1YKEB

Structure of the mediator med7/med21 subcomplex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
119
Chain Sequence
DRLTQLQICLDQMTEQFCATLNYIDKNHGFERLTVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLLRHVDSLIEDFVDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords RNA polymerase II mediator complex protein MED7
publication title A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 44
structure length 119
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11221 Med21 Subunit 21 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.470 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ykeB00
1YKHB 1YKEB
chains in the Genus database with same CATH superfamily
2RA1A 2MYSA 5JREA 2E9XC 2WBLA 4P0BA 2VL8A 3UU5A 3SWHA 4C90A 5A1LA 3RKOA 1WYBA 4UF0A 1YXRA 4I43B 1SUMB 5M4YA 3B5MA 5AQTB 3VRBA 2XQ4A 4O2AE 5JR9B 5F8PA 1X79A 3FHNA 3EDUA 1ZV4X 3KBTA 2NW7A 3N9PA 3P4PA 5HEUA 4O4IE 2QVAA 2B1EA 3SS1A 1IBLT 2XM1A 3ZSSA 2H7OA 3RIAA 5HWXA 4DV1T 3V5UA 3QB5A 4JI2T 3QUJA 3KV6A 1HTJF 4MALA 5JR9C 2CHOA 3I9WA 3WI3A 2Y6XA 5ETWA 3QC9A 3NZPA 2UXNB 4PJJA 3TLUA 5HEJA 2EHOB 2KLQA 2X0YA 4OYKA 2JMHA 5IHYA 3OYZA 3CQCB 4QWNB 2XAJB 3G06A 4LF9T 3LK3B 2BKOA 2YU1A 5AQUB 4NXMT 5JR9A 1BR1A 5HXHA 5FMNA 3L09A 1Y64B 2X9YA 2WDVA 2CXFA 2YEVC 2QGSA 3CQXC 4O4LE 3HKCE 2JQKA 2LT3A 4DMWA 2LJLA 2YDSA 2EHOC 4XZCA 3AVRA 1S94A 3RYFE 4DR2T 2M6BA 4MHCA 4O8SA 4AQFC 4IDQA 2NR4A 5E0OA 1YKEB 2OLTA 3N9NA 2W63A 5HEHA 2EHOA 1US7B 2ZM6T 3KVAA 3RF1A 4JI0T 4G63A 5AFUL 3D0TA 1MIVA 3AE7A 4AQYT 4DV4T 4HFDA 4AQFA 2WSSV 1U4QA 3O9XA 2WM9A 3ZCIA 2WWUA 3UTKA 4UV8B 4H9PC 5HXEA 2UUBT 2X9WA 4TN7B 2BBJA 3AE2A 3P50A 4H9QC 2A2FX 2XSBA 2JIWA 3EHZA 4PAGA 3PTRB 1MIWA 3ZMZB 4CXXA 2UUCT 3ZC0A 1I6ZA 3UU6A 4DIDB 2V5CA 2ZLYA 5FXXA 2NW9A 2PJQA 3AEFA 3BQLA 2LM2A 4QX8B 3AA1B 3L3PA 4DBQA 4CN6A 3KDSE 3RYHE 5L3CB 1UGOA 2P9BA 2IUBA 1XZYA 2JQHA 1N34T 2ACXA 3UUBA 4BJMA 3ZN1B 2J47A 3N2GE 3Q5EA 2CHNA 2W66A 2LE8A 1FEWA 3RRCA 4UV9B 4LF5T 4MLKA 4NUVA 3M65A 1ZEEA 5J0ZA 1I94T 2UU9T 5JDNA 5DJQC 3KV4A 4NIQA 4P09A 4P1NA 4PK5A 2IMLA 2WWVA 2PG8A 5HEOA 3RRWA 5LYJE 2KZ7B 2IW5B 4DUZT 1ZOYA 5EK2A 2K24A 2BVMA 1T98A 4HFCA 5LBQB 5LB7B 1D1CA 2OA5A 3VKGA 5C8YE 1YQ4A 4JV5T 2XUEA 5L3EB 5FY0A 4U7IA 3KV5A 2WCAA 4LMJA 4HTEA 5IUXA 2MOZA 3IA3A 3B13A 4HFIA 5HCMA 1QLBA 3TLSA 3UULA 5F5WA 2BKNA 2HN1A 2YU2A 2I6HA 3O4XE 2MAWA 2H7VC 4TX5A 3ZSTA 5DQVA 3WAJA 3E0ZA 1WRDA 4AKIA 5FL0A 4H63H 1HS7A 2LKGA 1J1JA 4GIWA 4Z8XA 3P4WA 1Z8UA 3JAFA 3EI0A 4X66T 2NWBA 2XQ3A 2WDRA 2D0TA 2RP4A 2WQYA 2EHOD 3LBXB 4YXDA 1MMNA 3PUSA 3EDVA 4ZS3A 4ILCA 3GA8A 4ADZA 4LFAT 4I55E 4U74A 3T1HT 2VVSA 4CI3B 4OK0A 3ZPOA 3C98B 1SE7A 3FZKB 3PUGA 4KX6A 5J2UE 1UURA 3TKLB 2V6XA 2ODVA 4DV6T 3N9MA 1E1HB 1VRBA 3M3ZB 5JRCB 2VB6A 1HX8A 2LEHA 5JDQA 1FIOA 1X9BA 3H3AA 3C4ZA 3AE8A 3OJAA 3PJAJ 5CJ5A 5LGNB 2XQ7A 3V5SA 3PUZF 4Z90A 3SFEA 1G73A 3F57A 2V8SV 3LBXA 4NPPA 2NW8A 3ZT6A 1N36T 3NKZA 3ZKRA 5AQRB 2YK0A 4X1YE 1QUUA 1HCIA 5FVLA 3AA7B 3SOLA 4YHHT 5L47A 1IBKT 5LA6E 3AE1A 4U7YA 4PFOA 4DR3T 5JRCA 2E5LT 4ZEYA 5LJMA 1OEDC 1T7SA 2J1DG 3S4UA 4BJNA 2ES0A 2H89A 1UCUA 4JEHB 4A56A 4PK6A 5HEGA 2LSJA 3PUWF 3KFWX 2K9AA 4KHPT 5LHHB 5AQHB 2E8IA 3OYXA 5LP6E 4YJ2E 4HFVA 4CI2B 4AISA 4AQGA 2XAHB 2IC6A 3I0QA 4A97A 4LMKA 3AAEB 1J5WA 4YSZA 5AQQB 1UUSA 3DTOA 4NUUA 3KINB 3QB5K 2X66A 3H37A 3PUAA 4U33A 1UX4A 4JEUB 2KNDA 4EAHA 1CHUA 4HWHA 3C51A 4C91A 2E9XB 3TLVA 3ZN0B 3I9YA 3N9LA 2XAQB 4ZI2C 1V9DA 1T72A 3RYIE 5AQSB 3FB2A 4IE0A 4DR4T 2WP9A 2W62A 3E08A 5L4HA 2W0GA 3ANWB 3NVOA 4EOZB 3PJAA 3ZMSB 5FL1A 3AEAA 3K3OA 1SA0E 2R6GF 1NWMX 5DQWA 4JI7T 4PW8A 1ZKEA 3HKBE 4YT0A 4UVBB 5JDMA 3JADA 1KNRA 1WYCA 2MTQA 2XQ9A 3QOFA 2VASA 2WMNA 3UQ7A 2YOEA 4ZZBA 4CZZB 4KUMB 4DR7T 2WZIA 2FJAA 2M67A 4Z91A 3MXZA 3UFEA 3C50A 2E9XA 2LOSA 3PDYA 2BS2A 5FXWA 1E2AA 3ANWA 1QSDA 2KINB 2C0SA 2XY8B 3OTOT 3K3QC 4WZXA 1KK7A 4YTMA 4DR1T 1M7KA 4HN9A 4KBMB 4JI3T 4K0KT 2HH7A 5LOVE 2XAFB 4ILUA 5CGMA 4CN1A 2WMOA 4EXTA 1SHZC 3JCFA 4U3CA 2X67A 3FXEB 2V7IA 4J2CA 2UXBT 4COFA 2LOPA 5F3JA 4X64T 2SPCA 4DVDA 2LRKA 1BR2A 4YTPA 3KBUA 1AJ3A 4YFSA 5LMNT 3AE3A 3IHRA 3K8PC 2WB5A 2L9QA 2D5UA 2VKHA 4HKAA 1M62A 4PK4A 2YDQA 5L3BB 2V6YB 2UXXB 2J4GA 5ABEA 1MNDA 3AEDA 1DU2A 5FXVA 4O4JE 1MMDA 4PJMA 3BQKA 4LFCT 2VWAA 1W09A 5FNVE 2LRLA 4HE8A 4EYYR 5LG4A 4CN4A 3AVSA 4GYRA 5TAOA 4WW0A 2BBHA 2Y8DA 4ZHQE 2FJDA 4TV9E 4WYVA 3R6NA 4IDZA 2BDEA 4ZI3C 2BG9E 4E7SA 5KX5E 2D9DA 3NWIA 3FZMB 4YJ3E 2CMRA 5JDLA 5H6QB 3K1SA 3J7Yq 2V6YA 2V7JA 4UEMA 4H9OC 3JC6C 4ZZCA 2YINA 4ZI2D 1D0XA 4AKGA 5LBMA 2IIUA 4PJLA 3CWZB 1XMQT 5JH7E 3KV9A 2LLYA 1YKHB 2LSYA 1XDOA 2MPKA 3ZYMA 5HXCA 2XJ7A 3AE6A 3LJCA 1NEKA 2E9XD 3RIFA 2LSIA 3MZKB 2WAUA 4LF6T 4DUYT 2AE9A 3NBXX 3X1DA 3ONXA 5FP3A 1FMVA 4B3ST 3RLFF 4K0UA 2FUPA 5LG3A 5ABFB 1VCSA 4DMVA 3ONLC 4B3RT 5HYAA 4DV5T 3HKEE 3GMIA 2IDOB 2ACZA 2JQ9A 3A7MA 2XSAA 2K3WA 3OBVE 3O1JA 3P4QA 1JNRA 4IDOA 3ABVA 3ZEFB 3EAMA 5FVKA 3DJBA 3ZLIA 3I0OA 3Q5DA 4N78D 3FZHB 2XTLA 1NENA 3NZQA 2FJEA 2X9HA 2KXPB 3LK42 5JVDE 5AQMB 2WZHA 1G8XA 1D0ZA 2VKJA 5HAXA 4ILAA 3HL6A 4HFHA 2AXDS 2FJBA 4B3MT 2XQ8A 2CXLA 5ABFA 5ABHA 5HXSA 4DR6T 4ANJA 3AE4A 3RI5A 1O3XA 3IF8B 3ZCJA 4O4HE 4KI0F 4GK0E 3A5XA 3F2EA 2LSGA 3DP7A 3F31A 1LVFA 3N9QA 4JUYA 5LGUB 5LJNA 4JI5T 4PJNA 4TNVA 2J62A 2BS4A 3ZJ2A 1WCRA 1GQEA 1KF6A 2NTXA 4L0RA 4U72A 2QA7A 4OYJA 3RPUA 2KMFA 1LRZA 1Y01A 2V26A 1L0VA 3IBPA 4UELA 2IC9A 5DABA 5J2TE 1HG2A 3P8CD 1UX5A 2DHRA 4ZI3D 2CLYB 4EZHA 4KMCA 4XBFB 5JDHA 1OEDB 1S35A 4AI6A 2JPFA 2HPJA 3RYCE 4PFPA 4HFBA 3AB3B 5AQFB 2FBWA 2F4VT 4TWHA 4JI8T 1UK5A 3O1IA 2HPLA 4JI4T 3N5LA 4EGWA 4LF7T 4KHZF 4CXYA 3OKQA 2CPTA 4GKJT 2CLYC 4TWFA 4LFBT 3BK9A 3L39A 3Q9DA 4I0UA 3P7IA 3AECA 4Q25A 4EEBA 3TLTA 2LHNA 1XDPA 4IREA 5EZYE 2XPKA 5CB4E 1HNZT 3I1AA 4EYUA 2NOXA 2H3RA 1OEDA 3UT5E 4AXPA 3CVRA 4EB6E 1JNZA 2A3DA 2A72A 3PUQA 4KP3C 5L3DB 4IE4A 4ZI7E 2VVNA 2Z6EA 1KNPA 2X9XA 4L9IA 4JBWF 5KDMC 3E22E 4DO0A 4YSXA 2YKSA 5LMUT 3ESLA 3RQWA 4CXWA 2W2UA 2CEAA 2YDRA 4B3TT 2XQYA 4HWDA 5CA1E 3RIUC 1KEYA 3MK7C 5JTGA 4H63V 4OFZA 4WNKA 4ERRA 2CWYA 5ABGA 4X65T 3MJXA 4DNDA 2N2NA 1HNWT 3VKHA 3LFMA 1IBMT 1N33T 4UXNB 4FI5A 4LF8T 3PUYF 5FY7A 2G0UA 1H7CA 2RPAA 3K3NA 1Z0PA 1IJ6A 3PURA 4H9NC 4UR9A 3L8RA 4HWCA 2VL0A 3PU3A 1ZP0A 1LKXA 2C5KT 5L3GB 3ZC1A 2CRBA 5AQIB 4XAXB 2ZM0A 3EUHA 3SFDA 3MA9A 1MMAA 5AQVB 5L3FB 4IDNA 3RC3A 5GONE 5H6RB 2LKHA 5FXZA 2PBIA 3MKDA 2XAGB 1IJ5A 1MMGA 5L2LA 4A5XA 4EIWA 5BR8T 4YSYA 3AEGA 4FJOA 5AQGB 2L3LA 4EV6A 4M1PA 4X1IE 4LF4T 4JYAT 4DR5T 4IE6A 4F8HA 3CQGB 5BMVE 3CIRA 4EEDA 1HR0T 2E2AA 4QXHB 3B57A 4YLHA 3UFGA 4JI6T 3RC8A 3NRXA 3CK6A 1IZNB 1OWAA 5FKYA 2V1DB 2CE7A 4F6RC 3NRYA 2W4XA 1VOMA 2M6IA 4IL4A 1HNXT 3T8OA 4G2AA 3RH3A 3PUXF 3OPCA 4WBNE 4QHOA 1XMOT 3VRAA 2X0HA 3QK6A 1WR6A 3N2OA 4BA9A 2UXDT 4IDPA 2UXCT 2GK9A 5FY1A 3ZJ1A 4U2YA 5LHIB 4QH1A 2CCQA 3LDQB 4ISSA 3HA4A 3UU3A 4OHFA 1XNQT 5KMGP 1XWMA 4X1KE 3ZMUB 3AXJB 3P4SA 5LCYA 1WLXA 2XM2A 3RX6A 4DV2T 4PNIA 2YN6A 3UUXB 4AKLA 3BQIA 2VKDA 4DBRA 3P4RA 3C64A 3ZT7A 3AA6B 3O1HA 5CA0E 3ONJA 2IHR1 3LG7A 4ILBA 2DWGA 2CWOA 3RKGA 3Q5WA 4H9SE 1W0AA 4U31A 2ZM8A 2DI4A 4H9RC 2BS3A 3U78A 3WAKA 1OEDE 1HG5A 3CMLA 5HWYA 2CBJA 1W0BA 3CX7B 1B7TA 5L4EA 3RHWA 3FBLA 3C4XA 1MNEA 4U2ZA 4MBQA 3AE5A 5JDGA 5LGTB 4GK5E 1IAPA 2X68A 2N9DA 3LK2B 2DLRA 2Q9QB 3AXJA 1ZHCA 4CI1B 2W67A 4IIJE 3AAIA 1VCTA 4A98A 2VURA 1EZ3A 2QYWA 4YY3T 2C5IT 2D2SA 5IYZE 4P0AA 4TWDA 4IGUA 2K48A 2V5DA 5LXTE 2UUAT 2DNXA 2CM0A 3PE0A 4QKNA 5AQLB 2Q9QC 4WBOA 2WS3A 3EABA 4AIUA 4B6XA 3PUVF 4AKRB 1D1AA 2KT9A 3AEEA 2L8KA 1MIYA 2XQAA 2WU5A 1CUNA 2VKOA 1KNZA 4HGAA 2JQQA 4TZ4C 2W61A 3QNUA 1R8IA 2ZMAA 4E7ZA 3ETVA 4GKKT 2CBIA 2Q9QA 2I0MA 3UU8A 4QXCB 3H3MA 2DL1A 3ETUA 4HFEA 3KVBA 3UUNA 4TUYE 4HWIB 3N2KE 1OXZA 3C4WA 5LNKA 3JAEA 5IWAT 4OX9T 3HI2A 2V7LA 3W15B 4ZS2A 4O2BE 2XZEA 4GYSA 4QXBB 2XHEB 2XASB 2JMKA 4HEAA 5AQNB 1YD8G 3VR9A 2B76A 2LM9A 2OV9A 3FXDB 1XNRT 2JJ9A 3CKDA 5C3JA 3IEEA 4DV0T 2BKPA 2XQ6A 2H88A 2X0LB 4ZOLE 1YQ3A 2PFVA 4L5GA 1HFAA 4LMLA 5ADXL 5AQOB 3PU8A 3UUMA 4QH4A 2NTYA 3ZYLA 4AKHA 2I59A 5AQJB 2N1GA 2KSRA 4V1Av 2VK9A 3CPZA 4ISTA 2DCFA 3FBZA 2BVLA 3RQUA 5FYMA 3RGLA 1WR0A 4MFRA 4UVAB 2MBGA 3UU4A 2LSKA 3ZMTB 1WFDA 3PV0F 4X62T 3SRZA 1FMWA 1D0YA 5EK4A 1HX1B 2HHHT 3HR0A 3U3IA 3J9X1 3AA0B 3MACA 3VU7H 3CX6B 2KWHA 2LHRA 3VR8A 3CX8B 1BR0A 1YW0A 3Q5XA 2VQET 2IAKA 2E5VA 2CXDA 3TLWA 3ZYKA 4JI1T 1NAFA 4X20E 4ASKA 3JC6D 3OVUA 2PTFA 4I4TE 1J5ET 2BG9B 3N9OA 2QRXA 2CA5A 2XQ5A 4DV3T 4IE5A 3GWHA 2NP9A 2WDQA 2X51A 1E7PA 2K5BB 2V7MA 1N32T 3AE9A 4I50E 2DWKA 4CQIA 3ZT5A 3FZLB 4TNWA 5KXJA 4X5TA 3GN5B 3Q2MA 5J1GA 4QX7B 2BG9C 5CFBA 5JQGE 3AEBA 1U5PA 2HN2A 4YHJA 2Q9QD 3UQ4A 3LSVA 4TV8E 4UVCB 4IHJE 5JDFA 1D1BA 3EVYA 3FZFB 2BG9A 2ODUA 4ZXLA 1BR4A 3T1YT 3VHLA 3AAAB 2VQFT 5AQKB 4QH5A 5HXRA 4UF0B 2C5JA 4JLEA 4HWFA 2A9UA 4GOUA 5EK3A 4EZ4A 3GN5A 2KWIB 2WY2A 3R84B 1W9RA 2WU2A 4IL9A 1LVKA 4NXNT 1HF8A 3A8YC 4IE7A 5HCJA 4UIGA 2ZM2A 5LHGB 1FJGT 2BZBA 3RIUA 4BAYB 4DV7T 3HKDE 2V7KA 2D0UA 2Y48B 4IT4A 2JRKA 4YTNA 1T8BA 3ZMVB 5AQPB 1KFYA 2W00A 5C2TA
chains in the Genus database with same CATH topology
1G73A 3F57A 3UUXB 3BQIA 4AKLA 2RA1A 2VKDA 3LBXA 4DBRA 3ZEFB 2MYSA 5JREA 2E9XC 2NW8A 3DJBA 2WBLA 3C64A 4P0BA 3I0OA 2VL8A 3ZLIA 3AA6B 3O1HA 4N78D 5CA0E 2XTLA 3LG7A 2DWGA 3SWHA 4C90A 2CWOA 5A1LA 3RKOA 3NZQA 2X9HA 1WYBA 4UF0A 3Q5WA 2KXPB 2YK0A 4H9SE 4X1YE 4I43B 3LK42 1QUUA 1HCIA 5M4YA 5JVDE 3AA7B 2ZM8A 3SOLA 2DI4A 4H9RC 1G8XA 4O2AE 1D0ZA 3U78A 5JR9B 2VKJA 5F8PA 1X79A 5HAXA 3WAKA 1HG5A 3HL6A 5LA6E 4PFOA 3CMLA 5HWYA 3CX7B 3FHNA 1B7TA 5JRCA 3EDUA 1ZV4X 5LJMA 3KBTA 3FBLA 3C4XA 2CXLA 2NW7A 3N9PA 1MNEA 5HXSA 2J1DG 3S4UA 4MBQA 4BJNA 2ES0A 4O4IE 5JDGA 1UCUA 4JEHB 4A56A 4ANJA 5LGTB 4GK5E 2B1EA 1IAPA 4PK6A 2X68A 3SS1A 2N9DA 1O3XA 3LK2B 2LSJA 2DLRA 2H7OA 3IF8B 2Q9QB 3KFWX 2K9AA 3ZCJA 5HWXA 4O4HE 1ZHCA 4CI1B 5LHHB 3V5UA 4GK0E 3A5XA 2E8IA 4IIJE 3OYXA 3AAIA 3F2EA 3QUJA 3KV6A 4HFVA 4CI2B 2LSGA 4YJ2E 3DP7A 1HTJF 3F31A 4MALA 1LVFA 5JR9C 3N9QA 4AQGA 3I9WA 4JUYA 2XAHB 1EZ3A 2IC6A 2Y6XA 5ETWA 3WI3A 5LGUB 2C5IT 2D2SA 5LJNA 5IYZE 4PJNA 4P0AA 3I0QA 3QC9A 3NZPA 2UXNB 3ZJ2A 4PJJA 3AAEB 4IGUA 2EHOB 2K48A 3DTOA 2KLQA 5LXTE 4NUUA 3KINB 2DNXA 2JMHA 4OYKA 2CM0A 2X66A 5IHYA 3OYZA 3CQCB 3H37A 3PUAA 4QWNB 2XAJB 1UX4A 2NTXA 3PE0A 4JEUB 4L0RA 3LK3B 2KNDA 4EAHA 4QKNA 4U72A 2QA7A 2YU1A 4OYJA 2Q9QC 2KMFA 5JR9A 3RPUA 4WBOA 3C51A 4C91A 1BR1A 5HXHA 1LRZA 5FMNA 2E9XB 3ZN0B 3I9YA 2V26A 3L09A 3N9LA 2XAQB 4ZI2C 1V9DA 1Y64B 3RYIE 2X9YA 3IBPA 4B6XA 4UELA 3FB2A 4IE0A 4AKRB 2CXFA 2YEVC 1D1AA 2KT9A 2QGSA 3CQXC 2L8KA 1MIYA 2IC9A 4O4LE 2W62A 3HKCE 1CUNA 2VKOA 3E08A 2W0GA 4HGAA 5DABA 2JQQA 3ANWB 4TZ4C 1KNZA 2W61A 2LT3A 4DMWA 2LJLA 5J2TE 2EHOC 4EOZB 1HG2A 3P8CD 2ZMAA 3ZMSB 4E7ZA 1UX5A 3ETVA 2DHRA 4XZCA 2Q9QA 4ZI3D 2CLYB 3K3OA 3AVRA 1S94A 3RYFE 1SA0E 4KMCA 4EZHA 4XBFB 1NWMX 4QXCB 4MHCA 4O8SA 5DQWA 3ETUA 4PW8A 4AQFC 5JDHA 1S35A 1ZKEA 5LP6E 3HKBE 4AI6A 2JPFA 5E0OA 4UVBB 1YKEB 5JDMA 2HPJA 3KVBA 3UUNA 3RYCE 1WYCA 3N9NA 4TUYE 4PFPA 2W63A 3AB3B 2MTQA 3N2KE 2EHOA 1US7B 2VASA 1OXZA 3C4WA 2WMNA 5LNKA 3KVAA 3O1IA 2HPLA 3N5LA 4G63A 4CZZB 5AFUL 3D0TA 4KUMB 1MIVA 3HI2A 2V7LA 3W15B 2M67A 4CXYA 4ZS2A 4AQFA 3OKQA 2WSSV 1U4QA 2CLYC 3MXZA 3UFEA 2WM9A 3O9XA 3C50A 2E9XA 3BK9A 2LOSA 4O2BE 2WWUA 3ZCIA 4GYSA 4QXBB 2XHEB 4UV8B 3UTKA 2XASB 4H9PC 3PDYA 3Q9DA 2JMKA 4HEAA 5HXEA 2X9WA 4TN7B 1YD8G 3P7IA 4H9QC 2A2FX 5FXWA 2LM9A 3ANWA 1QSDA 2KINB 2C0SA 3K3QC 4PAGA 1KK7A 3PTRB 3FXDB 1MIWA 2LHNA 2JJ9A 3CKDA 3IEEA 3ZMZB 5EZYE 4CXXA 4HN9A 2X0LB 5CB4E 4ZOLE 3ZC0A 2PFVA 3I1AA 4EYUA 4KBMB 2NOXA 4L5GA 1HFAA 2H3RA 2HH7A 2ZLYA 5LOVE 5FXXA 2XAFB 4ILUA 2NW9A 3UT5E 5ADXL 4AXPA 3CVRA 2PJQA 3BQLA 3PU8A 2WMOA 3UUMA 4EXTA 4EB6E 1SHZC 4QX8B 2A3DA 2A72A 3PUQA 4KP3C 5L3DB 4IE4A 3AA1B 2NTYA 3L3PA 3ZYLA 4ZI7E 4AKHA 4DBQA 2X67A 2Z6EA 2I59A 2V7IA 3FXEB 2X9XA 4L9IA 3KDSE 2N1GA 4J2CA 3RYHE 4V1Av 5KDMC 5L3CB 3E22E 2P9BA 4DO0A 2LOPA 5F3JA 2VK9A 3CPZA 3ESLA 4ISTA 2DCFA 3FBZA 2BVLA 2ACXA 5FYMA 4BJMA 3ZN1B 4CXWA 4MFRA 2SPCA 2CEAA 4DVDA 4UVAB 2MBGA 2LSKA 3N2GE 1BR2A 2XQYA 3KBUA 5CA1E 2LE8A 1AJ3A 1FEWA 3MK7C 4YFSA 3ZMTB 3IHRA 4H63V 4OFZA 4WNKA 3RRCA 4UV9B 2CWYA 3K8PC 4ERRA 3MJXA 2L9QA 2D5UA 4MLKA 4DNDA 3SRZA 1FMWA 2N2NA 4NUVA 3M65A 2VKHA 4HKAA 1D0YA 5EK4A 3VKHA 1ZEEA 3LFMA 3HR0A 3U3IA 4PK4A 3J9X1 3AA0B 3MACA 5L3BB 2UXXB 3VU7H 4UXNB 1MNDA 3CX6B 4FI5A 2KWHA 5JDNA 2LHRA 5FXVA 3CX8B 5FY7A 1BR0A 2G0UA 1H7CA 1YW0A 3K3NA 5DJQC 1Z0PA 1IJ6A 3KV4A 3Q5XA 2IAKA 4P09A 4PK5A 2CXDA 3PURA 4O4JE 1MMDA 4PJMA 2PG8A 4H9NC 3BQKA 3ZYKA 3RRWA 5LYJE 1NAFA 2KZ7B 2IW5B 4X20E 3PU3A 4ASKA 3JC6D 2VWAA 5EK2A 2K24A 2BVMA 1LKXA 1T98A 2C5KT 4I4TE 5L3GB 5LBQB 3ZC1A 1D1CA 2OA5A 3VKGA 4XAXB 3N9OA 5C8YE 2CA5A 5FNVE 2ZM0A 4HE8A 4IE5A 4EYYR 3EUHA 5LG4A 2XUEA 3GWHA 5L3EB 5FY0A 3KV5A 2NP9A 3AVSA 4HTEA 2X51A 4GYRA 5TAOA 4WW0A 3MA9A 2Y8DA 1MMAA 2MOZA 2K5BB 3RC3A 5L3FB 4ZHQE 2V7MA 4TV9E 3B13A 4I50E 5GONE 3R6NA 5H6RB 2DWKA 4IDZA 4CQIA 5FXZA 2BDEA 2PBIA 3UULA 4ZI3C 3MKDA 2XAGB 1IJ5A 2YU2A 4E7SA 3O4XE 1MMGA 5KX5E 3GN5B 5L2LA 4EIWA 3Q2MA 5J1GA 2H7VC 4YJ3E 4TX5A 2CMRA 4FJOA 4QX7B 5H6QB 5JDLA 5DQVA 3WAJA 3J7Yq 3E0ZA 1WRDA 5JQGE 2L3LA 4AKIA 4H63H 1U5PA 4M1PA 1HS7A 4X1IE 4YHJA 2V7JA 4UEMA 4H9OC 3JC6C 2Q9QD 4GIWA 4Z8XA 4IE6A 2YINA 4TV8E 4ZI2D 4UVCB 3CQGB 1D0XA 5BMVE 4QXHB 4AKGA 5LBMA 2NWBA 3B57A 4IHJE 5JDFA 2D0TA 4PJLA 1D1BA 3CWZB 3EVYA 4YLHA 5JH7E 3KV9A 1YKHB 2LSYA 2ODUA 2RP4A 2EHOD 3LBXB 1BR4A 3NRXA 3RC8A 1IZNB 3VHLA 3AAAB 1MMNA 1OWAA 2V1DB 3EDVA 3PUSA 2CE7A 4ZS3A 3NRYA 3GA8A 4F6RC 3ZYMA 4ADZA 5HXCA 1VOMA 4I55E 4U74A 5HXRA 3LJCA 4CI3B 4OK0A 4UF0B 4G2AA 3T8OA 2C5JA 3ZPOA 3RH3A 3C98B 4JLEA 2E9XD 4WBNE 4QHOA 3PUGA 2LSIA 3MZKB 2WAUA 4GOUA 3QK6A 1WR6A 3N2OA 4BA9A 5J2UE 5EK3A 4EZ4A 3TKLB 3GN5A 2ODVA 3NBXX 2GK9A 2KWIB 3R84B 3N9MA 1E1HB 3ONXA 1VRBA 5FY1A 3ZJ1A 5FP3A 1FMVA 5LHIB 1LVKA 5JRCB 2VB6A 2CCQA 1HF8A 4K0UA 4IE7A 1HX8A 4ISSA 3HA4A 4UIGA 2ZM2A 2LEHA 5LHGB 5JDQA 4DMVA 2BZBA 1FIOA 4OHFA 5HYAA 3H3AA 3HKEE 3C4ZA 4BAYB 3OJAA 3GMIA 3HKDE 2V7KA 2D0UA 5KMGP 2Y48B 2JRKA 4X1KE 5LGNB 3OBVE 3ZMVB 3V5SA 3ZMUB 2W00A 3O1JA 5LCYA 1WLXA 3RX6A 4PNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKH B;  1YKE B; 
#chains in the Genus database with same CATH topology
 2RA1 A;  2MYS A;  5JRE A;  2E9X C;  2WBL A;  4P0B A;  2VL8 A;  3UU5 A;  3SWH A;  4C90 A;  5A1L A;  3RKO A;  1WYB A;  4UF0 A;  1YXR A;  4I43 B;  1SUM B;  5M4Y A;  3B5M A;  5AQT B;  3VRB A;  2XQ4 A;  4O2A E;  5JR9 B;  5F8P A;  1X79 A;  3FHN A;  3EDU A;  1ZV4 X;  3KBT A;  2NW7 A;  3N9P A;  3P4P A;  5HEU A;  4O4I E;  2QVA A;  2B1E A;  3SS1 A;  1IBL T;  2XM1 A;  3ZSS A;  2H7O A;  3RIA A;  5HWX A;  4DV1 T;  3V5U A;  3QB5 A;  4JI2 T;  3QUJ A;  3KV6 A;  1HTJ F;  4MAL A;  5JR9 C;  2CHO A;  3I9W A;  3WI3 A;  2Y6X A;  5ETW A;  3QC9 A;  3NZP A;  2UXN B;  4PJJ A;  3TLU A;  5HEJ A;  2EHO B;  2KLQ A;  2X0Y A;  4OYK A;  2JMH A;  5IHY A;  3OYZ A;  3CQC B;  4QWN B;  2XAJ B;  3G06 A;  4LF9 T;  3LK3 B;  2BKO A;  2YU1 A;  5AQU B;  4NXM T;  5JR9 A;  1BR1 A;  5HXH A;  5FMN A;  3L09 A;  1Y64 B;  2X9Y A;  2WDV A;  2CXF A;  2YEV C;  2QGS A;  3CQX C;  4O4L E;  3HKC E;  2JQK A;  2LT3 A;  4DMW A;  2LJL A;  2YDS A;  2EHO C;  4XZC A;  3AVR A;  1S94 A;  3RYF E;  4DR2 T;  2M6B A;  4MHC A;  4O8S A;  4AQF C;  4IDQ A;  2NR4 A;  5E0O A;  1YKE B;  2OLT A;  3N9N A;  2W63 A;  5HEH A;  2EHO A;  1US7 B;  2ZM6 T;  3KVA A;  3RF1 A;  4JI0 T;  4G63 A;  5AFU L;  3D0T A;  1MIV A;  3AE7 A;  4AQY T;  4DV4 T;  4HFD A;  4AQF A;  2WSS V;  1U4Q A;  3O9X A;  2WM9 A;  3ZCI A;  2WWU A;  3UTK A;  4UV8 B;  4H9P C;  5HXE A;  2UUB T;  2X9W A;  4TN7 B;  2BBJ A;  3AE2 A;  3P50 A;  4H9Q C;  2A2F X;  2XSB A;  2JIW A;  3EHZ A;  4PAG A;  3PTR B;  1MIW A;  3ZMZ B;  4CXX A;  2UUC T;  3ZC0 A;  1I6Z A;  3UU6 A;  4DID B;  2V5C A;  2ZLY A;  5FXX A;  2NW9 A;  2PJQ A;  3AEF A;  3BQL A;  2LM2 A;  4QX8 B;  3AA1 B;  3L3P A;  4DBQ A;  4CN6 A;  3KDS E;  3RYH E;  5L3C B;  1UGO A;  2P9B A;  2IUB A;  1XZY A;  2JQH A;  1N34 T;  2ACX A;  3UUB A;  4BJM A;  3ZN1 B;  2J47 A;  3N2G E;  3Q5E A;  2CHN A;  2W66 A;  2LE8 A;  1FEW A;  3RRC A;  4UV9 B;  4LF5 T;  4MLK A;  4NUV A;  3M65 A;  1ZEE A;  5J0Z A;  1I94 T;  2UU9 T;  5JDN A;  5DJQ C;  3KV4 A;  4NIQ A;  4P09 A;  4P1N A;  4PK5 A;  2IML A;  2WWV A;  2PG8 A;  5HEO A;  3RRW A;  5LYJ E;  2KZ7 B;  2IW5 B;  4DUZ T;  1ZOY A;  5EK2 A;  2K24 A;  2BVM A;  1T98 A;  4HFC A;  5LBQ B;  5LB7 B;  1D1C A;  2OA5 A;  3VKG A;  5C8Y E;  1YQ4 A;  4JV5 T;  2XUE A;  5L3E B;  5FY0 A;  4U7I A;  3KV5 A;  2WCA A;  4LMJ A;  4HTE A;  5IUX A;  2MOZ A;  3IA3 A;  3B13 A;  4HFI A;  5HCM A;  1QLB A;  3TLS A;  3UUL A;  5F5W A;  2BKN A;  2HN1 A;  2YU2 A;  2I6H A;  3O4X E;  2MAW A;  2H7V C;  4TX5 A;  3ZST A;  5DQV A;  3WAJ A;  3E0Z A;  1WRD A;  4AKI A;  5FL0 A;  4H63 H;  1HS7 A;  2LKG A;  1J1J A;  4GIW A;  4Z8X A;  3P4W A;  1Z8U A;  3JAF A;  3EI0 A;  4X66 T;  2NWB A;  2XQ3 A;  2WDR A;  2D0T A;  2RP4 A;  2WQY A;  2EHO D;  3LBX B;  4YXD A;  1MMN A;  3PUS A;  3EDV A;  4ZS3 A;  4ILC A;  3GA8 A;  4ADZ A;  4LFA T;  4I55 E;  4U74 A;  3T1H T;  2VVS A;  4CI3 B;  4OK0 A;  3ZPO A;  3C98 B;  1SE7 A;  3FZK B;  3PUG A;  4KX6 A;  5J2U E;  1UUR A;  3TKL B;  2V6X A;  2ODV A;  4DV6 T;  3N9M A;  1E1H B;  1VRB A;  3M3Z B;  5JRC B;  2VB6 A;  1HX8 A;  2LEH A;  5JDQ A;  1FIO A;  1X9B A;  3H3A A;  3C4Z A;  3AE8 A;  3OJA A;  3PJA J;  5CJ5 A;  5LGN B;  2XQ7 A;  3V5S A;  3PUZ F;  4Z90 A;  3SFE A;  1G73 A;  3F57 A;  2V8S V;  3LBX A;  4NPP A;  2NW8 A;  3ZT6 A;  1N36 T;  3NKZ A;  3ZKR A;  5AQR B;  2YK0 A;  4X1Y E;  1QUU A;  1HCI A;  5FVL A;  3AA7 B;  3SOL A;  4YHH T;  5L47 A;  1IBK T;  5LA6 E;  3AE1 A;  4U7Y A;  4PFO A;  4DR3 T;  5JRC A;  2E5L T;  4ZEY A;  5LJM A;  1OED C;  1T7S A;  2J1D G;  3S4U A;  4BJN A;  2ES0 A;  2H89 A;  1UCU A;  4JEH B;  4A56 A;  4PK6 A;  5HEG A;  2LSJ A;  3PUW F;  3KFW X;  2K9A A;  4KHP T;  5LHH B;  5AQH B;  2E8I A;  3OYX A;  5LP6 E;  4YJ2 E;  4HFV A;  4CI2 B;  4AIS A;  4AQG A;  2XAH B;  2IC6 A;  3I0Q A;  4A97 A;  4LMK A;  3AAE B;  1J5W A;  4YSZ A;  5AQQ B;  1UUS A;  3DTO A;  4NUU A;  3KIN B;  3QB5 K;  2X66 A;  3H37 A;  3PUA A;  4U33 A;  1UX4 A;  4JEU B;  2KND A;  4EAH A;  1CHU A;  4HWH A;  3C51 A;  4C91 A;  2E9X B;  3TLV A;  3ZN0 B;  3I9Y A;  3N9L A;  2XAQ B;  4ZI2 C;  1V9D A;  1T72 A;  3RYI E;  5AQS B;  3FB2 A;  4IE0 A;  4DR4 T;  2WP9 A;  2W62 A;  3E08 A;  5L4H A;  2W0G A;  3ANW B;  3NVO A;  4EOZ B;  3PJA A;  3ZMS B;  5FL1 A;  3AEA A;  3K3O A;  1SA0 E;  2R6G F;  1NWM X;  5DQW A;  4JI7 T;  4PW8 A;  1ZKE A;  3HKB E;  4YT0 A;  4UVB B;  5JDM A;  3JAD A;  1KNR A;  1WYC A;  2MTQ A;  2XQ9 A;  3QOF A;  2VAS A;  2WMN A;  3UQ7 A;  2YOE A;  4ZZB A;  4CZZ B;  4KUM B;  4DR7 T;  2WZI A;  2FJA A;  2M67 A;  4Z91 A;  3MXZ A;  3UFE A;  3C50 A;  2E9X A;  2LOS A;  3PDY A;  2BS2 A;  5FXW A;  1E2A A;  3ANW A;  1QSD A;  2KIN B;  2C0S A;  2XY8 B;  3OTO T;  3K3Q C;  4WZX A;  1KK7 A;  4YTM A;  4DR1 T;  1M7K A;  4HN9 A;  4KBM B;  4JI3 T;  4K0K T;  2HH7 A;  5LOV E;  2XAF B;  4ILU A;  5CGM A;  4CN1 A;  2WMO A;  4EXT A;  1SHZ C;  3JCF A;  4U3C A;  2X67 A;  3FXE B;  2V7I A;  4J2C A;  2UXB T;  4COF A;  2LOP A;  5F3J A;  4X64 T;  2SPC A;  4DVD A;  2LRK A;  1BR2 A;  4YTP A;  3KBU A;  1AJ3 A;  4YFS A;  5LMN T;  3AE3 A;  3IHR A;  3K8P C;  2WB5 A;  2L9Q A;  2D5U A;  2VKH A;  4HKA A;  1M62 A;  4PK4 A;  2YDQ A;  5L3B B;  2V6Y B;  2UXX B;  2J4G A;  5ABE A;  1MND A;  3AED A;  1DU2 A;  5FXV A;  4O4J E;  1MMD A;  4PJM A;  3BQK A;  4LFC T;  2VWA A;  1W09 A;  5FNV E;  2LRL A;  4HE8 A;  4EYY R;  5LG4 A;  4CN4 A;  3AVS A;  4GYR A;  5TAO A;  4WW0 A;  2BBH A;  2Y8D A;  4ZHQ E;  2FJD A;  4TV9 E;  4WYV A;  3R6N A;  4IDZ A;  2BDE A;  4ZI3 C;  2BG9 E;  4E7S A;  5KX5 E;  2D9D A;  3NWI A;  3FZM B;  4YJ3 E;  2CMR A;  5JDL A;  5H6Q B;  3K1S A;  3J7Y q;  2V6Y A;  2V7J A;  4UEM A;  4H9O C;  3JC6 C;  4ZZC A;  2YIN A;  4ZI2 D;  1D0X A;  4AKG A;  5LBM A;  2IIU A;  4PJL A;  3CWZ B;  1XMQ T;  5JH7 E;  3KV9 A;  2LLY A;  1YKH B;  2LSY A;  1XDO A;  2MPK A;  3ZYM A;  5HXC A;  2XJ7 A;  3AE6 A;  3LJC A;  1NEK A;  2E9X D;  3RIF A;  2LSI A;  3MZK B;  2WAU A;  4LF6 T;  4DUY T;  2AE9 A;  3NBX X;  3X1D A;  3ONX A;  5FP3 A;  1FMV A;  4B3S T;  3RLF F;  4K0U A;  2FUP A;  5LG3 A;  5ABF B;  1VCS A;  4DMV A;  3ONL C;  4B3R T;  5HYA A;  4DV5 T;  3HKE E;  3GMI A;  2IDO B;  2ACZ A;  2JQ9 A;  3A7M A;  2XSA A;  2K3W A;  3OBV E;  3O1J A;  3P4Q A;  1JNR A;  4IDO A;  3ABV A;  3ZEF B;  3EAM A;  5FVK A;  3DJB A;  3ZLI A;  3I0O A;  3Q5D A;  4N78 D;  3FZH B;  2XTL A;  1NEN A;  3NZQ A;  2FJE A;  2X9H A;  2KXP B;  3LK4 2;  5JVD E;  5AQM B;  2WZH A;  1G8X A;  1D0Z A;  2VKJ A;  5HAX A;  4ILA A;  3HL6 A;  4HFH A;  2AXD S;  2FJB A;  4B3M T;  2XQ8 A;  2CXL A;  5ABF A;  5ABH A;  5HXS A;  4DR6 T;  4ANJ A;  3AE4 A;  3RI5 A;  1O3X A;  3IF8 B;  3ZCJ A;  4O4H E;  4KI0 F;  4GK0 E;  3A5X A;  3F2E A;  2LSG A;  3DP7 A;  3F31 A;  1LVF A;  3N9Q A;  4JUY A;  5LGU B;  5LJN A;  4JI5 T;  4PJN A;  4TNV A;  2J62 A;  2BS4 A;  3ZJ2 A;  1WCR A;  1GQE A;  1KF6 A;  2NTX A;  4L0R A;  4U72 A;  2QA7 A;  4OYJ A;  3RPU A;  2KMF A;  1LRZ A;  1Y01 A;  2V26 A;  1L0V A;  3IBP A;  4UEL A;  2IC9 A;  5DAB A;  5J2T E;  1HG2 A;  3P8C D;  1UX5 A;  2DHR A;  4ZI3 D;  2CLY B;  4EZH A;  4KMC A;  4XBF B;  5JDH A;  1OED B;  1S35 A;  4AI6 A;  2JPF A;  2HPJ A;  3RYC E;  4PFP A;  4HFB A;  3AB3 B;  5AQF B;  2FBW A;  2F4V T;  4TWH A;  4JI8 T;  1UK5 A;  3O1I A;  2HPL A;  4JI4 T;  3N5L A;  4EGW A;  4LF7 T;  4KHZ F;  4CXY A;  3OKQ A;  2CPT A;  4GKJ T;  2CLY C;  4TWF A;  4LFB T;  3BK9 A;  3L39 A;  3Q9D A;  4I0U A;  3P7I A;  3AEC A;  4Q25 A;  4EEB A;  3TLT A;  2LHN A;  1XDP A;  4IRE A;  5EZY E;  2XPK A;  5CB4 E;  1HNZ T;  3I1A A;  4EYU A;  2NOX A;  2H3R A;  1OED A;  3UT5 E;  4AXP A;  3CVR A;  4EB6 E;  1JNZ A;  2A3D A;  2A72 A;  3PUQ A;  4KP3 C;  5L3D B;  4IE4 A;  4ZI7 E;  2VVN A;  2Z6E A;  1KNP A;  2X9X A;  4L9I A;  4JBW F;  5KDM C;  3E22 E;  4DO0 A;  4YSX A;  2YKS A;  5LMU T;  3ESL A;  3RQW A;  4CXW A;  2W2U A;  2CEA A;  2YDR A;  4B3T T;  2XQY A;  4HWD A;  5CA1 E;  3RIU C;  1KEY A;  3MK7 C;  5JTG A;  4H63 V;  4OFZ A;  4WNK A;  4ERR A;  2CWY A;  5ABG A;  4X65 T;  3MJX A;  4DND A;  2N2N A;  1HNW T;  3VKH A;  3LFM A;  1IBM T;  1N33 T;  4UXN B;  4FI5 A;  4LF8 T;  3PUY F;  5FY7 A;  2G0U A;  1H7C A;  2RPA A;  3K3N A;  1Z0P A;  1IJ6 A;  3PUR A;  4H9N C;  4UR9 A;  3L8R A;  4HWC A;  2VL0 A;  3PU3 A;  1ZP0 A;  1LKX A;  2C5K T;  5L3G B;  3ZC1 A;  2CRB A;  5AQI B;  4XAX B;  2ZM0 A;  3EUH A;  3SFD A;  3MA9 A;  1MMA A;  5AQV B;  5L3F B;  4IDN A;  3RC3 A;  5GON E;  5H6R B;  2LKH A;  5FXZ A;  2PBI A;  3MKD A;  2XAG B;  1IJ5 A;  1MMG A;  5L2L A;  4A5X A;  4EIW A;  5BR8 T;  4YSY A;  3AEG A;  4FJO A;  5AQG B;  2L3L A;  4EV6 A;  4M1P A;  4X1I E;  4LF4 T;  4JYA T;  4DR5 T;  4IE6 A;  4F8H A;  3CQG B;  5BMV E;  3CIR A;  4EED A;  1HR0 T;  2E2A A;  4QXH B;  3B57 A;  4YLH A;  3UFG A;  4JI6 T;  3RC8 A;  3NRX A;  3CK6 A;  1IZN B;  1OWA A;  5FKY A;  2V1D B;  2CE7 A;  4F6R C;  3NRY A;  2W4X A;  1VOM A;  2M6I A;  4IL4 A;  1HNX T;  3T8O A;  4G2A A;  3RH3 A;  3PUX F;  3OPC A;  4WBN E;  4QHO A;  1XMO T;  3VRA A;  2X0H A;  3QK6 A;  1WR6 A;  3N2O A;  4BA9 A;  2UXD T;  4IDP A;  2UXC T;  2GK9 A;  5FY1 A;  3ZJ1 A;  4U2Y A;  5LHI B;  4QH1 A;  2CCQ A;  3LDQ B;  4ISS A;  3HA4 A;  3UU3 A;  4OHF A;  1XNQ T;  5KMG P;  1XWM A;  4X1K E;  3ZMU B;  3AXJ B;  3P4S A;  5LCY A;  1WLX A;  2XM2 A;  3RX6 A;  4DV2 T;  4PNI A;  2YN6 A;  3UUX B;  4AKL A;  3BQI A;  2VKD A;  4DBR A;  3P4R A;  3C64 A;  3ZT7 A;  3AA6 B;  3O1H A;  5CA0 E;  3ONJ A;  2IHR 1;  3LG7 A;  4ILB A;  2DWG A;  2CWO A;  3RKG A;  3Q5W A;  4H9S E;  1W0A A;  4U31 A;  2ZM8 A;  2DI4 A;  4H9R C;  2BS3 A;  3U78 A;  3WAK A;  1OED E;  1HG5 A;  3CML A;  5HWY A;  2CBJ A;  1W0B A;  3CX7 B;  1B7T A;  5L4E A;  3RHW A;  3FBL A;  3C4X A;  1MNE A;  4U2Z A;  4MBQ A;  3AE5 A;  5JDG A;  5LGT B;  4GK5 E;  1IAP A;  2X68 A;  2N9D A;  3LK2 B;  2DLR A;  2Q9Q B;  3AXJ A;  1ZHC A;  4CI1 B;  2W67 A;  4IIJ E;  3AAI A;  1VCT A;  4A98 A;  2VUR A;  1EZ3 A;  2QYW A;  4YY3 T;  2C5I T;  2D2S A;  5IYZ E;  4P0A A;  4TWD A;  4IGU A;  2K48 A;  2V5D A;  5LXT E;  2UUA T;  2DNX A;  2CM0 A;  3PE0 A;  4QKN A;  5AQL B;  2Q9Q C;  4WBO A;  2WS3 A;  3EAB A;  4AIU A;  4B6X A;  3PUV F;  4AKR B;  1D1A A;  2KT9 A;  3AEE A;  2L8K A;  1MIY A;  2XQA A;  2WU5 A;  1CUN A;  2VKO A;  1KNZ A;  4HGA A;  2JQQ A;  4TZ4 C;  2W61 A;  3QNU A;  1R8I A;  2ZMA A;  4E7Z A;  3ETV A;  4GKK T;  2CBI A;  2Q9Q A;  2I0M A;  3UU8 A;  4QXC B;  3H3M A;  2DL1 A;  3ETU A;  4HFE A;  3KVB A;  3UUN A;  4TUY E;  4HWI B;  3N2K E;  1OXZ A;  3C4W A;  5LNK A;  3JAE A;  5IWA T;  4OX9 T;  3HI2 A;  2V7L A;  3W15 B;  4ZS2 A;  4O2B E;  2XZE A;  4GYS A;  4QXB B;  2XHE B;  2XAS B;  2JMK A;  4HEA A;  5AQN B;  1YD8 G;  3VR9 A;  2B76 A;  2LM9 A;  2OV9 A;  3FXD B;  1XNR T;  2JJ9 A;  3CKD A;  5C3J A;  3IEE A;  4DV0 T;  2BKP A;  2XQ6 A;  2H88 A;  2X0L B;  4ZOL E;  1YQ3 A;  2PFV A;  4L5G A;  1HFA A;  4LML A;  5ADX L;  5AQO B;  3PU8 A;  3UUM A;  4QH4 A;  2NTY A;  3ZYL A;  4AKH A;  2I59 A;  5AQJ B;  2N1G A;  2KSR A;  4V1A v;  2VK9 A;  3CPZ A;  4IST A;  2DCF A;  3FBZ A;  2BVL A;  3RQU A;  5FYM A;  3RGL A;  1WR0 A;  4MFR A;  4UVA B;  2MBG A;  3UU4 A;  2LSK A;  3ZMT B;  1WFD A;  3PV0 F;  4X62 T;  3SRZ A;  1FMW A;  1D0Y A;  5EK4 A;  1HX1 B;  2HHH T;  3HR0 A;  3U3I A;  3J9X 1;  3AA0 B;  3MAC A;  3VU7 H;  3CX6 B;  2KWH A;  2LHR A;  3VR8 A;  3CX8 B;  1BR0 A;  1YW0 A;  3Q5X A;  2VQE T;  2IAK A;  2E5V A;  2CXD A;  3TLW A;  3ZYK A;  4JI1 T;  1NAF A;  4X20 E;  4ASK A;  3JC6 D;  3OVU A;  2PTF A;  4I4T E;  1J5E T;  2BG9 B;  3N9O A;  2QRX A;  2CA5 A;  2XQ5 A;  4DV3 T;  4IE5 A;  3GWH A;  2NP9 A;  2WDQ A;  2X51 A;  1E7P A;  2K5B B;  2V7M A;  1N32 T;  3AE9 A;  4I50 E;  2DWK A;  4CQI A;  3ZT5 A;  3FZL B;  4TNW A;  5KXJ A;  4X5T A;  3GN5 B;  3Q2M A;  5J1G A;  4QX7 B;  2BG9 C;  5CFB A;  5JQG E;  3AEB A;  1U5P A;  2HN2 A;  4YHJ A;  2Q9Q D;  3UQ4 A;  3LSV A;  4TV8 E;  4UVC B;  4IHJ E;  5JDF A;  1D1B A;  3EVY A;  3FZF B;  2BG9 A;  2ODU A;  4ZXL A;  1BR4 A;  3T1Y T;  3VHL A;  3AAA B;  2VQF T;  5AQK B;  4QH5 A;  5HXR A;  4UF0 B;  2C5J A;  4JLE A;  4HWF A;  2A9U A;  4GOU A;  5EK3 A;  4EZ4 A;  3GN5 A;  2KWI B;  2WY2 A;  3R84 B;  1W9R A;  2WU2 A;  4IL9 A;  1LVK A;  4NXN T;  1HF8 A;  3A8Y C;  4IE7 A;  5HCJ A;  4UIG A;  2ZM2 A;  5LHG B;  1FJG T;  2BZB A;  3RIU A;  4BAY B;  4DV7 T;  3HKD E;  2V7K A;  2D0U A;  2Y48 B;  4IT4 A;  2JRK A;  4YTN A;  1T8B A;  3ZMV B;  5AQP B;  1KFY A;  2W00 A;  5C2T A; 
#chains in the Genus database with same CATH homology
 1G73 A;  3F57 A;  3UUX B;  3BQI A;  4AKL A;  2RA1 A;  2VKD A;  3LBX A;  4DBR A;  3ZEF B;  2MYS A;  5JRE A;  2E9X C;  2NW8 A;  3DJB A;  2WBL A;  3C64 A;  4P0B A;  3I0O A;  2VL8 A;  3ZLI A;  3AA6 B;  3O1H A;  4N78 D;  5CA0 E;  2XTL A;  3LG7 A;  2DWG A;  3SWH A;  4C90 A;  2CWO A;  5A1L A;  3RKO A;  3NZQ A;  2X9H A;  1WYB A;  4UF0 A;  3Q5W A;  2KXP B;  2YK0 A;  4H9S E;  4X1Y E;  4I43 B;  3LK4 2;  1QUU A;  1HCI A;  5M4Y A;  5JVD E;  3AA7 B;  2ZM8 A;  3SOL A;  2DI4 A;  4H9R C;  1G8X A;  4O2A E;  1D0Z A;  3U78 A;  5JR9 B;  2VKJ A;  5F8P A;  1X79 A;  5HAX A;  3WAK A;  1HG5 A;  3HL6 A;  5LA6 E;  4PFO A;  3CML A;  5HWY A;  3CX7 B;  3FHN A;  1B7T A;  5JRC A;  3EDU A;  1ZV4 X;  5LJM A;  3KBT A;  3FBL A;  3C4X A;  2CXL A;  2NW7 A;  3N9P A;  1MNE A;  5HXS A;  2J1D G;  3S4U A;  4MBQ A;  4BJN A;  2ES0 A;  4O4I E;  5JDG A;  1UCU A;  4JEH B;  4A56 A;  4ANJ A;  5LGT B;  4GK5 E;  2B1E A;  1IAP A;  4PK6 A;  2X68 A;  3SS1 A;  2N9D A;  1O3X A;  3LK2 B;  2LSJ A;  2DLR A;  2H7O A;  3IF8 B;  2Q9Q B;  3KFW X;  2K9A A;  3ZCJ A;  5HWX A;  4O4H E;  1ZHC A;  4CI1 B;  5LHH B;  3V5U A;  4GK0 E;  3A5X A;  2E8I A;  4IIJ E;  3OYX A;  3AAI A;  3F2E A;  3QUJ A;  3KV6 A;  4HFV A;  4CI2 B;  2LSG A;  4YJ2 E;  3DP7 A;  1HTJ F;  3F31 A;  4MAL A;  1LVF A;  5JR9 C;  3N9Q A;  4AQG A;  3I9W A;  4JUY A;  2XAH B;  1EZ3 A;  2IC6 A;  2Y6X A;  5ETW A;  3WI3 A;  5LGU B;  2C5I T;  2D2S A;  5LJN A;  5IYZ E;  4PJN A;  4P0A A;  3I0Q A;  3QC9 A;  3NZP A;  2UXN B;  3ZJ2 A;  4PJJ A;  3AAE B;  4IGU A;  2EHO B;  2K48 A;  3DTO A;  2KLQ A;  5LXT E;  4NUU A;  3KIN B;  2DNX A;  2JMH A;  4OYK A;  2CM0 A;  2X66 A;  5IHY A;  3OYZ A;  3CQC B;  3H37 A;  3PUA A;  4QWN B;  2XAJ B;  1UX4 A;  2NTX A;  3PE0 A;  4JEU B;  4L0R A;  3LK3 B;  2KND A;  4EAH A;  4QKN A;  4U72 A;  2QA7 A;  2YU1 A;  4OYJ A;  2Q9Q C;  2KMF A;  5JR9 A;  3RPU A;  4WBO A;  3C51 A;  4C91 A;  1BR1 A;  5HXH A;  1LRZ A;  5FMN A;  2E9X B;  3ZN0 B;  3I9Y A;  2V26 A;  3L09 A;  3N9L A;  2XAQ B;  4ZI2 C;  1V9D A;  1Y64 B;  3RYI E;  2X9Y A;  3IBP A;  4B6X A;  4UEL A;  3FB2 A;  4IE0 A;  4AKR B;  2CXF A;  2YEV C;  1D1A A;  2KT9 A;  2QGS A;  3CQX C;  2L8K A;  1MIY A;  2IC9 A;  4O4L E;  2W62 A;  3HKC E;  1CUN A;  2VKO A;  3E08 A;  2W0G A;  4HGA A;  5DAB A;  2JQQ A;  3ANW B;  4TZ4 C;  1KNZ A;  2W61 A;  2LT3 A;  4DMW A;  2LJL A;  5J2T E;  2EHO C;  4EOZ B;  1HG2 A;  3P8C D;  2ZMA A;  3ZMS B;  4E7Z A;  1UX5 A;  3ETV A;  2DHR A;  4XZC A;  2Q9Q A;  4ZI3 D;  2CLY B;  3K3O A;  3AVR A;  1S94 A;  3RYF E;  1SA0 E;  4KMC A;  4EZH A;  4XBF B;  1NWM X;  4QXC B;  4MHC A;  4O8S A;  5DQW A;  3ETU A;  4PW8 A;  4AQF C;  5JDH A;  1S35 A;  1ZKE A;  5LP6 E;  3HKB E;  4AI6 A;  2JPF A;  5E0O A;  4UVB B;  1YKE B;  5JDM A;  2HPJ A;  3KVB A;  3UUN A;  3RYC E;  1WYC A;  3N9N A;  4TUY E;  4PFP A;  2W63 A;  3AB3 B;  2MTQ A;  3N2K E;  2EHO A;  1US7 B;  2VAS A;  1OXZ A;  3C4W A;  2WMN A;  5LNK A;  3KVA A;  3O1I A;  2HPL A;  3N5L A;  4G63 A;  4CZZ B;  5AFU L;  3D0T A;  4KUM B;  1MIV A;  3HI2 A;  2V7L A;  3W15 B;  2M67 A;  4CXY A;  4ZS2 A;  4AQF A;  3OKQ A;  2WSS V;  1U4Q A;  2CLY C;  3MXZ A;  3UFE A;  2WM9 A;  3O9X A;  3C50 A;  2E9X A;  3BK9 A;  2LOS A;  4O2B E;  2WWU A;  3ZCI A;  4GYS A;  4QXB B;  2XHE B;  4UV8 B;  3UTK A;  2XAS B;  4H9P C;  3PDY A;  3Q9D A;  2JMK A;  4HEA A;  5HXE A;  2X9W A;  4TN7 B;  1YD8 G;  3P7I A;  4H9Q C;  2A2F X;  5FXW A;  2LM9 A;  3ANW A;  1QSD A;  2KIN B;  2C0S A;  3K3Q C;  4PAG A;  1KK7 A;  3PTR B;  3FXD B;  1MIW A;  2LHN A;  2JJ9 A;  3CKD A;  3IEE A;  3ZMZ B;  5EZY E;  4CXX A;  4HN9 A;  2X0L B;  5CB4 E;  4ZOL E;  3ZC0 A;  2PFV A;  3I1A A;  4EYU A;  4KBM B;  2NOX A;  4L5G A;  1HFA A;  2H3R A;  2HH7 A;  2ZLY A;  5LOV E;  5FXX A;  2XAF B;  4ILU A;  2NW9 A;  3UT5 E;  5ADX L;  4AXP A;  3CVR A;  2PJQ A;  3BQL A;  3PU8 A;  2WMO A;  3UUM A;  4EXT A;  4EB6 E;  1SHZ C;  4QX8 B;  2A3D A;  2A72 A;  3PUQ A;  4KP3 C;  5L3D B;  4IE4 A;  3AA1 B;  2NTY A;  3L3P A;  3ZYL A;  4ZI7 E;  4AKH A;  4DBQ A;  2X67 A;  2Z6E A;  2I59 A;  2V7I A;  3FXE B;  2X9X A;  4L9I A;  3KDS E;  2N1G A;  4J2C A;  3RYH E;  4V1A v;  5KDM C;  5L3C B;  3E22 E;  2P9B A;  4DO0 A;  2LOP A;  5F3J A;  2VK9 A;  3CPZ A;  3ESL A;  4IST A;  2DCF A;  3FBZ A;  2BVL A;  2ACX A;  5FYM A;  4BJM A;  3ZN1 B;  4CXW A;  4MFR A;  2SPC A;  2CEA A;  4DVD A;  4UVA B;  2MBG A;  2LSK A;  3N2G E;  1BR2 A;  2XQY A;  3KBU A;  5CA1 E;  2LE8 A;  1AJ3 A;  1FEW A;  3MK7 C;  4YFS A;  3ZMT B;  3IHR A;  4H63 V;  4OFZ A;  4WNK A;  3RRC A;  4UV9 B;  2CWY A;  3K8P C;  4ERR A;  3MJX A;  2L9Q A;  2D5U A;  4MLK A;  4DND A;  3SRZ A;  1FMW A;  2N2N A;  4NUV A;  3M65 A;  2VKH A;  4HKA A;  1D0Y A;  5EK4 A;  3VKH A;  1ZEE A;  3LFM A;  3HR0 A;  3U3I A;  4PK4 A;  3J9X 1;  3AA0 B;  3MAC A;  5L3B B;  2UXX B;  3VU7 H;  4UXN B;  1MND A;  3CX6 B;  4FI5 A;  2KWH A;  5JDN A;  2LHR A;  5FXV A;  3CX8 B;  5FY7 A;  1BR0 A;  2G0U A;  1H7C A;  1YW0 A;  3K3N A;  5DJQ C;  1Z0P A;  1IJ6 A;  3KV4 A;  3Q5X A;  2IAK A;  4P09 A;  4PK5 A;  2CXD A;  3PUR A;  4O4J E;  1MMD A;  4PJM A;  2PG8 A;  4H9N C;  3BQK A;  3ZYK A;  3RRW A;  5LYJ E;  1NAF A;  2KZ7 B;  2IW5 B;  4X20 E;  3PU3 A;  4ASK A;  3JC6 D;  2VWA A;  5EK2 A;  2K24 A;  2BVM A;  1LKX A;  1T98 A;  2C5K T;  4I4T E;  5L3G B;  5LBQ B;  3ZC1 A;  1D1C A;  2OA5 A;  3VKG A;  4XAX B;  3N9O A;  5C8Y E;  2CA5 A;  5FNV E;  2ZM0 A;  4HE8 A;  4IE5 A;  4EYY R;  3EUH A;  5LG4 A;  2XUE A;  3GWH A;  5L3E B;  5FY0 A;  3KV5 A;  2NP9 A;  3AVS A;  4HTE A;  2X51 A;  4GYR A;  5TAO A;  4WW0 A;  3MA9 A;  2Y8D A;  1MMA A;  2MOZ A;  2K5B B;  3RC3 A;  5L3F B;  4ZHQ E;  2V7M A;  4TV9 E;  3B13 A;  4I50 E;  5GON E;  3R6N A;  5H6R B;  2DWK A;  4IDZ A;  4CQI A;  5FXZ A;  2BDE A;  2PBI A;  3UUL A;  4ZI3 C;  3MKD A;  2XAG B;  1IJ5 A;  2YU2 A;  4E7S A;  3O4X E;  1MMG A;  5KX5 E;  3GN5 B;  5L2L A;  4EIW A;  3Q2M A;  5J1G A;  2H7V C;  4YJ3 E;  4TX5 A;  2CMR A;  4FJO A;  4QX7 B;  5H6Q B;  5JDL A;  5DQV A;  3WAJ A;  3J7Y q;  3E0Z A;  1WRD A;  5JQG E;  2L3L A;  4AKI A;  4H63 H;  1U5P A;  4M1P A;  1HS7 A;  4X1I E;  4YHJ A;  2V7J A;  4UEM A;  4H9O C;  3JC6 C;  2Q9Q D;  4GIW A;  4Z8X A;  4IE6 A;  2YIN A;  4TV8 E;  4ZI2 D;  4UVC B;  3CQG B;  1D0X A;  5BMV E;  4QXH B;  4AKG A;  5LBM A;  2NWB A;  3B57 A;  4IHJ E;  5JDF A;  2D0T A;  4PJL A;  1D1B A;  3CWZ B;  3EVY A;  4YLH A;  5JH7 E;  3KV9 A;  1YKH B;  2LSY A;  2ODU A;  2RP4 A;  2EHO D;  3LBX B;  1BR4 A;  3NRX A;  3RC8 A;  1IZN B;  3VHL A;  3AAA B;  1MMN A;  1OWA A;  2V1D B;  3EDV A;  3PUS A;  2CE7 A;  4ZS3 A;  3NRY A;  3GA8 A;  4F6R C;  3ZYM A;  4ADZ A;  5HXC A;  1VOM A;  4I55 E;  4U74 A;  5HXR A;  3LJC A;  4CI3 B;  4OK0 A;  4UF0 B;  4G2A A;  3T8O A;  2C5J A;  3ZPO A;  3RH3 A;  3C98 B;  4JLE A;  2E9X D;  4WBN E;  4QHO A;  3PUG A;  2LSI A;  3MZK B;  2WAU A;  4GOU A;  3QK6 A;  1WR6 A;  3N2O A;  4BA9 A;  5J2U E;  5EK3 A;  4EZ4 A;  3TKL B;  3GN5 A;  2ODV A;  3NBX X;  2GK9 A;  2KWI B;  3R84 B;  3N9M A;  1E1H B;  3ONX A;  1VRB A;  5FY1 A;  3ZJ1 A;  5FP3 A;  1FMV A;  5LHI B;  1LVK A;  5JRC B;  2VB6 A;  2CCQ A;  1HF8 A;  4K0U A;  4IE7 A;  1HX8 A;  4ISS A;  3HA4 A;  4UIG A;  2ZM2 A;  2LEH A;  5LHG B;  5JDQ A;  4DMV A;  2BZB A;  1FIO A;  4OHF A;  5HYA A;  3H3A A;  3HKE E;  3C4Z A;  4BAY B;  3OJA A;  3GMI A;  3HKD E;  2V7K A;  2D0U A;  5KMG P;  2Y48 B;  2JRK A;  4X1K E;  5LGN B;  3OBV E;  3ZMV B;  3V5S A;  3ZMU B;  2W00 A;  3O1J A;  5LCY A;  1WLX A;  3RX6 A;  4PNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...