1YKEB

Structure of the mediator med7/med21 subcomplex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
119
Chain Sequence
DRLTQLQICLDQMTEQFCATLNYIDKNHGFERLTVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLLRHVDSLIEDFVDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords RNA polymerase II mediator complex protein MED7
total genus 44
structure length 119
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11221 Med21 Subunit 21 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.470 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ykeB00
1YKEB 1YKHB
chains in the Genus database with same CATH superfamily
2X68A 3NWIA 1UCUA 4DV1T 3PUXF 1HF8A 2Q9QB 2E9XB 3KV5A 4ZI3C 2NW7A 5J0ZA 5DABA 5LHGB 4ILUA 3RYIE 2RPAA 3PE0A 4U74A 4KX6A 4LMJA 2KXPB 2K9AA 2VVNA 3I0OA 4I50E 5LMNT 4P0AA 4YJ3E 2KZ7B 1J5ET 5J2TE 4OX9T 3EAMA 5LGUB 4PJLA 4H9QC 4PK6A 3PUQA 4GYSA 2XQAA 2NTXA 3O4XE 4CXWA 2IHR1 4YFSA 5FL1A 3TLVA 4EZ4A 2KINB 3RI5A 4CN1A 1HX8A 2CBIA 3HL6A 4DV4T 4EV6A 3RPUA 5FKYA 4UV9B 2BBJA 2VKHA 5LJMA 1D1BA 4LF7T 4GYRA 4YTNA 4F8HA 4JBWF 1IBLT 5L2LA 4AKIA 4TNWA 4ZEYA 3OKQA 3C50A 2BS3A 1HFAA 3A7MA 1VOMA 2HN2A 4DR1T 2UUAT 2Q9QA 4YTPA 2XQYA 3A8YC 5TAOA 4XBFB 1VRBA 2KSRA 2X0LB 3IA3A 1U4QA 2BVMA 3C64A 4HGAA 4IIJE 2ZM6T 4KMCA 4DR7T 2X9YA 2XUEA 3ZMTB 5JDHA 4IE6A 2FJAA 3KV4A 1JNRA 2BS4A 2LSJA 5FVKA 1WYBA 3BK9A 1N32T 3OPCA 2VL0A 2CE7A 3N2GE 3AE6A 1OEDA 5HEJA 2RP4A 2IIUA 4TWHA 4XZCA 3ONXA 1MMDA 1MMAA 2C5IT 1UX5A 3NRXA 3AE2A 3TLSA 2V5CA 2WDQA 5CA1E 1YQ3A 4HFVA 1S94A 3H3AA 4PAGA 3WAKA 5L3GB 5AQQB 4CN4A 2JRKA 3RYHE 3ZJ2A 4JI0T 3AAEB 4ZS3A 3ZPOA 1WFDA 2PG8A 1NENA 4QHOA 3T1YT 4LF5T 2YINA 3RIFA 3K1SA 3SFEA 2HPJA 3AEBA 5AQSB 4AXPA 1MNEA 5JREA 3QK6A 3AA7B 5FXVA 4BJNA 3VRAA 5FXWA 2V6XA 2EHOA 5AQMB 3CPZA 3SRZA 3HKEE 1X79A 2LSGA 2WMNA 3H3MA 4KP3C 5ETWA 1WYCA 4E7ZA 4CI1B 3AEEA 3V5SA 2J1DG 2V6YB 5L4EA 1SA0E 4K0UA 4GOUA 4P1NA 4NUVA 4DBQA 3O1IA 2BG9B 4U2ZA 3AEDA 4X1YE 4B3ST 3LSVA 2XQ4A 3LFMA 3D0TA 1AJ3A 3GA8A 4IREA 1D0ZA 1VCSA 3CQXC 3P7IA 2QYWA 1Y01A 3O1JA 3OYZA 4DV3T 2UUBT 2BKPA 2CHNA 2LSKA 3Q5XA 2XHEB 3NRYA 1IJ6A 1QSDA 3AECA 4G2AA 2VURA 5C3JA 5M4YA 3QOFA 2WDVA 3N2KE 2BZBA 2CA5A 4HFEA 2WAUA 2W67A 5HEOA 3TLTA 5LA6E 5LNKA 4JUYA 3ZMSB 2OV9A 4ZZBA 3PTRB 4O4HE 4A97A 1BR2A 4ISTA 4WZXA 1ZHCA 1XMOT 1G73A 4JI3T 3CQGB 5JDGA 2N1GA 4LF6T 5AQVB 5BR8T 5AQIB 4EYUA 1HNXT 2K24A 5AQPB 1US7B 2V7IA 2BG9E 4X1IE 1NAFA 3UUMA 3ETUA 4B6XA 1MMNA 4PJJA 5CFBA 5ABFA 2XQ7A 2XAGB 5JR9B 4DV5T 2XQ3A 3CQCB 1QLBA 2YU1A 4QXCB 3KV6A 3MK7C 2V6YA 1D0XA 1FEWA 3N9PA 4IHJE 4JI8T 1HS7A 4IDNA 4C91A 2VKJA 2UXCT 4HFIA 3ZEFB 2H7OA 2I0MA 2LSIA 2LM2A 3AA1B 5C8YE 3KV9A 4JEHB 4J2CA 2JJ9A 4WNKA 2LHNA 1KK7A 3PU8A 4ZHQE 4DR4T 2KNDA 4IL4A 4PK5A 1IJ5A 2P9BA 3MACA 2LOSA 3FBLA 3UFEA 4O2BE 1HNZT 4I0UA 2BKOA 2XAHB 4DO0A 5ABHA 5JRCA 2PFVA 4O4IE 4EB6E 3EDUA 4YT0A 2UU9T 3G06A 5LP6E 3E0ZA 3T8OA 2BS2A 2WQYA 2LRKA 3K3QC 3PURA 3PUYF 5LCYA 4EGWA 5AQFB 4AQFA 3CKDA 1KNRA 4X62T 4JI7T 1J5WA 1MMGA 4EAHA 1FIOA 3L09A 2VASA 2XPKA 1O3XA 5L3BB 5J1GA 3WI3A 3QB5A 1HNWT 2KMFA 2H7VC 3C4ZA 4JEUB 3N9MA 4H9OC 4UVBB 4WBOA 4P0BA 4QH5A 3C98B 2VL8A 3CVRA 2YOEA 4M1PA 3RGLA 1MNDA 3SOLA 2CMRA 4QWNB 4ZI2D 2NW9A 2E9XC 2WSSV 4UF0A 2QRXA 3PJAJ 3RX6A 4DR3T 4DMWA 4B3RT 1KF6A 1Z0PA 5FMNA 3SWHA 3WAJA 4KUMB 1WLXA 5FNVE 3UQ4A 1UK5A 4ZS2A 3UUXB 4U31A 4DNDA 5HXSA 5AQJB 3N2OA 5HCMA 3RIUC 3K3OA 4KHZF 3JAEA 4CN6A 3KBUA 5KDMC 5AQTB 4ZI3D 3Q5WA 3PUZF 3RH3A 3ZLIA 3QB5K 1HX1B 2PBIA 3CX7B 1XDPA 2WZHA 3AE3A 4DBRA 3PUGA 2W2UA 3UU8A 1BR0A 1YD8G 4TV9E 2QGSA 3ESLA 3HI2A 5LGTB 4UEMA 5KX5E 2LRLA 3AXJB 3Q5EA 3RIUA 2V7KA 4JLEA 2LKGA 1WR6A 5HEHA 4BA9A 3HKBE 4HFDA 4EYYR 4U3CA 3N9OA 5IUXA 3CIRA 1UGOA 4HWHA 3VR8A 3O9XA 2JQ9A 4PW8A 4U72A 3JAFA 3ONLC 3HKDE 3NZQA 2KWIB 4OHFA 2NWBA 4PK4A 4HN9A 5H6RB 2Y8DA 3ZN1B 2VWAA 2YKSA 4A98A 3GWHA 1XNQT 1VCTA 2A3DA 5FYMA 5HWXA 1HG5A 2YN6A 4H9PC 3L39A 1UX4A 2V5DA 3AE7A 3QUJA 1QUUA 3RLFF 5A1LA 4H9SE 5JVDE 3HKCE 4YSYA 5E0OA 3B5MA 4DR2T 5FVLA 1HTJF 3I9WA 2AE9A 4LMLA 2OLTA 3ZT6A 3EABA 4KI0F 2CXLA 3JC6C 2CRBA 2N9DA 4IDOA 2DLRA 4NXMT 3AAIA 3KVBA 3RYFE 4DVDA 2L3LA 2WP9A 4UXNB 2NOXA 2LT3A 4NUUA 2VQET 5LHHB 1Z8UA 2V26A 4AIUA 2DI4A 3AE1A 4IE4A 4X66T 4O2AE 2M67A 3F31A 4MHCA 4IDQA 1YQ4A 4ASKA 5HXEA 3RIAA 3LK3B 4UIGA 2W62A 1JNZA 3ZYKA 2E9XA 4YSZA 1OXZA 3IHRA 4GK0E 4CXYA 2MOZA 3K3NA 2VK9A 4PFPA 4UR9A 4YJ2E 1IAPA 3GN5B 3MXZA 3JADA 3DJBA 3P50A 1XNRT 5LHIB 2VKDA 4TWFA 3OVUA 3AVRA 3UTKA 3ZSSA 2WS3A 1M62A 2J47A 4IL9A 4X1KE 1YW0A 2A2FX 3N9NA 3RHWA 4UELA 4CI3B 1I6ZA 4YHJA 3VKGA 1M7KA 3I9YA 4EEBA 1U5PA 2CLYB 2KWHA 4I55E 3UU5A 2FJEA 4HKAA 4AQFC 3KVAA 2J4GA 3TLWA 4WBNE 1IBKT 4ZI2C 1X9BA 5JDFA 2R6GF 3MJXA 5JRCB 2HH7A 1V9DA 1G8XA 3NBXX 4DMVA 1LKXA 3ZMZB 4NXNT 4OYKA 5IHYA 2CXFA 2D5UA 1W0AA 5DJQC 4NPPA 5EK3A 4AKHA 2DHRA 5JTGA 2UXDT 3ZT5A 2K48A 4JYAT 2DWGA 3VKHA 2WDRA 5LJNA 2B1EA 3O1HA 4PFOA 5JH7E 2XM1A 4H63V 2V7LA 1ZEEA 3DP7A 3I1AA 3M65A 2W4XA 2FUPA 3AE5A 4CZZB 3N9QA 2BDEA 3R84B 4EZHA 2VKOA 1T98A 3LK2B 3P4WA 1YXRA 2C5KT 2XY8B 3GN5A 3PV0F 3QC9A 4O8SA 4X5TA 3RQWA 5JDLA 1HR0T 2FJBA 2LKHA 2N2NA 3PDYA 5LGNB 1OWAA 2MAWA 5ABEA 1GQEA 1SHZC 4FI5A 4LMKA 5FY7A 3H37A 2IAKA 2XAFB 2CWOA 3Q2MA 2NTYA 2WY2A 4HWFA 1R8IA 1WCRA 3AEGA 3R6NA 2NW8A 2D9DA 4IT4A 4L5GA 4QX7B 4WYVA 3ZKRA 2E2AA 3AEAA 2JQHA 3CWZB 1XZYA 3U78A 5HXHA 3ANWA 2Y48B 3GMIA 4X65T 3EVYA 3OTOT 1S35A 2LHRA 3UFGA 2LJLA 2WMOA 3X1DA 3W15B 4EIWA 2C5JA 2XAQB 2ZM8A 4TN7B 4HWDA 3LK42 2CPTA 4DUZT 1UURA 2W61A 5JDMA 4UVCB 2QVAA 3AXJA 2WZIA 3J9X1 5HAXA 1UUSA 2CHOA 1DU2A 2QA7A 4UVAB 5IWAT 4H9RC 2XQ5A 4ILBA 4NIQA 3CK6A 5FL0A 2V7JA 3ETVA 5HEGA 2JPFA 3LJCA 4HWCA 4DV0T 2ZMAA 2VVSA 2WU5A 3EDVA 4U7IA 3LBXB 5FY0A 2ZM2A 3N5LA 5ABFB 1N33T 1D0YA 3AA6B 3AE4A 5AQRB 1SUMB 2WCAA 4OFZA 4EXTA 3E22E 2C0SA 4HFCA 3FZMB 2W66A 3PUWF 4ZI7E 2EHOC 2WM9A 3BQKA 2IDOB 2MYSA 5AQKB 3ZT7A 4E7SA 2ACXA 1IBMT 4LFCT 3LG7A 4AKGA 2WWUA 3KINB 3P4SA 4YSXA 1ZOYA 2JQQA 3AE9A 2IMLA 3JCFA 3PU3A 4KBMB 2X9HA 3UU4A 4YXDA 2ODUA 2HN1A 2YDSA 3ABVA 2RA1A 5EK2A 1WR0A 5LBMA 5JDQA 5JQGE 2M6BA 4GIWA 2PJQA 4U33A 2MBGA 2UXXB 3ZYMA 5LOVE 4TNVA 2PTFA 5HWYA 2G0UA 2LEHA 3LDQB 4QX8B 4WW0A 3UU3A 3KBTA 5LMUT 5H6QB 4ZOLE 2CXDA 4XAXB 3VR9A 3RC8A 1OEDC 4AKRB 1ZP0A 3FZHB 5BMVE 5L3FB 1YKEB 3RRCA 1B7TA 4V1Av 5AQUB 4TUYE 4DV6T 3A5XA 2LOPA 4H63H 1J1JA 3RRWA 1IZNB 2Q9QD 1LVKA 2VQFT 5AQHB 3TKLB 2K5BB 2ACZA 4MBQA 3PUSA 5DQWA 5AQLB 4ZXLA 4IE0A 1D1CA 2L8KA 2WBLA 3Q5DA 4IGUA 4IDPA 4MALA 3MA9A 3BQIA 2A9UA 2YDRA 3IEEA 5DQVA 2Q9QC 3OYXA 3P4PA 2E5LT 5HXRA 4LF4T 1OEDE 2D0UA 1MIVA 3P4RA 3QNUA 5HCJA 3UULA 1N34T 2BBHA 2CEAA 3DTOA 2FBWA 3FXEB 2L9QA 5KXJA 3SFDA 2WU2A 1E1HB 4Q25A 1FMVA 1MIYA 2BG9A 2KT9A 4B3MT 4JV5T 2LM9A 2V8SV 2X67A 4Z91A 2W0GA 4P09A 4JI5T 3UUNA 2DCFA 2YEVC 4LF8T 3K8PC 4AI6A 2X9XA 3RYCE 4L9IA 3AEFA 3HR0A 4CXXA 1N36T 3RC3A 3FZLB 3ZCIA 3RQUA 1LVFA 4HFBA 1KNPA 4H9NC 4QH1A 1L0VA 3NZPA 1W9RA 4L0RA 2YDQA 3CX8B 2W63A 3P4QA 1XMQT 2JMKA 1ZKEA 3KDSE 4Z90A 5L3DB 2IC9A 3FB2A 4BAYB 2XQ8A 3AB3B 2EHOD 5C2TA 2WB5A 4TZ4C 2IW5B 1D1AA 1KNZA 3ZJ1A 2J62A 3M3ZB 2JIWA 4AQYT 2AXDS 2X51A 5ADXL 3AA0B 4U2YA 2DNXA 4EOZB 3UUBA 2BKNA 3JC6D 1SE7A 2NP9A 3F2EA 5LBQB 4A56A 2Y6XA 1MIWA 2IC6A 2GK9A 2JQKA 4PJMA 2ZLYA 2ZM0A 3VRBA 2LSYA 4TX5A 3ZC1A 2H89A 1OEDB 3EHZA 4DUYT 5AQGB 3B13A 3C4XA 3TLUA 2H88A 3E08A 5L3EB 2XSAA 4I43B 3N9LA 3OJAA 1XDOA 2CBJA 2VB6A 2Z6EA 3RKGA 2HPLA 4FJOA 3FZKB 5EK4A 3ZCJA 3ZC0A 2X0HA 3ZN0B 4AKLA 2XQ6A 4COFA 2I6HA 3AVSA 1CUNA 4O4JE 4TV8E 2CCQA 4ILAA 4JI1T 4PNIA 4N78D 3OBVE 1XWMA 2A72A 2XJ7A 4IE7A 5F8PA 3ZSTA 5FXZA 4DV2T 3S4UA 5LB7B 5EZYE 1ZV4X 4ZZCA 2YU2A 4G63A 1WRDA 2LLYA 2I59A 4DIDB 4UV8B 4A5XA 1NEKA 2X0YA 3AAAB 3KFWX 4ADZA 3EI0A 5CB4E 5JR9C 3L8RA 4HTEA 2BG9C 3SS1A 1HG2A 4IDZA 2CM0A 2XAJB 5L4HA 5CJ5A 5L47A 2XZEA 1KFYA 4LFAT 2CLYC 5KMGP 1W0BA 3BQLA 3CMLA 4X20E 3F57A 2WWVA 3P8CD 4CQIA 1NWMX 4HE8A 1HCIA 4AISA 4CI2B 4HFHA 3I0QA 2KLQA 1Y64B 2E9XD 3ONJA 4QXHB 3T1HT 4YLHA 3MKDA 1H7CA 5F3JA 2F4VT 4IE5A 5HEUA 3IF8B 4QKNA 4F6RC 4MFRA 3CX6B 4LFBT 3B57A 4U7YA 2UUCT 4YY3T 4B3TT 2MTQA 3PUAA 4X64T 4EEDA 5IYZE 4ERRA 2ODVA 1T8BA 5F5WA 3ZMUB 2UXNB 3NVOA 2HHHT 4DR6T 2LE8A 3C51A 1YKHB 2XASB 5JDNA 3EUHA 3L3PA 2DWKA 4OK0A 3U3IA 3J7Yq 3C4WA 3FBZA 4HWIB 2YK0A 3NKZA 5LG3A 4GKJT 4GKKT 3VU7H 5LYJE 2V7MA 4AQGA 1BR4A 4ANJA 3LBXA 5CA0E 3FXDB 3RKOA 3ZYLA 1KEYA 1E7PA 1W09A 2FJDA 2OA5A 3MZKB 3PJAA 5JR9A 5AQNB 3Q9DA 4MLKA 4JI2T 2EHOB 5AFUL 3RF1A 1EZ3A 2BVLA 2V1DB 5LXTE 1FMWA 4C90A 2E5VA 2D0TA 2MPKA 5ABGA 2M6IA 4PJNA 4QXBB 4O4LE 3UT5E 4K0KT 2ES0A 4KHPT 4YTMA 1BR1A 4DV7T 2W00A 5HXCA 1T72A 5CGMA 1T7SA 2UXBT 5HYAA 4DR5T 2XSBA 3ANWB 2H3RA 3FHNA 4I4TE 2JMHA 2X66A 5AQOB 2CWYA 2XQ9A 3UU6A 3VHLA 3UQ7A 2D2SA 3HA4A 5FY1A 5J2UE 2NR4A 2IUBA 2X9WA 3V5UA 1CHUA 3AE8A 4YHHT 1FJGT 2B76A 4HEAA 4QH4A 4BJMA 5LG4A 4OYJA 1I94T 4JI4T 5FXXA 3PUVF 4GK5E 3FZFB 2XM2A 4ILCA 5L3CB 3ZMVB 3IBPA 5FP3A 4TWDA 2SPCA 5GONE 2E8IA 2DL1A 1LRZA 2K3WA 4ISSA 2XTLA 4JI6T 1E2AA 4LF9T 4UF0B 4Z8XA
chains in the Genus database with same CATH topology
2X68A 1UCUA 1HF8A 2Q9QB 2E9XB 3KV5A 4ZI3C 2NW7A 5DABA 5LHGB 4ILUA 3RYIE 3PE0A 4U74A 2KXPB 2K9AA 3I0OA 4I50E 4P0AA 4YJ3E 2KZ7B 5J2TE 5LGUB 4PJLA 4H9QC 4PK6A 3PUQA 4GYSA 2NTXA 3O4XE 4CXWA 4YFSA 4EZ4A 2KINB 1HX8A 3HL6A 3RPUA 4UV9B 2VKHA 5LJMA 1D1BA 4GYRA 5L2LA 4AKIA 3OKQA 3C50A 1HFAA 1VOMA 2Q9QA 2XQYA 5TAOA 4XBFB 1VRBA 2X0LB 4IIJE 1U4QA 2BVMA 3C64A 4HGAA 4KMCA 2X9YA 2XUEA 3ZMTB 5JDHA 4IE6A 3KV4A 2LSJA 1WYBA 3BK9A 2CE7A 3N2GE 2RP4A 4XZCA 3ONXA 1MMDA 1MMAA 2C5IT 1UX5A 3NRXA 5CA1E 4HFVA 1S94A 3H3AA 4PAGA 3WAKA 5L3GB 2JRKA 3RYHE 3ZJ2A 3AAEB 4ZS3A 3ZPOA 2PG8A 4QHOA 2YINA 2HPJA 4AXPA 1MNEA 5JREA 3QK6A 3AA7B 5FXVA 4BJNA 5FXWA 3SRZA 2EHOA 3CPZA 3HKEE 1X79A 2LSGA 2WMNA 4KP3C 5ETWA 4E7ZA 1WYCA 4CI1B 3V5SA 2J1DG 1SA0E 4K0UA 4GOUA 4NUVA 4DBQA 3O1IA 1AJ3A 4X1YE 3LFMA 3D0TA 3GA8A 1D0ZA 3CQXC 3P7IA 3OYZA 3O1JA 4TV9E 3Q5XA 2LSKA 4G2AA 2XHEB 3NRYA 1IJ6A 1QSDA 5M4YA 3N2KE 2BZBA 2CA5A 2WAUA 5LA6E 5LNKA 4JUYA 3ZMSB 3PTRB 4O4HE 1BR2A 4ISTA 1ZHCA 1G73A 3CQGB 5JDGA 2N1GA 4EYUA 2K24A 1US7B 2V7IA 4X1IE 3UUMA 1NAFA 4B6XA 3ETUA 1MMNA 4PJJA 2XAGB 5JR9B 3CQCB 2YU1A 4QXCB 3KV6A 3MK7C 3N9PA 1D0XA 1FEWA 4IHJE 1HS7A 4C91A 2VKJA 3ZEFB 2H7OA 2LSIA 3AA1B 5C8YE 3KV9A 4JEHB 4J2CA 2JJ9A 4WNKA 2LHNA 1KK7A 3PU8A 4ZHQE 2KNDA 4PK5A 1IJ5A 2P9BA 3MACA 2LOSA 3FBLA 3UFEA 4O2BE 2XAHB 4DO0A 5JRCA 2PFVA 4O4IE 4EB6E 3EDUA 5LP6E 3E0ZA 3T8OA 3PURA 3K3QC 5LCYA 4AQFA 3CKDA 1MMGA 4EAHA 1FIOA 3L09A 2VASA 1O3XA 5L3BB 5J1GA 3WI3A 2KMFA 2H7VC 3C4ZA 4JEUB 3N9MA 4H9OC 4UVBB 4WBOA 4P0BA 3C98B 2VL8A 3CVRA 4M1PA 3SOLA 1MNDA 4ZI2D 2CMRA 4QWNB 2NW9A 2E9XC 2WSSV 4UF0A 3RX6A 4DMWA 1Z0PA 5FMNA 3SWHA 3WAJA 4KUMB 1WLXA 5FNVE 4ZS2A 3UUXB 4DNDA 3N2OA 3K3OA 5KDMC 3KBUA 4ZI3D 3Q5WA 3RH3A 3ZLIA 2PBIA 3CX7B 4DBRA 3PUGA 1BR0A 1YD8G 2QGSA 3ESLA 3HI2A 5LGTB 4UEMA 5KX5E 2V7KA 4JLEA 1WR6A 4BA9A 3HKBE 4EYYR 3N9OA 3O9XA 4PW8A 4U72A 3HKDE 3NZQA 2KWIB 4OHFA 2NWBA 4PK4A 4HN9A 5H6RB 2Y8DA 3ZN1B 2VWAA 3GWHA 2A3DA 5FYMA 5HWXA 1HG5A 4H9PC 1UX4A 3QUJA 5A1LA 1QUUA 4H9SE 5JVDE 3HKCE 5E0OA 1HTJF 3I9WA 2CXLA 3JC6C 2N9DA 2DLRA 3AAIA 3KVBA 3RYFE 4DVDA 2L3LA 4UXNB 2NOXA 2LT3A 4NUUA 5LHHB 2V26A 2DI4A 4IE4A 4O2AE 2M67A 3F31A 4MHCA 5HXEA 4ASKA 3LK3B 4UIGA 2W62A 3ZYKA 2E9XA 1OXZA 3IHRA 4GK0E 4CXYA 2MOZA 3K3NA 2VK9A 4PFPA 4YJ2E 1IAPA 3GN5B 3MXZA 3DJBA 5LHIB 2VKDA 3AVRA 3UTKA 4CI3B 4X1KE 1YW0A 2A2FX 3N9NA 4UELA 4YHJA 3VKGA 3I9YA 1U5PA 2CLYB 2KWHA 4I55E 4HKAA 4AQFC 3KVAA 4WBNE 4ZI2C 5JDFA 3MJXA 5JRCB 2HH7A 1V9DA 1G8XA 3NBXX 4DMVA 1LKXA 3ZMZB 4OYKA 5IHYA 2CXFA 2D5UA 5DJQC 5EK3A 4AKHA 2DHRA 2K48A 2DWGA 3VKHA 5LJNA 2B1EA 3O1HA 4PFOA 5JH7E 4H63V 2V7LA 1ZEEA 3DP7A 3I1AA 3M65A 4CZZB 3N9QA 2BDEA 3R84B 4EZHA 2VKOA 1T98A 3LK2B 3GN5A 2C5KT 3QC9A 4O8SA 5JDLA 2N2NA 3PDYA 5LGNB 1OWAA 1SHZC 4FI5A 5FY7A 3H37A 2IAKA 2XAFB 2CWOA 3Q2MA 2NTYA 3R6NA 2NW8A 4L5GA 4QX7B 3CWZB 3U78A 5HXHA 3ANWA 2Y48B 3GMIA 3EVYA 1S35A 2LHRA 2LJLA 2WMOA 4EIWA 3W15B 2C5JA 2XAQB 2ZM8A 4TN7B 3LK42 2W61A 5JDMA 4UVCB 3J9X1 5HAXA 2QA7A 4UVAB 4H9RC 2V7JA 3ETVA 2JPFA 3LJCA 2ZMAA 3EDVA 3LBXB 5FY0A 2ZM2A 3N5LA 1D0YA 3AA6B 4OFZA 4EXTA 3E22E 2C0SA 4ZI7E 2EHOC 2WM9A 3BQKA 2MYSA 4E7SA 2ACXA 3LG7A 4AKGA 2WWUA 3KINB 2JQQA 3PU3A 4KBMB 2X9HA 2ODUA 5JQGE 2RA1A 5EK2A 5LBMA 5JDQA 4GIWA 2PJQA 2MBGA 2UXXB 3ZYMA 5LOVE 5HWYA 2G0UA 2LEHA 4QX8B 4WW0A 3KBTA 5H6QB 4ZOLE 2CXDA 4XAXB 3RC8A 4AKRB 5BMVE 5L3FB 1YKEB 3RRCA 1B7TA 4V1Av 4TUYE 3A5XA 2LOPA 4H63H 3RRWA 1IZNB 2Q9QD 1LVKA 3TKLB 2K5BB 4MBQA 5DQWA 3PUSA 4IE0A 1D1CA 2L8KA 2WBLA 4IGUA 4MALA 5DQVA 3MA9A 3BQIA 3IEEA 2Q9QC 3OYXA 5HXRA 2D0UA 1MIVA 3UULA 2CEAA 3DTOA 3FXEB 2L9QA 1E1HB 1FMVA 1MIYA 2KT9A 2LM9A 2X67A 2W0GA 4P09A 3UUNA 2DCFA 2YEVC 3K8PC 4AI6A 2X9XA 3RYCE 4L9IA 3HR0A 4CXXA 3RC3A 3ZCIA 1LVFA 4H9NC 3NZPA 4L0RA 3CX8B 2W63A 2JMKA 1ZKEA 3KDSE 5L3DB 2IC9A 3FB2A 4BAYB 3AB3B 2EHOD 4TZ4C 2IW5B 1D1AA 1KNZA 3ZJ1A 2X51A 5ADXL 3AA0B 2DNXA 4EOZB 3JC6D 2NP9A 3F2EA 5LBQB 4A56A 2Y6XA 1MIWA 2IC6A 2GK9A 4PJMA 2ZLYA 2ZM0A 2LSYA 4TX5A 3ZC1A 3B13A 3C4XA 3E08A 5L3EB 4I43B 3N9LA 3OJAA 2Z6EA 2VB6A 2HPLA 4FJOA 3ZCJA 5EK4A 3ZC0A 3ZN0B 4AKLA 3AVSA 1CUNA 4O4JE 4TV8E 2CCQA 4PNIA 4N78D 3OBVE 2A72A 4IE7A 5F8PA 5FXZA 3S4UA 5EZYE 1ZV4X 2YU2A 4G63A 1WRDA 2I59A 4UV8B 5JR9C 3KFWX 4ADZA 3AAAB 5CB4E 4HTEA 3SS1A 1HG2A 4IDZA 2CM0A 2XAJB 2CLYC 5KMGP 3BQLA 3CMLA 4X20E 3F57A 4CQIA 3P8CD 1NWMX 4HE8A 1HCIA 4CI2B 3I0QA 2KLQA 1Y64B 2E9XD 4QXHB 4YLHA 3MKDA 1H7CA 5F3JA 4IE5A 4F6RC 3IF8B 4QKNA 4MFRA 3CX6B 3B57A 2MTQA 3PUAA 5IYZE 4ERRA 2ODVA 3ZMUB 2UXNB 2LE8A 3C51A 1YKHB 2XASB 5JDNA 3EUHA 3L3PA 2DWKA 4OK0A 3U3IA 3J7Yq 3C4WA 3FBZA 2YK0A 3VU7H 5LYJE 2V7MA 4AQGA 1BR4A 4ANJA 3LBXA 5CA0E 3FXDB 3RKOA 3ZYLA 2OA5A 3MZKB 5JR9A 3Q9DA 4MLKA 5AFUL 2EHOB 1EZ3A 2BVLA 2V1DB 5LXTE 1FMWA 4C90A 2D0TA 4PJNA 4QXBB 4O4LE 3UT5E 2ES0A 1BR1A 2W00A 5HXCA 5HYAA 3FHNA 2H3RA 3ANWB 4I4TE 2JMHA 2X66A 3VHLA 2CWYA 2D2SA 3HA4A 5FY1A 5J2UE 2X9WA 3V5UA 4HEAA 4BJMA 5LG4A 4OYJA 5FXXA 4GK5E 5L3CB 3ZMVB 3IBPA 5FP3A 2SPCA 5GONE 2E8IA 4ISSA 1LRZA 2XTLA 5HXSA 4UF0B 4Z8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKE B;  1YKH B; 
#chains in the Genus database with same CATH topology
 2X68 A;  3NWI A;  1UCU A;  4DV1 T;  3PUX F;  1HF8 A;  2Q9Q B;  2E9X B;  3KV5 A;  4ZI3 C;  2NW7 A;  5J0Z A;  5DAB A;  5LHG B;  4ILU A;  3RYI E;  2RPA A;  3PE0 A;  4U74 A;  4KX6 A;  4LMJ A;  2KXP B;  2K9A A;  2VVN A;  3I0O A;  4I50 E;  5LMN T;  4P0A A;  4YJ3 E;  2KZ7 B;  1J5E T;  5J2T E;  4OX9 T;  3EAM A;  5LGU B;  4PJL A;  4H9Q C;  4PK6 A;  3PUQ A;  4GYS A;  2XQA A;  2NTX A;  3O4X E;  4CXW A;  2IHR 1;  4YFS A;  5FL1 A;  3TLV A;  4EZ4 A;  2KIN B;  3RI5 A;  4CN1 A;  1HX8 A;  2CBI A;  3HL6 A;  4DV4 T;  4EV6 A;  3RPU A;  5FKY A;  4UV9 B;  2BBJ A;  2VKH A;  5LJM A;  1D1B A;  4LF7 T;  4GYR A;  4YTN A;  4F8H A;  4JBW F;  1IBL T;  5L2L A;  4AKI A;  4TNW A;  4ZEY A;  3OKQ A;  3C50 A;  2BS3 A;  1HFA A;  3A7M A;  1VOM A;  2HN2 A;  4DR1 T;  2UUA T;  2Q9Q A;  4YTP A;  2XQY A;  3A8Y C;  5TAO A;  4XBF B;  1VRB A;  2KSR A;  2X0L B;  3IA3 A;  1U4Q A;  2BVM A;  3C64 A;  4HGA A;  4IIJ E;  2ZM6 T;  4KMC A;  4DR7 T;  2X9Y A;  2XUE A;  3ZMT B;  5JDH A;  4IE6 A;  2FJA A;  3KV4 A;  1JNR A;  2BS4 A;  2LSJ A;  5FVK A;  1WYB A;  3BK9 A;  1N32 T;  3OPC A;  2VL0 A;  2CE7 A;  3N2G E;  3AE6 A;  1OED A;  5HEJ A;  2RP4 A;  2IIU A;  4TWH A;  4XZC A;  3ONX A;  1MMD A;  1MMA A;  2C5I T;  1UX5 A;  3NRX A;  3AE2 A;  3TLS A;  2V5C A;  2WDQ A;  5CA1 E;  1YQ3 A;  4HFV A;  1S94 A;  3H3A A;  4PAG A;  3WAK A;  5L3G B;  5AQQ B;  4CN4 A;  2JRK A;  3RYH E;  3ZJ2 A;  4JI0 T;  3AAE B;  4ZS3 A;  3ZPO A;  1WFD A;  2PG8 A;  1NEN A;  4QHO A;  3T1Y T;  4LF5 T;  2YIN A;  3RIF A;  3K1S A;  3SFE A;  2HPJ A;  3AEB A;  5AQS B;  4AXP A;  1MNE A;  5JRE A;  3QK6 A;  3AA7 B;  5FXV A;  4BJN A;  3VRA A;  5FXW A;  2V6X A;  2EHO A;  5AQM B;  3CPZ A;  3SRZ A;  3HKE E;  1X79 A;  2LSG A;  2WMN A;  3H3M A;  4KP3 C;  5ETW A;  1WYC A;  4E7Z A;  4CI1 B;  3AEE A;  3V5S A;  2J1D G;  2V6Y B;  5L4E A;  1SA0 E;  4K0U A;  4GOU A;  4P1N A;  4NUV A;  4DBQ A;  3O1I A;  2BG9 B;  4U2Z A;  3AED A;  4X1Y E;  4B3S T;  3LSV A;  2XQ4 A;  3LFM A;  3D0T A;  1AJ3 A;  3GA8 A;  4IRE A;  1D0Z A;  1VCS A;  3CQX C;  3P7I A;  2QYW A;  1Y01 A;  3O1J A;  3OYZ A;  4DV3 T;  2UUB T;  2BKP A;  2CHN A;  2LSK A;  3Q5X A;  2XHE B;  3NRY A;  1IJ6 A;  1QSD A;  3AEC A;  4G2A A;  2VUR A;  5C3J A;  5M4Y A;  3QOF A;  2WDV A;  3N2K E;  2BZB A;  2CA5 A;  4HFE A;  2WAU A;  2W67 A;  5HEO A;  3TLT A;  5LA6 E;  5LNK A;  4JUY A;  3ZMS B;  2OV9 A;  4ZZB A;  3PTR B;  4O4H E;  4A97 A;  1BR2 A;  4IST A;  4WZX A;  1ZHC A;  1XMO T;  1G73 A;  4JI3 T;  3CQG B;  5JDG A;  2N1G A;  4LF6 T;  5AQV B;  5BR8 T;  5AQI B;  4EYU A;  1HNX T;  2K24 A;  5AQP B;  1US7 B;  2V7I A;  2BG9 E;  4X1I E;  1NAF A;  3UUM A;  3ETU A;  4B6X A;  1MMN A;  4PJJ A;  5CFB A;  5ABF A;  2XQ7 A;  2XAG B;  5JR9 B;  4DV5 T;  2XQ3 A;  3CQC B;  1QLB A;  2YU1 A;  4QXC B;  3KV6 A;  3MK7 C;  2V6Y A;  1D0X A;  1FEW A;  3N9P A;  4IHJ E;  4JI8 T;  1HS7 A;  4IDN A;  4C91 A;  2VKJ A;  2UXC T;  4HFI A;  3ZEF B;  2H7O A;  2I0M A;  2LSI A;  2LM2 A;  3AA1 B;  5C8Y E;  3KV9 A;  4JEH B;  4J2C A;  2JJ9 A;  4WNK A;  2LHN A;  1KK7 A;  3PU8 A;  4ZHQ E;  4DR4 T;  2KND A;  4IL4 A;  4PK5 A;  1IJ5 A;  2P9B A;  3MAC A;  2LOS A;  3FBL A;  3UFE A;  4O2B E;  1HNZ T;  4I0U A;  2BKO A;  2XAH B;  4DO0 A;  5ABH A;  5JRC A;  2PFV A;  4O4I E;  4EB6 E;  3EDU A;  4YT0 A;  2UU9 T;  3G06 A;  5LP6 E;  3E0Z A;  3T8O A;  2BS2 A;  2WQY A;  2LRK A;  3K3Q C;  3PUR A;  3PUY F;  5LCY A;  4EGW A;  5AQF B;  4AQF A;  3CKD A;  1KNR A;  4X62 T;  4JI7 T;  1J5W A;  1MMG A;  4EAH A;  1FIO A;  3L09 A;  2VAS A;  2XPK A;  1O3X A;  5L3B B;  5J1G A;  3WI3 A;  3QB5 A;  1HNW T;  2KMF A;  2H7V C;  3C4Z A;  4JEU B;  3N9M A;  4H9O C;  4UVB B;  4WBO A;  4P0B A;  4QH5 A;  3C98 B;  2VL8 A;  3CVR A;  2YOE A;  4M1P A;  3RGL A;  1MND A;  3SOL A;  2CMR A;  4QWN B;  4ZI2 D;  2NW9 A;  2E9X C;  2WSS V;  4UF0 A;  2QRX A;  3PJA J;  3RX6 A;  4DR3 T;  4DMW A;  4B3R T;  1KF6 A;  1Z0P A;  5FMN A;  3SWH A;  3WAJ A;  4KUM B;  1WLX A;  5FNV E;  3UQ4 A;  1UK5 A;  4ZS2 A;  3UUX B;  4U31 A;  4DND A;  5HXS A;  5AQJ B;  3N2O A;  5HCM A;  3RIU C;  3K3O A;  4KHZ F;  3JAE A;  4CN6 A;  3KBU A;  5KDM C;  5AQT B;  4ZI3 D;  3Q5W A;  3PUZ F;  3RH3 A;  3ZLI A;  3QB5 K;  1HX1 B;  2PBI A;  3CX7 B;  1XDP A;  2WZH A;  3AE3 A;  4DBR A;  3PUG A;  2W2U A;  3UU8 A;  1BR0 A;  1YD8 G;  4TV9 E;  2QGS A;  3ESL A;  3HI2 A;  5LGT B;  4UEM A;  5KX5 E;  2LRL A;  3AXJ B;  3Q5E A;  3RIU A;  2V7K A;  4JLE A;  2LKG A;  1WR6 A;  5HEH A;  4BA9 A;  3HKB E;  4HFD A;  4EYY R;  4U3C A;  3N9O A;  5IUX A;  3CIR A;  1UGO A;  4HWH A;  3VR8 A;  3O9X A;  2JQ9 A;  4PW8 A;  4U72 A;  3JAF A;  3ONL C;  3HKD E;  3NZQ A;  2KWI B;  4OHF A;  2NWB A;  4PK4 A;  4HN9 A;  5H6R B;  2Y8D A;  3ZN1 B;  2VWA A;  2YKS A;  4A98 A;  3GWH A;  1XNQ T;  1VCT A;  2A3D A;  5FYM A;  5HWX A;  1HG5 A;  2YN6 A;  4H9P C;  3L39 A;  1UX4 A;  2V5D A;  3AE7 A;  3QUJ A;  1QUU A;  3RLF F;  5A1L A;  4H9S E;  5JVD E;  3HKC E;  4YSY A;  5E0O A;  3B5M A;  4DR2 T;  5FVL A;  1HTJ F;  3I9W A;  2AE9 A;  4LML A;  2OLT A;  3ZT6 A;  3EAB A;  4KI0 F;  2CXL A;  3JC6 C;  2CRB A;  2N9D A;  4IDO A;  2DLR A;  4NXM T;  3AAI A;  3KVB A;  3RYF E;  4DVD A;  2L3L A;  2WP9 A;  4UXN B;  2NOX A;  2LT3 A;  4NUU A;  2VQE T;  5LHH B;  1Z8U A;  2V26 A;  4AIU A;  2DI4 A;  3AE1 A;  4IE4 A;  4X66 T;  4O2A E;  2M67 A;  3F31 A;  4MHC A;  4IDQ A;  1YQ4 A;  4ASK A;  5HXE A;  3RIA A;  3LK3 B;  4UIG A;  2W62 A;  1JNZ A;  3ZYK A;  2E9X A;  4YSZ A;  1OXZ A;  3IHR A;  4GK0 E;  4CXY A;  2MOZ A;  3K3N A;  2VK9 A;  4PFP A;  4UR9 A;  4YJ2 E;  1IAP A;  3GN5 B;  3MXZ A;  3JAD A;  3DJB A;  3P50 A;  1XNR T;  5LHI B;  2VKD A;  4TWF A;  3OVU A;  3AVR A;  3UTK A;  3ZSS A;  2WS3 A;  1M62 A;  2J47 A;  4IL9 A;  4X1K E;  1YW0 A;  2A2F X;  3N9N A;  3RHW A;  4UEL A;  4CI3 B;  1I6Z A;  4YHJ A;  3VKG A;  1M7K A;  3I9Y A;  4EEB A;  1U5P A;  2CLY B;  2KWH A;  4I55 E;  3UU5 A;  2FJE A;  4HKA A;  4AQF C;  3KVA A;  2J4G A;  3TLW A;  4WBN E;  1IBK T;  4ZI2 C;  1X9B A;  5JDF A;  2R6G F;  3MJX A;  5JRC B;  2HH7 A;  1V9D A;  1G8X A;  3NBX X;  4DMV A;  1LKX A;  3ZMZ B;  4NXN T;  4OYK A;  5IHY A;  2CXF A;  2D5U A;  1W0A A;  5DJQ C;  4NPP A;  5EK3 A;  4AKH A;  2DHR A;  5JTG A;  2UXD T;  3ZT5 A;  2K48 A;  4JYA T;  2DWG A;  3VKH A;  2WDR A;  5LJN A;  2B1E A;  3O1H A;  4PFO A;  5JH7 E;  2XM1 A;  4H63 V;  2V7L A;  1ZEE A;  3DP7 A;  3I1A A;  3M65 A;  2W4X A;  2FUP A;  3AE5 A;  4CZZ B;  3N9Q A;  2BDE A;  3R84 B;  4EZH A;  2VKO A;  1T98 A;  3LK2 B;  3P4W A;  1YXR A;  2C5K T;  2XY8 B;  3GN5 A;  3PV0 F;  3QC9 A;  4O8S A;  4X5T A;  3RQW A;  5JDL A;  1HR0 T;  2FJB A;  2LKH A;  2N2N A;  3PDY A;  5LGN B;  1OWA A;  2MAW A;  5ABE A;  1GQE A;  1SHZ C;  4FI5 A;  4LMK A;  5FY7 A;  3H37 A;  2IAK A;  2XAF B;  2CWO A;  3Q2M A;  2NTY A;  2WY2 A;  4HWF A;  1R8I A;  1WCR A;  3AEG A;  3R6N A;  2NW8 A;  2D9D A;  4IT4 A;  4L5G A;  4QX7 B;  4WYV A;  3ZKR A;  2E2A A;  3AEA A;  2JQH A;  3CWZ B;  1XZY A;  3U78 A;  5HXH A;  3ANW A;  2Y48 B;  3GMI A;  4X65 T;  3EVY A;  3OTO T;  1S35 A;  2LHR A;  3UFG A;  2LJL A;  2WMO A;  3X1D A;  3W15 B;  4EIW A;  2C5J A;  2XAQ B;  2ZM8 A;  4TN7 B;  4HWD A;  3LK4 2;  2CPT A;  4DUZ T;  1UUR A;  2W61 A;  5JDM A;  4UVC B;  2QVA A;  3AXJ A;  2WZI A;  3J9X 1;  5HAX A;  1UUS A;  2CHO A;  1DU2 A;  2QA7 A;  4UVA B;  5IWA T;  4H9R C;  2XQ5 A;  4ILB A;  4NIQ A;  3CK6 A;  5FL0 A;  2V7J A;  3ETV A;  5HEG A;  2JPF A;  3LJC A;  4HWC A;  4DV0 T;  2ZMA A;  2VVS A;  2WU5 A;  3EDV A;  4U7I A;  3LBX B;  5FY0 A;  2ZM2 A;  3N5L A;  5ABF B;  1N33 T;  1D0Y A;  3AA6 B;  3AE4 A;  5AQR B;  1SUM B;  2WCA A;  4OFZ A;  4EXT A;  3E22 E;  2C0S A;  4HFC A;  3FZM B;  2W66 A;  3PUW F;  4ZI7 E;  2EHO C;  2WM9 A;  3BQK A;  2IDO B;  2MYS A;  5AQK B;  3ZT7 A;  4E7S A;  2ACX A;  1IBM T;  4LFC T;  3LG7 A;  4AKG A;  2WWU A;  3KIN B;  3P4S A;  4YSX A;  1ZOY A;  2JQQ A;  3AE9 A;  2IML A;  3JCF A;  3PU3 A;  4KBM B;  2X9H A;  3UU4 A;  4YXD A;  2ODU A;  2HN1 A;  2YDS A;  3ABV A;  2RA1 A;  5EK2 A;  1WR0 A;  5LBM A;  5JDQ A;  5JQG E;  2M6B A;  4GIW A;  2PJQ A;  4U33 A;  2MBG A;  2UXX B;  3ZYM A;  5LOV E;  4TNV A;  2PTF A;  5HWY A;  2G0U A;  2LEH A;  3LDQ B;  4QX8 B;  4WW0 A;  3UU3 A;  3KBT A;  5LMU T;  5H6Q B;  4ZOL E;  2CXD A;  4XAX B;  3VR9 A;  3RC8 A;  1OED C;  4AKR B;  1ZP0 A;  3FZH B;  5BMV E;  5L3F B;  1YKE B;  3RRC A;  1B7T A;  4V1A v;  5AQU B;  4TUY E;  4DV6 T;  3A5X A;  2LOP A;  4H63 H;  1J1J A;  3RRW A;  1IZN B;  2Q9Q D;  1LVK A;  2VQF T;  5AQH B;  3TKL B;  2K5B B;  2ACZ A;  4MBQ A;  3PUS A;  5DQW A;  5AQL B;  4ZXL A;  4IE0 A;  1D1C A;  2L8K A;  2WBL A;  3Q5D A;  4IGU A;  4IDP A;  4MAL A;  3MA9 A;  3BQI A;  2A9U A;  2YDR A;  3IEE A;  5DQV A;  2Q9Q C;  3OYX A;  3P4P A;  2E5L T;  5HXR A;  4LF4 T;  1OED E;  2D0U A;  1MIV A;  3P4R A;  3QNU A;  5HCJ A;  3UUL A;  1N34 T;  2BBH A;  2CEA A;  3DTO A;  2FBW A;  3FXE B;  2L9Q A;  5KXJ A;  3SFD A;  2WU2 A;  1E1H B;  4Q25 A;  1FMV A;  1MIY A;  2BG9 A;  2KT9 A;  4B3M T;  4JV5 T;  2LM9 A;  2V8S V;  2X67 A;  4Z91 A;  2W0G A;  4P09 A;  4JI5 T;  3UUN A;  2DCF A;  2YEV C;  4LF8 T;  3K8P C;  4AI6 A;  2X9X A;  3RYC E;  4L9I A;  3AEF A;  3HR0 A;  4CXX A;  1N36 T;  3RC3 A;  3FZL B;  3ZCI A;  3RQU A;  1LVF A;  4HFB A;  1KNP A;  4H9N C;  4QH1 A;  1L0V A;  3NZP A;  1W9R A;  4L0R A;  2YDQ A;  3CX8 B;  2W63 A;  3P4Q A;  1XMQ T;  2JMK A;  1ZKE A;  3KDS E;  4Z90 A;  5L3D B;  2IC9 A;  3FB2 A;  4BAY B;  2XQ8 A;  3AB3 B;  2EHO D;  5C2T A;  2WB5 A;  4TZ4 C;  2IW5 B;  1D1A A;  1KNZ A;  3ZJ1 A;  2J62 A;  3M3Z B;  2JIW A;  4AQY T;  2AXD S;  2X51 A;  5ADX L;  3AA0 B;  4U2Y A;  2DNX A;  4EOZ B;  3UUB A;  2BKN A;  3JC6 D;  1SE7 A;  2NP9 A;  3F2E A;  5LBQ B;  4A56 A;  2Y6X A;  1MIW A;  2IC6 A;  2GK9 A;  2JQK A;  4PJM A;  2ZLY A;  2ZM0 A;  3VRB A;  2LSY A;  4TX5 A;  3ZC1 A;  2H89 A;  1OED B;  3EHZ A;  4DUY T;  5AQG B;  3B13 A;  3C4X A;  3TLU A;  2H88 A;  3E08 A;  5L3E B;  2XSA A;  4I43 B;  3N9L A;  3OJA A;  1XDO A;  2CBJ A;  2VB6 A;  2Z6E A;  3RKG A;  2HPL A;  4FJO A;  3FZK B;  5EK4 A;  3ZCJ A;  3ZC0 A;  2X0H A;  3ZN0 B;  4AKL A;  2XQ6 A;  4COF A;  2I6H A;  3AVS A;  1CUN A;  4O4J E;  4TV8 E;  2CCQ A;  4ILA A;  4JI1 T;  4PNI A;  4N78 D;  3OBV E;  1XWM A;  2A72 A;  2XJ7 A;  4IE7 A;  5F8P A;  3ZST A;  5FXZ A;  4DV2 T;  3S4U A;  5LB7 B;  5EZY E;  1ZV4 X;  4ZZC A;  2YU2 A;  4G63 A;  1WRD A;  2LLY A;  2I59 A;  4DID B;  4UV8 B;  4A5X A;  1NEK A;  2X0Y A;  3AAA B;  3KFW X;  4ADZ A;  3EI0 A;  5CB4 E;  5JR9 C;  3L8R A;  4HTE A;  2BG9 C;  3SS1 A;  1HG2 A;  4IDZ A;  2CM0 A;  2XAJ B;  5L4H A;  5CJ5 A;  5L47 A;  2XZE A;  1KFY A;  4LFA T;  2CLY C;  5KMG P;  1W0B A;  3BQL A;  3CML A;  4X20 E;  3F57 A;  2WWV A;  3P8C D;  4CQI A;  1NWM X;  4HE8 A;  1HCI A;  4AIS A;  4CI2 B;  4HFH A;  3I0Q A;  2KLQ A;  1Y64 B;  2E9X D;  3ONJ A;  4QXH B;  3T1H T;  4YLH A;  3MKD A;  1H7C A;  5F3J A;  2F4V T;  4IE5 A;  5HEU A;  3IF8 B;  4QKN A;  4F6R C;  4MFR A;  3CX6 B;  4LFB T;  3B57 A;  4U7Y A;  2UUC T;  4YY3 T;  4B3T T;  2MTQ A;  3PUA A;  4X64 T;  4EED A;  5IYZ E;  4ERR A;  2ODV A;  1T8B A;  5F5W A;  3ZMU B;  2UXN B;  3NVO A;  2HHH T;  4DR6 T;  2LE8 A;  3C51 A;  1YKH B;  2XAS B;  5JDN A;  3EUH A;  3L3P A;  2DWK A;  4OK0 A;  3U3I A;  3J7Y q;  3C4W A;  3FBZ A;  4HWI B;  2YK0 A;  3NKZ A;  5LG3 A;  4GKJ T;  4GKK T;  3VU7 H;  5LYJ E;  2V7M A;  4AQG A;  1BR4 A;  4ANJ A;  3LBX A;  5CA0 E;  3FXD B;  3RKO A;  3ZYL A;  1KEY A;  1E7P A;  1W09 A;  2FJD A;  2OA5 A;  3MZK B;  3PJA A;  5JR9 A;  5AQN B;  3Q9D A;  4MLK A;  4JI2 T;  2EHO B;  5AFU L;  3RF1 A;  1EZ3 A;  2BVL A;  2V1D B;  5LXT E;  1FMW A;  4C90 A;  2E5V A;  2D0T A;  2MPK A;  5ABG A;  2M6I A;  4PJN A;  4QXB B;  4O4L E;  3UT5 E;  4K0K T;  2ES0 A;  4KHP T;  4YTM A;  1BR1 A;  4DV7 T;  2W00 A;  5HXC A;  1T72 A;  5CGM A;  1T7S A;  2UXB T;  5HYA A;  4DR5 T;  2XSB A;  3ANW B;  2H3R A;  3FHN A;  4I4T E;  2JMH A;  2X66 A;  5AQO B;  2CWY A;  2XQ9 A;  3UU6 A;  3VHL A;  3UQ7 A;  2D2S A;  3HA4 A;  5FY1 A;  5J2U E;  2NR4 A;  2IUB A;  2X9W A;  3V5U A;  1CHU A;  3AE8 A;  4YHH T;  1FJG T;  2B76 A;  4HEA A;  4QH4 A;  4BJM A;  5LG4 A;  4OYJ A;  1I94 T;  4JI4 T;  5FXX A;  3PUV F;  4GK5 E;  3FZF B;  2XM2 A;  4ILC A;  5L3C B;  3ZMV B;  3IBP A;  5FP3 A;  4TWD A;  2SPC A;  5GON E;  2E8I A;  2DL1 A;  1LRZ A;  2K3W A;  4ISS A;  2XTL A;  4JI6 T;  1E2A A;  4LF9 T;  4UF0 B;  4Z8X A; 
#chains in the Genus database with same CATH homology
 2X68 A;  1UCU A;  1HF8 A;  2Q9Q B;  2E9X B;  3KV5 A;  4ZI3 C;  2NW7 A;  5DAB A;  5LHG B;  4ILU A;  3RYI E;  3PE0 A;  4U74 A;  2KXP B;  2K9A A;  3I0O A;  4I50 E;  4P0A A;  4YJ3 E;  2KZ7 B;  5J2T E;  5LGU B;  4PJL A;  4H9Q C;  4PK6 A;  3PUQ A;  4GYS A;  2NTX A;  3O4X E;  4CXW A;  4YFS A;  4EZ4 A;  2KIN B;  1HX8 A;  3HL6 A;  3RPU A;  4UV9 B;  2VKH A;  5LJM A;  1D1B A;  4GYR A;  5L2L A;  4AKI A;  3OKQ A;  3C50 A;  1HFA A;  1VOM A;  2Q9Q A;  2XQY A;  5TAO A;  4XBF B;  1VRB A;  2X0L B;  4IIJ E;  1U4Q A;  2BVM A;  3C64 A;  4HGA A;  4KMC A;  2X9Y A;  2XUE A;  3ZMT B;  5JDH A;  4IE6 A;  3KV4 A;  2LSJ A;  1WYB A;  3BK9 A;  2CE7 A;  3N2G E;  2RP4 A;  4XZC A;  3ONX A;  1MMD A;  1MMA A;  2C5I T;  1UX5 A;  3NRX A;  5CA1 E;  4HFV A;  1S94 A;  3H3A A;  4PAG A;  3WAK A;  5L3G B;  2JRK A;  3RYH E;  3ZJ2 A;  3AAE B;  4ZS3 A;  3ZPO A;  2PG8 A;  4QHO A;  2YIN A;  2HPJ A;  4AXP A;  1MNE A;  5JRE A;  3QK6 A;  3AA7 B;  5FXV A;  4BJN A;  5FXW A;  3SRZ A;  2EHO A;  3CPZ A;  3HKE E;  1X79 A;  2LSG A;  2WMN A;  4KP3 C;  5ETW A;  4E7Z A;  1WYC A;  4CI1 B;  3V5S A;  2J1D G;  1SA0 E;  4K0U A;  4GOU A;  4NUV A;  4DBQ A;  3O1I A;  1AJ3 A;  4X1Y E;  3LFM A;  3D0T A;  3GA8 A;  1D0Z A;  3CQX C;  3P7I A;  3OYZ A;  3O1J A;  4TV9 E;  3Q5X A;  2LSK A;  4G2A A;  2XHE B;  3NRY A;  1IJ6 A;  1QSD A;  5M4Y A;  3N2K E;  2BZB A;  2CA5 A;  2WAU A;  5LA6 E;  5LNK A;  4JUY A;  3ZMS B;  3PTR B;  4O4H E;  1BR2 A;  4IST A;  1ZHC A;  1G73 A;  3CQG B;  5JDG A;  2N1G A;  4EYU A;  2K24 A;  1US7 B;  2V7I A;  4X1I E;  3UUM A;  1NAF A;  4B6X A;  3ETU A;  1MMN A;  4PJJ A;  2XAG B;  5JR9 B;  3CQC B;  2YU1 A;  4QXC B;  3KV6 A;  3MK7 C;  3N9P A;  1D0X A;  1FEW A;  4IHJ E;  1HS7 A;  4C91 A;  2VKJ A;  3ZEF B;  2H7O A;  2LSI A;  3AA1 B;  5C8Y E;  3KV9 A;  4JEH B;  4J2C A;  2JJ9 A;  4WNK A;  2LHN A;  1KK7 A;  3PU8 A;  4ZHQ E;  2KND A;  4PK5 A;  1IJ5 A;  2P9B A;  3MAC A;  2LOS A;  3FBL A;  3UFE A;  4O2B E;  2XAH B;  4DO0 A;  5JRC A;  2PFV A;  4O4I E;  4EB6 E;  3EDU A;  5LP6 E;  3E0Z A;  3T8O A;  3PUR A;  3K3Q C;  5LCY A;  4AQF A;  3CKD A;  1MMG A;  4EAH A;  1FIO A;  3L09 A;  2VAS A;  1O3X A;  5L3B B;  5J1G A;  3WI3 A;  2KMF A;  2H7V C;  3C4Z A;  4JEU B;  3N9M A;  4H9O C;  4UVB B;  4WBO A;  4P0B A;  3C98 B;  2VL8 A;  3CVR A;  4M1P A;  3SOL A;  1MND A;  4ZI2 D;  2CMR A;  4QWN B;  2NW9 A;  2E9X C;  2WSS V;  4UF0 A;  3RX6 A;  4DMW A;  1Z0P A;  5FMN A;  3SWH A;  3WAJ A;  4KUM B;  1WLX A;  5FNV E;  4ZS2 A;  3UUX B;  4DND A;  3N2O A;  3K3O A;  5KDM C;  3KBU A;  4ZI3 D;  3Q5W A;  3RH3 A;  3ZLI A;  2PBI A;  3CX7 B;  4DBR A;  3PUG A;  1BR0 A;  1YD8 G;  2QGS A;  3ESL A;  3HI2 A;  5LGT B;  4UEM A;  5KX5 E;  2V7K A;  4JLE A;  1WR6 A;  4BA9 A;  3HKB E;  4EYY R;  3N9O A;  3O9X A;  4PW8 A;  4U72 A;  3HKD E;  3NZQ A;  2KWI B;  4OHF A;  2NWB A;  4PK4 A;  4HN9 A;  5H6R B;  2Y8D A;  3ZN1 B;  2VWA A;  3GWH A;  2A3D A;  5FYM A;  5HWX A;  1HG5 A;  4H9P C;  1UX4 A;  3QUJ A;  5A1L A;  1QUU A;  4H9S E;  5JVD E;  3HKC E;  5E0O A;  1HTJ F;  3I9W A;  2CXL A;  3JC6 C;  2N9D A;  2DLR A;  3AAI A;  3KVB A;  3RYF E;  4DVD A;  2L3L A;  4UXN B;  2NOX A;  2LT3 A;  4NUU A;  5LHH B;  2V26 A;  2DI4 A;  4IE4 A;  4O2A E;  2M67 A;  3F31 A;  4MHC A;  5HXE A;  4ASK A;  3LK3 B;  4UIG A;  2W62 A;  3ZYK A;  2E9X A;  1OXZ A;  3IHR A;  4GK0 E;  4CXY A;  2MOZ A;  3K3N A;  2VK9 A;  4PFP A;  4YJ2 E;  1IAP A;  3GN5 B;  3MXZ A;  3DJB A;  5LHI B;  2VKD A;  3AVR A;  3UTK A;  4CI3 B;  4X1K E;  1YW0 A;  2A2F X;  3N9N A;  4UEL A;  4YHJ A;  3VKG A;  3I9Y A;  1U5P A;  2CLY B;  2KWH A;  4I55 E;  4HKA A;  4AQF C;  3KVA A;  4WBN E;  4ZI2 C;  5JDF A;  3MJX A;  5JRC B;  2HH7 A;  1V9D A;  1G8X A;  3NBX X;  4DMV A;  1LKX A;  3ZMZ B;  4OYK A;  5IHY A;  2CXF A;  2D5U A;  5DJQ C;  5EK3 A;  4AKH A;  2DHR A;  2K48 A;  2DWG A;  3VKH A;  5LJN A;  2B1E A;  3O1H A;  4PFO A;  5JH7 E;  4H63 V;  2V7L A;  1ZEE A;  3DP7 A;  3I1A A;  3M65 A;  4CZZ B;  3N9Q A;  2BDE A;  3R84 B;  4EZH A;  2VKO A;  1T98 A;  3LK2 B;  3GN5 A;  2C5K T;  3QC9 A;  4O8S A;  5JDL A;  2N2N A;  3PDY A;  5LGN B;  1OWA A;  1SHZ C;  4FI5 A;  5FY7 A;  3H37 A;  2IAK A;  2XAF B;  2CWO A;  3Q2M A;  2NTY A;  3R6N A;  2NW8 A;  4L5G A;  4QX7 B;  3CWZ B;  3U78 A;  5HXH A;  3ANW A;  2Y48 B;  3GMI A;  3EVY A;  1S35 A;  2LHR A;  2LJL A;  2WMO A;  4EIW A;  3W15 B;  2C5J A;  2XAQ B;  2ZM8 A;  4TN7 B;  3LK4 2;  2W61 A;  5JDM A;  4UVC B;  3J9X 1;  5HAX A;  2QA7 A;  4UVA B;  4H9R C;  2V7J A;  3ETV A;  2JPF A;  3LJC A;  2ZMA A;  3EDV A;  3LBX B;  5FY0 A;  2ZM2 A;  3N5L A;  1D0Y A;  3AA6 B;  4OFZ A;  4EXT A;  3E22 E;  2C0S A;  4ZI7 E;  2EHO C;  2WM9 A;  3BQK A;  2MYS A;  4E7S A;  2ACX A;  3LG7 A;  4AKG A;  2WWU A;  3KIN B;  2JQQ A;  3PU3 A;  4KBM B;  2X9H A;  2ODU A;  5JQG E;  2RA1 A;  5EK2 A;  5LBM A;  5JDQ A;  4GIW A;  2PJQ A;  2MBG A;  2UXX B;  3ZYM A;  5LOV E;  5HWY A;  2G0U A;  2LEH A;  4QX8 B;  4WW0 A;  3KBT A;  5H6Q B;  4ZOL E;  2CXD A;  4XAX B;  3RC8 A;  4AKR B;  5BMV E;  5L3F B;  1YKE B;  3RRC A;  1B7T A;  4V1A v;  4TUY E;  3A5X A;  2LOP A;  4H63 H;  3RRW A;  1IZN B;  2Q9Q D;  1LVK A;  3TKL B;  2K5B B;  4MBQ A;  5DQW A;  3PUS A;  4IE0 A;  1D1C A;  2L8K A;  2WBL A;  4IGU A;  4MAL A;  5DQV A;  3MA9 A;  3BQI A;  3IEE A;  2Q9Q C;  3OYX A;  5HXR A;  2D0U A;  1MIV A;  3UUL A;  2CEA A;  3DTO A;  3FXE B;  2L9Q A;  1E1H B;  1FMV A;  1MIY A;  2KT9 A;  2LM9 A;  2X67 A;  2W0G A;  4P09 A;  3UUN A;  2DCF A;  2YEV C;  3K8P C;  4AI6 A;  2X9X A;  3RYC E;  4L9I A;  3HR0 A;  4CXX A;  3RC3 A;  3ZCI A;  1LVF A;  4H9N C;  3NZP A;  4L0R A;  3CX8 B;  2W63 A;  2JMK A;  1ZKE A;  3KDS E;  5L3D B;  2IC9 A;  3FB2 A;  4BAY B;  3AB3 B;  2EHO D;  4TZ4 C;  2IW5 B;  1D1A A;  1KNZ A;  3ZJ1 A;  2X51 A;  5ADX L;  3AA0 B;  2DNX A;  4EOZ B;  3JC6 D;  2NP9 A;  3F2E A;  5LBQ B;  4A56 A;  2Y6X A;  1MIW A;  2IC6 A;  2GK9 A;  4PJM A;  2ZLY A;  2ZM0 A;  2LSY A;  4TX5 A;  3ZC1 A;  3B13 A;  3C4X A;  3E08 A;  5L3E B;  4I43 B;  3N9L A;  3OJA A;  2Z6E A;  2VB6 A;  2HPL A;  4FJO A;  3ZCJ A;  5EK4 A;  3ZC0 A;  3ZN0 B;  4AKL A;  3AVS A;  1CUN A;  4O4J E;  4TV8 E;  2CCQ A;  4PNI A;  4N78 D;  3OBV E;  2A72 A;  4IE7 A;  5F8P A;  5FXZ A;  3S4U A;  5EZY E;  1ZV4 X;  2YU2 A;  4G63 A;  1WRD A;  2I59 A;  4UV8 B;  5JR9 C;  3KFW X;  4ADZ A;  3AAA B;  5CB4 E;  4HTE A;  3SS1 A;  1HG2 A;  4IDZ A;  2CM0 A;  2XAJ B;  2CLY C;  5KMG P;  3BQL A;  3CML A;  4X20 E;  3F57 A;  4CQI A;  3P8C D;  1NWM X;  4HE8 A;  1HCI A;  4CI2 B;  3I0Q A;  2KLQ A;  1Y64 B;  2E9X D;  4QXH B;  4YLH A;  3MKD A;  1H7C A;  5F3J A;  4IE5 A;  4F6R C;  3IF8 B;  4QKN A;  4MFR A;  3CX6 B;  3B57 A;  2MTQ A;  3PUA A;  5IYZ E;  4ERR A;  2ODV A;  3ZMU B;  2UXN B;  2LE8 A;  3C51 A;  1YKH B;  2XAS B;  5JDN A;  3EUH A;  3L3P A;  2DWK A;  4OK0 A;  3U3I A;  3J7Y q;  3C4W A;  3FBZ A;  2YK0 A;  3VU7 H;  5LYJ E;  2V7M A;  4AQG A;  1BR4 A;  4ANJ A;  3LBX A;  5CA0 E;  3FXD B;  3RKO A;  3ZYL A;  2OA5 A;  3MZK B;  5JR9 A;  3Q9D A;  4MLK A;  5AFU L;  2EHO B;  1EZ3 A;  2BVL A;  2V1D B;  5LXT E;  1FMW A;  4C90 A;  2D0T A;  4PJN A;  4QXB B;  4O4L E;  3UT5 E;  2ES0 A;  1BR1 A;  2W00 A;  5HXC A;  5HYA A;  3FHN A;  2H3R A;  3ANW B;  4I4T E;  2JMH A;  2X66 A;  3VHL A;  2CWY A;  2D2S A;  3HA4 A;  5FY1 A;  5J2U E;  2X9W A;  3V5U A;  4HEA A;  4BJM A;  5LG4 A;  4OYJ A;  5FXX A;  4GK5 E;  5L3C B;  3ZMV B;  3IBP A;  5FP3 A;  2SPC A;  5GON E;  2E8I A;  4ISS A;  1LRZ A;  2XTL A;  5HXS A;  4UF0 B;  4Z8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...