1YKEB

Structure of the mediator med7/med21 subcomplex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
119
Chain Sequence
DRLTQLQICLDQMTEQFCATLNYIDKNHGFERLTVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLLRHVDSLIEDFVDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords RNA polymerase II mediator complex protein MED7
total genus 44
structure length 119
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11221 Med21 Subunit 21 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.470 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ykeB00
1YKHB 1YKEB
chains in the Genus database with same CATH superfamily
5L47A 5ABFB 1QUUA 3LBXA 2CWOA 2V5DA 3CPZA 1FMWA 3FZKB 4PK6A 1W0AA 3UUNA 2XM2A 1OEDE 1VRBA 3I1AA 4A56A 2IUBA 3C4WA 2XQ7A 2X67A 3EVYA 4U2YA 5HXCA 5JDLA 1NWMX 5JR9C 4GK5E 2W67A 3IHRA 2UUBT 2A9UA 2LSKA 4MBQA 1GQEA 4MHCA 1US7B 2LM2A 3HA4A 3FBLA 3JCFA 3PUSA 4HFVA 4DR4T 1KFYA 5L3CB 1YW0A 4LFAT 4H9PC 4YFSA 1U4QA 2Q9QA 2D9DA 3EAMA 3ANWB 4KHZF 4OFZA 3VHLA 1HNZT 3NBXX 3PUGA 3AAIA 2H3RA 4FJOA 4Q25A 3RHWA 4H63H 1KEYA 5EK2A 4JI1T 4HFDA 4DR5T 1W0BA 3ETUA 2KSRA 4ISSA 2YDSA 3RPUA 4DV7T 2XQ9A 4EGWA 2Y8DA 4YSZA 3RC8A 2G0UA 3N2KE 2DWKA 1ZHCA 2H89A 2E9XB 1ZOYA 3I9WA 3ABVA 4ASKA 1HNXT 1IAPA 2K5BB 3AEDA 4TWDA 1T7SA 3GWHA 1IJ6A 5DQWA 4DO0A 4ZZBA 1X9BA 3N2GE 1LKXA 2LEHA 2MAWA 1CUNA 3AVRA 3ZCJA 3ONLC 4ILCA 2XPKA 3U78A 3VKHA 2PJQA 4AIUA 4DUZT 2LRLA 5FL0A 2CM0A 3CK6A 2IMLA 3LSVA 5L3GB 5L4HA 3N9OA 4X64T 4YHJA 1XZYA 5LB7B 2BVLA 3JAEA 3NWIA 3RGLA 2WZIA 5LMNT 4AI6A 3L8RA 2QVAA 4IE6A 3RLFF 1IBMT 3Q5EA 1HG2A 4ILBA 3RX6A 4BAYB 3AE9A 2W0GA 2NTXA 1FMVA 2P9BA 5DJQC 2WWVA 5JTGA 5GONE 5JREA 3N9QA 4B3MT 2ES0A 3HL6A 4IREA 4LF5T 4GYSA 4JYAT 2LHNA 4PNIA 4O2BE 1E2AA 4TNVA 3Q9DA 3RIUC 4X1IE 2BS3A 1BR0A 4JI6T 4QXBB 1M62A 2PFVA 1WLXA 2HH7A 2V26A 2WM9A 2XHEB 2WU2A 1BR4A 5CGMA 2X0LB 4YJ2E 1T8BA 5HXSA 4HKAA 5FY1A 1VCSA 3CX8B 4QX7B 2RA1A 3P8CD 1L0VA 4WYVA 1ZV4X 3AE4A 2OA5A 2VKHA 2NP9A 1MIWA 3BK9A 4KMCA 4DBQA 4B6XA 3AA7B 3HI2A 3D0TA 4JI7T 3C4XA 5AQHB 2XAJB 3UUMA 2UXBT 3ZMSB 2VL8A 3QB5A 2YDRA 3VRAA 5BR8T 5LA6E 5FMNA 4TUYE 2FBWA 1IZNB 2W00A 4I4TE 4ZI7E 3P4WA 2X9WA 5LMUT 1XNRT 4JI8T 3KV6A 4EYYR 2YKSA 2VL0A 2XQ3A 2CXLA 4HTEA 4HE8A 2I6HA 2WSSV 1WYCA 2CA5A 1W9RA 3IA3A 4UV8B 3OTOT 4QH4A 1UK5A 2WDQA 5AQMB 4X66T 4DV0T 4X65T 4HWHA 4YXDA 4QH1A 1HG5A 2M67A 3TKLB 2BKNA 5ABGA 2V7MA 5FXVA 4DV3T 1IJ5A 4P1NA 4EZHA 3FHNA 5HEGA 2CWYA 3I0QA 4AQFA 2KNDA 2ZM2A 2BKPA 3ESLA 4H63V 2CE7A 5LGTB 4DV6T 4PFOA 4B3TT 1WR6A 3PJAJ 3WI3A 5LG3A 1NENA 2EHOA 2DLRA 4ZS2A 3P7IA 1MIVA 4JLEA 5FYMA 5JVDE 1E1HB 5KX5E 3HKEE 2CBJA 4PK4A 2M6BA 4WBOA 2UUAT 2ACXA 4TWFA 2D0UA 4QKNA 4NXMT 4IL4A 1HR0T 2ZMAA 4AQYT 2LSIA 5LCYA 3KVAA 1UURA 3HR0A 2MTQA 4TN7B 4UELA 2XQ4A 4GIWA 3PUVF 3BQLA 3O1IA 5BMVE 2XSBA 2BG9C 3PTRB 5LOVE 3RC3A 3TLWA 3LK42 3ZSSA 2F4VT 5H6RB 1KNRA 2W66A 2BVMA 4U74A 1N36T 4I50E 5JH7E 1XDOA 5ABFA 4JI5T 2MOZA 3UUBA 1WYBA 1Y01A 5LXTE 2NOXA 3GN5A 2IW5B 4AQGA 5HWXA 2XUEA 2FJEA 2WY2A 2ZLYA 3KDSE 3RIFA 3RRCA 3K8PC 3L09A 3U3IA 5HEJA 2J1DG 2Y6XA 3GMIA 2YDQA 5L3FB 5JDHA 2JJ9A 2HPLA 2LOPA 1IBLT 4K0KT 2A2FX 2RPAA 3Q5XA 5EK3A 3O9XA 3Q2MA 5JDGA 3OJAA 5LP6E 4P0AA 2Y48B 3ZMUB 2JIWA 2E8IA 3PV0F 3VU7H 3ZN0B 3JAFA 3ZSTA 3AAEB 1OEDC 2JQHA 4E7SA 4X5TA 4HN9A 4EV6A 2M6IA 4H9NC 4CXWA 4PJLA 3UTKA 5AQIB 4PK5A 3ZLIA 1D0XA 2DI4A 5IHYA 5AQGB 1D1CA 4UEMA 3ZT5A 4AKRB 1MNEA 2WMOA 3VR8A 2IHR1 4I0UA 1N32T 3PUXF 2LSGA 2SPCA 1MMNA 2X9YA 3AEAA 5FVKA 3UU4A 4GOUA 2XJ7A 5J1GA 4DUYT 2A3DA 2W62A 1W09A 2E9XD 1SUMB 3VKGA 5AQNB 3AXJA 2PTFA 3PUQA 2VKJA 3RQWA 2XQ8A 1NAFA 2CHNA 2RP4A 4YSYA 3TLUA 3V5UA 3OBVE 3O1JA 5AQVB 5FP3A 2NTYA 3NRYA 4LMKA 4DR1T 2YINA 5AQJB 2V5CA 3UQ7A 2LE8A 2JQKA 1QLBA 2OLTA 2XZEA 3QUJA 5CFBA 5AQTB 3ZPOA 5J0ZA 2L8KA 2PBIA 3ZKRA 4JI4T 1B7TA 3OYZA 3Q5DA 2VB6A 3MACA 4IE5A 2XAQB 1ZP0A 3N9MA 3CX7B 5AQPB 4DVDA 3TLTA 5L3DB 2UUCT 1U5PA 4OYJA 4U3CA 4CQIA 3SWHA 1OEDB 2WMNA 3DP7A 5C3JA 4L5GA 4IE7A 2Q9QD 3DTOA 4PW8A 2K48A 3N5LA 4L9IA 5LBMA 4Z91A 4YY3T 3AEBA 5HEHA 5FNVE 2ZM6T 3T1YT 5TAOA 2BKOA 3QOFA 4O4HE 4AKLA 3LK2B 3H37A 3JC6C 4ZZCA 1MNDA 1X79A 1WR0A 2J62A 3RKOA 2YEVC 4IL9A 3UUXB 4UVBB 5DQVA 4ZEYA 4BA9A 4OHFA 2WS3A 5C2TA 3SOLA 2JMKA 5FXZA 3LBXB 4Z8XA 5CB4E 2V7JA 3HKDE 5ABEA 2WWUA 5EK4A 2VQFT 4IDQA 3VR9A 3AEEA 4CI1B 1IBKT 2VURA 1LVKA 2AXDS 2LKGA 3AE3A 4O2AE 2X66A 4DBRA 1YKHB 5IWAT 4WZXA 4GKJT 3FZMB 3H3MA 4CZZB 3RIUA 1YD8G 3NRXA 3W15B 3ZJ2A 3ZMVB 5J2UE 5CA0E 2WQYA 4HFBA 3DJBA 4ILUA 2H88A 5AQFB 5FY7A 2KMFA 4LF4T 2C5KT 3OYXA 2VWAA 4HWFA 2CPTA 1J5ET 4JBWF 4AKIA 2IAKA 4H9QC 4TNWA 4PFPA 3UU8A 5LHGB 4IHJE 1HX8A 2KINB 2KWHA 3EABA 3E08A 2BG9A 5J2TE 4JV5T 4DV1T 4PJJA 3QK6A 3KV9A 4UV9B 1ZEEA 3FZLB 2HN2A 1HNWT 1MIYA 1OXZA 3AE6A 3R6NA 4QHOA 2DHRA 2IIUA 1SHZC 3CKDA 5HXEA 4DR2T 3KBUA 3P50A 4B3RT 3KINB 2CXDA 1QSDA 2D2SA 1H7CA 2XAFB 2ZM8A 3AE1A 1VCTA 3A5XA 3O4XE 5JR9B 4LF9T 4NXNT 1WCRA 1UX5A 2ACZA 2ODVA 3AE7A 4WNKA 3ANWA 3FB2A 5C8YE 4IDNA 5LJMA 5HCJA 4X62T 2FJDA 2EHOD 1JNZA 2UXXB 2X0HA 4YTPA 3NZQA 4OX9T 2DL1A 2NR4A 4U2ZA 4H9SE 3OPCA 3JADA 4ILAA 5FXWA 4ADZA 2V7LA 2KLQA 1YQ3A 3ETVA 2JMHA 3IBPA 2QYWA 4CN6A 1R8IA 3EI0A 2W4XA 4G63A 4AQFC 3LFMA 1J1JA 4EAHA 5LG4A 3CVRA 1MMAA 5LHIB 3KFWX 4HWCA 1MMDA 1AJ3A 2V7KA 5HEUA 5LGNB 1Z8UA 3PJAA 5EZYE 2CHOA 3OKQA 3A7MA 4JI3T 2CLYC 4AKHA 1UCUA 5L4EA 1KNZA 2KT9A 2I0MA 2Q9QC 4HGAA 3LK3B 5AQSB 2YOEA 5HXRA 2QA7A 2V8SV 5JQGE 2L9QA 2CEAA 2DNXA 1XMQT 5F5WA 4A5XA 3CWZB 4MFRA 5JDFA 5AFUL 1EZ3A 4ZI3C 3T1HT 3FXDB 1XWMA 3J7Yq 2BZBA 3K3NA 4HFIA 4IIJE 4ZHQE 5LJNA 5AQRB 2XQ5A 2E2AA 4HFHA 1D0ZA 5HWYA 3MXZA 4EEBA 3OVUA 5M4YA 2XY8B 3AXJB 3F31A 3PUZF 3J9X1 4UIGA 3E22E 4CI2B 2R6GF 2QGSA 5F3JA 4YLHA 4EOZB 3LDQB 4U31A 3N2OA 3P4SA 2E9XC 2GK9A 3AEFA 3CX6B 1CHUA 4ZOLE 3AA6B 4NIQA 2MBGA 5FL1A 2IDOB 3ZMZB 4JI2T 1KF6A 1O3XA 3RYFE 4LF7T 1HTJF 4TX5A 5IYZE 4CI3B 2E5VA 3N9NA 3MA9A 3BQKA 1J5WA 3AB3B 1SA0E 1FIOA 4KI0F 4GKKT 5LGUB 2LKHA 2VK9A 2XAGB 4GK0E 5ABHA 2WP9A 2YN6A 4QWNB 3L3PA 4LF8T 3PDYA 1UX4A 4KHPT 2VKOA 4QXCB 4Z90A 4YT0A 2UXDT 3MZKB 3PU3A 3ZC1A 1D0YA 2X0YA 1HS7A 2K3WA 3CMLA 4IE0A 2VKDA 2FJAA 3HKBE 1FEWA 2L3LA 3MJXA 3FXEB 1UGOA 3P4QA 4KBMB 2EHOB 4TV8E 4AISA 3RYIE 1E7PA 2CRBA 4J2CA 4CN1A 3ZEFB 4DR3T 2W2UA 3L39A 4I43B 1ZKEA 5FXXA 1Y64B 2LOSA 4A97A 3ZMTB 5ADXL 5L3BB 4BJMA 2LM9A 3A8YC 3KBTA 3MK7C 4JEUB 4O4LE 4QXHB 2D0TA 4ZS3A 5FVLA 3MKDA 4ANJA 1BR1A 4DNDA 5HAXA 4ERRA 2C0SA 4NPPA 2CBIA 3PUAA 2N2NA 4CN4A 2V6YB 2OV9A 3HKCE 3AEGA 3IF8B 1YXRA 4NUUA 3TLSA 1UUSA 4EZ4A 4P09A 4LMJA 3NZPA 3B13A 4HWIB 2H7VC 2KZ7B 5ETWA 3SRZA 4PJNA 5LHHB 3UFEA 4DV4T 4B3ST 1N33T 2UXCT 2WU5A 2LHRA 2X68A 1YQ4A 4ISTA 4YTMA 2WB5A 5JR9A 4DIDB 3PUYF 4KX6A 3RYHE 4ZI2D 2J47A 1MMGA 1YKEB 2WZHA 2IC6A 3QB5K 4DV2T 4O4JE 5KXJA 4KP3C 4UVAB 3AVSA 5AQQB 2HN1A 4CXXA 5HCMA 4UR9A 4PAGA 4HFEA 3UQ4A 3VRBA 3NVOA 3FZHB 2BG9B 2CCQA 4IGUA 4YJ3E 2FUPA 4G2AA 3B5MA 2B76A 4X1KE 1NEKA 3EDVA 2XQAA 5HEOA 5JDMA 3O1HA 4NUVA 3C98B 2W63A 3AAAB 2PG8A 4IDOA 2QRXA 2UXNB 4U72A 3SS1A 5JDQA 4DR7T 3ZYLA 2JPFA 3EDUA 2DCFA 1S94A 2JQQA 3M3ZB 3N9LA 4MLKA 2BBHA 1WRDA 4ZI2C 3UFGA 2N1GA 2V6XA 4EB6E 2X9XA 3R84B 2LRKA 3I0OA 2BDEA 2YU2A 4C90A 2VVSA 4PJMA 1G8XA 2XSAA 3PE0A 4E7ZA 5JDNA 3WAJA 3UULA 3IEEA 4I55E 3K3QC 5KMGP 1HX1B 2VVNA 3C4ZA 2XQ6A 4AKGA 1KK7A 1HF8A 3C64A 5L3EB 1OEDA 2LLYA 5FY0A 5KDMC 3CQGB 2AE9A 5H6QB 3K1SA 2KXPB 2CXFA 2JRKA 2BBJA 5HXHA 4QX8B 3GA8A 4IT4A 1HCIA 1LRZA 3SFDA 2V7IA 2MYSA 2K24A 3ONJA 4U7IA 2V1DB 4XZCA 1D1AA 3UU5A 5HYAA 1XNQT 4U33A 3FZFB 5FKYA 3UU6A 4DV5T 1LVFA 4MALA 2B1EA 4N78D 4ZXLA 3ZYKA 4IE4A 2D5UA 4EXTA 5CJ5A 2HHHT 1FJGT 4A98A 2BS4A 2K9AA 2VASA 3X1DA 3RKGA 4EYUA 2WDRA 4WBNE 3AECA 1VOMA 3JC6D 3T8OA 4YHHT 2E5LT 3ZYMA 4LFBT 3P4RA 4X20E 3RRWA 1G73A 5CA1E 1D1BA 2BS2A 2YK0A 3ONXA 4X1YE 3ZCIA 2IC9A 4GYRA 3UU3A 3F57A 5L2LA 1I6ZA 3TLVA 4M1PA 1Z0PA 2C5IT 2CLYB 3GN5B 3NKZA 4LFCT 4WW0A 1OWAA 3LJCA 2ODUA 4IDPA 3EUHA 2UU9T 3PURA 4HWDA 2WBLA 4CXYA 2DWGA 3PU8A 4O4IE 3RYCE 2WCAA 2YU1A 3LG7A 2NWBA 5AQOB 4F6RC 3RF1A 2W61A 4UF0A 1SE7A 3KV4A 2MPKA 4O8SA 2J4GA 4HEAA 3SFEA 4EIWA 4YSXA 3KVBA 1XMOT 2HPJA 4OK0A 2VQET 2BG9E 2C5JA 4TWHA 1JNRA 3B57A 4V1Av 4XAXB 4TZ4C 4JI0T 4XBFB 3F2EA 2Z6EA 4UVCB 4DMWA 2ZM0A 4QH5A 4KUMB 4DMVA 3FBZA 3RIAA 1V9DA 3QC9A 4C91A 1KNPA 3AE5A 1WFDA 2XASB 4UF0B 3N9PA 4P0BA 4UXNB 4ZI3D 4JEHB 4LF6T 3V5SA 3ZT6A 5DABA 3EHZA 4TV9E 2LSJA 3ZN1B 3CQCB 4YTNA 2A72A 4JUYA 3CQXC 3ZJ1A 5IUXA 1M7KA 2NW8A 2X51A 1I94T 4H9OC 3RI5A 4EEDA 1N34T 5AQUB 2LSYA 3M65A 4IDZA 3C50A 4F8HA 4K0UA 3AA1B 2WAUA 1DU2A 3E0ZA 2WDVA 3QNUA 1HFAA 4DR6T 2NW7A 2X9HA 5JRCB 2XQYA 5LYJE 3H3AA 2H7OA 4H9RC 1BR2A 3UT5E 2KWIB 5LNKA 4L0RA 4OYKA 2NW9A 5AQLB 2V6YA 2LJLA 3P4PA 5E0OA 1S35A 3C51A 2XAHB 5F8PA 3RH3A 3WAKA 2XTLA 2JQ9A 2XM1A 5LBQB 5A1LA 3ZC0A 3AA0B 2I59A 3AE2A 4FI5A 2EHOC 1XDPA 3S4UA 3G06A 5AQKB 4AXPA 2E9XA 3RQUA 4BJNA 3ZT7A 1T98A 3I9YA 2N9DA 2LT3A 3PUWF 3Q5WA 2FJBA 3K3OA 4HFCA 1T72A 3BQIA 3AE8A 3KV5A 4U7YA 2Q9QB 2CMRA 4COFA 3CIRA 4LMLA 5JRCA
chains in the Genus database with same CATH topology
1QUUA 3LBXA 2CWOA 3CPZA 4PK6A 1FMWA 3UUNA 1VRBA 3I1AA 4A56A 4CXYA 3C4WA 5HXCA 2X67A 3EVYA 5JDLA 1NWMX 5JR9C 4GK5E 3IHRA 2LSKA 4MBQA 4MHCA 5M4YA 1US7B 3HA4A 3PUSA 3FBLA 4HFVA 5L3CB 1YW0A 4H9PC 4YFSA 1U4QA 2Q9QA 4OFZA 3VHLA 3ANWB 3NBXX 3PUGA 3AAIA 2H3RA 4FJOA 4H63H 5EK2A 3ETUA 4ISSA 3RPUA 2Y8DA 3RC8A 2G0UA 3N2KE 2DWKA 1ZHCA 2E9XB 3I9WA 4ASKA 1IAPA 2K5BB 3GWHA 1IJ6A 5DQWA 4DO0A 3N2GE 1LKXA 2LEHA 3ZCJA 1CUNA 3AVRA 3U78A 2PJQA 2CM0A 5L3GB 3N9OA 4YHJA 2BVLA 4AI6A 4IE6A 3RX6A 1HG2A 4BAYB 5DJQC 2W0GA 2NTXA 1FMVA 2P9BA 5GONE 5JREA 3N9QA 2ES0A 3HL6A 4GYSA 2LHNA 4PNIA 4O2BE 3Q9DA 4X1IE 1BR0A 4QXBB 2PFVA 1WLXA 2HH7A 2V26A 2WM9A 2XHEB 1BR4A 5HXSA 2X0LB 4YJ2E 4HKAA 5FY1A 3CX8B 4QX7B 2RA1A 3P8CD 1ZV4X 2OA5A 2VKHA 2NP9A 1MIWA 3BK9A 4KMCA 4DBQA 4B6XA 3AA7B 3HI2A 3D0TA 3C4XA 3UUMA 2XAJB 3ZMSB 2VL8A 5LA6E 5FMNA 4TUYE 1IZNB 2W00A 4I4TE 4ZI7E 2X9WA 3KV6A 4EYYR 2CXLA 4HTEA 4HE8A 2WSSV 1WYCA 2CA5A 4UV8B 1HG5A 2M67A 3TKLB 2V7MA 5FXVA 1IJ5A 4EZHA 3FHNA 2CWYA 3I0QA 4AQFA 2KNDA 2ZM2A 4H63V 3ESLA 5LGTB 2CE7A 4PFOA 1WR6A 3WI3A 2EHOA 4ZS2A 2DLRA 5KX5E 3P7IA 1MIVA 4JLEA 5FYMA 5JVDE 1E1HB 5L3BB 3HKEE 4PK4A 4WBOA 2ACXA 2D0UA 4QKNA 2ZMAA 2LSIA 5LCYA 3KVAA 4TN7B 3HR0A 2MTQA 4UELA 4GIWA 3BQLA 3O1IA 3PTRB 5LOVE 3RC3A 3LK42 5H6RB 4U74A 2BVMA 4I50E 5JH7E 2MOZA 1WYBA 5LXTE 2NOXA 3GN5A 2IW5B 4AQGA 5HWXA 2XUEA 3KDSE 2ZLYA 3RRCA 3U3IA 3K8PC 3L09A 5L3FB 2J1DG 2Y6XA 3GMIA 5JDHA 2JJ9A 2HPLA 2LOPA 2A2FX 3Q5XA 5EK3A 3O9XA 3Q2MA 5JDGA 3OJAA 5LP6E 4P0AA 2Y48B 3ZMUB 3VU7H 2E8IA 3ZN0B 3AAEB 4E7SA 4HN9A 4CXWA 4H9NC 4PJLA 3UTKA 5BMVE 4PK5A 3ZLIA 1D0XA 2DI4A 5IHYA 4AKRB 1D1CA 4UEMA 1MNEA 2WMOA 2LSGA 2SPCA 1MMNA 2X9YA 4GOUA 5J1GA 2A3DA 2W62A 2E9XD 3VKGA 3PUQA 2VKJA 1NAFA 2RP4A 3V5UA 3OBVE 3O1JA 5FP3A 2NTYA 3NRYA 2YINA 2LE8A 3QUJA 3ZPOA 2L8KA 2PBIA 1B7TA 3OYZA 5LHGB 2VB6A 3MACA 4IE5A 2XAQB 3N9MA 4DVDA 3CX7B 5L3DB 1U5PA 4OYJA 4CQIA 3SWHA 2WMNA 3DP7A 4L5GA 4IE7A 2Q9QD 3DTOA 4PW8A 2K48A 3N5LA 4L9IA 5LBMA 5FNVE 5TAOA 4O4HE 4AKLA 3LK2B 3H37A 3JC6C 1MNDA 1X79A 3RKOA 2YEVC 3UUXB 4UVBB 5DQVA 4BA9A 4OHFA 3SOLA 2JMKA 5FXZA 3LBXB 4Z8XA 5CB4E 2V7JA 3HKDE 2WWUA 5EK4A 4CI1B 1LVKA 4O2AE 2X66A 4DBRA 1YKHB 4CZZB 1YD8G 3NRXA 3W15B 3ZJ2A 3ZMVB 5J2TE 5CA0E 4ILUA 3DJBA 5FY7A 2KMFA 2C5KT 3OYXA 2VWAA 4AKIA 2IAKA 4H9QC 4PFPA 4IHJE 1HX8A 2KINB 2KWHA 3E08A 4PJJA 3QK6A 3KV9A 4UV9B 1ZEEA 1MIYA 1OXZA 3R6NA 4QHOA 2DHRA 1SHZC 3CKDA 5HXEA 3KBUA 3KINB 2CXDA 2ZM8A 1QSDA 2D2SA 1H7CA 2XAFB 3O4XE 3A5XA 5JR9B 1UX5A 2ODVA 4WNKA 5C8YE 3ANWA 3FB2A 5LJMA 2EHOD 2UXXB 3NZQA 4H9SE 5FXWA 4ADZA 2V7LA 2KLQA 3ETVA 2JMHA 3IBPA 4G63A 4AQFC 3LFMA 5LG4A 4EAHA 3CVRA 1MMAA 5LHIB 3KFWX 1MMDA 1AJ3A 2V7KA 5LGNB 5EZYE 3OKQA 4AKHA 2CLYC 1UCUA 1KNZA 2KT9A 4HGAA 2Q9QC 3LK3B 5JQGE 5HXRA 2QA7A 2L9QA 2CEAA 2DNXA 3CWZB 4MFRA 5JDFA 5AFUL 1EZ3A 4ZI3C 3FXDB 3J7Yq 2BZBA 3K3NA 5LJNA 4IIJE 4ZHQE 1D0ZA 5HWYA 3MXZA 3F31A 3J9X1 4UIGA 3E22E 4CI2B 5F3JA 2QGSA 4YLHA 4EOZB 3N2OA 2E9XC 2GK9A 3CX6B 4ZOLE 3AA6B 2MBGA 3ZMZB 3RYFE 1O3XA 1HTJF 4TX5A 5IYZE 4CI3B 3N9NA 3MA9A 3BQKA 3AB3B 1SA0E 1FIOA 5LGUB 2XAGB 2VK9A 4GK0E 4QWNB 3L3PA 3PDYA 1UX4A 2VKOA 4QXCB 3MZKB 3PU3A 3ZC1A 1D0YA 1HS7A 3CMLA 4IE0A 2VKDA 3HKBE 1FEWA 2L3LA 3MJXA 3FXEB 4TV8E 4KBMB 2EHOB 3RYIE 4J2CA 3ZEFB 4I43B 1ZKEA 5FXXA 1Y64B 2LOSA 3ZMTB 5ADXL 4BJMA 2LM9A 3KBTA 3MK7C 4JEUB 4O4LE 4ZS3A 4QXHB 2D0TA 4ANJA 4DNDA 3MKDA 1BR1A 5HAXA 4ERRA 2C0SA 3PUAA 2N2NA 3HKCE 3IF8B 4NUUA 4EZ4A 4P09A 3NZPA 3B13A 2H7VC 2KZ7B 5ETWA 3SRZA 4PJNA 5LHHB 3UFEA 2LHRA 2X68A 4ISTA 5JR9A 4ZI2D 3RYHE 1MMGA 1YKEB 2IC6A 4O4JE 4KP3C 4UVAB 3AVSA 4CXXA 4PAGA 2CCQA 4IGUA 4YJ3E 4G2AA 4X1KE 5JDMA 3EDVA 3O1HA 4NUVA 3C98B 2W63A 3AAAB 2PG8A 4U72A 2UXNB 5JDQA 3VKHA 3SS1A 3ZYLA 2JPFA 3EDUA 2DCFA 1S94A 2JQQA 3N9LA 5J2UE 4MLKA 1WRDA 4ZI2C 4EB6E 2N1GA 2X9XA 3R84B 3I0OA 2BDEA 2YU2A 4C90A 4PJMA 1G8XA 3PE0A 4E7ZA 5JDNA 3WAJA 3UULA 3IEEA 4I55E 3K3QC 5KMGP 3C4ZA 4AKGA 1KK7A 1HF8A 3C64A 5L3EB 5FY0A 5KDMC 3CQGB 5H6QB 2KXPB 2CXFA 2JRKA 5HXHA 4QX8B 3GA8A 1HCIA 1LRZA 2V7IA 2MYSA 2K24A 4XZCA 2V1DB 5HYAA 1D1AA 1LVFA 4MALA 2B1EA 4N78D 3ZYKA 4EXTA 4IE4A 2D5UA 2VASA 2K9AA 4EYUA 4WBNE 1VOMA 3JC6D 3T8OA 3ZYMA 4X20E 3RRWA 1G73A 5CA1E 1D1BA 2YK0A 3ONXA 4X1YE 3ZCIA 2IC9A 4GYRA 3F57A 5L2LA 4M1PA 1Z0PA 2C5IT 2CLYB 3GN5B 4WW0A 1OWAA 3LJCA 2ODUA 3EUHA 3PURA 2WBLA 2DWGA 3PU8A 4O4IE 3RYCE 2YU1A 3LG7A 2NWBA 4F6RC 2W61A 4UF0A 3KV4A 4EIWA 4O8SA 4HEAA 3KVBA 2HPJA 4OK0A 2C5JA 4XAXB 3B57A 4V1Av 4TZ4C 4XBFB 3F2EA 2Z6EA 4UVCB 4DMWA 2ZM0A 4KUMB 4DMVA 3FBZA 1V9DA 3QC9A 4C91A 2XASB 4UF0B 3N9PA 4P0BA 4UXNB 4ZI3D 4JEHB 3V5SA 5DABA 4TV9E 2LSJA 3ZN1B 3CQCB 2A72A 4JUYA 3CQXC 3ZJ1A 2NW8A 2X51A 4H9OC 2LSYA 3M65A 4IDZA 3C50A 4K0UA 3AA1B 2WAUA 3E0ZA 1HFAA 2NW7A 2X9HA 5JRCB 2XQYA 5LYJE 3H3AA 2H7OA 4H9RC 1BR2A 3UT5E 2KWIB 5LNKA 4L0RA 4OYKA 2NW9A 2LJLA 5E0OA 5F8PA 1S35A 3C51A 2XAHB 3RH3A 3WAKA 2XTLA 5A1LA 5LBQB 3ZC0A 3AA0B 2I59A 4FI5A 2EHOC 3S4UA 4AXPA 2E9XA 4BJNA 1T98A 3I9YA 2LT3A 2N9DA 3Q5WA 3K3OA 3KV5A 3BQIA 5JRCA 2Q9QB 2CMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKH B;  1YKE B; 
#chains in the Genus database with same CATH topology
 5L47 A;  5ABF B;  1QUU A;  3LBX A;  2CWO A;  2V5D A;  3CPZ A;  1FMW A;  3FZK B;  4PK6 A;  1W0A A;  3UUN A;  2XM2 A;  1OED E;  1VRB A;  3I1A A;  4A56 A;  2IUB A;  3C4W A;  2XQ7 A;  2X67 A;  3EVY A;  4U2Y A;  5HXC A;  5JDL A;  1NWM X;  5JR9 C;  4GK5 E;  2W67 A;  3IHR A;  2UUB T;  2A9U A;  2LSK A;  4MBQ A;  1GQE A;  4MHC A;  1US7 B;  2LM2 A;  3HA4 A;  3FBL A;  3JCF A;  3PUS A;  4HFV A;  4DR4 T;  1KFY A;  5L3C B;  1YW0 A;  4LFA T;  4H9P C;  4YFS A;  1U4Q A;  2Q9Q A;  2D9D A;  3EAM A;  3ANW B;  4KHZ F;  4OFZ A;  3VHL A;  1HNZ T;  3NBX X;  3PUG A;  3AAI A;  2H3R A;  4FJO A;  4Q25 A;  3RHW A;  4H63 H;  1KEY A;  5EK2 A;  4JI1 T;  4HFD A;  4DR5 T;  1W0B A;  3ETU A;  2KSR A;  4ISS A;  2YDS A;  3RPU A;  4DV7 T;  2XQ9 A;  4EGW A;  2Y8D A;  4YSZ A;  3RC8 A;  2G0U A;  3N2K E;  2DWK A;  1ZHC A;  2H89 A;  2E9X B;  1ZOY A;  3I9W A;  3ABV A;  4ASK A;  1HNX T;  1IAP A;  2K5B B;  3AED A;  4TWD A;  1T7S A;  3GWH A;  1IJ6 A;  5DQW A;  4DO0 A;  4ZZB A;  1X9B A;  3N2G E;  1LKX A;  2LEH A;  2MAW A;  1CUN A;  3AVR A;  3ZCJ A;  3ONL C;  4ILC A;  2XPK A;  3U78 A;  3VKH A;  2PJQ A;  4AIU A;  4DUZ T;  2LRL A;  5FL0 A;  2CM0 A;  3CK6 A;  2IML A;  3LSV A;  5L3G B;  5L4H A;  3N9O A;  4X64 T;  4YHJ A;  1XZY A;  5LB7 B;  2BVL A;  3JAE A;  3NWI A;  3RGL A;  2WZI A;  5LMN T;  4AI6 A;  3L8R A;  2QVA A;  4IE6 A;  3RLF F;  1IBM T;  3Q5E A;  1HG2 A;  4ILB A;  3RX6 A;  4BAY B;  3AE9 A;  2W0G A;  2NTX A;  1FMV A;  2P9B A;  5DJQ C;  2WWV A;  5JTG A;  5GON E;  5JRE A;  3N9Q A;  4B3M T;  2ES0 A;  3HL6 A;  4IRE A;  4LF5 T;  4GYS A;  4JYA T;  2LHN A;  4PNI A;  4O2B E;  1E2A A;  4TNV A;  3Q9D A;  3RIU C;  4X1I E;  2BS3 A;  1BR0 A;  4JI6 T;  4QXB B;  1M62 A;  2PFV A;  1WLX A;  2HH7 A;  2V26 A;  2WM9 A;  2XHE B;  2WU2 A;  1BR4 A;  5CGM A;  2X0L B;  4YJ2 E;  1T8B A;  5HXS A;  4HKA A;  5FY1 A;  1VCS A;  3CX8 B;  4QX7 B;  2RA1 A;  3P8C D;  1L0V A;  4WYV A;  1ZV4 X;  3AE4 A;  2OA5 A;  2VKH A;  2NP9 A;  1MIW A;  3BK9 A;  4KMC A;  4DBQ A;  4B6X A;  3AA7 B;  3HI2 A;  3D0T A;  4JI7 T;  3C4X A;  5AQH B;  2XAJ B;  3UUM A;  2UXB T;  3ZMS B;  2VL8 A;  3QB5 A;  2YDR A;  3VRA A;  5BR8 T;  5LA6 E;  5FMN A;  4TUY E;  2FBW A;  1IZN B;  2W00 A;  4I4T E;  4ZI7 E;  3P4W A;  2X9W A;  5LMU T;  1XNR T;  4JI8 T;  3KV6 A;  4EYY R;  2YKS A;  2VL0 A;  2XQ3 A;  2CXL A;  4HTE A;  4HE8 A;  2I6H A;  2WSS V;  1WYC A;  2CA5 A;  1W9R A;  3IA3 A;  4UV8 B;  3OTO T;  4QH4 A;  1UK5 A;  2WDQ A;  5AQM B;  4X66 T;  4DV0 T;  4X65 T;  4HWH A;  4YXD A;  4QH1 A;  1HG5 A;  2M67 A;  3TKL B;  2BKN A;  5ABG A;  2V7M A;  5FXV A;  4DV3 T;  1IJ5 A;  4P1N A;  4EZH A;  3FHN A;  5HEG A;  2CWY A;  3I0Q A;  4AQF A;  2KND A;  2ZM2 A;  2BKP A;  3ESL A;  4H63 V;  2CE7 A;  5LGT B;  4DV6 T;  4PFO A;  4B3T T;  1WR6 A;  3PJA J;  3WI3 A;  5LG3 A;  1NEN A;  2EHO A;  2DLR A;  4ZS2 A;  3P7I A;  1MIV A;  4JLE A;  5FYM A;  5JVD E;  1E1H B;  5KX5 E;  3HKE E;  2CBJ A;  4PK4 A;  2M6B A;  4WBO A;  2UUA T;  2ACX A;  4TWF A;  2D0U A;  4QKN A;  4NXM T;  4IL4 A;  1HR0 T;  2ZMA A;  4AQY T;  2LSI A;  5LCY A;  3KVA A;  1UUR A;  3HR0 A;  2MTQ A;  4TN7 B;  4UEL A;  2XQ4 A;  4GIW A;  3PUV F;  3BQL A;  3O1I A;  5BMV E;  2XSB A;  2BG9 C;  3PTR B;  5LOV E;  3RC3 A;  3TLW A;  3LK4 2;  3ZSS A;  2F4V T;  5H6R B;  1KNR A;  2W66 A;  2BVM A;  4U74 A;  1N36 T;  4I50 E;  5JH7 E;  1XDO A;  5ABF A;  4JI5 T;  2MOZ A;  3UUB A;  1WYB A;  1Y01 A;  5LXT E;  2NOX A;  3GN5 A;  2IW5 B;  4AQG A;  5HWX A;  2XUE A;  2FJE A;  2WY2 A;  2ZLY A;  3KDS E;  3RIF A;  3RRC A;  3K8P C;  3L09 A;  3U3I A;  5HEJ A;  2J1D G;  2Y6X A;  3GMI A;  2YDQ A;  5L3F B;  5JDH A;  2JJ9 A;  2HPL A;  2LOP A;  1IBL T;  4K0K T;  2A2F X;  2RPA A;  3Q5X A;  5EK3 A;  3O9X A;  3Q2M A;  5JDG A;  3OJA A;  5LP6 E;  4P0A A;  2Y48 B;  3ZMU B;  2JIW A;  2E8I A;  3PV0 F;  3VU7 H;  3ZN0 B;  3JAF A;  3ZST A;  3AAE B;  1OED C;  2JQH A;  4E7S A;  4X5T A;  4HN9 A;  4EV6 A;  2M6I A;  4H9N C;  4CXW A;  4PJL A;  3UTK A;  5AQI B;  4PK5 A;  3ZLI A;  1D0X A;  2DI4 A;  5IHY A;  5AQG B;  1D1C A;  4UEM A;  3ZT5 A;  4AKR B;  1MNE A;  2WMO A;  3VR8 A;  2IHR 1;  4I0U A;  1N32 T;  3PUX F;  2LSG A;  2SPC A;  1MMN A;  2X9Y A;  3AEA A;  5FVK A;  3UU4 A;  4GOU A;  2XJ7 A;  5J1G A;  4DUY T;  2A3D A;  2W62 A;  1W09 A;  2E9X D;  1SUM B;  3VKG A;  5AQN B;  3AXJ A;  2PTF A;  3PUQ A;  2VKJ A;  3RQW A;  2XQ8 A;  1NAF A;  2CHN A;  2RP4 A;  4YSY A;  3TLU A;  3V5U A;  3OBV E;  3O1J A;  5AQV B;  5FP3 A;  2NTY A;  3NRY A;  4LMK A;  4DR1 T;  2YIN A;  5AQJ B;  2V5C A;  3UQ7 A;  2LE8 A;  2JQK A;  1QLB A;  2OLT A;  2XZE A;  3QUJ A;  5CFB A;  5AQT B;  3ZPO A;  5J0Z A;  2L8K A;  2PBI A;  3ZKR A;  4JI4 T;  1B7T A;  3OYZ A;  3Q5D A;  2VB6 A;  3MAC A;  4IE5 A;  2XAQ B;  1ZP0 A;  3N9M A;  3CX7 B;  5AQP B;  4DVD A;  3TLT A;  5L3D B;  2UUC T;  1U5P A;  4OYJ A;  4U3C A;  4CQI A;  3SWH A;  1OED B;  2WMN A;  3DP7 A;  5C3J A;  4L5G A;  4IE7 A;  2Q9Q D;  3DTO A;  4PW8 A;  2K48 A;  3N5L A;  4L9I A;  5LBM A;  4Z91 A;  4YY3 T;  3AEB A;  5HEH A;  5FNV E;  2ZM6 T;  3T1Y T;  5TAO A;  2BKO A;  3QOF A;  4O4H E;  4AKL A;  3LK2 B;  3H37 A;  3JC6 C;  4ZZC A;  1MND A;  1X79 A;  1WR0 A;  2J62 A;  3RKO A;  2YEV C;  4IL9 A;  3UUX B;  4UVB B;  5DQV A;  4ZEY A;  4BA9 A;  4OHF A;  2WS3 A;  5C2T A;  3SOL A;  2JMK A;  5FXZ A;  3LBX B;  4Z8X A;  5CB4 E;  2V7J A;  3HKD E;  5ABE A;  2WWU A;  5EK4 A;  2VQF T;  4IDQ A;  3VR9 A;  3AEE A;  4CI1 B;  1IBK T;  2VUR A;  1LVK A;  2AXD S;  2LKG A;  3AE3 A;  4O2A E;  2X66 A;  4DBR A;  1YKH B;  5IWA T;  4WZX A;  4GKJ T;  3FZM B;  3H3M A;  4CZZ B;  3RIU A;  1YD8 G;  3NRX A;  3W15 B;  3ZJ2 A;  3ZMV B;  5J2U E;  5CA0 E;  2WQY A;  4HFB A;  3DJB A;  4ILU A;  2H88 A;  5AQF B;  5FY7 A;  2KMF A;  4LF4 T;  2C5K T;  3OYX A;  2VWA A;  4HWF A;  2CPT A;  1J5E T;  4JBW F;  4AKI A;  2IAK A;  4H9Q C;  4TNW A;  4PFP A;  3UU8 A;  5LHG B;  4IHJ E;  1HX8 A;  2KIN B;  2KWH A;  3EAB A;  3E08 A;  2BG9 A;  5J2T E;  4JV5 T;  4DV1 T;  4PJJ A;  3QK6 A;  3KV9 A;  4UV9 B;  1ZEE A;  3FZL B;  2HN2 A;  1HNW T;  1MIY A;  1OXZ A;  3AE6 A;  3R6N A;  4QHO A;  2DHR A;  2IIU A;  1SHZ C;  3CKD A;  5HXE A;  4DR2 T;  3KBU A;  3P50 A;  4B3R T;  3KIN B;  2CXD A;  1QSD A;  2D2S A;  1H7C A;  2XAF B;  2ZM8 A;  3AE1 A;  1VCT A;  3A5X A;  3O4X E;  5JR9 B;  4LF9 T;  4NXN T;  1WCR A;  1UX5 A;  2ACZ A;  2ODV A;  3AE7 A;  4WNK A;  3ANW A;  3FB2 A;  5C8Y E;  4IDN A;  5LJM A;  5HCJ A;  4X62 T;  2FJD A;  2EHO D;  1JNZ A;  2UXX B;  2X0H A;  4YTP A;  3NZQ A;  4OX9 T;  2DL1 A;  2NR4 A;  4U2Z A;  4H9S E;  3OPC A;  3JAD A;  4ILA A;  5FXW A;  4ADZ A;  2V7L A;  2KLQ A;  1YQ3 A;  3ETV A;  2JMH A;  3IBP A;  2QYW A;  4CN6 A;  1R8I A;  3EI0 A;  2W4X A;  4G63 A;  4AQF C;  3LFM A;  1J1J A;  4EAH A;  5LG4 A;  3CVR A;  1MMA A;  5LHI B;  3KFW X;  4HWC A;  1MMD A;  1AJ3 A;  2V7K A;  5HEU A;  5LGN B;  1Z8U A;  3PJA A;  5EZY E;  2CHO A;  3OKQ A;  3A7M A;  4JI3 T;  2CLY C;  4AKH A;  1UCU A;  5L4E A;  1KNZ A;  2KT9 A;  2I0M A;  2Q9Q C;  4HGA A;  3LK3 B;  5AQS B;  2YOE A;  5HXR A;  2QA7 A;  2V8S V;  5JQG E;  2L9Q A;  2CEA A;  2DNX A;  1XMQ T;  5F5W A;  4A5X A;  3CWZ B;  4MFR A;  5JDF A;  5AFU L;  1EZ3 A;  4ZI3 C;  3T1H T;  3FXD B;  1XWM A;  3J7Y q;  2BZB A;  3K3N A;  4HFI A;  4IIJ E;  4ZHQ E;  5LJN A;  5AQR B;  2XQ5 A;  2E2A A;  4HFH A;  1D0Z A;  5HWY A;  3MXZ A;  4EEB A;  3OVU A;  5M4Y A;  2XY8 B;  3AXJ B;  3F31 A;  3PUZ F;  3J9X 1;  4UIG A;  3E22 E;  4CI2 B;  2R6G F;  2QGS A;  5F3J A;  4YLH A;  4EOZ B;  3LDQ B;  4U31 A;  3N2O A;  3P4S A;  2E9X C;  2GK9 A;  3AEF A;  3CX6 B;  1CHU A;  4ZOL E;  3AA6 B;  4NIQ A;  2MBG A;  5FL1 A;  2IDO B;  3ZMZ B;  4JI2 T;  1KF6 A;  1O3X A;  3RYF E;  4LF7 T;  1HTJ F;  4TX5 A;  5IYZ E;  4CI3 B;  2E5V A;  3N9N A;  3MA9 A;  3BQK A;  1J5W A;  3AB3 B;  1SA0 E;  1FIO A;  4KI0 F;  4GKK T;  5LGU B;  2LKH A;  2VK9 A;  2XAG B;  4GK0 E;  5ABH A;  2WP9 A;  2YN6 A;  4QWN B;  3L3P A;  4LF8 T;  3PDY A;  1UX4 A;  4KHP T;  2VKO A;  4QXC B;  4Z90 A;  4YT0 A;  2UXD T;  3MZK B;  3PU3 A;  3ZC1 A;  1D0Y A;  2X0Y A;  1HS7 A;  2K3W A;  3CML A;  4IE0 A;  2VKD A;  2FJA A;  3HKB E;  1FEW A;  2L3L A;  3MJX A;  3FXE B;  1UGO A;  3P4Q A;  4KBM B;  2EHO B;  4TV8 E;  4AIS A;  3RYI E;  1E7P A;  2CRB A;  4J2C A;  4CN1 A;  3ZEF B;  4DR3 T;  2W2U A;  3L39 A;  4I43 B;  1ZKE A;  5FXX A;  1Y64 B;  2LOS A;  4A97 A;  3ZMT B;  5ADX L;  5L3B B;  4BJM A;  2LM9 A;  3A8Y C;  3KBT A;  3MK7 C;  4JEU B;  4O4L E;  4QXH B;  2D0T A;  4ZS3 A;  5FVL A;  3MKD A;  4ANJ A;  1BR1 A;  4DND A;  5HAX A;  4ERR A;  2C0S A;  4NPP A;  2CBI A;  3PUA A;  2N2N A;  4CN4 A;  2V6Y B;  2OV9 A;  3HKC E;  3AEG A;  3IF8 B;  1YXR A;  4NUU A;  3TLS A;  1UUS A;  4EZ4 A;  4P09 A;  4LMJ A;  3NZP A;  3B13 A;  4HWI B;  2H7V C;  2KZ7 B;  5ETW A;  3SRZ A;  4PJN A;  5LHH B;  3UFE A;  4DV4 T;  4B3S T;  1N33 T;  2UXC T;  2WU5 A;  2LHR A;  2X68 A;  1YQ4 A;  4IST A;  4YTM A;  2WB5 A;  5JR9 A;  4DID B;  3PUY F;  4KX6 A;  3RYH E;  4ZI2 D;  2J47 A;  1MMG A;  1YKE B;  2WZH A;  2IC6 A;  3QB5 K;  4DV2 T;  4O4J E;  5KXJ A;  4KP3 C;  4UVA B;  3AVS A;  5AQQ B;  2HN1 A;  4CXX A;  5HCM A;  4UR9 A;  4PAG A;  4HFE A;  3UQ4 A;  3VRB A;  3NVO A;  3FZH B;  2BG9 B;  2CCQ A;  4IGU A;  4YJ3 E;  2FUP A;  4G2A A;  3B5M A;  2B76 A;  4X1K E;  1NEK A;  3EDV A;  2XQA A;  5HEO A;  5JDM A;  3O1H A;  4NUV A;  3C98 B;  2W63 A;  3AAA B;  2PG8 A;  4IDO A;  2QRX A;  2UXN B;  4U72 A;  3SS1 A;  5JDQ A;  4DR7 T;  3ZYL A;  2JPF A;  3EDU A;  2DCF A;  1S94 A;  2JQQ A;  3M3Z B;  3N9L A;  4MLK A;  2BBH A;  1WRD A;  4ZI2 C;  3UFG A;  2N1G A;  2V6X A;  4EB6 E;  2X9X A;  3R84 B;  2LRK A;  3I0O A;  2BDE A;  2YU2 A;  4C90 A;  2VVS A;  4PJM A;  1G8X A;  2XSA A;  3PE0 A;  4E7Z A;  5JDN A;  3WAJ A;  3UUL A;  3IEE A;  4I55 E;  3K3Q C;  5KMG P;  1HX1 B;  2VVN A;  3C4Z A;  2XQ6 A;  4AKG A;  1KK7 A;  1HF8 A;  3C64 A;  5L3E B;  1OED A;  2LLY A;  5FY0 A;  5KDM C;  3CQG B;  2AE9 A;  5H6Q B;  3K1S A;  2KXP B;  2CXF A;  2JRK A;  2BBJ A;  5HXH A;  4QX8 B;  3GA8 A;  4IT4 A;  1HCI A;  1LRZ A;  3SFD A;  2V7I A;  2MYS A;  2K24 A;  3ONJ A;  4U7I A;  2V1D B;  4XZC A;  1D1A A;  3UU5 A;  5HYA A;  1XNQ T;  4U33 A;  3FZF B;  5FKY A;  3UU6 A;  4DV5 T;  1LVF A;  4MAL A;  2B1E A;  4N78 D;  4ZXL A;  3ZYK A;  4IE4 A;  2D5U A;  4EXT A;  5CJ5 A;  2HHH T;  1FJG T;  4A98 A;  2BS4 A;  2K9A A;  2VAS A;  3X1D A;  3RKG A;  4EYU A;  2WDR A;  4WBN E;  3AEC A;  1VOM A;  3JC6 D;  3T8O A;  4YHH T;  2E5L T;  3ZYM A;  4LFB T;  3P4R A;  4X20 E;  3RRW A;  1G73 A;  5CA1 E;  1D1B A;  2BS2 A;  2YK0 A;  3ONX A;  4X1Y E;  3ZCI A;  2IC9 A;  4GYR A;  3UU3 A;  3F57 A;  5L2L A;  1I6Z A;  3TLV A;  4M1P A;  1Z0P A;  2C5I T;  2CLY B;  3GN5 B;  3NKZ A;  4LFC T;  4WW0 A;  1OWA A;  3LJC A;  2ODU A;  4IDP A;  3EUH A;  2UU9 T;  3PUR A;  4HWD A;  2WBL A;  4CXY A;  2DWG A;  3PU8 A;  4O4I E;  3RYC E;  2WCA A;  2YU1 A;  3LG7 A;  2NWB A;  5AQO B;  4F6R C;  3RF1 A;  2W61 A;  4UF0 A;  1SE7 A;  3KV4 A;  2MPK A;  4O8S A;  2J4G A;  4HEA A;  3SFE A;  4EIW A;  4YSX A;  3KVB A;  1XMO T;  2HPJ A;  4OK0 A;  2VQE T;  2BG9 E;  2C5J A;  4TWH A;  1JNR A;  3B57 A;  4V1A v;  4XAX B;  4TZ4 C;  4JI0 T;  4XBF B;  3F2E A;  2Z6E A;  4UVC B;  4DMW A;  2ZM0 A;  4QH5 A;  4KUM B;  4DMV A;  3FBZ A;  3RIA A;  1V9D A;  3QC9 A;  4C91 A;  1KNP A;  3AE5 A;  1WFD A;  2XAS B;  4UF0 B;  3N9P A;  4P0B A;  4UXN B;  4ZI3 D;  4JEH B;  4LF6 T;  3V5S A;  3ZT6 A;  5DAB A;  3EHZ A;  4TV9 E;  2LSJ A;  3ZN1 B;  3CQC B;  4YTN A;  2A72 A;  4JUY A;  3CQX C;  3ZJ1 A;  5IUX A;  1M7K A;  2NW8 A;  2X51 A;  1I94 T;  4H9O C;  3RI5 A;  4EED A;  1N34 T;  5AQU B;  2LSY A;  3M65 A;  4IDZ A;  3C50 A;  4F8H A;  4K0U A;  3AA1 B;  2WAU A;  1DU2 A;  3E0Z A;  2WDV A;  3QNU A;  1HFA A;  4DR6 T;  2NW7 A;  2X9H A;  5JRC B;  2XQY A;  5LYJ E;  3H3A A;  2H7O A;  4H9R C;  1BR2 A;  3UT5 E;  2KWI B;  5LNK A;  4L0R A;  4OYK A;  2NW9 A;  5AQL B;  2V6Y A;  2LJL A;  3P4P A;  5E0O A;  1S35 A;  3C51 A;  2XAH B;  5F8P A;  3RH3 A;  3WAK A;  2XTL A;  2JQ9 A;  2XM1 A;  5LBQ B;  5A1L A;  3ZC0 A;  3AA0 B;  2I59 A;  3AE2 A;  4FI5 A;  2EHO C;  1XDP A;  3S4U A;  3G06 A;  5AQK B;  4AXP A;  2E9X A;  3RQU A;  4BJN A;  3ZT7 A;  1T98 A;  3I9Y A;  2N9D A;  2LT3 A;  3PUW F;  3Q5W A;  2FJB A;  3K3O A;  4HFC A;  1T72 A;  3BQI A;  3AE8 A;  3KV5 A;  4U7Y A;  2Q9Q B;  2CMR A;  4COF A;  3CIR A;  4LML A;  5JRC A; 
#chains in the Genus database with same CATH homology
 1QUU A;  3LBX A;  2CWO A;  3CPZ A;  4PK6 A;  1FMW A;  3UUN A;  1VRB A;  3I1A A;  4A56 A;  4CXY A;  3C4W A;  5HXC A;  2X67 A;  3EVY A;  5JDL A;  1NWM X;  5JR9 C;  4GK5 E;  3IHR A;  2LSK A;  4MBQ A;  4MHC A;  5M4Y A;  1US7 B;  3HA4 A;  3PUS A;  3FBL A;  4HFV A;  5L3C B;  1YW0 A;  4H9P C;  4YFS A;  1U4Q A;  2Q9Q A;  4OFZ A;  3VHL A;  3ANW B;  3NBX X;  3PUG A;  3AAI A;  2H3R A;  4FJO A;  4H63 H;  5EK2 A;  3ETU A;  4ISS A;  3RPU A;  2Y8D A;  3RC8 A;  2G0U A;  3N2K E;  2DWK A;  1ZHC A;  2E9X B;  3I9W A;  4ASK A;  1IAP A;  2K5B B;  3GWH A;  1IJ6 A;  5DQW A;  4DO0 A;  3N2G E;  1LKX A;  2LEH A;  3ZCJ A;  1CUN A;  3AVR A;  3U78 A;  2PJQ A;  2CM0 A;  5L3G B;  3N9O A;  4YHJ A;  2BVL A;  4AI6 A;  4IE6 A;  3RX6 A;  1HG2 A;  4BAY B;  5DJQ C;  2W0G A;  2NTX A;  1FMV A;  2P9B A;  5GON E;  5JRE A;  3N9Q A;  2ES0 A;  3HL6 A;  4GYS A;  2LHN A;  4PNI A;  4O2B E;  3Q9D A;  4X1I E;  1BR0 A;  4QXB B;  2PFV A;  1WLX A;  2HH7 A;  2V26 A;  2WM9 A;  2XHE B;  1BR4 A;  5HXS A;  2X0L B;  4YJ2 E;  4HKA A;  5FY1 A;  3CX8 B;  4QX7 B;  2RA1 A;  3P8C D;  1ZV4 X;  2OA5 A;  2VKH A;  2NP9 A;  1MIW A;  3BK9 A;  4KMC A;  4DBQ A;  4B6X A;  3AA7 B;  3HI2 A;  3D0T A;  3C4X A;  3UUM A;  2XAJ B;  3ZMS B;  2VL8 A;  5LA6 E;  5FMN A;  4TUY E;  1IZN B;  2W00 A;  4I4T E;  4ZI7 E;  2X9W A;  3KV6 A;  4EYY R;  2CXL A;  4HTE A;  4HE8 A;  2WSS V;  1WYC A;  2CA5 A;  4UV8 B;  1HG5 A;  2M67 A;  3TKL B;  2V7M A;  5FXV A;  1IJ5 A;  4EZH A;  3FHN A;  2CWY A;  3I0Q A;  4AQF A;  2KND A;  2ZM2 A;  4H63 V;  3ESL A;  5LGT B;  2CE7 A;  4PFO A;  1WR6 A;  3WI3 A;  2EHO A;  4ZS2 A;  2DLR A;  5KX5 E;  3P7I A;  1MIV A;  4JLE A;  5FYM A;  5JVD E;  1E1H B;  5L3B B;  3HKE E;  4PK4 A;  4WBO A;  2ACX A;  2D0U A;  4QKN A;  2ZMA A;  2LSI A;  5LCY A;  3KVA A;  4TN7 B;  3HR0 A;  2MTQ A;  4UEL A;  4GIW A;  3BQL A;  3O1I A;  3PTR B;  5LOV E;  3RC3 A;  3LK4 2;  5H6R B;  4U74 A;  2BVM A;  4I50 E;  5JH7 E;  2MOZ A;  1WYB A;  5LXT E;  2NOX A;  3GN5 A;  2IW5 B;  4AQG A;  5HWX A;  2XUE A;  3KDS E;  2ZLY A;  3RRC A;  3U3I A;  3K8P C;  3L09 A;  5L3F B;  2J1D G;  2Y6X A;  3GMI A;  5JDH A;  2JJ9 A;  2HPL A;  2LOP A;  2A2F X;  3Q5X A;  5EK3 A;  3O9X A;  3Q2M A;  5JDG A;  3OJA A;  5LP6 E;  4P0A A;  2Y48 B;  3ZMU B;  3VU7 H;  2E8I A;  3ZN0 B;  3AAE B;  4E7S A;  4HN9 A;  4CXW A;  4H9N C;  4PJL A;  3UTK A;  5BMV E;  4PK5 A;  3ZLI A;  1D0X A;  2DI4 A;  5IHY A;  4AKR B;  1D1C A;  4UEM A;  1MNE A;  2WMO A;  2LSG A;  2SPC A;  1MMN A;  2X9Y A;  4GOU A;  5J1G A;  2A3D A;  2W62 A;  2E9X D;  3VKG A;  3PUQ A;  2VKJ A;  1NAF A;  2RP4 A;  3V5U A;  3OBV E;  3O1J A;  5FP3 A;  2NTY A;  3NRY A;  2YIN A;  2LE8 A;  3QUJ A;  3ZPO A;  2L8K A;  2PBI A;  1B7T A;  3OYZ A;  5LHG B;  2VB6 A;  3MAC A;  4IE5 A;  2XAQ B;  3N9M A;  4DVD A;  3CX7 B;  5L3D B;  1U5P A;  4OYJ A;  4CQI A;  3SWH A;  2WMN A;  3DP7 A;  4L5G A;  4IE7 A;  2Q9Q D;  3DTO A;  4PW8 A;  2K48 A;  3N5L A;  4L9I A;  5LBM A;  5FNV E;  5TAO A;  4O4H E;  4AKL A;  3LK2 B;  3H37 A;  3JC6 C;  1MND A;  1X79 A;  3RKO A;  2YEV C;  3UUX B;  4UVB B;  5DQV A;  4BA9 A;  4OHF A;  3SOL A;  2JMK A;  5FXZ A;  3LBX B;  4Z8X A;  5CB4 E;  2V7J A;  3HKD E;  2WWU A;  5EK4 A;  4CI1 B;  1LVK A;  4O2A E;  2X66 A;  4DBR A;  1YKH B;  4CZZ B;  1YD8 G;  3NRX A;  3W15 B;  3ZJ2 A;  3ZMV B;  5J2T E;  5CA0 E;  4ILU A;  3DJB A;  5FY7 A;  2KMF A;  2C5K T;  3OYX A;  2VWA A;  4AKI A;  2IAK A;  4H9Q C;  4PFP A;  4IHJ E;  1HX8 A;  2KIN B;  2KWH A;  3E08 A;  4PJJ A;  3QK6 A;  3KV9 A;  4UV9 B;  1ZEE A;  1MIY A;  1OXZ A;  3R6N A;  4QHO A;  2DHR A;  1SHZ C;  3CKD A;  5HXE A;  3KBU A;  3KIN B;  2CXD A;  2ZM8 A;  1QSD A;  2D2S A;  1H7C A;  2XAF B;  3O4X E;  3A5X A;  5JR9 B;  1UX5 A;  2ODV A;  4WNK A;  5C8Y E;  3ANW A;  3FB2 A;  5LJM A;  2EHO D;  2UXX B;  3NZQ A;  4H9S E;  5FXW A;  4ADZ A;  2V7L A;  2KLQ A;  3ETV A;  2JMH A;  3IBP A;  4G63 A;  4AQF C;  3LFM A;  5LG4 A;  4EAH A;  3CVR A;  1MMA A;  5LHI B;  3KFW X;  1MMD A;  1AJ3 A;  2V7K A;  5LGN B;  5EZY E;  3OKQ A;  4AKH A;  2CLY C;  1UCU A;  1KNZ A;  2KT9 A;  4HGA A;  2Q9Q C;  3LK3 B;  5JQG E;  5HXR A;  2QA7 A;  2L9Q A;  2CEA A;  2DNX A;  3CWZ B;  4MFR A;  5JDF A;  5AFU L;  1EZ3 A;  4ZI3 C;  3FXD B;  3J7Y q;  2BZB A;  3K3N A;  5LJN A;  4IIJ E;  4ZHQ E;  1D0Z A;  5HWY A;  3MXZ A;  3F31 A;  3J9X 1;  4UIG A;  3E22 E;  4CI2 B;  5F3J A;  2QGS A;  4YLH A;  4EOZ B;  3N2O A;  2E9X C;  2GK9 A;  3CX6 B;  4ZOL E;  3AA6 B;  2MBG A;  3ZMZ B;  3RYF E;  1O3X A;  1HTJ F;  4TX5 A;  5IYZ E;  4CI3 B;  3N9N A;  3MA9 A;  3BQK A;  3AB3 B;  1SA0 E;  1FIO A;  5LGU B;  2XAG B;  2VK9 A;  4GK0 E;  4QWN B;  3L3P A;  3PDY A;  1UX4 A;  2VKO A;  4QXC B;  3MZK B;  3PU3 A;  3ZC1 A;  1D0Y A;  1HS7 A;  3CML A;  4IE0 A;  2VKD A;  3HKB E;  1FEW A;  2L3L A;  3MJX A;  3FXE B;  4TV8 E;  4KBM B;  2EHO B;  3RYI E;  4J2C A;  3ZEF B;  4I43 B;  1ZKE A;  5FXX A;  1Y64 B;  2LOS A;  3ZMT B;  5ADX L;  4BJM A;  2LM9 A;  3KBT A;  3MK7 C;  4JEU B;  4O4L E;  4ZS3 A;  4QXH B;  2D0T A;  4ANJ A;  4DND A;  3MKD A;  1BR1 A;  5HAX A;  4ERR A;  2C0S A;  3PUA A;  2N2N A;  3HKC E;  3IF8 B;  4NUU A;  4EZ4 A;  4P09 A;  3NZP A;  3B13 A;  2H7V C;  2KZ7 B;  5ETW A;  3SRZ A;  4PJN A;  5LHH B;  3UFE A;  2LHR A;  2X68 A;  4IST A;  5JR9 A;  4ZI2 D;  3RYH E;  1MMG A;  1YKE B;  2IC6 A;  4O4J E;  4KP3 C;  4UVA B;  3AVS A;  4CXX A;  4PAG A;  2CCQ A;  4IGU A;  4YJ3 E;  4G2A A;  4X1K E;  5JDM A;  3EDV A;  3O1H A;  4NUV A;  3C98 B;  2W63 A;  3AAA B;  2PG8 A;  4U72 A;  2UXN B;  5JDQ A;  3VKH A;  3SS1 A;  3ZYL A;  2JPF A;  3EDU A;  2DCF A;  1S94 A;  2JQQ A;  3N9L A;  5J2U E;  4MLK A;  1WRD A;  4ZI2 C;  4EB6 E;  2N1G A;  2X9X A;  3R84 B;  3I0O A;  2BDE A;  2YU2 A;  4C90 A;  4PJM A;  1G8X A;  3PE0 A;  4E7Z A;  5JDN A;  3WAJ A;  3UUL A;  3IEE A;  4I55 E;  3K3Q C;  5KMG P;  3C4Z A;  4AKG A;  1KK7 A;  1HF8 A;  3C64 A;  5L3E B;  5FY0 A;  5KDM C;  3CQG B;  5H6Q B;  2KXP B;  2CXF A;  2JRK A;  5HXH A;  4QX8 B;  3GA8 A;  1HCI A;  1LRZ A;  2V7I A;  2MYS A;  2K24 A;  4XZC A;  2V1D B;  5HYA A;  1D1A A;  1LVF A;  4MAL A;  2B1E A;  4N78 D;  3ZYK A;  4EXT A;  4IE4 A;  2D5U A;  2VAS A;  2K9A A;  4EYU A;  4WBN E;  1VOM A;  3JC6 D;  3T8O A;  3ZYM A;  4X20 E;  3RRW A;  1G73 A;  5CA1 E;  1D1B A;  2YK0 A;  3ONX A;  4X1Y E;  3ZCI A;  2IC9 A;  4GYR A;  3F57 A;  5L2L A;  4M1P A;  1Z0P A;  2C5I T;  2CLY B;  3GN5 B;  4WW0 A;  1OWA A;  3LJC A;  2ODU A;  3EUH A;  3PUR A;  2WBL A;  2DWG A;  3PU8 A;  4O4I E;  3RYC E;  2YU1 A;  3LG7 A;  2NWB A;  4F6R C;  2W61 A;  4UF0 A;  3KV4 A;  4EIW A;  4O8S A;  4HEA A;  3KVB A;  2HPJ A;  4OK0 A;  2C5J A;  4XAX B;  3B57 A;  4V1A v;  4TZ4 C;  4XBF B;  3F2E A;  2Z6E A;  4UVC B;  4DMW A;  2ZM0 A;  4KUM B;  4DMV A;  3FBZ A;  1V9D A;  3QC9 A;  4C91 A;  2XAS B;  4UF0 B;  3N9P A;  4P0B A;  4UXN B;  4ZI3 D;  4JEH B;  3V5S A;  5DAB A;  4TV9 E;  2LSJ A;  3ZN1 B;  3CQC B;  2A72 A;  4JUY A;  3CQX C;  3ZJ1 A;  2NW8 A;  2X51 A;  4H9O C;  2LSY A;  3M65 A;  4IDZ A;  3C50 A;  4K0U A;  3AA1 B;  2WAU A;  3E0Z A;  1HFA A;  2NW7 A;  2X9H A;  5JRC B;  2XQY A;  5LYJ E;  3H3A A;  2H7O A;  4H9R C;  1BR2 A;  3UT5 E;  2KWI B;  5LNK A;  4L0R A;  4OYK A;  2NW9 A;  2LJL A;  5E0O A;  5F8P A;  1S35 A;  3C51 A;  2XAH B;  3RH3 A;  3WAK A;  2XTL A;  5A1L A;  5LBQ B;  3ZC0 A;  3AA0 B;  2I59 A;  4FI5 A;  2EHO C;  3S4U A;  4AXP A;  2E9X A;  4BJN A;  1T98 A;  3I9Y A;  2LT3 A;  2N9D A;  3Q5W A;  3K3O A;  3KV5 A;  3BQI A;  5JRC A;  2Q9Q B;  2CMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...