5AQIB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqiB00
5AQNB 5AQJB 5AQMB 5AQRB 4HWFA 1M7KA 2D9DA 5AQQB 1M62A 3M3ZB 3A8YC 1HX1B 1T7SA 4HWHA 5AQKB 3FZMB 5AQVB 3FZKB 5AQSB 3FZFB 1UK5A 5AQIB 4HWIB 3FZLB 4HWDA 5AQHB 5AQGB 1I6ZA 5AQTB 5AQFB 1UGOA 4HWCA 5AQUB 5AQLB 3FZHB 3LDQB 5AQOB 5AQPB
chains in the Genus database with same CATH superfamily
4ANJA 4QXHB 3ZN0B 4AKRB 2V26A 3ESLA 4DMVA 2HHHT 2LRKA 2WWUA 4ZEYA 4HEAA 3ANWB 2XZEA 4LMJA 3MA9A 4ERRA 4AKIA 1LRZA 4NXMT 5LNKA 4OFZA 3I1AA 4Z8XA 2JRKA 2F4VT 4ISSA 5HEHA 4PJJA 4P0BA 3UU5A 2L9QA 3T1HT 5L3DB 5BR8T 5TAOA 3NWIA 1AJ3A 3KBTA 3UTKA 4O8SA 3N2GE 4KHPT 4WW0A 4UR9A 5L2LA 2XAJB 4IREA 1UX4A 2V5DA 3AE1A 2PTFA 2FJDA 2WWVA 3Q5XA 2MTQA 2VL0A 2JPFA 5LP6E 3AE7A 1FJGT 3GWHA 2UUCT 5AQRB 2ZM2A 4J2CA 2XTLA 3LBXB 2IC6A 1G73A 4F6RC 1QUUA 3VRAA 2WDRA 3FB2A 4I43B 5HXCA 1VCSA 3P50A 3RRCA 2VL8A 3PUGA 3L09A 3N9PA 5FL1A 2RPAA 4PJNA 5FP3A 4HWDA 3PUVF 5ABHA 3ZC1A 3NZQA 1EZ3A 3ZJ2A 2YKSA 4QKNA 2ODVA 2X66A 3I0OA 3P8CD 2ZLYA 4HWHA 4FI5A 4B3RT 3NZPA 4U31A 3FZLB 2WB5A 2Z6EA 2IUBA 4JBWF 3PU8A 4YTMA 1E1HB 2Y48B 3EABA 1XMOT 1T7SA 3Q9DA 5AQVB 5FY1A 3OYXA 5HEJA 3BQKA 3C4WA 3VKGA 4H63H 2LJLA 3T8OA 3NRYA 3AE2A 3K8PC 2XQAA 3IHRA 2D2SA 3CKDA 3Q5WA 1Y01A 5F8PA 3A5XA 3AA0B 3EDVA 1W0BA 1W09A 4M1PA 4P0AA 3SRZA 2LLYA 3AEEA 3GN5B 4X66T 2VK9A 2JMHA 3ZT6A 2R6GF 1KK7A 3V5SA 1LVFA 2DLRA 2P9BA 3SOLA 4EV6A 2DHRA 2CLYB 2V6YA 4CI3B 5L4HA 3QNUA 4QH5A 4IIJE 1J5ET 4O4JE 1M7KA 3NRXA 4C90A 5EK4A 2N1GA 5FXZA 4FJOA 2KNDA 2X9YA 3QB5A 4PJMA 4COFA 2C0SA 4H9SE 2VKOA 1X79A 1U5PA 1YD8G 2XPKA 3UULA 3OPCA 3I9YA 3FBZA 2VKJA 2MBGA 4LF4T 2KZ7B 2PG8A 3AE3A 4I50E 2CMRA 4OK0A 4MFRA 1ZV4X 1GQEA 4A5XA 3ZT5A 2XJ7A 1ZKEA 5JDGA 2RP4A 3FBLA 1NWMX 2E8IA 5L3FB 3IEEA 4LF6T 5AQOB 3AA7B 3RRWA 2JMKA 5LG3A 3BQLA 2PFVA 1IBKT 1S94A 4DR1T 4HFBA 2X51A 3RYHE 3UFEA 4QX7B 3FZFB 3P4RA 4HWIB 1R8IA 2I59A 3VRBA 4ZI7E 4IL4A 4DR6T 3RH3A 5HXEA 2IC9A 2MOZA 1HCIA 2CHOA 3LFMA 4L9IA 2BS2A 3RC8A 2UXCT 2W62A 5DQWA 3OJAA 4H9OC 2XQ4A 3IBPA 5L4EA 4DV1T 5LHHB 2X0LB 4UV9B 2NW8A 4PK5A 4X62T 3ZJ1A 2FBWA 3NKZA 3RHWA 1MIVA 3CIRA 2IIUA 2D0TA 2LSIA 4HKAA 4ZS3A 4A97A 2WY2A 4HTEA 4YJ3E 4JUYA 3F2EA 3AB3B 2WCAA 5A1LA 2WZIA 3JC6D 3PE0A 2LOSA 2LM2A 3RIUC 3AE5A 4LF7T 3M3ZB 3O4XE 4JI5T 1HX8A 2H7VC 3FZKB 3HKBE 4F8HA 2W63A 1MNEA 2PJQA 4O2AE 2CEAA 4UELA 2JQQA 4ZOLE 4DNDA 1BR4A 1HTJF 3RGLA 5JREA 4LFBT 3AVRA 4HWFA 4JV5T 4QWNB 4CN4A 1N32T 4A56A 5JDMA 1HFAA 5AQGB 5LJMA 2XAGB 3AA1B 1WLXA 5CA1E 4YTPA 4HE8A 2ODUA 3K3OA 4G63A 2YU2A 1OXZA 4HFIA 4ZI2C 4AI6A 3OVUA 4X1KE 1IJ6A 2M6BA 3C50A 3ZMZB 3N2OA 1D0XA 3C4XA 3L3PA 3N9OA 3CMLA 2WM9A 1IZNB 4DR4T 5HYAA 1XMQT 4WYVA 3ZMVB 1XWMA 4ZS2A 4KBMB 2YOEA 1WR6A 5LBMA 5EK3A 4YSZA 2W61A 4EEDA 1ZEEA 1MMNA 4IE5A 3UQ7A 3RQUA 3CVRA 4X1YE 2E9XA 2J47A 3L8RA 1FIOA 2CRBA 5HCMA 5C8YE 2ZM0A 5L3BB 5IHYA 2IAKA 3V5UA 2V7MA 1VRBA 4DIDB 4DV0T 4TN7B 4EB6E 3VR8A 5HCJA 2YK0A 3B13A 2N9DA 5EK2A 3AXJB 3VHLA 2UXXB 2A2FX 4IT4A 1WYBA 2K24A 3KDSE 3KV4A 5JDQA 3UU8A 3MK7C 2CE7A 2HN2A 3LJCA 1XZYA 2QA7A 4GYSA 4O2BE 5HWYA 2VWAA 1G8XA 3JC6C 2FUPA 3B57A 5JDLA 3PDYA 3PU3A 3ZKRA 2LE8A 4UEMA 4TWFA 3E22E 1XDPA 3PV0F 4GKKT 4I0UA 4PAGA 2XSBA 5AQTB 3UUNA 4JEUB 2Y8DA 1UX5A 2LEHA 3KV9A 3O9XA 2VQFT 4U7YA 5JRCA 1WYCA 3RKGA 5FY0A 5IYZE 2XQ9A 4PFPA 3Q2MA 4U2ZA 5LBQB 2Y6XA 2XQ8A 2WAUA 3VKHA 2OLTA 2XUEA 4X64T 4AISA 5AQMB 2LSYA 1OEDA 5KX5E 2WP9A 2BDEA 4TWDA 3ZC0A 1MIWA 4JYAT 3HKEE 3RC3A 3A7MA 4CXYA 3HI2A 4LF9T 2AE9A 2WQYA 1E2AA 2XASB 3Q5DA 4B3ST 2J62A 2PBIA 2B1EA 4QHOA 5LA6E 5FNVE 4TUYE 1NAFA 1FEWA 3N9QA 5CGMA 2QRXA 4CI2B 5FMNA 3CX8B 5KMGP 1JNRA 1SHZC 3L39A 2IHR1 5HEOA 4ZZBA 3LK2B 3UU3A 3MACA 3KBUA 3N5LA 4GOUA 2NR4A 4LF8T 3AAAB 5LHGB 4JI3T 3ETVA 5FXXA 4UVBB 3LK42 4OYJA 3K1SA 1HS7A 2CBJA 4IE0A 4DV6T 2KLQA 4ZI3D 4K0UA 2W00A 2BS4A 2DWGA 4CI1B 3K3NA 5LMNT 3AA6B 4PK4A 3VR9A 4BJMA 2MPKA 3BK9A 2LOPA 5LXTE 4CQIA 2DL1A 1MMDA 1D1CA 1XNQT 3PUWF 3EUHA 3KV6A 4CXXA 4HN9A 2M6IA 2DNXA 3AE8A 2E5LT 2IDOB 2M67A 2CCQA 4B3MT 5HWXA 2LKGA 1D0YA 3PJAJ 1MMAA 3AEBA 1KFYA 3ZMTB 5ETWA 5HXSA 4JI4T 2VKDA 5AQNB 4DV3T 2BBHA 5LG4A 1HNXT 5AQQB 1KEYA 2CHNA 3PURA 3EVYA 3ZPOA 1YKEB 1T98A 5HEUA 2E5VA 3TLVA 5L3GB 4Z90A 5ABEA 2K3WA 2CWOA 5C2TA 2LM9A 4X20E 2XSAA 3KVAA 4KUMB 4IHJE 2FJEA 3RQWA 4V1Av 5LJNA 2V6YB 1WCRA 4TV9E 3P4SA 2XHEB 3P4PA 1KNRA 4L0RA 4EXTA 3C64A 3ZSSA 2D9DA 2C5JA 4TNVA 3OKQA 2UXNB 4OX9T 1ZHCA 4CN1A 2MYSA 4HWCA 3M65A 1KNZA 2LSGA 1JNZA 4Q25A 4AQFC 2DWKA 4JLEA 4AQFA 2RA1A 4ZI2D 3HR0A 3PJAA 2WDVA 4E7SA 3HKCE 4ZI3C 4DV5T 3UUBA 2KWHA 1V9DA 1BR2A 1Z8UA 3BQIA 5LOVE 1N34T 2YDSA 5JTGA 5C3JA 4ILCA 4U33A 4AQGA 3KVBA 5LHIB 5ADXL 3LSVA 1KNPA 4GIWA 5HEGA 1NENA 4O4HE 2QYWA 4HGAA 5IUXA 1OEDE 5AQKB 4U2YA 2H88A 4CZZB 4BJNA 4ZHQE 3ETUA 2E9XD 2V7IA 2LSKA 3JCFA 2UUAT 2X9WA 2BS3A 3CX7B 5HAXA 3ONLC 3R84B 2I0MA 2BZBA 2KSRA 4NUUA 3D0TA 4JI8T 5J2UE 4IE7A 3ONXA 5JR9C 4O4LE 4EZ4A 4GKJT 5JR9A 3JAFA 2YDRA 3PUZF 4DV2T 3WI3A 3AEGA 2VVNA 4DBRA 3K3QC 5AQHB 4UF0A 3JADA 2X0HA 4NIQA 5AQUB 1HNWT 3WAJA 5FYMA 3N9LA 4U3CA 3FXEB 1D0ZA 3AEFA 3HKDE 4IL9A 2WMNA 2NTXA 3O1JA 3QB5K 2BKOA 2V7LA 2L8KA 2KT9A 4YT0A 1UCUA 4UF0B 5BMVE 3CK6A 2XQ7A 2UU9T 2JQHA 1I94T 5FL0A 1Y64B 4BA9A 2BVLA 2QGSA 1YW0A 3TLTA 2NWBA 2HH7A 5L3CB 3Q5EA 3RIFA 2X9XA 1HR0T 5L3EB 2WU2A 2XAHB 5LGUB 5J0ZA 4AXPA 3ZSTA 4WBNE 4E7ZA 3HL6A 3AAEB 4YXDA 1CHUA 5FY7A 4CXWA 1M62A 3E08A 4CN6A 2KINB 2Q9QD 3RIAA 5JDFA 2K9AA 4WZXA 4AKHA 2G0UA 4EAHA 3IF8B 4PK6A 3H37A 4DR7T 2E2AA 5KDMC 3NBXX 4ZZCA 4QXCB 2VB6A 5DJQC 1D1AA 4I4TE 2WBLA 1BR1A 3LK3B 2OV9A 5DABA 2JIWA 2E9XC 4MBQA 3ONJA 4TX5A 3EAMA 1D1BA 5ABFA 2XAQB 2CBIA 1WRDA 2L3LA 1ZOYA 3ZCJA 5LGTB 1UK5A 1LVKA 1E7PA 2VASA 3SFDA 4GK0E 3U3IA 2E9XB 3I0QA 4QH4A 2LSJA 5HXHA 1FMWA 2YN6A 4B3TT 1HF8A 4UIGA 4I55E 4DR3T 2JJ9A 5F5WA 1YQ4A 1OWAA 2YEVC 4O4IE 4JI2T 5HXRA 4EOZB 4YHHT 4IDZA 2XQ5A 1W0AA 3ZN1B 3ANWA 2HPLA 4EYUA 2WU5A 3EDUA 2LHNA 3PUYF 3RLFF 4YTNA 2V1DB 2WMOA 4QX8B 3C51A 1XDOA 2J1DG 4JI1T 3AAIA 3DTOA 3H3AA 3TLWA 2VKHA 3UUXB 1US7B 3ZYLA 3ZMSB 5AFUL 2ZM8A 3VU7H 4KP3C 3ABVA 3OBVE 4G2AA 5LYJE 3CQXC 3AE9A 4AQYT 2LRLA 1OEDC 4L5GA 2ACZA 1YKHB 4JI0T 5JRCB 1LKXA 5JH7E 4WBOA 2LHRA 2Q9QC 2FJBA 2ZMAA 3DP7A 1VOMA 4MHCA 4JEHB 4BAYB 3GMIA 4DO0A 2Q9QA 5ABGA 4UXNB 2D0UA 3C4ZA 3MJXA 5LMUT 2ACXA 3CQCB 1WFDA 4YY3T 3B5MA 2ES0A 4GK5E 4U7IA 1IBLT 3LBXA 1OEDB 3RYIE 4EGWA 3KV5A 4KHZF 4EEBA 2Q9QB 3AEDA 2NW9A 2XM2A 2A72A 2BKPA 2KMFA 4TZ4C 4UVCB 2CWYA 5LB7B 4ILUA 1YQ3A 3RYCE 3AE4A 2UXBT 2N2NA 2ZM6T 3QK6A 1UGOA 3UFGA 4WNKA 5DQVA 2V7JA 4QH1A 1T8BA 3RKOA 3MXZA 3QC9A 4K0KT 1YXRA 2KWIB 3TLUA 4MLKA 3UU4A 3OTOT 5FXWA 2YINA 4H9QC 4TWHA 4P09A 4XBFB 2XY8B 3SWHA 3W15B 3P7IA 1MNDA 4LFAT 4DV7T 4DUZT 2EHOD 5FVKA 3PUQA 4H9PC 1DU2A 2C5IT 2VQET 2CXFA 2DI4A 3ZEFB 1S35A 1W9RA 5JDHA 5LCYA 3FZHB 2BKNA 3F57A 1IBMT 2IW5B 2UUBT 5CJ5A 4ADZA 3NVOA 2WZHA 4UV8B 4N78D 3PTRB 3CPZA 2BG9E 2C5KT 4NUVA 1J1JA 4UVAB 2OA5A 1X9BA 1MIYA 3ZCIA 4DR5T 2XM1A 4HFEA 1L0VA 2K48A 3P4WA 4HFVA 3GN5A 3CX6B 3ZT7A 2W67A 4H9RC 1SUMB 3C98B 3KINB 4LMLA 3RPUA 2V8SV 3O1HA 3A8YC 2CLYC 2X67A 1SE7A 4EZHA 2XQYA 2W66A 3LG7A 4TV8E 2X0YA 2LT3A 1N33T 2V6XA 3DJBA 4QXBB 3SFEA 2KXPB 4JI7T 3AE6A 2X68A 3AVSA 5AQFB 2NTYA 4KX6A 4AIUA 3T1YT 5AQLB 4DBQA 2I6HA 3LDQB 4YLHA 2WDQA 4NXNT 3R6NA 2MAWA 2HN1A 4OHFA 2YDQA 2VURA 4ILAA 3EHZA 5JVDE 3J7Yq 4H63V 3AEAA 4TNWA 4ZXLA 3P4QA 1XNRT 4HFDA 3G06A 4HFCA 4NPPA 5GONE 2H89A 4AKGA 5M4YA 1J5WA 5E0OA 4IE6A 2EHOC 1CUNA 1UURA 2XQ3A 4X5TA 2EHOA 4YFSA 4IE4A 4P1NA 2JQKA 2H3RA 4AKLA 3RI5A 4IDOA 3WAKA 2CXLA 2V5CA 2NP9A 4X1IE 2EHOB 4U72A 2YU1A 5F3JA 5FVLA 3N2KE 2D5UA 2J4GA 3O1IA 4IDQA 2WSSV 4DV4T 5EZYE 3ZYKA 5KXJA 4XZCA 2A3DA 2A9UA 4ASKA 1H7CA 4IDPA 5AQIB 3UU6A 2XAFB 4PJLA 2VVSA 5JR9B 2NW7A 4OYKA 1FMVA 2IMLA 2NOXA 4C91A 4MALA 3PUSA 3AECA 2WS3A 1KF6A 5L47A 1WR0A 3GA8A 5AQPB 2QVAA 4ILBA 1VCTA 5CB4E 4YHJA 4DMWA 2HPJA 3SS1A 3U78A 5FKYA 2BVMA 3RIUA 3TLSA 5AQSB 4A98A 2W4XA 1MMGA 2B76A 1BR0A 5J2TE 3HA4A 1I6ZA 2CM0A 3PUXF 3TKLB 3MZKB 3MKDA 3N9MA 4U74A 4H9NC 4LMKA 2LKHA 3EI0A 4B6XA 2H7OA 3PUAA 1U4QA 5IWAT 1IJ5A 2XQ6A 4LFCT 3QOFA 2AXDS 4HFHA 1SA0E 4Z91A 3RYFE 1ZP0A 2FJAA 2BG9C 4EYYR 3H3MA 5LGNB 4YJ2E 3FZMB 1N36T 2GK9A 2BG9A 3UUMA 3S4UA 4YSXA 4EIWA 4X65T 2SPCA 3JAEA 5H6RB 4YSYA 4DUYT 4IGUA 1UUSA 2CA5A 3X1DA 3E0ZA 4IDNA 1IAPA 5JQGE 2CXDA 4PFOA 2CPTA 1HX1B 1QSDA 3RF1A 5FXVA 2BG9B 3FXDB 5JDNA 1HG5A 1Z0PA 3KFWX 3CWZB 2DCFA 5J1GA 2X9HA 3FHNA 3N9NA 5ABFB 1HG2A 3OYZA 3AXJA 4GYRA 3J9X1 3ZMUB 1T72A 5AQJB 1NEKA 5CA0E 2BBJA 2JQ9A 5H6QB 4JI6T 1O3XA 2V7KA 3CQGB 4KMCA 3RX6A 1B7TA 4KI0F 2W2UA 2W0GA 3QUJA 5CFBA 4LF5T 4DR2T 2K5BB 3UT5E 4DVDA 4XAXB 3ZLIA 3UQ4A 4ISTA 3I9WA 4PW8A 2UXDT 1HNZT 3ZYMA 3F31A 4PNIA 1QLBA 3IA3A
chains in the Genus database with same CATH topology
5AQNB 5AQJB 5AQMB 5AQRB 4HWFA 1M7KA 2D9DA 5AQQB 1M62A 3M3ZB 3A8YC 1HX1B 1T7SA 4HWHA 5AQKB 3FZMB 5AQVB 3FZKB 5AQSB 3FZFB 1UK5A 5AQIB 4HWIB 3FZLB 4HWDA 5AQHB 5AQGB 1I6ZA 5AQTB 5AQFB 1UGOA 4HWCA 5AQUB 5AQLB 3FZHB 3LDQB 5AQOB 5AQPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQN B;  5AQJ B;  5AQM B;  5AQR B;  4HWF A;  1M7K A;  2D9D A;  5AQQ B;  1M62 A;  3M3Z B;  3A8Y C;  1HX1 B;  1T7S A;  4HWH A;  5AQK B;  3FZM B;  5AQV B;  3FZK B;  5AQS B;  3FZF B;  1UK5 A;  5AQI B;  4HWI B;  3FZL B;  4HWD A;  5AQH B;  5AQG B;  1I6Z A;  5AQT B;  5AQF B;  1UGO A;  4HWC A;  5AQU B;  5AQL B;  3FZH B;  3LDQ B;  5AQO B;  5AQP B; 
#chains in the Genus database with same CATH topology
 4ANJ A;  4QXH B;  3ZN0 B;  4AKR B;  2V26 A;  3ESL A;  4DMV A;  2HHH T;  2LRK A;  2WWU A;  4ZEY A;  4HEA A;  3ANW B;  2XZE A;  4LMJ A;  3MA9 A;  4ERR A;  4AKI A;  1LRZ A;  4NXM T;  5LNK A;  4OFZ A;  3I1A A;  4Z8X A;  2JRK A;  2F4V T;  4ISS A;  5HEH A;  4PJJ A;  4P0B A;  3UU5 A;  2L9Q A;  3T1H T;  5L3D B;  5BR8 T;  5TAO A;  3NWI A;  1AJ3 A;  3KBT A;  3UTK A;  4O8S A;  3N2G E;  4KHP T;  4WW0 A;  4UR9 A;  5L2L A;  2XAJ B;  4IRE A;  1UX4 A;  2V5D A;  3AE1 A;  2PTF A;  2FJD A;  2WWV A;  3Q5X A;  2MTQ A;  2VL0 A;  2JPF A;  5LP6 E;  3AE7 A;  1FJG T;  3GWH A;  2UUC T;  5AQR B;  2ZM2 A;  4J2C A;  2XTL A;  3LBX B;  2IC6 A;  1G73 A;  4F6R C;  1QUU A;  3VRA A;  2WDR A;  3FB2 A;  4I43 B;  5HXC A;  1VCS A;  3P50 A;  3RRC A;  2VL8 A;  3PUG A;  3L09 A;  3N9P A;  5FL1 A;  2RPA A;  4PJN A;  5FP3 A;  4HWD A;  3PUV F;  5ABH A;  3ZC1 A;  3NZQ A;  1EZ3 A;  3ZJ2 A;  2YKS A;  4QKN A;  2ODV A;  2X66 A;  3I0O A;  3P8C D;  2ZLY A;  4HWH A;  4FI5 A;  4B3R T;  3NZP A;  4U31 A;  3FZL B;  2WB5 A;  2Z6E A;  2IUB A;  4JBW F;  3PU8 A;  4YTM A;  1E1H B;  2Y48 B;  3EAB A;  1XMO T;  1T7S A;  3Q9D A;  5AQV B;  5FY1 A;  3OYX A;  5HEJ A;  3BQK A;  3C4W A;  3VKG A;  4H63 H;  2LJL A;  3T8O A;  3NRY A;  3AE2 A;  3K8P C;  2XQA A;  3IHR A;  2D2S A;  3CKD A;  3Q5W A;  1Y01 A;  5F8P A;  3A5X A;  3AA0 B;  3EDV A;  1W0B A;  1W09 A;  4M1P A;  4P0A A;  3SRZ A;  2LLY A;  3AEE A;  3GN5 B;  4X66 T;  2VK9 A;  2JMH A;  3ZT6 A;  2R6G F;  1KK7 A;  3V5S A;  1LVF A;  2DLR A;  2P9B A;  3SOL A;  4EV6 A;  2DHR A;  2CLY B;  2V6Y A;  4CI3 B;  5L4H A;  3QNU A;  4QH5 A;  4IIJ E;  1J5E T;  4O4J E;  1M7K A;  3NRX A;  4C90 A;  5EK4 A;  2N1G A;  5FXZ A;  4FJO A;  2KND A;  2X9Y A;  3QB5 A;  4PJM A;  4COF A;  2C0S A;  4H9S E;  2VKO A;  1X79 A;  1U5P A;  1YD8 G;  2XPK A;  3UUL A;  3OPC A;  3I9Y A;  3FBZ A;  2VKJ A;  2MBG A;  4LF4 T;  2KZ7 B;  2PG8 A;  3AE3 A;  4I50 E;  2CMR A;  4OK0 A;  4MFR A;  1ZV4 X;  1GQE A;  4A5X A;  3ZT5 A;  2XJ7 A;  1ZKE A;  5JDG A;  2RP4 A;  3FBL A;  1NWM X;  2E8I A;  5L3F B;  3IEE A;  4LF6 T;  5AQO B;  3AA7 B;  3RRW A;  2JMK A;  5LG3 A;  3BQL A;  2PFV A;  1IBK T;  1S94 A;  4DR1 T;  4HFB A;  2X51 A;  3RYH E;  3UFE A;  4QX7 B;  3FZF B;  3P4R A;  4HWI B;  1R8I A;  2I59 A;  3VRB A;  4ZI7 E;  4IL4 A;  4DR6 T;  3RH3 A;  5HXE A;  2IC9 A;  2MOZ A;  1HCI A;  2CHO A;  3LFM A;  4L9I A;  2BS2 A;  3RC8 A;  2UXC T;  2W62 A;  5DQW A;  3OJA A;  4H9O C;  2XQ4 A;  3IBP A;  5L4E A;  4DV1 T;  5LHH B;  2X0L B;  4UV9 B;  2NW8 A;  4PK5 A;  4X62 T;  3ZJ1 A;  2FBW A;  3NKZ A;  3RHW A;  1MIV A;  3CIR A;  2IIU A;  2D0T A;  2LSI A;  4HKA A;  4ZS3 A;  4A97 A;  2WY2 A;  4HTE A;  4YJ3 E;  4JUY A;  3F2E A;  3AB3 B;  2WCA A;  5A1L A;  2WZI A;  3JC6 D;  3PE0 A;  2LOS A;  2LM2 A;  3RIU C;  3AE5 A;  4LF7 T;  3M3Z B;  3O4X E;  4JI5 T;  1HX8 A;  2H7V C;  3FZK B;  3HKB E;  4F8H A;  2W63 A;  1MNE A;  2PJQ A;  4O2A E;  2CEA A;  4UEL A;  2JQQ A;  4ZOL E;  4DND A;  1BR4 A;  1HTJ F;  3RGL A;  5JRE A;  4LFB T;  3AVR A;  4HWF A;  4JV5 T;  4QWN B;  4CN4 A;  1N32 T;  4A56 A;  5JDM A;  1HFA A;  5AQG B;  5LJM A;  2XAG B;  3AA1 B;  1WLX A;  5CA1 E;  4YTP A;  4HE8 A;  2ODU A;  3K3O A;  4G63 A;  2YU2 A;  1OXZ A;  4HFI A;  4ZI2 C;  4AI6 A;  3OVU A;  4X1K E;  1IJ6 A;  2M6B A;  3C50 A;  3ZMZ B;  3N2O A;  1D0X A;  3C4X A;  3L3P A;  3N9O A;  3CML A;  2WM9 A;  1IZN B;  4DR4 T;  5HYA A;  1XMQ T;  4WYV A;  3ZMV B;  1XWM A;  4ZS2 A;  4KBM B;  2YOE A;  1WR6 A;  5LBM A;  5EK3 A;  4YSZ A;  2W61 A;  4EED A;  1ZEE A;  1MMN A;  4IE5 A;  3UQ7 A;  3RQU A;  3CVR A;  4X1Y E;  2E9X A;  2J47 A;  3L8R A;  1FIO A;  2CRB A;  5HCM A;  5C8Y E;  2ZM0 A;  5L3B B;  5IHY A;  2IAK A;  3V5U A;  2V7M A;  1VRB A;  4DID B;  4DV0 T;  4TN7 B;  4EB6 E;  3VR8 A;  5HCJ A;  2YK0 A;  3B13 A;  2N9D A;  5EK2 A;  3AXJ B;  3VHL A;  2UXX B;  2A2F X;  4IT4 A;  1WYB A;  2K24 A;  3KDS E;  3KV4 A;  5JDQ A;  3UU8 A;  3MK7 C;  2CE7 A;  2HN2 A;  3LJC A;  1XZY A;  2QA7 A;  4GYS A;  4O2B E;  5HWY A;  2VWA A;  1G8X A;  3JC6 C;  2FUP A;  3B57 A;  5JDL A;  3PDY A;  3PU3 A;  3ZKR A;  2LE8 A;  4UEM A;  4TWF A;  3E22 E;  1XDP A;  3PV0 F;  4GKK T;  4I0U A;  4PAG A;  2XSB A;  5AQT B;  3UUN A;  4JEU B;  2Y8D A;  1UX5 A;  2LEH A;  3KV9 A;  3O9X A;  2VQF T;  4U7Y A;  5JRC A;  1WYC A;  3RKG A;  5FY0 A;  5IYZ E;  2XQ9 A;  4PFP A;  3Q2M A;  4U2Z A;  5LBQ B;  2Y6X A;  2XQ8 A;  2WAU A;  3VKH A;  2OLT A;  2XUE A;  4X64 T;  4AIS A;  5AQM B;  2LSY A;  1OED A;  5KX5 E;  2WP9 A;  2BDE A;  4TWD A;  3ZC0 A;  1MIW A;  4JYA T;  3HKE E;  3RC3 A;  3A7M A;  4CXY A;  3HI2 A;  4LF9 T;  2AE9 A;  2WQY A;  1E2A A;  2XAS B;  3Q5D A;  4B3S T;  2J62 A;  2PBI A;  2B1E A;  4QHO A;  5LA6 E;  5FNV E;  4TUY E;  1NAF A;  1FEW A;  3N9Q A;  5CGM A;  2QRX A;  4CI2 B;  5FMN A;  3CX8 B;  5KMG P;  1JNR A;  1SHZ C;  3L39 A;  2IHR 1;  5HEO A;  4ZZB A;  3LK2 B;  3UU3 A;  3MAC A;  3KBU A;  3N5L A;  4GOU A;  2NR4 A;  4LF8 T;  3AAA B;  5LHG B;  4JI3 T;  3ETV A;  5FXX A;  4UVB B;  3LK4 2;  4OYJ A;  3K1S A;  1HS7 A;  2CBJ A;  4IE0 A;  4DV6 T;  2KLQ A;  4ZI3 D;  4K0U A;  2W00 A;  2BS4 A;  2DWG A;  4CI1 B;  3K3N A;  5LMN T;  3AA6 B;  4PK4 A;  3VR9 A;  4BJM A;  2MPK A;  3BK9 A;  2LOP A;  5LXT E;  4CQI A;  2DL1 A;  1MMD A;  1D1C A;  1XNQ T;  3PUW F;  3EUH A;  3KV6 A;  4CXX A;  4HN9 A;  2M6I A;  2DNX A;  3AE8 A;  2E5L T;  2IDO B;  2M67 A;  2CCQ A;  4B3M T;  5HWX A;  2LKG A;  1D0Y A;  3PJA J;  1MMA A;  3AEB A;  1KFY A;  3ZMT B;  5ETW A;  5HXS A;  4JI4 T;  2VKD A;  5AQN B;  4DV3 T;  2BBH A;  5LG4 A;  1HNX T;  5AQQ B;  1KEY A;  2CHN A;  3PUR A;  3EVY A;  3ZPO A;  1YKE B;  1T98 A;  5HEU A;  2E5V A;  3TLV A;  5L3G B;  4Z90 A;  5ABE A;  2K3W A;  2CWO A;  5C2T A;  2LM9 A;  4X20 E;  2XSA A;  3KVA A;  4KUM B;  4IHJ E;  2FJE A;  3RQW A;  4V1A v;  5LJN A;  2V6Y B;  1WCR A;  4TV9 E;  3P4S A;  2XHE B;  3P4P A;  1KNR A;  4L0R A;  4EXT A;  3C64 A;  3ZSS A;  2D9D A;  2C5J A;  4TNV A;  3OKQ A;  2UXN B;  4OX9 T;  1ZHC A;  4CN1 A;  2MYS A;  4HWC A;  3M65 A;  1KNZ A;  2LSG A;  1JNZ A;  4Q25 A;  4AQF C;  2DWK A;  4JLE A;  4AQF A;  2RA1 A;  4ZI2 D;  3HR0 A;  3PJA A;  2WDV A;  4E7S A;  3HKC E;  4ZI3 C;  4DV5 T;  3UUB A;  2KWH A;  1V9D A;  1BR2 A;  1Z8U A;  3BQI A;  5LOV E;  1N34 T;  2YDS A;  5JTG A;  5C3J A;  4ILC A;  4U33 A;  4AQG A;  3KVB A;  5LHI B;  5ADX L;  3LSV A;  1KNP A;  4GIW A;  5HEG A;  1NEN A;  4O4H E;  2QYW A;  4HGA A;  5IUX A;  1OED E;  5AQK B;  4U2Y A;  2H88 A;  4CZZ B;  4BJN A;  4ZHQ E;  3ETU A;  2E9X D;  2V7I A;  2LSK A;  3JCF A;  2UUA T;  2X9W A;  2BS3 A;  3CX7 B;  5HAX A;  3ONL C;  3R84 B;  2I0M A;  2BZB A;  2KSR A;  4NUU A;  3D0T A;  4JI8 T;  5J2U E;  4IE7 A;  3ONX A;  5JR9 C;  4O4L E;  4EZ4 A;  4GKJ T;  5JR9 A;  3JAF A;  2YDR A;  3PUZ F;  4DV2 T;  3WI3 A;  3AEG A;  2VVN A;  4DBR A;  3K3Q C;  5AQH B;  4UF0 A;  3JAD A;  2X0H A;  4NIQ A;  5AQU B;  1HNW T;  3WAJ A;  5FYM A;  3N9L A;  4U3C A;  3FXE B;  1D0Z A;  3AEF A;  3HKD E;  4IL9 A;  2WMN A;  2NTX A;  3O1J A;  3QB5 K;  2BKO A;  2V7L A;  2L8K A;  2KT9 A;  4YT0 A;  1UCU A;  4UF0 B;  5BMV E;  3CK6 A;  2XQ7 A;  2UU9 T;  2JQH A;  1I94 T;  5FL0 A;  1Y64 B;  4BA9 A;  2BVL A;  2QGS A;  1YW0 A;  3TLT A;  2NWB A;  2HH7 A;  5L3C B;  3Q5E A;  3RIF A;  2X9X A;  1HR0 T;  5L3E B;  2WU2 A;  2XAH B;  5LGU B;  5J0Z A;  4AXP A;  3ZST A;  4WBN E;  4E7Z A;  3HL6 A;  3AAE B;  4YXD A;  1CHU A;  5FY7 A;  4CXW A;  1M62 A;  3E08 A;  4CN6 A;  2KIN B;  2Q9Q D;  3RIA A;  5JDF A;  2K9A A;  4WZX A;  4AKH A;  2G0U A;  4EAH A;  3IF8 B;  4PK6 A;  3H37 A;  4DR7 T;  2E2A A;  5KDM C;  3NBX X;  4ZZC A;  4QXC B;  2VB6 A;  5DJQ C;  1D1A A;  4I4T E;  2WBL A;  1BR1 A;  3LK3 B;  2OV9 A;  5DAB A;  2JIW A;  2E9X C;  4MBQ A;  3ONJ A;  4TX5 A;  3EAM A;  1D1B A;  5ABF A;  2XAQ B;  2CBI A;  1WRD A;  2L3L A;  1ZOY A;  3ZCJ A;  5LGT B;  1UK5 A;  1LVK A;  1E7P A;  2VAS A;  3SFD A;  4GK0 E;  3U3I A;  2E9X B;  3I0Q A;  4QH4 A;  2LSJ A;  5HXH A;  1FMW A;  2YN6 A;  4B3T T;  1HF8 A;  4UIG A;  4I55 E;  4DR3 T;  2JJ9 A;  5F5W A;  1YQ4 A;  1OWA A;  2YEV C;  4O4I E;  4JI2 T;  5HXR A;  4EOZ B;  4YHH T;  4IDZ A;  2XQ5 A;  1W0A A;  3ZN1 B;  3ANW A;  2HPL A;  4EYU A;  2WU5 A;  3EDU A;  2LHN A;  3PUY F;  3RLF F;  4YTN A;  2V1D B;  2WMO A;  4QX8 B;  3C51 A;  1XDO A;  2J1D G;  4JI1 T;  3AAI A;  3DTO A;  3H3A A;  3TLW A;  2VKH A;  3UUX B;  1US7 B;  3ZYL A;  3ZMS B;  5AFU L;  2ZM8 A;  3VU7 H;  4KP3 C;  3ABV A;  3OBV E;  4G2A A;  5LYJ E;  3CQX C;  3AE9 A;  4AQY T;  2LRL A;  1OED C;  4L5G A;  2ACZ A;  1YKH B;  4JI0 T;  5JRC B;  1LKX A;  5JH7 E;  4WBO A;  2LHR A;  2Q9Q C;  2FJB A;  2ZMA A;  3DP7 A;  1VOM A;  4MHC A;  4JEH B;  4BAY B;  3GMI A;  4DO0 A;  2Q9Q A;  5ABG A;  4UXN B;  2D0U A;  3C4Z A;  3MJX A;  5LMU T;  2ACX A;  3CQC B;  1WFD A;  4YY3 T;  3B5M A;  2ES0 A;  4GK5 E;  4U7I A;  1IBL T;  3LBX A;  1OED B;  3RYI E;  4EGW A;  3KV5 A;  4KHZ F;  4EEB A;  2Q9Q B;  3AED A;  2NW9 A;  2XM2 A;  2A72 A;  2BKP A;  2KMF A;  4TZ4 C;  4UVC B;  2CWY A;  5LB7 B;  4ILU A;  1YQ3 A;  3RYC E;  3AE4 A;  2UXB T;  2N2N A;  2ZM6 T;  3QK6 A;  1UGO A;  3UFG A;  4WNK A;  5DQV A;  2V7J A;  4QH1 A;  1T8B A;  3RKO A;  3MXZ A;  3QC9 A;  4K0K T;  1YXR A;  2KWI B;  3TLU A;  4MLK A;  3UU4 A;  3OTO T;  5FXW A;  2YIN A;  4H9Q C;  4TWH A;  4P09 A;  4XBF B;  2XY8 B;  3SWH A;  3W15 B;  3P7I A;  1MND A;  4LFA T;  4DV7 T;  4DUZ T;  2EHO D;  5FVK A;  3PUQ A;  4H9P C;  1DU2 A;  2C5I T;  2VQE T;  2CXF A;  2DI4 A;  3ZEF B;  1S35 A;  1W9R A;  5JDH A;  5LCY A;  3FZH B;  2BKN A;  3F57 A;  1IBM T;  2IW5 B;  2UUB T;  5CJ5 A;  4ADZ A;  3NVO A;  2WZH A;  4UV8 B;  4N78 D;  3PTR B;  3CPZ A;  2BG9 E;  2C5K T;  4NUV A;  1J1J A;  4UVA B;  2OA5 A;  1X9B A;  1MIY A;  3ZCI A;  4DR5 T;  2XM1 A;  4HFE A;  1L0V A;  2K48 A;  3P4W A;  4HFV A;  3GN5 A;  3CX6 B;  3ZT7 A;  2W67 A;  4H9R C;  1SUM B;  3C98 B;  3KIN B;  4LML A;  3RPU A;  2V8S V;  3O1H A;  3A8Y C;  2CLY C;  2X67 A;  1SE7 A;  4EZH A;  2XQY A;  2W66 A;  3LG7 A;  4TV8 E;  2X0Y A;  2LT3 A;  1N33 T;  2V6X A;  3DJB A;  4QXB B;  3SFE A;  2KXP B;  4JI7 T;  3AE6 A;  2X68 A;  3AVS A;  5AQF B;  2NTY A;  4KX6 A;  4AIU A;  3T1Y T;  5AQL B;  4DBQ A;  2I6H A;  3LDQ B;  4YLH A;  2WDQ A;  4NXN T;  3R6N A;  2MAW A;  2HN1 A;  4OHF A;  2YDQ A;  2VUR A;  4ILA A;  3EHZ A;  5JVD E;  3J7Y q;  4H63 V;  3AEA A;  4TNW A;  4ZXL A;  3P4Q A;  1XNR T;  4HFD A;  3G06 A;  4HFC A;  4NPP A;  5GON E;  2H89 A;  4AKG A;  5M4Y A;  1J5W A;  5E0O A;  4IE6 A;  2EHO C;  1CUN A;  1UUR A;  2XQ3 A;  4X5T A;  2EHO A;  4YFS A;  4IE4 A;  4P1N A;  2JQK A;  2H3R A;  4AKL A;  3RI5 A;  4IDO A;  3WAK A;  2CXL A;  2V5C A;  2NP9 A;  4X1I E;  2EHO B;  4U72 A;  2YU1 A;  5F3J A;  5FVL A;  3N2K E;  2D5U A;  2J4G A;  3O1I A;  4IDQ A;  2WSS V;  4DV4 T;  5EZY E;  3ZYK A;  5KXJ A;  4XZC A;  2A3D A;  2A9U A;  4ASK A;  1H7C A;  4IDP A;  5AQI B;  3UU6 A;  2XAF B;  4PJL A;  2VVS A;  5JR9 B;  2NW7 A;  4OYK A;  1FMV A;  2IML A;  2NOX A;  4C91 A;  4MAL A;  3PUS A;  3AEC A;  2WS3 A;  1KF6 A;  5L47 A;  1WR0 A;  3GA8 A;  5AQP B;  2QVA A;  4ILB A;  1VCT A;  5CB4 E;  4YHJ A;  4DMW A;  2HPJ A;  3SS1 A;  3U78 A;  5FKY A;  2BVM A;  3RIU A;  3TLS A;  5AQS B;  4A98 A;  2W4X A;  1MMG A;  2B76 A;  1BR0 A;  5J2T E;  3HA4 A;  1I6Z A;  2CM0 A;  3PUX F;  3TKL B;  3MZK B;  3MKD A;  3N9M A;  4U74 A;  4H9N C;  4LMK A;  2LKH A;  3EI0 A;  4B6X A;  2H7O A;  3PUA A;  1U4Q A;  5IWA T;  1IJ5 A;  2XQ6 A;  4LFC T;  3QOF A;  2AXD S;  4HFH A;  1SA0 E;  4Z91 A;  3RYF E;  1ZP0 A;  2FJA A;  2BG9 C;  4EYY R;  3H3M A;  5LGN B;  4YJ2 E;  3FZM B;  1N36 T;  2GK9 A;  2BG9 A;  3UUM A;  3S4U A;  4YSX A;  4EIW A;  4X65 T;  2SPC A;  3JAE A;  5H6R B;  4YSY A;  4DUY T;  4IGU A;  1UUS A;  2CA5 A;  3X1D A;  3E0Z A;  4IDN A;  1IAP A;  5JQG E;  2CXD A;  4PFO A;  2CPT A;  1HX1 B;  1QSD A;  3RF1 A;  5FXV A;  2BG9 B;  3FXD B;  5JDN A;  1HG5 A;  1Z0P A;  3KFW X;  3CWZ B;  2DCF A;  5J1G A;  2X9H A;  3FHN A;  3N9N A;  5ABF B;  1HG2 A;  3OYZ A;  3AXJ A;  4GYR A;  3J9X 1;  3ZMU B;  1T72 A;  5AQJ B;  1NEK A;  5CA0 E;  2BBJ A;  2JQ9 A;  5H6Q B;  4JI6 T;  1O3X A;  2V7K A;  3CQG B;  4KMC A;  3RX6 A;  1B7T A;  4KI0 F;  2W2U A;  2W0G A;  3QUJ A;  5CFB A;  4LF5 T;  4DR2 T;  2K5B B;  3UT5 E;  4DVD A;  4XAX B;  3ZLI A;  3UQ4 A;  4IST A;  3I9W A;  4PW8 A;  2UXD T;  1HNZ T;  3ZYM A;  3F31 A;  4PNI A;  1QLB A;  3IA3 A; 
#chains in the Genus database with same CATH homology
 5AQN B;  5AQJ B;  5AQM B;  5AQR B;  4HWF A;  1M7K A;  2D9D A;  5AQQ B;  1M62 A;  3M3Z B;  3A8Y C;  1HX1 B;  1T7S A;  4HWH A;  5AQK B;  3FZM B;  5AQV B;  3FZK B;  5AQS B;  3FZF B;  1UK5 A;  5AQI B;  4HWI B;  3FZL B;  4HWD A;  5AQH B;  5AQG B;  1I6Z A;  5AQT B;  5AQF B;  1UGO A;  4HWC A;  5AQU B;  5AQL B;  3FZH B;  3LDQ B;  5AQO B;  5AQP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...