5AQIB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 45
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqiB00
5AQTB 4HWFA 1M62A 5AQUB 5AQOB 5AQNB 3A8YC 5AQMB 1HX1B 3FZLB 5AQVB 3FZHB 3FZFB 4HWIB 1M7KA 5AQKB 5AQGB 5AQLB 1T7SA 4HWDA 5AQIB 1UK5A 3FZMB 3LDQB 5AQRB 1I6ZA 5AQFB 2D9DA 5AQJB 5AQSB 5AQQB 1UGOA 3M3ZB 5AQHB 4HWCA 5AQPB 4HWHA 3FZKB
chains in the Genus database with same CATH superfamily
4PFPA 1KNPA 4JI4T 1HG5A 4AKHA 2IW5B 3MXZA 2WZIA 1NEKA 3CK6A 5KXJA 1KNZA 2VASA 4EV6A 2XQ4A 3CMLA 3ZPOA 2LLYA 5FL1A 2J47A 2D0UA 2J1DG 4IE4A 2CM0A 3PJAJ 3PJAA 3RLFF 5LGNB 1UK5A 2BKNA 3Q5EA 5DABA 4HE8A 1ZV4X 2QGSA 5LHHB 2FJDA 1WFDA 2LHRA 2IIUA 5L3BB 1Z0PA 1MMGA 3H37A 3ONJA 4TZ4C 3ZSSA 2YU1A 3ZEFB 2P9BA 2E5LT 4L0RA 4JI6T 3RGLA 1MMAA 4X20E 2W62A 2M6IA 1LVKA 2X9WA 3SS1A 4TX5A 3WI3A 2DNXA 2ACXA 3V5UA 5BMVE 2WMNA 3VHLA 1FMWA 1ZOYA 3C4ZA 4PW8A 3SFDA 2XSBA 2EHOC 2KXPB 2W4XA 5AQUB 1J5ET 2IAKA 4LFCT 5HEOA 3A8YC 2NP9A 3AEFA 4EEBA 4MBQA 1OEDE 4N78D 5ABHA 5CA0E 3ZT7A 2LOSA 3UU6A 1N36T 4CQIA 2LE8A 2YOEA 4CXXA 2WMOA 5L4HA 2E9XD 3RKGA 1T7SA 2C0SA 2WWUA 3QB5A 2JRKA 4G2AA 4YLHA 3RYCE 4ZHQE 3L8RA 2WDQA 3N9QA 4HN9A 4ILBA 4DVDA 2B1EA 3C50A 4H9OC 3FBLA 2D2SA 2LEHA 4GIWA 3PU8A 4TNVA 4U72A 5FNVE 1YQ4A 2XQYA 3BQLA 4YSYA 3PUSA 5JH7E 2OV9A 3HKEE 5FY0A 3IF8B 3M3ZB 4LFAT 2CXFA 3ZCJA 4J2CA 4EZ4A 3I0OA 2XAGB 2XQ5A 3JC6D 3Q5WA 4X5TA 3AE4A 1M62A 4IDOA 4Q25A 2Y48B 4ADZA 5LGUB 1V9DA 3F57A 4L5GA 2VQFT 3LJCA 4GYRA 2CHNA 2XTLA 3ANWB 3RH3A 2HHHT 2WQYA 2XAQB 1N32T 2X51A 5AQVB 4HFEA 4NXNT 5JTGA 3FHNA 4AQGA 1SE7A 4UVAB 2BBJA 1D1BA 3LK42 4AIUA 4X1KE 2BKOA 1I6ZA 2FJAA 2CLYC 2PTFA 2JMHA 5ADXL 2UXXB 3FXDB 3K1SA 5F8PA 2K5BB 2XY8B 1IJ6A 2XASB 1XMQT 3WAKA 2FUPA 1ZP0A 2CEAA 2CPTA 3IEEA 2PFVA 4KUMB 2LRLA 2MTQA 4NPPA 5JDMA 4YTPA 2I6HA 2XQ7A 4ISTA 2CBIA 3D0TA 2JIWA 2Q9QB 3N9OA 2PJQA 3AA7B 5IWAT 3O1HA 2LM2A 3N2OA 2XAFB 4QH5A 5J2TE 4AKIA 3KBTA 4HWHA 1ZKEA 4O4LE 4OHFA 3W15B 1NAFA 3VR8A 5LBQB 4EOZB 5LJNA 1HF8A 2XJ7A 5AQOB 4DV0T 3P7IA 4XBFB 3RRCA 3RC3A 5F3JA 3IBPA 5HEGA 3ZKRA 1LRZA 5C8YE 4BA9A 4DV3T 3N5LA 1J5WA 2VURA 3U78A 4LF5T 2KLQA 3TKLB 4E7SA 1UCUA 3CVRA 3HA4A 3ZLIA 2XUEA 3PUWF 2BKPA 2FJEA 5KDMC 3EABA 2W00A 3NBXX 2F4VT 3HKDE 4ZZCA 4O4JE 4PK4A 4WZXA 3NZPA 2Z6EA 5L47A 3UU5A 1JNZA 4LF4T 2M6BA 4TV9E 2LSYA 3SRZA 4IE6A 4M1PA 3L3PA 4ZI2D 2YDRA 3OPCA 4H9PC 3LBXB 3GWHA 3ONXA 5LB7B 2Y8DA 3GN5A 3OVUA 4GYSA 5AQHB 3PV0F 3BK9A 4AKRB 4B3RT 1MIVA 1HNWT 3H3MA 4I4TE 4IIJE 3L39A 4NIQA 5CB4E 4IREA 5L3GB 2IMLA 4PJJA 1UX4A 2K48A 2YEVC 1SHZC 3N9PA 4PFOA 1NWMX 4LMJA 4WBNE 4KMCA 2VKJA 2YINA 3RIFA 5ABFB 1YW0A 1HNXT 3Q9DA 3FZFB 3AAIA 2V6YB 2XZEA 4YJ2E 2VVSA 4Z91A 5JQGE 3O4XE 4JI7T 3VRBA 5AQGB 5IHYA 1N33T 2MAWA 2BVLA 4GK5E 3CX7B 4JV5T 2N2NA 4COFA 3AA0B 1UURA 3N9MA 4FI5A 4FJOA 1OXZA 2CA5A 2W61A 4U74A 4U2YA 3ZN0B 4EXTA 4IE0A 1KF6A 2WM9A 5HXEA 3P4WA 1HTJF 4IE5A 4HGAA 4DUZT 2JMKA 5AQSB 3B5MA 5DQWA 1E7PA 5FXVA 1UGOA 5L2LA 2ZM8A 3RPUA 3SWHA 5L3EB 1BR2A 3AEDA 3RHWA 4UV9B 4WW0A 4EYUA 2BS2A 3AA6B 3LBXA 2MBGA 4DV2T 3AAAB 4XAXB 3FZKB 1XDOA 5ABGA 2KMFA 4LF7T 3ESLA 2X67A 4I0UA 2JQQA 2OA5A 2XQ8A 3QUJA 4O8SA 4HFBA 3AEGA 2YKSA 3OTOT 4HTEA 3K3NA 5AQMB 1Y01A 3PUXF 2NW8A 4QHOA 4TN7B 4AQFA 4ZI7E 4CI1B 2ZM6T 2LSJA 4WYVA 1N34T 3CQGB 3O1JA 5LXTE 3KFWX 2QYWA 4HFHA 1OWAA 2XSAA 2BZBA 2X0YA 5HWXA 4ILUA 2H7VC 2MPKA 3A5XA 3I9YA 2A9UA 4DR2T 4UVCB 2LHNA 4X65T 4DR3T 2H3RA 3ZYKA 1DU2A 5HCMA 2VKHA 2XQ9A 1KEYA 2JQHA 3GMIA 1HCIA 3PUZF 2VL8A 4H9QC 2LKHA 5HEUA 3UFGA 2V5DA 4F8HA 1IAPA 2NW9A 5J0ZA 1XMOT 1BR0A 1MNEA 5JREA 2J4GA 2ODVA 3EUHA 2J62A 4AXPA 1ZHCA 4H63H 5C2TA 1OEDA 4U7IA 2QA7A 4EAHA 2CCQA 2I59A 4DR4T 4G63A 3DP7A 3MJXA 5FXZA 4DV4T 3RIUC 4XZCA 4YSZA 2NTYA 3C64A 4JEHB 2XAHB 1SA0E 2DWKA 2HN1A 2NOXA 3PUQA 4QXBB 2UXNB 3RYHE 4GKKT 1FMVA 2DWGA 4KI0F 3N9NA 2OLTA 5FP3A 3LSVA 4QWNB 4YTMA 4TV8E 3UQ4A 1XNRT 2K3WA 4ISSA 4JI8T 5JDQA 1WYCA 2KSRA 4TWDA 2A2FX 2BG9B 5GONE 2CE7A 3NRXA 3C4WA 2LT3A 2XHEB 4OK0A 5FYMA 4GOUA 4B3TT 2WB5A 4DR6T 2UXCT 4AI6A 3B57A 2LRKA 4HWCA 4KHPT 2FBWA 2YDSA 2ACZA 4H9SE 3O9XA 2V5CA 3LG7A 2EHOB 3N9LA 1KNRA 2K9AA 3CQXC 3RIAA 2H7OA 5AQTB 3UUMA 3FXEB 5AQNB 4GK0E 1J1JA 2V1DB 2XM1A 3EAMA 3MKDA 1HX1B 2CBJA 2WSSV 1G8XA 2XAJB 3RRWA 3MACA 5CJ5A 2CWOA 3OKQA 4MALA 5J1GA 2CXDA 4YJ3E 4BAYB 4L9IA 3QNUA 1XWMA 2JJ9A 2Y6XA 5JDLA 4F6RC 5LJMA 2VQET 4PJLA 2EHOD 4QH4A 2WWVA 5KMGP 5KX5E 5L3CB 3JC6C 4DV1T 3NWIA 3AA1B 3ZCIA 3RIUA 5LG3A 1FIOA 5JR9B 1FJGT 3P8CD 2H88A 3CWZB 4JI1T 3ZT5A 4X1IE 3AE6A 3TLVA 2E8IA 1OEDC 3O1IA 2PBIA 3KDSE 4ANJA 2ES0A 4Z90A 1GQEA 1S94A 1IBMT 4JLEA 2YU2A 2W66A 1HS7A 3ZT6A 3MA9A 4I43B 1H7CA 2K24A 1D1CA 2BVMA 2ODUA 3KV6A 4DBRA 1X79A 3I0QA 4CI2B 1CHUA 2W63A 2WZHA 1G73A 5E0OA 3ZMUB 4CN1A 5HEJA 4X62T 4YSXA 3RKOA 3UT5E 5LHGB 3P4RA 4JI0T 5H6QB 1M7KA 1VCSA 2IC6A 2UXDT 4I50E 3CIRA 1W0AA 4UR9A 4DNDA 5LG4A 4ZI3C 3PURA 1Y64B 5FXWA 2E9XC 4NUUA 4DR5T 4DO0A 4QH1A 3VKHA 4JI3T 4U31A 1L0VA 1EZ3A 2WDVA 2VVNA 2YK0A 3FB2A 3K3OA 3HR0A 3Q2MA 2AE9A 3KV4A 5ABEA 5LGTB 5JVDE 2RPAA 3G06A 4PNIA 4A98A 4B3ST 5FVLA 3KV9A 3P4PA 5LMNT 3I9WA 1LVFA 1QLBA 3QOFA 4ILCA 3OJAA 3IHRA 3RI5A 3T1HT 2N9DA 2X68A 2G0UA 4IGUA 2AXDS 4U2ZA 4V1Av 3NRYA 2WBLA 1AJ3A 5FXXA 5CFBA 2NTXA 2UUBT 4A5XA 2WU5A 5LA6E 4ZI2C 3AE8A 4PJNA 1MIYA 4CN4A 5AQKB 5EK3A 2IHR1 3VRAA 4DIDB 3AEBA 5LOVE 2LSKA 3EHZA 3R84B 3RF1A 3J9X1 3KINB 2HH7A 4BJNA 2MYSA 4HFIA 3UULA 4JBWF 2ZLYA 2DLRA 3P4QA 1O3XA 2LM9A 1XDPA 3HKBE 5FMNA 2C5IT 2Q9QA 5HXRA 2X9XA 3ZJ1A 2WY2A 4ZEYA 4Z8XA 3KV5A 3CX8B 2D0TA 3L09A 1IBLT 4LF9T 2X66A 3JCFA 2HN2A 4QXHB 1ZEEA 3PUAA 5ETWA 4A97A 4C91A 2WAUA 4YXDA 4DUYT 2L8KA 1T72A 4ZI3D 3C98B 1D0XA 3LFMA 3ZYLA 3C51A 2V26A 5LHIB 5LNKA 2PG8A 2V7KA 4DR7T 5JDGA 2B76A 2WCAA 2IUBA 3JAFA 4IDZA 2KT9A 1KFYA 3AAEB 1QSDA 4O2BE 5JRCB 3FZLB 4UELA 3QB5K 4KBMB 3T1YT 5FY1A 4E7ZA 4DV5T 3LK2B 3UUNA 2C5JA 4HFDA 3ZSTA 5AQIB 2X9YA 3AECA 2GK9A 5EZYE 4EEDA 4AQYT 4YHJA 5LCYA 3LK3B 2A3DA 3AVRA 2A72A 2V6XA 2HPLA 2RA1A 3AE2A 3ANWA 4JI5T 4KX6A 3V5SA 5HXHA 4UIGA 1W09A 3UQ7A 1E1HB 5A1LA 1U5PA 2JQKA 4O2AE 4ASKA 1Z8UA 4IL9A 2UUCT 3B13A 4OFZA 5FL0A 4DMWA 1MMDA 3H3AA 4TWHA 3TLUA 2V7IA 2VKOA 5DQVA 3CKDA 3N2GE 2RP4A 4K0KT 4IHJE 5JDFA 1YKHB 3N2KE 5JR9C 2XM2A 5L3DB 4P0AA 3DJBA 1E2AA 4LF8T 3VKGA 3E08A 3K3QC 4YHHT 2BBHA 3PU3A 1YKEB 2C5KT 3AEEA 3OYXA 4IDQA 4TUYE 4ZS2A 5C3JA 5JRCA 5HCJA 2E5VA 2EHOA 2X0LB 3CX6B 1UUSA 3PUGA 4O4HE 3FZMB 2LOPA 3NZQA 3P4SA 2KWHA 1IJ5A 2X0HA 4LMLA 4PK5A 4JYAT 5BR8T 1NENA 3AEAA 3AE1A 3RYFE 1BR1A 4UEMA 1T8BA 3ZN1B 5ABFA 3UTKA 1XNQT 3T8OA 4DV6T 5HAXA 4LF6T 2ZMAA 4EGWA 1UX5A 1MMNA 2CWYA 2YN6A 3ZYMA 3PDYA 4P1NA 4ZXLA 5LMUT 3AXJA 4UF0B 2LJLA 3R6NA 2KINB 3QK6A 4H9RC 1WR6A 2XQ6A 2IC9A 2LSIA 2QVAA 3CPZA 4IE7A 3ZMVB 5FKYA 2BS3A 1IBKT 4HFCA 5HXSA 4CXYA 3M65A 3MZKB 2CRBA 2WS3A 3Q5XA 3S4UA 1D1AA 4X1YE 2UUAT 3K8PC 1US7B 3AE5A 5AQLB 2V8SV 1KK7A 2CMRA 2CHOA 4HWDA 4ILAA 4WBOA 4CXWA 2DHRA 5CGMA 5M4YA 2LKGA 3AVSA 4ZZBA 3RQWA 4UV8B 4AKGA 3AE9A 1XZYA 2CLYB 4HEAA 3OYZA 4EIWA 1B7TA 1D0ZA 4IL4A 2JPFA 5IUXA 1VOMA 3A7MA 1W9RA 2WP9A 2BDEA 4KHZF 5AQQB 1MIWA 3ZC1A 3E22E 4AKLA 2E2AA 1D0YA 5JR9A 3ETVA 2H89A 4ZS3A 3AE3A 3RC8A 2M67A 1BR4A 3F31A 2BG9E 2Q9QD 4U33A 5AQPB 1U4QA 4IDPA 4AISA 5JDHA 4NXMT 4U3CA 3OBVE 3VU7H 5EK2A 3TLTA 4YFSA 3IA3A 3EI0A 2WU2A 4QXCB 3J7Yq 3AXJB 4UF0A 4B3MT 1MNDA 3AB3B 2VKDA 2V7JA 5LBMA 4JEUB 2NW7A 1JNRA 4HWIB 5EK4A 3P50A 4PJMA 2FJBA 1WR0A 2XPKA 3KBUA 1YQ3A 2BS4A 3I1AA 2L3LA 4LMKA 5FY7A 5IYZE 3TLSA 2V6YA 4CI3B 4DR1T 2L9QA 1YXRA 4OYKA 5F5WA 3GA8A 2D5UA 3UUBA 3BQIA 4YT0A 1HFAA 5AQFB 2WDRA 2KZ7B 5FVKA 3VR9A 3ABVA 1OEDB 4QKNA 4UVBB 3WAJA 2ZM2A 5HXCA 4BJMA 4MHCA 2NWBA 4PAGA 3F2EA 1I94T 4JUYA 3JADA 3PUYF 4U7YA 4OYJA 3PE0A 4EB6E 3ZMTB 3UUXB 3QC9A 4MFRA 4C90A 4DMVA 2MOZA 3C4XA 2V7MA 1R8IA 2IDOB 3HKCE 2UU9T 3KVBA 5HWYA 3ZMSB 2VB6A 1WRDA 4PK6A 5HEHA 2N1GA 3CQCB 3FBZA 2BG9A 3FZHB 3UU8A 4DBQA 2YDQA 4KP3C 4ERRA 4H63V 2KWIB 2VK9A 2SPCA 2E9XB 1FEWA 4HKAA 2XQAA 1WLXA 4I55E 3LDQB 4P0BA 1IZNB 1QUUA 3AE7A 3ONLC 4EZHA 2LSGA 1LKXA 5AFUL 5J2UE 2D9DA 5L3FB 4OX9T 3NKZA 3ZMZB 2X9HA 4EYYR 3GN5B 5L4EA 3Q5DA 2ZM0A 1VCTA 2R6GF 2VWAA 4O4IE 4WNKA 4JI2T 4ZOLE 4YTNA 4X66T 1HNZT 3HI2A 5DJQC 2DL1A 1YD8G 3EDUA 4X64T 3U3IA 3UU4A 3ZJ2A 4B6XA 4IT4A 2I0MA 2V7LA 5CA1E 3EVYA 1HG2A 1CUNA 3RQUA 4YY3T 4UXNB 3BQKA 3X1DA 4HWFA 1T98A 2DCFA 4TWFA 5H6RB 2HPJA 5TAOA 4A56A 1WCRA 1SUMB 3PUVF 2CXLA 3TLWA 4MLKA 3KVAA 2XQ3A 3DTOA 2JQ9A 3UU3A 4NUVA 2Q9QC 4HFVA 3ETUA 1HR0T 5LP6E 1S35A 2E9XA 5HYAA 5AQRB 3E0ZA 3PTRB 2BG9C 2KNDA 4QX7B 2W0GA 3JAEA 3NVOA 4TNWA 2NR4A 3UFEA 4CZZB 4CN6A 4DV7T 4LFBT 4H9NC 1VRBA 5AQJB 3ZC0A 1WYBA 4P09A 5JDNA 5LYJE 2W67A 4QX8B 3MK7C 3EDVA 2W2UA 2UXBT 3SFEA 2QRXA 1HX8A 1W0BA 1X9BA 2DI4A 2VL0A 3SOLA 4AQFC 4GKJT 4K0UA 3RYIE 3HL6A 4IDNA 3RX6A
chains in the Genus database with same CATH topology
5AQTB 4HWFA 1M62A 5AQUB 5AQOB 5AQNB 3A8YC 5AQMB 1HX1B 3FZLB 5AQVB 3FZHB 3FZFB 4HWIB 1M7KA 5AQKB 5AQGB 5AQLB 1T7SA 4HWDA 5AQIB 1UK5A 3FZMB 3LDQB 5AQRB 1I6ZA 5AQFB 2D9DA 5AQJB 5AQSB 5AQQB 1UGOA 3M3ZB 5AQHB 4HWCA 5AQPB 4HWHA 3FZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQT B;  4HWF A;  1M62 A;  5AQU B;  5AQO B;  5AQN B;  3A8Y C;  5AQM B;  1HX1 B;  3FZL B;  5AQV B;  3FZH B;  3FZF B;  4HWI B;  1M7K A;  5AQK B;  5AQG B;  5AQL B;  1T7S A;  4HWD A;  5AQI B;  1UK5 A;  3FZM B;  3LDQ B;  5AQR B;  1I6Z A;  5AQF B;  2D9D A;  5AQJ B;  5AQS B;  5AQQ B;  1UGO A;  3M3Z B;  5AQH B;  4HWC A;  5AQP B;  4HWH A;  3FZK B; 
#chains in the Genus database with same CATH topology
 4PFP A;  1KNP A;  4JI4 T;  1HG5 A;  4AKH A;  2IW5 B;  3MXZ A;  2WZI A;  1NEK A;  3CK6 A;  5KXJ A;  1KNZ A;  2VAS A;  4EV6 A;  2XQ4 A;  3CML A;  3ZPO A;  2LLY A;  5FL1 A;  2J47 A;  2D0U A;  2J1D G;  4IE4 A;  2CM0 A;  3PJA J;  3PJA A;  3RLF F;  5LGN B;  1UK5 A;  2BKN A;  3Q5E A;  5DAB A;  4HE8 A;  1ZV4 X;  2QGS A;  5LHH B;  2FJD A;  1WFD A;  2LHR A;  2IIU A;  5L3B B;  1Z0P A;  1MMG A;  3H37 A;  3ONJ A;  4TZ4 C;  3ZSS A;  2YU1 A;  3ZEF B;  2P9B A;  2E5L T;  4L0R A;  4JI6 T;  3RGL A;  1MMA A;  4X20 E;  2W62 A;  2M6I A;  1LVK A;  2X9W A;  3SS1 A;  4TX5 A;  3WI3 A;  2DNX A;  2ACX A;  3V5U A;  5BMV E;  2WMN A;  3VHL A;  1FMW A;  1ZOY A;  3C4Z A;  4PW8 A;  3SFD A;  2XSB A;  2EHO C;  2KXP B;  2W4X A;  5AQU B;  1J5E T;  2IAK A;  4LFC T;  5HEO A;  3A8Y C;  2NP9 A;  3AEF A;  4EEB A;  4MBQ A;  1OED E;  4N78 D;  5ABH A;  5CA0 E;  3ZT7 A;  2LOS A;  3UU6 A;  1N36 T;  4CQI A;  2LE8 A;  2YOE A;  4CXX A;  2WMO A;  5L4H A;  2E9X D;  3RKG A;  1T7S A;  2C0S A;  2WWU A;  3QB5 A;  2JRK A;  4G2A A;  4YLH A;  3RYC E;  4ZHQ E;  3L8R A;  2WDQ A;  3N9Q A;  4HN9 A;  4ILB A;  4DVD A;  2B1E A;  3C50 A;  4H9O C;  3FBL A;  2D2S A;  2LEH A;  4GIW A;  3PU8 A;  4TNV A;  4U72 A;  5FNV E;  1YQ4 A;  2XQY A;  3BQL A;  4YSY A;  3PUS A;  5JH7 E;  2OV9 A;  3HKE E;  5FY0 A;  3IF8 B;  3M3Z B;  4LFA T;  2CXF A;  3ZCJ A;  4J2C A;  4EZ4 A;  3I0O A;  2XAG B;  2XQ5 A;  3JC6 D;  3Q5W A;  4X5T A;  3AE4 A;  1M62 A;  4IDO A;  4Q25 A;  2Y48 B;  4ADZ A;  5LGU B;  1V9D A;  3F57 A;  4L5G A;  2VQF T;  3LJC A;  4GYR A;  2CHN A;  2XTL A;  3ANW B;  3RH3 A;  2HHH T;  2WQY A;  2XAQ B;  1N32 T;  2X51 A;  5AQV B;  4HFE A;  4NXN T;  5JTG A;  3FHN A;  4AQG A;  1SE7 A;  4UVA B;  2BBJ A;  1D1B A;  3LK4 2;  4AIU A;  4X1K E;  2BKO A;  1I6Z A;  2FJA A;  2CLY C;  2PTF A;  2JMH A;  5ADX L;  2UXX B;  3FXD B;  3K1S A;  5F8P A;  2K5B B;  2XY8 B;  1IJ6 A;  2XAS B;  1XMQ T;  3WAK A;  2FUP A;  1ZP0 A;  2CEA A;  2CPT A;  3IEE A;  2PFV A;  4KUM B;  2LRL A;  2MTQ A;  4NPP A;  5JDM A;  4YTP A;  2I6H A;  2XQ7 A;  4IST A;  2CBI A;  3D0T A;  2JIW A;  2Q9Q B;  3N9O A;  2PJQ A;  3AA7 B;  5IWA T;  3O1H A;  2LM2 A;  3N2O A;  2XAF B;  4QH5 A;  5J2T E;  4AKI A;  3KBT A;  4HWH A;  1ZKE A;  4O4L E;  4OHF A;  3W15 B;  1NAF A;  3VR8 A;  5LBQ B;  4EOZ B;  5LJN A;  1HF8 A;  2XJ7 A;  5AQO B;  4DV0 T;  3P7I A;  4XBF B;  3RRC A;  3RC3 A;  5F3J A;  3IBP A;  5HEG A;  3ZKR A;  1LRZ A;  5C8Y E;  4BA9 A;  4DV3 T;  3N5L A;  1J5W A;  2VUR A;  3U78 A;  4LF5 T;  2KLQ A;  3TKL B;  4E7S A;  1UCU A;  3CVR A;  3HA4 A;  3ZLI A;  2XUE A;  3PUW F;  2BKP A;  2FJE A;  5KDM C;  3EAB A;  2W00 A;  3NBX X;  2F4V T;  3HKD E;  4ZZC A;  4O4J E;  4PK4 A;  4WZX A;  3NZP A;  2Z6E A;  5L47 A;  3UU5 A;  1JNZ A;  4LF4 T;  2M6B A;  4TV9 E;  2LSY A;  3SRZ A;  4IE6 A;  4M1P A;  3L3P A;  4ZI2 D;  2YDR A;  3OPC A;  4H9P C;  3LBX B;  3GWH A;  3ONX A;  5LB7 B;  2Y8D A;  3GN5 A;  3OVU A;  4GYS A;  5AQH B;  3PV0 F;  3BK9 A;  4AKR B;  4B3R T;  1MIV A;  1HNW T;  3H3M A;  4I4T E;  4IIJ E;  3L39 A;  4NIQ A;  5CB4 E;  4IRE A;  5L3G B;  2IML A;  4PJJ A;  1UX4 A;  2K48 A;  2YEV C;  1SHZ C;  3N9P A;  4PFO A;  1NWM X;  4LMJ A;  4WBN E;  4KMC A;  2VKJ A;  2YIN A;  3RIF A;  5ABF B;  1YW0 A;  1HNX T;  3Q9D A;  3FZF B;  3AAI A;  2V6Y B;  2XZE A;  4YJ2 E;  2VVS A;  4Z91 A;  5JQG E;  3O4X E;  4JI7 T;  3VRB A;  5AQG B;  5IHY A;  1N33 T;  2MAW A;  2BVL A;  4GK5 E;  3CX7 B;  4JV5 T;  2N2N A;  4COF A;  3AA0 B;  1UUR A;  3N9M A;  4FI5 A;  4FJO A;  1OXZ A;  2CA5 A;  2W61 A;  4U74 A;  4U2Y A;  3ZN0 B;  4EXT A;  4IE0 A;  1KF6 A;  2WM9 A;  5HXE A;  3P4W A;  1HTJ F;  4IE5 A;  4HGA A;  4DUZ T;  2JMK A;  5AQS B;  3B5M A;  5DQW A;  1E7P A;  5FXV A;  1UGO A;  5L2L A;  2ZM8 A;  3RPU A;  3SWH A;  5L3E B;  1BR2 A;  3AED A;  3RHW A;  4UV9 B;  4WW0 A;  4EYU A;  2BS2 A;  3AA6 B;  3LBX A;  2MBG A;  4DV2 T;  3AAA B;  4XAX B;  3FZK B;  1XDO A;  5ABG A;  2KMF A;  4LF7 T;  3ESL A;  2X67 A;  4I0U A;  2JQQ A;  2OA5 A;  2XQ8 A;  3QUJ A;  4O8S A;  4HFB A;  3AEG A;  2YKS A;  3OTO T;  4HTE A;  3K3N A;  5AQM B;  1Y01 A;  3PUX F;  2NW8 A;  4QHO A;  4TN7 B;  4AQF A;  4ZI7 E;  4CI1 B;  2ZM6 T;  2LSJ A;  4WYV A;  1N34 T;  3CQG B;  3O1J A;  5LXT E;  3KFW X;  2QYW A;  4HFH A;  1OWA A;  2XSA A;  2BZB A;  2X0Y A;  5HWX A;  4ILU A;  2H7V C;  2MPK A;  3A5X A;  3I9Y A;  2A9U A;  4DR2 T;  4UVC B;  2LHN A;  4X65 T;  4DR3 T;  2H3R A;  3ZYK A;  1DU2 A;  5HCM A;  2VKH A;  2XQ9 A;  1KEY A;  2JQH A;  3GMI A;  1HCI A;  3PUZ F;  2VL8 A;  4H9Q C;  2LKH A;  5HEU A;  3UFG A;  2V5D A;  4F8H A;  1IAP A;  2NW9 A;  5J0Z A;  1XMO T;  1BR0 A;  1MNE A;  5JRE A;  2J4G A;  2ODV A;  3EUH A;  2J62 A;  4AXP A;  1ZHC A;  4H63 H;  5C2T A;  1OED A;  4U7I A;  2QA7 A;  4EAH A;  2CCQ A;  2I59 A;  4DR4 T;  4G63 A;  3DP7 A;  3MJX A;  5FXZ A;  4DV4 T;  3RIU C;  4XZC A;  4YSZ A;  2NTY A;  3C64 A;  4JEH B;  2XAH B;  1SA0 E;  2DWK A;  2HN1 A;  2NOX A;  3PUQ A;  4QXB B;  2UXN B;  3RYH E;  4GKK T;  1FMV A;  2DWG A;  4KI0 F;  3N9N A;  2OLT A;  5FP3 A;  3LSV A;  4QWN B;  4YTM A;  4TV8 E;  3UQ4 A;  1XNR T;  2K3W A;  4ISS A;  4JI8 T;  5JDQ A;  1WYC A;  2KSR A;  4TWD A;  2A2F X;  2BG9 B;  5GON E;  2CE7 A;  3NRX A;  3C4W A;  2LT3 A;  2XHE B;  4OK0 A;  5FYM A;  4GOU A;  4B3T T;  2WB5 A;  4DR6 T;  2UXC T;  4AI6 A;  3B57 A;  2LRK A;  4HWC A;  4KHP T;  2FBW A;  2YDS A;  2ACZ A;  4H9S E;  3O9X A;  2V5C A;  3LG7 A;  2EHO B;  3N9L A;  1KNR A;  2K9A A;  3CQX C;  3RIA A;  2H7O A;  5AQT B;  3UUM A;  3FXE B;  5AQN B;  4GK0 E;  1J1J A;  2V1D B;  2XM1 A;  3EAM A;  3MKD A;  1HX1 B;  2CBJ A;  2WSS V;  1G8X A;  2XAJ B;  3RRW A;  3MAC A;  5CJ5 A;  2CWO A;  3OKQ A;  4MAL A;  5J1G A;  2CXD A;  4YJ3 E;  4BAY B;  4L9I A;  3QNU A;  1XWM A;  2JJ9 A;  2Y6X A;  5JDL A;  4F6R C;  5LJM A;  2VQE T;  4PJL A;  2EHO D;  4QH4 A;  2WWV A;  5KMG P;  5KX5 E;  5L3C B;  3JC6 C;  4DV1 T;  3NWI A;  3AA1 B;  3ZCI A;  3RIU A;  5LG3 A;  1FIO A;  5JR9 B;  1FJG T;  3P8C D;  2H88 A;  3CWZ B;  4JI1 T;  3ZT5 A;  4X1I E;  3AE6 A;  3TLV A;  2E8I A;  1OED C;  3O1I A;  2PBI A;  3KDS E;  4ANJ A;  2ES0 A;  4Z90 A;  1GQE A;  1S94 A;  1IBM T;  4JLE A;  2YU2 A;  2W66 A;  1HS7 A;  3ZT6 A;  3MA9 A;  4I43 B;  1H7C A;  2K24 A;  1D1C A;  2BVM A;  2ODU A;  3KV6 A;  4DBR A;  1X79 A;  3I0Q A;  4CI2 B;  1CHU A;  2W63 A;  2WZH A;  1G73 A;  5E0O A;  3ZMU B;  4CN1 A;  5HEJ A;  4X62 T;  4YSX A;  3RKO A;  3UT5 E;  5LHG B;  3P4R A;  4JI0 T;  5H6Q B;  1M7K A;  1VCS A;  2IC6 A;  2UXD T;  4I50 E;  3CIR A;  1W0A A;  4UR9 A;  4DND A;  5LG4 A;  4ZI3 C;  3PUR A;  1Y64 B;  5FXW A;  2E9X C;  4NUU A;  4DR5 T;  4DO0 A;  4QH1 A;  3VKH A;  4JI3 T;  4U31 A;  1L0V A;  1EZ3 A;  2WDV A;  2VVN A;  2YK0 A;  3FB2 A;  3K3O A;  3HR0 A;  3Q2M A;  2AE9 A;  3KV4 A;  5ABE A;  5LGT B;  5JVD E;  2RPA A;  3G06 A;  4PNI A;  4A98 A;  4B3S T;  5FVL A;  3KV9 A;  3P4P A;  5LMN T;  3I9W A;  1LVF A;  1QLB A;  3QOF A;  4ILC A;  3OJA A;  3IHR A;  3RI5 A;  3T1H T;  2N9D A;  2X68 A;  2G0U A;  4IGU A;  2AXD S;  4U2Z A;  4V1A v;  3NRY A;  2WBL A;  1AJ3 A;  5FXX A;  5CFB A;  2NTX A;  2UUB T;  4A5X A;  2WU5 A;  5LA6 E;  4ZI2 C;  3AE8 A;  4PJN A;  1MIY A;  4CN4 A;  5AQK B;  5EK3 A;  2IHR 1;  3VRA A;  4DID B;  3AEB A;  5LOV E;  2LSK A;  3EHZ A;  3R84 B;  3RF1 A;  3J9X 1;  3KIN B;  2HH7 A;  4BJN A;  2MYS A;  4HFI A;  3UUL A;  4JBW F;  2ZLY A;  2DLR A;  3P4Q A;  1O3X A;  2LM9 A;  1XDP A;  3HKB E;  5FMN A;  2C5I T;  2Q9Q A;  5HXR A;  2X9X A;  3ZJ1 A;  2WY2 A;  4ZEY A;  4Z8X A;  3KV5 A;  3CX8 B;  2D0T A;  3L09 A;  1IBL T;  4LF9 T;  2X66 A;  3JCF A;  2HN2 A;  4QXH B;  1ZEE A;  3PUA A;  5ETW A;  4A97 A;  4C91 A;  2WAU A;  4YXD A;  4DUY T;  2L8K A;  1T72 A;  4ZI3 D;  3C98 B;  1D0X A;  3LFM A;  3ZYL A;  3C51 A;  2V26 A;  5LHI B;  5LNK A;  2PG8 A;  2V7K A;  4DR7 T;  5JDG A;  2B76 A;  2WCA A;  2IUB A;  3JAF A;  4IDZ A;  2KT9 A;  1KFY A;  3AAE B;  1QSD A;  4O2B E;  5JRC B;  3FZL B;  4UEL A;  3QB5 K;  4KBM B;  3T1Y T;  5FY1 A;  4E7Z A;  4DV5 T;  3LK2 B;  3UUN A;  2C5J A;  4HFD A;  3ZST A;  5AQI B;  2X9Y A;  3AEC A;  2GK9 A;  5EZY E;  4EED A;  4AQY T;  4YHJ A;  5LCY A;  3LK3 B;  2A3D A;  3AVR A;  2A72 A;  2V6X A;  2HPL A;  2RA1 A;  3AE2 A;  3ANW A;  4JI5 T;  4KX6 A;  3V5S A;  5HXH A;  4UIG A;  1W09 A;  3UQ7 A;  1E1H B;  5A1L A;  1U5P A;  2JQK A;  4O2A E;  4ASK A;  1Z8U A;  4IL9 A;  2UUC T;  3B13 A;  4OFZ A;  5FL0 A;  4DMW A;  1MMD A;  3H3A A;  4TWH A;  3TLU A;  2V7I A;  2VKO A;  5DQV A;  3CKD A;  3N2G E;  2RP4 A;  4K0K T;  4IHJ E;  5JDF A;  1YKH B;  3N2K E;  5JR9 C;  2XM2 A;  5L3D B;  4P0A A;  3DJB A;  1E2A A;  4LF8 T;  3VKG A;  3E08 A;  3K3Q C;  4YHH T;  2BBH A;  3PU3 A;  1YKE B;  2C5K T;  3AEE A;  3OYX A;  4IDQ A;  4TUY E;  4ZS2 A;  5C3J A;  5JRC A;  5HCJ A;  2E5V A;  2EHO A;  2X0L B;  3CX6 B;  1UUS A;  3PUG A;  4O4H E;  3FZM B;  2LOP A;  3NZQ A;  3P4S A;  2KWH A;  1IJ5 A;  2X0H A;  4LML A;  4PK5 A;  4JYA T;  5BR8 T;  1NEN A;  3AEA A;  3AE1 A;  3RYF E;  1BR1 A;  4UEM A;  1T8B A;  3ZN1 B;  5ABF A;  3UTK A;  1XNQ T;  3T8O A;  4DV6 T;  5HAX A;  4LF6 T;  2ZMA A;  4EGW A;  1UX5 A;  1MMN A;  2CWY A;  2YN6 A;  3ZYM A;  3PDY A;  4P1N A;  4ZXL A;  5LMU T;  3AXJ A;  4UF0 B;  2LJL A;  3R6N A;  2KIN B;  3QK6 A;  4H9R C;  1WR6 A;  2XQ6 A;  2IC9 A;  2LSI A;  2QVA A;  3CPZ A;  4IE7 A;  3ZMV B;  5FKY A;  2BS3 A;  1IBK T;  4HFC A;  5HXS A;  4CXY A;  3M65 A;  3MZK B;  2CRB A;  2WS3 A;  3Q5X A;  3S4U A;  1D1A A;  4X1Y E;  2UUA T;  3K8P C;  1US7 B;  3AE5 A;  5AQL B;  2V8S V;  1KK7 A;  2CMR A;  2CHO A;  4HWD A;  4ILA A;  4WBO A;  4CXW A;  2DHR A;  5CGM A;  5M4Y A;  2LKG A;  3AVS A;  4ZZB A;  3RQW A;  4UV8 B;  4AKG A;  3AE9 A;  1XZY A;  2CLY B;  4HEA A;  3OYZ A;  4EIW A;  1B7T A;  1D0Z A;  4IL4 A;  2JPF A;  5IUX A;  1VOM A;  3A7M A;  1W9R A;  2WP9 A;  2BDE A;  4KHZ F;  5AQQ B;  1MIW A;  3ZC1 A;  3E22 E;  4AKL A;  2E2A A;  1D0Y A;  5JR9 A;  3ETV A;  2H89 A;  4ZS3 A;  3AE3 A;  3RC8 A;  2M67 A;  1BR4 A;  3F31 A;  2BG9 E;  2Q9Q D;  4U33 A;  5AQP B;  1U4Q A;  4IDP A;  4AIS A;  5JDH A;  4NXM T;  4U3C A;  3OBV E;  3VU7 H;  5EK2 A;  3TLT A;  4YFS A;  3IA3 A;  3EI0 A;  2WU2 A;  4QXC B;  3J7Y q;  3AXJ B;  4UF0 A;  4B3M T;  1MND A;  3AB3 B;  2VKD A;  2V7J A;  5LBM A;  4JEU B;  2NW7 A;  1JNR A;  4HWI B;  5EK4 A;  3P50 A;  4PJM A;  2FJB A;  1WR0 A;  2XPK A;  3KBU A;  1YQ3 A;  2BS4 A;  3I1A A;  2L3L A;  4LMK A;  5FY7 A;  5IYZ E;  3TLS A;  2V6Y A;  4CI3 B;  4DR1 T;  2L9Q A;  1YXR A;  4OYK A;  5F5W A;  3GA8 A;  2D5U A;  3UUB A;  3BQI A;  4YT0 A;  1HFA A;  5AQF B;  2WDR A;  2KZ7 B;  5FVK A;  3VR9 A;  3ABV A;  1OED B;  4QKN A;  4UVB B;  3WAJ A;  2ZM2 A;  5HXC A;  4BJM A;  4MHC A;  2NWB A;  4PAG A;  3F2E A;  1I94 T;  4JUY A;  3JAD A;  3PUY F;  4U7Y A;  4OYJ A;  3PE0 A;  4EB6 E;  3ZMT B;  3UUX B;  3QC9 A;  4MFR A;  4C90 A;  4DMV A;  2MOZ A;  3C4X A;  2V7M A;  1R8I A;  2IDO B;  3HKC E;  2UU9 T;  3KVB A;  5HWY A;  3ZMS B;  2VB6 A;  1WRD A;  4PK6 A;  5HEH A;  2N1G A;  3CQC B;  3FBZ A;  2BG9 A;  3FZH B;  3UU8 A;  4DBQ A;  2YDQ A;  4KP3 C;  4ERR A;  4H63 V;  2KWI B;  2VK9 A;  2SPC A;  2E9X B;  1FEW A;  4HKA A;  2XQA A;  1WLX A;  4I55 E;  3LDQ B;  4P0B A;  1IZN B;  1QUU A;  3AE7 A;  3ONL C;  4EZH A;  2LSG A;  1LKX A;  5AFU L;  5J2U E;  2D9D A;  5L3F B;  4OX9 T;  3NKZ A;  3ZMZ B;  2X9H A;  4EYY R;  3GN5 B;  5L4E A;  3Q5D A;  2ZM0 A;  1VCT A;  2R6G F;  2VWA A;  4O4I E;  4WNK A;  4JI2 T;  4ZOL E;  4YTN A;  4X66 T;  1HNZ T;  3HI2 A;  5DJQ C;  2DL1 A;  1YD8 G;  3EDU A;  4X64 T;  3U3I A;  3UU4 A;  3ZJ2 A;  4B6X A;  4IT4 A;  2I0M A;  2V7L A;  5CA1 E;  3EVY A;  1HG2 A;  1CUN A;  3RQU A;  4YY3 T;  4UXN B;  3BQK A;  3X1D A;  4HWF A;  1T98 A;  2DCF A;  4TWF A;  5H6R B;  2HPJ A;  5TAO A;  4A56 A;  1WCR A;  1SUM B;  3PUV F;  2CXL A;  3TLW A;  4MLK A;  3KVA A;  2XQ3 A;  3DTO A;  2JQ9 A;  3UU3 A;  4NUV A;  2Q9Q C;  4HFV A;  3ETU A;  1HR0 T;  5LP6 E;  1S35 A;  2E9X A;  5HYA A;  5AQR B;  3E0Z A;  3PTR B;  2BG9 C;  2KND A;  4QX7 B;  2W0G A;  3JAE A;  3NVO A;  4TNW A;  2NR4 A;  3UFE A;  4CZZ B;  4CN6 A;  4DV7 T;  4LFB T;  4H9N C;  1VRB A;  5AQJ B;  3ZC0 A;  1WYB A;  4P09 A;  5JDN A;  5LYJ E;  2W67 A;  4QX8 B;  3MK7 C;  3EDV A;  2W2U A;  2UXB T;  3SFE A;  2QRX A;  1HX8 A;  1W0B A;  1X9B A;  2DI4 A;  2VL0 A;  3SOL A;  4AQF C;  4GKJ T;  4K0U A;  3RYI E;  3HL6 A;  4IDN A;  3RX6 A; 
#chains in the Genus database with same CATH homology
 5AQT B;  4HWF A;  1M62 A;  5AQU B;  5AQO B;  5AQN B;  3A8Y C;  5AQM B;  1HX1 B;  3FZL B;  5AQV B;  3FZH B;  3FZF B;  4HWI B;  1M7K A;  5AQK B;  5AQG B;  5AQL B;  1T7S A;  4HWD A;  5AQI B;  1UK5 A;  3FZM B;  3LDQ B;  5AQR B;  1I6Z A;  5AQF B;  2D9D A;  5AQJ B;  5AQS B;  5AQQ B;  1UGO A;  3M3Z B;  5AQH B;  4HWC A;  5AQP B;  4HWH A;  3FZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...