2LSIA

Solution structure of polymerase-interacting domain of human rev1 in complex with translesional synthesis polymerase kappa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
GHMAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the scaffold mechanism of human Rev1 in translesional synthesis revealed by the structural studies on its polymerase-interacting domain
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA repair protein REV1
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsiA00
2LSIA 2N1GA 4FJOA 4GK5E 2LSGA 4EXTA 4BA9A 2LSYA 3VU7H 2LSJA 4GK0E 2LSKA
chains in the Genus database with same CATH superfamily
4JI7T 1M7KA 1WR0A 3AA1B 3AAEB 3T8OA 5HXEA 2YKSA 2LT3A 3O4XE 3ZPOA 3LJCA 5EK2A 2FUPA 5LP6E 2CA5A 4GOUA 2NW9A 2NOXA 3PU8A 1UGOA 1XMQT 3L3PA 2IIUA 4ZI7E 3C51A 4HTEA 2ZM2A 2MAWA 2XQ6A 2VL0A 4HWDA 2QVAA 2BS2A 2VASA 4DR5T 5HCJA 1NENA 2BG9E 2MYSA 3AECA 3IHRA 4I50E 2XQ5A 3ESLA 5EK4A 4A5XA 1UX4A 3JC6C 3KVBA 4GK5E 4U3CA 4BJMA 3UFEA 4EZ4A 1UK5A 5AQFB 2WWVA 2LJLA 2YDQA 1HG2A 2UUAT 4GKKT 4EEDA 2HPLA 3RYIE 2WB5A 2X9WA 2BG9A 4X1YE 5E0OA 2ODVA 5HEUA 4H9PC 2FBWA 4HFDA 4IL9A 2BG9B 1N36T 4YJ3E 2K5BB 2RP4A 3HKCE 3L09A 4TZ4C 4ADZA 4C91A 1MIVA 5LHHB 4HN9A 3K3NA 5FMNA 5JRCA 1IAPA 3JAFA 1SE7A 3PUWF 4IDOA 5AQOB 2V7KA 4E7SA 2UUCT 4B3ST 3N2OA 2CPTA 1HFAA 4U72A 5AQHB 3U3IA 3J7Yq 3HR0A 1JNZA 5L47A 3ABVA 4X65T 1S35A 4QKNA 5LNKA 1BR2A 3CX8B 3PV0F 4HFCA 4OFZA 3VR8A 1JNRA 1UCUA 1XZYA 4DMWA 2XQYA 2FJBA 1IJ5A 3AE7A 4H9OC 3WI3A 3ZMTB 2VKDA 2V1DB 3WAJA 3IF8B 3VR9A 1WR6A 1J5WA 1R8IA 1WFDA 1W0AA 2NTXA 4QX8B 3TLWA 4C90A 3P4SA 2E5LT 3G06A 1ZV4X 2FJEA 4IDQA 5IWAT 3Q5EA 5FXWA 2BG9C 1AJ3A 2WSSV 1KNZA 5HXHA 3AE8A 2X0YA 4DV2T 3GN5B 2D5UA 4HWHA 2LM2A 2LEHA 3ONXA 5H6RB 5KXJA 4PFOA 1X79A 2V7IA 3CWZB 4CQIA 4QHOA 3UU5A 5JTGA 3UQ7A 3PUQA 3UU8A 5EZYE 1M62A 3FHNA 4HWFA 5DABA 3RQUA 2J1DG 2ACZA 2WDQA 4EIWA 5JQGE 2CBJA 3ZLIA 4LFBT 5LXTE 3J9X1 4L9IA 3HKDE 1Y64B 5HEGA 4CN6A 5JR9B 2DWKA 2LKHA 3EDUA 4CXXA 5L4EA 4TV9E 4UVCB 1VCSA 4X20E 3GMIA 5AQTB 4X64T 4DUYT 4LFCT 2OA5A 4CI3B 3AE2A 3LK2B 4HEAA 4V1Av 3UUMA 4YSYA 2V6YA 2Q9QD 3EABA 5LHGB 1Y01A 3ONJA 4O8SA 3AXJA 3P4QA 2V7JA 2W67A 3OYZA 4UF0A 5FY1A 5AQNB 1ZKEA 2LSKA 4I0UA 4ZI2C 4LF4T 1MMDA 1OEDE 3C4ZA 1FIOA 1H7CA 1KFYA 4PK6A 5FVKA 5LHIB 3SOLA 5ABFB 4WZXA 2XAQB 3C50A 4X62T 4DV6T 4L0RA 4JI6T 3RPUA 4UVBB 4DV1T 2E9XB 2H7OA 2KT9A 2LHRA 4XZCA 2DLRA 3RYFE 3ZMSB 5CA0E 1U4QA 1UURA 2EHOD 3E08A 4LMJA 2YU2A 1BR1A 2CHOA 2J62A 2N2NA 4JUYA 1YD8G 5ETWA 1T7SA 5FP3A 3ZC0A 1L0VA 5JR9C 2JMKA 4GYSA 3AEEA 3W15B 2L3LA 5EK3A 2MBGA 1W09A 1Z8UA 3LK42 2H3RA 3CQGB 4LF8T 4A98A 3WAKA 2BS3A 4YSXA 4EYUA 2NW8A 1HX8A 2ZM0A 1KF6A 2KSRA 2WZIA 2E9XC 4GIWA 2BKPA 5FKYA 5GONE 5F5WA 5LB7B 3TLSA 4YTMA 4A56A 3RF1A 2NR4A 3PJAJ 3PDYA 5H6QB 2A9UA 2V26A 3A8YC 1YQ4A 3MACA 2I59A 1KK7A 1V9DA 1MIYA 3NBXX 2I0MA 4EV6A 4DR3T 3GA8A 4P0BA 2JPFA 4NPPA 2D9DA 5L3DB 2HPJA 5IHYA 2XQ7A 2LLYA 3AE1A 4ISTA 3V5SA 4YXDA 4DUZT 3LK3B 5M4YA 4MLKA 4H9NC 4YSZA 2NP9A 1OXZA 2A72A 2WU2A 1Z0PA 3Q2MA 4G63A 4UXNB 3UUBA 4CZZB 3RH3A 4EYYR 4TUYE 1IZNB 1CUNA 5FY0A 1HNXT 4AKHA 4GK0E 4IE7A 4PAGA 2W62A 4TN7B 4TNVA 3AEBA 4GKJT 2OLTA 4PJMA 4AKIA 2X0HA 4QH1A 2W2UA 2J47A 2Y6XA 2BZBA 1YKHB 5ABGA 3C4WA 2CLYC 2LHNA 3N9MA 3QC9A 5AQIB 1ZP0A 4IDPA 2R6GF 4ISSA 3T1YT 1N32T 1BR0A 2QRXA 3ZYLA 4DVDA 2MOZA 3EDVA 2E8IA 2KZ7B 2J4GA 4YHJA 3RIUA 4DR1T 2XAJB 3KV6A 4HWIB 3I9WA 5FNVE 3FXDB 4HFHA 2OV9A 4N78D 4O4JE 5CB4E 4DIDB 4DV7T 4JV5T 3O1JA 2E2AA 2Q9QB 3H37A 1XNRT 1I94T 4EOZB 3AA0B 2XHEB 4O2BE 3ZCJA 2AXDS 1XNQT 2DNXA 1VCTA 1U5PA 2WZHA 4H9RC 3EI0A 2DL1A 4NUUA 4TNWA 4JI1T 3N9LA 2WCAA 2L8KA 4ZI3D 1US7B 1D0XA 4KBMB 1XWMA 1FJGT 3KDSE 2YK0A 3O1IA 3I9YA 4OYKA 2ZM6T 4NUVA 4KX6A 1MNEA 2KMFA 4H9SE 3BQKA 2EHOB 4IE5A 5JVDE 3AEDA 4NIQA 4IE0A 2CMRA 2IC6A 2B1EA 3P4RA 4DMVA 3FZHB 3F2EA 2X0LB 4DV0T 2XAHB 2JQ9A 1NEKA 2YOEA 1QSDA 3DP7A 3AXJB 3KV9A 2JJ9A 4UF0B 5HXCA 3SWHA 2JQKA 5J1GA 3FXEB 4LF9T 5JDNA 4YFSA 2XJ7A 3CK6A 3AVSA 3FZMB 2CWOA 3PUYF 5LOVE 2HN1A 3UU3A 2Y8DA 4DNDA 2D0UA 2V5CA 2YDSA 2CE7A 4QXBB 5AQQB 4U7YA 1D1AA 1GQEA 5JRCB 2PG8A 3CMLA 4P09A 5HEJA 3OPCA 2EHOC 2E5VA 4PJNA 3AE6A 1KEYA 4DBRA 5AQKB 2NWBA 2XUEA 2LM9A 3P8CD 4UEMA 4P0AA 3ZMVB 4IE4A 1CHUA 2XQ9A 3ZCIA 3PUXF 3FZKB 4TV8E 3UQ4A 3NZQA 4ZZBA 3D0TA 2LRLA 2NTYA 5ABHA 1W9RA 3AAAB 5AQPB 3CPZA 4O4HE 4CN1A 4K0UA 4JLEA 5F8PA 1WRDA 1UX5A 2W66A 4H63H 5HAXA 3RKGA 3UTKA 4PK4A 3PUSA 5JDMA 4U2ZA 3ZN0B 3K3QC 2SPCA 2X9HA 4UELA 4COFA 4EZHA 1BR4A 3RYCE 4YT0A 5HYAA 2X68A 4HKAA 5DQVA 3N2GE 1LVFA 3RKOA 3OKQA 2X9XA 5FYMA 4JYAT 2WU5A 5JH7E 2LKGA 4IGUA 5C8YE 5CJ5A 4LF7T 3NVOA 1FEWA 5LMUT 4XBFB 4IIJE 2XY8B 1I6ZA 1MNDA 3KV5A 4H9QC 2C5IT 3R6NA 1WCRA 2FJAA 4PNIA 2G0UA 4Z8XA 2V5DA 1LVKA 3K8PC 2CCQA 4J2CA 2H89A 1VOMA 2CLYB 3FB2A 3MA9A 2DCFA 4PFPA 2QYWA 2VWAA 5FL0A 2UXNB 1MIWA 5HXSA 1YW0A 2WY2A 3AEFA 3ONLC 2KLQA 3E0ZA 3UUXB 1QLBA 2LSJA 4AQGA 1QUUA 2A2FX 4AKRB 4MHCA 1LKXA 4JI8T 2MPKA 2YINA 4BJNA 4ILAA 1T72A 4ZXLA 2YU1A 5LG3A 4ZS3A 2VVNA 2W63A 4HWCA 5C2TA 4DR7T 2VKJA 2WDRA 2XTLA 3ZKRA 4YTPA 4CXYA 4NXMT 4ERRA 2XAFB 4JEUB 2YEVC 3C4XA 3Q5DA 4U7IA 4Q25A 2Q9QA 3K3OA 3VKHA 1B7TA 3FBLA 4ZOLE 4Z90A 4DV3T 4AKGA 3SS1A 1OEDA 5JDQA 4I43B 1D1BA 2C5JA 2IHR1 4IE6A 3O1HA 3KBUA 4DR2T 3HA4A 2BDEA 4OYJA 4B3RT 4JI3T 3K1SA 1D1CA 2W61A 4QWNB 4F6RC 3RI5A 5LYJE 2WAUA 3RYHE 4FJOA 4LMKA 3TLTA 3V5UA 5KX5E 4DR6T 4K0KT 4ILUA 2C5KT 3ETUA 1KNPA 3VU7H 3IEEA 4UIGA 3RLFF 4AQFC 3B57A 5L3GB 1SHZC 5BR8T 3OJAA 3OYXA 3ZYKA 5DJQC 3QNUA 4CI1B 3O9XA 2XQ8A 3ZN1B 3AE4A 3LFMA 2XSAA 3FZLB 2QGSA 2C0SA 3KBTA 5JDLA 3N2KE 2UXCT 4A97A 3OVUA 4ASKA 4BAYB 5AQMB 3RQWA 3HI2A 3ANWA 3R84B 1N33T 3B13A 3AA7B 4AXPA 2HN2A 4MBQA 3CKDA 3Q5WA 4QH5A 3I0OA 4DV4T 2N1GA 4EB6E 3E22E 4HFEA 4X1IE 5AQJB 2CXDA 3B5MA 5LJMA 4AQFA 4DR4T 2XQ3A 5L2LA 2JRKA 2X9YA 3CX7B 2Q9QC 3NKZA 2KINB 3P4PA 5LMNT 3JCFA 1WLXA 4KUMB 5KDMC 2BVMA 2XZEA 3I0QA 2XM2A 5LGUB 3PJAA 4HFIA 5ADXL 3KVAA 2CXLA 2WDVA 1ZEEA 3LSVA 2IUBA 2KNDA 4DO0A 5FXVA 5AQSB 3T1HT 3AEAA 3ANWB 2DWGA 3PE0A 5KMGP 2XSBA 4WBOA 3UUNA 2N9DA 1HCIA 2WWUA 2X51A 3PUVF 3QB5K 1OEDC 1VRBA 2LOPA 2HH7A 2WBLA 2IDOB 4O4LE 4X5TA 2QA7A 3ZJ1A 2XM1A 3AB3B 5LBMA 3BQLA 4QXHB 3ZT6A 3OBVE 1D0ZA 5LGNB 2ODUA 4UVAB 3ZMZB 3EUHA 4M1PA 1IBMT 4IREA 3UULA 4PW8A 4TX5A 4AKLA 1J5ET 4WW0A 2WQYA 3DTOA 3FBZA 5J0ZA 3TKLB 4O4IE 5AQGB 3AVRA 3M3ZB 2L9QA 4IL4A 5LJNA 2M67A 3EHZA 2ZLYA 2ZM8A 4KP3C 3RIUC 4MFRA 2WM9A 2WMNA 1XMOT 1X9BA 1OWAA 1ZOYA 1G73A 4X1KE 3QUJA 3IBPA 2V8SV 3RGLA 4TWHA 2HHHT 4UV9B 5BMVE 2KXPB 3NZPA 3RX6A 4ILCA 3X1DA 4ZHQE 4TWFA 2ZMAA 4KHZF 2UUBT 3ZMUB 4UR9A 3VRAA 3VKGA 3S4UA 2AE9A 1HS7A 2YN6A 3Q5XA 3CIRA 4JBWF 3M65A 3GN5A 2PFVA 3A7MA 2I6HA 2UU9T 4P1NA 3BQIA 5AQRB 4AI6A 2W00A 2IW5B 1IBKT 4QX7B 3OTOT 5LBQB 1YXRA 2EHOA 3PURA 4I55E 1DU2A 2WMOA 1HR0T 4YLHA 2LSGA 3TLVA 5HWYA 1IJ6A 5CA1E 5F3JA 5FVLA 1MMAA 2VURA 4EEBA 3U78A 3PUZF 4CN4A 5C3JA 1WYCA 3HKBE 4HFVA 5L3BB 2RPAA 3CQCB 2BKOA 3ZC1A 4AISA 5ABEA 5L3EB 3SFDA 3ZSSA 3PTRB 4WNKA 4YHHT 2V6YB 5CGMA 3Q9DA 2M6IA 4LF6T 2UXDT 3QB5A 5FXXA 4Z91A 3RC3A 4L5GA 2H88A 1HX1B 3ETVA 3IA3A 2LSYA 3MZKB 4PJJA 1WYBA 1XDOA 3EAMA 2WS3A 1W0BA 2VVSA 3CVRA 1S94A 2D2SA 3P4WA 4IT4A 4DBQA 4B3TT 5AQVB 5JR9A 4ZI3C 2WP9A 3LBXB 2UXBT 3UT5E 2BS4A 4IHJE 2GK9A 2IC9A 2A3DA 3KFWX 3UU4A 2K3WA 4GYRA 1FMWA 2ACXA 2X66A 2XQAA 4DV5T 2DHRA 2RA1A 3P50A 2BBJA 4U31A 5HCMA 4ANJA 2IMLA 2NW7A 3AE5A 3JC6D 5L3CB 5LG4A 2H7VC 2VK9A 3PUGA 3P7IA 3RIFA 1KNRA 2CBIA 2CRBA 5FY7A 3TLUA 2FJDA 5FL1A 3CX6B 2V7LA 2CM0A 3LDQB 1HG5A 1E1HB 3ZSTA 3NRXA 5IUXA 3LBXA 3L8RA 5AQLB 3UFGA 3AA6B 4E7ZA 3I1AA 4CXWA 4WBNE 3QK6A 2K9AA 3MK7C 2BKNA 1MMGA 4FI5A 1J1JA 2LSIA 2BVLA 3HKEE 3PUAA 3DJBA 3QOFA 3ZEFB 2LE8A 4YTNA 1HTJF 2F4VT 2VL8A 2UXXB 3SRZA 4U74A 5HEHA 2JIWA 4EGWA 4LFAT 2LOSA 5IYZE 3ZJ2A 1EZ3A 3RRWA 3N9QA 4AQYT 1SUMB 4TWDA 1MMNA 4OK0A 3RRCA 4QXCB 4CI2B 2XASB 1SA0E 2XQ4A 3ZYMA 1YQ3A 2CXFA 4ZZCA 2PTFA 4B6XA 2W0GA 3JAEA 1O3XA 2K24A 5AQUB 4BA9A 2DI4A 4IDZA 4B3MT 1G8XA 5LCYA 4JI0T 3AE9A 1IBLT 4OHFA 1LRZA 2V7MA 4HFBA 3MJXA 4G2AA 4U33A 2M6BA 4XAXB 2CHNA 4ZS2A 1ZHCA 5J2TE 4X66T 4ZEYA 2D0TA 4JI2T 2W4XA 1XDPA 5JDHA 2BBHA 5A1LA 3MXZA 2V6XA 2ES0A 3C98B 3BK9A 2JMHA 2Y48B 4QH4A 5HXRA 3RIAA 3SFEA 1N34T 3N9PA 4MALA 2YDRA 4HGAA 4F8HA 2P9BA 3EVYA 3ZT5A 3H3MA 4PK5A 2MTQA 2K48A 1HNZT 3KV4A 3RHWA 4JI4T 3N5LA 2KWHA 3C64A 4EXTA 1NWMX 4WYVA 3VHLA 4H63V 3H3AA 2VB6A 2B76A 4KI0F 2VKHA 4JI5T 5J2UE 4LF5T 5FXZA 4IDNA 3ZT7A 2IAKA 2PJQA 4YY3T 5L3FB 3JADA 4YJ2E 5HWXA 3MKDA 5JDGA 1E2AA 1HNWT 2CWYA 5JDFA 5TAOA 2VKOA 5AFUL 3LG7A 1NAFA 1HF8A 4ZI2D 4KHPT 3PU3A 4O2AE 5DQWA 3CQXC 3KINB 5JREA 1FMVA 1OEDB 2XPKA 2E9XA 4U2YA 4UV8B 2VQFT 2JQQA 3FZFB 2JQHA 3NWIA 2VQET 5CFBA 5ABFA 3AAIA 3N9NA 4KMCA 3UU6A 3RC8A 3VRBA 2KWIB 2X67A 2Z6EA 5L4HA 4NXNT 1T98A 3AEGA 4OX9T 4JEHB 4PJLA 1UUSA 5LGTB 5LA6E 1T8BA 4EAHA 2E9XD 3F31A 3N9OA 3HL6A 4LMLA 3L39A 1D0YA 3NRYA 1E7PA 1YKEB 4HE8A 4I4TE 5HEOA 4AIUA 2PBIA 2LRKA 2XAGB 3F57A 3GWHA 3AE3A 4ILBA 3A5XA 2CEAA
chains in the Genus database with same CATH topology
3AA1B 3AAEB 3T8OA 5HXEA 3O4XE 2LT3A 3ZPOA 5LP6E 3LJCA 5EK2A 2CA5A 4GOUA 2NW9A 2NOXA 3L3PA 4ZI7E 3C51A 4HTEA 2ZM2A 2VASA 3IHRA 4I50E 2MYSA 5EK4A 3ESLA 4BJMA 4EZ4A 1UX4A 3JC6C 3KVBA 4GK5E 5JDMA 3UFEA 2LJLA 1HG2A 2HPLA 3RYIE 2X9WA 4X1YE 5E0OA 2ODVA 4H9PC 4YJ3E 2K5BB 2RP4A 3HKCE 3L09A 4TZ4C 4ADZA 4C91A 1MIVA 5LHHB 4HN9A 3K3NA 5FMNA 5JRCA 1IAPA 2V7KA 4E7SA 3N2OA 3U3IA 1HFAA 4U72A 3J7Yq 3HR0A 1S35A 4QKNA 5LNKA 1BR2A 3CX8B 4OFZA 1UCUA 4DMWA 2XQYA 1IJ5A 3ZMTB 4H9OC 3WI3A 3WAJA 2VKDA 2V1DB 3IF8B 1WR6A 2NTXA 4QX8B 1ZV4X 1AJ3A 5FXWA 2WSSV 1KNZA 5HXHA 3GN5B 2D5UA 5H6RB 2LEHA 3ONXA 4PFOA 1X79A 2V7IA 3CWZB 4CQIA 4QHOA 3PUQA 5EZYE 3FHNA 5DABA 2J1DG 4EIWA 5JQGE 3ZLIA 5LXTE 3J9X1 4L9IA 3HKDE 1Y64B 5JR9B 2DWKA 3EDUA 4CXXA 4TV9E 4UVCB 4X20E 3GMIA 2OA5A 4CI3B 4HEAA 3LK2B 4V1Av 3UUMA 2Q9QD 5LHGB 4O8SA 4UF0A 2V7JA 5FY1A 3OYZA 1ZKEA 2LSKA 4ZI2C 1MMDA 3C4ZA 4PK6A 1FIOA 1H7CA 5LHIB 3SOLA 2XAQB 3C50A 4L0RA 3RPUA 4UVBB 2E9XB 2H7OA 2KT9A 2LHRA 4XZCA 2DLRA 3RYFE 3ZMSB 5CA0E 1U4QA 2EHOD 3E08A 2YU2A 1BR1A 2N2NA 4JUYA 5ETWA 5FP3A 1YD8G 3ZC0A 5JR9C 2JMKA 4GYSA 3W15B 2L3LA 5EK3A 2MBGA 3LK42 2H3RA 3CQGB 3WAKA 4EYUA 2NW8A 1HX8A 2ZM0A 4AQFC 5GONE 2E9XC 4GIWA 4A56A 3PDYA 5H6QB 2V26A 3MACA 1KK7A 2I59A 1V9DA 1MIYA 3NBXX 3GA8A 4P0BA 2JPFA 5L3DB 2HPJA 5IHYA 3V5SA 4ISTA 3LK3B 5M4YA 4MLKA 4H9NC 2NP9A 1OXZA 2A72A 4G63A 1Z0PA 3Q2MA 4UXNB 4CZZB 3RH3A 4EYYR 4TUYE 1IZNB 1CUNA 5FY0A 4AKHA 4GK0E 4IE7A 4PAGA 2W62A 4TN7B 4AKIA 4PJMA 2Y6XA 2BZBA 1YKHB 3C4WA 2CLYC 2LHNA 3N9MA 3QC9A 4ISSA 1BR0A 3ZYLA 4DVDA 2MOZA 3EDVA 2E8IA 2KZ7B 4YHJA 2XAJB 3KV6A 3I9WA 5FNVE 3FXDB 4N78D 4O4JE 5CB4E 3O1JA 2Q9QB 3H37A 4EOZB 3AA0B 2XHEB 4O2BE 3ZCJA 2DNXA 1U5PA 4H9RC 4NUUA 3N9LA 4ZI3D 2L8KA 1US7B 1D0XA 4KBMB 3KDSE 2YK0A 3O1IA 3I9YA 4OYKA 4NUVA 1MNEA 2KMFA 4H9SE 3BQKA 2EHOB 4IE5A 5JVDE 4IE0A 2CMRA 2IC6A 2B1EA 4DMVA 3F2EA 2X0LB 2XAHB 3DP7A 1QSDA 4UF0B 3KV9A 2JJ9A 5HXCA 3SWHA 5J1GA 3FXEB 5JDNA 4YFSA 3AVSA 5LOVE 2CWOA 4DNDA 2Y8DA 2D0UA 4QXBB 2CE7A 1D1AA 5JRCB 2PG8A 3CMLA 4P09A 2EHOC 4PJNA 4DBRA 2NWBA 2XUEA 2LM9A 3P8CD 4UEMA 4P0AA 3ZMVB 4IE4A 3ZCIA 4TV8E 3NZQA 3D0TA 2NTYA 3AAAB 3CPZA 4O4HE 4K0UA 4JLEA 5F8PA 1WRDA 1UX5A 4H63H 5HAXA 3UTKA 4PK4A 3PUSA 3ZN0B 3K3QC 2SPCA 2X9HA 4UELA 4EZHA 1BR4A 3RYCE 5HYAA 2X68A 4HKAA 5DQVA 3N2GE 1LVFA 3RKOA 3OKQA 2X9XA 5FYMA 5JH7E 4IGUA 5C8YE 1FEWA 4XBFB 4IIJE 1MNDA 3KV5A 4H9QC 2C5IT 3R6NA 4PNIA 4Z8XA 2G0UA 1LVKA 3K8PC 2CCQA 4J2CA 1VOMA 2CLYB 3FB2A 3MA9A 2DCFA 4PFPA 2VWAA 2UXNB 1MIWA 5HXSA 1YW0A 3UUXB 4C90A 4AQGA 2KLQA 3E0ZA 2LSJA 1QUUA 2A2FX 4AKRB 4MHCA 1LKXA 2YINA 4BJNA 2YU1A 4ZS3A 2W63A 2VKJA 2XTLA 4CXYA 4ERRA 2XAFB 4JEUB 2YEVC 3C4XA 2Q9QA 3K3OA 3VKHA 1B7TA 3FBLA 4ZOLE 4AKGA 3SS1A 5JDQA 4I43B 1D1BA 2C5JA 4IE6A 3O1HA 3KBUA 3HA4A 2BDEA 4OYJA 1D1CA 2W61A 4QWNB 4F6RC 5LYJE 2WAUA 3RYHE 4FJOA 3V5UA 5KX5E 4ILUA 2C5KT 3ETUA 3VU7H 3IEEA 4UIGA 3B57A 5L3GB 1SHZC 3OJAA 3OYXA 3ZYKA 5DJQC 4CI1B 3O9XA 3ZN1B 3LFMA 2QGSA 2C0SA 3KBTA 5JDLA 3N2KE 4ASKA 4BAYB 3HI2A 3ANWA 3R84B 3B13A 3AA7B 4AXPA 4MBQA 3CKDA 3Q5WA 3I0OA 2N1GA 4EB6E 3E22E 4X1IE 2CXDA 5LJMA 4AQFA 5L2LA 2JRKA 2X9YA 3CX7B 2Q9QC 2KINB 1WLXA 4KUMB 5KDMC 2BVMA 3I0QA 5LGUB 5ADXL 3KVAA 2CXLA 1ZEEA 4DO0A 2KNDA 5FXVA 3ANWB 2DWGA 3PE0A 5KMGP 4WBOA 3UUNA 2N9DA 1HCIA 2WWUA 2X51A 2LOPA 1VRBA 2WBLA 2HH7A 4O4LE 3ZJ1A 2QA7A 3AB3B 5LBMA 3BQLA 4QXHB 5LGNB 3OBVE 1D0ZA 2ODUA 4UVAB 3ZMZB 3EUHA 4M1PA 3UULA 4PW8A 4TX5A 4AKLA 4WW0A 3DTOA 3FBZA 3TKLB 4O4IE 3AVRA 2L9QA 5LJNA 2M67A 2ZLYA 2ZM8A 4KP3C 4MFRA 2WM9A 2WMNA 1OWAA 1G73A 4X1KE 3QUJA 3IBPA 4UV9B 5BMVE 2KXPB 3NZPA 3RX6A 4ZHQE 3VKGA 2ZMAA 3ZMUB 3S4UA 1HS7A 3Q5XA 3M65A 3GN5A 2PFVA 3BQIA 2W00A 2IW5B 4QX7B 5LBQB 2EHOA 3PURA 4I55E 2WMOA 4YLHA 2LSGA 5HWYA 1IJ6A 5CA1E 5F3JA 1MMAA 3U78A 1WYCA 3HKBE 4HFVA 5L3BB 3CQCB 3ZC1A 5L3EB 3PTRB 4WNKA 3Q9DA 5FXXA 3RC3A 4L5GA 3ETVA 3MZKB 4PJJA 2LSYA 4AI6A 1WYBA 3CVRA 1S94A 2D2SA 4DBQA 5JR9A 4ZI3C 3LBXB 3UT5E 4IHJE 2GK9A 2IC9A 2A3DA 3KFWX 4GYRA 1FMWA 2ACXA 2X66A 2DHRA 2RA1A 4ANJA 2NW7A 3JC6D 5L3CB 5LG4A 2H7VC 2VK9A 3PUGA 3P7IA 5FY7A 3CX6B 2V7LA 2CM0A 1HG5A 1E1HB 3NRXA 3LBXA 3AA6B 4E7ZA 3I1AA 4CXWA 4WBNE 3QK6A 2K9AA 3MK7C 1MMGA 4FI5A 2LSIA 2BVLA 3HKEE 3PUAA 3DJBA 3ZEFB 2LE8A 1HTJF 2VL8A 2UXXB 3SRZA 4U74A 2LOSA 5IYZE 3ZJ2A 1EZ3A 3RRWA 3N9QA 3RRCA 1MMNA 4OK0A 4CI2B 4QXCB 2XASB 1SA0E 3ZYMA 2CXFA 4B6XA 2W0GA 1O3XA 2K24A 4BA9A 2DI4A 4IDZA 1G8XA 5LCYA 4OHFA 1LRZA 2V7MA 3MJXA 4G2AA 4XAXB 4ZS2A 5J2TE 1ZHCA 2D0TA 5JDHA 5A1LA 3MXZA 3C98B 2ES0A 3BK9A 2JMHA 2Y48B 5HXRA 3N9PA 4MALA 4HGAA 2P9BA 3EVYA 4PK5A 2MTQA 2K48A 3KV4A 3N5LA 2KWHA 3C64A 4EXTA 1NWMX 3VHLA 4H63V 3H3AA 2VB6A 2VKHA 5J2UE 5FXZA 2IAKA 2PJQA 5L3FB 4YJ2E 5HWXA 3MKDA 5JDGA 2CWYA 5JDFA 5TAOA 2VKOA 5AFUL 3LG7A 1NAFA 1HF8A 4ZI2D 3PU3A 4O2AE 5DQWA 3CQXC 3KINB 5JREA 1FMVA 4UV8B 2E9XA 2JQQA 3AAIA 3N9NA 4KMCA 3RC8A 2KWIB 2X67A 2Z6EA 1T98A 4JEHB 4PJLA 5LGTB 5LA6E 4EAHA 2E9XD 3F31A 3N9OA 3HL6A 1D0YA 3NRYA 4HE8A 1YKEB 4I4TE 2PBIA 2XAGB 3F57A 3GWHA 3PU8A 3A5XA 2CEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSI A;  2N1G A;  4FJO A;  4GK5 E;  2LSG A;  4EXT A;  4BA9 A;  2LSY A;  3VU7 H;  2LSJ A;  4GK0 E;  2LSK A; 
#chains in the Genus database with same CATH topology
 4JI7 T;  1M7K A;  1WR0 A;  3AA1 B;  3AAE B;  3T8O A;  5HXE A;  2YKS A;  2LT3 A;  3O4X E;  3ZPO A;  3LJC A;  5EK2 A;  2FUP A;  5LP6 E;  2CA5 A;  4GOU A;  2NW9 A;  2NOX A;  3PU8 A;  1UGO A;  1XMQ T;  3L3P A;  2IIU A;  4ZI7 E;  3C51 A;  4HTE A;  2ZM2 A;  2MAW A;  2XQ6 A;  2VL0 A;  4HWD A;  2QVA A;  2BS2 A;  2VAS A;  4DR5 T;  5HCJ A;  1NEN A;  2BG9 E;  2MYS A;  3AEC A;  3IHR A;  4I50 E;  2XQ5 A;  3ESL A;  5EK4 A;  4A5X A;  1UX4 A;  3JC6 C;  3KVB A;  4GK5 E;  4U3C A;  4BJM A;  3UFE A;  4EZ4 A;  1UK5 A;  5AQF B;  2WWV A;  2LJL A;  2YDQ A;  1HG2 A;  2UUA T;  4GKK T;  4EED A;  2HPL A;  3RYI E;  2WB5 A;  2X9W A;  2BG9 A;  4X1Y E;  5E0O A;  2ODV A;  5HEU A;  4H9P C;  2FBW A;  4HFD A;  4IL9 A;  2BG9 B;  1N36 T;  4YJ3 E;  2K5B B;  2RP4 A;  3HKC E;  3L09 A;  4TZ4 C;  4ADZ A;  4C91 A;  1MIV A;  5LHH B;  4HN9 A;  3K3N A;  5FMN A;  5JRC A;  1IAP A;  3JAF A;  1SE7 A;  3PUW F;  4IDO A;  5AQO B;  2V7K A;  4E7S A;  2UUC T;  4B3S T;  3N2O A;  2CPT A;  1HFA A;  4U72 A;  5AQH B;  3U3I A;  3J7Y q;  3HR0 A;  1JNZ A;  5L47 A;  3ABV A;  4X65 T;  1S35 A;  4QKN A;  5LNK A;  1BR2 A;  3CX8 B;  3PV0 F;  4HFC A;  4OFZ A;  3VR8 A;  1JNR A;  1UCU A;  1XZY A;  4DMW A;  2XQY A;  2FJB A;  1IJ5 A;  3AE7 A;  4H9O C;  3WI3 A;  3ZMT B;  2VKD A;  2V1D B;  3WAJ A;  3IF8 B;  3VR9 A;  1WR6 A;  1J5W A;  1R8I A;  1WFD A;  1W0A A;  2NTX A;  4QX8 B;  3TLW A;  4C90 A;  3P4S A;  2E5L T;  3G06 A;  1ZV4 X;  2FJE A;  4IDQ A;  5IWA T;  3Q5E A;  5FXW A;  2BG9 C;  1AJ3 A;  2WSS V;  1KNZ A;  5HXH A;  3AE8 A;  2X0Y A;  4DV2 T;  3GN5 B;  2D5U A;  4HWH A;  2LM2 A;  2LEH A;  3ONX A;  5H6R B;  5KXJ A;  4PFO A;  1X79 A;  2V7I A;  3CWZ B;  4CQI A;  4QHO A;  3UU5 A;  5JTG A;  3UQ7 A;  3PUQ A;  3UU8 A;  5EZY E;  1M62 A;  3FHN A;  4HWF A;  5DAB A;  3RQU A;  2J1D G;  2ACZ A;  2WDQ A;  4EIW A;  5JQG E;  2CBJ A;  3ZLI A;  4LFB T;  5LXT E;  3J9X 1;  4L9I A;  3HKD E;  1Y64 B;  5HEG A;  4CN6 A;  5JR9 B;  2DWK A;  2LKH A;  3EDU A;  4CXX A;  5L4E A;  4TV9 E;  4UVC B;  1VCS A;  4X20 E;  3GMI A;  5AQT B;  4X64 T;  4DUY T;  4LFC T;  2OA5 A;  4CI3 B;  3AE2 A;  3LK2 B;  4HEA A;  4V1A v;  3UUM A;  4YSY A;  2V6Y A;  2Q9Q D;  3EAB A;  5LHG B;  1Y01 A;  3ONJ A;  4O8S A;  3AXJ A;  3P4Q A;  2V7J A;  2W67 A;  3OYZ A;  4UF0 A;  5FY1 A;  5AQN B;  1ZKE A;  2LSK A;  4I0U A;  4ZI2 C;  4LF4 T;  1MMD A;  1OED E;  3C4Z A;  1FIO A;  1H7C A;  1KFY A;  4PK6 A;  5FVK A;  5LHI B;  3SOL A;  5ABF B;  4WZX A;  2XAQ B;  3C50 A;  4X62 T;  4DV6 T;  4L0R A;  4JI6 T;  3RPU A;  4UVB B;  4DV1 T;  2E9X B;  2H7O A;  2KT9 A;  2LHR A;  4XZC A;  2DLR A;  3RYF E;  3ZMS B;  5CA0 E;  1U4Q A;  1UUR A;  2EHO D;  3E08 A;  4LMJ A;  2YU2 A;  1BR1 A;  2CHO A;  2J62 A;  2N2N A;  4JUY A;  1YD8 G;  5ETW A;  1T7S A;  5FP3 A;  3ZC0 A;  1L0V A;  5JR9 C;  2JMK A;  4GYS A;  3AEE A;  3W15 B;  2L3L A;  5EK3 A;  2MBG A;  1W09 A;  1Z8U A;  3LK4 2;  2H3R A;  3CQG B;  4LF8 T;  4A98 A;  3WAK A;  2BS3 A;  4YSX A;  4EYU A;  2NW8 A;  1HX8 A;  2ZM0 A;  1KF6 A;  2KSR A;  2WZI A;  2E9X C;  4GIW A;  2BKP A;  5FKY A;  5GON E;  5F5W A;  5LB7 B;  3TLS A;  4YTM A;  4A56 A;  3RF1 A;  2NR4 A;  3PJA J;  3PDY A;  5H6Q B;  2A9U A;  2V26 A;  3A8Y C;  1YQ4 A;  3MAC A;  2I59 A;  1KK7 A;  1V9D A;  1MIY A;  3NBX X;  2I0M A;  4EV6 A;  4DR3 T;  3GA8 A;  4P0B A;  2JPF A;  4NPP A;  2D9D A;  5L3D B;  2HPJ A;  5IHY A;  2XQ7 A;  2LLY A;  3AE1 A;  4IST A;  3V5S A;  4YXD A;  4DUZ T;  3LK3 B;  5M4Y A;  4MLK A;  4H9N C;  4YSZ A;  2NP9 A;  1OXZ A;  2A72 A;  2WU2 A;  1Z0P A;  3Q2M A;  4G63 A;  4UXN B;  3UUB A;  4CZZ B;  3RH3 A;  4EYY R;  4TUY E;  1IZN B;  1CUN A;  5FY0 A;  1HNX T;  4AKH A;  4GK0 E;  4IE7 A;  4PAG A;  2W62 A;  4TN7 B;  4TNV A;  3AEB A;  4GKJ T;  2OLT A;  4PJM A;  4AKI A;  2X0H A;  4QH1 A;  2W2U A;  2J47 A;  2Y6X A;  2BZB A;  1YKH B;  5ABG A;  3C4W A;  2CLY C;  2LHN A;  3N9M A;  3QC9 A;  5AQI B;  1ZP0 A;  4IDP A;  2R6G F;  4ISS A;  3T1Y T;  1N32 T;  1BR0 A;  2QRX A;  3ZYL A;  4DVD A;  2MOZ A;  3EDV A;  2E8I A;  2KZ7 B;  2J4G A;  4YHJ A;  3RIU A;  4DR1 T;  2XAJ B;  3KV6 A;  4HWI B;  3I9W A;  5FNV E;  3FXD B;  4HFH A;  2OV9 A;  4N78 D;  4O4J E;  5CB4 E;  4DID B;  4DV7 T;  4JV5 T;  3O1J A;  2E2A A;  2Q9Q B;  3H37 A;  1XNR T;  1I94 T;  4EOZ B;  3AA0 B;  2XHE B;  4O2B E;  3ZCJ A;  2AXD S;  1XNQ T;  2DNX A;  1VCT A;  1U5P A;  2WZH A;  4H9R C;  3EI0 A;  2DL1 A;  4NUU A;  4TNW A;  4JI1 T;  3N9L A;  2WCA A;  2L8K A;  4ZI3 D;  1US7 B;  1D0X A;  4KBM B;  1XWM A;  1FJG T;  3KDS E;  2YK0 A;  3O1I A;  3I9Y A;  4OYK A;  2ZM6 T;  4NUV A;  4KX6 A;  1MNE A;  2KMF A;  4H9S E;  3BQK A;  2EHO B;  4IE5 A;  5JVD E;  3AED A;  4NIQ A;  4IE0 A;  2CMR A;  2IC6 A;  2B1E A;  3P4R A;  4DMV A;  3FZH B;  3F2E A;  2X0L B;  4DV0 T;  2XAH B;  2JQ9 A;  1NEK A;  2YOE A;  1QSD A;  3DP7 A;  3AXJ B;  3KV9 A;  2JJ9 A;  4UF0 B;  5HXC A;  3SWH A;  2JQK A;  5J1G A;  3FXE B;  4LF9 T;  5JDN A;  4YFS A;  2XJ7 A;  3CK6 A;  3AVS A;  3FZM B;  2CWO A;  3PUY F;  5LOV E;  2HN1 A;  3UU3 A;  2Y8D A;  4DND A;  2D0U A;  2V5C A;  2YDS A;  2CE7 A;  4QXB B;  5AQQ B;  4U7Y A;  1D1A A;  1GQE A;  5JRC B;  2PG8 A;  3CML A;  4P09 A;  5HEJ A;  3OPC A;  2EHO C;  2E5V A;  4PJN A;  3AE6 A;  1KEY A;  4DBR A;  5AQK B;  2NWB A;  2XUE A;  2LM9 A;  3P8C D;  4UEM A;  4P0A A;  3ZMV B;  4IE4 A;  1CHU A;  2XQ9 A;  3ZCI A;  3PUX F;  3FZK B;  4TV8 E;  3UQ4 A;  3NZQ A;  4ZZB A;  3D0T A;  2LRL A;  2NTY A;  5ABH A;  1W9R A;  3AAA B;  5AQP B;  3CPZ A;  4O4H E;  4CN1 A;  4K0U A;  4JLE A;  5F8P A;  1WRD A;  1UX5 A;  2W66 A;  4H63 H;  5HAX A;  3RKG A;  3UTK A;  4PK4 A;  3PUS A;  5JDM A;  4U2Z A;  3ZN0 B;  3K3Q C;  2SPC A;  2X9H A;  4UEL A;  4COF A;  4EZH A;  1BR4 A;  3RYC E;  4YT0 A;  5HYA A;  2X68 A;  4HKA A;  5DQV A;  3N2G E;  1LVF A;  3RKO A;  3OKQ A;  2X9X A;  5FYM A;  4JYA T;  2WU5 A;  5JH7 E;  2LKG A;  4IGU A;  5C8Y E;  5CJ5 A;  4LF7 T;  3NVO A;  1FEW A;  5LMU T;  4XBF B;  4IIJ E;  2XY8 B;  1I6Z A;  1MND A;  3KV5 A;  4H9Q C;  2C5I T;  3R6N A;  1WCR A;  2FJA A;  4PNI A;  2G0U A;  4Z8X A;  2V5D A;  1LVK A;  3K8P C;  2CCQ A;  4J2C A;  2H89 A;  1VOM A;  2CLY B;  3FB2 A;  3MA9 A;  2DCF A;  4PFP A;  2QYW A;  2VWA A;  5FL0 A;  2UXN B;  1MIW A;  5HXS A;  1YW0 A;  2WY2 A;  3AEF A;  3ONL C;  2KLQ A;  3E0Z A;  3UUX B;  1QLB A;  2LSJ A;  4AQG A;  1QUU A;  2A2F X;  4AKR B;  4MHC A;  1LKX A;  4JI8 T;  2MPK A;  2YIN A;  4BJN A;  4ILA A;  1T72 A;  4ZXL A;  2YU1 A;  5LG3 A;  4ZS3 A;  2VVN A;  2W63 A;  4HWC A;  5C2T A;  4DR7 T;  2VKJ A;  2WDR A;  2XTL A;  3ZKR A;  4YTP A;  4CXY A;  4NXM T;  4ERR A;  2XAF B;  4JEU B;  2YEV C;  3C4X A;  3Q5D A;  4U7I A;  4Q25 A;  2Q9Q A;  3K3O A;  3VKH A;  1B7T A;  3FBL A;  4ZOL E;  4Z90 A;  4DV3 T;  4AKG A;  3SS1 A;  1OED A;  5JDQ A;  4I43 B;  1D1B A;  2C5J A;  2IHR 1;  4IE6 A;  3O1H A;  3KBU A;  4DR2 T;  3HA4 A;  2BDE A;  4OYJ A;  4B3R T;  4JI3 T;  3K1S A;  1D1C A;  2W61 A;  4QWN B;  4F6R C;  3RI5 A;  5LYJ E;  2WAU A;  3RYH E;  4FJO A;  4LMK A;  3TLT A;  3V5U A;  5KX5 E;  4DR6 T;  4K0K T;  4ILU A;  2C5K T;  3ETU A;  1KNP A;  3VU7 H;  3IEE A;  4UIG A;  3RLF F;  4AQF C;  3B57 A;  5L3G B;  1SHZ C;  5BR8 T;  3OJA A;  3OYX A;  3ZYK A;  5DJQ C;  3QNU A;  4CI1 B;  3O9X A;  2XQ8 A;  3ZN1 B;  3AE4 A;  3LFM A;  2XSA A;  3FZL B;  2QGS A;  2C0S A;  3KBT A;  5JDL A;  3N2K E;  2UXC T;  4A97 A;  3OVU A;  4ASK A;  4BAY B;  5AQM B;  3RQW A;  3HI2 A;  3ANW A;  3R84 B;  1N33 T;  3B13 A;  3AA7 B;  4AXP A;  2HN2 A;  4MBQ A;  3CKD A;  3Q5W A;  4QH5 A;  3I0O A;  4DV4 T;  2N1G A;  4EB6 E;  3E22 E;  4HFE A;  4X1I E;  5AQJ B;  2CXD A;  3B5M A;  5LJM A;  4AQF A;  4DR4 T;  2XQ3 A;  5L2L A;  2JRK A;  2X9Y A;  3CX7 B;  2Q9Q C;  3NKZ A;  2KIN B;  3P4P A;  5LMN T;  3JCF A;  1WLX A;  4KUM B;  5KDM C;  2BVM A;  2XZE A;  3I0Q A;  2XM2 A;  5LGU B;  3PJA A;  4HFI A;  5ADX L;  3KVA A;  2CXL A;  2WDV A;  1ZEE A;  3LSV A;  2IUB A;  2KND A;  4DO0 A;  5FXV A;  5AQS B;  3T1H T;  3AEA A;  3ANW B;  2DWG A;  3PE0 A;  5KMG P;  2XSB A;  4WBO A;  3UUN A;  2N9D A;  1HCI A;  2WWU A;  2X51 A;  3PUV F;  3QB5 K;  1OED C;  1VRB A;  2LOP A;  2HH7 A;  2WBL A;  2IDO B;  4O4L E;  4X5T A;  2QA7 A;  3ZJ1 A;  2XM1 A;  3AB3 B;  5LBM A;  3BQL A;  4QXH B;  3ZT6 A;  3OBV E;  1D0Z A;  5LGN B;  2ODU A;  4UVA B;  3ZMZ B;  3EUH A;  4M1P A;  1IBM T;  4IRE A;  3UUL A;  4PW8 A;  4TX5 A;  4AKL A;  1J5E T;  4WW0 A;  2WQY A;  3DTO A;  3FBZ A;  5J0Z A;  3TKL B;  4O4I E;  5AQG B;  3AVR A;  3M3Z B;  2L9Q A;  4IL4 A;  5LJN A;  2M67 A;  3EHZ A;  2ZLY A;  2ZM8 A;  4KP3 C;  3RIU C;  4MFR A;  2WM9 A;  2WMN A;  1XMO T;  1X9B A;  1OWA A;  1ZOY A;  1G73 A;  4X1K E;  3QUJ A;  3IBP A;  2V8S V;  3RGL A;  4TWH A;  2HHH T;  4UV9 B;  5BMV E;  2KXP B;  3NZP A;  3RX6 A;  4ILC A;  3X1D A;  4ZHQ E;  4TWF A;  2ZMA A;  4KHZ F;  2UUB T;  3ZMU B;  4UR9 A;  3VRA A;  3VKG A;  3S4U A;  2AE9 A;  1HS7 A;  2YN6 A;  3Q5X A;  3CIR A;  4JBW F;  3M65 A;  3GN5 A;  2PFV A;  3A7M A;  2I6H A;  2UU9 T;  4P1N A;  3BQI A;  5AQR B;  4AI6 A;  2W00 A;  2IW5 B;  1IBK T;  4QX7 B;  3OTO T;  5LBQ B;  1YXR A;  2EHO A;  3PUR A;  4I55 E;  1DU2 A;  2WMO A;  1HR0 T;  4YLH A;  2LSG A;  3TLV A;  5HWY A;  1IJ6 A;  5CA1 E;  5F3J A;  5FVL A;  1MMA A;  2VUR A;  4EEB A;  3U78 A;  3PUZ F;  4CN4 A;  5C3J A;  1WYC A;  3HKB E;  4HFV A;  5L3B B;  2RPA A;  3CQC B;  2BKO A;  3ZC1 A;  4AIS A;  5ABE A;  5L3E B;  3SFD A;  3ZSS A;  3PTR B;  4WNK A;  4YHH T;  2V6Y B;  5CGM A;  3Q9D A;  2M6I A;  4LF6 T;  2UXD T;  3QB5 A;  5FXX A;  4Z91 A;  3RC3 A;  4L5G A;  2H88 A;  1HX1 B;  3ETV A;  3IA3 A;  2LSY A;  3MZK B;  4PJJ A;  1WYB A;  1XDO A;  3EAM A;  2WS3 A;  1W0B A;  2VVS A;  3CVR A;  1S94 A;  2D2S A;  3P4W A;  4IT4 A;  4DBQ A;  4B3T T;  5AQV B;  5JR9 A;  4ZI3 C;  2WP9 A;  3LBX B;  2UXB T;  3UT5 E;  2BS4 A;  4IHJ E;  2GK9 A;  2IC9 A;  2A3D A;  3KFW X;  3UU4 A;  2K3W A;  4GYR A;  1FMW A;  2ACX A;  2X66 A;  2XQA A;  4DV5 T;  2DHR A;  2RA1 A;  3P50 A;  2BBJ A;  4U31 A;  5HCM A;  4ANJ A;  2IML A;  2NW7 A;  3AE5 A;  3JC6 D;  5L3C B;  5LG4 A;  2H7V C;  2VK9 A;  3PUG A;  3P7I A;  3RIF A;  1KNR A;  2CBI A;  2CRB A;  5FY7 A;  3TLU A;  2FJD A;  5FL1 A;  3CX6 B;  2V7L A;  2CM0 A;  3LDQ B;  1HG5 A;  1E1H B;  3ZST A;  3NRX A;  5IUX A;  3LBX A;  3L8R A;  5AQL B;  3UFG A;  3AA6 B;  4E7Z A;  3I1A A;  4CXW A;  4WBN E;  3QK6 A;  2K9A A;  3MK7 C;  2BKN A;  1MMG A;  4FI5 A;  1J1J A;  2LSI A;  2BVL A;  3HKE E;  3PUA A;  3DJB A;  3QOF A;  3ZEF B;  2LE8 A;  4YTN A;  1HTJ F;  2F4V T;  2VL8 A;  2UXX B;  3SRZ A;  4U74 A;  5HEH A;  2JIW A;  4EGW A;  4LFA T;  2LOS A;  5IYZ E;  3ZJ2 A;  1EZ3 A;  3RRW A;  3N9Q A;  4AQY T;  1SUM B;  4TWD A;  1MMN A;  4OK0 A;  3RRC A;  4QXC B;  4CI2 B;  2XAS B;  1SA0 E;  2XQ4 A;  3ZYM A;  1YQ3 A;  2CXF A;  4ZZC A;  2PTF A;  4B6X A;  2W0G A;  3JAE A;  1O3X A;  2K24 A;  5AQU B;  4BA9 A;  2DI4 A;  4IDZ A;  4B3M T;  1G8X A;  5LCY A;  4JI0 T;  3AE9 A;  1IBL T;  4OHF A;  1LRZ A;  2V7M A;  4HFB A;  3MJX A;  4G2A A;  4U33 A;  2M6B A;  4XAX B;  2CHN A;  4ZS2 A;  1ZHC A;  5J2T E;  4X66 T;  4ZEY A;  2D0T A;  4JI2 T;  2W4X A;  1XDP A;  5JDH A;  2BBH A;  5A1L A;  3MXZ A;  2V6X A;  2ES0 A;  3C98 B;  3BK9 A;  2JMH A;  2Y48 B;  4QH4 A;  5HXR A;  3RIA A;  3SFE A;  1N34 T;  3N9P A;  4MAL A;  2YDR A;  4HGA A;  4F8H A;  2P9B A;  3EVY A;  3ZT5 A;  3H3M A;  4PK5 A;  2MTQ A;  2K48 A;  1HNZ T;  3KV4 A;  3RHW A;  4JI4 T;  3N5L A;  2KWH A;  3C64 A;  4EXT A;  1NWM X;  4WYV A;  3VHL A;  4H63 V;  3H3A A;  2VB6 A;  2B76 A;  4KI0 F;  2VKH A;  4JI5 T;  5J2U E;  4LF5 T;  5FXZ A;  4IDN A;  3ZT7 A;  2IAK A;  2PJQ A;  4YY3 T;  5L3F B;  3JAD A;  4YJ2 E;  5HWX A;  3MKD A;  5JDG A;  1E2A A;  1HNW T;  2CWY A;  5JDF A;  5TAO A;  2VKO A;  5AFU L;  3LG7 A;  1NAF A;  1HF8 A;  4ZI2 D;  4KHP T;  3PU3 A;  4O2A E;  5DQW A;  3CQX C;  3KIN B;  5JRE A;  1FMV A;  1OED B;  2XPK A;  2E9X A;  4U2Y A;  4UV8 B;  2VQF T;  2JQQ A;  3FZF B;  2JQH A;  3NWI A;  2VQE T;  5CFB A;  5ABF A;  3AAI A;  3N9N A;  4KMC A;  3UU6 A;  3RC8 A;  3VRB A;  2KWI B;  2X67 A;  2Z6E A;  5L4H A;  4NXN T;  1T98 A;  3AEG A;  4OX9 T;  4JEH B;  4PJL A;  1UUS A;  5LGT B;  5LA6 E;  1T8B A;  4EAH A;  2E9X D;  3F31 A;  3N9O A;  3HL6 A;  4LML A;  3L39 A;  1D0Y A;  3NRY A;  1E7P A;  1YKE B;  4HE8 A;  4I4T E;  5HEO A;  4AIU A;  2PBI A;  2LRK A;  2XAG B;  3F57 A;  3GWH A;  3AE3 A;  4ILB A;  3A5X A;  2CEA A; 
#chains in the Genus database with same CATH homology
 3AA1 B;  3AAE B;  3T8O A;  5HXE A;  3O4X E;  2LT3 A;  3ZPO A;  5LP6 E;  3LJC A;  5EK2 A;  2CA5 A;  4GOU A;  2NW9 A;  2NOX A;  3L3P A;  4ZI7 E;  3C51 A;  4HTE A;  2ZM2 A;  2VAS A;  3IHR A;  4I50 E;  2MYS A;  5EK4 A;  3ESL A;  4BJM A;  4EZ4 A;  1UX4 A;  3JC6 C;  3KVB A;  4GK5 E;  5JDM A;  3UFE A;  2LJL A;  1HG2 A;  2HPL A;  3RYI E;  2X9W A;  4X1Y E;  5E0O A;  2ODV A;  4H9P C;  4YJ3 E;  2K5B B;  2RP4 A;  3HKC E;  3L09 A;  4TZ4 C;  4ADZ A;  4C91 A;  1MIV A;  5LHH B;  4HN9 A;  3K3N A;  5FMN A;  5JRC A;  1IAP A;  2V7K A;  4E7S A;  3N2O A;  3U3I A;  1HFA A;  4U72 A;  3J7Y q;  3HR0 A;  1S35 A;  4QKN A;  5LNK A;  1BR2 A;  3CX8 B;  4OFZ A;  1UCU A;  4DMW A;  2XQY A;  1IJ5 A;  3ZMT B;  4H9O C;  3WI3 A;  3WAJ A;  2VKD A;  2V1D B;  3IF8 B;  1WR6 A;  2NTX A;  4QX8 B;  1ZV4 X;  1AJ3 A;  5FXW A;  2WSS V;  1KNZ A;  5HXH A;  3GN5 B;  2D5U A;  5H6R B;  2LEH A;  3ONX A;  4PFO A;  1X79 A;  2V7I A;  3CWZ B;  4CQI A;  4QHO A;  3PUQ A;  5EZY E;  3FHN A;  5DAB A;  2J1D G;  4EIW A;  5JQG E;  3ZLI A;  5LXT E;  3J9X 1;  4L9I A;  3HKD E;  1Y64 B;  5JR9 B;  2DWK A;  3EDU A;  4CXX A;  4TV9 E;  4UVC B;  4X20 E;  3GMI A;  2OA5 A;  4CI3 B;  4HEA A;  3LK2 B;  4V1A v;  3UUM A;  2Q9Q D;  5LHG B;  4O8S A;  4UF0 A;  2V7J A;  5FY1 A;  3OYZ A;  1ZKE A;  2LSK A;  4ZI2 C;  1MMD A;  3C4Z A;  4PK6 A;  1FIO A;  1H7C A;  5LHI B;  3SOL A;  2XAQ B;  3C50 A;  4L0R A;  3RPU A;  4UVB B;  2E9X B;  2H7O A;  2KT9 A;  2LHR A;  4XZC A;  2DLR A;  3RYF E;  3ZMS B;  5CA0 E;  1U4Q A;  2EHO D;  3E08 A;  2YU2 A;  1BR1 A;  2N2N A;  4JUY A;  5ETW A;  5FP3 A;  1YD8 G;  3ZC0 A;  5JR9 C;  2JMK A;  4GYS A;  3W15 B;  2L3L A;  5EK3 A;  2MBG A;  3LK4 2;  2H3R A;  3CQG B;  3WAK A;  4EYU A;  2NW8 A;  1HX8 A;  2ZM0 A;  4AQF C;  5GON E;  2E9X C;  4GIW A;  4A56 A;  3PDY A;  5H6Q B;  2V26 A;  3MAC A;  1KK7 A;  2I59 A;  1V9D A;  1MIY A;  3NBX X;  3GA8 A;  4P0B A;  2JPF A;  5L3D B;  2HPJ A;  5IHY A;  3V5S A;  4IST A;  3LK3 B;  5M4Y A;  4MLK A;  4H9N C;  2NP9 A;  1OXZ A;  2A72 A;  4G63 A;  1Z0P A;  3Q2M A;  4UXN B;  4CZZ B;  3RH3 A;  4EYY R;  4TUY E;  1IZN B;  1CUN A;  5FY0 A;  4AKH A;  4GK0 E;  4IE7 A;  4PAG A;  2W62 A;  4TN7 B;  4AKI A;  4PJM A;  2Y6X A;  2BZB A;  1YKH B;  3C4W A;  2CLY C;  2LHN A;  3N9M A;  3QC9 A;  4ISS A;  1BR0 A;  3ZYL A;  4DVD A;  2MOZ A;  3EDV A;  2E8I A;  2KZ7 B;  4YHJ A;  2XAJ B;  3KV6 A;  3I9W A;  5FNV E;  3FXD B;  4N78 D;  4O4J E;  5CB4 E;  3O1J A;  2Q9Q B;  3H37 A;  4EOZ B;  3AA0 B;  2XHE B;  4O2B E;  3ZCJ A;  2DNX A;  1U5P A;  4H9R C;  4NUU A;  3N9L A;  4ZI3 D;  2L8K A;  1US7 B;  1D0X A;  4KBM B;  3KDS E;  2YK0 A;  3O1I A;  3I9Y A;  4OYK A;  4NUV A;  1MNE A;  2KMF A;  4H9S E;  3BQK A;  2EHO B;  4IE5 A;  5JVD E;  4IE0 A;  2CMR A;  2IC6 A;  2B1E A;  4DMV A;  3F2E A;  2X0L B;  2XAH B;  3DP7 A;  1QSD A;  4UF0 B;  3KV9 A;  2JJ9 A;  5HXC A;  3SWH A;  5J1G A;  3FXE B;  5JDN A;  4YFS A;  3AVS A;  5LOV E;  2CWO A;  4DND A;  2Y8D A;  2D0U A;  4QXB B;  2CE7 A;  1D1A A;  5JRC B;  2PG8 A;  3CML A;  4P09 A;  2EHO C;  4PJN A;  4DBR A;  2NWB A;  2XUE A;  2LM9 A;  3P8C D;  4UEM A;  4P0A A;  3ZMV B;  4IE4 A;  3ZCI A;  4TV8 E;  3NZQ A;  3D0T A;  2NTY A;  3AAA B;  3CPZ A;  4O4H E;  4K0U A;  4JLE A;  5F8P A;  1WRD A;  1UX5 A;  4H63 H;  5HAX A;  3UTK A;  4PK4 A;  3PUS A;  3ZN0 B;  3K3Q C;  2SPC A;  2X9H A;  4UEL A;  4EZH A;  1BR4 A;  3RYC E;  5HYA A;  2X68 A;  4HKA A;  5DQV A;  3N2G E;  1LVF A;  3RKO A;  3OKQ A;  2X9X A;  5FYM A;  5JH7 E;  4IGU A;  5C8Y E;  1FEW A;  4XBF B;  4IIJ E;  1MND A;  3KV5 A;  4H9Q C;  2C5I T;  3R6N A;  4PNI A;  4Z8X A;  2G0U A;  1LVK A;  3K8P C;  2CCQ A;  4J2C A;  1VOM A;  2CLY B;  3FB2 A;  3MA9 A;  2DCF A;  4PFP A;  2VWA A;  2UXN B;  1MIW A;  5HXS A;  1YW0 A;  3UUX B;  4C90 A;  4AQG A;  2KLQ A;  3E0Z A;  2LSJ A;  1QUU A;  2A2F X;  4AKR B;  4MHC A;  1LKX A;  2YIN A;  4BJN A;  2YU1 A;  4ZS3 A;  2W63 A;  2VKJ A;  2XTL A;  4CXY A;  4ERR A;  2XAF B;  4JEU B;  2YEV C;  3C4X A;  2Q9Q A;  3K3O A;  3VKH A;  1B7T A;  3FBL A;  4ZOL E;  4AKG A;  3SS1 A;  5JDQ A;  4I43 B;  1D1B A;  2C5J A;  4IE6 A;  3O1H A;  3KBU A;  3HA4 A;  2BDE A;  4OYJ A;  1D1C A;  2W61 A;  4QWN B;  4F6R C;  5LYJ E;  2WAU A;  3RYH E;  4FJO A;  3V5U A;  5KX5 E;  4ILU A;  2C5K T;  3ETU A;  3VU7 H;  3IEE A;  4UIG A;  3B57 A;  5L3G B;  1SHZ C;  3OJA A;  3OYX A;  3ZYK A;  5DJQ C;  4CI1 B;  3O9X A;  3ZN1 B;  3LFM A;  2QGS A;  2C0S A;  3KBT A;  5JDL A;  3N2K E;  4ASK A;  4BAY B;  3HI2 A;  3ANW A;  3R84 B;  3B13 A;  3AA7 B;  4AXP A;  4MBQ A;  3CKD A;  3Q5W A;  3I0O A;  2N1G A;  4EB6 E;  3E22 E;  4X1I E;  2CXD A;  5LJM A;  4AQF A;  5L2L A;  2JRK A;  2X9Y A;  3CX7 B;  2Q9Q C;  2KIN B;  1WLX A;  4KUM B;  5KDM C;  2BVM A;  3I0Q A;  5LGU B;  5ADX L;  3KVA A;  2CXL A;  1ZEE A;  4DO0 A;  2KND A;  5FXV A;  3ANW B;  2DWG A;  3PE0 A;  5KMG P;  4WBO A;  3UUN A;  2N9D A;  1HCI A;  2WWU A;  2X51 A;  2LOP A;  1VRB A;  2WBL A;  2HH7 A;  4O4L E;  3ZJ1 A;  2QA7 A;  3AB3 B;  5LBM A;  3BQL A;  4QXH B;  5LGN B;  3OBV E;  1D0Z A;  2ODU A;  4UVA B;  3ZMZ B;  3EUH A;  4M1P A;  3UUL A;  4PW8 A;  4TX5 A;  4AKL A;  4WW0 A;  3DTO A;  3FBZ A;  3TKL B;  4O4I E;  3AVR A;  2L9Q A;  5LJN A;  2M67 A;  2ZLY A;  2ZM8 A;  4KP3 C;  4MFR A;  2WM9 A;  2WMN A;  1OWA A;  1G73 A;  4X1K E;  3QUJ A;  3IBP A;  4UV9 B;  5BMV E;  2KXP B;  3NZP A;  3RX6 A;  4ZHQ E;  3VKG A;  2ZMA A;  3ZMU B;  3S4U A;  1HS7 A;  3Q5X A;  3M65 A;  3GN5 A;  2PFV A;  3BQI A;  2W00 A;  2IW5 B;  4QX7 B;  5LBQ B;  2EHO A;  3PUR A;  4I55 E;  2WMO A;  4YLH A;  2LSG A;  5HWY A;  1IJ6 A;  5CA1 E;  5F3J A;  1MMA A;  3U78 A;  1WYC A;  3HKB E;  4HFV A;  5L3B B;  3CQC B;  3ZC1 A;  5L3E B;  3PTR B;  4WNK A;  3Q9D A;  5FXX A;  3RC3 A;  4L5G A;  3ETV A;  3MZK B;  4PJJ A;  2LSY A;  4AI6 A;  1WYB A;  3CVR A;  1S94 A;  2D2S A;  4DBQ A;  5JR9 A;  4ZI3 C;  3LBX B;  3UT5 E;  4IHJ E;  2GK9 A;  2IC9 A;  2A3D A;  3KFW X;  4GYR A;  1FMW A;  2ACX A;  2X66 A;  2DHR A;  2RA1 A;  4ANJ A;  2NW7 A;  3JC6 D;  5L3C B;  5LG4 A;  2H7V C;  2VK9 A;  3PUG A;  3P7I A;  5FY7 A;  3CX6 B;  2V7L A;  2CM0 A;  1HG5 A;  1E1H B;  3NRX A;  3LBX A;  3AA6 B;  4E7Z A;  3I1A A;  4CXW A;  4WBN E;  3QK6 A;  2K9A A;  3MK7 C;  1MMG A;  4FI5 A;  2LSI A;  2BVL A;  3HKE E;  3PUA A;  3DJB A;  3ZEF B;  2LE8 A;  1HTJ F;  2VL8 A;  2UXX B;  3SRZ A;  4U74 A;  2LOS A;  5IYZ E;  3ZJ2 A;  1EZ3 A;  3RRW A;  3N9Q A;  3RRC A;  1MMN A;  4OK0 A;  4CI2 B;  4QXC B;  2XAS B;  1SA0 E;  3ZYM A;  2CXF A;  4B6X A;  2W0G A;  1O3X A;  2K24 A;  4BA9 A;  2DI4 A;  4IDZ A;  1G8X A;  5LCY A;  4OHF A;  1LRZ A;  2V7M A;  3MJX A;  4G2A A;  4XAX B;  4ZS2 A;  5J2T E;  1ZHC A;  2D0T A;  5JDH A;  5A1L A;  3MXZ A;  3C98 B;  2ES0 A;  3BK9 A;  2JMH A;  2Y48 B;  5HXR A;  3N9P A;  4MAL A;  4HGA A;  2P9B A;  3EVY A;  4PK5 A;  2MTQ A;  2K48 A;  3KV4 A;  3N5L A;  2KWH A;  3C64 A;  4EXT A;  1NWM X;  3VHL A;  4H63 V;  3H3A A;  2VB6 A;  2VKH A;  5J2U E;  5FXZ A;  2IAK A;  2PJQ A;  5L3F B;  4YJ2 E;  5HWX A;  3MKD A;  5JDG A;  2CWY A;  5JDF A;  5TAO A;  2VKO A;  5AFU L;  3LG7 A;  1NAF A;  1HF8 A;  4ZI2 D;  3PU3 A;  4O2A E;  5DQW A;  3CQX C;  3KIN B;  5JRE A;  1FMV A;  4UV8 B;  2E9X A;  2JQQ A;  3AAI A;  3N9N A;  4KMC A;  3RC8 A;  2KWI B;  2X67 A;  2Z6E A;  1T98 A;  4JEH B;  4PJL A;  5LGT B;  5LA6 E;  4EAH A;  2E9X D;  3F31 A;  3N9O A;  3HL6 A;  1D0Y A;  3NRY A;  4HE8 A;  1YKE B;  4I4T E;  2PBI A;  2XAG B;  3F57 A;  3GWH A;  3PU8 A;  3A5X A;  2CEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...