GWH A;  3E22 E;  5HWX A;  4QKN A;  4P0B A;  4JLE A;  4CZZ B;  4U74 A;  2X9W A;  1OXZ A;  5FXZ A;  2J1D G;  4UVB B;  3OKQ A;  3ZN0 B;  2EHO C;  3ZMU B;  1Z0P A;  3FXE B;  3UUX B;  3MA9 A;  5JDH A;  5JRC A;  4PJJ A;  2KXP B;  3ZPO A;  5JRC B;  1T98 A;  2XAQ B;  2C5K T;  3LK3 B;  1YKE B;  3N5L A;  5KMG P;  5JRE A;  3LJC A;  2ODU A;  3ETV A;  1G8X A;  4DBR A;  1BR1 A;  4O8S A;  5FXW A;  3L3P A;  2YK0 A;  4PJM A;  2LSI A;  3CX8 B;  4PJL A;  5LCY A;  2A3D A;  2DLR A;  4YHJ A;  3R84 B;  3ZLI A;  4ZI2 D;  3EVY A;  3N9Q A;  5EK2 A;  2JQQ A;  3JC6 D;  4L5G A;  2LOP A;  1QUU A;  3VKH A;  2WM9 A;  3F31 A;  4G2A A;  1KK7 A;  3Q2M A;  3E0Z A;  4GK5 E;  2CA5 A;  2N9D A;  5CA0 E;  3VKG A;  1AJ3 A;  5LHG B;  2XUE A;  4IE7 A;  3CQX C;  4OK0 A;  5LGT B;  3CQC B;  2WSS V;  2CM0 A;  3C98 B;  4HEA A;  2CE7 A;  4H63 V;  1MND A;  3IEE A;  4H63 H;  2MOZ A;  3N9N A;  1MIY A;  3SRZ A;  2NTX A;  5H6R B;  4DVD A;  5JDF A;  3VHL A;  2EHO A;  3BQI A;  4ERR A;  2LSY A;  4E7Z A;  4Z8X A;  4IE4 A;  4XAX B;  2RA1 A;  3OBV E;  4MFR A;  1D1C A;  2DWK A;  2K5B B;  4O4L E;  2HPJ A;  4DO0 A;  3KIN B;  3QK6 A;  2WMN A;  3RRC A;  3I0O A;  1E1H B;  5JVD E;  3RYF E;  2B1E A;  4BJM A;  2NOX A;  1HCI A;  1S35 A;  2XAS B;  5CA1 E;  2K9A A;  2D0T A;  1NAF A;  1FMV A;  3RC3 A;  5C8Y E;  5LXT E;  3O1H A;  1HX8 A;  4EIW A;  4CXW A;  3KDS E;  3RKO A;  4H9P C;  4JEU B;  2K24 A;  1SA0 E;  4XZC A;  4PNI A;  3ZC1 A;  1V9D A;  4IE5 A;  3B57 A;  3PUS A;  5KX5 E;  5LG4 A;  3PUQ A;  1LKX A;  2LM9 A;  5FYM A;  4X1K E;  2CEA A;  3H37 A;  5JR9 B;  3J7Y q;  2DWG A;  2MTQ A;  2KZ7 B;  4L0R A;  4QXH B;  5F3J A;  4ISS A;  2BZB A;  3UUN A;  4DND A;  4H9N C;  4I4T E;  1HG5 A;  3F57 A;  4OYK A;  3ANW A;  4UF0 A;  4UF0 B;  2BDE A;  3O9X A;  4EZH A;  2WWU A;  4XBF B;  4AQF C;  2LSK A;  3BQK A;  2VK9 A;  2Y48 B;  3EUH A;  3GN5 B;  3HKE E;  3O1J A;  5EK4 A;  4UVA B;  3UUM A;  1LRZ A;  4WW0 A;  3CQG B;  3KV5 A;  4WNK A;  5L3F B;  3ZCI A;  4JUY A;  3LK4 2;  2WBL A;  2XTL A;  5LGN B;  3I9Y A;  2YEV C;  4HGA A;  4AXP A;  5HXH A;  2I59 A;  2UXX B;  4CXX A;  2X9X A;  2MBG A;  4I43 B;  4MAL A;  3ZN1 B;  2NP9 A;  3KVB A;  5EZY E;  5FY0 A;  2CLY C;  4YFS A;  4KMC A;  2VKO A;  2DCF A;  3N9O A;  3P8C D;  4HFV A;  4IST A;  4PK4 A;  3NRX A;  1D0Y A;  3K3Q C;  3Q5X A;  2DI4 A;  4BJN A;  1UCU A;  3ETU A;  4ANJ A;  3FB2 A;  5LGU B;  5KDM C;  3CVR A;  4TV8 E;  4O2B E;  4TV9 E;  2JMH A;  2A72 A;  3RYC E;  4ILU A;  4MLK A;  4IE0 A;  3C4W A;  3HA4 A;  4AQF A;  2V7K A;  4GIW A;  5JDM A;  4WBN E;  4L9I A;  4M1P A;  1B7T A;  1MMN A;  5HWY A;  2DHR A;  4OFZ A;  2OA5 A;  3KV4 A;  3IHR A;  3ZMV B;  4OYJ A;  2CXF A;  2V7L A;  2X68 A;  5IHY A;  2XAF B;  3OJA A;  2XAG B;  1WLX A;  2CXD A;  2M67 A;  5E0O A;  2NW8 A;  1MMG A;  2LHR A;  3UFE A;  2H3R A;  5H6Q B;  1G73 A;  3AA6 B;  2E8I A;  2W0G A;  2V1D B;  2V7M A;  2VB6 A;  5JDL A;  3N9P A;  4F6R C;  2BVL A;  2N1G A;  5ETW A;  2X67 A;  1QSD A;  5ADX L;  3CWZ B;  3DJB A;  3H3A A;  1YW0 A;  4ZS3 A;  5CB4 E;  3NZQ A;  2LOS A;  2RP4 A;  2UXN B;  3B13 A;  4PFP A;  1MMD A;  1IAP A;  3RYI E;  3HKC E;  4CI3 B;  4QXB B;  4UV9 B;  3RYH E;  2NWB A;  3AA1 B;  4O4I E;  4AKR B;  3PUG A;  2KMF A;  4P09 A;  5GON E;  3S4U A;  3ZYK A;  2EHO D;  3KBU A;  4EOZ B;  3SS1 A;  4EAH A;  2EHO B;  4JEH B;  2X51 A;  3PTR B;  3OYZ A;  3CX7 B;  2JPF A;  5HXS A;  2DNX A;  3LBX A;  4MBQ A;  1EZ3 A;  3LBX B;  3O4X E;  2V26 A;  3U78 A;  3UT5 E;  1IJ6 A;  2L9Q A;  4TN7 B;  5LHH B;  4CXY A;  2D2S A;  5J2T E;  3K3N A;  2LSG A;  1VOM A;  2W63 A;  2BVM A;  5HXR A;  3O1I A;  2VKJ A;  3ESL A;  3ZCJ A;  2LEH A;  3MXZ A;  3AVR A;  3GMI A;  3E08 A;  1MIW A;  3U3I A;  1HTJ F;  4DMW A;  1YKH B;  1LVK A;  3ZYM A;  1X79 A;  3NZP A;  3QC9 A;  3QUJ A;  3AVS A;  2LE8 A;  4GOU A;  3ZYL A;  2W61 A;  3ZJ1 A;  3KVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...