2LSIA

Solution structure of polymerase-interacting domain of human rev1 in complex with translesional synthesis polymerase kappa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
GHMAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title Insights into the scaffold mechanism of human Rev1 in translesional synthesis revealed by the structural studies on its polymerase-interacting domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsiA00
2LSYA 2N1GA 4BA9A 2LSGA 4GK0E 2LSJA 4GK5E 3VU7H 2LSIA 2LSKA 4FJOA 4EXTA
chains in the Genus database with same CATH superfamily
4DIDB 3WI3A 3C4XA 3KBTA 4DR4T 3RLFF 3P7IA 4X20E 2WMNA 4KP3C 4M1PA 2UXNB 5LBMA 4AQFC 4HFBA 3OTOT 2D0UA 3AB3B 4E7ZA 2X67A 3BQIA 5CFBA 3FXEB 4ANJA 2X9HA 4YSYA 3AE4A 1UURA 4PK5A 2H3RA 1WYBA 4U72A 1AJ3A 2E9XB 1MMAA 2Q9QC 2YOEA 3K3NA 1FJGT 4EOZB 2HHHT 3AVSA 5EK2A 1UK5A 2A9UA 2CRBA 4P09A 5CB4E 5F5WA 2CWOA 2LLYA 4IDZA 1E2AA 1UGOA 3EAMA 4DV2T 2WZIA 4U3CA 3KV4A 4WNKA 3KVBA 4DR7T 2CM0A 5JDFA 1KFYA 4AQYT 3TLUA 1HG2A 4ZOLE 4AKHA 4X62T 3X1DA 5LOVE 2UUCT 2WAUA 4U2YA 1W9RA 3ZT6A 2Q9QB 2SPCA 1WCRA 2KSRA 4YHHT 5HXHA 3PUVF 3S4UA 1OXZA 3HKBE 5GONE 2DHRA 3IA3A 3L8RA 4ISTA 1XNQT 1E7PA 1O3XA 4O4JE 2HH7A 5KX5E 4YLHA 5JDQA 4JI8T 5L3CB 5AQOB 4ZI3C 4X5TA 5LCYA 3FBZA 1FEWA 3UFEA 3ETUA 3HKDE 2BG9B 5LMNT 2LHNA 2EHOB 2BKOA 2V7JA 2BVMA 2V8SV 2J1DG 2AE9A 4O2BE 1Y64B 4EB6E 5JQGE 3EHZA 3MK7C 2X51A 4JI5T 1KNPA 4LFAT 2BKPA 5HCMA 5AQFB 5AQPB 3JCFA 5HEOA 1HNZT 2V5DA 2VVSA 3LDQB 2VKJA 3ZKRA 3JC6C 3N9QA 4TX5A 1WYCA 3G06A 2WBLA 1WR0A 4AKGA 3L39A 4UELA 2IHR1 3UUXB 4EZ4A 4ZS2A 5LHIB 5AQHB 3O1JA 2DLRA 5LG4A 2XQ3A 1ZKEA 4IE7A 4OYJA 2WDVA 4CN6A 2QRXA 2LSIA 2H89A 4TN7B 4O2AE 3K1SA 5AQNB 4TV9E 1BR2A 2QA7A 3JADA 4UV8B 2I0MA 3AEEA 3RYCE 4EXTA 3TLVA 2LOPA 2FJEA 4UVCB 4YT0A 5TAOA 2NR4A 2WP9A 1N34T 5KXJA 2WU2A 3CX7B 3CQCB 2V6XA 3UU8A 4JV5T 2PBIA 4CN4A 4U74A 3LK2B 1V9DA 3RIFA 3AE2A 3CX8B 3LSVA 2E9XD 1D1CA 2X9YA 3UU4A 4B3MT 3PUWF 2M6BA 2W66A 2RA1A 2CLYC 3VRBA 5ADXL 1KEYA 3Q5DA 2W2UA 4QHOA 5AQJB 4V1Av 2H7OA 2B76A 4UEMA 2PFVA 4IE6A 5F8PA 5AQRB 4PK6A 3UU3A 1HTJF 3CK6A 4KMCA 4J2CA 3ZLIA 5LGTB 2NOXA 1FMVA 3JAFA 4WZXA 1I6ZA 2ES0A 3MZKB 4QXHB 2WS3A 3KV6A 5DABA 4ZI7E 3QOFA 1DU2A 3LJCA 4ISSA 2PG8A 2Q9QD 5LG3A 2DWGA 2LSGA 2N9DA 4B3ST 2ZM0A 3UT5E 2CLYB 1KF6A 5IHYA 3ZCJA 4DR3T 4GKJT 4YXDA 1WR6A 4IL4A 3U78A 5L4EA 3ETVA 3VRAA 4U33A 3ZSSA 2CHOA 4KBMB 2J62A 4ASKA 4TZ4C 3V5UA 1QSDA 1ZP0A 2CHNA 3P50A 4AKLA 4XAXB 2CPTA 3CQGB 4MHCA 1BR1A 4UV9B 2LRLA 2LT3A 2X68A 5JDLA 2XHEB 1XZYA 3ZYMA 1SA0E 2F4VT 3P4RA 3QC9A 4Z90A 2KT9A 4TNWA 3NZQA 5FXWA 3KFWX 2X0HA 1T7SA 2V7LA 3ZCIA 2CBIA 3LBXA 3RQWA 2XJ7A 2DWKA 3KVAA 2LEHA 2VKOA 4EZHA 4WYVA 4GK0E 3N5LA 3OVUA 2JMKA 3FZFB 4GYRA 5HCJA 2V5CA 4HN9A 2VVNA 4JEHB 2J4GA 3AE1A 1OEDE 4HFHA 4BJNA 2XQAA 3UUMA 4OHFA 2LKHA 2VKDA 1L0VA 2YEVC 5LA6E 5AQUB 2WWUA 2LKGA 3SWHA 2C5IT 3NKZA 2WM9A 2IAKA 3ESLA 5J2UE 5LJNA 4EV6A 3RKGA 2QVAA 2K5BB 4DNDA 4CI1B 3OKQA 4CZZB 3AA1B 1UUSA 5AQLB 3ZJ2A 4YSXA 2XSAA 1WRDA 1D0YA 3JC6D 3OPCA 5J0ZA 4L5GA 2PTFA 2E8IA 1VCSA 3HKCE 1E1HB 1LRZA 3RGLA 2UXBT 3N9PA 3BQLA 3CKDA 2WZHA 2CCQA 4XBFB 4ZXLA 4N78D 3RYFE 4ZS3A 4PFPA 2BBHA 3ZYKA 2UXDT 4L0RA 1X79A 4KI0F 2XQ8A 4CXYA 3O1IA 4JI1T 3FHNA 3AAIA 3WAJA 4DV0T 3ZT7A 5FYMA 4OX9T 3M3ZB 1MNDA 3VKHA 4BAYB 2KLQA 1JNRA 2VL0A 2CXLA 3ANWB 2XAGB 4G2AA 3I9WA 2IC6A 3R84B 1R8IA 2M6IA 3P8CD 3P4SA 4X65T 5FY0A 4WBNE 3VU7H 5FL1A 4DMWA 3KBUA 2K3WA 3UULA 5L47A 5EK4A 2IC9A 3OYZA 2YU1A 2W63A 4HWFA 4Z91A 2BBJA 3MACA 2GK9A 1YQ4A 1SUMB 3N9LA 4K0KT 1T98A 4WW0A 4OFZA 2ODVA 1HNXT 3ZMUB 3SOLA 1HS7A 1OEDB 3C4WA 4BJMA 3I0QA 4TUYE 3AE6A 4ILCA 2XAHB 4UVBB 3RRWA 2JPFA 4HKAA 2AXDS 5HYAA 2W61A 5BMVE 1SE7A 4QKNA 2Y8DA 1BR4A 3AE9A 4HWDA 1MNEA 2XAQB 1IBLT 3Q5EA 5FY1A 2JQHA 4LFBT 5JRCB 4H9OC 4NIQA 2XTLA 1VRBA 3AEGA 4U7IA 3UTKA 5AQSB 3O9XA 3OYXA 3ZN0B 3ZYLA 2V7KA 4KHZF 1YXRA 1VCTA 2LHRA 3UUBA 5HEUA 5LP6E 3IHRA 2V6YB 3KV9A 3MKDA 3C51A 4ZEYA 2BG9A 2EHOA 1SHZC 4LF8T 3KV5A 5M4YA 3V5SA 3E0ZA 2OV9A 4EIWA 3SFEA 4CXXA 2XAFB 3FZMB 3Q2MA 3PUAA 1LVFA 3E08A 2H88A 4JI2T 1MIVA 1NAFA 1HF8A 2LJLA 3CWZB 1XWMA 4PK4A 3IF8B 5L3EB 4PJMA 3AEFA 4P0BA 1Z0PA 1HG5A 4I43B 3EDUA 3HR0A 3ONXA 1ZEEA 1IJ5A 1D0ZA 3PU3A 3TLTA 3I0OA 4LF5T 4YTNA 3HL6A 5L3DB 4H9PC 4P0AA 2XQ6A 5ETWA 4AXPA 3SRZA 5JR9C 3RIUA 2KNDA 4B3RT 5CJ5A 5E0OA 4A5XA 3Q5XA 4BA9A 1KNRA 2NTXA 4TNVA 4XZCA 2XQ7A 3ZMTB 2XASB 4CQIA 1M62A 2L8KA 4UIGA 4A56A 2LSJA 2MOZA 1QUUA 2W00A 2L3LA 5FY7A 5FXZA 4HE8A 2CXDA 3KDSE 4U2ZA 3TLWA 3W15B 2LRKA 4JUYA 3UU5A 4C91A 1T8BA 4JI4T 2KMFA 3J7Yq 3QNUA 4LMLA 3RH3A 2NWBA 4DV3T 2OLTA 5HEHA 3RPUA 2E5LT 1UX5A 5JR9B 4IDPA 4DV5T 2C5KT 4JI3T 2LOSA 4YFSA 4H9RC 4EGWA 2CA5A 4F8HA 2D9DA 2K24A 1HR0T 3DTOA 4DR2T 5JDHA 5EK3A 4COFA 4JBWF 2W0GA 4LF9T 2XY8B 3FZKB 3ONLC 2XSBA 3UU6A 3ZEFB 3GN5B 2ACZA 4X64T 5FMNA 4H9NC 4ILAA 3J9X1 4QX8B 3AE7A 1NEKA 3ZN1B 3ZJ1A 5L3GB 1XNRT 1T72A 3IEEA 3CQXC 4GIWA 1J5WA 4IL9A 1UX4A 1U4QA 3RC8A 4ERRA 3AXJA 4LF4T 5CA1E 3ZC0A 2BVLA 4ADZA 2QGSA 1OWAA 5HWXA 2JMHA 1QLBA 1YKHB 5LB7B 3SFDA 4H9SE 5LBQB 5JDNA 4UR9A 3PUQA 3AAAB 1ZOYA 3NRYA 2Y6XA 3C50A 2XAJB 2BKNA 3UQ7A 4H9QC 3EI0A 2YK0A 4H63H 4PW8A 2WB5A 2WQYA 4DV4T 4DR6T 2QYWA 5LYJE 4DV1T 4HFEA 1W0AA 5AQMB 1VOMA 2LM2A 3N9MA 4PJLA 1FMWA 4IHJE 5FNVE 2FBWA 2X66A 3IBPA 2XQ5A 5HWYA 1KNZA 4MALA 1N33T 2ODUA 3RIAA 4Q25A 2FJBA 3DP7A 4OK0A 4NUVA 3K3OA 4GK5E 2X9WA 2WY2A 4HFDA 4JI6T 2WMOA 5HXSA 3RYIE 3FZLB 3ZMZB 5HXEA 1MMDA 3A7MA 3KINB 2M67A 2ZLYA 4O4LE 4G63A 1US7B 3LK42 4FJOA 3HA4A 1ZV4X 2UUBT 3C4ZA 4X66T 4DBQA 2W4XA 4YJ3E 4B3TT 2MTQA 4TWDA 5HAXA 3EABA 3HI2A 3U3IA 4E7SA 2JQKA 4UXNB 3GMIA 2UUAT 4KUMB 4IGUA 5HEJA 2BDEA 4IIJE 5LNKA 2XM1A 5ABFB 1IJ6A 2V1DB 4AIUA 3MJXA 1B7TA 2YKSA 2FJDA 1LKXA 1N32T 5DQVA 1CUNA 4IDQA 2MPKA 4F6RC 2VK9A 1YW0A 4HFVA 1XMQT 4IE0A 4O8SA 3TKLB 2KXPB 1W0BA 1CHUA 3EUHA 1H7CA 2A2FX 2VWAA 4EEDA 3O4XE 3EDVA 4EAHA 2XUEA 5HXRA 5L3FB 2JQ9A 3B57A 2Z6EA 3PUSA 5ABGA 2WU5A 3CX6B 2H7VC 3PJAJ 4NPPA 5AQIB 3K8PC 4DV7T 2XZEA 4HEAA 5KMGP 2VL8A 4TWHA 2VQET 2E5VA 2W67A 4LF7T 3CVRA 2X0YA 1MIWA 5JREA 1HCIA 4YTMA 4TV8E 4U7YA 5FXVA 5H6QB 4NXMT 2VKHA 2JIWA 4ILUA 2KWIB 5HXCA 4DMVA 1MMGA 1M7KA 3GA8A 4UF0B 3M65A 4MFRA 3Q5WA 3AEDA 4JI0T 2G0UA 2YDQA 4QXCB 4DUZT 2K9AA 4HWIB 2NP9A 1BR0A 1LVKA 4DO0A 2JQQA 4CN1A 4MLKA 3FBLA 4ZI2D 3P4WA 3QB5A 1OEDA 2UXXB 2E9XA 4MBQA 1NENA 1G8XA 1G73A 4AKRB 4IDNA 2MAWA 2K48A 4LMKA 3N2OA 3RX6A 5KDMC 4QH5A 5F3JA 4PJNA 5LGNB 2YU2A 4B6XA 4IT4A 1WLXA 3D0TA 3AA0B 5DJQC 2KZ7B 4AQFA 4CI2B 4KHPT 4I0UA 3R6NA 4O4HE 3AEAA 3CMLA 5JRCA 4YTPA 3O1HA 1HX8A 3ABVA 4ZZBA 3NZPA 2WDQA 2LSYA 4OYKA 1J5ET 3RF1A 2D5UA 2YINA 4YJ2E 3NVOA 2Q9QA 2BS2A 2ZM6T 2XQ9A 5IUXA 2ZM2A 3N2GE 2BZBA 3RQUA 2V6YA 2LE8A 5C3JA 2R6GF 3PUXF 2NW9A 1N36T 5CGMA 3FXDB 4HFCA 2BG9C 5FXXA 2EHOC 5J1GA 2CWYA 4HWCA 4H63V 2WSSV 3SS1A 4ZHQE 2MYSA 4P1NA 3F31A 3LFMA 3N2KE 2P9BA 3FB2A 5LMUT 2HN1A 2IUBA 4L9IA 3P4QA 5L2LA 3PUGA 4UVAB 4C90A 1MIYA 3QUJA 2N1GA 1W09A 3AEBA 5H6RB 2W62A 1GQEA 4AISA 3T1HT 5JDMA 3JAEA 1XMOT 3VHLA 3PUYF 4DVDA 3ZT5A 3VR9A 1D1AA 2DNXA 2VASA 4QH4A 3PU8A 3AE8A 4EEBA 3RIUC 5JH7E 2IIUA 5LHGB 2ZMAA 4AQGA 3PV0F 1YD8G 5L4HA 3PDYA 5C2TA 3LK3B 3C64A 1IAPA 4YSZA 2XQ4A 3FZHB 3B5MA 2YN6A 4DV6T 3RKOA 2C5JA 5AQQB 4K0UA 2WWVA 3ZSTA 2CEAA 5ABEA 1HFAA 2XM2A 2L9QA 3VR8A 4QH1A 2BS4A 3VKGA 2RP4A 3T1YT 2ACXA 5JR9A 5LGUB 1XDPA 2PJQA 2KINB 2HPLA 2CE7A 4LFCT 3PTRB 2XPKA 3K3QC 5L3BB 4QXBB 3RC3A 4AI6A 4LF6T 2FUPA 5BR8T 3NRXA 2J47A 4U31A 4Z8XA 3GN5A 5EZYE 3RHWA 3H37A 4X1YE 2NW8A 2CBJA 3UFGA 4CI3B 4I55E 4IDOA 4ZI2C 2OA5A 3AA7B 3LG7A 5CA0E 4CXWA 3RI5A 3I9YA 3AA6B 4QX7B 5IWAT 2NTYA 4O4IE 2E2AA 4IREA 2MBGA 1IBMT 2B1EA 1ZHCA 2UXCT 3PE0A 4LMJA 2A3DA 2HPJA 3F2EA 2UU9T 2XQYA 2JRKA 4TWFA 3AE5A 3CPZA 3N9NA 4DR5T 3B13A 4NXNT 2BS3A 2RPAA 2YDRA 2ZM8A 2CMRA 2JJ9A 2DL1A 1JNZA 4A98A 4DR1T 3H3AA 1NWMX 3AXJB 4EYUA 3AVRA 4X1IE 2I6HA 3Q9DA 3I1AA 5FP3A 2Y48B 1YKEB 4NUUA 3N9OA 5IYZE 4YHJA 5AQVB 3AECA 3C98B 4JYAT 4JI7T 1FIOA 2D0TA 3OJAA 5LXTE 5JDGA 2EHOD 5LJMA 2C0SA 1UCUA 2LM9A 2LSKA 4AKIA 4HWHA 5AQGB 2IW5B 1X9BA 1XDOA 3A8YC 2N2NA 5ABFA 3ZC1A 1D0XA 3MXZA 2DCFA 3ZMVB 3L09A 3BQKA 5C8YE 5AQTB 3H3MA 3ZPOA 2CXFA 2V26A 1EZ3A 1I94T 1HX1B 1D1BA 3TLSA 5JVDE 2VB6A 3LBXB 4ILBA 5FVLA 4DBRA 5HEGA 4HFIA 4ZI3D 1KK7A 4I50E 3AAEB 3E22E 4IE5A 3MA9A 5FL0A 2I59A 2X9XA 3UUNA 4X1KE 2IDOB 1Y01A 2X0LB 4GYSA 4PFOA 3QB5K 2NW7A 3DJBA 2V7IA 1WFDA 5ABHA 5AFUL 1IBKT 4PNIA 4HGAA 4QWNB 3RRCA 3P4PA 1S94A 5JTGA 3AE3A 4WBOA 2DI4A 1U5PA 3PUZF 1IZNB 3ZMSB 5LHHB 3ONJA 1S35A 2V7MA 2HN2A 3NWIA 3CIRA 2WDRA 1HNWT 5A1LA 4PAGA 2VQFT 5J2TE 2VURA 2WCAA 4KX6A 3RYHE 2A72A 5FVKA 3GWHA 3F57A 4GOUA 4PJJA 3ANWA 5DQWA 4A97A 4UF0A 4JLEA 5AQKB 3UQ4A 4ZZCA 4HTEA 3QK6A 3L3PA 3T8OA 3HKEE 3PJAA 3EVYA 3BK9A 2IMLA 4JEUB 4GKKT 5FKYA 2FJAA 2YDSA 3PURA 3WAKA 1J1JA 2D2SA 1YQ3A 1OEDC 4YY3T 2E9XC 2BG9E 1MMNA 4FI5A 2KWHA 4DUYT 3A5XA 1Z8UA 4IE4A 3NBXX 4EYYR 3OBVE 4I4TE
chains in the Genus database with same CATH topology
4JEHB 3ZN1B 4DVDA 3WI3A 3C4XA 3ZJ1A 4BJNA 3KBTA 5L3GB 3UUMA 3P7IA 4OHFA 2VKDA 4X20E 3IEEA 2WMNA 4KP3C 4M1PA 3CQXC 4GIWA 1D1AA 2YEVC 5LA6E 2DNXA 2VASA 2WWUA 2UXNB 1UX4A 3SWHA 1U4QA 3PU8A 5LBMA 4AQFC 2C5IT 3RC8A 2WM9A 2IAKA 2D0UA 5JH7E 3AB3B 4ERRA 5LHGB 4E7ZA 3ESLA 2ZMAA 2X67A 5CA1E 5J2UE 3BQIA 5LJNA 3ZC0A 2BVLA 4AQGA 3FXEB 4ANJA 1YD8G 2X9HA 4ADZA 2K5BB 2QGSA 3PDYA 4DNDA 3LK3B 1OWAA 5HWXA 2JMHA 3C64A 4PK5A 1YKHB 4CI1B 4H9SE 2H3RA 5LBQB 3OKQA 1IAPA 4CZZB 3AA1B 1WYBA 4U72A 1AJ3A 2E9XB 5JDNA 3PUQA 3ZJ2A 1MMAA 2Q9QC 3AAAB 3NRYA 2Y6XA 3K3NA 1WRDA 3RKOA 3C50A 2C5JA 2XAJB 4EOZB 1D0YA 3JC6D 4H9QC 4K0UA 3AVSA 5EK2A 2YK0A 2CEAA 4L5GA 1HFAA 4H63H 4PW8A 2E8IA 2L9QA 3HKCE 1E1HB 4P09A 3VKGA 5LYJE 1LRZA 5CB4E 2RP4A 1VOMA 2CWOA 3N9PA 4IDZA 3BQLA 3CKDA 3N9MA 2ACXA 4PJLA 5JR9A 2CCQA 4XBFB 5LGUB 1FMWA 4N78D 2PJQA 4ZS3A 2KINB 2HPLA 3KV4A 4PFPA 4IHJE 3RYFE 2CE7A 3KVBA 3PTRB 4WNKA 3ZYKA 5FNVE 4L0RA 3K3QC 2X66A 5L3BB 3IBPA 5HWYA 2CM0A 1X79A 4QXBB 1KNZA 4MALA 3RC3A 4AI6A 5JDFA 1HG2A 2ODUA 3O1IA 4CXYA 4ZOLE 4AKHA 3FHNA 3AAIA 3WAJA 3DP7A 4OK0A 5LOVE 3NRXA 4NUVA 5FYMA 2WAUA 4Z8XA 3GN5A 3K3OA 2X9WA 4GK5E 2WMOA 5HXSA 2Q9QB 1MNDA 2SPCA 5EZYE 3H37A 3VKHA 4BAYB 5HXHA 2KLQA 3RYIE 4X1YE 3ZMZB 3S4UA 5HXEA 1MMDA 2CXLA 3ANWB 2M67A 2ZLYA 3KINB 4O4LE 1OXZA 3HKBE 4G63A 1US7B 3LK42 2XAGB 2NW8A 4FJOA 2DHRA 3HA4A 1ZV4X 4G2AA 5GONE 3I9WA 3C4ZA 4ISTA 4CI3B 2IC6A 3R84B 4DBQA 4I55E 4YJ3E 2MTQA 3P8CD 1O3XA 4O4JE 5HAXA 5FY0A 4WBNE 2HH7A 3HI2A 4ZI2C 3U3IA 3VU7H 2OA5A 5KX5E 4E7SA 4UXNB 3GMIA 4YLHA 4KUMB 3AA7B 4IGUA 3LG7A 4DMWA 5JDQA 5L3CB 5CA0E 2BDEA 4IIJE 4ZI3C 4CXWA 3KBUA 5LCYA 3UULA 5LNKA 3FBZA 1FEWA 3UFEA 3I9YA 3ETUA 3AA6B 1IJ6A 4QX7B 3HKDE 2V1DB 3MJXA 5EK4A 2IC9A 2NTYA 1B7TA 4O4IE 2LHNA 2EHOB 3OYZA 1LKXA 2V7JA 2YU1A 2BVMA 2MBGA 2W63A 2J1DG 2B1EA 1ZHCA 4O2BE 5DQVA 1CUNA 1Y64B 4EB6E 5JQGE 3MACA 2GK9A 3PE0A 2A3DA 2HPJA 3N9LA 3F2EA 3MK7C 2XQYA 1T98A 4WW0A 2X51A 4OFZA 2ODVA 4F6RC 2JRKA 2VK9A 3ZMUB 3SOLA 1HS7A 1YW0A 3CPZA 3N9NA 3B13A 3C4WA 4HFVA 4BJMA 3I0QA 4TUYE 4IE0A 4O8SA 3TKLB 2KXPB 2ZM8A 2VKJA 2CMRA 4UVBB 2XAHB 3EUHA 1H7CA 3RRWA 3JC6C 2A2FX 2JPFA 2JJ9A 2VWAA 4HKAA 3O4XE 3EDVA 4EAHA 3N9QA 4TX5A 1WYCA 4AKGA 2WBLA 5HYAA 2W61A 5BMVE 2XUEA 4QKNA 2Y8DA 4UELA 3UUXB 1BR4A 4EZ4A 4ZS2A 3H3AA 5HXRA 1NWMX 5L3FB 5LHIB 3B57A 2Z6EA 3PUSA 3O1JA 2DLRA 4EYUA 5LG4A 3AVRA 1ZKEA 3CX6B 2H7VC 4X1IE 4IE7A 3K8PC 4OYJA 1MNEA 3Q9DA 3I1AA 5FP3A 2Y48B 4HEAA 2XAQB 5KMGP 1YKEB 2VL8A 4NUUA 2LSIA 4TN7B 4O2AE 3N9OA 5FY1A 4TV9E 5JRCB 1BR2A 2QA7A 4H9OC 2XTLA 5IYZE 3CVRA 4UV8B 1VRBA 4YHJA 1MIWA 3UTKA 3C98B 3RYCE 3O9XA 5JREA 4EXTA 3OYXA 2LOPA 1FIOA 2D0TA 1HCIA 3OJAA 5LXTE 3ZN0B 5JDGA 4TV8E 2EHOD 2V7KA 3ZYLA 5LJMA 4UVCB 2LHRA 5FXVA 5H6QB 2C0SA 1UCUA 2VKHA 5LP6E 3IHRA 2LM9A 4ILUA 2LSKA 5TAOA 4AKIA 2KWIB 2IW5B 5HXCA 3KV9A 4DMVA 1MMGA 3CX7B 2N2NA 3GA8A 3CQCB 4UF0B 2PBIA 3M65A 3ZC1A 4MFRA 1D0XA 3MKDA 3C51A 2DCFA 3MXZA 3Q5WA 4U74A 3LK2B 1V9DA 2EHOA 1SHZC 3ZMVB 3L09A 3BQKA 3KV5A 5M4YA 5C8YE 3CX8B 3V5SA 3E0ZA 2E9XD 1D1CA 2G0UA 4EIWA 2X9YA 4CXXA 2XAFB 4QXCB 3Q2MA 2K9AA 3ZPOA 3PUAA 1LVFA 3E08A 2RA1A 2CLYC 2CXFA 2NP9A 1LVKA 1BR0A 2V26A 5ADXL 4DO0A 1EZ3A 1MIVA 1NAFA 1HF8A 2JQQA 2LJLA 3CWZB 4MLKA 1D1BA 3FBLA 4QHOA 5JVDE 4ZI2D 4PK4A 3IF8B 5L3EB 2VB6A 4V1Av 2H7OA 4PJMA 3LBXB 4UEMA 2UXXB 2PFVA 4DBRA 2E9XA 4MBQA 4IE6A 5F8PA 1G8XA 4PK6A 4ZI3D 1HTJF 1KK7A 4P0BA 1G73A 4AKRB 4I50E 1Z0PA 2K48A 4KMCA 1HG5A 4I43B 3EDUA 3AAEB 3HR0A 4J2CA 3ZLIA 3N2OA 3ONXA 5LGTB 1ZEEA 2NOXA 3E22E 1FMVA 4IE5A 1IJ5A 3RX6A 3MA9A 2I59A 2X9XA 3UUNA 5KDMC 4X1KE 1D0ZA 5F3JA 2X0LB 4PJNA 3PU3A 4GYSA 2ES0A 3MZKB 4QXHB 5LGNB 3I0OA 3KV6A 4PFOA 2NW7A 2YU2A 5DABA 3HL6A 4B6XA 3DJBA 4ZI7E 5L3DB 2V7IA 5AFUL 4H9PC 4P0AA 1WLXA 3D0TA 3AA0B 5DJQC 4PNIA 5ETWA 4AXPA 4HGAA 4QWNB 3RRCA 2KZ7B 3SRZA 1S94A 4AQFA 5JR9C 4CI2B 3LJCA 4ISSA 2KNDA 2PG8A 5E0OA 3R6NA 3Q5XA 2Q9QD 4WBOA 2DI4A 2DWGA 4BA9A 2LSGA 4O4HE 1U5PA 2N9DA 2NTXA 3CMLA 5JRCA 3O1HA 4XZCA 2ZM0A 1IZNB 3UT5E 2CLYB 5IHYA 1HX8A 3ZCJA 3ZMSB 3ZMTB 5LHHB 2XASB 1S35A 3NZPA 2V7MA 1WR6A 4CQIA 2L8KA 3U78A 4UIGA 2LSYA 4OYKA 3ETVA 4A56A 2D5UA 2LSJA 2MOZA 2YINA 4KBMB 4YJ2E 5A1LA 1QUUA 4PAGA 4ASKA 4TZ4C 2W00A 2L3LA 5FY7A 3V5UA 1QSDA 2Q9QA 5FXZA 4HE8A 2CXDA 3KDSE 5J2TE 4AKLA 2ZM2A 3N2GE 2BZBA 3W15B 3RYHE 2A72A 3GWHA 4XAXB 3F57A 4GOUA 4PJJA 2LE8A 3ANWA 5DQWA 4JUYA 4UF0A 4C91A 3CQGB 4MHCA 1BR1A 4JLEA 4UV9B 2LT3A 2X68A 2NW9A 3FXDB 5JDLA 2XHEB 2KMFA 4HTEA 3J7Yq 3QK6A 5FXXA 2EHOC 3RH3A 2NWBA 3L3PA 3ZYMA 3T8OA 3HKEE 5J1GA 3EVYA 3BK9A 1SA0E 2CWYA 4H63V 3QC9A 3RPUA 4JEUB 2KT9A 2WSSV 3SS1A 3PURA 4ZHQE 3NZQA 2MYSA 1UX5A 3F31A 5FXWA 3WAKA 3KFWX 5JR9B 3LFMA 2C5KT 2V7LA 3N2KE 2P9BA 3ZCIA 2D2SA 2LOSA 3FB2A 4H9RC 4YFSA 2CA5A 2K24A 3LBXA 4L9IA 5L2LA 3DTOA 3PUGA 4UVAB 4C90A 2DWKA 1MIYA 3KVAA 2LEHA 2E9XC 2VKOA 1MMNA 5JDHA 4FI5A 5EK3A 2KWHA 4EZHA 3QUJA 4GK0E 2W0GA 3N5LA 2N1GA 3A5XA 5H6RB 2JMKA 3ZEFB 2W62A 4GYRA 4IE4A 3GN5B 3NBXX 5FMNA 4H9NC 4EYYR 3OBVE 3J9X1 4HN9A 4QX8B 5JDMA 3VHLA 4I4TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSY A;  2N1G A;  4BA9 A;  2LSG A;  4GK0 E;  2LSJ A;  4GK5 E;  3VU7 H;  2LSI A;  2LSK A;  4FJO A;  4EXT A; 
#chains in the Genus database with same CATH topology
 4DID B;  3WI3 A;  3C4X A;  3KBT A;  4DR4 T;  3RLF F;  3P7I A;  4X20 E;  2WMN A;  4KP3 C;  4M1P A;  2UXN B;  5LBM A;  4AQF C;  4HFB A;  3OTO T;  2D0U A;  3AB3 B;  4E7Z A;  2X67 A;  3BQI A;  5CFB A;  3FXE B;  4ANJ A;  2X9H A;  4YSY A;  3AE4 A;  1UUR A;  4PK5 A;  2H3R A;  1WYB A;  4U72 A;  1AJ3 A;  2E9X B;  1MMA A;  2Q9Q C;  2YOE A;  3K3N A;  1FJG T;  4EOZ B;  2HHH T;  3AVS A;  5EK2 A;  1UK5 A;  2A9U A;  2CRB A;  4P09 A;  5CB4 E;  5F5W A;  2CWO A;  2LLY A;  4IDZ A;  1E2A A;  1UGO A;  3EAM A;  4DV2 T;  2WZI A;  4U3C A;  3KV4 A;  4WNK A;  3KVB A;  4DR7 T;  2CM0 A;  5JDF A;  1KFY A;  4AQY T;  3TLU A;  1HG2 A;  4ZOL E;  4AKH A;  4X62 T;  3X1D A;  5LOV E;  2UUC T;  2WAU A;  4U2Y A;  1W9R A;  3ZT6 A;  2Q9Q B;  2SPC A;  1WCR A;  2KSR A;  4YHH T;  5HXH A;  3PUV F;  3S4U A;  1OXZ A;  3HKB E;  5GON E;  2DHR A;  3IA3 A;  3L8R A;  4IST A;  1XNQ T;  1E7P A;  1O3X A;  4O4J E;  2HH7 A;  5KX5 E;  4YLH A;  5JDQ A;  4JI8 T;  5L3C B;  5AQO B;  4ZI3 C;  4X5T A;  5LCY A;  3FBZ A;  1FEW A;  3UFE A;  3ETU A;  3HKD E;  2BG9 B;  5LMN T;  2LHN A;  2EHO B;  2BKO A;  2V7J A;  2BVM A;  2V8S V;  2J1D G;  2AE9 A;  4O2B E;  1Y64 B;  4EB6 E;  5JQG E;  3EHZ A;  3MK7 C;  2X51 A;  4JI5 T;  1KNP A;  4LFA T;  2BKP A;  5HCM A;  5AQF B;  5AQP B;  3JCF A;  5HEO A;  1HNZ T;  2V5D A;  2VVS A;  3LDQ B;  2VKJ A;  3ZKR A;  3JC6 C;  3N9Q A;  4TX5 A;  1WYC A;  3G06 A;  2WBL A;  1WR0 A;  4AKG A;  3L39 A;  4UEL A;  2IHR 1;  3UUX B;  4EZ4 A;  4ZS2 A;  5LHI B;  5AQH B;  3O1J A;  2DLR A;  5LG4 A;  2XQ3 A;  1ZKE A;  4IE7 A;  4OYJ A;  2WDV A;  4CN6 A;  2QRX A;  2LSI A;  2H89 A;  4TN7 B;  4O2A E;  3K1S A;  5AQN B;  4TV9 E;  1BR2 A;  2QA7 A;  3JAD A;  4UV8 B;  2I0M A;  3AEE A;  3RYC E;  4EXT A;  3TLV A;  2LOP A;  2FJE A;  4UVC B;  4YT0 A;  5TAO A;  2NR4 A;  2WP9 A;  1N34 T;  5KXJ A;  2WU2 A;  3CX7 B;  3CQC B;  2V6X A;  3UU8 A;  4JV5 T;  2PBI A;  4CN4 A;  4U74 A;  3LK2 B;  1V9D A;  3RIF A;  3AE2 A;  3CX8 B;  3LSV A;  2E9X D;  1D1C A;  2X9Y A;  3UU4 A;  4B3M T;  3PUW F;  2M6B A;  2W66 A;  2RA1 A;  2CLY C;  3VRB A;  5ADX L;  1KEY A;  3Q5D A;  2W2U A;  4QHO A;  5AQJ B;  4V1A v;  2H7O A;  2B76 A;  4UEM A;  2PFV A;  4IE6 A;  5F8P A;  5AQR B;  4PK6 A;  3UU3 A;  1HTJ F;  3CK6 A;  4KMC A;  4J2C A;  3ZLI A;  5LGT B;  2NOX A;  1FMV A;  3JAF A;  4WZX A;  1I6Z A;  2ES0 A;  3MZK B;  4QXH B;  2WS3 A;  3KV6 A;  5DAB A;  4ZI7 E;  3QOF A;  1DU2 A;  3LJC A;  4ISS A;  2PG8 A;  2Q9Q D;  5LG3 A;  2DWG A;  2LSG A;  2N9D A;  4B3S T;  2ZM0 A;  3UT5 E;  2CLY B;  1KF6 A;  5IHY A;  3ZCJ A;  4DR3 T;  4GKJ T;  4YXD A;  1WR6 A;  4IL4 A;  3U78 A;  5L4E A;  3ETV A;  3VRA A;  4U33 A;  3ZSS A;  2CHO A;  4KBM B;  2J62 A;  4ASK A;  4TZ4 C;  3V5U A;  1QSD A;  1ZP0 A;  2CHN A;  3P50 A;  4AKL A;  4XAX B;  2CPT A;  3CQG B;  4MHC A;  1BR1 A;  4UV9 B;  2LRL A;  2LT3 A;  2X68 A;  5JDL A;  2XHE B;  1XZY A;  3ZYM A;  1SA0 E;  2F4V T;  3P4R A;  3QC9 A;  4Z90 A;  2KT9 A;  4TNW A;  3NZQ A;  5FXW A;  3KFW X;  2X0H A;  1T7S A;  2V7L A;  3ZCI A;  2CBI A;  3LBX A;  3RQW A;  2XJ7 A;  2DWK A;  3KVA A;  2LEH A;  2VKO A;  4EZH A;  4WYV A;  4GK0 E;  3N5L A;  3OVU A;  2JMK A;  3FZF B;  4GYR A;  5HCJ A;  2V5C A;  4HN9 A;  2VVN A;  4JEH B;  2J4G A;  3AE1 A;  1OED E;  4HFH A;  4BJN A;  2XQA A;  3UUM A;  4OHF A;  2LKH A;  2VKD A;  1L0V A;  2YEV C;  5LA6 E;  5AQU B;  2WWU A;  2LKG A;  3SWH A;  2C5I T;  3NKZ A;  2WM9 A;  2IAK A;  3ESL A;  5J2U E;  5LJN A;  4EV6 A;  3RKG A;  2QVA A;  2K5B B;  4DND A;  4CI1 B;  3OKQ A;  4CZZ B;  3AA1 B;  1UUS A;  5AQL B;  3ZJ2 A;  4YSX A;  2XSA A;  1WRD A;  1D0Y A;  3JC6 D;  3OPC A;  5J0Z A;  4L5G A;  2PTF A;  2E8I A;  1VCS A;  3HKC E;  1E1H B;  1LRZ A;  3RGL A;  2UXB T;  3N9P A;  3BQL A;  3CKD A;  2WZH A;  2CCQ A;  4XBF B;  4ZXL A;  4N78 D;  3RYF E;  4ZS3 A;  4PFP A;  2BBH A;  3ZYK A;  2UXD T;  4L0R A;  1X79 A;  4KI0 F;  2XQ8 A;  4CXY A;  3O1I A;  4JI1 T;  3FHN A;  3AAI A;  3WAJ A;  4DV0 T;  3ZT7 A;  5FYM A;  4OX9 T;  3M3Z B;  1MND A;  3VKH A;  4BAY B;  2KLQ A;  1JNR A;  2VL0 A;  2CXL A;  3ANW B;  2XAG B;  4G2A A;  3I9W A;  2IC6 A;  3R84 B;  1R8I A;  2M6I A;  3P8C D;  3P4S A;  4X65 T;  5FY0 A;  4WBN E;  3VU7 H;  5FL1 A;  4DMW A;  3KBU A;  2K3W A;  3UUL A;  5L47 A;  5EK4 A;  2IC9 A;  3OYZ A;  2YU1 A;  2W63 A;  4HWF A;  4Z91 A;  2BBJ A;  3MAC A;  2GK9 A;  1YQ4 A;  1SUM B;  3N9L A;  4K0K T;  1T98 A;  4WW0 A;  4OFZ A;  2ODV A;  1HNX T;  3ZMU B;  3SOL A;  1HS7 A;  1OED B;  3C4W A;  4BJM A;  3I0Q A;  4TUY E;  3AE6 A;  4ILC A;  2XAH B;  4UVB B;  3RRW A;  2JPF A;  4HKA A;  2AXD S;  5HYA A;  2W61 A;  5BMV E;  1SE7 A;  4QKN A;  2Y8D A;  1BR4 A;  3AE9 A;  4HWD A;  1MNE A;  2XAQ B;  1IBL T;  3Q5E A;  5FY1 A;  2JQH A;  4LFB T;  5JRC B;  4H9O C;  4NIQ A;  2XTL A;  1VRB A;  3AEG A;  4U7I A;  3UTK A;  5AQS B;  3O9X A;  3OYX A;  3ZN0 B;  3ZYL A;  2V7K A;  4KHZ F;  1YXR A;  1VCT A;  2LHR A;  3UUB A;  5HEU A;  5LP6 E;  3IHR A;  2V6Y B;  3KV9 A;  3MKD A;  3C51 A;  4ZEY A;  2BG9 A;  2EHO A;  1SHZ C;  4LF8 T;  3KV5 A;  5M4Y A;  3V5S A;  3E0Z A;  2OV9 A;  4EIW A;  3SFE A;  4CXX A;  2XAF B;  3FZM B;  3Q2M A;  3PUA A;  1LVF A;  3E08 A;  2H88 A;  4JI2 T;  1MIV A;  1NAF A;  1HF8 A;  2LJL A;  3CWZ B;  1XWM A;  4PK4 A;  3IF8 B;  5L3E B;  4PJM A;  3AEF A;  4P0B A;  1Z0P A;  1HG5 A;  4I43 B;  3EDU A;  3HR0 A;  3ONX A;  1ZEE A;  1IJ5 A;  1D0Z A;  3PU3 A;  3TLT A;  3I0O A;  4LF5 T;  4YTN A;  3HL6 A;  5L3D B;  4H9P C;  4P0A A;  2XQ6 A;  5ETW A;  4AXP A;  3SRZ A;  5JR9 C;  3RIU A;  2KND A;  4B3R T;  5CJ5 A;  5E0O A;  4A5X A;  3Q5X A;  4BA9 A;  1KNR A;  2NTX A;  4TNV A;  4XZC A;  2XQ7 A;  3ZMT B;  2XAS B;  4CQI A;  1M62 A;  2L8K A;  4UIG A;  4A56 A;  2LSJ A;  2MOZ A;  1QUU A;  2W00 A;  2L3L A;  5FY7 A;  5FXZ A;  4HE8 A;  2CXD A;  3KDS E;  4U2Z A;  3TLW A;  3W15 B;  2LRK A;  4JUY A;  3UU5 A;  4C91 A;  1T8B A;  4JI4 T;  2KMF A;  3J7Y q;  3QNU A;  4LML A;  3RH3 A;  2NWB A;  4DV3 T;  2OLT A;  5HEH A;  3RPU A;  2E5L T;  1UX5 A;  5JR9 B;  4IDP A;  4DV5 T;  2C5K T;  4JI3 T;  2LOS A;  4YFS A;  4H9R C;  4EGW A;  2CA5 A;  4F8H A;  2D9D A;  2K24 A;  1HR0 T;  3DTO A;  4DR2 T;  5JDH A;  5EK3 A;  4COF A;  4JBW F;  2W0G A;  4LF9 T;  2XY8 B;  3FZK B;  3ONL C;  2XSB A;  3UU6 A;  3ZEF B;  3GN5 B;  2ACZ A;  4X64 T;  5FMN A;  4H9N C;  4ILA A;  3J9X 1;  4QX8 B;  3AE7 A;  1NEK A;  3ZN1 B;  3ZJ1 A;  5L3G B;  1XNR T;  1T72 A;  3IEE A;  3CQX C;  4GIW A;  1J5W A;  4IL9 A;  1UX4 A;  1U4Q A;  3RC8 A;  4ERR A;  3AXJ A;  4LF4 T;  5CA1 E;  3ZC0 A;  2BVL A;  4ADZ A;  2QGS A;  1OWA A;  5HWX A;  2JMH A;  1QLB A;  1YKH B;  5LB7 B;  3SFD A;  4H9S E;  5LBQ B;  5JDN A;  4UR9 A;  3PUQ A;  3AAA B;  1ZOY A;  3NRY A;  2Y6X A;  3C50 A;  2XAJ B;  2BKN A;  3UQ7 A;  4H9Q C;  3EI0 A;  2YK0 A;  4H63 H;  4PW8 A;  2WB5 A;  2WQY A;  4DV4 T;  4DR6 T;  2QYW A;  5LYJ E;  4DV1 T;  4HFE A;  1W0A A;  5AQM B;  1VOM A;  2LM2 A;  3N9M A;  4PJL A;  1FMW A;  4IHJ E;  5FNV E;  2FBW A;  2X66 A;  3IBP A;  2XQ5 A;  5HWY A;  1KNZ A;  4MAL A;  1N33 T;  2ODU A;  3RIA A;  4Q25 A;  2FJB A;  3DP7 A;  4OK0 A;  4NUV A;  3K3O A;  4GK5 E;  2X9W A;  2WY2 A;  4HFD A;  4JI6 T;  2WMO A;  5HXS A;  3RYI E;  3FZL B;  3ZMZ B;  5HXE A;  1MMD A;  3A7M A;  3KIN B;  2M67 A;  2ZLY A;  4O4L E;  4G63 A;  1US7 B;  3LK4 2;  4FJO A;  3HA4 A;  1ZV4 X;  2UUB T;  3C4Z A;  4X66 T;  4DBQ A;  2W4X A;  4YJ3 E;  4B3T T;  2MTQ A;  4TWD A;  5HAX A;  3EAB A;  3HI2 A;  3U3I A;  4E7S A;  2JQK A;  4UXN B;  3GMI A;  2UUA T;  4KUM B;  4IGU A;  5HEJ A;  2BDE A;  4IIJ E;  5LNK A;  2XM1 A;  5ABF B;  1IJ6 A;  2V1D B;  4AIU A;  3MJX A;  1B7T A;  2YKS A;  2FJD A;  1LKX A;  1N32 T;  5DQV A;  1CUN A;  4IDQ A;  2MPK A;  4F6R C;  2VK9 A;  1YW0 A;  4HFV A;  1XMQ T;  4IE0 A;  4O8S A;  3TKL B;  2KXP B;  1W0B A;  1CHU A;  3EUH A;  1H7C A;  2A2F X;  2VWA A;  4EED A;  3O4X E;  3EDV A;  4EAH A;  2XUE A;  5HXR A;  5L3F B;  2JQ9 A;  3B57 A;  2Z6E A;  3PUS A;  5ABG A;  2WU5 A;  3CX6 B;  2H7V C;  3PJA J;  4NPP A;  5AQI B;  3K8P C;  4DV7 T;  2XZE A;  4HEA A;  5KMG P;  2VL8 A;  4TWH A;  2VQE T;  2E5V A;  2W67 A;  4LF7 T;  3CVR A;  2X0Y A;  1MIW A;  5JRE A;  1HCI A;  4YTM A;  4TV8 E;  4U7Y A;  5FXV A;  5H6Q B;  4NXM T;  2VKH A;  2JIW A;  4ILU A;  2KWI B;  5HXC A;  4DMV A;  1MMG A;  1M7K A;  3GA8 A;  4UF0 B;  3M65 A;  4MFR A;  3Q5W A;  3AED A;  4JI0 T;  2G0U A;  2YDQ A;  4QXC B;  4DUZ T;  2K9A A;  4HWI B;  2NP9 A;  1BR0 A;  1LVK A;  4DO0 A;  2JQQ A;  4CN1 A;  4MLK A;  3FBL A;  4ZI2 D;  3P4W A;  3QB5 A;  1OED A;  2UXX B;  2E9X A;  4MBQ A;  1NEN A;  1G8X A;  1G73 A;  4AKR B;  4IDN A;  2MAW A;  2K48 A;  4LMK A;  3N2O A;  3RX6 A;  5KDM C;  4QH5 A;  5F3J A;  4PJN A;  5LGN B;  2YU2 A;  4B6X A;  4IT4 A;  1WLX A;  3D0T A;  3AA0 B;  5DJQ C;  2KZ7 B;  4AQF A;  4CI2 B;  4KHP T;  4I0U A;  3R6N A;  4O4H E;  3AEA A;  3CML A;  5JRC A;  4YTP A;  3O1H A;  1HX8 A;  3ABV A;  4ZZB A;  3NZP A;  2WDQ A;  2LSY A;  4OYK A;  1J5E T;  3RF1 A;  2D5U A;  2YIN A;  4YJ2 E;  3NVO A;  2Q9Q A;  2BS2 A;  2ZM6 T;  2XQ9 A;  5IUX A;  2ZM2 A;  3N2G E;  2BZB A;  3RQU A;  2V6Y A;  2LE8 A;  5C3J A;  2R6G F;  3PUX F;  2NW9 A;  1N36 T;  5CGM A;  3FXD B;  4HFC A;  2BG9 C;  5FXX A;  2EHO C;  5J1G A;  2CWY A;  4HWC A;  4H63 V;  2WSS V;  3SS1 A;  4ZHQ E;  2MYS A;  4P1N A;  3F31 A;  3LFM A;  3N2K E;  2P9B A;  3FB2 A;  5LMU T;  2HN1 A;  2IUB A;  4L9I A;  3P4Q A;  5L2L A;  3PUG A;  4UVA B;  4C90 A;  1MIY A;  3QUJ A;  2N1G A;  1W09 A;  3AEB A;  5H6R B;  2W62 A;  1GQE A;  4AIS A;  3T1H T;  5JDM A;  3JAE A;  1XMO T;  3VHL A;  3PUY F;  4DVD A;  3ZT5 A;  3VR9 A;  1D1A A;  2DNX A;  2VAS A;  4QH4 A;  3PU8 A;  3AE8 A;  4EEB A;  3RIU C;  5JH7 E;  2IIU A;  5LHG B;  2ZMA A;  4AQG A;  3PV0 F;  1YD8 G;  5L4H A;  3PDY A;  5C2T A;  3LK3 B;  3C64 A;  1IAP A;  4YSZ A;  2XQ4 A;  3FZH B;  3B5M A;  2YN6 A;  4DV6 T;  3RKO A;  2C5J A;  5AQQ B;  4K0U A;  2WWV A;  3ZST A;  2CEA A;  5ABE A;  1HFA A;  2XM2 A;  2L9Q A;  3VR8 A;  4QH1 A;  2BS4 A;  3VKG A;  2RP4 A;  3T1Y T;  2ACX A;  5JR9 A;  5LGU B;  1XDP A;  2PJQ A;  2KIN B;  2HPL A;  2CE7 A;  4LFC T;  3PTR B;  2XPK A;  3K3Q C;  5L3B B;  4QXB B;  3RC3 A;  4AI6 A;  4LF6 T;  2FUP A;  5BR8 T;  3NRX A;  2J47 A;  4U31 A;  4Z8X A;  3GN5 A;  5EZY E;  3RHW A;  3H37 A;  4X1Y E;  2NW8 A;  2CBJ A;  3UFG A;  4CI3 B;  4I55 E;  4IDO A;  4ZI2 C;  2OA5 A;  3AA7 B;  3LG7 A;  5CA0 E;  4CXW A;  3RI5 A;  3I9Y A;  3AA6 B;  4QX7 B;  5IWA T;  2NTY A;  4O4I E;  2E2A A;  4IRE A;  2MBG A;  1IBM T;  2B1E A;  1ZHC A;  2UXC T;  3PE0 A;  4LMJ A;  2A3D A;  2HPJ A;  3F2E A;  2UU9 T;  2XQY A;  2JRK A;  4TWF A;  3AE5 A;  3CPZ A;  3N9N A;  4DR5 T;  3B13 A;  4NXN T;  2BS3 A;  2RPA A;  2YDR A;  2ZM8 A;  2CMR A;  2JJ9 A;  2DL1 A;  1JNZ A;  4A98 A;  4DR1 T;  3H3A A;  1NWM X;  3AXJ B;  4EYU A;  3AVR A;  4X1I E;  2I6H A;  3Q9D A;  3I1A A;  5FP3 A;  2Y48 B;  1YKE B;  4NUU A;  3N9O A;  5IYZ E;  4YHJ A;  5AQV B;  3AEC A;  3C98 B;  4JYA T;  4JI7 T;  1FIO A;  2D0T A;  3OJA A;  5LXT E;  5JDG A;  2EHO D;  5LJM A;  2C0S A;  1UCU A;  2LM9 A;  2LSK A;  4AKI A;  4HWH A;  5AQG B;  2IW5 B;  1X9B A;  1XDO A;  3A8Y C;  2N2N A;  5ABF A;  3ZC1 A;  1D0X A;  3MXZ A;  2DCF A;  3ZMV B;  3L09 A;  3BQK A;  5C8Y E;  5AQT B;  3H3M A;  3ZPO A;  2CXF A;  2V26 A;  1EZ3 A;  1I94 T;  1HX1 B;  1D1B A;  3TLS A;  5JVD E;  2VB6 A;  3LBX B;  4ILB A;  5FVL A;  4DBR A;  5HEG A;  4HFI A;  4ZI3 D;  1KK7 A;  4I50 E;  3AAE B;  3E22 E;  4IE5 A;  3MA9 A;  5FL0 A;  2I59 A;  2X9X A;  3UUN A;  4X1K E;  2IDO B;  1Y01 A;  2X0L B;  4GYS A;  4PFO A;  3QB5 K;  2NW7 A;  3DJB A;  2V7I A;  1WFD A;  5ABH A;  5AFU L;  1IBK T;  4PNI A;  4HGA A;  4QWN B;  3RRC A;  3P4P A;  1S94 A;  5JTG A;  3AE3 A;  4WBO A;  2DI4 A;  1U5P A;  3PUZ F;  1IZN B;  3ZMS B;  5LHH B;  3ONJ A;  1S35 A;  2V7M A;  2HN2 A;  3NWI A;  3CIR A;  2WDR A;  1HNW T;  5A1L A;  4PAG A;  2VQF T;  5J2T E;  2VUR A;  2WCA A;  4KX6 A;  3RYH E;  2A72 A;  5FVK A;  3GWH A;  3F57 A;  4GOU A;  4PJJ A;  3ANW A;  5DQW A;  4A97 A;  4UF0 A;  4JLE A;  5AQK B;  3UQ4 A;  4ZZC A;  4HTE A;  3QK6 A;  3L3P A;  3T8O A;  3HKE E;  3PJA A;  3EVY A;  3BK9 A;  2IML A;  4JEU B;  4GKK T;  5FKY A;  2FJA A;  2YDS A;  3PUR A;  3WAK A;  1J1J A;  2D2S A;  1YQ3 A;  1OED C;  4YY3 T;  2E9X C;  2BG9 E;  1MMN A;  4FI5 A;  2KWH A;  4DUY T;  3A5X A;  1Z8U A;  4IE4 A;  3NBX X;  4EYY R;  3OBV E;  4I4T E; 
#chains in the Genus database with same CATH homology
 4JEH B;  3ZN1 B;  4DVD A;  3WI3 A;  3C4X A;  3ZJ1 A;  4BJN A;  3KBT A;  5L3G B;  3UUM A;  3P7I A;  4OHF A;  2VKD A;  4X20 E;  3IEE A;  2WMN A;  4KP3 C;  4M1P A;  3CQX C;  4GIW A;  1D1A A;  2YEV C;  5LA6 E;  2DNX A;  2VAS A;  2WWU A;  2UXN B;  1UX4 A;  3SWH A;  1U4Q A;  3PU8 A;  5LBM A;  4AQF C;  2C5I T;  3RC8 A;  2WM9 A;  2IAK A;  2D0U A;  5JH7 E;  3AB3 B;  4ERR A;  5LHG B;  4E7Z A;  3ESL A;  2ZMA A;  2X67 A;  5CA1 E;  5J2U E;  3BQI A;  5LJN A;  3ZC0 A;  2BVL A;  4AQG A;  3FXE B;  4ANJ A;  1YD8 G;  2X9H A;  4ADZ A;  2K5B B;  2QGS A;  3PDY A;  4DND A;  3LK3 B;  1OWA A;  5HWX A;  2JMH A;  3C64 A;  4PK5 A;  1YKH B;  4CI1 B;  4H9S E;  2H3R A;  5LBQ B;  3OKQ A;  1IAP A;  4CZZ B;  3AA1 B;  1WYB A;  4U72 A;  1AJ3 A;  2E9X B;  5JDN A;  3PUQ A;  3ZJ2 A;  1MMA A;  2Q9Q C;  3AAA B;  3NRY A;  2Y6X A;  3K3N A;  1WRD A;  3RKO A;  3C50 A;  2C5J A;  2XAJ B;  4EOZ B;  1D0Y A;  3JC6 D;  4H9Q C;  4K0U A;  3AVS A;  5EK2 A;  2YK0 A;  2CEA A;  4L5G A;  1HFA A;  4H63 H;  4PW8 A;  2E8I A;  2L9Q A;  3HKC E;  1E1H B;  4P09 A;  3VKG A;  5LYJ E;  1LRZ A;  5CB4 E;  2RP4 A;  1VOM A;  2CWO A;  3N9P A;  4IDZ A;  3BQL A;  3CKD A;  3N9M A;  2ACX A;  4PJL A;  5JR9 A;  2CCQ A;  4XBF B;  5LGU B;  1FMW A;  4N78 D;  2PJQ A;  4ZS3 A;  2KIN B;  2HPL A;  3KV4 A;  4PFP A;  4IHJ E;  3RYF E;  2CE7 A;  3KVB A;  3PTR B;  4WNK A;  3ZYK A;  5FNV E;  4L0R A;  3K3Q C;  2X66 A;  5L3B B;  3IBP A;  5HWY A;  2CM0 A;  1X79 A;  4QXB B;  1KNZ A;  4MAL A;  3RC3 A;  4AI6 A;  5JDF A;  1HG2 A;  2ODU A;  3O1I A;  4CXY A;  4ZOL E;  4AKH A;  3FHN A;  3AAI A;  3WAJ A;  3DP7 A;  4OK0 A;  5LOV E;  3NRX A;  4NUV A;  5FYM A;  2WAU A;  4Z8X A;  3GN5 A;  3K3O A;  2X9W A;  4GK5 E;  2WMO A;  5HXS A;  2Q9Q B;  1MND A;  2SPC A;  5EZY E;  3H37 A;  3VKH A;  4BAY B;  5HXH A;  2KLQ A;  3RYI E;  4X1Y E;  3ZMZ B;  3S4U A;  5HXE A;  1MMD A;  2CXL A;  3ANW B;  2M67 A;  2ZLY A;  3KIN B;  4O4L E;  1OXZ A;  3HKB E;  4G63 A;  1US7 B;  3LK4 2;  2XAG B;  2NW8 A;  4FJO A;  2DHR A;  3HA4 A;  1ZV4 X;  4G2A A;  5GON E;  3I9W A;  3C4Z A;  4IST A;  4CI3 B;  2IC6 A;  3R84 B;  4DBQ A;  4I55 E;  4YJ3 E;  2MTQ A;  3P8C D;  1O3X A;  4O4J E;  5HAX A;  5FY0 A;  4WBN E;  2HH7 A;  3HI2 A;  4ZI2 C;  3U3I A;  3VU7 H;  2OA5 A;  5KX5 E;  4E7S A;  4UXN B;  3GMI A;  4YLH A;  4KUM B;  3AA7 B;  4IGU A;  3LG7 A;  4DMW A;  5JDQ A;  5L3C B;  5CA0 E;  2BDE A;  4IIJ E;  4ZI3 C;  4CXW A;  3KBU A;  5LCY A;  3UUL A;  5LNK A;  3FBZ A;  1FEW A;  3UFE A;  3I9Y A;  3ETU A;  3AA6 B;  1IJ6 A;  4QX7 B;  3HKD E;  2V1D B;  3MJX A;  5EK4 A;  2IC9 A;  2NTY A;  1B7T A;  4O4I E;  2LHN A;  2EHO B;  3OYZ A;  1LKX A;  2V7J A;  2YU1 A;  2BVM A;  2MBG A;  2W63 A;  2J1D G;  2B1E A;  1ZHC A;  4O2B E;  5DQV A;  1CUN A;  1Y64 B;  4EB6 E;  5JQG E;  3MAC A;  2GK9 A;  3PE0 A;  2A3D A;  2HPJ A;  3N9L A;  3F2E A;  3MK7 C;  2XQY A;  1T98 A;  4WW0 A;  2X51 A;  4OFZ A;  2ODV A;  4F6R C;  2JRK A;  2VK9 A;  3ZMU B;  3SOL A;  1HS7 A;  1YW0 A;  3CPZ A;  3N9N A;  3B13 A;  3C4W A;  4HFV A;  4BJM A;  3I0Q A;  4TUY E;  4IE0 A;  4O8S A;  3TKL B;  2KXP B;  2ZM8 A;  2VKJ A;  2CMR A;  4UVB B;  2XAH B;  3EUH A;  1H7C A;  3RRW A;  3JC6 C;  2A2F X;  2JPF A;  2JJ9 A;  2VWA A;  4HKA A;  3O4X E;  3EDV A;  4EAH A;  3N9Q A;  4TX5 A;  1WYC A;  4AKG A;  2WBL A;  5HYA A;  2W61 A;  5BMV E;  2XUE A;  4QKN A;  2Y8D A;  4UEL A;  3UUX B;  1BR4 A;  4EZ4 A;  4ZS2 A;  3H3A A;  5HXR A;  1NWM X;  5L3F B;  5LHI B;  3B57 A;  2Z6E A;  3PUS A;  3O1J A;  2DLR A;  4EYU A;  5LG4 A;  3AVR A;  1ZKE A;  3CX6 B;  2H7V C;  4X1I E;  4IE7 A;  3K8P C;  4OYJ A;  1MNE A;  3Q9D A;  3I1A A;  5FP3 A;  2Y48 B;  4HEA A;  2XAQ B;  5KMG P;  1YKE B;  2VL8 A;  4NUU A;  2LSI A;  4TN7 B;  4O2A E;  3N9O A;  5FY1 A;  4TV9 E;  5JRC B;  1BR2 A;  2QA7 A;  4H9O C;  2XTL A;  5IYZ E;  3CVR A;  4UV8 B;  1VRB A;  4YHJ A;  1MIW A;  3UTK A;  3C98 B;  3RYC E;  3O9X A;  5JRE A;  4EXT A;  3OYX A;  2LOP A;  1FIO A;  2D0T A;  1HCI A;  3OJA A;  5LXT E;  3ZN0 B;  5JDG A;  4TV8 E;  2EHO D;  2V7K A;  3ZYL A;  5LJM A;  4UVC B;  2LHR A;  5FXV A;  5H6Q B;  2C0S A;  1UCU A;  2VKH A;  5LP6 E;  3IHR A;  2LM9 A;  4ILU A;  2LSK A;  5TAO A;  4AKI A;  2KWI B;  2IW5 B;  5HXC A;  3KV9 A;  4DMV A;  1MMG A;  3CX7 B;  2N2N A;  3GA8 A;  3CQC B;  4UF0 B;  2PBI A;  3M65 A;  3ZC1 A;  4MFR A;  1D0X A;  3MKD A;  3C51 A;  2DCF A;  3MXZ A;  3Q5W A;  4U74 A;  3LK2 B;  1V9D A;  2EHO A;  1SHZ C;  3ZMV B;  3L09 A;  3BQK A;  3KV5 A;  5M4Y A;  5C8Y E;  3CX8 B;  3V5S A;  3E0Z A;  2E9X D;  1D1C A;  2G0U A;  4EIW A;  2X9Y A;  4CXX A;  2XAF B;  4QXC B;  3Q2M A;  2K9A A;  3ZPO A;  3PUA A;  1LVF A;  3E08 A;  2RA1 A;  2CLY C;  2CXF A;  2NP9 A;  1LVK A;  1BR0 A;  2V26 A;  5ADX L;  4DO0 A;  1EZ3 A;  1MIV A;  1NAF A;  1HF8 A;  2JQQ A;  2LJL A;  3CWZ B;  4MLK A;  1D1B A;  3FBL A;  4QHO A;  5JVD E;  4ZI2 D;  4PK4 A;  3IF8 B;  5L3E B;  2VB6 A;  4V1A v;  2H7O A;  4PJM A;  3LBX B;  4UEM A;  2UXX B;  2PFV A;  4DBR A;  2E9X A;  4MBQ A;  4IE6 A;  5F8P A;  1G8X A;  4PK6 A;  4ZI3 D;  1HTJ F;  1KK7 A;  4P0B A;  1G73 A;  4AKR B;  4I50 E;  1Z0P A;  2K48 A;  4KMC A;  1HG5 A;  4I43 B;  3EDU A;  3AAE B;  3HR0 A;  4J2C A;  3ZLI A;  3N2O A;  3ONX A;  5LGT B;  1ZEE A;  2NOX A;  3E22 E;  1FMV A;  4IE5 A;  1IJ5 A;  3RX6 A;  3MA9 A;  2I59 A;  2X9X A;  3UUN A;  5KDM C;  4X1K E;  1D0Z A;  5F3J A;  2X0L B;  4PJN A;  3PU3 A;  4GYS A;  2ES0 A;  3MZK B;  4QXH B;  5LGN B;  3I0O A;  3KV6 A;  4PFO A;  2NW7 A;  2YU2 A;  5DAB A;  3HL6 A;  4B6X A;  3DJB A;  4ZI7 E;  5L3D B;  2V7I A;  5AFU L;  4H9P C;  4P0A A;  1WLX A;  3D0T A;  3AA0 B;  5DJQ C;  4PNI A;  5ETW A;  4AXP A;  4HGA A;  4QWN B;  3RRC A;  2KZ7 B;  3SRZ A;  1S94 A;  4AQF A;  5JR9 C;  4CI2 B;  3LJC A;  4ISS A;  2KND A;  2PG8 A;  5E0O A;  3R6N A;  3Q5X A;  2Q9Q D;  4WBO A;  2DI4 A;  2DWG A;  4BA9 A;  2LSG A;  4O4H E;  1U5P A;  2N9D A;  2NTX A;  3CML A;  5JRC A;  3O1H A;  4XZC A;  2ZM0 A;  1IZN B;  3UT5 E;  2CLY B;  5IHY A;  1HX8 A;  3ZCJ A;  3ZMS B;  3ZMT B;  5LHH B;  2XAS B;  1S35 A;  3NZP A;  2V7M A;  1WR6 A;  4CQI A;  2L8K A;  3U78 A;  4UIG A;  2LSY A;  4OYK A;  3ETV A;  4A56 A;  2D5U A;  2LSJ A;  2MOZ A;  2YIN A;  4KBM B;  4YJ2 E;  5A1L A;  1QUU A;  4PAG A;  4ASK A;  4TZ4 C;  2W00 A;  2L3L A;  5FY7 A;  3V5U A;  1QSD A;  2Q9Q A;  5FXZ A;  4HE8 A;  2CXD A;  3KDS E;  5J2T E;  4AKL A;  2ZM2 A;  3N2G E;  2BZB A;  3W15 B;  3RYH E;  2A72 A;  3GWH A;  4XAX B;  3F57 A;  4GOU A;  4PJJ A;  2LE8 A;  3ANW A;  5DQW A;  4JUY A;  4UF0 A;  4C91 A;  3CQG B;  4MHC A;  1BR1 A;  4JLE A;  4UV9 B;  2LT3 A;  2X68 A;  2NW9 A;  3FXD B;  5JDL A;  2XHE B;  2KMF A;  4HTE A;  3J7Y q;  3QK6 A;  5FXX A;  2EHO C;  3RH3 A;  2NWB A;  3L3P A;  3ZYM A;  3T8O A;  3HKE E;  5J1G A;  3EVY A;  3BK9 A;  1SA0 E;  2CWY A;  4H63 V;  3QC9 A;  3RPU A;  4JEU B;  2KT9 A;  2WSS V;  3SS1 A;  3PUR A;  4ZHQ E;  3NZQ A;  2MYS A;  1UX5 A;  3F31 A;  5FXW A;  3WAK A;  3KFW X;  5JR9 B;  3LFM A;  2C5K T;  2V7L A;  3N2K E;  2P9B A;  3ZCI A;  2D2S A;  2LOS A;  3FB2 A;  4H9R C;  4YFS A;  2CA5 A;  2K24 A;  3LBX A;  4L9I A;  5L2L A;  3DTO A;  3PUG A;  4UVA B;  4C90 A;  2DWK A;  1MIY A;  3KVA A;  2LEH A;  2E9X C;  2VKO A;  1MMN A;  5JDH A;  4FI5 A;  5EK3 A;  2KWH A;  4EZH A;  3QUJ A;  4GK0 E;  2W0G A;  3N5L A;  2N1G A;  3A5X A;  5H6R B;  2JMK A;  3ZEF B;  2W62 A;  4GYR A;  4IE4 A;  3GN5 B;  3NBX X;  5FMN A;  4H9N C;  4EYY R;  3OBV E;  3J9X 1;  4HN9 A;  4QX8 B;  5JDM A;  3VHL A;  4I4T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...