5AQIB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
b'SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
molecule tags Chaperone
source organism Homo sapiens
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
total genus 45
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqiB00
4HWHA 2D9DA 5AQMB 3A8YC 4HWDA 5AQQB 1UK5A 1I6ZA 4HWIB 1M62A 5AQRB 5AQLB 5AQUB 5AQVB 3M3ZB 5AQHB 1UGOA 3FZHB 5AQOB 1HX1B 5AQFB 3FZFB 3FZLB 5AQIB 5AQGB 5AQSB 3FZMB 3LDQB 4HWCA 5AQPB 5AQTB 4HWFA 5AQKB 3FZKB 5AQNB 5AQJB 1M7KA 1T7SA
chains in the Genus database with same CATH superfamily
3LK2B 2J62A 2HPJA 5F5WA 2JJ9A 3DP7A 4J2CA 4JLEA 2VASA 1N36T 2ZM2A 2DCFA 4YTPA 3SFEA 1KFYA 1HS7A 4ZOLE 3VU7H 4LMJA 2NW9A 5LBQB 3VKHA 5FXVA 1L0VA 2XHEB 3U3IA 4EAHA 2DWGA 2LLYA 2UUAT 2OA5A 3I0QA 3P4QA 5FXWA 2BG9E 3FB2A 4QH5A 2V6YB 3QC9A 2A2FX 2IW5B 3ZEFB 2ES0A 3AE4A 4NPPA 2W63A 4PK4A 1CUNA 3OYXA 5L3EB 4GKJT 3T1HT 4OYJA 3KV4A 2VVNA 4K0KT 3ZMUB 1JNRA 4JI5T 3RF1A 2ACZA 3CKDA 4WZXA 3QOFA 5LGNB 4DO0A 4JEUB 3CMLA 1YW0A 3AE8A 3CX7B 4BJMA 5LGTB 1XMQT 2YN6A 1Y01A 3JADA 3RRWA 3AEFA 2WDQA 4HWDA 2CE7A 2NWBA 4EOZB 4XBFB 5EK3A 1UK5A 4LF7T 2XTLA 1KK7A 1D1BA 5LB7B 1NWMX 4EV6A 1LVKA 5HAXA 3RYFE 1XWMA 5IUXA 3N9MA 4QH1A 2CPTA 2JIWA 3NKZA 4A56A 5LMNT 3AXJB 2FJAA 4O8SA 2CHNA 2LKHA 3AE2A 3FXDB 4MALA 5HXRA 3UU5A 2CCQA 5AQOB 4COFA 5JDLA 1U5PA 1WYBA 2LE8A 2MAWA 2W2UA 2WZIA 3OPCA 4ILBA 4N78D 3ZMVB 5JDQA 1SA0E 2QA7A 4X1KE 3KV6A 2VURA 5F3JA 2JPFA 1X9BA 3V5UA 4CXYA 3UU6A 2Q9QA 2XJ7A 5FVKA 4UV9B 2IIUA 2RA1A 4PJNA 1O3XA 2C5JA 2CWOA 2WBLA 4YTNA 4JI6T 3RC8A 3AEBA 2VKDA 5BMVE 3AE3A 3PUVF 4LF8T 2IDOB 2V1DB 2YDSA 2YU1A 3N2OA 4MLKA 4X62T 5JRCB 2CHOA 4DR2T 5C3JA 2XAFB 4P0AA 4JI0T 4K0UA 2W61A 1VRBA 4HWIB 3MK7C 3UFGA 2WDRA 2XY8B 2KWIB 1HG5A 3ANWB 4YSZA 3R6NA 1MMNA 2ODVA 4HKAA 1WR0A 2ZLYA 3FXEB 2M67A 2JMKA 3AA1B 1UGOA 1UX4A 4GOUA 3MXZA 3Q5XA 3LJCA 4JBWF 4IDOA 4ZI2C 5LYJE 5J2TE 2CXDA 4HGAA 3CPZA 3J9X1 3VRBA 2A9UA 3ZT6A 4YHHT 5HEJA 2E5LT 2KXPB 1WYCA 3ZT5A 3RYIE 2BBHA 2W62A 3F57A 4CN6A 2D0UA 2DNXA 5JDFA 1YXRA 2BZBA 2E9XB 1CHUA 2WY2A 3CQCB 3K3OA 2JQ9A 5AQJB 3BQKA 2E5VA 5ADXL 4G63A 3CQXC 2CMRA 2LEHA 3C98B 4EIWA 3IF8B 4ZEYA 1X79A 3PV0F 5CFBA 3KBTA 2IUBA 5FXXA 2XQ8A 5ABEA 3O1IA 3P4RA 1T72A 3QB5K 4G2AA 1VCTA 4TWFA 5ETWA 2WWVA 3PUAA 4KHPT 1XMOT 1OEDE 2X0HA 3Q2MA 3AE9A 3QUJA 3V5SA 5L2LA 3KDSE 4HFHA 2LSJA 1UUSA 2J1DG 4H9SE 2CLYB 3MJXA 3AXJA 1HX1B 1WLXA 1BR4A 2XQ5A 2YDRA 3N2GE 4L0RA 5HWYA 3RQUA 4TV8E 4H63H 4QH4A 3P7IA 3QB5A 1WFDA 1YQ3A 3AA0B 4X20E 3LDQB 2CM0A 4CN4A 5L3BB 2VL0A 1W09A 4H9QC 4HWCA 3SS1A 4WW0A 2LSIA 4DVDA 4ZI2D 5JVDE 2A3DA 2N1GA 1IBMT 4CI2B 3AVRA 2BKOA 3I0OA 2P9BA 4JI4T 4YSXA 4MBQA 3A7MA 3PDYA 5JR9C 5HXHA 2CEAA 4AQYT 4YHJA 1H7CA 3RKOA 5LHGB 3RKGA 3RPUA 3PUXF 4PK5A 2WDVA 4AI6A 4Z91A 3AVSA 5JREA 1HR0T 5DQWA 4DIDB 1UX5A 2X66A 4GYSA 4L9IA 3LBXB 5AQRB 5HXSA 4JI1T 2W67A 3NWIA 3RX6A 2EHOB 2NOXA 4CQIA 4DMVA 4DR1T 4AKIA 1FEWA 4KP3C 4TWHA 5FNVE 5JTGA 4O4LE 3N9NA 1OWAA 2VKOA 2C5IT 2YK0A 3NRYA 3ZSTA 3M65A 4C90A 4EEBA 5CA1E 2I59A 2IMLA 2DHRA 2LJLA 5AQGB 3TLUA 1OXZA 5H6RB 3NVOA 1R8IA 5KXJA 3PURA 2H7OA 2V26A 4OFZA 2Z6EA 2JRKA 2X51A 3JCFA 3RRCA 4NXNT 4QXCB 1XDOA 4HWHA 3IHRA 1YQ4A 3NZQA 3NBXX 2WU5A 2MBGA 3HKEE 4X1YE 1IJ5A 4KX6A 3TLTA 4LF6T 1J1JA 1FJGT 2XM1A 2NW7A 3Q5WA 4ANJA 3H3MA 4ERRA 3RC3A 2LM9A 1KEYA 2WMNA 3GN5B 4HFBA 5LP6E 2LT3A 3EABA 2BG9B 2EHOA 2HN1A 3EI0A 4KHZF 3ZC1A 3ZCIA 1S94A 5HCMA 3U78A 4LF4T 2HPLA 5FVLA 3AAIA 4EB6E 3O9XA 4TNVA 2W66A 1W0AA 2YKSA 4Z90A 1Y64B 3R84B 4Q25A 4U72A 2KZ7B 1FIOA 4QX7B 4DV4T 4ASKA 2EHOC 2PJQA 4WBOA 5JR9B 3C4WA 3ZC0A 3CIRA 4GKKT 5IHYA 4PW8A 1XNQT 3UU4A 2KNDA 1B7TA 2JQQA 3IEEA 3UUNA 1HTJF 4A97A 5LJNA 2E2AA 1OEDA 3H37A 5AQNB 2PG8A 3HKDE 3BQLA 4OK0A 4AKLA 1D0YA 3L09A 4WNKA 3LG7A 3C4XA 3RYCE 4YXDA 2FBWA 3AEEA 2JQHA 4Z8XA 4UF0B 3VR8A 2PFVA 4BJNA 2BG9C 3KV9A 2I6HA 1MIVA 2GK9A 2KMFA 1E2AA 3P4WA 4UXNB 3J7Yq 2ZM0A 4IDNA 2DL1A 5ABFA 4HFEA 3PUQA 3AE1A 5L4HA 2XQ6A 2VWAA 3EDUA 4XAXB 2V7KA 4YTMA 3RGLA 5A1LA 2LSGA 4B6XA 4ZI3C 2LSKA 4DBQA 2F4VT 1I94T 5AFUL 2FJEA 2D5UA 2J47A 3RI5A 1MNDA 2M6BA 3L8RA 4TX5A 1XDPA 4DR7T 3PUYF 3DTOA 4HFDA 4UV8B 3IBPA 3ZMTB 3PUSA 4YSYA 2JMHA 4QKNA 2ZM8A 5ABHA 4TUYE 5IWAT 4CI3B 3LK42 2YOEA 4AKRB 2KSRA 4ISTA 2H88A 3CVRA 3N9OA 3ZCJA 1HNWT 5LG4A 3AE7A 5J0ZA 4DR4T 4ILAA 4B3RT 2LSYA 4DV2T 3N9PA 5AQMB 2XSBA 2H3RA 3A8YC 4JUYA 2H89A 3RQWA 3OTOT 1E7PA 3EHZA 3I9WA 2XQ7A 4IDZA 3UQ4A 3LBXA 4DNDA 2BDEA 5L4EA 2LOSA 3JC6C 4U3CA 3MACA 2H7VC 4DR3T 4QX8B 1FMWA 1D0ZA 2ODUA 4QXHB 3CWZB 4UVAB 4C91A 2BS2A 4H9PC 4DMWA 1HX8A 2VQET 2CXLA 2Y48B 5F8PA 5AQVB 4DV7T 1N34T 2J4GA 1HNXT 3A5XA 3AA6B 4IL4A 3ZT7A 1T98A 5LHHB 3NRXA 2WB5A 5LXTE 3AE6A 3FZLB 4X65T 3PU3A 2CWYA 4X5TA 5EZYE 3RHWA 1YKHB 4NIQA 2V8SV 2D0TA 4E7ZA 1UCUA 2CLYC 3F31A 1YKEB 3PJAJ 4PJLA 4DBRA 3JC6D 3HA4A 4CI1B 1IBKT 3AEDA 3FZKB 3JAFA 3N9LA 1M7KA 4MHCA 3UT5E 2D9DA 2I0MA 2X9XA 3P4PA 2PTFA 3PJAA 3B57A 3KBUA 5FYMA 3N2KE 4A98A 2UUCT 4WBNE 4LFAT 5JDNA 3VKGA 4CXWA 3I1AA 3EVYA 4ZS3A 2K3WA 3HKCE 3HR0A 4AISA 3UUXB 4EYUA 3QK6A 5J2UE 1Z8UA 2C5KT 2X0YA 2XQ9A 3ONJA 4GK0E 2HHHT 4IDPA 4M1PA 4UIGA 4LF5T 2V6XA 3CX6B 2V5CA 2XAHB 2WZHA 3CX8B 5AQIB 2L3LA 4I4TE 4AQFC 4H63V 5FY0A 2VQFT 1J5ET 4EGWA 4IIJE 5AQSB 1WRDA 3ZJ1A 3ZPOA 4F8HA 5FKYA 4LMKA 3AEGA 3C4ZA 4IREA 4IE7A 4O4HE 1NEKA 4IT4A 4TNWA 5HEHA 2XQYA 4JYAT 1YD8G 4OHFA 2UXDT 4QXBB 4ZZBA 5LCYA 2VVSA 1D1CA 5FY7A 4LF9T 3UU3A 4O2AE 3CQGB 5LJMA 3X1DA 4B3ST 1IZNB 1ZEEA 2IAKA 4UR9A 3SWHA 1HFAA 3WI3A 4ZI7E 2X0LB 5LHIB 2QRXA 2VKJA 2WMOA 2BBJA 2DWKA 2YINA 4YJ3E 5LA6E 4LFBT 1S35A 2A72A 4O2BE 2EHOD 4GYRA 2E8IA 1WCRA 4X1IE 5KX5E 5FL0A 3ABVA 3E0ZA 4OX9T 3FZHB 4P09A 4P0BA 4XZCA 2K48A 3NZPA 2IC6A 2WS3A 5IYZE 1QSDA 2W4XA 2CBIA 2QGSA 2LOPA 5HEOA 3TLSA 3PUWF 2ZM6T 1N33T 3G06A 5EK4A 3S4UA 2XQAA 3GA8A 3UTKA 1SHZC 5GONE 4HWFA 3UQ7A 2LHRA 4NUVA 2V7MA 3OYZA 2JQKA 2QYWA 4X64T 3ZJ2A 4KI0F 2M6IA 1KF6A 3KFWX 3VHLA 5M4YA 3B13A 4PAGA 4ILUA 2V7JA 4EEDA 3ETUA 2VL8A 3MA9A 2CRBA 4KMCA 2KINB 3EDVA 4OYKA 4TWDA 5FXZA 2W0GA 4HEAA 3RLFF 4O4JE 3W15B 4F6RC 1VOMA 2UU9T 5FP3A 4TN7B 3OVUA 3DJBA 5ABGA 1M62A 2Y6XA 1MMDA 4ZZCA 4BA9A 2HN2A 4DUZT 3OJAA 3ZYKA 2L8KA 2CXFA 3C64A 3Q5DA 2V5DA 5AQUB 3ZYMA 2XQ3A 1SE7A 1MIYA 3OBVE 5AQHB 3UULA 4DR6T 1W0BA 2C0SA 4AKGA 1MIWA 3FZFB 3QNUA 2MYSA 3TKLB 4EZHA 3ZSSA 5L47A 1DU2A 2K9AA 4CXXA 1V9DA 5JDHA 3UUMA 2W00A 4PJJA 1XZYA 4UF0A 2R6GF 2E9XC 2BKNA 5H6QB 3AAAB 3PU8A 5LOVE 4JI2T 2LRLA 4P1NA 5C2TA 2NTXA 3RYHE 4DV1T 2L9QA 3ZN1B 4YFSA 2UXXB 4FJOA 3F2EA 2VB6A 4UELA 1HF8A 4U74A 3Q9DA 1SUMB 3BK9A 3C51A 3I9YA 3UU8A 5HYAA 5BR8T 4H9RC 1N32T 4CN1A 4YJ2E 3PTRB 3UUBA 4WYVA 4IDQA 3UFEA 2Y8DA 3RIAA 3ONXA 3C50A 1GQEA 2UXNB 3AAEB 2IHR1 3AEAA 2VKHA 3D0TA 3FBZA 3LFMA 4HFCA 5HXEA 2WSSV 5TAOA 2NR4A 2UXCT 1IAPA 2E9XD 3ETVA 4YLHA 5AQFB 2QVAA 4DV6T 3BQIA 5E0OA 1G8XA 2XAGB 1NAFA 2WU2A 3HKBE 3AB3B 3MZKB 4TV9E 1W9RA 4X66T 5HCJA 1IBLT 2WM9A 5KDMC 5L3FB 3OKQA 5JH7E 3KVAA 2WQYA 3LK3B 2CBJA 5HXCA 2XQ4A 5CA0E 2DI4A 4JI3T 3L3PA 4NUUA 4IL9A 3SOLA 2UXBT 4I55E 2Q9QB 3L39A 1LKXA 3K3NA 2WWUA 1ZP0A 2OLTA 3KVBA 2MPKA 2NP9A 3ESLA 3K8PC 4PK6A 2X9WA 1KNPA 4U2ZA 3ZLIA 5JQGE 5CJ5A 4HTEA 1ZKEA 3O4XE 2ZMAA 4GIWA 2MOZA 4YY3T 3TLVA 2AE9A 2X67A 2B76A 2D2SA 2WAUA 3LSVA 3M3ZB 3PE0A 5FL1A 4KBMB 5LG3A 2XAJB 4FI5A 1OEDB 2BS3A 3B5MA 1LRZA 3GWHA 4U33A 4UEMA 4U31A 3ZN0B 4BAYB 1JNZA 3EAMA 2LKGA 4DV3T 5FY1A 5AQTB 3P8CD 1U4QA 2BS4A 2ACXA 2LM2A 2OV9A 4LMLA 3KV5A 1QLBA 5HEUA 4U7YA 4AXPA 5C8YE 5DQVA 2FJDA 3E22E 2IC9A 2BVMA 2N2NA 4JI7T 3TLWA 1HCIA 3GN5A 4MFRA 5JR9A 3RH3A 3CK6A 4U2YA 4AQGA 2X9YA 3ANWA 1MMAA 5JDMA 1I6ZA 2HH7A 2KT9A 4I0UA 1US7B 2YDQA 4I43B 1KNRA 4H9OC 3KINB 4GK5E 2AXDS 5AQLB 2VK9A 5JRCA 4KUMB 2V6YA 4JI8T 4H9NC 1E1HB 3AECA 4IHJE 3N5LA 3WAJA 4AKHA 1T8BA 1QUUA 3PUZF 5LMUT 3RIUA 4O4IE 2G0UA 4CZZB 2PBIA 4IE4A 1LVFA 1ZOYA 2K24A 4QWNB 5EK2A 1BR0A 4UVBB 4AQFA 4HN9A 3ZKRA 3JAEA 2WCAA 5AQPB 3WAKA 3T1YT 4A5XA 2UUBT 4V1Av 4B3TT 4HFVA 4UVCB 3EUHA 2XPKA 3H3AA 4E7SA 3VRAA 2WP9A 4EYYR 4IGUA 3Q5EA 4DUYT 1Z0PA 1NENA 3K3QC 4PFOA 4ZS2A 3SRZA 2V7LA 1MNEA 2X68A 2RPAA 4JEHB 3ZMZB 2LRKA 4ILCA 3IA3A 1WR6A 5LBMA 1HG2A 4NXMT 4JV5T 1FMVA 5L3DB 3N9QA 2FJBA 2KLQA 2KWHA 2SPCA 4IE5A 2XM2A 3FBLA 5CGMA 2DLRA 1BR1A 1EZ3A 1HNZT 3SFDA 4PNIA 3VR9A 2N9DA 2YEVC 3ZMSB 5LGUB 2K5BB 3AE5A 1KNZA 3P50A 4IE6A 5KMGP 2RP4A 3FZMB 4LFCT 2LHNA 4EZ4A 4PFPA 1D1AA 3T8OA 4DR5T 3E08A 1AJ3A 2XZEA 5CB4E 4DV0T 4I50E 5HEGA 5FMNA 3FHNA 5AQKB 3ONLC 3ZYLA 2YU2A 1VCSA 1T7SA 4ZHQE 2BG9A 4PJMA 3O1HA 5DJQC 1UURA 1OEDC 2XAQB 4ADZA 2CA5A 2FUPA 2NTYA 2NW8A 2XSAA 2Q9QC 4IE0A 4ISSA 5L3GB 5AQQB 4DV5T 4AIUA 5L3CB 5HWXA 2XASB 3O1JA 4YT0A 2MTQA 1G73A 3RIUC 2BKPA 3MKDA 4HE8A 3K1SA 3PUGA 1J5WA 1ZHCA 2X9HA 1XNRT 4ZXLA 1MMGA 3HL6A 5ABFB 3GMIA 4B3MT 2E9XA 4L5GA 2V7IA 3RIFA 1IJ6A 1D0XA 3P4SA 5JDGA 5DABA 2BVLA 2XUEA 4ZI3D 3HI2A 4U7IA 4EXTA 1BR2A 4HFIA 5J1GA 2B1EA 4QHOA 2Q9QD 1ZV4X 3AA7B 4TZ4C 5LNKA
chains in the Genus database with same CATH topology
4HWHA 2D9DA 5AQMB 3A8YC 4HWDA 5AQQB 1UK5A 1I6ZA 4HWIB 1M62A 5AQRB 5AQLB 5AQUB 5AQVB 3M3ZB 5AQHB 1UGOA 3FZHB 5AQOB 1HX1B 5AQFB 3FZFB 3FZLB 5AQIB 5AQGB 5AQSB 3FZMB 3LDQB 4HWCA 5AQPB 5AQTB 4HWFA 5AQKB 3FZKB 5AQNB 5AQJB 1M7KA 1T7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWH A;  2D9D A;  5AQM B;  3A8Y C;  4HWD A;  5AQQ B;  1UK5 A;  1I6Z A;  4HWI B;  1M62 A;  5AQR B;  5AQL B;  5AQU B;  5AQV B;  3M3Z B;  5AQH B;  1UGO A;  3FZH B;  5AQO B;  1HX1 B;  5AQF B;  3FZF B;  3FZL B;  5AQI B;  5AQG B;  5AQS B;  3FZM B;  3LDQ B;  4HWC A;  5AQP B;  5AQT B;  4HWF A;  5AQK B;  3FZK B;  5AQN B;  5AQJ B;  1M7K A;  1T7S A; 
#chains in the Genus database with same CATH topology
 3LK2 B;  2J62 A;  2HPJ A;  5F5W A;  2JJ9 A;  3DP7 A;  4J2C A;  4JLE A;  2VAS A;  1N36 T;  2ZM2 A;  2DCF A;  4YTP A;  3SFE A;  1KFY A;  1HS7 A;  4ZOL E;  3VU7 H;  4LMJ A;  2NW9 A;  5LBQ B;  3VKH A;  5FXV A;  1L0V A;  2XHE B;  3U3I A;  4EAH A;  2DWG A;  2LLY A;  2UUA T;  2OA5 A;  3I0Q A;  3P4Q A;  5FXW A;  2BG9 E;  3FB2 A;  4QH5 A;  2V6Y B;  3QC9 A;  2A2F X;  2IW5 B;  3ZEF B;  2ES0 A;  3AE4 A;  4NPP A;  2W63 A;  4PK4 A;  1CUN A;  3OYX A;  5L3E B;  4GKJ T;  3T1H T;  4OYJ A;  3KV4 A;  2VVN A;  4K0K T;  3ZMU B;  1JNR A;  4JI5 T;  3RF1 A;  2ACZ A;  3CKD A;  4WZX A;  3QOF A;  5LGN B;  4DO0 A;  4JEU B;  3CML A;  1YW0 A;  3AE8 A;  3CX7 B;  4BJM A;  5LGT B;  1XMQ T;  2YN6 A;  1Y01 A;  3JAD A;  3RRW A;  3AEF A;  2WDQ A;  4HWD A;  2CE7 A;  2NWB A;  4EOZ B;  4XBF B;  5EK3 A;  1UK5 A;  4LF7 T;  2XTL A;  1KK7 A;  1D1B A;  5LB7 B;  1NWM X;  4EV6 A;  1LVK A;  5HAX A;  3RYF E;  1XWM A;  5IUX A;  3N9M A;  4QH1 A;  2CPT A;  2JIW A;  3NKZ A;  4A56 A;  5LMN T;  3AXJ B;  2FJA A;  4O8S A;  2CHN A;  2LKH A;  3AE2 A;  3FXD B;  4MAL A;  5HXR A;  3UU5 A;  2CCQ A;  5AQO B;  4COF A;  5JDL A;  1U5P A;  1WYB A;  2LE8 A;  2MAW A;  2W2U A;  2WZI A;  3OPC A;  4ILB A;  4N78 D;  3ZMV B;  5JDQ A;  1SA0 E;  2QA7 A;  4X1K E;  3KV6 A;  2VUR A;  5F3J A;  2JPF A;  1X9B A;  3V5U A;  4CXY A;  3UU6 A;  2Q9Q A;  2XJ7 A;  5FVK A;  4UV9 B;  2IIU A;  2RA1 A;  4PJN A;  1O3X A;  2C5J A;  2CWO A;  2WBL A;  4YTN A;  4JI6 T;  3RC8 A;  3AEB A;  2VKD A;  5BMV E;  3AE3 A;  3PUV F;  4LF8 T;  2IDO B;  2V1D B;  2YDS A;  2YU1 A;  3N2O A;  4MLK A;  4X62 T;  5JRC B;  2CHO A;  4DR2 T;  5C3J A;  2XAF B;  4P0A A;  4JI0 T;  4K0U A;  2W61 A;  1VRB A;  4HWI B;  3MK7 C;  3UFG A;  2WDR A;  2XY8 B;  2KWI B;  1HG5 A;  3ANW B;  4YSZ A;  3R6N A;  1MMN A;  2ODV A;  4HKA A;  1WR0 A;  2ZLY A;  3FXE B;  2M67 A;  2JMK A;  3AA1 B;  1UGO A;  1UX4 A;  4GOU A;  3MXZ A;  3Q5X A;  3LJC A;  4JBW F;  4IDO A;  4ZI2 C;  5LYJ E;  5J2T E;  2CXD A;  4HGA A;  3CPZ A;  3J9X 1;  3VRB A;  2A9U A;  3ZT6 A;  4YHH T;  5HEJ A;  2E5L T;  2KXP B;  1WYC A;  3ZT5 A;  3RYI E;  2BBH A;  2W62 A;  3F57 A;  4CN6 A;  2D0U A;  2DNX A;  5JDF A;  1YXR A;  2BZB A;  2E9X B;  1CHU A;  2WY2 A;  3CQC B;  3K3O A;  2JQ9 A;  5AQJ B;  3BQK A;  2E5V A;  5ADX L;  4G63 A;  3CQX C;  2CMR A;  2LEH A;  3C98 B;  4EIW A;  3IF8 B;  4ZEY A;  1X79 A;  3PV0 F;  5CFB A;  3KBT A;  2IUB A;  5FXX A;  2XQ8 A;  5ABE A;  3O1I A;  3P4R A;  1T72 A;  3QB5 K;  4G2A A;  1VCT A;  4TWF A;  5ETW A;  2WWV A;  3PUA A;  4KHP T;  1XMO T;  1OED E;  2X0H A;  3Q2M A;  3AE9 A;  3QUJ A;  3V5S A;  5L2L A;  3KDS E;  4HFH A;  2LSJ A;  1UUS A;  2J1D G;  4H9S E;  2CLY B;  3MJX A;  3AXJ A;  1HX1 B;  1WLX A;  1BR4 A;  2XQ5 A;  2YDR A;  3N2G E;  4L0R A;  5HWY A;  3RQU A;  4TV8 E;  4H63 H;  4QH4 A;  3P7I A;  3QB5 A;  1WFD A;  1YQ3 A;  3AA0 B;  4X20 E;  3LDQ B;  2CM0 A;  4CN4 A;  5L3B B;  2VL0 A;  1W09 A;  4H9Q C;  4HWC A;  3SS1 A;  4WW0 A;  2LSI A;  4DVD A;  4ZI2 D;  5JVD E;  2A3D A;  2N1G A;  1IBM T;  4CI2 B;  3AVR A;  2BKO A;  3I0O A;  2P9B A;  4JI4 T;  4YSX A;  4MBQ A;  3A7M A;  3PDY A;  5JR9 C;  5HXH A;  2CEA A;  4AQY T;  4YHJ A;  1H7C A;  3RKO A;  5LHG B;  3RKG A;  3RPU A;  3PUX F;  4PK5 A;  2WDV A;  4AI6 A;  4Z91 A;  3AVS A;  5JRE A;  1HR0 T;  5DQW A;  4DID B;  1UX5 A;  2X66 A;  4GYS A;  4L9I A;  3LBX B;  5AQR B;  5HXS A;  4JI1 T;  2W67 A;  3NWI A;  3RX6 A;  2EHO B;  2NOX A;  4CQI A;  4DMV A;  4DR1 T;  4AKI A;  1FEW A;  4KP3 C;  4TWH A;  5FNV E;  5JTG A;  4O4L E;  3N9N A;  1OWA A;  2VKO A;  2C5I T;  2YK0 A;  3NRY A;  3ZST A;  3M65 A;  4C90 A;  4EEB A;  5CA1 E;  2I59 A;  2IML A;  2DHR A;  2LJL A;  5AQG B;  3TLU A;  1OXZ A;  5H6R B;  3NVO A;  1R8I A;  5KXJ A;  3PUR A;  2H7O A;  2V26 A;  4OFZ A;  2Z6E A;  2JRK A;  2X51 A;  3JCF A;  3RRC A;  4NXN T;  4QXC B;  1XDO A;  4HWH A;  3IHR A;  1YQ4 A;  3NZQ A;  3NBX X;  2WU5 A;  2MBG A;  3HKE E;  4X1Y E;  1IJ5 A;  4KX6 A;  3TLT A;  4LF6 T;  1J1J A;  1FJG T;  2XM1 A;  2NW7 A;  3Q5W A;  4ANJ A;  3H3M A;  4ERR A;  3RC3 A;  2LM9 A;  1KEY A;  2WMN A;  3GN5 B;  4HFB A;  5LP6 E;  2LT3 A;  3EAB A;  2BG9 B;  2EHO A;  2HN1 A;  3EI0 A;  4KHZ F;  3ZC1 A;  3ZCI A;  1S94 A;  5HCM A;  3U78 A;  4LF4 T;  2HPL A;  5FVL A;  3AAI A;  4EB6 E;  3O9X A;  4TNV A;  2W66 A;  1W0A A;  2YKS A;  4Z90 A;  1Y64 B;  3R84 B;  4Q25 A;  4U72 A;  2KZ7 B;  1FIO A;  4QX7 B;  4DV4 T;  4ASK A;  2EHO C;  2PJQ A;  4WBO A;  5JR9 B;  3C4W A;  3ZC0 A;  3CIR A;  4GKK T;  5IHY A;  4PW8 A;  1XNQ T;  3UU4 A;  2KND A;  1B7T A;  2JQQ A;  3IEE A;  3UUN A;  1HTJ F;  4A97 A;  5LJN A;  2E2A A;  1OED A;  3H37 A;  5AQN B;  2PG8 A;  3HKD E;  3BQL A;  4OK0 A;  4AKL A;  1D0Y A;  3L09 A;  4WNK A;  3LG7 A;  3C4X A;  3RYC E;  4YXD A;  2FBW A;  3AEE A;  2JQH A;  4Z8X A;  4UF0 B;  3VR8 A;  2PFV A;  4BJN A;  2BG9 C;  3KV9 A;  2I6H A;  1MIV A;  2GK9 A;  2KMF A;  1E2A A;  3P4W A;  4UXN B;  3J7Y q;  2ZM0 A;  4IDN A;  2DL1 A;  5ABF A;  4HFE A;  3PUQ A;  3AE1 A;  5L4H A;  2XQ6 A;  2VWA A;  3EDU A;  4XAX B;  2V7K A;  4YTM A;  3RGL A;  5A1L A;  2LSG A;  4B6X A;  4ZI3 C;  2LSK A;  4DBQ A;  2F4V T;  1I94 T;  5AFU L;  2FJE A;  2D5U A;  2J47 A;  3RI5 A;  1MND A;  2M6B A;  3L8R A;  4TX5 A;  1XDP A;  4DR7 T;  3PUY F;  3DTO A;  4HFD A;  4UV8 B;  3IBP A;  3ZMT B;  3PUS A;  4YSY A;  2JMH A;  4QKN A;  2ZM8 A;  5ABH A;  4TUY E;  5IWA T;  4CI3 B;  3LK4 2;  2YOE A;  4AKR B;  2KSR A;  4IST A;  2H88 A;  3CVR A;  3N9O A;  3ZCJ A;  1HNW T;  5LG4 A;  3AE7 A;  5J0Z A;  4DR4 T;  4ILA A;  4B3R T;  2LSY A;  4DV2 T;  3N9P A;  5AQM B;  2XSB A;  2H3R A;  3A8Y C;  4JUY A;  2H89 A;  3RQW A;  3OTO T;  1E7P A;  3EHZ A;  3I9W A;  2XQ7 A;  4IDZ A;  3UQ4 A;  3LBX A;  4DND A;  2BDE A;  5L4E A;  2LOS A;  3JC6 C;  4U3C A;  3MAC A;  2H7V C;  4DR3 T;  4QX8 B;  1FMW A;  1D0Z A;  2ODU A;  4QXH B;  3CWZ B;  4UVA B;  4C91 A;  2BS2 A;  4H9P C;  4DMW A;  1HX8 A;  2VQE T;  2CXL A;  2Y48 B;  5F8P A;  5AQV B;  4DV7 T;  1N34 T;  2J4G A;  1HNX T;  3A5X A;  3AA6 B;  4IL4 A;  3ZT7 A;  1T98 A;  5LHH B;  3NRX A;  2WB5 A;  5LXT E;  3AE6 A;  3FZL B;  4X65 T;  3PU3 A;  2CWY A;  4X5T A;  5EZY E;  3RHW A;  1YKH B;  4NIQ A;  2V8S V;  2D0T A;  4E7Z A;  1UCU A;  2CLY C;  3F31 A;  1YKE B;  3PJA J;  4PJL A;  4DBR A;  3JC6 D;  3HA4 A;  4CI1 B;  1IBK T;  3AED A;  3FZK B;  3JAF A;  3N9L A;  1M7K A;  4MHC A;  3UT5 E;  2D9D A;  2I0M A;  2X9X A;  3P4P A;  2PTF A;  3PJA A;  3B57 A;  3KBU A;  5FYM A;  3N2K E;  4A98 A;  2UUC T;  4WBN E;  4LFA T;  5JDN A;  3VKG A;  4CXW A;  3I1A A;  3EVY A;  4ZS3 A;  2K3W A;  3HKC E;  3HR0 A;  4AIS A;  3UUX B;  4EYU A;  3QK6 A;  5J2U E;  1Z8U A;  2C5K T;  2X0Y A;  2XQ9 A;  3ONJ A;  4GK0 E;  2HHH T;  4IDP A;  4M1P A;  4UIG A;  4LF5 T;  2V6X A;  3CX6 B;  2V5C A;  2XAH B;  2WZH A;  3CX8 B;  5AQI B;  2L3L A;  4I4T E;  4AQF C;  4H63 V;  5FY0 A;  2VQF T;  1J5E T;  4EGW A;  4IIJ E;  5AQS B;  1WRD A;  3ZJ1 A;  3ZPO A;  4F8H A;  5FKY A;  4LMK A;  3AEG A;  3C4Z A;  4IRE A;  4IE7 A;  4O4H E;  1NEK A;  4IT4 A;  4TNW A;  5HEH A;  2XQY A;  4JYA T;  1YD8 G;  4OHF A;  2UXD T;  4QXB B;  4ZZB A;  5LCY A;  2VVS A;  1D1C A;  5FY7 A;  4LF9 T;  3UU3 A;  4O2A E;  3CQG B;  5LJM A;  3X1D A;  4B3S T;  1IZN B;  1ZEE A;  2IAK A;  4UR9 A;  3SWH A;  1HFA A;  3WI3 A;  4ZI7 E;  2X0L B;  5LHI B;  2QRX A;  2VKJ A;  2WMO A;  2BBJ A;  2DWK A;  2YIN A;  4YJ3 E;  5LA6 E;  4LFB T;  1S35 A;  2A72 A;  4O2B E;  2EHO D;  4GYR A;  2E8I A;  1WCR A;  4X1I E;  5KX5 E;  5FL0 A;  3ABV A;  3E0Z A;  4OX9 T;  3FZH B;  4P09 A;  4P0B A;  4XZC A;  2K48 A;  3NZP A;  2IC6 A;  2WS3 A;  5IYZ E;  1QSD A;  2W4X A;  2CBI A;  2QGS A;  2LOP A;  5HEO A;  3TLS A;  3PUW F;  2ZM6 T;  1N33 T;  3G06 A;  5EK4 A;  3S4U A;  2XQA A;  3GA8 A;  3UTK A;  1SHZ C;  5GON E;  4HWF A;  3UQ7 A;  2LHR A;  4NUV A;  2V7M A;  3OYZ A;  2JQK A;  2QYW A;  4X64 T;  3ZJ2 A;  4KI0 F;  2M6I A;  1KF6 A;  3KFW X;  3VHL A;  5M4Y A;  3B13 A;  4PAG A;  4ILU A;  2V7J A;  4EED A;  3ETU A;  2VL8 A;  3MA9 A;  2CRB A;  4KMC A;  2KIN B;  3EDV A;  4OYK A;  4TWD A;  5FXZ A;  2W0G A;  4HEA A;  3RLF F;  4O4J E;  3W15 B;  4F6R C;  1VOM A;  2UU9 T;  5FP3 A;  4TN7 B;  3OVU A;  3DJB A;  5ABG A;  1M62 A;  2Y6X A;  1MMD A;  4ZZC A;  4BA9 A;  2HN2 A;  4DUZ T;  3OJA A;  3ZYK A;  2L8K A;  2CXF A;  3C64 A;  3Q5D A;  2V5D A;  5AQU B;  3ZYM A;  2XQ3 A;  1SE7 A;  1MIY A;  3OBV E;  5AQH B;  3UUL A;  4DR6 T;  1W0B A;  2C0S A;  4AKG A;  1MIW A;  3FZF B;  3QNU A;  2MYS A;  3TKL B;  4EZH A;  3ZSS A;  5L47 A;  1DU2 A;  2K9A A;  4CXX A;  1V9D A;  5JDH A;  3UUM A;  2W00 A;  4PJJ A;  1XZY A;  4UF0 A;  2R6G F;  2E9X C;  2BKN A;  5H6Q B;  3AAA B;  3PU8 A;  5LOV E;  4JI2 T;  2LRL A;  4P1N A;  5C2T A;  2NTX A;  3RYH E;  4DV1 T;  2L9Q A;  3ZN1 B;  4YFS A;  2UXX B;  4FJO A;  3F2E A;  2VB6 A;  4UEL A;  1HF8 A;  4U74 A;  3Q9D A;  1SUM B;  3BK9 A;  3C51 A;  3I9Y A;  3UU8 A;  5HYA A;  5BR8 T;  4H9R C;  1N32 T;  4CN1 A;  4YJ2 E;  3PTR B;  3UUB A;  4WYV A;  4IDQ A;  3UFE A;  2Y8D A;  3RIA A;  3ONX A;  3C50 A;  1GQE A;  2UXN B;  3AAE B;  2IHR 1;  3AEA A;  2VKH A;  3D0T A;  3FBZ A;  3LFM A;  4HFC A;  5HXE A;  2WSS V;  5TAO A;  2NR4 A;  2UXC T;  1IAP A;  2E9X D;  3ETV A;  4YLH A;  5AQF B;  2QVA A;  4DV6 T;  3BQI A;  5E0O A;  1G8X A;  2XAG B;  1NAF A;  2WU2 A;  3HKB E;  3AB3 B;  3MZK B;  4TV9 E;  1W9R A;  4X66 T;  5HCJ A;  1IBL T;  2WM9 A;  5KDM C;  5L3F B;  3OKQ A;  5JH7 E;  3KVA A;  2WQY A;  3LK3 B;  2CBJ A;  5HXC A;  2XQ4 A;  5CA0 E;  2DI4 A;  4JI3 T;  3L3P A;  4NUU A;  4IL9 A;  3SOL A;  2UXB T;  4I55 E;  2Q9Q B;  3L39 A;  1LKX A;  3K3N A;  2WWU A;  1ZP0 A;  2OLT A;  3KVB A;  2MPK A;  2NP9 A;  3ESL A;  3K8P C;  4PK6 A;  2X9W A;  1KNP A;  4U2Z A;  3ZLI A;  5JQG E;  5CJ5 A;  4HTE A;  1ZKE A;  3O4X E;  2ZMA A;  4GIW A;  2MOZ A;  4YY3 T;  3TLV A;  2AE9 A;  2X67 A;  2B76 A;  2D2S A;  2WAU A;  3LSV A;  3M3Z B;  3PE0 A;  5FL1 A;  4KBM B;  5LG3 A;  2XAJ B;  4FI5 A;  1OED B;  2BS3 A;  3B5M A;  1LRZ A;  3GWH A;  4U33 A;  4UEM A;  4U31 A;  3ZN0 B;  4BAY B;  1JNZ A;  3EAM A;  2LKG A;  4DV3 T;  5FY1 A;  5AQT B;  3P8C D;  1U4Q A;  2BS4 A;  2ACX A;  2LM2 A;  2OV9 A;  4LML A;  3KV5 A;  1QLB A;  5HEU A;  4U7Y A;  4AXP A;  5C8Y E;  5DQV A;  2FJD A;  3E22 E;  2IC9 A;  2BVM A;  2N2N A;  4JI7 T;  3TLW A;  1HCI A;  3GN5 A;  4MFR A;  5JR9 A;  3RH3 A;  3CK6 A;  4U2Y A;  4AQG A;  2X9Y A;  3ANW A;  1MMA A;  5JDM A;  1I6Z A;  2HH7 A;  2KT9 A;  4I0U A;  1US7 B;  2YDQ A;  4I43 B;  1KNR A;  4H9O C;  3KIN B;  4GK5 E;  2AXD S;  5AQL B;  2VK9 A;  5JRC A;  4KUM B;  2V6Y A;  4JI8 T;  4H9N C;  1E1H B;  3AEC A;  4IHJ E;  3N5L A;  3WAJ A;  4AKH A;  1T8B A;  1QUU A;  3PUZ F;  5LMU T;  3RIU A;  4O4I E;  2G0U A;  4CZZ B;  2PBI A;  4IE4 A;  1LVF A;  1ZOY A;  2K24 A;  4QWN B;  5EK2 A;  1BR0 A;  4UVB B;  4AQF A;  4HN9 A;  3ZKR A;  3JAE A;  2WCA A;  5AQP B;  3WAK A;  3T1Y T;  4A5X A;  2UUB T;  4V1A v;  4B3T T;  4HFV A;  4UVC B;  3EUH A;  2XPK A;  3H3A A;  4E7S A;  3VRA A;  2WP9 A;  4EYY R;  4IGU A;  3Q5E A;  4DUY T;  1Z0P A;  1NEN A;  3K3Q C;  4PFO A;  4ZS2 A;  3SRZ A;  2V7L A;  1MNE A;  2X68 A;  2RPA A;  4JEH B;  3ZMZ B;  2LRK A;  4ILC A;  3IA3 A;  1WR6 A;  5LBM A;  1HG2 A;  4NXM T;  4JV5 T;  1FMV A;  5L3D B;  3N9Q A;  2FJB A;  2KLQ A;  2KWH A;  2SPC A;  4IE5 A;  2XM2 A;  3FBL A;  5CGM A;  2DLR A;  1BR1 A;  1EZ3 A;  1HNZ T;  3SFD A;  4PNI A;  3VR9 A;  2N9D A;  2YEV C;  3ZMS B;  5LGU B;  2K5B B;  3AE5 A;  1KNZ A;  3P50 A;  4IE6 A;  5KMG P;  2RP4 A;  3FZM B;  4LFC T;  2LHN A;  4EZ4 A;  4PFP A;  1D1A A;  3T8O A;  4DR5 T;  3E08 A;  1AJ3 A;  2XZE A;  5CB4 E;  4DV0 T;  4I50 E;  5HEG A;  5FMN A;  3FHN A;  5AQK B;  3ONL C;  3ZYL A;  2YU2 A;  1VCS A;  1T7S A;  4ZHQ E;  2BG9 A;  4PJM A;  3O1H A;  5DJQ C;  1UUR A;  1OED C;  2XAQ B;  4ADZ A;  2CA5 A;  2FUP A;  2NTY A;  2NW8 A;  2XSA A;  2Q9Q C;  4IE0 A;  4ISS A;  5L3G B;  5AQQ B;  4DV5 T;  4AIU A;  5L3C B;  5HWX A;  2XAS B;  3O1J A;  4YT0 A;  2MTQ A;  1G73 A;  3RIU C;  2BKP A;  3MKD A;  4HE8 A;  3K1S A;  3PUG A;  1J5W A;  1ZHC A;  2X9H A;  1XNR T;  4ZXL A;  1MMG A;  3HL6 A;  5ABF B;  3GMI A;  4B3M T;  2E9X A;  4L5G A;  2V7I A;  3RIF A;  1IJ6 A;  1D0X A;  3P4S A;  5JDG A;  5DAB A;  2BVL A;  2XUE A;  4ZI3 D;  3HI2 A;  4U7I A;  4EXT A;  1BR2 A;  4HFI A;  5J1G A;  2B1E A;  4QHO A;  2Q9Q D;  1ZV4 X;  3AA7 B;  4TZ4 C;  5LNK A; 
#chains in the Genus database with same CATH homology
 4HWH A;  2D9D A;  5AQM B;  3A8Y C;  4HWD A;  5AQQ B;  1UK5 A;  1I6Z A;  4HWI B;  1M62 A;  5AQR B;  5AQL B;  5AQU B;  5AQV B;  3M3Z B;  5AQH B;  1UGO A;  3FZH B;  5AQO B;  1HX1 B;  5AQF B;  3FZF B;  3FZL B;  5AQI B;  5AQG B;  5AQS B;  3FZM B;  3LDQ B;  4HWC A;  5AQP B;  5AQT B;  4HWF A;  5AQK B;  3FZK B;  5AQN B;  5AQJ B;  1M7K A;  1T7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...