1YKEB

Structure of the mediator med7/med21 subcomplex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
119
Chain Sequence
DRLTQLQICLDQMTEQFCATLNYIDKNHGFERLTVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLLRHVDSLIEDFVDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II mediator complex protein MED7
publication title A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 44
structure length 119
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11221 Med21 Subunit 21 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.470 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1ykeB00
1YKEB 1YKHB
chains in the Genus database with same CATH superfamily
1SUMB 4PW8A 3ZYKA 3LK3B 3QB5A 4AKGA 4IL4A 2LKHA 4XBFB 2HH7A 5JTGA 3PUYF 1W0AA 2YU1A 5FKYA 2KSRA 2QYWA 5HWXA 2UXXB 4JI0T 2BKOA 1NAFA 3LK42 1MNEA 5LB7B 4ILCA 1X9BA 3ESLA 2Q9QC 5CA0E 1MMNA 4PFOA 4HFCA 2XM2A 2CRBA 3P4SA 3RYFE 1IAPA 2PG8A 4NXMT 2E9XA 4IE5A 4ZI2D 3EVYA 2E2AA 4IDZA 3L39A 3AE8A 5LMNT 4B6XA 2ACXA 4JBWF 3KBUA 5ABGA 2D9DA 4TZ4C 3UTKA 4QX7B 1HF8A 3UU4A 2H3RA 4UEMA 2LEHA 1HG2A 1B7TA 1OEDE 4DV5T 4NUVA 4XAXB 3MACA 1R8IA 4MFRA 2WDQA 3FZHB 4EIWA 2LRLA 5FL1A 1XDPA 3BK9A 4HWFA 5JVDE 2LHNA 4YXDA 3K3NA 1D0YA 1VCSA 4H63V 2ACZA 2CE7A 5FY7A 4HN9A 5LNKA 1ZP0A 5HXSA 4L9IA 3B13A 2V6YB 5AQUB 2FJAA 3V5UA 4DR3T 3PV0F 3EAMA 3P4WA 4LFAT 2WU5A 2W2UA 5HXHA 3PJAA 5H6RB 5DQWA 5HEJA 2NP9A 4NUUA 3MXZA 4O4IE 3J9X1 3VRAA 1HX1B 3RQWA 2K3WA 4CXYA 4KMCA 5AQNB 2C5JA 4PJLA 4GYSA 5FY1A 2J4GA 4H9NC 4HWIB 5ABFA 3P50A 2Y8DA 2YN6A 2RP4A 3NZQA 4PK4A 4ZHQE 2KMFA 2XQ5A 2MTQA 2CLYC 4FI5A 4DUZT 1UUSA 2CWYA 1HG5A 1UX4A 4U31A 2DCFA 4Z8XA 2C0SA 5HWYA 5JDHA 1VRBA 4QH1A 2HN1A 2LM9A 3D0TA 4UELA 4E7SA 4JEUB 4H9RC 3T8OA 1XDOA 4IGUA 1D0XA 3VRBA 5KX5E 3N5LA 5JH7E 5M4YA 4AIUA 4KX6A 5HXEA 2A9UA 2XQAA 2V6XA 1T8BA 4QXCB 5LXTE 2UUBT 5LGTB 4HFDA 1HS7A 5EZYE 4TN7B 2XM1A 5LG3A 1VOMA 3OYXA 1AJ3A 4F8HA 3ZC1A 4P09A 3RI5A 4TWDA 4E7ZA 4JEHB 3OKQA 5AQOB 5AQTB 3ZEFB 4ZZBA 3NBXX 2VVSA 3ZT7A 4TV9E 2ZMAA 2E8IA 2CHNA 2BS4A 2JJ9A 4MALA 2XQ7A 5HXCA 4JI4T 5JRCA 2Z6EA 4YSZA 5HXRA 4ILAA 3PUAA 2NTYA 5ABEA 3FZKB 1DU2A 3KVBA 3I0OA 3ZLIA 5L2LA 2ES0A 5L4EA 4DBRA 4ZI2C 5CJ5A 4GKKT 2PTFA 2IDOB 3QOFA 2KLQA 3CVRA 2NW9A 5FP3A 4JI6T 5JR9C 5DQVA 5AQVB 2YDQA 1UK5A 4LMJA 4PJNA 3CKDA 4GKJT 3CX7B 5HCMA 4CXXA 5AQGB 3NVOA 1MNDA 5AQQB 3E08A 4A98A 1NWMX 4AKHA 1H7CA 1KFYA 2LE8A 3C4ZA 2PFVA 1I6ZA 4DV2T 1OEDB 1W9RA 4P0BA 3MJXA 4X1KE 4ZS2A 2VASA 2MOZA 4MHCA 1NEKA 5E0OA 3ZMZB 4LF9T 2LM2A 3PUZF 4EZHA 2XQYA 3AVRA 3SS1A 3JAFA 3UFGA 5LBQB 3RQUA 2V7KA 4ZI3D 2X0HA 5HCJA 3Q5WA 3BQIA 4I0UA 4A97A 1UX5A 5JDLA 4XZCA 1WCRA 1ZEEA 4EYYR 4OYJA 5LHHB 2YDRA 4G63A 2VQFT 1YXRA 3IF8B 4UV8B 4GOUA 3UT5E 2IUBA 3AAIA 3ONXA 5CB4E 5CA1E 3IBPA 3RIFA 2BDEA 2WU2A 3OTOT 1US7B 4U72A 2V26A 3O4XE 1IJ5A 3AA6B 4CI2B 5CGMA 1BR2A 2WY2A 3C4WA 1OXZA 1S35A 3GMIA 4AKLA 2VQET 2WZIA 5A1LA 4DBQA 3M3ZB 4TWFA 5KMGP 2XQ4A 4CZZB 2Q9QA 4ANJA 5IYZE 2WWVA 2IMLA 3KINB 4U33A 3LBXB 2FJEA 3GN5A 1XNQT 2XSBA 1YKEB 4IE6A 4DV0T 3RIUC 3QNUA 4HKAA 2CBJA 3TLSA 2IC9A 3ABVA 4WBNE 4ILUA 3I1AA 1FIOA 2AE9A 2VURA 2P9BA 4IE0A 2L8KA 4GYRA 3N9OA 4YLHA 5LHGB 4COFA 2YDSA 2QA7A 4X64T 5AQHB 3HKEE 4L5GA 2KNDA 2X67A 5FNVE 2VKDA 4EEBA 3C64A 3IA3A 3LDQB 3AECA 5FVKA 3RYIE 3X1DA 1HNWT 5EK3A 5AQPB 4DV6T 2JIWA 3RRWA 2LOSA 4TV8E 5IUXA 3AXJB 4QXBB 1Z0PA 4K0KT 3KV5A 4DR7T 4PAGA 3RPUA 3OJAA 3N9LA 2LHRA 4LFBT 2BG9A 1XMQT 4U2ZA 4PJJA 4IDQA 2H89A 3AEAA 4O2BE 4PK6A 2N2NA 4IL9A 2X9XA 3IHRA 3VKHA 5IWAT 1N36T 3ZJ2A 4U3CA 2W63A 4YSXA 3K3OA 4Z91A 2L9QA 2HPLA 4MBQA 1O3XA 4PNIA 3Q5XA 4BAYB 3L09A 3ZT5A 4DUYT 4BJMA 2RPAA 1UGOA 3UUNA 3FBZA 4LF4T 2N1GA 4H9QC 3I0QA 3RGLA 2XQ9A 1Z8UA 4YJ3E 5AQRB 2LSGA 1XZYA 2ODUA 1Y01A 4DV7T 5HEUA 3I9YA 3KFWX 2CCQA 2DWKA 1HNZT 2WSSV 3ZYMA 4KP3C 3PUVF 5TAOA 2XY8B 3AAEB 2VVNA 2A72A 5LBMA 2UU9T 1T98A 3ETVA 5DJQC 2YEVC 3ZYLA 1I94T 1LVKA 3ANWB 5BMVE 1N33T 3P4RA 4PK5A 4WBOA 4O4LE 4HWHA 1UCUA 3KBTA 2LSKA 2WMNA 3UU6A 5LP6E 4HGAA 4HEAA 3GWHA 4I4TE 4DV4T 5FXXA 1ZV4X 2CXLA 4KBMB 1MIVA 3LK2B 3HKBE 2BG9C 4UVBB 2K48A 2C5IT 4N78D 4ASKA 4JI1T 4HFHA 3PE0A 2I0MA 3ONLC 5JDQA 2VL0A 3AVSA 4CXWA 2UXBT 1LVFA 4B3TT 2PBIA 4HFEA 3UU5A 4U7YA 4IREA 3N9PA 3A5XA 4O8SA 2LLYA 3CX6B 1OEDC 2XSAA 4CN6A 3KV6A 4I43B 3EDUA 5LGUB 4O4HE 3FHNA 1QSDA 5JR9A 3E22E 2XAFB 2M6IA 2RA1A 4AKIA 2XQ3A 2W66A 4ZI7E 4JV5T 3K8PC 2VK9A 3R6NA 2EHOC 1E2AA 2XAJB 3SOLA 2ODVA 1MMDA 2CBIA 5J2TE 3AE1A 3NKZA 3RLFF 5FL0A 3CQCB 3DTOA 2NW7A 3RF1A 3O9XA 3ZT6A 2QVAA 1LKXA 3ZMSB 4EZ4A 5JDFA 5LCYA 5JDMA 4IDOA 1JNRA 3Q9DA 3F31A 3VHLA 1KK7A 4IIJE 3JCFA 1FJGT 4M1PA 3K3QC 3PUQA 4BA9A 2B1EA 2HN2A 5C8YE 4UV9B 4YSYA 5LA6E 2Y48B 3AE9A 4P0AA 2D0UA 2WQYA 2I6HA 3Q5DA 3UU8A 2FUPA 1D1CA 1FMWA 3ZKRA 2WM9A 1M7KA 3WAKA 2M67A 2WB5A 4KI0F 2BS2A 3ZCJA 3AE5A 2CPTA 4O2AE 4L0RA 4DV3T 4JI2T 2IIUA 4A5XA 2K5BB 5EK2A 2VKOA 1GQEA 3JC6D 4YHJA 4OX9T 2LRKA 4EAHA 4IE4A 2CEAA 3HR0A 2X9YA 3PURA 4J2CA 1G8XA 3T1HT 1N32T 3RYHE 2WDRA 4DV1T 4QHOA 3MK7C 1W0BA 4GIWA 4ZOLE 2NOXA 3VU7H 3O1IA 2GK9A 2UXCT 3B57A 4HFVA 4WYVA 5J2UE 4ZXLA 2IHR1 2VWAA 1SE7A 4H63H 2R6GF 2X66A 1T7SA 3C50A 3UQ7A 2VKJA 3HI2A 2XZEA 4IDNA 2E9XB 3AE2A 3RIUA 4DR5T 3L8RA 5IHYA 5ETWA 4JI8T 4WW0A 4ZS3A 2V5DA 2YU2A 2YKSA 2WCAA 4QH5A 5JDGA 3WAJA 2JPFA 2CLYB 4YTMA 4QXHB 2XASB 2V6YA 1HX8A 2I59A 5LJNA 4DNDA 4BJNA 1MIWA 1YQ3A 3QC9A 4LF6T 2LJLA 2IC6A 2V1DB 1MMGA 5J0ZA 2XPKA 2D5UA 1WYCA 5L3DB 3GA8A 2LSYA 4EGWA 2NR4A 2CA5A 4B3ST 1KNPA 2HPJA 3AE6A 4AQYT 2NW8A 5AQJB 1N34T 3UULA 1HCIA 2B76A 4NPPA 3DP7A 4HE8A 4OFZA 4UXNB 2J1DG 5KXJA 4DVDA 4EV6A 3ZMTB 2MBGA 1JNZA 2FJDA 5AQIB 2W00A 3G06A 2LSIA 5LG4A 2V5CA 4QH4A 4CN1A 4JI3T 3AEBA 2W4XA 3TLTA 3OPCA 2X0YA 2L3LA 2D0TA 3H3MA 3AE7A 3AEEA 1HFAA 3N9MA 3QB5K 3FB2A 2CXDA 2W67A 3CK6A 2BBHA 5AQMB 2E9XD 1QUUA 3L3PA 1KEYA 5HEOA 5ABFB 2X0LB 2BVLA 3RC8A 2ZM6T 4YTNA 4DO0A 1KNZA 3NWIA 3ZMVB 4UVCB 3CQGB 3OYZA 1W09A 2V8SV 3RYCE 3CX8B 3PUWF 3KV9A 4X1IE 2BBJA 3CQXC 2DL1A 2WDVA 2HHHT 3ZC0A 3MA9A 2LOPA 3U3IA 4ZEYA 3CWZB 4IT4A 4DR6T 4P1NA 1WRDA 2XUEA 4JLEA 2JQKA 2BS3A 5L47A 4IHJE 4TWHA 1XNRT 3R84B 2OLTA 3N9NA 3RHWA 5DABA 1YD8G 4X5TA 5AQLB 3NZPA 2CHOA 2J47A 3TLUA 3AE4A 2CM0A 2JRKA 2UXNB 1WYBA 2MAWA 3RKOA 5KDMC 3F2EA 4IDPA 4MLKA 4DMWA 1KNRA 3VKGA 1S94A 1BR4A 4WZXA 2JQHA 4X65T 1OEDA 5JRCB 5HAXA 4EXTA 1WR6A 1M62A 2ZM0A 4U2YA 3AEGA 4AXPA 2K9AA 3KDSE 1U5PA 3P7IA 2QGSA 4TNVA 3RKGA 2XAQB 3JADA 4HWDA 4Z90A 1NENA 5F3JA 4F6RC 3H3AA 3FXEB 4TNWA 4TX5A 3SFEA 3N9QA 3RX6A 5L3EB 5BR8T 4ZI3C 5J1GA 2BG9E 1CUNA 2JMHA 1D1BA 3LFMA 2EHOA 2JMKA 3UUXB 4ADZA 2G0UA 3A8YC 4K0UA 4LF7T 3S4UA 2DHRA 3DJBA 4DMVA 3B5MA 3IEEA 1IBLT 1BR0A 1WR0A 2BKNA 4HFBA 3AA7B 5JQGE 4YFSA 3SFDA 4AQFC 2KWHA 3CPZA 3HA4A 4DIDB 4FJOA 3N2OA 3PDYA 3K1SA 3TLVA 4LMKA 2UUCT 1CHUA 4PJMA 4ISTA 4X62T 2IAKA 1IJ6A 5L3BB 1FEWA 1L0VA 1YKHB 3EUHA 2NWBA 2PJQA 2YK0A 2NTXA 3QK6A 1IZNB 3V5SA 4EOZB 3NRYA 3P4QA 5AFUL 3AAAB 3OVUA 4YT0A 3T1YT 2WZHA 5AQFB 3LBXA 2H7OA 3RH3A 3C51A 2IW5B 3FXDB 1FMVA 1HTJF 2E9XC 3FZFB 4I55E 5LYJE 2LT3A 3VR8A 1T72A 2BZBA 5JDNA 2FBWA 4GK0E 4UVAB 2H88A 2J62A 2XTLA 5LJMA 2X68A 5LHIB 5L3CB 3MZKB 2WAUA 3FBLA 3LJCA 5C3JA 5JREA 3O1HA 2E5VA 4OK0A 3FZMB 4LMLA 3RRCA 1IBMT 3EHZA 1SHZC 2JQ9A 2AXDS 2XQ8A 2N9DA 3PJAJ 1HNXT 3RIAA 4UF0A 4V1Av 5ABHA 2Q9QB 2KXPB 4I50E 1IBKT 1YQ4A 5FXZA 5FMNA 5C2TA 3UU3A 2MPKA 2WWUA 3GN5B 4NIQA 4OHFA 3ZN1B 2XAGB 3UUMA 4X66T 3AXJA 4JI7T 4YHHT 2UXDT 2DLRA 1MMAA 2A2FX 4ISSA 2KZ7B 1ZKEA 4QWNB 1J5ET 4C90A 5HEHA 3AEDA 4CN4A 2VL8A 5FVLA 4C91A 4DR4T 2CXFA 1XWMA 5LOVE 3NRXA 3O1JA 3ZCIA 2YOEA 1VCTA 3ZSTA 2KWIB 3C98B 4H9SE 4UR9A 4HTEA 1E7PA 3U78A 3QUJA 4G2AA 4AI6A 2ZM8A 3OBVE 5ADXL 4QX8B 1EZ3A 5FYMA 3ZPOA 3SRZA 3E0ZA 2BG9B 4WNKA 1HR0T 2C5KT 4NXNT 2KINB 2K24A 1KF6A 2ZM2A 2A3DA 2YINA 2Q9QD 4ILBA 4QKNA 2DI4A 5FXWA 3ANWA 2DNXA 2SPCA 1G73A 3ZJ1A 3EI0A 2V7JA 2V7IA 1ZOYA 3MKDA 4YTPA 5H6QB 3PUXF 3CMLA 2JQQA 3F57A 1YW0A 1XMOT 3ZMUB 2XJ7A 4TUYE 3AEFA 2D2SA 3AE3A 3BQLA 3N2GE 4KHZF 5FY0A 4LF8T 4AQGA 4LF5T 2X9HA 1X79A 2LSJA 3JAEA 2FJBA 1OWAA 1Y64B 3UQ4A 2WP9A 2XQ6A 2EHOB 5FXVA 1MIYA 2Y6XA 2E5LT 4GK5E 4HWCA 5L3FB 5L3GB 2BKPA 3PU3A 2BVMA 3CIRA 1D1AA 4X20E 3AA0B 5HYAA 3EDVA 1D0ZA 5LGNB 2DWGA 3UUBA 2W61A 3M65A 3ZSSA 3RC3A 4YY3T 2W0GA 2ZLYA 5EK4A 4CI1B 2M6BA 4H9PC 2F4VT 1J5WA 4EEDA 4O4JE 4AKRB 2OV9A 3PUGA 5LMUT 4A56A 5GONE 2QRXA 4JI5T 1E1HB 4JYAT 4KHPT 5L4HA 1U4QA 3J7Yq 2CMRA 4U7IA 3VR9A 2UUAT 4HFIA 3BQKA 3WI3A 4CI3B 4PFPA 5CFBA 1J1JA 3AB3B 3FZLB 4DR1T 4EB6E 1QLBA 3W15B 3ZN0B 2X51A 2V7LA 3N2KE 5F8PA 2LKGA 4JUYA 2XAHB 4H9OC 3LG7A 1WFDA 2WMOA 4DR2T 3KV4A 1V9DA 1ZHCA 4YJ2E 4B3RT 3UFEA 2KT9A 4CQIA 2H7VC 3LSVA 3H37A 4IE7A 3PTRB 5JR9B 1SA0E 3EABA 2OA5A 3C4XA 3Q2MA 4KUMB 3I9WA 3A7MA 4UIGA 3AA1B 5AQKB 4EYUA 3P4PA 3ETUA 2X9WA 3PU8A 1LRZA 4ERRA 4OYKA 2XHEB 1UURA 3TKLB 2V7MA 4U74A 3Q5EA 2VB6A 2EHOD 2WBLA 3SWHA 3HKDE 3TLWA 2CWOA 1WLXA 4X1YE 2VKHA 4AQFA 4ZZCA 4UF0B 3JC6C 4Q25A 2W62A 4LFCT 2WS3A 4AISA 1BR1A 3HKCE 3KVAA 5HEGA 5AQSB 2MYSA 3ONJA 5F5WA 3HL6A 3PUSA 4B3MT 3P8CD
chains in the Genus database with same CATH topology
4PW8A 3UT5E 2PJQA 3ZYKA 2YK0A 2NTXA 3AAIA 3LK3B 3ZCJA 3QK6A 4AKGA 1IZNB 3ONXA 4O2AE 4XBFB 2HH7A 4L0RA 3V5SA 4EOZB 3NRYA 5CB4E 5CA1E 3IBPA 2YU1A 2BDEA 1US7B 2K5BB 5AFUL 3AAAB 2V26A 4U72A 5EK2A 5HWXA 2VKOA 2UXXB 3O4XE 3JC6D 3LBXA 2H7OA 4YHJA 1IJ5A 3RH3A 3AA6B 4CI2B 1BR2A 1NAFA 3LK42 3C4WA 1OXZA 1S35A 4EAHA 1MNEA 3C51A 4IE4A 2CEAA 3GMIA 3HR0A 2IW5B 2X9YA 4AKLA 3PURA 4J2CA 1G8XA 3ESLA 3FXDB 1FMVA 2Q9QC 3RYHE 1HTJF 2E9XC 4I55E 1MMNA 5A1LA 5CA0E 4QHOA 3MK7C 4GIWA 4DBQA 5LYJE 4ZOLE 4PFOA 2LT3A 2NOXA 5KMGP 2BZBA 4CZZB 3VU7H 3RYFE 1IAPA 2PG8A 5JDNA 3O1IA 4GK0E 2Q9QA 4UVAB 2E9XA 4ANJA 2XTLA 5LJMA 5IYZE 4IE5A 4ZI2D 2GK9A 3EVYA 3KINB 2X68A 3B57A 3LBXB 4HFVA 5J2UE 5LHIB 2VWAA 3GN5A 5L3CB 4IDZA 4H63H 3MZKB 2WAUA 3FBLA 3LJCA 1YKEB 4IE6A 2X66A 3O1HA 4B6XA 5JREA 2ACXA 3C50A 4OK0A 3KBUA 2VKJA 3RRCA 3HI2A 1SHZC 4TZ4C 3UTKA 4HKAA 2N9DA 2IC9A 4QX7B 4UF0A 4WBNE 4V1Av 4ILUA 2Q9QB 1HF8A 1FIOA 3I1AA 2E9XB 2KXPB 4I50E 2P9BA 4IE0A 5FXZA 5FMNA 2L8KA 2WWUA 5IHYA 2H3RA 4GYRA 5ETWA 4UEMA 4WW0A 4ZS3A 3GN5B 3N9OA 2YU2A 4YLHA 5LHGB 4OHFA 2LEHA 2QA7A 1HG2A 5JDGA 3WAJA 3ZN1B 2XAGB 3UUMA 3HKEE 2JPFA 2CLYB 1B7TA 2KNDA 4L5GA 4NUVA 2X67A 4XAXB 5FNVE 2VKDA 4QXHB 2DLRA 2XASB 1MMAA 1HX8A 2A2FX 2I59A 5LJNA 3MACA 4DNDA 4MFRA 4ISSA 4BJNA 1MIWA 2KZ7B 4EIWA 1ZKEA 4QWNB 3C64A 4C90A 3BK9A 3QC9A 3RYIE 2LJLA 5JVDE 2IC6A 2V1DB 5EK3A 1MMGA 3RRWA 2D5UA 2LHNA 1WYCA 2LOSA 5L3DB 4TV8E 2VL8A 3K3NA 1D0YA 3GA8A 4C91A 2LSYA 4H63V 2CA5A 2CE7A 4QXBB 5FY7A 2CXFA 4HN9A 1Z0PA 5LNKA 3KV5A 5HXSA 2HPJA 4L9IA 3B13A 4PAGA 3RPUA 3OJAA 3N9LA 2LHRA 2NW8A 5LOVE 3V5UA 3UULA 1HCIA 3NRXA 3O1JA 3ZCIA 5HXHA 4PJJA 3DP7A 4HE8A 5H6RB 4O2BE 4PK6A 4OFZA 4UXNB 2KWIB 2N2NA 5DQWA 2J1DG 3C98B 2NP9A 2X9XA 3IHRA 3VKHA 4NUUA 4DVDA 4H9SE 3MXZA 2MBGA 3ZMTB 3ZJ2A 4O4IE 3J9X1 4HTEA 2W63A 2W00A 4CXYA 4KMCA 2LSIA 3K3OA 3QUJA 2C5JA 4G2AA 4GYSA 4PJLA 3U78A 5FY1A 4AI6A 2ZM8A 5LG4A 4H9NC 3OBVE 5ADXL 4QX8B 1EZ3A 5FYMA 2L9QA 2HPLA 4MBQA 3ZPOA 3SRZA 1O3XA 3E0ZA 4PNIA 2Y8DA 2L3LA 4WNKA 3NZQA 2RP4A 3Q5XA 2D0TA 4PK4A 4ZHQE 4BAYB 2KMFA 3L09A 2C5KT 2KINB 2MTQA 1HFAA 3N9MA 2CLYC 4FI5A 3FB2A 2CWYA 4BJMA 1HG5A 1UX4A 2CXDA 2K24A 2DCFA 4Z8XA 3UUNA 2C0SA 5HWYA 5JDHA 3FBZA 1VRBA 2ZM2A 2LM9A 3D0TA 4UELA 4E7SA 4JEUB 2A3DA 2YINA 2Q9QD 2N1GA 2E9XD 4H9QC 4QKNA 2DI4A 3I0QA 4H9RC 1QUUA 5FXWA 3L3PA 3T8OA 3ANWA 4IGUA 1D0XA 2DNXA 2SPCA 4YJ3E 1G73A 3ZJ1A 2LSGA 2X0LB 5KX5E 2BVLA 3N5LA 3RC8A 2ODUA 5JH7E 5M4YA 2V7JA 2V7IA 5HXEA 3MKDA 4DO0A 3I9YA 3KFWX 5H6QB 1KNZA 2CCQA 2DWKA 2WSSV 3ZYMA 3CMLA 2JQQA 3F57A 3ZMVB 1YW0A 4KP3C 4QXCB 4UVCB 5LXTE 5LGTB 3ZMUB 5TAOA 3CQGB 1HS7A 3AAEB 4TUYE 5EZYE 2A72A 2D2SA 3OYZA 3BQLA 5LBMA 3N2GE 1T98A 5FY0A 3RYCE 3ETVA 3CX8B 5DJQC 4AQGA 3KV9A 2YEVC 3ZYLA 4TN7B 1LVKA 4X1IE 3ANWB 5BMVE 2X9HA 1VOMA 3CQXC 3OYXA 4PK5A 4WBOA 4O4LE 3ZC0A 1X79A 1UCUA 3MA9A 3KBTA 2LSJA 2LOPA 2LSKA 3U3IA 1AJ3A 2WMNA 5LP6E 4HGAA 3ZC1A 1OWAA 4HEAA 1Y64B 3CWZB 4P09A 3GWHA 4I4TE 5FXXA 1ZV4X 1WRDA 2CXLA 2XUEA 4KBMB 1MIVA 2EHOB 5FXVA 4JLEA 1MIYA 3LK2B 4E7ZA 4JEHB 2Y6XA 3OKQA 4IHJE 3HKBE 4GK5E 3ZEFB 5L3FB 5L3GB 3PU3A 3N9NA 2K48A 2C5IT 2BVMA 4UVBB 1D1AA 3NBXX 4N78D 3R84B 4ASKA 5DABA 4TV9E 2ZMAA 4X20E 2E8IA 3AA0B 5HYAA 3EDVA 1D0ZA 3PE0A 1YD8G 3NZPA 5LGNB 2DWGA 2JJ9A 5JDQA 2W61A 3M65A 4MALA 3RC3A 5HXCA 5JRCA 3AVSA 4CXWA 1LVFA 2CM0A 2W0GA 2ZLYA 5EK4A 4CI1B 2JRKA 2UXNB 4H9PC 2Z6EA 1WYBA 5HXRA 2PBIA 3RKOA 3PUAA 4O4JE 3N9PA 2NTYA 4AKRB 3A5XA 3PUGA 5KDMC 3KVBA 3I0OA 5GONE 3ZLIA 4A56A 3F2EA 4O8SA 3CX6B 2ES0A 4DBRA 4ZI2C 5L2LA 4MLKA 4DMWA 1E1HB 2KLQA 3VKGA 3CVRA 1S94A 2NW9A 1BR4A 5FP3A 1U4QA 5JR9C 3KV6A 4I43B 3J7Yq 3EDUA 2CMRA 5DQVA 5JRCB 5HAXA 4EXTA 1WR6A 5LGUB 3BQKA 4O4HE 3FHNA 3WI3A 4CI3B 4PFPA 4PJNA 2ZM0A 3AB3B 1QSDA 3CKDA 5JR9A 3E22E 4AXPA 4EB6E 3W15B 3ZN0B 2X51A 2XAFB 2K9AA 2V7LA 3KDSE 1U5PA 3N2KE 3P7IA 2RA1A 3CX7B 5F8PA 4CXXA 4AKIA 2QGSA 2XAQB 1MNDA 4JUYA 2XAHB 3E08A 1NWMX 4H9OC 3LG7A 5F3JA 4AKHA 4ZI7E 4F6RC 1H7CA 2WMOA 3K8PC 2VK9A 3H3AA 2LE8A 3C4ZA 3FXEB 2PFVA 3KV4A 1V9DA 3R6NA 4TX5A 1ZHCA 2EHOC 4YJ2E 3UFEA 2XAJB 3N9QA 3SOLA 3RX6A 2KT9A 2ODVA 5L3EB 1MMDA 5J2TE 4ZI3C 4CQIA 2H7VC 4P0BA 5J1GA 3MJXA 3H37A 1CUNA 3CQCB 2NW7A 3DTOA 2JMHA 4IE7A 3PTRB 5JR9B 1SA0E 1D1BA 3LFMA 2EHOA 2JMKA 3UUXB 3O9XA 4X1KE 4ADZA 2OA5A 2G0UA 3C4XA 3Q2MA 4KUMB 4K0UA 4ZS2A 3I9WA 4UIGA 2VASA 2MOZA 1LKXA 3AA1B 4MHCA 4EYUA 3ZMSB 3ETUA 3S4UA 4EZ4A 2X9WA 2DHRA 5JDFA 5LCYA 3DJBA 3PU8A 5E0OA 5JDMA 1LRZA 3ZMZB 4DMVA 4ERRA 4OYKA 4EZHA 2XQYA 3IEEA 3F31A 3Q9DA 1BR0A 3VHLA 1KK7A 4IIJE 3AVRA 2XHEB 3SS1A 3AA7B 3TKLB 5JQGE 2V7MA 4U74A 2VB6A 2EHOD 4YFSA 4M1PA 3K3QC 3PUQA 2WBLA 4AQFC 4BA9A 3SWHA 2B1EA 5LBQB 3HKDE 2KWHA 5C8YE 2V7KA 4UV9B 4ZI3D 3CPZA 3Q5WA 3BQIA 2CWOA 2Y48B 5LA6E 1WLXA 4X1YE 4P0AA 1UX5A 2D0UA 3HA4A 5JDLA 2VKHA 4FJOA 4XZCA 4AQFA 3N2OA 3PDYA 4UF0B 3JC6C 2W62A 1ZEEA 4EYYR 4PJMA 4OYJA 4ISTA 5LHHB 1D1CA 1BR1A 4G63A 3HKCE 3KVAA 1FMWA 2IAKA 2MYSA 3IF8B 2WM9A 4UV8B 3WAKA 1IJ6A 2M67A 5L3BB 3HL6A 3PUSA 1FEWA 4GOUA 1YKHB 3EUHA 3P8CD 2NWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKE B;  1YKH B; 
#chains in the Genus database with same CATH topology
 1SUM B;  4PW8 A;  3ZYK A;  3LK3 B;  3QB5 A;  4AKG A;  4IL4 A;  2LKH A;  4XBF B;  2HH7 A;  5JTG A;  3PUY F;  1W0A A;  2YU1 A;  5FKY A;  2KSR A;  2QYW A;  5HWX A;  2UXX B;  4JI0 T;  2BKO A;  1NAF A;  3LK4 2;  1MNE A;  5LB7 B;  4ILC A;  1X9B A;  3ESL A;  2Q9Q C;  5CA0 E;  1MMN A;  4PFO A;  4HFC A;  2XM2 A;  2CRB A;  3P4S A;  3RYF E;  1IAP A;  2PG8 A;  4NXM T;  2E9X A;  4IE5 A;  4ZI2 D;  3EVY A;  2E2A A;  4IDZ A;  3L39 A;  3AE8 A;  5LMN T;  4B6X A;  2ACX A;  4JBW F;  3KBU A;  5ABG A;  2D9D A;  4TZ4 C;  3UTK A;  4QX7 B;  1HF8 A;  3UU4 A;  2H3R A;  4UEM A;  2LEH A;  1HG2 A;  1B7T A;  1OED E;  4DV5 T;  4NUV A;  4XAX B;  3MAC A;  1R8I A;  4MFR A;  2WDQ A;  3FZH B;  4EIW A;  2LRL A;  5FL1 A;  1XDP A;  3BK9 A;  4HWF A;  5JVD E;  2LHN A;  4YXD A;  3K3N A;  1D0Y A;  1VCS A;  4H63 V;  2ACZ A;  2CE7 A;  5FY7 A;  4HN9 A;  5LNK A;  1ZP0 A;  5HXS A;  4L9I A;  3B13 A;  2V6Y B;  5AQU B;  2FJA A;  3V5U A;  4DR3 T;  3PV0 F;  3EAM A;  3P4W A;  4LFA T;  2WU5 A;  2W2U A;  5HXH A;  3PJA A;  5H6R B;  5DQW A;  5HEJ A;  2NP9 A;  4NUU A;  3MXZ A;  4O4I E;  3J9X 1;  3VRA A;  1HX1 B;  3RQW A;  2K3W A;  4CXY A;  4KMC A;  5AQN B;  2C5J A;  4PJL A;  4GYS A;  5FY1 A;  2J4G A;  4H9N C;  4HWI B;  5ABF A;  3P50 A;  2Y8D A;  2YN6 A;  2RP4 A;  3NZQ A;  4PK4 A;  4ZHQ E;  2KMF A;  2XQ5 A;  2MTQ A;  2CLY C;  4FI5 A;  4DUZ T;  1UUS A;  2CWY A;  1HG5 A;  1UX4 A;  4U31 A;  2DCF A;  4Z8X A;  2C0S A;  5HWY A;  5JDH A;  1VRB A;  4QH1 A;  2HN1 A;  2LM9 A;  3D0T A;  4UEL A;  4E7S A;  4JEU B;  4H9R C;  3T8O A;  1XDO A;  4IGU A;  1D0X A;  3VRB A;  5KX5 E;  3N5L A;  5JH7 E;  5M4Y A;  4AIU A;  4KX6 A;  5HXE A;  2A9U A;  2XQA A;  2V6X A;  1T8B A;  4QXC B;  5LXT E;  2UUB T;  5LGT B;  4HFD A;  1HS7 A;  5EZY E;  4TN7 B;  2XM1 A;  5LG3 A;  1VOM A;  3OYX A;  1AJ3 A;  4F8H A;  3ZC1 A;  4P09 A;  3RI5 A;  4TWD A;  4E7Z A;  4JEH B;  3OKQ A;  5AQO B;  5AQT B;  3ZEF B;  4ZZB A;  3NBX X;  2VVS A;  3ZT7 A;  4TV9 E;  2ZMA A;  2E8I A;  2CHN A;  2BS4 A;  2JJ9 A;  4MAL A;  2XQ7 A;  5HXC A;  4JI4 T;  5JRC A;  2Z6E A;  4YSZ A;  5HXR A;  4ILA A;  3PUA A;  2NTY A;  5ABE A;  3FZK B;  1DU2 A;  3KVB A;  3I0O A;  3ZLI A;  5L2L A;  2ES0 A;  5L4E A;  4DBR A;  4ZI2 C;  5CJ5 A;  4GKK T;  2PTF A;  2IDO B;  3QOF A;  2KLQ A;  3CVR A;  2NW9 A;  5FP3 A;  4JI6 T;  5JR9 C;  5DQV A;  5AQV B;  2YDQ A;  1UK5 A;  4LMJ A;  4PJN A;  3CKD A;  4GKJ T;  3CX7 B;  5HCM A;  4CXX A;  5AQG B;  3NVO A;  1MND A;  5AQQ B;  3E08 A;  4A98 A;  1NWM X;  4AKH A;  1H7C A;  1KFY A;  2LE8 A;  3C4Z A;  2PFV A;  1I6Z A;  4DV2 T;  1OED B;  1W9R A;  4P0B A;  3MJX A;  4X1K E;  4ZS2 A;  2VAS A;  2MOZ A;  4MHC A;  1NEK A;  5E0O A;  3ZMZ B;  4LF9 T;  2LM2 A;  3PUZ F;  4EZH A;  2XQY A;  3AVR A;  3SS1 A;  3JAF A;  3UFG A;  5LBQ B;  3RQU A;  2V7K A;  4ZI3 D;  2X0H A;  5HCJ A;  3Q5W A;  3BQI A;  4I0U A;  4A97 A;  1UX5 A;  5JDL A;  4XZC A;  1WCR A;  1ZEE A;  4EYY R;  4OYJ A;  5LHH B;  2YDR A;  4G63 A;  2VQF T;  1YXR A;  3IF8 B;  4UV8 B;  4GOU A;  3UT5 E;  2IUB A;  3AAI A;  3ONX A;  5CB4 E;  5CA1 E;  3IBP A;  3RIF A;  2BDE A;  2WU2 A;  3OTO T;  1US7 B;  4U72 A;  2V26 A;  3O4X E;  1IJ5 A;  3AA6 B;  4CI2 B;  5CGM A;  1BR2 A;  2WY2 A;  3C4W A;  1OXZ A;  1S35 A;  3GMI A;  4AKL A;  2VQE T;  2WZI A;  5A1L A;  4DBQ A;  3M3Z B;  4TWF A;  5KMG P;  2XQ4 A;  4CZZ B;  2Q9Q A;  4ANJ A;  5IYZ E;  2WWV A;  2IML A;  3KIN B;  4U33 A;  3LBX B;  2FJE A;  3GN5 A;  1XNQ T;  2XSB A;  1YKE B;  4IE6 A;  4DV0 T;  3RIU C;  3QNU A;  4HKA A;  2CBJ A;  3TLS A;  2IC9 A;  3ABV A;  4WBN E;  4ILU A;  3I1A A;  1FIO A;  2AE9 A;  2VUR A;  2P9B A;  4IE0 A;  2L8K A;  4GYR A;  3N9O A;  4YLH A;  5LHG B;  4COF A;  2YDS A;  2QA7 A;  4X64 T;  5AQH B;  3HKE E;  4L5G A;  2KND A;  2X67 A;  5FNV E;  2VKD A;  4EEB A;  3C64 A;  3IA3 A;  3LDQ B;  3AEC A;  5FVK A;  3RYI E;  3X1D A;  1HNW T;  5EK3 A;  5AQP B;  4DV6 T;  2JIW A;  3RRW A;  2LOS A;  4TV8 E;  5IUX A;  3AXJ B;  4QXB B;  1Z0P A;  4K0K T;  3KV5 A;  4DR7 T;  4PAG A;  3RPU A;  3OJA A;  3N9L A;  2LHR A;  4LFB T;  2BG9 A;  1XMQ T;  4U2Z A;  4PJJ A;  4IDQ A;  2H89 A;  3AEA A;  4O2B E;  4PK6 A;  2N2N A;  4IL9 A;  2X9X A;  3IHR A;  3VKH A;  5IWA T;  1N36 T;  3ZJ2 A;  4U3C A;  2W63 A;  4YSX A;  3K3O A;  4Z91 A;  2L9Q A;  2HPL A;  4MBQ A;  1O3X A;  4PNI A;  3Q5X A;  4BAY B;  3L09 A;  3ZT5 A;  4DUY T;  4BJM A;  2RPA A;  1UGO A;  3UUN A;  3FBZ A;  4LF4 T;  2N1G A;  4H9Q C;  3I0Q A;  3RGL A;  2XQ9 A;  1Z8U A;  4YJ3 E;  5AQR B;  2LSG A;  1XZY A;  2ODU A;  1Y01 A;  4DV7 T;  5HEU A;  3I9Y A;  3KFW X;  2CCQ A;  2DWK A;  1HNZ T;  2WSS V;  3ZYM A;  4KP3 C;  3PUV F;  5TAO A;  2XY8 B;  3AAE B;  2VVN A;  2A72 A;  5LBM A;  2UU9 T;  1T98 A;  3ETV A;  5DJQ C;  2YEV C;  3ZYL A;  1I94 T;  1LVK A;  3ANW B;  5BMV E;  1N33 T;  3P4R A;  4PK5 A;  4WBO A;  4O4L E;  4HWH A;  1UCU A;  3KBT A;  2LSK A;  2WMN A;  3UU6 A;  5LP6 E;  4HGA A;  4HEA A;  3GWH A;  4I4T E;  4DV4 T;  5FXX A;  1ZV4 X;  2CXL A;  4KBM B;  1MIV A;  3LK2 B;  3HKB E;  2BG9 C;  4UVB B;  2K48 A;  2C5I T;  4N78 D;  4ASK A;  4JI1 T;  4HFH A;  3PE0 A;  2I0M A;  3ONL C;  5JDQ A;  2VL0 A;  3AVS A;  4CXW A;  2UXB T;  1LVF A;  4B3T T;  2PBI A;  4HFE A;  3UU5 A;  4U7Y A;  4IRE A;  3N9P A;  3A5X A;  4O8S A;  2LLY A;  3CX6 B;  1OED C;  2XSA A;  4CN6 A;  3KV6 A;  4I43 B;  3EDU A;  5LGU B;  4O4H E;  3FHN A;  1QSD A;  5JR9 A;  3E22 E;  2XAF B;  2M6I A;  2RA1 A;  4AKI A;  2XQ3 A;  2W66 A;  4ZI7 E;  4JV5 T;  3K8P C;  2VK9 A;  3R6N A;  2EHO C;  1E2A A;  2XAJ B;  3SOL A;  2ODV A;  1MMD A;  2CBI A;  5J2T E;  3AE1 A;  3NKZ A;  3RLF F;  5FL0 A;  3CQC B;  3DTO A;  2NW7 A;  3RF1 A;  3O9X A;  3ZT6 A;  2QVA A;  1LKX A;  3ZMS B;  4EZ4 A;  5JDF A;  5LCY A;  5JDM A;  4IDO A;  1JNR A;  3Q9D A;  3F31 A;  3VHL A;  1KK7 A;  4IIJ E;  3JCF A;  1FJG T;  4M1P A;  3K3Q C;  3PUQ A;  4BA9 A;  2B1E A;  2HN2 A;  5C8Y E;  4UV9 B;  4YSY A;  5LA6 E;  2Y48 B;  3AE9 A;  4P0A A;  2D0U A;  2WQY A;  2I6H A;  3Q5D A;  3UU8 A;  2FUP A;  1D1C A;  1FMW A;  3ZKR A;  2WM9 A;  1M7K A;  3WAK A;  2M67 A;  2WB5 A;  4KI0 F;  2BS2 A;  3ZCJ A;  3AE5 A;  2CPT A;  4O2A E;  4L0R A;  4DV3 T;  4JI2 T;  2IIU A;  4A5X A;  2K5B B;  5EK2 A;  2VKO A;  1GQE A;  3JC6 D;  4YHJ A;  4OX9 T;  2LRK A;  4EAH A;  4IE4 A;  2CEA A;  3HR0 A;  2X9Y A;  3PUR A;  4J2C A;  1G8X A;  3T1H T;  1N32 T;  3RYH E;  2WDR A;  4DV1 T;  4QHO A;  3MK7 C;  1W0B A;  4GIW A;  4ZOL E;  2NOX A;  3VU7 H;  3O1I A;  2GK9 A;  2UXC T;  3B57 A;  4HFV A;  4WYV A;  5J2U E;  4ZXL A;  2IHR 1;  2VWA A;  1SE7 A;  4H63 H;  2R6G F;  2X66 A;  1T7S A;  3C50 A;  3UQ7 A;  2VKJ A;  3HI2 A;  2XZE A;  4IDN A;  2E9X B;  3AE2 A;  3RIU A;  4DR5 T;  3L8R A;  5IHY A;  5ETW A;  4JI8 T;  4WW0 A;  4ZS3 A;  2V5D A;  2YU2 A;  2YKS A;  2WCA A;  4QH5 A;  5JDG A;  3WAJ A;  2JPF A;  2CLY B;  4YTM A;  4QXH B;  2XAS B;  2V6Y A;  1HX8 A;  2I59 A;  5LJN A;  4DND A;  4BJN A;  1MIW A;  1YQ3 A;  3QC9 A;  4LF6 T;  2LJL A;  2IC6 A;  2V1D B;  1MMG A;  5J0Z A;  2XPK A;  2D5U A;  1WYC A;  5L3D B;  3GA8 A;  2LSY A;  4EGW A;  2NR4 A;  2CA5 A;  4B3S T;  1KNP A;  2HPJ A;  3AE6 A;  4AQY T;  2NW8 A;  5AQJ B;  1N34 T;  3UUL A;  1HCI A;  2B76 A;  4NPP A;  3DP7 A;  4HE8 A;  4OFZ A;  4UXN B;  2J1D G;  5KXJ A;  4DVD A;  4EV6 A;  3ZMT B;  2MBG A;  1JNZ A;  2FJD A;  5AQI B;  2W00 A;  3G06 A;  2LSI A;  5LG4 A;  2V5C A;  4QH4 A;  4CN1 A;  4JI3 T;  3AEB A;  2W4X A;  3TLT A;  3OPC A;  2X0Y A;  2L3L A;  2D0T A;  3H3M A;  3AE7 A;  3AEE A;  1HFA A;  3N9M A;  3QB5 K;  3FB2 A;  2CXD A;  2W67 A;  3CK6 A;  2BBH A;  5AQM B;  2E9X D;  1QUU A;  3L3P A;  1KEY A;  5HEO A;  5ABF B;  2X0L B;  2BVL A;  3RC8 A;  2ZM6 T;  4YTN A;  4DO0 A;  1KNZ A;  3NWI A;  3ZMV B;  4UVC B;  3CQG B;  3OYZ A;  1W09 A;  2V8S V;  3RYC E;  3CX8 B;  3PUW F;  3KV9 A;  4X1I E;  2BBJ A;  3CQX C;  2DL1 A;  2WDV A;  2HHH T;  3ZC0 A;  3MA9 A;  2LOP A;  3U3I A;  4ZEY A;  3CWZ B;  4IT4 A;  4DR6 T;  4P1N A;  1WRD A;  2XUE A;  4JLE A;  2JQK A;  2BS3 A;  5L47 A;  4IHJ E;  4TWH A;  1XNR T;  3R84 B;  2OLT A;  3N9N A;  3RHW A;  5DAB A;  1YD8 G;  4X5T A;  5AQL B;  3NZP A;  2CHO A;  2J47 A;  3TLU A;  3AE4 A;  2CM0 A;  2JRK A;  2UXN B;  1WYB A;  2MAW A;  3RKO A;  5KDM C;  3F2E A;  4IDP A;  4MLK A;  4DMW A;  1KNR A;  3VKG A;  1S94 A;  1BR4 A;  4WZX A;  2JQH A;  4X65 T;  1OED A;  5JRC B;  5HAX A;  4EXT A;  1WR6 A;  1M62 A;  2ZM0 A;  4U2Y A;  3AEG A;  4AXP A;  2K9A A;  3KDS E;  1U5P A;  3P7I A;  2QGS A;  4TNV A;  3RKG A;  2XAQ B;  3JAD A;  4HWD A;  4Z90 A;  1NEN A;  5F3J A;  4F6R C;  3H3A A;  3FXE B;  4TNW A;  4TX5 A;  3SFE A;  3N9Q A;  3RX6 A;  5L3E B;  5BR8 T;  4ZI3 C;  5J1G A;  2BG9 E;  1CUN A;  2JMH A;  1D1B A;  3LFM A;  2EHO A;  2JMK A;  3UUX B;  4ADZ A;  2G0U A;  3A8Y C;  4K0U A;  4LF7 T;  3S4U A;  2DHR A;  3DJB A;  4DMV A;  3B5M A;  3IEE A;  1IBL T;  1BR0 A;  1WR0 A;  2BKN A;  4HFB A;  3AA7 B;  5JQG E;  4YFS A;  3SFD A;  4AQF C;  2KWH A;  3CPZ A;  3HA4 A;  4DID B;  4FJO A;  3N2O A;  3PDY A;  3K1S A;  3TLV A;  4LMK A;  2UUC T;  1CHU A;  4PJM A;  4IST A;  4X62 T;  2IAK A;  1IJ6 A;  5L3B B;  1FEW A;  1L0V A;  1YKH B;  3EUH A;  2NWB A;  2PJQ A;  2YK0 A;  2NTX A;  3QK6 A;  1IZN B;  3V5S A;  4EOZ B;  3NRY A;  3P4Q A;  5AFU L;  3AAA B;  3OVU A;  4YT0 A;  3T1Y T;  2WZH A;  5AQF B;  3LBX A;  2H7O A;  3RH3 A;  3C51 A;  2IW5 B;  3FXD B;  1FMV A;  1HTJ F;  2E9X C;  3FZF B;  4I55 E;  5LYJ E;  2LT3 A;  3VR8 A;  1T72 A;  2BZB A;  5JDN A;  2FBW A;  4GK0 E;  4UVA B;  2H88 A;  2J62 A;  2XTL A;  5LJM A;  2X68 A;  5LHI B;  5L3C B;  3MZK B;  2WAU A;  3FBL A;  3LJC A;  5C3J A;  5JRE A;  3O1H A;  2E5V A;  4OK0 A;  3FZM B;  4LML A;  3RRC A;  1IBM T;  3EHZ A;  1SHZ C;  2JQ9 A;  2AXD S;  2XQ8 A;  2N9D A;  3PJA J;  1HNX T;  3RIA A;  4UF0 A;  4V1A v;  5ABH A;  2Q9Q B;  2KXP B;  4I50 E;  1IBK T;  1YQ4 A;  5FXZ A;  5FMN A;  5C2T A;  3UU3 A;  2MPK A;  2WWU A;  3GN5 B;  4NIQ A;  4OHF A;  3ZN1 B;  2XAG B;  3UUM A;  4X66 T;  3AXJ A;  4JI7 T;  4YHH T;  2UXD T;  2DLR A;  1MMA A;  2A2F X;  4ISS A;  2KZ7 B;  1ZKE A;  4QWN B;  1J5E T;  4C90 A;  5HEH A;  3AED A;  4CN4 A;  2VL8 A;  5FVL A;  4C91 A;  4DR4 T;  2CXF A;  1XWM A;  5LOV E;  3NRX A;  3O1J A;  3ZCI A;  2YOE A;  1VCT A;  3ZST A;  2KWI B;  3C98 B;  4H9S E;  4UR9 A;  4HTE A;  1E7P A;  3U78 A;  3QUJ A;  4G2A A;  4AI6 A;  2ZM8 A;  3OBV E;  5ADX L;  4QX8 B;  1EZ3 A;  5FYM A;  3ZPO A;  3SRZ A;  3E0Z A;  2BG9 B;  4WNK A;  1HR0 T;  2C5K T;  4NXN T;  2KIN B;  2K24 A;  1KF6 A;  2ZM2 A;  2A3D A;  2YIN A;  2Q9Q D;  4ILB A;  4QKN A;  2DI4 A;  5FXW A;  3ANW A;  2DNX A;  2SPC A;  1G73 A;  3ZJ1 A;  3EI0 A;  2V7J A;  2V7I A;  1ZOY A;  3MKD A;  4YTP A;  5H6Q B;  3PUX F;  3CML A;  2JQQ A;  3F57 A;  1YW0 A;  1XMO T;  3ZMU B;  2XJ7 A;  4TUY E;  3AEF A;  2D2S A;  3AE3 A;  3BQL A;  3N2G E;  4KHZ F;  5FY0 A;  4LF8 T;  4AQG A;  4LF5 T;  2X9H A;  1X79 A;  2LSJ A;  3JAE A;  2FJB A;  1OWA A;  1Y64 B;  3UQ4 A;  2WP9 A;  2XQ6 A;  2EHO B;  5FXV A;  1MIY A;  2Y6X A;  2E5L T;  4GK5 E;  4HWC A;  5L3F B;  5L3G B;  2BKP A;  3PU3 A;  2BVM A;  3CIR A;  1D1A A;  4X20 E;  3AA0 B;  5HYA A;  3EDV A;  1D0Z A;  5LGN B;  2DWG A;  3UUB A;  2W61 A;  3M65 A;  3ZSS A;  3RC3 A;  4YY3 T;  2W0G A;  2ZLY A;  5EK4 A;  4CI1 B;  2M6B A;  4H9P C;  2F4V T;  1J5W A;  4EED A;  4O4J E;  4AKR B;  2OV9 A;  3PUG A;  5LMU T;  4A56 A;  5GON E;  2QRX A;  4JI5 T;  1E1H B;  4JYA T;  4KHP T;  5L4H A;  1U4Q A;  3J7Y q;  2CMR A;  4U7I A;  3VR9 A;  2UUA T;  4HFI A;  3BQK A;  3WI3 A;  4CI3 B;  4PFP A;  5CFB A;  1J1J A;  3AB3 B;  3FZL B;  4DR1 T;  4EB6 E;  1QLB A;  3W15 B;  3ZN0 B;  2X51 A;  2V7L A;  3N2K E;  5F8P A;  2LKG A;  4JUY A;  2XAH B;  4H9O C;  3LG7 A;  1WFD A;  2WMO A;  4DR2 T;  3KV4 A;  1V9D A;  1ZHC A;  4YJ2 E;  4B3R T;  3UFE A;  2KT9 A;  4CQI A;  2H7V C;  3LSV A;  3H37 A;  4IE7 A;  3PTR B;  5JR9 B;  1SA0 E;  3EAB A;  2OA5 A;  3C4X A;  3Q2M A;  4KUM B;  3I9W A;  3A7M A;  4UIG A;  3AA1 B;  5AQK B;  4EYU A;  3P4P A;  3ETU A;  2X9W A;  3PU8 A;  1LRZ A;  4ERR A;  4OYK A;  2XHE B;  1UUR A;  3TKL B;  2V7M A;  4U74 A;  3Q5E A;  2VB6 A;  2EHO D;  2WBL A;  3SWH A;  3HKD E;  3TLW A;  2CWO A;  1WLX A;  4X1Y E;  2VKH A;  4AQF A;  4ZZC A;  4UF0 B;  3JC6 C;  4Q25 A;  2W62 A;  4LFC T;  2WS3 A;  4AIS A;  1BR1 A;  3HKC E;  3KVA A;  5HEG A;  5AQS B;  2MYS A;  3ONJ A;  5F5W A;  3HL6 A;  3PUS A;  4B3M T;  3P8C D; 
#chains in the Genus database with same CATH homology
 4PW8 A;  3UT5 E;  2PJQ A;  3ZYK A;  2YK0 A;  2NTX A;  3AAI A;  3LK3 B;  3ZCJ A;  3QK6 A;  4AKG A;  1IZN B;  3ONX A;  4O2A E;  4XBF B;  2HH7 A;  4L0R A;  3V5S A;  4EOZ B;  3NRY A;  5CB4 E;  5CA1 E;  3IBP A;  2YU1 A;  2BDE A;  1US7 B;  2K5B B;  5AFU L;  3AAA B;  2V26 A;  4U72 A;  5EK2 A;  5HWX A;  2VKO A;  2UXX B;  3O4X E;  3JC6 D;  3LBX A;  2H7O A;  4YHJ A;  1IJ5 A;  3RH3 A;  3AA6 B;  4CI2 B;  1BR2 A;  1NAF A;  3LK4 2;  3C4W A;  1OXZ A;  1S35 A;  4EAH A;  1MNE A;  3C51 A;  4IE4 A;  2CEA A;  3GMI A;  3HR0 A;  2IW5 B;  2X9Y A;  4AKL A;  3PUR A;  4J2C A;  1G8X A;  3ESL A;  3FXD B;  1FMV A;  2Q9Q C;  3RYH E;  1HTJ F;  2E9X C;  4I55 E;  1MMN A;  5A1L A;  5CA0 E;  4QHO A;  3MK7 C;  4GIW A;  4DBQ A;  5LYJ E;  4ZOL E;  4PFO A;  2LT3 A;  2NOX A;  5KMG P;  2BZB A;  4CZZ B;  3VU7 H;  3RYF E;  1IAP A;  2PG8 A;  5JDN A;  3O1I A;  4GK0 E;  2Q9Q A;  4UVA B;  2E9X A;  4ANJ A;  2XTL A;  5LJM A;  5IYZ E;  4IE5 A;  4ZI2 D;  2GK9 A;  3EVY A;  3KIN B;  2X68 A;  3B57 A;  3LBX B;  4HFV A;  5J2U E;  5LHI B;  2VWA A;  3GN5 A;  5L3C B;  4IDZ A;  4H63 H;  3MZK B;  2WAU A;  3FBL A;  3LJC A;  1YKE B;  4IE6 A;  2X66 A;  3O1H A;  4B6X A;  5JRE A;  2ACX A;  3C50 A;  4OK0 A;  3KBU A;  2VKJ A;  3RRC A;  3HI2 A;  1SHZ C;  4TZ4 C;  3UTK A;  4HKA A;  2N9D A;  2IC9 A;  4QX7 B;  4UF0 A;  4WBN E;  4V1A v;  4ILU A;  2Q9Q B;  1HF8 A;  1FIO A;  3I1A A;  2E9X B;  2KXP B;  4I50 E;  2P9B A;  4IE0 A;  5FXZ A;  5FMN A;  2L8K A;  2WWU A;  5IHY A;  2H3R A;  4GYR A;  5ETW A;  4UEM A;  4WW0 A;  4ZS3 A;  3GN5 B;  3N9O A;  2YU2 A;  4YLH A;  5LHG B;  4OHF A;  2LEH A;  2QA7 A;  1HG2 A;  5JDG A;  3WAJ A;  3ZN1 B;  2XAG B;  3UUM A;  3HKE E;  2JPF A;  2CLY B;  1B7T A;  2KND A;  4L5G A;  4NUV A;  2X67 A;  4XAX B;  5FNV E;  2VKD A;  4QXH B;  2DLR A;  2XAS B;  1MMA A;  1HX8 A;  2A2F X;  2I59 A;  5LJN A;  3MAC A;  4DND A;  4MFR A;  4ISS A;  4BJN A;  1MIW A;  2KZ7 B;  4EIW A;  1ZKE A;  4QWN B;  3C64 A;  4C90 A;  3BK9 A;  3QC9 A;  3RYI E;  2LJL A;  5JVD E;  2IC6 A;  2V1D B;  5EK3 A;  1MMG A;  3RRW A;  2D5U A;  2LHN A;  1WYC A;  2LOS A;  5L3D B;  4TV8 E;  2VL8 A;  3K3N A;  1D0Y A;  3GA8 A;  4C91 A;  2LSY A;  4H63 V;  2CA5 A;  2CE7 A;  4QXB B;  5FY7 A;  2CXF A;  4HN9 A;  1Z0P A;  5LNK A;  3KV5 A;  5HXS A;  2HPJ A;  4L9I A;  3B13 A;  4PAG A;  3RPU A;  3OJA A;  3N9L A;  2LHR A;  2NW8 A;  5LOV E;  3V5U A;  3UUL A;  1HCI A;  3NRX A;  3O1J A;  3ZCI A;  5HXH A;  4PJJ A;  3DP7 A;  4HE8 A;  5H6R B;  4O2B E;  4PK6 A;  4OFZ A;  4UXN B;  2KWI B;  2N2N A;  5DQW A;  2J1D G;  3C98 B;  2NP9 A;  2X9X A;  3IHR A;  3VKH A;  4NUU A;  4DVD A;  4H9S E;  3MXZ A;  2MBG A;  3ZMT B;  3ZJ2 A;  4O4I E;  3J9X 1;  4HTE A;  2W63 A;  2W00 A;  4CXY A;  4KMC A;  2LSI A;  3K3O A;  3QUJ A;  2C5J A;  4G2A A;  4GYS A;  4PJL A;  3U78 A;  5FY1 A;  4AI6 A;  2ZM8 A;  5LG4 A;  4H9N C;  3OBV E;  5ADX L;  4QX8 B;  1EZ3 A;  5FYM A;  2L9Q A;  2HPL A;  4MBQ A;  3ZPO A;  3SRZ A;  1O3X A;  3E0Z A;  4PNI A;  2Y8D A;  2L3L A;  4WNK A;  3NZQ A;  2RP4 A;  3Q5X A;  2D0T A;  4PK4 A;  4ZHQ E;  4BAY B;  2KMF A;  3L09 A;  2C5K T;  2KIN B;  2MTQ A;  1HFA A;  3N9M A;  2CLY C;  4FI5 A;  3FB2 A;  2CWY A;  4BJM A;  1HG5 A;  1UX4 A;  2CXD A;  2K24 A;  2DCF A;  4Z8X A;  3UUN A;  2C0S A;  5HWY A;  5JDH A;  3FBZ A;  1VRB A;  2ZM2 A;  2LM9 A;  3D0T A;  4UEL A;  4E7S A;  4JEU B;  2A3D A;  2YIN A;  2Q9Q D;  2N1G A;  2E9X D;  4H9Q C;  4QKN A;  2DI4 A;  3I0Q A;  4H9R C;  1QUU A;  5FXW A;  3L3P A;  3T8O A;  3ANW A;  4IGU A;  1D0X A;  2DNX A;  2SPC A;  4YJ3 E;  1G73 A;  3ZJ1 A;  2LSG A;  2X0L B;  5KX5 E;  2BVL A;  3N5L A;  3RC8 A;  2ODU A;  5JH7 E;  5M4Y A;  2V7J A;  2V7I A;  5HXE A;  3MKD A;  4DO0 A;  3I9Y A;  3KFW X;  5H6Q B;  1KNZ A;  2CCQ A;  2DWK A;  2WSS V;  3ZYM A;  3CML A;  2JQQ A;  3F57 A;  3ZMV B;  1YW0 A;  4KP3 C;  4QXC B;  4UVC B;  5LXT E;  5LGT B;  3ZMU B;  5TAO A;  3CQG B;  1HS7 A;  3AAE B;  4TUY E;  5EZY E;  2A72 A;  2D2S A;  3OYZ A;  3BQL A;  5LBM A;  3N2G E;  1T98 A;  5FY0 A;  3RYC E;  3ETV A;  3CX8 B;  5DJQ C;  4AQG A;  3KV9 A;  2YEV C;  3ZYL A;  4TN7 B;  1LVK A;  4X1I E;  3ANW B;  5BMV E;  2X9H A;  1VOM A;  3CQX C;  3OYX A;  4PK5 A;  4WBO A;  4O4L E;  3ZC0 A;  1X79 A;  1UCU A;  3MA9 A;  3KBT A;  2LSJ A;  2LOP A;  2LSK A;  3U3I A;  1AJ3 A;  2WMN A;  5LP6 E;  4HGA A;  3ZC1 A;  1OWA A;  4HEA A;  1Y64 B;  3CWZ B;  4P09 A;  3GWH A;  4I4T E;  5FXX A;  1ZV4 X;  1WRD A;  2CXL A;  2XUE A;  4KBM B;  1MIV A;  2EHO B;  5FXV A;  4JLE A;  1MIY A;  3LK2 B;  4E7Z A;  4JEH B;  2Y6X A;  3OKQ A;  4IHJ E;  3HKB E;  4GK5 E;  3ZEF B;  5L3F B;  5L3G B;  3PU3 A;  3N9N A;  2K48 A;  2C5I T;  2BVM A;  4UVB B;  1D1A A;  3NBX X;  4N78 D;  3R84 B;  4ASK A;  5DAB A;  4TV9 E;  2ZMA A;  4X20 E;  2E8I A;  3AA0 B;  5HYA A;  3EDV A;  1D0Z A;  3PE0 A;  1YD8 G;  3NZP A;  5LGN B;  2DWG A;  2JJ9 A;  5JDQ A;  2W61 A;  3M65 A;  4MAL A;  3RC3 A;  5HXC A;  5JRC A;  3AVS A;  4CXW A;  1LVF A;  2CM0 A;  2W0G A;  2ZLY A;  5EK4 A;  4CI1 B;  2JRK A;  2UXN B;  4H9P C;  2Z6E A;  1WYB A;  5HXR A;  2PBI A;  3RKO A;  3PUA A;  4O4J E;  3N9P A;  2NTY A;  4AKR B;  3A5X A;  3PUG A;  5KDM C;  3KVB A;  3I0O A;  5GON E;  3ZLI A;  4A56 A;  3F2E A;  4O8S A;  3CX6 B;  2ES0 A;  4DBR A;  4ZI2 C;  5L2L A;  4MLK A;  4DMW A;  1E1H B;  2KLQ A;  3VKG A;  3CVR A;  1S94 A;  2NW9 A;  1BR4 A;  5FP3 A;  1U4Q A;  5JR9 C;  3KV6 A;  4I43 B;  3J7Y q;  3EDU A;  2CMR A;  5DQV A;  5JRC B;  5HAX A;  4EXT A;  1WR6 A;  5LGU B;  3BQK A;  4O4H E;  3FHN A;  3WI3 A;  4CI3 B;  4PFP A;  4PJN A;  2ZM0 A;  3AB3 B;  1QSD A;  3CKD A;  5JR9 A;  3E22 E;  4AXP A;  4EB6 E;  3W15 B;  3ZN0 B;  2X51 A;  2XAF B;  2K9A A;  2V7L A;  3KDS E;  1U5P A;  3N2K E;  3P7I A;  2RA1 A;  3CX7 B;  5F8P A;  4CXX A;  4AKI A;  2QGS A;  2XAQ B;  1MND A;  4JUY A;  2XAH B;  3E08 A;  1NWM X;  4H9O C;  3LG7 A;  5F3J A;  4AKH A;  4ZI7 E;  4F6R C;  1H7C A;  2WMO A;  3K8P C;  2VK9 A;  3H3A A;  2LE8 A;  3C4Z A;  3FXE B;  2PFV A;  3KV4 A;  1V9D A;  3R6N A;  4TX5 A;  1ZHC A;  2EHO C;  4YJ2 E;  3UFE A;  2XAJ B;  3N9Q A;  3SOL A;  3RX6 A;  2KT9 A;  2ODV A;  5L3E B;  1MMD A;  5J2T E;  4ZI3 C;  4CQI A;  2H7V C;  4P0B A;  5J1G A;  3MJX A;  3H37 A;  1CUN A;  3CQC B;  2NW7 A;  3DTO A;  2JMH A;  4IE7 A;  3PTR B;  5JR9 B;  1SA0 E;  1D1B A;  3LFM A;  2EHO A;  2JMK A;  3UUX B;  3O9X A;  4X1K E;  4ADZ A;  2OA5 A;  2G0U A;  3C4X A;  3Q2M A;  4KUM B;  4K0U A;  4ZS2 A;  3I9W A;  4UIG A;  2VAS A;  2MOZ A;  1LKX A;  3AA1 B;  4MHC A;  4EYU A;  3ZMS B;  3ETU A;  3S4U A;  4EZ4 A;  2X9W A;  2DHR A;  5JDF A;  5LCY A;  3DJB A;  3PU8 A;  5E0O A;  5JDM A;  1LRZ A;  3ZMZ B;  4DMV A;  4ERR A;  4OYK A;  4EZH A;  2XQY A;  3IEE A;  3F31 A;  3Q9D A;  1BR0 A;  3VHL A;  1KK7 A;  4IIJ E;  3AVR A;  2XHE B;  3SS1 A;  3AA7 B;  3TKL B;  5JQG E;  2V7M A;  4U74 A;  2VB6 A;  2EHO D;  4YFS A;  4M1P A;  3K3Q C;  3PUQ A;  2WBL A;  4AQF C;  4BA9 A;  3SWH A;  2B1E A;  5LBQ B;  3HKD E;  2KWH A;  5C8Y E;  2V7K A;  4UV9 B;  4ZI3 D;  3CPZ A;  3Q5W A;  3BQI A;  2CWO A;  2Y48 B;  5LA6 E;  1WLX A;  4X1Y E;  4P0A A;  1UX5 A;  2D0U A;  3HA4 A;  5JDL A;  2VKH A;  4FJO A;  4XZC A;  4AQF A;  3N2O A;  3PDY A;  4UF0 B;  3JC6 C;  2W62 A;  1ZEE A;  4EYY R;  4PJM A;  4OYJ A;  4IST A;  5LHH B;  1D1C A;  1BR1 A;  4G63 A;  3HKC E;  3KVA A;  1FMW A;  2IAK A;  2MYS A;  3IF8 B;  2WM9 A;  4UV8 B;  3WAK A;  1IJ6 A;  2M67 A;  5L3B B;  3HL6 A;  3PUS A;  1FEW A;  4GOU A;  1YKH B;  3EUH A;  3P8C D;  2NWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...