2LSIA

Solution structure of polymerase-interacting domain of human rev1 in complex with translesional synthesis polymerase kappa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'GHMAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title Insights into the scaffold mechanism of human Rev1 in translesional synthesis revealed by the structural studies on its polymerase-interacting domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lsiA00
2LSKA 2LSIA 2LSJA 4GK0E 3VU7H 4GK5E 4EXTA 4BA9A 2LSGA 2LSYA 4FJOA 2N1GA
chains in the Genus database with same CATH superfamily
2W00A 3GN5B 1UCUA 5L47A 3B13A 3W15B 4X62T 1T7SA 2BG9C 3ZLIA 3P8CD 5JQGE 1FIOA 4AQFA 2A2FX 4WNKA 2CHOA 3SS1A 4DR6T 1VCSA 2DWKA 2WM9A 1WFDA 3TLUA 4Z8XA 1WYBA 4XAXB 1OWAA 3MA9A 3MKDA 5F8PA 3PUAA 2DCFA 1R8IA 3KV9A 3A7MA 3P50A 3HR0A 4DMVA 5J2TE 1XDPA 2XASB 2E2AA 4DUYT 3UULA 3L39A 2A3DA 2UXDT 1WLXA 4ISTA 2MBGA 1BR2A 2HN1A 4A97A 3AXJA 3EUHA 4AQGA 4AQYT 2NWBA 4FJOA 2XY8B 3K3QC 5FP3A 4H9NC 4H9SE 2CCQA 2YINA 2UXXB 1IZNB 4UELA 4PFOA 3BK9A 5AQRB 2E9XD 4TN7B 2ZM0A 2YU2A 3ZMUB 3UU3A 1SUMB 2LHRA 2D0UA 3C51A 3AA1B 2X67A 3N9OA 1FEWA 4ZI2D 4ISSA 4U7IA 4UF0B 2D9DA 1WRDA 1T98A 4X65T 3UQ7A 2DLRA 2V7JA 3N2GE 1IJ6A 4HWDA 4ERRA 1OXZA 4C91A 3EAMA 2R6GF 5AQLB 3AE7A 3LBXA 4LF4T 3ABVA 3AAEB 1MIWA 1NAFA 1OEDA 2LKHA 4IE6A 4PW8A 2XQ5A 3CX6B 3IA3A 5LP6E 3AAAB 4HFEA 2W4XA 3FXEB 4DIDB 3OJAA 3RF1A 4TWFA 2VASA 4ILCA 5HXSA 4EZ4A 4DV5T 3S4UA 3ZEFB 2RA1A 4BJMA 5L3DB 4ZEYA 2BKPA 5AQPB 2FBWA 2EHOC 5KXJA 5FY7A 2KLQA 3AXJB 4B3MT 4NUVA 3D0TA 5DJQC 2XQ8A 4L9IA 2JJ9A 1D0ZA 4YSYA 5KDMC 2XAFB 1LRZA 1HX1B 3NZQA 1HFAA 4IE5A 4IE0A 1GQEA 1J5WA 2LOSA 4M1PA 3VRBA 3UFGA 2X66A 4A5XA 1IBKT 2LT3A 3CIRA 2E9XA 3GMIA 2WB5A 2E5VA 4EEDA 5CB4E 3RPUA 2JPFA 5ABEA 4IDOA 4HFDA 4YY3T 3F2EA 5KMGP 2FJAA 5J2UE 2LEHA 1MMGA 5FXZA 2LSYA 3UUNA 1D1BA 2CPTA 2XQ7A 1OEDB 4F6RC 1MIYA 2WBLA 2XSAA 1W0BA 4DNDA 3RYHE 2KT9A 2VVNA 4ZZCA 5A1LA 4O4LE 4O4JE 3OPCA 5HEJA 4UXNB 1FJGT 4MHCA 2X0LB 3R84B 4JI5T 5IWAT 3MZKB 5ABFA 2KMFA 3SFEA 3LK3B 4KX6A 1NWMX 2H3RA 2J47A 2ZLYA 5C2TA 4ILBA 1UGOA 5FYMA 3VR9A 1KNZA 4U3CA 1IAPA 3F31A 2EHOA 4JI7T 2X9WA 3LK2B 1I94T 3K3OA 4AISA 2VK9A 2OA5A 2HN2A 5C8YE 4EEBA 4LFAT 1IBMT 4O8SA 3O1IA 2KSRA 2QVAA 1EZ3A 3AE1A 1VOMA 2E9XB 4BJNA 4DV6T 3PJAJ 4OHFA 5AQOB 3K1SA 4JUYA 3WAKA 1M62A 2BS2A 5LCYA 4PAGA 1LVKA 5DABA 3PDYA 3HKDE 1MIVA 2V6YA 3V5UA 2VWAA 2IUBA 4HFBA 4B3ST 1X79A 4E7ZA 2YK0A 4UV9B 5EZYE 4DV3T 3C50A 3QOFA 4UEMA 3O1HA 4MALA 5AQIB 3IBPA 3KBUA 3FZMB 2KINB 2WWUA 4ZI7E 2CWYA 5FVLA 2LOPA 1KEYA 4ZS2A 2EHOB 4O2BE 5FXWA 2LSGA 2ODVA 3OTOT 3ZJ1A 5TAOA 5M4YA 4LF8T 2N9DA 3MK7C 4X64T 2PFVA 3ZMZB 4LFCT 2XAHB 2X51A 4ILAA 4GKKT 4YHJA 1ZV4X 5LNKA 4CXYA 3AE3A 3PUWF 4QWNB 3PUGA 2NR4A 2VL0A 3FZLB 1UK5A 2ZM8A 1XZYA 2WS3A 4NUUA 2MTQA 4QKNA 3ONLC 2NW9A 5JTGA 2CWOA 3ZYLA 5AQHB 2WWVA 2K5BB 1G8XA 1OEDE 2JMKA 5JDNA 5LHIB 2OLTA 1MMDA 2V5CA 3UQ4A 2W62A 4I4TE 4DUZT 3QUJA 1JNRA 5CA0E 1E1HB 4MLKA 4QHOA 1KNRA 3AE6A 5LYJE 4HWIB 3C4WA 3WI3A 1G73A 4KBMB 3C98B 4X20E 5E0OA 2BZBA 4MFRA 3VRAA 4COFA 4BA9A 4NPPA 4OFZA 2XAGB 3O1JA 4TNVA 5DQVA 4QXBB 2WDVA 4HWFA 4NXNT 2BKOA 1OEDC 1M7KA 2WSSV 1V9DA 1AJ3A 2LM9A 3Q5DA 2W61A 3G06A 1HX8A 3PURA 2WDRA 3CVRA 3HKBE 2NW7A 3JAFA 2WAUA 3ONJA 3HL6A 1XDOA 5LG3A 3FBLA 5LJMA 4GIWA 5JREA 2PTFA 2CLYB 2C5JA 5HWYA 4IDNA 2WZIA 3OYXA 4DV2T 2W66A 3NRXA 3QNUA 4CN4A 3ZT7A 4U74A 4GKJT 5HEGA 2XM2A 3JADA 4JI0T 2BKNA 2IAKA 3AVRA 3UU6A 4CXXA 3PUXF 2D5UA 4H63V 1MNDA 4U72A 2N1GA 3RYIE 3N9NA 4G63A 3ZC0A 4G2AA 4H9OC 4HFVA 4GYSA 3VKGA 2E9XC 1W0AA 4IL9A 4FI5A 4QXCB 3QB5A 4QX8B 3JCFA 3NRYA 3IHRA 4Q25A 4DR3T 5CGMA 2QGSA 3I9YA 3ZYKA 4AI6A 2MOZA 4HEAA 3NWIA 2KNDA 4CN6A 1D1CA 1MMAA 3K3NA 2ZM6T 4HKAA 5LHHB 3C4XA 2ZM2A 3R6NA 2VKOA 3PUYF 5J1GA 2Q9QD 4DO0A 3UT5E 1B7TA 2V7IA 4ANJA 2I59A 1XNQT 5IYZE 3LG7A 4KHPT 1HF8A 2C5KT 3ZT5A 4JI8T 4P0AA 3RQWA 3NKZA 1HG5A 4IE7A 3LJCA 2NP9A 2PJQA 2Y48B 3J9X1 4DR1T 5JDLA 3EDVA 3PU8A 2K24A 3E22E 2QA7A 2M6BA 4AIUA 5FNVE 3UU4A 2DHRA 5HCMA 4TNWA 3RIAA 1UX5A 3AVSA 4HFHA 1YW0A 2B76A 3AEDA 1ZEEA 2HPJA 2RP4A 5LBQB 3FZHB 2W63A 5L3FB 2CE7A 4EZHA 5IUXA 4IL4A 2IW5B 4DR7T 4UVBB 3PV0F 4ZXLA 1SE7A 4B6XA 5HEOA 2XTLA 4I55E 5BR8T 5JDFA 2VL8A 2H7OA 4LFBT 2VKDA 3AE9A 3LK42 5CFBA 2LE8A 2BS3A 5JR9C 2CXDA 4HTEA 4UR9A 4QX7B 3LBXB 4O4IE 3N9PA 3OKQA 5L3EB 2W67A 2BVLA 4PNIA 3EI0A 4U2ZA 3SWHA 3L3PA 5L2LA 1YD8G 3UUMA 2CXFA 1JNZA 3DJBA 2LSJA 5AQKB 4DV1T 2XHEB 3PUSA 4JEUB 3LFMA 5FL1A 3I9WA 5FY1A 4TV9E 3RYCE 2DNXA 4HFCA 3JC6C 5FMNA 5L4HA 5F3JA 1QUUA 4XBFB 3KBTA 2IHR1 1XWMA 3FZFB 5KX5E 5EK2A 4H9RC 3RGLA 2AE9A 2CBIA 2M6IA 1Z8UA 3AA7B 2V5DA 4IIJE 1HR0T 4IDZA 4AKRB 1IBLT 4V1Av 2C5IT 4KP3C 4EYYR 4DBRA 3ZKRA 3CPZA 4U33A 2KZ7B 2CLYC 3KDSE 5FL0A 4P09A 3ZT6A 1KK7A 3AE2A 3SOLA 5LA6E 2VQET 5HXCA 3NVOA 1E7PA 2LSIA 4UIGA 4YHHT 3PUVF 4JEHB 4YJ2E 4L5GA 3I0QA 3RHWA 1N32T 3CQXC 3ZCIA 4ZZBA 5JDHA 2NOXA 4IDPA 4YFSA 2V7MA 2YOEA 5JR9A 2BVMA 4GK0E 5L3BB 4YTPA 3AE8A 3M3ZB 4JI4T 1SA0E 2CMRA 4KI0F 5AQGB 2YDRA 2L8KA 5LBMA 5AQFB 4ADZA 4NIQA 3B5MA 2MAWA 3CWZB 3DTOA 3GWHA 4JLEA 4I0UA 5ABFB 2ZMAA 4PJJA 2WCAA 4EYUA 1BR0A 4F8HA 4OYKA 3RI5A 5EK3A 1N33T 2XUEA 1S94A 4CQIA 2X9YA 2WP9A 3FBZA 3T8OA 4ZI3D 3WAJA 3H3MA 3ZPOA 4YTMA 4O4HE 3AA6B 4CZZB 4N78D 4U31A 4X1KE 4QXHB 1LVFA 1S35A 3CQGB 1WYCA 2N2NA 1BR4A 3LDQB 5HXHA 2XQYA 4WYVA 2VURA 1BR1A 3AE4A 5HEUA 1ZOYA 2VQFT 3TLSA 5LGUB 1Z0PA 4KUMB 3Q9DA 4PK5A 2LRKA 3L8RA 3AE5A 4DR4T 3OVUA 5GONE 2Y6XA 3ZSSA 4WBOA 1VCTA 3ANWA 5BMVE 3RRWA 2Z6EA 2V6YB 1Y64B 2X9HA 4WZXA 5J0ZA 2XQ6A 3C4ZA 3AEEA 5JR9B 1H7CA 4EOZB 4YXDA 2XAJB 4IDQA 2UXNB 2E5LT 4HGAA 4PJLA 3RIUA 2JMHA 5ABGA 4JV5T 2HH7A 2YEVC 3UTKA 3ZN0B 2H88A 3CKDA 3E08A 5LMNT 3F57A 2W2UA 3N9MA 4B3TT 5F5WA 1LKXA 2UXCT 3PU3A 2D2SA 4HN9A 4QH4A 2KXPB 4JBWF 4O2AE 2VVSA 2NTXA 4AKIA 3U3IA 4LMKA 3CK6A 5JDQA 3H37A 2JRKA 3RC3A 2X0HA 4IGUA 2DL1A 3FXDB 2I6HA 3PTRB 3EABA 3L09A 3CX8B 1KFYA 3T1HT 2VKJA 2IDOB 4YTNA 3EHZA 3AEGA 3BQIA 2ODUA 4GOUA 3ZMSB 2A9UA 2CHNA 3ANWB 5FVKA 3N2KE 2E8IA 3FB2A 5AQVB 4LF9T 1T72A 3ETVA 2F4VT 3UFEA 2M67A 2UUCT 4PK4A 3UUXB 3KINB 4I43B 3I0OA 4YSXA 2YDQA 5LB7B 2AXDS 4ZS3A 5HCJA 3U78A 2FJEA 4L0RA 4TZ4C 3UU5A 2XZEA 2IMLA 5FXVA 5AQQB 3P4SA 5IHYA 4AKLA 2WMOA 5ABHA 2JQKA 3ONXA 3BQLA 2L3LA 3RYFE 1XNRT 4AXPA 1KNPA 2Y8DA 2QRXA 1W09A 4CN1A 5LJNA 4IHJE 4ASKA 3TLVA 2LHNA 3O9XA 1US7B 2UUAT 3TLWA 3TKLB 4EAHA 1W9RA 3ESLA 4ZI2C 3P4QA 3KV6A 4H63H 3ZC1A 1HNXT 4JI1T 1QSDA 2Q9QC 3PUZF 2X9XA 1IJ5A 1D1AA 3ZSTA 5AFUL 4X1IE 2WU2A 3OBVE 2IC9A 4I50E 4AKHA 2ES0A 3BQKA 3I1AA 3N9LA 3Q2MA 4U2YA 2K9AA 2BBJA 4EV6A 3HKEE 5H6RB 4CI3B 4TUYE 5CA1E 5HAXA 2A72A 3UU8A 2VKHA 2K48A 3QB5K 2JIWA 4EIWA 1ZKEA 4YSZA 2UUBT 2X68A 3FHNA 1N36T 2XPKA 2H89A 4WW0A 2BG9A 3P4PA 4K0KT 2XM1A 1U5PA 2CBJA 2CM0A 3RKOA 3TLTA 2H7VC 5JDMA 4CI2B 2IC6A 2CA5A 1FMVA 2V8SV 3OYZA 4KHZF 5HWXA 2NTYA 4YJ3E 2I0MA 4QH5A 2EHOD 2UXBT 3C64A 5AQMB 3NZPA 3RX6A 4YT0A 3AECA 1XMOT 2OV9A 3PE0A 2J62A 3GA8A 4TWDA 2WQYA 4OX9T 2D0TA 4DR2T 2SPCA 3AA0B 2CRBA 3T1YT 2RPAA 4H9QC 3KV5A 3ZJ2A 1D0YA 3IF8B 5AQJB 3AEAA 4DBQA 2FUPA 3V5SA 3Q5EA 4PJNA 5LHGB 4PJMA 2B1EA 2JQHA 3JAEA 5CJ5A 2LSKA 1E2AA 5JRCA 5HYAA 2Q9QA 5JVDE 5L4EA 4CI1B 1NEKA 4EGWA 1YXRA 1N34T 2PBIA 5ADXL 1HNZT 4KMCA 4A98A 3NBXX 2FJDA 3DP7A 5LGNB 3H3AA 3P7IA 2W0GA 4NXMT 3J7Yq 3CX7B 4PFPA 2BG9B 2QYWA 1YQ3A 4GK5E 5JH7E 4E7SA 1SHZC 5L3GB 4OK0A 3KV4A 3HI2A 4DR5T 1WR0A 1YKEB 4GYRA 2GK9A 3LSVA 3PJAA 3QC9A 1FMWA 4IREA 2HPLA 1DU2A 4H9PC 2V6XA 4CXWA 1WCRA 4PK6A 2YN6A 4ZOLE 2V1DB 4YLHA 2XSBA 3PUQA 2YU1A 5HXEA 3AAIA 5LGTB 2XJ7A 2BBHA 3JC6D 4EXTA 5HEHA 3B57A 3E0ZA 2XQAA 3O4XE 4LF5T 4HFIA 3RIFA 2PG8A 2XQ9A 5DQWA 5ETWA 4LF6T 5H6QB 2WDQA 5AQSB 5FY0A 5HXRA 4XZCA 1KF6A 3HKCE 2V26A 5AQTB 4TV8E 2G0UA 2UU9T 2J1DG 3MACA 4UV8B 3RIUC 5AQNB 3RC8A 2LJLA 1L0VA 5JRCB 2Q9QB 4DVDA 1YQ4A 4QH1A 3SFDA 1O3XA 1ZHCA 1UUSA 4JYAT 1CUNA 3UUBA 2ACXA 1J1JA 3M65A 2C0SA 3VKHA 2LRLA 1T8BA 3SRZA 2LM2A 1CHUA 4LMLA 4Z90A 5EK4A 4HE8A 3ZCJA 4DV7T 1HTJF 2HHHT 3AB3B 3EVYA 4AKGA 1UX4A 2XAQB 1XMQT 3IEEA 3P4RA 4JI3T 4ZI3C 2J4GA 3QK6A 4DV4T 2YDSA 3X1DA 4ZHQE 4ILUA 4B3RT 1J5ET 2P9BA 5FXXA 2KWIB 3A5XA 1HS7A 4DV0T 4TX5A 3Q5XA 3N9QA 4C90A 2KWHA 2LLYA 4TWHA 1YKHB 3RLFF 1D0XA 4P0BA 1WR6A 3P4WA 4A56A 1ZP0A 5LMUT 1X9BA 4DMWA 4AQFC 3ETUA 5JDGA 2YKSA 2V7LA 3KVBA 3N2OA 4OYJA 3GN5A 1QLBA 4X66T 5C3JA 1HCIA 1I6ZA 3RKGA 3CMLA 4JI6T 4BAYB 4UVAB 4X5TA 4LF7T 2V7KA 2K3WA 2DI4A 3KFWX 2DWGA 2ACZA 3VR8A 2FJBA 5LG4A 2BDEA 3RRCA 1NENA 4MBQA 4UVCB 3ZN1B 4K0UA 4P1NA 2JQ9A 2MYSA 3MJXA 3VHLA 1VRBA 2BS4A 3EDUA 4HWHA 3RQUA 2JQQA 4HWCA 3Q5WA 3ZMTB 5L3CB 3K8PC 1HG2A 2VB6A 1MMNA 3HA4A 3N5LA 1Y01A 2CEAA 3AEBA 4U7YA 4EB6E 4IT4A 2BG9E 2WZHA 2XQ4A 3FZKB 4IE4A 1HNWT 5AQUB 2IIUA 2WMNA 3AEFA 2L9QA 3ZMVB 2X0YA 5LXTE 4WBNE 4LMJA 4JI2T 3RH3A 3CQCB 5LOVE 3A8YC 1MNEA 4X1YE 4Z91A 3MXZA 2WY2A 1U4QA 2WU5A 3VU7H 2NW8A 2CXLA 5FKYA 3ZYMA 2XQ3A 4UF0A 1UURA 4J2CA 2LKGA 2MPKA 3KVAA
chains in the Genus database with same CATH topology
2W00A 3RYCE 2DNXA 3ZJ1A 5TAOA 3GN5B 1UCUA 5M4YA 3B13A 2VKHA 2K48A 3W15B 2N9DA 3MK7C 4EIWA 2PFVA 1ZKEA 3JC6C 2X68A 3FHNA 5FMNA 5F3JA 3ZLIA 3P8CD 4WW0A 1QUUA 5JQGE 4XBFB 3KBTA 3ZMZB 1FIOA 4AQFA 2A2FX 1U5PA 4WNKA 2CM0A 3RKOA 5KX5E 5EK2A 4H9RC 2XAHB 2X51A 2H7VC 4YHJA 3SS1A 5JDMA 4CI2B 1ZV4X 2IC6A 3AA7B 2CA5A 5LNKA 4IIJE 4CXYA 2DWKA 4IDZA 4QWNB 4AKRB 2WM9A 3PUGA 1FMVA 4V1Av 2C5IT 4KP3C 4EYYR 4DBRA 3OYZA 5HWXA 4Z8XA 1WYBA 2NTYA 3CPZA 4XAXB 4YJ3E 1OWAA 3MA9A 3MKDA 2EHOD 2KZ7B 2CLYC 5F8PA 3KDSE 3PUAA 2ZM8A 4P09A 2DCFA 3C64A 3KV9A 3NZPA 3RX6A 1KK7A 4NUUA 3SOLA 5LA6E 2MTQA 3HR0A 4DMVA 5J2TE 5HXCA 2XASB 3PE0A 4QKNA 3GA8A 3UULA 2A3DA 2LSIA 4UIGA 2NW9A 2D0TA 2CWOA 3ZYLA 2SPCA 3AA0B 1WLXA 4ISTA 2MBGA 1BR2A 2K5BB 1G8XA 3EUHA 4JEHB 4AQGA 4H9QC 4L5GA 2JMKA 2NWBA 4YJ2E 3I0QA 3KV5A 4FJOA 3ZJ2A 5JDNA 1D0YA 3IF8B 5LHIB 3K3QC 5FP3A 3CQXC 1MMDA 3ZCIA 4H9NC 4H9SE 2CCQA 2YINA 4DBQA 5JDHA 2NOXA 2W62A 4YFSA 2V7MA 4I4TE 2UXXB 1IZNB 5JR9A 2BVMA 3QUJA 3V5SA 4UELA 4PFOA 3BK9A 4GK0E 4PJNA 5L3BB 5LHGB 2E9XD 4PJMA 5CA0E 1E1HB 2B1EA 1SA0E 2CMRA 4MLKA 4QHOA 4TN7B 2ZM0A 5LYJE 2L8KA 2YU2A 5LBMA 2LSKA 4ADZA 3ZMUB 3C4WA 3WI3A 1G73A 3CWZB 3DTOA 3GWHA 4KBMB 5JRCA 5HYAA 2LHRA 2Q9QA 4JLEA 5JVDE 2ZMAA 3C98B 4PJJA 4X20E 4CI1B 2D0UA 5E0OA 3C51A 4EYUA 1BR0A 2PBIA 3AA1B 3KVAA 2X67A 3N9OA 4OYKA 1FEWA 2BZBA 4ZI2D 5ADXL 4ISSA 4MFRA 4UF0B 5EK3A 1WRDA 1T98A 4KMCA 4BA9A 3NBXX 2DLRA 2V7JA 2XUEA 3N2GE 1S94A 3DP7A 4OFZA 2X9YA 3FBZA 4CQIA 5LGNB 2XAGB 1IJ6A 3H3AA 3O1JA 3P7IA 3T8OA 4ZI3D 4ERRA 1OXZA 2W0GA 3WAJA 4C91A 3J7Yq 3CX7B 5DQVA 3LBXA 4PFPA 4QXBB 3ZPOA 4O4HE 3AA6B 5JH7E 3AAEB 4GK5E 4N78D 4CZZB 4E7SA 1MIWA 1NAFA 1SHZC 1V9DA 2WSSV 1AJ3A 4IE6A 4PW8A 5L3GB 4OK0A 2LM9A 3CX6B 4X1KE 5LP6E 4QXHB 3KV4A 3HI2A 1LVFA 1S35A 2W61A 3CQGB 1YKEB 4GYRA 2GK9A 1HX8A 3AAAB 3PURA 1WYCA 2N2NA 3CVRA 5HAXA 3HKBE 3FXEB 3QC9A 2NW7A 1BR4A 1FMWA 2WAUA 3OJAA 5HXHA 2XQYA 1BR1A 2HPLA 3HL6A 4H9PC 2VASA 4CXWA 3FBLA 5LJMA 4GIWA 4PK6A 5HXSA 5JREA 2CLYB 4ZOLE 2V1DB 2C5JA 4EZ4A 5HWYA 5LGUB 4YLHA 1Z0PA 3S4UA 4KUMB 3Q9DA 4PK5A 3ZEFB 2RA1A 3OYXA 3PUQA 2YU1A 4BJMA 5L3DB 5HXEA 3AAIA 5LGTB 2EHOC 3JC6D 5GONE 4EXTA 2Y6XA 4WBOA 3B57A 5FY7A 3E0ZA 3NRXA 3ANWA 5BMVE 3RRWA 2KLQA 3O4XE 4NUVA 4U74A 3D0TA 5DJQC 2Z6EA 4L9IA 2PG8A 2JJ9A 1Y64B 2X9HA 5DQWA 5ETWA 1D0ZA 5H6QB 2IAKA 3AVRA 5KDMC 3C4ZA 5FY0A 2XAFB 5HXRA 4CXXA 5JR9B 4XZCA 1LRZA 3HKCE 1H7CA 2D5UA 2V26A 3NZQA 1HFAA 4EOZB 4H63V 4TV8E 2G0UA 2XAJB 4IE5A 1MNDA 4IE0A 4U72A 2UXNB 2J1DG 3MACA 4UV8B 2N1GA 3RYIE 3N9NA 3RC8A 2LJLA 4G63A 2LOSA 4HGAA 4M1PA 4PJLA 5JRCB 2JMHA 2Q9QB 3ZC0A 4DVDA 4G2AA 4H9OC 2X66A 4HFVA 1O3XA 4GYSA 2HH7A 2E9XC 1ZHCA 3VKGA 2YEVC 1CUNA 2LT3A 4FI5A 2ACXA 3UTKA 3M65A 3ZN0B 2E9XA 2C0SA 4QXCB 3VKHA 3GMIA 3CKDA 3E08A 4QX8B 3SRZA 3NRYA 3F57A 5CB4E 2JPFA 3IHRA 3RPUA 5EK4A 4HE8A 3ZCJA 3F2EA 5KMGP 2QGSA 5J2UE 3N9MA 3I9YA 2LEHA 1MMGA 1HTJF 4AKGA 3AB3B 3EVYA 5FXZA 2LSYA 3UUNA 3ZYKA 2MOZA 4AI6A 1D1BA 1UX4A 2XAQB 1LKXA 2KNDA 4HEAA 1D1CA 3IEEA 1MMAA 3K3NA 3PU3A 4HKAA 2D2SA 4HN9A 2KXPB 5LHHB 3C4XA 2ZM2A 4F6RC 4ZI3C 1MIYA 4O2AE 2NTXA 2VKOA 5J1GA 3R6NA 2WBLA 3QK6A 2Q9QD 4AKIA 4DO0A 3UT5E 3U3IA 1B7TA 2V7IA 4DNDA 3RYHE 5JDQA 3H37A 2KT9A 4ANJA 2JRKA 3RC3A 5A1LA 4IGUA 3FXDB 4ZHQE 4O4LE 4O4JE 4ILUA 2I59A 3PTRB 4UXNB 3L09A 3CX8B 4MHCA 2X0LB 3R84B 5IYZE 2P9BA 5FXXA 3LG7A 2KWIB 2VKJA 3A5XA 1HS7A 3MZKB 4TX5A 3BQIA 3Q5XA 2ODUA 1HF8A 2C5KT 3N9QA 4GOUA 4C90A 2KMFA 3ZMSB 2KWHA 4P0AA 1YKHB 1D0XA 3LK3B 1HG5A 3ANWB 4IE7A 1NWMX 3N2KE 1WR6A 3LJCA 2E8IA 2H3RA 2NP9A 4P0BA 3FB2A 2PJQA 4A56A 3ETVA 2ZLYA 2Y48B 3J9X1 3UFEA 4DMWA 2M67A 4PK4A 3UUXB 3KINB 5FYMA 4AQFC 3ETUA 5JDGA 4I43B 3I0OA 5JDLA 1KNZA 3EDVA 3PU8A 2K24A 1IAPA 3E22E 3F31A 2EHOA 2X9WA 3LK2B 2QA7A 2V7LA 3KVBA 3K3OA 3N2OA 2VK9A 4OYJA 5FNVE 4ZS3A 2DHRA 3U78A 2OA5A 4L0RA 3GN5A 5C8YE 4TZ4C 1UX5A 4O8SA 3AVSA 1HCIA 5FXVA 1YW0A 3O1IA 1ZEEA 2HPJA 3CMLA 5IHYA 1EZ3A 4BAYB 2RP4A 4UVAB 4AKLA 1VOMA 2E9XB 4BJNA 2V7KA 2WMOA 2DI4A 3KFWX 5LBQB 2DWGA 4OHFA 2W63A 5L3FB 2CE7A 4EZHA 5LG4A 4JUYA 3WAKA 3ONXA 2BDEA 3RRCA 3BQLA 2L3LA 2IW5B 3RYFE 4MBQA 4UVCB 5LCYA 4K0UA 3ZN1B 4PAGA 4UVBB 1LVKA 5DABA 2MYSA 4AXPA 3PDYA 2Y8DA 3MJXA 3VHLA 1VRBA 4B6XA 3HKDE 2XTLA 4I55E 3EDUA 5JDFA 5LJNA 1MIVA 2JQQA 2VL8A 3Q5WA 4IHJE 4ASKA 2H7OA 2LHNA 3O9XA 2VKDA 3ZMTB 3K8PC 1US7B 3V5UA 1HG2A 5L3CB 2VB6A 2VWAA 1MMNA 3LK42 3HA4A 2LE8A 3N5LA 3TKLB 5JR9C 4EAHA 2CXDA 2CEAA 4HTEA 4QX7B 3LBXB 3ESLA 4O4IE 4EB6E 4ZI2C 3N9PA 3KV6A 3OKQA 4H63H 5L3EB 3ZC1A 4IE4A 1QSDA 2Q9QC 2BVLA 2X9XA 2WMNA 4PNIA 1IJ5A 1X79A 2L9QA 4E7ZA 1D1AA 5AFUL 3ZMVB 5LXTE 4WBNE 2YK0A 4X1IE 3SWHA 3L3PA 4UV9B 5EZYE 5L2LA 1YD8G 3C50A 3UUMA 4UEMA 2CXFA 3RH3A 3CQCB 3OBVE 5LOVE 1MNEA 3DJBA 4X1YE 2LSJA 2IC9A 3MXZA 4I50E 4AKHA 3O1HA 4MALA 1U4QA 2ES0A 2XHEB 3BQKA 3I1AA 3IBPA 3KBUA 3N9LA 3Q2MA 3VU7H 2K9AA 2NW8A 2CXLA 2KINB 2WWUA 3HKEE 3PUSA 5H6RB 4ZI7E 3ZYMA 2CWYA 4CI3B 2LOPA 4TUYE 4JEUB 4ZS2A 4UF0A 2EHOB 3LFMA 4J2CA 3I9WA 5CA1E 4O2BE 5FXWA 5FY1A 2LSGA 2ODVA 4TV9E 2A72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSK A;  2LSI A;  2LSJ A;  4GK0 E;  3VU7 H;  4GK5 E;  4EXT A;  4BA9 A;  2LSG A;  2LSY A;  4FJO A;  2N1G A; 
#chains in the Genus database with same CATH topology
 2W00 A;  3GN5 B;  1UCU A;  5L47 A;  3B13 A;  3W15 B;  4X62 T;  1T7S A;  2BG9 C;  3ZLI A;  3P8C D;  5JQG E;  1FIO A;  4AQF A;  2A2F X;  4WNK A;  2CHO A;  3SS1 A;  4DR6 T;  1VCS A;  2DWK A;  2WM9 A;  1WFD A;  3TLU A;  4Z8X A;  1WYB A;  4XAX B;  1OWA A;  3MA9 A;  3MKD A;  5F8P A;  3PUA A;  2DCF A;  1R8I A;  3KV9 A;  3A7M A;  3P50 A;  3HR0 A;  4DMV A;  5J2T E;  1XDP A;  2XAS B;  2E2A A;  4DUY T;  3UUL A;  3L39 A;  2A3D A;  2UXD T;  1WLX A;  4IST A;  2MBG A;  1BR2 A;  2HN1 A;  4A97 A;  3AXJ A;  3EUH A;  4AQG A;  4AQY T;  2NWB A;  4FJO A;  2XY8 B;  3K3Q C;  5FP3 A;  4H9N C;  4H9S E;  2CCQ A;  2YIN A;  2UXX B;  1IZN B;  4UEL A;  4PFO A;  3BK9 A;  5AQR B;  2E9X D;  4TN7 B;  2ZM0 A;  2YU2 A;  3ZMU B;  3UU3 A;  1SUM B;  2LHR A;  2D0U A;  3C51 A;  3AA1 B;  2X67 A;  3N9O A;  1FEW A;  4ZI2 D;  4ISS A;  4U7I A;  4UF0 B;  2D9D A;  1WRD A;  1T98 A;  4X65 T;  3UQ7 A;  2DLR A;  2V7J A;  3N2G E;  1IJ6 A;  4HWD A;  4ERR A;  1OXZ A;  4C91 A;  3EAM A;  2R6G F;  5AQL B;  3AE7 A;  3LBX A;  4LF4 T;  3ABV A;  3AAE B;  1MIW A;  1NAF A;  1OED A;  2LKH A;  4IE6 A;  4PW8 A;  2XQ5 A;  3CX6 B;  3IA3 A;  5LP6 E;  3AAA B;  4HFE A;  2W4X A;  3FXE B;  4DID B;  3OJA A;  3RF1 A;  4TWF A;  2VAS A;  4ILC A;  5HXS A;  4EZ4 A;  4DV5 T;  3S4U A;  3ZEF B;  2RA1 A;  4BJM A;  5L3D B;  4ZEY A;  2BKP A;  5AQP B;  2FBW A;  2EHO C;  5KXJ A;  5FY7 A;  2KLQ A;  3AXJ B;  4B3M T;  4NUV A;  3D0T A;  5DJQ C;  2XQ8 A;  4L9I A;  2JJ9 A;  1D0Z A;  4YSY A;  5KDM C;  2XAF B;  1LRZ A;  1HX1 B;  3NZQ A;  1HFA A;  4IE5 A;  4IE0 A;  1GQE A;  1J5W A;  2LOS A;  4M1P A;  3VRB A;  3UFG A;  2X66 A;  4A5X A;  1IBK T;  2LT3 A;  3CIR A;  2E9X A;  3GMI A;  2WB5 A;  2E5V A;  4EED A;  5CB4 E;  3RPU A;  2JPF A;  5ABE A;  4IDO A;  4HFD A;  4YY3 T;  3F2E A;  5KMG P;  2FJA A;  5J2U E;  2LEH A;  1MMG A;  5FXZ A;  2LSY A;  3UUN A;  1D1B A;  2CPT A;  2XQ7 A;  1OED B;  4F6R C;  1MIY A;  2WBL A;  2XSA A;  1W0B A;  4DND A;  3RYH E;  2KT9 A;  2VVN A;  4ZZC A;  5A1L A;  4O4L E;  4O4J E;  3OPC A;  5HEJ A;  4UXN B;  1FJG T;  4MHC A;  2X0L B;  3R84 B;  4JI5 T;  5IWA T;  3MZK B;  5ABF A;  2KMF A;  3SFE A;  3LK3 B;  4KX6 A;  1NWM X;  2H3R A;  2J47 A;  2ZLY A;  5C2T A;  4ILB A;  1UGO A;  5FYM A;  3VR9 A;  1KNZ A;  4U3C A;  1IAP A;  3F31 A;  2EHO A;  4JI7 T;  2X9W A;  3LK2 B;  1I94 T;  3K3O A;  4AIS A;  2VK9 A;  2OA5 A;  2HN2 A;  5C8Y E;  4EEB A;  4LFA T;  1IBM T;  4O8S A;  3O1I A;  2KSR A;  2QVA A;  1EZ3 A;  3AE1 A;  1VOM A;  2E9X B;  4BJN A;  4DV6 T;  3PJA J;  4OHF A;  5AQO B;  3K1S A;  4JUY A;  3WAK A;  1M62 A;  2BS2 A;  5LCY A;  4PAG A;  1LVK A;  5DAB A;  3PDY A;  3HKD E;  1MIV A;  2V6Y A;  3V5U A;  2VWA A;  2IUB A;  4HFB A;  4B3S T;  1X79 A;  4E7Z A;  2YK0 A;  4UV9 B;  5EZY E;  4DV3 T;  3C50 A;  3QOF A;  4UEM A;  3O1H A;  4MAL A;  5AQI B;  3IBP A;  3KBU A;  3FZM B;  2KIN B;  2WWU A;  4ZI7 E;  2CWY A;  5FVL A;  2LOP A;  1KEY A;  4ZS2 A;  2EHO B;  4O2B E;  5FXW A;  2LSG A;  2ODV A;  3OTO T;  3ZJ1 A;  5TAO A;  5M4Y A;  4LF8 T;  2N9D A;  3MK7 C;  4X64 T;  2PFV A;  3ZMZ B;  4LFC T;  2XAH B;  2X51 A;  4ILA A;  4GKK T;  4YHJ A;  1ZV4 X;  5LNK A;  4CXY A;  3AE3 A;  3PUW F;  4QWN B;  3PUG A;  2NR4 A;  2VL0 A;  3FZL B;  1UK5 A;  2ZM8 A;  1XZY A;  2WS3 A;  4NUU A;  2MTQ A;  4QKN A;  3ONL C;  2NW9 A;  5JTG A;  2CWO A;  3ZYL A;  5AQH B;  2WWV A;  2K5B B;  1G8X A;  1OED E;  2JMK A;  5JDN A;  5LHI B;  2OLT A;  1MMD A;  2V5C A;  3UQ4 A;  2W62 A;  4I4T E;  4DUZ T;  3QUJ A;  1JNR A;  5CA0 E;  1E1H B;  4MLK A;  4QHO A;  1KNR A;  3AE6 A;  5LYJ E;  4HWI B;  3C4W A;  3WI3 A;  1G73 A;  4KBM B;  3C98 B;  4X20 E;  5E0O A;  2BZB A;  4MFR A;  3VRA A;  4COF A;  4BA9 A;  4NPP A;  4OFZ A;  2XAG B;  3O1J A;  4TNV A;  5DQV A;  4QXB B;  2WDV A;  4HWF A;  4NXN T;  2BKO A;  1OED C;  1M7K A;  2WSS V;  1V9D A;  1AJ3 A;  2LM9 A;  3Q5D A;  2W61 A;  3G06 A;  1HX8 A;  3PUR A;  2WDR A;  3CVR A;  3HKB E;  2NW7 A;  3JAF A;  2WAU A;  3ONJ A;  3HL6 A;  1XDO A;  5LG3 A;  3FBL A;  5LJM A;  4GIW A;  5JRE A;  2PTF A;  2CLY B;  2C5J A;  5HWY A;  4IDN A;  2WZI A;  3OYX A;  4DV2 T;  2W66 A;  3NRX A;  3QNU A;  4CN4 A;  3ZT7 A;  4U74 A;  4GKJ T;  5HEG A;  2XM2 A;  3JAD A;  4JI0 T;  2BKN A;  2IAK A;  3AVR A;  3UU6 A;  4CXX A;  3PUX F;  2D5U A;  4H63 V;  1MND A;  4U72 A;  2N1G A;  3RYI E;  3N9N A;  4G63 A;  3ZC0 A;  4G2A A;  4H9O C;  4HFV A;  4GYS A;  3VKG A;  2E9X C;  1W0A A;  4IL9 A;  4FI5 A;  4QXC B;  3QB5 A;  4QX8 B;  3JCF A;  3NRY A;  3IHR A;  4Q25 A;  4DR3 T;  5CGM A;  2QGS A;  3I9Y A;  3ZYK A;  4AI6 A;  2MOZ A;  4HEA A;  3NWI A;  2KND A;  4CN6 A;  1D1C A;  1MMA A;  3K3N A;  2ZM6 T;  4HKA A;  5LHH B;  3C4X A;  2ZM2 A;  3R6N A;  2VKO A;  3PUY F;  5J1G A;  2Q9Q D;  4DO0 A;  3UT5 E;  1B7T A;  2V7I A;  4ANJ A;  2I59 A;  1XNQ T;  5IYZ E;  3LG7 A;  4KHP T;  1HF8 A;  2C5K T;  3ZT5 A;  4JI8 T;  4P0A A;  3RQW A;  3NKZ A;  1HG5 A;  4IE7 A;  3LJC A;  2NP9 A;  2PJQ A;  2Y48 B;  3J9X 1;  4DR1 T;  5JDL A;  3EDV A;  3PU8 A;  2K24 A;  3E22 E;  2QA7 A;  2M6B A;  4AIU A;  5FNV E;  3UU4 A;  2DHR A;  5HCM A;  4TNW A;  3RIA A;  1UX5 A;  3AVS A;  4HFH A;  1YW0 A;  2B76 A;  3AED A;  1ZEE A;  2HPJ A;  2RP4 A;  5LBQ B;  3FZH B;  2W63 A;  5L3F B;  2CE7 A;  4EZH A;  5IUX A;  4IL4 A;  2IW5 B;  4DR7 T;  4UVB B;  3PV0 F;  4ZXL A;  1SE7 A;  4B6X A;  5HEO A;  2XTL A;  4I55 E;  5BR8 T;  5JDF A;  2VL8 A;  2H7O A;  4LFB T;  2VKD A;  3AE9 A;  3LK4 2;  5CFB A;  2LE8 A;  2BS3 A;  5JR9 C;  2CXD A;  4HTE A;  4UR9 A;  4QX7 B;  3LBX B;  4O4I E;  3N9P A;  3OKQ A;  5L3E B;  2W67 A;  2BVL A;  4PNI A;  3EI0 A;  4U2Z A;  3SWH A;  3L3P A;  5L2L A;  1YD8 G;  3UUM A;  2CXF A;  1JNZ A;  3DJB A;  2LSJ A;  5AQK B;  4DV1 T;  2XHE B;  3PUS A;  4JEU B;  3LFM A;  5FL1 A;  3I9W A;  5FY1 A;  4TV9 E;  3RYC E;  2DNX A;  4HFC A;  3JC6 C;  5FMN A;  5L4H A;  5F3J A;  1QUU A;  4XBF B;  3KBT A;  2IHR 1;  1XWM A;  3FZF B;  5KX5 E;  5EK2 A;  4H9R C;  3RGL A;  2AE9 A;  2CBI A;  2M6I A;  1Z8U A;  3AA7 B;  2V5D A;  4IIJ E;  1HR0 T;  4IDZ A;  4AKR B;  1IBL T;  4V1A v;  2C5I T;  4KP3 C;  4EYY R;  4DBR A;  3ZKR A;  3CPZ A;  4U33 A;  2KZ7 B;  2CLY C;  3KDS E;  5FL0 A;  4P09 A;  3ZT6 A;  1KK7 A;  3AE2 A;  3SOL A;  5LA6 E;  2VQE T;  5HXC A;  3NVO A;  1E7P A;  2LSI A;  4UIG A;  4YHH T;  3PUV F;  4JEH B;  4YJ2 E;  4L5G A;  3I0Q A;  3RHW A;  1N32 T;  3CQX C;  3ZCI A;  4ZZB A;  5JDH A;  2NOX A;  4IDP A;  4YFS A;  2V7M A;  2YOE A;  5JR9 A;  2BVM A;  4GK0 E;  5L3B B;  4YTP A;  3AE8 A;  3M3Z B;  4JI4 T;  1SA0 E;  2CMR A;  4KI0 F;  5AQG B;  2YDR A;  2L8K A;  5LBM A;  5AQF B;  4ADZ A;  4NIQ A;  3B5M A;  2MAW A;  3CWZ B;  3DTO A;  3GWH A;  4JLE A;  4I0U A;  5ABF B;  2ZMA A;  4PJJ A;  2WCA A;  4EYU A;  1BR0 A;  4F8H A;  4OYK A;  3RI5 A;  5EK3 A;  1N33 T;  2XUE A;  1S94 A;  4CQI A;  2X9Y A;  2WP9 A;  3FBZ A;  3T8O A;  4ZI3 D;  3WAJ A;  3H3M A;  3ZPO A;  4YTM A;  4O4H E;  3AA6 B;  4CZZ B;  4N78 D;  4U31 A;  4X1K E;  4QXH B;  1LVF A;  1S35 A;  3CQG B;  1WYC A;  2N2N A;  1BR4 A;  3LDQ B;  5HXH A;  2XQY A;  4WYV A;  2VUR A;  1BR1 A;  3AE4 A;  5HEU A;  1ZOY A;  2VQF T;  3TLS A;  5LGU B;  1Z0P A;  4KUM B;  3Q9D A;  4PK5 A;  2LRK A;  3L8R A;  3AE5 A;  4DR4 T;  3OVU A;  5GON E;  2Y6X A;  3ZSS A;  4WBO A;  1VCT A;  3ANW A;  5BMV E;  3RRW A;  2Z6E A;  2V6Y B;  1Y64 B;  2X9H A;  4WZX A;  5J0Z A;  2XQ6 A;  3C4Z A;  3AEE A;  5JR9 B;  1H7C A;  4EOZ B;  4YXD A;  2XAJ B;  4IDQ A;  2UXN B;  2E5L T;  4HGA A;  4PJL A;  3RIU A;  2JMH A;  5ABG A;  4JV5 T;  2HH7 A;  2YEV C;  3UTK A;  3ZN0 B;  2H88 A;  3CKD A;  3E08 A;  5LMN T;  3F57 A;  2W2U A;  3N9M A;  4B3T T;  5F5W A;  1LKX A;  2UXC T;  3PU3 A;  2D2S A;  4HN9 A;  4QH4 A;  2KXP B;  4JBW F;  4O2A E;  2VVS A;  2NTX A;  4AKI A;  3U3I A;  4LMK A;  3CK6 A;  5JDQ A;  3H37 A;  2JRK A;  3RC3 A;  2X0H A;  4IGU A;  2DL1 A;  3FXD B;  2I6H A;  3PTR B;  3EAB A;  3L09 A;  3CX8 B;  1KFY A;  3T1H T;  2VKJ A;  2IDO B;  4YTN A;  3EHZ A;  3AEG A;  3BQI A;  2ODU A;  4GOU A;  3ZMS B;  2A9U A;  2CHN A;  3ANW B;  5FVK A;  3N2K E;  2E8I A;  3FB2 A;  5AQV B;  4LF9 T;  1T72 A;  3ETV A;  2F4V T;  3UFE A;  2M67 A;  2UUC T;  4PK4 A;  3UUX B;  3KIN B;  4I43 B;  3I0O A;  4YSX A;  2YDQ A;  5LB7 B;  2AXD S;  4ZS3 A;  5HCJ A;  3U78 A;  2FJE A;  4L0R A;  4TZ4 C;  3UU5 A;  2XZE A;  2IML A;  5FXV A;  5AQQ B;  3P4S A;  5IHY A;  4AKL A;  2WMO A;  5ABH A;  2JQK A;  3ONX A;  3BQL A;  2L3L A;  3RYF E;  1XNR T;  4AXP A;  1KNP A;  2Y8D A;  2QRX A;  1W09 A;  4CN1 A;  5LJN A;  4IHJ E;  4ASK A;  3TLV A;  2LHN A;  3O9X A;  1US7 B;  2UUA T;  3TLW A;  3TKL B;  4EAH A;  1W9R A;  3ESL A;  4ZI2 C;  3P4Q A;  3KV6 A;  4H63 H;  3ZC1 A;  1HNX T;  4JI1 T;  1QSD A;  2Q9Q C;  3PUZ F;  2X9X A;  1IJ5 A;  1D1A A;  3ZST A;  5AFU L;  4X1I E;  2WU2 A;  3OBV E;  2IC9 A;  4I50 E;  4AKH A;  2ES0 A;  3BQK A;  3I1A A;  3N9L A;  3Q2M A;  4U2Y A;  2K9A A;  2BBJ A;  4EV6 A;  3HKE E;  5H6R B;  4CI3 B;  4TUY E;  5CA1 E;  5HAX A;  2A72 A;  3UU8 A;  2VKH A;  2K48 A;  3QB5 K;  2JIW A;  4EIW A;  1ZKE A;  4YSZ A;  2UUB T;  2X68 A;  3FHN A;  1N36 T;  2XPK A;  2H89 A;  4WW0 A;  2BG9 A;  3P4P A;  4K0K T;  2XM1 A;  1U5P A;  2CBJ A;  2CM0 A;  3RKO A;  3TLT A;  2H7V C;  5JDM A;  4CI2 B;  2IC6 A;  2CA5 A;  1FMV A;  2V8S V;  3OYZ A;  4KHZ F;  5HWX A;  2NTY A;  4YJ3 E;  2I0M A;  4QH5 A;  2EHO D;  2UXB T;  3C64 A;  5AQM B;  3NZP A;  3RX6 A;  4YT0 A;  3AEC A;  1XMO T;  2OV9 A;  3PE0 A;  2J62 A;  3GA8 A;  4TWD A;  2WQY A;  4OX9 T;  2D0T A;  4DR2 T;  2SPC A;  3AA0 B;  2CRB A;  3T1Y T;  2RPA A;  4H9Q C;  3KV5 A;  3ZJ2 A;  1D0Y A;  3IF8 B;  5AQJ B;  3AEA A;  4DBQ A;  2FUP A;  3V5S A;  3Q5E A;  4PJN A;  5LHG B;  4PJM A;  2B1E A;  2JQH A;  3JAE A;  5CJ5 A;  2LSK A;  1E2A A;  5JRC A;  5HYA A;  2Q9Q A;  5JVD E;  5L4E A;  4CI1 B;  1NEK A;  4EGW A;  1YXR A;  1N34 T;  2PBI A;  5ADX L;  1HNZ T;  4KMC A;  4A98 A;  3NBX X;  2FJD A;  3DP7 A;  5LGN B;  3H3A A;  3P7I A;  2W0G A;  4NXM T;  3J7Y q;  3CX7 B;  4PFP A;  2BG9 B;  2QYW A;  1YQ3 A;  4GK5 E;  5JH7 E;  4E7S A;  1SHZ C;  5L3G B;  4OK0 A;  3KV4 A;  3HI2 A;  4DR5 T;  1WR0 A;  1YKE B;  4GYR A;  2GK9 A;  3LSV A;  3PJA A;  3QC9 A;  1FMW A;  4IRE A;  2HPL A;  1DU2 A;  4H9P C;  2V6X A;  4CXW A;  1WCR A;  4PK6 A;  2YN6 A;  4ZOL E;  2V1D B;  4YLH A;  2XSB A;  3PUQ A;  2YU1 A;  5HXE A;  3AAI A;  5LGT B;  2XJ7 A;  2BBH A;  3JC6 D;  4EXT A;  5HEH A;  3B57 A;  3E0Z A;  2XQA A;  3O4X E;  4LF5 T;  4HFI A;  3RIF A;  2PG8 A;  2XQ9 A;  5DQW A;  5ETW A;  4LF6 T;  5H6Q B;  2WDQ A;  5AQS B;  5FY0 A;  5HXR A;  4XZC A;  1KF6 A;  3HKC E;  2V26 A;  5AQT B;  4TV8 E;  2G0U A;  2UU9 T;  2J1D G;  3MAC A;  4UV8 B;  3RIU C;  5AQN B;  3RC8 A;  2LJL A;  1L0V A;  5JRC B;  2Q9Q B;  4DVD A;  1YQ4 A;  4QH1 A;  3SFD A;  1O3X A;  1ZHC A;  1UUS A;  4JYA T;  1CUN A;  3UUB A;  2ACX A;  1J1J A;  3M65 A;  2C0S A;  3VKH A;  2LRL A;  1T8B A;  3SRZ A;  2LM2 A;  1CHU A;  4LML A;  4Z90 A;  5EK4 A;  4HE8 A;  3ZCJ A;  4DV7 T;  1HTJ F;  2HHH T;  3AB3 B;  3EVY A;  4AKG A;  1UX4 A;  2XAQ B;  1XMQ T;  3IEE A;  3P4R A;  4JI3 T;  4ZI3 C;  2J4G A;  3QK6 A;  4DV4 T;  2YDS A;  3X1D A;  4ZHQ E;  4ILU A;  4B3R T;  1J5E T;  2P9B A;  5FXX A;  2KWI B;  3A5X A;  1HS7 A;  4DV0 T;  4TX5 A;  3Q5X A;  3N9Q A;  4C90 A;  2KWH A;  2LLY A;  4TWH A;  1YKH B;  3RLF F;  1D0X A;  4P0B A;  1WR6 A;  3P4W A;  4A56 A;  1ZP0 A;  5LMU T;  1X9B A;  4DMW A;  4AQF C;  3ETU A;  5JDG A;  2YKS A;  2V7L A;  3KVB A;  3N2O A;  4OYJ A;  3GN5 A;  1QLB A;  4X66 T;  5C3J A;  1HCI A;  1I6Z A;  3RKG A;  3CML A;  4JI6 T;  4BAY B;  4UVA B;  4X5T A;  4LF7 T;  2V7K A;  2K3W A;  2DI4 A;  3KFW X;  2DWG A;  2ACZ A;  3VR8 A;  2FJB A;  5LG4 A;  2BDE A;  3RRC A;  1NEN A;  4MBQ A;  4UVC B;  3ZN1 B;  4K0U A;  4P1N A;  2JQ9 A;  2MYS A;  3MJX A;  3VHL A;  1VRB A;  2BS4 A;  3EDU A;  4HWH A;  3RQU A;  2JQQ A;  4HWC A;  3Q5W A;  3ZMT B;  5L3C B;  3K8P C;  1HG2 A;  2VB6 A;  1MMN A;  3HA4 A;  3N5L A;  1Y01 A;  2CEA A;  3AEB A;  4U7Y A;  4EB6 E;  4IT4 A;  2BG9 E;  2WZH A;  2XQ4 A;  3FZK B;  4IE4 A;  1HNW T;  5AQU B;  2IIU A;  2WMN A;  3AEF A;  2L9Q A;  3ZMV B;  2X0Y A;  5LXT E;  4WBN E;  4LMJ A;  4JI2 T;  3RH3 A;  3CQC B;  5LOV E;  3A8Y C;  1MNE A;  4X1Y E;  4Z91 A;  3MXZ A;  2WY2 A;  1U4Q A;  2WU5 A;  3VU7 H;  2NW8 A;  2CXL A;  5FKY A;  3ZYM A;  2XQ3 A;  4UF0 A;  1UUR A;  4J2C A;  2LKG A;  2MPK A;  3KVA A; 
#chains in the Genus database with same CATH homology
 2W00 A;  3RYC E;  2DNX A;  3ZJ1 A;  5TAO A;  3GN5 B;  1UCU A;  5M4Y A;  3B13 A;  2VKH A;  2K48 A;  3W15 B;  2N9D A;  3MK7 C;  4EIW A;  2PFV A;  1ZKE A;  3JC6 C;  2X68 A;  3FHN A;  5FMN A;  5F3J A;  3ZLI A;  3P8C D;  4WW0 A;  1QUU A;  5JQG E;  4XBF B;  3KBT A;  3ZMZ B;  1FIO A;  4AQF A;  2A2F X;  1U5P A;  4WNK A;  2CM0 A;  3RKO A;  5KX5 E;  5EK2 A;  4H9R C;  2XAH B;  2X51 A;  2H7V C;  4YHJ A;  3SS1 A;  5JDM A;  4CI2 B;  1ZV4 X;  2IC6 A;  3AA7 B;  2CA5 A;  5LNK A;  4IIJ E;  4CXY A;  2DWK A;  4IDZ A;  4QWN B;  4AKR B;  2WM9 A;  3PUG A;  1FMV A;  4V1A v;  2C5I T;  4KP3 C;  4EYY R;  4DBR A;  3OYZ A;  5HWX A;  4Z8X A;  1WYB A;  2NTY A;  3CPZ A;  4XAX B;  4YJ3 E;  1OWA A;  3MA9 A;  3MKD A;  2EHO D;  2KZ7 B;  2CLY C;  5F8P A;  3KDS E;  3PUA A;  2ZM8 A;  4P09 A;  2DCF A;  3C64 A;  3KV9 A;  3NZP A;  3RX6 A;  1KK7 A;  4NUU A;  3SOL A;  5LA6 E;  2MTQ A;  3HR0 A;  4DMV A;  5J2T E;  5HXC A;  2XAS B;  3PE0 A;  4QKN A;  3GA8 A;  3UUL A;  2A3D A;  2LSI A;  4UIG A;  2NW9 A;  2D0T A;  2CWO A;  3ZYL A;  2SPC A;  3AA0 B;  1WLX A;  4IST A;  2MBG A;  1BR2 A;  2K5B B;  1G8X A;  3EUH A;  4JEH B;  4AQG A;  4H9Q C;  4L5G A;  2JMK A;  2NWB A;  4YJ2 E;  3I0Q A;  3KV5 A;  4FJO A;  3ZJ2 A;  5JDN A;  1D0Y A;  3IF8 B;  5LHI B;  3K3Q C;  5FP3 A;  3CQX C;  1MMD A;  3ZCI A;  4H9N C;  4H9S E;  2CCQ A;  2YIN A;  4DBQ A;  5JDH A;  2NOX A;  2W62 A;  4YFS A;  2V7M A;  4I4T E;  2UXX B;  1IZN B;  5JR9 A;  2BVM A;  3QUJ A;  3V5S A;  4UEL A;  4PFO A;  3BK9 A;  4GK0 E;  4PJN A;  5L3B B;  5LHG B;  2E9X D;  4PJM A;  5CA0 E;  1E1H B;  2B1E A;  1SA0 E;  2CMR A;  4MLK A;  4QHO A;  4TN7 B;  2ZM0 A;  5LYJ E;  2L8K A;  2YU2 A;  5LBM A;  2LSK A;  4ADZ A;  3ZMU B;  3C4W A;  3WI3 A;  1G73 A;  3CWZ B;  3DTO A;  3GWH A;  4KBM B;  5JRC A;  5HYA A;  2LHR A;  2Q9Q A;  4JLE A;  5JVD E;  2ZMA A;  3C98 B;  4PJJ A;  4X20 E;  4CI1 B;  2D0U A;  5E0O A;  3C51 A;  4EYU A;  1BR0 A;  2PBI A;  3AA1 B;  3KVA A;  2X67 A;  3N9O A;  4OYK A;  1FEW A;  2BZB A;  4ZI2 D;  5ADX L;  4ISS A;  4MFR A;  4UF0 B;  5EK3 A;  1WRD A;  1T98 A;  4KMC A;  4BA9 A;  3NBX X;  2DLR A;  2V7J A;  2XUE A;  3N2G E;  1S94 A;  3DP7 A;  4OFZ A;  2X9Y A;  3FBZ A;  4CQI A;  5LGN B;  2XAG B;  1IJ6 A;  3H3A A;  3O1J A;  3P7I A;  3T8O A;  4ZI3 D;  4ERR A;  1OXZ A;  2W0G A;  3WAJ A;  4C91 A;  3J7Y q;  3CX7 B;  5DQV A;  3LBX A;  4PFP A;  4QXB B;  3ZPO A;  4O4H E;  3AA6 B;  5JH7 E;  3AAE B;  4GK5 E;  4N78 D;  4CZZ B;  4E7S A;  1MIW A;  1NAF A;  1SHZ C;  1V9D A;  2WSS V;  1AJ3 A;  4IE6 A;  4PW8 A;  5L3G B;  4OK0 A;  2LM9 A;  3CX6 B;  4X1K E;  5LP6 E;  4QXH B;  3KV4 A;  3HI2 A;  1LVF A;  1S35 A;  2W61 A;  3CQG B;  1YKE B;  4GYR A;  2GK9 A;  1HX8 A;  3AAA B;  3PUR A;  1WYC A;  2N2N A;  3CVR A;  5HAX A;  3HKB E;  3FXE B;  3QC9 A;  2NW7 A;  1BR4 A;  1FMW A;  2WAU A;  3OJA A;  5HXH A;  2XQY A;  1BR1 A;  2HPL A;  3HL6 A;  4H9P C;  2VAS A;  4CXW A;  3FBL A;  5LJM A;  4GIW A;  4PK6 A;  5HXS A;  5JRE A;  2CLY B;  4ZOL E;  2V1D B;  2C5J A;  4EZ4 A;  5HWY A;  5LGU B;  4YLH A;  1Z0P A;  3S4U A;  4KUM B;  3Q9D A;  4PK5 A;  3ZEF B;  2RA1 A;  3OYX A;  3PUQ A;  2YU1 A;  4BJM A;  5L3D B;  5HXE A;  3AAI A;  5LGT B;  2EHO C;  3JC6 D;  5GON E;  4EXT A;  2Y6X A;  4WBO A;  3B57 A;  5FY7 A;  3E0Z A;  3NRX A;  3ANW A;  5BMV E;  3RRW A;  2KLQ A;  3O4X E;  4NUV A;  4U74 A;  3D0T A;  5DJQ C;  2Z6E A;  4L9I A;  2PG8 A;  2JJ9 A;  1Y64 B;  2X9H A;  5DQW A;  5ETW A;  1D0Z A;  5H6Q B;  2IAK A;  3AVR A;  5KDM C;  3C4Z A;  5FY0 A;  2XAF B;  5HXR A;  4CXX A;  5JR9 B;  4XZC A;  1LRZ A;  3HKC E;  1H7C A;  2D5U A;  2V26 A;  3NZQ A;  1HFA A;  4EOZ B;  4H63 V;  4TV8 E;  2G0U A;  2XAJ B;  4IE5 A;  1MND A;  4IE0 A;  4U72 A;  2UXN B;  2J1D G;  3MAC A;  4UV8 B;  2N1G A;  3RYI E;  3N9N A;  3RC8 A;  2LJL A;  4G63 A;  2LOS A;  4HGA A;  4M1P A;  4PJL A;  5JRC B;  2JMH A;  2Q9Q B;  3ZC0 A;  4DVD A;  4G2A A;  4H9O C;  2X66 A;  4HFV A;  1O3X A;  4GYS A;  2HH7 A;  2E9X C;  1ZHC A;  3VKG A;  2YEV C;  1CUN A;  2LT3 A;  4FI5 A;  2ACX A;  3UTK A;  3M65 A;  3ZN0 B;  2E9X A;  2C0S A;  4QXC B;  3VKH A;  3GMI A;  3CKD A;  3E08 A;  4QX8 B;  3SRZ A;  3NRY A;  3F57 A;  5CB4 E;  2JPF A;  3IHR A;  3RPU A;  5EK4 A;  4HE8 A;  3ZCJ A;  3F2E A;  5KMG P;  2QGS A;  5J2U E;  3N9M A;  3I9Y A;  2LEH A;  1MMG A;  1HTJ F;  4AKG A;  3AB3 B;  3EVY A;  5FXZ A;  2LSY A;  3UUN A;  3ZYK A;  2MOZ A;  4AI6 A;  1D1B A;  1UX4 A;  2XAQ B;  1LKX A;  2KND A;  4HEA A;  1D1C A;  3IEE A;  1MMA A;  3K3N A;  3PU3 A;  4HKA A;  2D2S A;  4HN9 A;  2KXP B;  5LHH B;  3C4X A;  2ZM2 A;  4F6R C;  4ZI3 C;  1MIY A;  4O2A E;  2NTX A;  2VKO A;  5J1G A;  3R6N A;  2WBL A;  3QK6 A;  2Q9Q D;  4AKI A;  4DO0 A;  3UT5 E;  3U3I A;  1B7T A;  2V7I A;  4DND A;  3RYH E;  5JDQ A;  3H37 A;  2KT9 A;  4ANJ A;  2JRK A;  3RC3 A;  5A1L A;  4IGU A;  3FXD B;  4ZHQ E;  4O4L E;  4O4J E;  4ILU A;  2I59 A;  3PTR B;  4UXN B;  3L09 A;  3CX8 B;  4MHC A;  2X0L B;  3R84 B;  5IYZ E;  2P9B A;  5FXX A;  3LG7 A;  2KWI B;  2VKJ A;  3A5X A;  1HS7 A;  3MZK B;  4TX5 A;  3BQI A;  3Q5X A;  2ODU A;  1HF8 A;  2C5K T;  3N9Q A;  4GOU A;  4C90 A;  2KMF A;  3ZMS B;  2KWH A;  4P0A A;  1YKH B;  1D0X A;  3LK3 B;  1HG5 A;  3ANW B;  4IE7 A;  1NWM X;  3N2K E;  1WR6 A;  3LJC A;  2E8I A;  2H3R A;  2NP9 A;  4P0B A;  3FB2 A;  2PJQ A;  4A56 A;  3ETV A;  2ZLY A;  2Y48 B;  3J9X 1;  3UFE A;  4DMW A;  2M67 A;  4PK4 A;  3UUX B;  3KIN B;  5FYM A;  4AQF C;  3ETU A;  5JDG A;  4I43 B;  3I0O A;  5JDL A;  1KNZ A;  3EDV A;  3PU8 A;  2K24 A;  1IAP A;  3E22 E;  3F31 A;  2EHO A;  2X9W A;  3LK2 B;  2QA7 A;  2V7L A;  3KVB A;  3K3O A;  3N2O A;  2VK9 A;  4OYJ A;  5FNV E;  4ZS3 A;  2DHR A;  3U78 A;  2OA5 A;  4L0R A;  3GN5 A;  5C8Y E;  4TZ4 C;  1UX5 A;  4O8S A;  3AVS A;  1HCI A;  5FXV A;  1YW0 A;  3O1I A;  1ZEE A;  2HPJ A;  3CML A;  5IHY A;  1EZ3 A;  4BAY B;  2RP4 A;  4UVA B;  4AKL A;  1VOM A;  2E9X B;  4BJN A;  2V7K A;  2WMO A;  2DI4 A;  3KFW X;  5LBQ B;  2DWG A;  4OHF A;  2W63 A;  5L3F B;  2CE7 A;  4EZH A;  5LG4 A;  4JUY A;  3WAK A;  3ONX A;  2BDE A;  3RRC A;  3BQL A;  2L3L A;  2IW5 B;  3RYF E;  4MBQ A;  4UVC B;  5LCY A;  4K0U A;  3ZN1 B;  4PAG A;  4UVB B;  1LVK A;  5DAB A;  2MYS A;  4AXP A;  3PDY A;  2Y8D A;  3MJX A;  3VHL A;  1VRB A;  4B6X A;  3HKD E;  2XTL A;  4I55 E;  3EDU A;  5JDF A;  5LJN A;  1MIV A;  2JQQ A;  2VL8 A;  3Q5W A;  4IHJ E;  4ASK A;  2H7O A;  2LHN A;  3O9X A;  2VKD A;  3ZMT B;  3K8P C;  1US7 B;  3V5U A;  1HG2 A;  5L3C B;  2VB6 A;  2VWA A;  1MMN A;  3LK4 2;  3HA4 A;  2LE8 A;  3N5L A;  3TKL B;  5JR9 C;  4EAH A;  2CXD A;  2CEA A;  4HTE A;  4QX7 B;  3LBX B;  3ESL A;  4O4I E;  4EB6 E;  4ZI2 C;  3N9P A;  3KV6 A;  3OKQ A;  4H63 H;  5L3E B;  3ZC1 A;  4IE4 A;  1QSD A;  2Q9Q C;  2BVL A;  2X9X A;  2WMN A;  4PNI A;  1IJ5 A;  1X79 A;  2L9Q A;  4E7Z A;  1D1A A;  5AFU L;  3ZMV B;  5LXT E;  4WBN E;  2YK0 A;  4X1I E;  3SWH A;  3L3P A;  4UV9 B;  5EZY E;  5L2L A;  1YD8 G;  3C50 A;  3UUM A;  4UEM A;  2CXF A;  3RH3 A;  3CQC B;  3OBV E;  5LOV E;  1MNE A;  3DJB A;  4X1Y E;  2LSJ A;  2IC9 A;  3MXZ A;  4I50 E;  4AKH A;  3O1H A;  4MAL A;  1U4Q A;  2ES0 A;  2XHE B;  3BQK A;  3I1A A;  3IBP A;  3KBU A;  3N9L A;  3Q2M A;  3VU7 H;  2K9A A;  2NW8 A;  2CXL A;  2KIN B;  2WWU A;  3HKE E;  3PUS A;  5H6R B;  4ZI7 E;  3ZYM A;  2CWY A;  4CI3 B;  2LOP A;  4TUY E;  4JEU B;  4ZS2 A;  4UF0 A;  2EHO B;  3LFM A;  4J2C A;  3I9W A;  5CA1 E;  4O2B E;  5FXW A;  5FY1 A;  2LSG A;  2ODV A;  4TV9 E;  2A72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...