5AQIB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 45
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqiB00
1HX1B 5AQUB 5AQTB 1UK5A 3M3ZB 1I6ZA 5AQQB 1M7KA 2D9DA 5AQGB 4HWIB 3LDQB 5AQMB 4HWDA 5AQLB 1M62A 5AQNB 5AQFB 5AQHB 3FZFB 5AQOB 4HWFA 3FZHB 1UGOA 3FZMB 5AQIB 3FZKB 4HWCA 5AQRB 5AQSB 1T7SA 5AQKB 4HWHA 3A8YC 5AQJB 5AQVB 5AQPB 3FZLB
chains in the Genus database with same CATH superfamily
2CM0A 1Y64B 2YU1A 1T8BA 4CI1B 5ABGA 2KWIB 3R84B 3PURA 3PUSA 2LHNA 2K48A 2CLYB 2W4XA 2YDRA 1SHZC 1R8IA 1VCSA 2BKPA 1MIWA 3L8RA 4CXXA 3UQ4A 3TLVA 3QK6A 5L3EB 3AE1A 5LHIB 1BR0A 4Q25A 4UVAB 5C3JA 5J0ZA 1G73A 2JPFA 2E5VA 3UU8A 4AQGA 4YTNA 3AA6B 3HKCE 1AJ3A 3I9WA 1Z0PA 2XQ6A 2YDQA 1NWMX 4EOZB 4LF6T 4U3CA 3UU5A 4ZZBA 5HEJA 3LK2B 3ZN1B 4AQFC 4JBWF 3VHLA 3PUZF 4ILCA 3ANWB 3C4XA 3CMLA 5IHYA 4LF4T 2H7VC 2CXLA 2RA1A 4A56A 4JI3T 4TN7B 3UT5E 2WWVA 4N78D 2JIWA 4IL4A 4UEMA 5AQIB 4ZZCA 4IE5A 5CGMA 3CQCB 3LBXB 3GMIA 1YKEB 4XZCA 1MIVA 2BS2A 3AE2A 4CN4A 4YSXA 5JTGA 5JRCB 3ZJ2A 1XMQT 2BBHA 2H88A 3E0ZA 4AISA 4EEDA 3Q5XA 5GONE 5AQGB 4IDPA 2WMNA 1FIOA 3PJAJ 4HFEA 4KX6A 5AQMB 3RHWA 4CXWA 4CXYA 2K5BB 4DV3T 4PFPA 4DBRA 3C4WA 2KZ7B 3HL6A 2ACZA 2CMRA 3KBTA 2ZM0A 2W2UA 4IDQA 4KI0F 4BAYB 5CFBA 1YQ3A 1IBMT 4J2CA 2YINA 3ANWA 2WWUA 4L5GA 4ZXLA 4NXMT 4UF0A 4KHPT 1W09A 2X9YA 1D0XA 3JAEA 1FJGT 4HWCA 4X5TA 2KINB 3P8CD 2AE9A 3P4RA 4UR9A 2Q9QD 4PW8A 3A8YC 5AQJB 5JR9A 2W66A 4JI8T 2E2AA 3HKDE 4ANJA 3FBZA 4OX9T 5LNKA 4UELA 2BG9B 4GIWA 4EGWA 2VQET 4ILBA 4DR3T 3A7MA 1HX1B 1NEKA 4DR4T 3JC6C 3K3OA 3ZSSA 3U3IA 4F6RC 3UUXB 4CN6A 4IDOA 3BQIA 4UVCB 4TWFA 2FJAA 3AE4A 1OWAA 3ZT7A 2ZM6T 5FNVE 3B5MA 3N9OA 4DMVA 3TLWA 1KNRA 2CHOA 4YTPA 2V6YB 2CRBA 1NAFA 2ZMAA 2XAGB 3KINB 4HFCA 1QUUA 2HN1A 1KK7A 2E9XA 2PFVA 4ZHQE 1MIYA 2BG9E 3AE8A 1D0YA 2V7IA 5HWYA 3SWHA 2QYWA 2PTFA 5BR8T 2V7LA 3BQLA 1HF8A 3PTRB 4X1KE 4X20E 4LFCT 4ERRA 2SPCA 4DR1T 2MBGA 2I0MA 2Y48B 5J2TE 4JI1T 1LVFA 1WLXA 2A3DA 1MNDA 3AE6A 4WBOA 3Q9DA 3LSVA 5AQPB 5HEHA 3ZYMA 2IUBA 2WS3A 3K3QC 4X65T 3NZQA 3VR8A 3NRXA 3PUYF 3N2GE 3DTOA 4LF8T 2XM1A 1WCRA 4CZZB 1HNXT 2L3LA 1T72A 4PJLA 2CEAA 1MNEA 1WYCA 3PUVF 1WR6A 3N9QA 4IGUA 2LSKA 3OYXA 1L0VA 3T1HT 2WM9A 4P0AA 3Q5DA 3S4UA 5LBMA 2IHR1 3CKDA 2MAWA 1WR0A 4IIJE 3UUMA 4A5XA 1X9BA 4C91A 3JADA 5IUXA 4I55E 3U78A 1MMAA 2V6YA 2BKNA 3AECA 2MPKA 1MMGA 4IL9A 3VRBA 2B76A 2X66A 3OVUA 3AEGA 4JLEA 2XQ5A 3RYCE 4X66T 2CBJA 1YQ4A 5HCJA 3RI5A 3ZSTA 4COFA 4EIWA 4DUYT 3AA0B 1HNWT 4TX5A 1D1BA 3RIUC 5LMUT 2WZIA 5FYMA 2DL1A 3C4ZA 3ZKRA 3ZMZB 3AE9A 3L09A 2NP9A 2LKGA 1IJ5A 4UIGA 5FY0A 1QSDA 5CA0E 3IF8B 2WZHA 3ZLIA 3FZLB 2XSAA 2ZM8A 3PV0F 3K3NA 4ZS3A 3F2EA 4OFZA 3ZPOA 4AKRB 4EZHA 1U5PA 2WY2A 3EI0A 2NR4A 2ODUA 4HFDA 4X1IE 3EAMA 3HI2A 3MA9A 1XNQT 2WAUA 1N32T 3Q2MA 3IEEA 3NWIA 4IE4A 3N2KE 1YW0A 3G06A 4QH4A 3JCFA 5ABHA 5JDQA 3Q5EA 4DV6T 4JI6T 3RRCA 2ES0A 1HR0T 5BMVE 2A72A 3AE7A 2DI4A 4WW0A 4WZXA 2VL0A 3QNUA 2CLYC 2CHNA 1KF6A 5A1LA 4A97A 1IZNB 2WDQA 4ZI2D 3FZMB 2V8SV 2JQ9A 5FP3A 3VKGA 4KHZF 3PUGA 3PU8A 3ZMUB 2BS3A 4HWHA 2DCFA 4GYSA 1XZYA 3SOLA 3AAAB 2FUPA 3ZYLA 2XPKA 3SFEA 2VB6A 5HWXA 1UURA 3P4PA 5CB4E 2XQ9A 4PJMA 2J4GA 1WYBA 3P4SA 2I59A 5ADXL 4TZ4C 4QXHB 2LT3A 2N2NA 3I0OA 5LYJE 2UU9T 1YKHB 2VVSA 2VKJA 2OLTA 2XJ7A 5FXZA 5DQVA 4TV9E 3RKGA 3ZCJA 4B6XA 5JDNA 2W63A 2XSBA 3UULA 2ACXA 3OKQA 2VVNA 3N9NA 3N9PA 3ONXA 4AQYT 5LG4A 5L4EA 2QRXA 4JYAT 4MALA 2WMOA 3V5UA 4C90A 5ABEA 2XQAA 5HCMA 2IDOB 4KBMB 5L3DB 4PAGA 2JQQA 2LSJA 4UXNB 5EZYE 5HEGA 4NIQA 4ZS2A 2K9AA 2UXNB 4LFAT 2H3RA 1UUSA 2LOSA 3O1HA 3QC9A 4I43B 3W15B 5ABFA 2MOZA 5JREA 2L8KA 2BG9A 4IREA 5L47A 1UX4A 2ODVA 4H9QC 1D1CA 4QHOA 3CIRA 3TLUA 5F8PA 4JI0T 4H9OC 3ZT5A 5LGNB 3RIAA 4XAXB 5DJQC 3M3ZB 3T1YT 4JI4T 2D2SA 4H9RC 5CJ5A 1JNZA 2IC9A 1N34T 2XAJB 2X9XA 3IBPA 3VU7H 5ABFB 3C64A 2V7MA 4HWDA 1OEDC 5LA6E 1KNPA 3SFDA 3OJAA 3H3MA 4PJNA 2FJDA 2LOPA 4P1NA 2RPAA 5HYAA 2J62A 2YOEA 4LMJA 2M6BA 3F57A 2XQYA 3C50A 2WU5A 4CI2B 3RH3A 4EZ4A 2LM9A 4QX8B 3KV5A 4HWFA 3CX7B 4O8SA 3HKEE 1DU2A 4TNVA 4ADZA 3ONLC 2MYSA 4O4LE 3EUHA 3VRAA 4DR7T 4ZI2C 4WBNE 3N9LA 2EHOA 2CE7A 1W0BA 2CWYA 2V7KA 2WDVA 2X68A 4JI2T 5FMNA 4B3RT 1B7TA 3RQWA 2KMFA 4K0KT 1Y01A 1N33T 2DWGA 1ZV4X 3MZKB 4NUUA 3TKLB 3ZJ1A 5IYZE 3EABA 4PJJA 4B3MT 2RP4A 3UFEA 4YXDA 1HFAA 1JNRA 3L39A 2XTLA 4JI5T 4IT4A 5AQLB 3GN5A 1IJ6A 4B3ST 1VCTA 3AEAA 2VASA 4EYUA 3ESLA 1VRBA 2YKSA 1XNRT 5ETWA 2VWAA 4GOUA 5TAOA 3LG7A 3PUQA 2LLYA 4X1YE 5AQOB 3WI3A 3KVAA 4QXBB 1BR4A 4TUYE 5KXJA 4P09A 3FBLA 5AQRB 4EB6E 3AB3B 1ZHCA 2CA5A 3AAEB 1HX8A 5JR9C 4DUZT 3KDSE 5HXCA 2WP9A 3MACA 2KLQA 2J1DG 4I0UA 4PK5A 3V5SA 5KX5E 2LE8A 4HGAA 2V7JA 2XUEA 3ZMVB 1OEDB 4LF9T 2WU2A 3RYIE 4QXCB 5KMGP 2LSYA 2DWKA 4IE7A 2KT9A 5AQTB 5CA1E 2LRLA 5LHHB 3SRZA 2IIUA 2Q9QC 3CVRA 4NXNT 1ZP0A 3SS1A 1M7KA 1J5ET 2KNDA 2C0SA 4KUMB 5IWAT 4U2ZA 4DIDB 4HKAA 3UU6A 3PUWF 4CQIA 2XAHB 5JDFA 2HHHT 1E7PA 3QOFA 2JMHA 4NPPA 4UVBB 3FB2A 5JDLA 2E9XC 3O9XA 4F8HA 4DV2T 2WBLA 1N36T 1V9DA 3AEDA 1OEDE 5JRCA 3AE3A 2UXDT 5C2TA 2NW8A 5LG3A 2LEHA 4X64T 2BVMA 2CWOA 1KFYA 2HH7A 3C51A 5E0OA 4EXTA 3IA3A 4L0RA 5HAXA 2UXBT 4H63V 2H7OA 5LGUB 3K8PC 4UV9B 1NENA 3UQ7A 2LSGA 3NVOA 5LHGB 2NTYA 5HEOA 1E1HB 3RQUA 4DBQA 3WAKA 1VOMA 2DHRA 2PBIA 2W61A 2LSIA 5FVKA 2JQHA 3RC8A 3UFGA 3MKDA 3AVRA 3C98B 4LMKA 3ZC0A 2QA7A 2E8IA 3NKZA 5FL0A 3FXDB 3RYHE 4AXPA 3KV4A 1UCUA 3KFWX 4HN9A 4YHJA 4YY3T 2K3WA 2X67A 5AQFB 5JDGA 3FZFB 2WQYA 4IE0A 4YT0A 5L3CB 3OTOT 4JEHB 3ZCIA 1D0ZA 1I94T 4U33A 2QVAA 1FEWA 2K24A 1HS7A 3N2OA 1W9RA 3ETVA 5JQGE 5H6QB 3T8OA 2VQFT 4O4IE 2IMLA 1SA0E 3ZMTB 2UUAT 5FKYA 2X9WA 3VKHA 4Z90A 2E9XD 2HPJA 2X0HA 4LF7T 4GK5E 2W0GA 3NBXX 2BDEA 3ZT6A 1KNZA 2LKHA 4TV8E 5FL1A 4ILAA 1D1AA 1UK5A 3FHNA 4GKKT 2L9QA 2B1EA 3B57A 3CQGB 2JJ9A 3RRWA 2D9DA 4H9PC 4E7SA 3X1DA 3WAJA 4DMWA 5DQWA 3LDQB 2FJEA 3L3PA 3HKBE 4IE6A 4QWNB 2XASB 4U7YA 4U74A 2M6IA 4IDNA 4ZOLE 1XDPA 3JAFA 5HXSA 5L3GB 4YSZA 3H3AA 5JDHA 4X62T 2XQ7A 2DNXA 3QB5A 3DJBA 4AKHA 2XAFB 3ZYKA 4TNWA 2CCQA 1GQEA 3R6NA 2W67A 4ASKA 3UU4A 5JR9B 2CPTA 3HR0A 2XHEB 2ZM2A 4ZI3D 5JH7E 4FI5A 1J5WA 5LJNA 5AQKB 4AQFA 2UXCT 1BR2A 3EDVA 4OYKA 4JUYA 1G8XA 1W0AA 2DLRA 2IW5B 4HEAA 3RC3A 5AQVB 4O4JE 3F31A 3RKOA 4DV1T 4DV4T 5FY1A 3PE0A 1U4QA 3O1JA 3H37A 2JRKA 4H9NC 5H6RB 3ZC1A 3E08A 3LBXA 2NW7A 3BK9A 5LB7B 4KP3C 4ISSA 3J9X1 4DR2T 2PG8A 4PK6A 4U2YA 4A98A 1FMWA 2KXPB 3AE5A 3NRYA 4QH5A 1LRZA 4HFIA 1QLBA 4G2AA 2JMKA 5HXHA 4PFOA 4H63H 5LJMA 5LXTE 4BJNA 4OHFA 1H7CA 1FMVA 2CBIA 1T98A 3ONJA 2D0TA 4QH1A 2J47A 4OYJA 3FZHB 3KVBA 3LK3B 3OYZA 4UV8B 2NOXA 1LKXA 4YJ3E 4ZI3C 5LCYA 1ZKEA 3AAIA 4DV5T 2N9DA 3GN5B 3N9MA 5HXRA 2V6XA 1MMNA 3I1AA 4MFRA 4LF5T 4O2AE 3ETUA 4YFSA 4ZEYA 1X79A 1HCIA 3PDYA 3RLFF 3P4QA 1Z8UA 1IAPA 4LMLA 4HTEA 4U72A 2XQ3A 5L3BB 1EZ3A 3EDUA 2R6GF 4XBFB 3KBUA 4KMCA 4LFBT 4K0UA 2I6HA 3GA8A 3KV6A 3CPZA 2H89A 3PUXF 2Q9QA 4HFVA 3Q5WA 4U7IA 4M1PA 2OV9A 5AQQB 3AVSA 5FXVA 4TWDA 2QGSA 3PU3A 2HN2A 2VURA 2A2FX 2MTQA 4YHHT 2G0UA 3LJCA 2BVLA 1YXRA 3BQKA 4CI3B 5EK2A 2F4VT 4IDZA 4ISTA 5F3JA 4AKIA 2D5UA 2FBWA 1KEYA 2Q9QB 4IHJE 1SUMB 2X51A 4AKLA 1ZEEA 4JI7T 1LVKA 3CWZB 5AQSB 3VR9A 4Z91A 2EHOB 2Y6XA 1UX5A 5F5WA 2EHOC 2IC6A 2C5IT 4I4TE 3CK6A 3AXJA 4HE8A 4I50E 3RPUA 2NTXA 1HG2A 1SE7A 4MHCA 5LBQB 2YU2A 2BKOA 5L2LA 4B3TT 3JC6D 2E5LT 2PJQA 2E9XB 4YTMA 4PNIA 4L9IA 2N1GA 5L4HA 1MMDA 2CXFA 3O1IA 5FVLA 2KWHA 1IBKT 5C8YE 4O4HE 2LM2A 5FXXA 1OXZA 5HXEA 3D0TA 2IAKA 4H9SE 1M62A 2V1DB 1OEDA 5AQNB 4JEUB 3RX6A 1HTJF 1WFDA 2VKHA 3FXEB 2Y8DA 3OBVE 4PK4A 2XM2A 5DABA 3TLSA 4WYVA 1HNZT 2XZEA 2WB5A 3K1SA 5EK4A 3MK7C 2M67A 3J7Yq 4Z8XA 2VK9A 2WCAA 2W00A 4AIUA 2YK0A 1HG5A 4GYRA 5J1GA 4JV5T 3AEFA 3CX8B 3IHRA 4UF0B 3PUAA 3EHZA 4TWHA 2A9UA 1J1JA 2X0YA 3AEBA 5FY7A 3UUBA 5LP6E 1BR1A 2NWBA 3LFMA 5L3FB 3RGLA 4YSYA 2WDRA 4DR5T 3I9YA 3I0QA 2BBJA 5AQUB 3LK42 2FJBA 3ZN0B 4EAHA 4E7ZA 2LRKA 3AA1B 4ILUA 4YLHA 5JVDE 2OA5A 1YD8G 4QX7B 3ZMSB 4AI6A 5EK3A 2YN6A 1S94A 5FXWA 3RF1A 4HWIB 2C5JA 4YJ2E 4DNDA 2NW9A 4NUVA 4MBQA 3RIFA 4EYYR 3MJXA 4G63A 5AQHB 4DR6T 2KSRA 3GWHA 2Z6EA 4EEBA 4V1Av 3KV9A 2UUBT 3EVYA 3AEEA 3A5XA 5J2UE 2HPLA 3ZEFB 5KDMC 2LHRA 2X9HA 3MXZA 4HFBA 4DVDA 1XMOT 1UGOA 2CXDA 5M4YA 4CN1A 2UUCT 4OK0A 4DV7T 2BG9C 4BA9A 3PJAA 3N5LA 2XQ4A 4GK0E 4QKNA 3RYFE 4BJMA 2BS4A 2BZBA 2P9BA 2XQ8A 4FJOA 1O3XA 3AXJB 3UUNA 3P4WA 2AXDS 2D0UA 3QB5K 1CUNA 4GKJT 3P7IA 3OPCA 1US7B 5LOVE 2UXXB 1CHUA 3M65A 3CQXC 3HA4A 1ZOYA 1I6ZA 2XAQB 2XY8B 2C5KT 2X0LB 3P50A 1S35A 2VL8A 2ZLYA 3QUJA 2JQKA 4O2BE 5LGTB 2LJLA 4ZI7E 4P0BA 4AKGA 2W62A 3E22E 2WSSV 1WRDA 2V26A 2V5DA 3B13A 3DP7A 4U31A 3TLTA 1XDOA 3AA7B 4HFHA 4MLKA 3UTKA 4DO0A 4DV0T 1IBLT 3RIUA 3NZPA 2GK9A 1XWMA 2EHOD 3ABVA 3FZKB 4WNKA 5AFUL 1E2AA 1T7SA 3CX6B 3O4XE 2V5CA 5JDMA 2VKDA 2YEVC 4EV6A 2YDSA 5LMNT 5HEUA 2VKOA 3UU3A
chains in the Genus database with same CATH topology
1HX1B 5AQUB 5AQTB 1UK5A 3M3ZB 1I6ZA 5AQQB 1M7KA 2D9DA 5AQGB 4HWIB 3LDQB 5AQMB 4HWDA 5AQLB 1M62A 5AQNB 5AQFB 5AQHB 3FZFB 5AQOB 4HWFA 3FZHB 1UGOA 3FZMB 5AQIB 3FZKB 4HWCA 5AQRB 5AQSB 1T7SA 5AQKB 4HWHA 3A8YC 5AQJB 5AQVB 5AQPB 3FZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 B;  5AQU B;  5AQT B;  1UK5 A;  3M3Z B;  1I6Z A;  5AQQ B;  1M7K A;  2D9D A;  5AQG B;  4HWI B;  3LDQ B;  5AQM B;  4HWD A;  5AQL B;  1M62 A;  5AQN B;  5AQF B;  5AQH B;  3FZF B;  5AQO B;  4HWF A;  3FZH B;  1UGO A;  3FZM B;  5AQI B;  3FZK B;  4HWC A;  5AQR B;  5AQS B;  1T7S A;  5AQK B;  4HWH A;  3A8Y C;  5AQJ B;  5AQV B;  5AQP B;  3FZL B; 
#chains in the Genus database with same CATH topology
 2CM0 A;  1Y64 B;  2YU1 A;  1T8B A;  4CI1 B;  5ABG A;  2KWI B;  3R84 B;  3PUR A;  3PUS A;  2LHN A;  2K48 A;  2CLY B;  2W4X A;  2YDR A;  1SHZ C;  1R8I A;  1VCS A;  2BKP A;  1MIW A;  3L8R A;  4CXX A;  3UQ4 A;  3TLV A;  3QK6 A;  5L3E B;  3AE1 A;  5LHI B;  1BR0 A;  4Q25 A;  4UVA B;  5C3J A;  5J0Z A;  1G73 A;  2JPF A;  2E5V A;  3UU8 A;  4AQG A;  4YTN A;  3AA6 B;  3HKC E;  1AJ3 A;  3I9W A;  1Z0P A;  2XQ6 A;  2YDQ A;  1NWM X;  4EOZ B;  4LF6 T;  4U3C A;  3UU5 A;  4ZZB A;  5HEJ A;  3LK2 B;  3ZN1 B;  4AQF C;  4JBW F;  3VHL A;  3PUZ F;  4ILC A;  3ANW B;  3C4X A;  3CML A;  5IHY A;  4LF4 T;  2H7V C;  2CXL A;  2RA1 A;  4A56 A;  4JI3 T;  4TN7 B;  3UT5 E;  2WWV A;  4N78 D;  2JIW A;  4IL4 A;  4UEM A;  5AQI B;  4ZZC A;  4IE5 A;  5CGM A;  3CQC B;  3LBX B;  3GMI A;  1YKE B;  4XZC A;  1MIV A;  2BS2 A;  3AE2 A;  4CN4 A;  4YSX A;  5JTG A;  5JRC B;  3ZJ2 A;  1XMQ T;  2BBH A;  2H88 A;  3E0Z A;  4AIS A;  4EED A;  3Q5X A;  5GON E;  5AQG B;  4IDP A;  2WMN A;  1FIO A;  3PJA J;  4HFE A;  4KX6 A;  5AQM B;  3RHW A;  4CXW A;  4CXY A;  2K5B B;  4DV3 T;  4PFP A;  4DBR A;  3C4W A;  2KZ7 B;  3HL6 A;  2ACZ A;  2CMR A;  3KBT A;  2ZM0 A;  2W2U A;  4IDQ A;  4KI0 F;  4BAY B;  5CFB A;  1YQ3 A;  1IBM T;  4J2C A;  2YIN A;  3ANW A;  2WWU A;  4L5G A;  4ZXL A;  4NXM T;  4UF0 A;  4KHP T;  1W09 A;  2X9Y A;  1D0X A;  3JAE A;  1FJG T;  4HWC A;  4X5T A;  2KIN B;  3P8C D;  2AE9 A;  3P4R A;  4UR9 A;  2Q9Q D;  4PW8 A;  3A8Y C;  5AQJ B;  5JR9 A;  2W66 A;  4JI8 T;  2E2A A;  3HKD E;  4ANJ A;  3FBZ A;  4OX9 T;  5LNK A;  4UEL A;  2BG9 B;  4GIW A;  4EGW A;  2VQE T;  4ILB A;  4DR3 T;  3A7M A;  1HX1 B;  1NEK A;  4DR4 T;  3JC6 C;  3K3O A;  3ZSS A;  3U3I A;  4F6R C;  3UUX B;  4CN6 A;  4IDO A;  3BQI A;  4UVC B;  4TWF A;  2FJA A;  3AE4 A;  1OWA A;  3ZT7 A;  2ZM6 T;  5FNV E;  3B5M A;  3N9O A;  4DMV A;  3TLW A;  1KNR A;  2CHO A;  4YTP A;  2V6Y B;  2CRB A;  1NAF A;  2ZMA A;  2XAG B;  3KIN B;  4HFC A;  1QUU A;  2HN1 A;  1KK7 A;  2E9X A;  2PFV A;  4ZHQ E;  1MIY A;  2BG9 E;  3AE8 A;  1D0Y A;  2V7I A;  5HWY A;  3SWH A;  2QYW A;  2PTF A;  5BR8 T;  2V7L A;  3BQL A;  1HF8 A;  3PTR B;  4X1K E;  4X20 E;  4LFC T;  4ERR A;  2SPC A;  4DR1 T;  2MBG A;  2I0M A;  2Y48 B;  5J2T E;  4JI1 T;  1LVF A;  1WLX A;  2A3D A;  1MND A;  3AE6 A;  4WBO A;  3Q9D A;  3LSV A;  5AQP B;  5HEH A;  3ZYM A;  2IUB A;  2WS3 A;  3K3Q C;  4X65 T;  3NZQ A;  3VR8 A;  3NRX A;  3PUY F;  3N2G E;  3DTO A;  4LF8 T;  2XM1 A;  1WCR A;  4CZZ B;  1HNX T;  2L3L A;  1T72 A;  4PJL A;  2CEA A;  1MNE A;  1WYC A;  3PUV F;  1WR6 A;  3N9Q A;  4IGU A;  2LSK A;  3OYX A;  1L0V A;  3T1H T;  2WM9 A;  4P0A A;  3Q5D A;  3S4U A;  5LBM A;  2IHR 1;  3CKD A;  2MAW A;  1WR0 A;  4IIJ E;  3UUM A;  4A5X A;  1X9B A;  4C91 A;  3JAD A;  5IUX A;  4I55 E;  3U78 A;  1MMA A;  2V6Y A;  2BKN A;  3AEC A;  2MPK A;  1MMG A;  4IL9 A;  3VRB A;  2B76 A;  2X66 A;  3OVU A;  3AEG A;  4JLE A;  2XQ5 A;  3RYC E;  4X66 T;  2CBJ A;  1YQ4 A;  5HCJ A;  3RI5 A;  3ZST A;  4COF A;  4EIW A;  4DUY T;  3AA0 B;  1HNW T;  4TX5 A;  1D1B A;  3RIU C;  5LMU T;  2WZI A;  5FYM A;  2DL1 A;  3C4Z A;  3ZKR A;  3ZMZ B;  3AE9 A;  3L09 A;  2NP9 A;  2LKG A;  1IJ5 A;  4UIG A;  5FY0 A;  1QSD A;  5CA0 E;  3IF8 B;  2WZH A;  3ZLI A;  3FZL B;  2XSA A;  2ZM8 A;  3PV0 F;  3K3N A;  4ZS3 A;  3F2E A;  4OFZ A;  3ZPO A;  4AKR B;  4EZH A;  1U5P A;  2WY2 A;  3EI0 A;  2NR4 A;  2ODU A;  4HFD A;  4X1I E;  3EAM A;  3HI2 A;  3MA9 A;  1XNQ T;  2WAU A;  1N32 T;  3Q2M A;  3IEE A;  3NWI A;  4IE4 A;  3N2K E;  1YW0 A;  3G06 A;  4QH4 A;  3JCF A;  5ABH A;  5JDQ A;  3Q5E A;  4DV6 T;  4JI6 T;  3RRC A;  2ES0 A;  1HR0 T;  5BMV E;  2A72 A;  3AE7 A;  2DI4 A;  4WW0 A;  4WZX A;  2VL0 A;  3QNU A;  2CLY C;  2CHN A;  1KF6 A;  5A1L A;  4A97 A;  1IZN B;  2WDQ A;  4ZI2 D;  3FZM B;  2V8S V;  2JQ9 A;  5FP3 A;  3VKG A;  4KHZ F;  3PUG A;  3PU8 A;  3ZMU B;  2BS3 A;  4HWH A;  2DCF A;  4GYS A;  1XZY A;  3SOL A;  3AAA B;  2FUP A;  3ZYL A;  2XPK A;  3SFE A;  2VB6 A;  5HWX A;  1UUR A;  3P4P A;  5CB4 E;  2XQ9 A;  4PJM A;  2J4G A;  1WYB A;  3P4S A;  2I59 A;  5ADX L;  4TZ4 C;  4QXH B;  2LT3 A;  2N2N A;  3I0O A;  5LYJ E;  2UU9 T;  1YKH B;  2VVS A;  2VKJ A;  2OLT A;  2XJ7 A;  5FXZ A;  5DQV A;  4TV9 E;  3RKG A;  3ZCJ A;  4B6X A;  5JDN A;  2W63 A;  2XSB A;  3UUL A;  2ACX A;  3OKQ A;  2VVN A;  3N9N A;  3N9P A;  3ONX A;  4AQY T;  5LG4 A;  5L4E A;  2QRX A;  4JYA T;  4MAL A;  2WMO A;  3V5U A;  4C90 A;  5ABE A;  2XQA A;  5HCM A;  2IDO B;  4KBM B;  5L3D B;  4PAG A;  2JQQ A;  2LSJ A;  4UXN B;  5EZY E;  5HEG A;  4NIQ A;  4ZS2 A;  2K9A A;  2UXN B;  4LFA T;  2H3R A;  1UUS A;  2LOS A;  3O1H A;  3QC9 A;  4I43 B;  3W15 B;  5ABF A;  2MOZ A;  5JRE A;  2L8K A;  2BG9 A;  4IRE A;  5L47 A;  1UX4 A;  2ODV A;  4H9Q C;  1D1C A;  4QHO A;  3CIR A;  3TLU A;  5F8P A;  4JI0 T;  4H9O C;  3ZT5 A;  5LGN B;  3RIA A;  4XAX B;  5DJQ C;  3M3Z B;  3T1Y T;  4JI4 T;  2D2S A;  4H9R C;  5CJ5 A;  1JNZ A;  2IC9 A;  1N34 T;  2XAJ B;  2X9X A;  3IBP A;  3VU7 H;  5ABF B;  3C64 A;  2V7M A;  4HWD A;  1OED C;  5LA6 E;  1KNP A;  3SFD A;  3OJA A;  3H3M A;  4PJN A;  2FJD A;  2LOP A;  4P1N A;  2RPA A;  5HYA A;  2J62 A;  2YOE A;  4LMJ A;  2M6B A;  3F57 A;  2XQY A;  3C50 A;  2WU5 A;  4CI2 B;  3RH3 A;  4EZ4 A;  2LM9 A;  4QX8 B;  3KV5 A;  4HWF A;  3CX7 B;  4O8S A;  3HKE E;  1DU2 A;  4TNV A;  4ADZ A;  3ONL C;  2MYS A;  4O4L E;  3EUH A;  3VRA A;  4DR7 T;  4ZI2 C;  4WBN E;  3N9L A;  2EHO A;  2CE7 A;  1W0B A;  2CWY A;  2V7K A;  2WDV A;  2X68 A;  4JI2 T;  5FMN A;  4B3R T;  1B7T A;  3RQW A;  2KMF A;  4K0K T;  1Y01 A;  1N33 T;  2DWG A;  1ZV4 X;  3MZK B;  4NUU A;  3TKL B;  3ZJ1 A;  5IYZ E;  3EAB A;  4PJJ A;  4B3M T;  2RP4 A;  3UFE A;  4YXD A;  1HFA A;  1JNR A;  3L39 A;  2XTL A;  4JI5 T;  4IT4 A;  5AQL B;  3GN5 A;  1IJ6 A;  4B3S T;  1VCT A;  3AEA A;  2VAS A;  4EYU A;  3ESL A;  1VRB A;  2YKS A;  1XNR T;  5ETW A;  2VWA A;  4GOU A;  5TAO A;  3LG7 A;  3PUQ A;  2LLY A;  4X1Y E;  5AQO B;  3WI3 A;  3KVA A;  4QXB B;  1BR4 A;  4TUY E;  5KXJ A;  4P09 A;  3FBL A;  5AQR B;  4EB6 E;  3AB3 B;  1ZHC A;  2CA5 A;  3AAE B;  1HX8 A;  5JR9 C;  4DUZ T;  3KDS E;  5HXC A;  2WP9 A;  3MAC A;  2KLQ A;  2J1D G;  4I0U A;  4PK5 A;  3V5S A;  5KX5 E;  2LE8 A;  4HGA A;  2V7J A;  2XUE A;  3ZMV B;  1OED B;  4LF9 T;  2WU2 A;  3RYI E;  4QXC B;  5KMG P;  2LSY A;  2DWK A;  4IE7 A;  2KT9 A;  5AQT B;  5CA1 E;  2LRL A;  5LHH B;  3SRZ A;  2IIU A;  2Q9Q C;  3CVR A;  4NXN T;  1ZP0 A;  3SS1 A;  1M7K A;  1J5E T;  2KND A;  2C0S A;  4KUM B;  5IWA T;  4U2Z A;  4DID B;  4HKA A;  3UU6 A;  3PUW F;  4CQI A;  2XAH B;  5JDF A;  2HHH T;  1E7P A;  3QOF A;  2JMH A;  4NPP A;  4UVB B;  3FB2 A;  5JDL A;  2E9X C;  3O9X A;  4F8H A;  4DV2 T;  2WBL A;  1N36 T;  1V9D A;  3AED A;  1OED E;  5JRC A;  3AE3 A;  2UXD T;  5C2T A;  2NW8 A;  5LG3 A;  2LEH A;  4X64 T;  2BVM A;  2CWO A;  1KFY A;  2HH7 A;  3C51 A;  5E0O A;  4EXT A;  3IA3 A;  4L0R A;  5HAX A;  2UXB T;  4H63 V;  2H7O A;  5LGU B;  3K8P C;  4UV9 B;  1NEN A;  3UQ7 A;  2LSG A;  3NVO A;  5LHG B;  2NTY A;  5HEO A;  1E1H B;  3RQU A;  4DBQ A;  3WAK A;  1VOM A;  2DHR A;  2PBI A;  2W61 A;  2LSI A;  5FVK A;  2JQH A;  3RC8 A;  3UFG A;  3MKD A;  3AVR A;  3C98 B;  4LMK A;  3ZC0 A;  2QA7 A;  2E8I A;  3NKZ A;  5FL0 A;  3FXD B;  3RYH E;  4AXP A;  3KV4 A;  1UCU A;  3KFW X;  4HN9 A;  4YHJ A;  4YY3 T;  2K3W A;  2X67 A;  5AQF B;  5JDG A;  3FZF B;  2WQY A;  4IE0 A;  4YT0 A;  5L3C B;  3OTO T;  4JEH B;  3ZCI A;  1D0Z A;  1I94 T;  4U33 A;  2QVA A;  1FEW A;  2K24 A;  1HS7 A;  3N2O A;  1W9R A;  3ETV A;  5JQG E;  5H6Q B;  3T8O A;  2VQF T;  4O4I E;  2IML A;  1SA0 E;  3ZMT B;  2UUA T;  5FKY A;  2X9W A;  3VKH A;  4Z90 A;  2E9X D;  2HPJ A;  2X0H A;  4LF7 T;  4GK5 E;  2W0G A;  3NBX X;  2BDE A;  3ZT6 A;  1KNZ A;  2LKH A;  4TV8 E;  5FL1 A;  4ILA A;  1D1A A;  1UK5 A;  3FHN A;  4GKK T;  2L9Q A;  2B1E A;  3B57 A;  3CQG B;  2JJ9 A;  3RRW A;  2D9D A;  4H9P C;  4E7S A;  3X1D A;  3WAJ A;  4DMW A;  5DQW A;  3LDQ B;  2FJE A;  3L3P A;  3HKB E;  4IE6 A;  4QWN B;  2XAS B;  4U7Y A;  4U74 A;  2M6I A;  4IDN A;  4ZOL E;  1XDP A;  3JAF A;  5HXS A;  5L3G B;  4YSZ A;  3H3A A;  5JDH A;  4X62 T;  2XQ7 A;  2DNX A;  3QB5 A;  3DJB A;  4AKH A;  2XAF B;  3ZYK A;  4TNW A;  2CCQ A;  1GQE A;  3R6N A;  2W67 A;  4ASK A;  3UU4 A;  5JR9 B;  2CPT A;  3HR0 A;  2XHE B;  2ZM2 A;  4ZI3 D;  5JH7 E;  4FI5 A;  1J5W A;  5LJN A;  5AQK B;  4AQF A;  2UXC T;  1BR2 A;  3EDV A;  4OYK A;  4JUY A;  1G8X A;  1W0A A;  2DLR A;  2IW5 B;  4HEA A;  3RC3 A;  5AQV B;  4O4J E;  3F31 A;  3RKO A;  4DV1 T;  4DV4 T;  5FY1 A;  3PE0 A;  1U4Q A;  3O1J A;  3H37 A;  2JRK A;  4H9N C;  5H6R B;  3ZC1 A;  3E08 A;  3LBX A;  2NW7 A;  3BK9 A;  5LB7 B;  4KP3 C;  4ISS A;  3J9X 1;  4DR2 T;  2PG8 A;  4PK6 A;  4U2Y A;  4A98 A;  1FMW A;  2KXP B;  3AE5 A;  3NRY A;  4QH5 A;  1LRZ A;  4HFI A;  1QLB A;  4G2A A;  2JMK A;  5HXH A;  4PFO A;  4H63 H;  5LJM A;  5LXT E;  4BJN A;  4OHF A;  1H7C A;  1FMV A;  2CBI A;  1T98 A;  3ONJ A;  2D0T A;  4QH1 A;  2J47 A;  4OYJ A;  3FZH B;  3KVB A;  3LK3 B;  3OYZ A;  4UV8 B;  2NOX A;  1LKX A;  4YJ3 E;  4ZI3 C;  5LCY A;  1ZKE A;  3AAI A;  4DV5 T;  2N9D A;  3GN5 B;  3N9M A;  5HXR A;  2V6X A;  1MMN A;  3I1A A;  4MFR A;  4LF5 T;  4O2A E;  3ETU A;  4YFS A;  4ZEY A;  1X79 A;  1HCI A;  3PDY A;  3RLF F;  3P4Q A;  1Z8U A;  1IAP A;  4LML A;  4HTE A;  4U72 A;  2XQ3 A;  5L3B B;  1EZ3 A;  3EDU A;  2R6G F;  4XBF B;  3KBU A;  4KMC A;  4LFB T;  4K0U A;  2I6H A;  3GA8 A;  3KV6 A;  3CPZ A;  2H89 A;  3PUX F;  2Q9Q A;  4HFV A;  3Q5W A;  4U7I A;  4M1P A;  2OV9 A;  5AQQ B;  3AVS A;  5FXV A;  4TWD A;  2QGS A;  3PU3 A;  2HN2 A;  2VUR A;  2A2F X;  2MTQ A;  4YHH T;  2G0U A;  3LJC A;  2BVL A;  1YXR A;  3BQK A;  4CI3 B;  5EK2 A;  2F4V T;  4IDZ A;  4IST A;  5F3J A;  4AKI A;  2D5U A;  2FBW A;  1KEY A;  2Q9Q B;  4IHJ E;  1SUM B;  2X51 A;  4AKL A;  1ZEE A;  4JI7 T;  1LVK A;  3CWZ B;  5AQS B;  3VR9 A;  4Z91 A;  2EHO B;  2Y6X A;  1UX5 A;  5F5W A;  2EHO C;  2IC6 A;  2C5I T;  4I4T E;  3CK6 A;  3AXJ A;  4HE8 A;  4I50 E;  3RPU A;  2NTX A;  1HG2 A;  1SE7 A;  4MHC A;  5LBQ B;  2YU2 A;  2BKO A;  5L2L A;  4B3T T;  3JC6 D;  2E5L T;  2PJQ A;  2E9X B;  4YTM A;  4PNI A;  4L9I A;  2N1G A;  5L4H A;  1MMD A;  2CXF A;  3O1I A;  5FVL A;  2KWH A;  1IBK T;  5C8Y E;  4O4H E;  2LM2 A;  5FXX A;  1OXZ A;  5HXE A;  3D0T A;  2IAK A;  4H9S E;  1M62 A;  2V1D B;  1OED A;  5AQN B;  4JEU B;  3RX6 A;  1HTJ F;  1WFD A;  2VKH A;  3FXE B;  2Y8D A;  3OBV E;  4PK4 A;  2XM2 A;  5DAB A;  3TLS A;  4WYV A;  1HNZ T;  2XZE A;  2WB5 A;  3K1S A;  5EK4 A;  3MK7 C;  2M67 A;  3J7Y q;  4Z8X A;  2VK9 A;  2WCA A;  2W00 A;  4AIU A;  2YK0 A;  1HG5 A;  4GYR A;  5J1G A;  4JV5 T;  3AEF A;  3CX8 B;  3IHR A;  4UF0 B;  3PUA A;  3EHZ A;  4TWH A;  2A9U A;  1J1J A;  2X0Y A;  3AEB A;  5FY7 A;  3UUB A;  5LP6 E;  1BR1 A;  2NWB A;  3LFM A;  5L3F B;  3RGL A;  4YSY A;  2WDR A;  4DR5 T;  3I9Y A;  3I0Q A;  2BBJ A;  5AQU B;  3LK4 2;  2FJB A;  3ZN0 B;  4EAH A;  4E7Z A;  2LRK A;  3AA1 B;  4ILU A;  4YLH A;  5JVD E;  2OA5 A;  1YD8 G;  4QX7 B;  3ZMS B;  4AI6 A;  5EK3 A;  2YN6 A;  1S94 A;  5FXW A;  3RF1 A;  4HWI B;  2C5J A;  4YJ2 E;  4DND A;  2NW9 A;  4NUV A;  4MBQ A;  3RIF A;  4EYY R;  3MJX A;  4G63 A;  5AQH B;  4DR6 T;  2KSR A;  3GWH A;  2Z6E A;  4EEB A;  4V1A v;  3KV9 A;  2UUB T;  3EVY A;  3AEE A;  3A5X A;  5J2U E;  2HPL A;  3ZEF B;  5KDM C;  2LHR A;  2X9H A;  3MXZ A;  4HFB A;  4DVD A;  1XMO T;  1UGO A;  2CXD A;  5M4Y A;  4CN1 A;  2UUC T;  4OK0 A;  4DV7 T;  2BG9 C;  4BA9 A;  3PJA A;  3N5L A;  2XQ4 A;  4GK0 E;  4QKN A;  3RYF E;  4BJM A;  2BS4 A;  2BZB A;  2P9B A;  2XQ8 A;  4FJO A;  1O3X A;  3AXJ B;  3UUN A;  3P4W A;  2AXD S;  2D0U A;  3QB5 K;  1CUN A;  4GKJ T;  3P7I A;  3OPC A;  1US7 B;  5LOV E;  2UXX B;  1CHU A;  3M65 A;  3CQX C;  3HA4 A;  1ZOY A;  1I6Z A;  2XAQ B;  2XY8 B;  2C5K T;  2X0L B;  3P50 A;  1S35 A;  2VL8 A;  2ZLY A;  3QUJ A;  2JQK A;  4O2B E;  5LGT B;  2LJL A;  4ZI7 E;  4P0B A;  4AKG A;  2W62 A;  3E22 E;  2WSS V;  1WRD A;  2V26 A;  2V5D A;  3B13 A;  3DP7 A;  4U31 A;  3TLT A;  1XDO A;  3AA7 B;  4HFH A;  4MLK A;  3UTK A;  4DO0 A;  4DV0 T;  1IBL T;  3RIU A;  3NZP A;  2GK9 A;  1XWM A;  2EHO D;  3ABV A;  3FZK B;  4WNK A;  5AFU L;  1E2A A;  1T7S A;  3CX6 B;  3O4X E;  2V5C A;  5JDM A;  2VKD A;  2YEV C;  4EV6 A;  2YDS A;  5LMN T;  5HEU A;  2VKO A;  3UU3 A; 
#chains in the Genus database with same CATH homology
 1HX1 B;  5AQU B;  5AQT B;  1UK5 A;  3M3Z B;  1I6Z A;  5AQQ B;  1M7K A;  2D9D A;  5AQG B;  4HWI B;  3LDQ B;  5AQM B;  4HWD A;  5AQL B;  1M62 A;  5AQN B;  5AQF B;  5AQH B;  3FZF B;  5AQO B;  4HWF A;  3FZH B;  1UGO A;  3FZM B;  5AQI B;  3FZK B;  4HWC A;  5AQR B;  5AQS B;  1T7S A;  5AQK B;  4HWH A;  3A8Y C;  5AQJ B;  5AQV B;  5AQP B;  3FZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...