2KSRA

Nmr structures of tm domain of the n-acetylcholine receptor b2 subunit
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
140
structure length
140
Chain Sequence
RRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTPRGGGGYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Neuronal acetylcholine receptor subunit beta-2
publication title NMR structure of the transmembrane domain of the n-acetylcholine receptor beta2 subunit.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2ksrA01
3UU8A 5HCJA 2YKSA 4TWDA 5HEOA 4IL9A 3LSVA 4LMLA 5HEJA 3UU6A 2YOEA 2XQ3A 4TNWA 2XQ5A 4HFCA 4ILCA 3UQ7A 4IL4A 3UU4A 2LKGA 4TWFA 2BG9E 3TLVA 4LMJA 3UQ4A 5HEHA 4F8HA 4QH4A 2XQ7A 2XQAA 5L4HA 4Z91A 3TLSA 4ILBA 2M6IA 4COFA 4QH1A 4IREA 2LKHA 3RQUA 4HFBA 5L4EA 3JAEA 1OEDA 1OEDC 2YN6A 4TWHA 3JAFA 3UUBA 4X5TA 2XQ4A 4A97A 5J0ZA 4HFEA 4LMKA 3RI5A 2BG9A 3JADA 4ZZCA 3TLUA 2LLYA 2LM2A 3P50A 4HFHA 4NPPA 3TLWA 4ILAA 1OEDB 4ZZBA 3EI0A 5L47A 4A98A 4QH5A 5IUXA 3RQWA 1OEDE 3UU5A 3TLTA 3EHZA 4Z90A 4TNVA 2VL0A 2XQ6A 2XQ9A 2MAWA 5LG3A 2BG9B 3P4WA 5CFBA 2BG9C 5HEUA 3RIFA 2M6BA 5HCMA 4HFDA 3RHWA 2XQ8A 2KSRA 3RIAA 4HFIA 5HEGA 3ZKRA 3EAMA 3UU3A
chains in the Genus database with same CATH superfamily
2FBWA 1IJ5A 4DR4T 4TV8E 2UXDT 4DUYT 2H7OA 4I55E 2WU2A 1WYBA 1CHUA 3IBPA 5L3FB 2BKNA 1W09A 1MNEA 2W4XA 3AA1B 2BG9E 2ZM0A 3JC6D 3FHNA 3E0ZA 4ZXLA 2XSBA 4EYUA 4L9IA 3FBLA 4QH1A 3AA0B 1VCTA 1Y01A 5L3GB 4HFBA 3ZT5A 5F5WA 2V6YB 1UURA 3SOLA 2HN1A 3UULA 4H9QC 3RRCA 4PK4A 5AQGB 5L3BB 2WWVA 5J0ZA 2JQQA 1HNZT 3ZC0A 3RI5A 4JEHB 2B1EA 1KEYA 4M1PA 3ZN1B 4ILAA 3RGLA 2XQYA 2Q9QA 2UXNB 2W66A 3SFEA 4A98A 4UVBB 3LFMA 1AJ3A 4YSZA 1ZV4X 5JQGE 2UXXB 4O2BE 4AQYT 2P9BA 4DUZT 2J47A 3LBXB 2DWKA 2MOZA 4DV6T 3ZKRA 3S4UA 4B3RT 3C4XA 2AE9A 4PW8A 3K3NA 3MACA 2BDEA 4CI2B 4YSYA 3NVOA 1D0ZA 5LMUT 4EOZB 2W63A 3TLVA 3UQ4A 1J5WA 4LFBT 4F8HA 3L39A 1ZOYA 1N36T 1WR0A 2N9DA 2W0GA 3TLSA 2LSKA 4IE0A 3RF1A 1VRBA 2X67A 2LSGA 5FXZA 4OX9T 5JDNA 1XMOT 3N9QA 3AE9A 2ZM6T 3P7IA 4PAGA 5JDGA 4QHOA 4NUVA 2A9UA 4LMKA 1YQ4A 4ISTA 4HKAA 3P50A 3LBXA 4ZOLE 3VKHA 3N2OA 4H63V 3C4WA 3BK9A 4V1Av 4X66T 3EHZA 5L3EB 4YHHT 3DTOA 2AXDS 5FL0A 2A2FX 2FJBA 1I6ZA 4OYKA 3VRAA 4QWNB 4B6XA 2V1DB 2VL8A 1ZHCA 4UVAB 2K3WA 3ZT7A 3H37A 3UU3A 5AQOB 3ONJA 5JR9B 2DL1A 1U4QA 2LOPA 2CWOA 2H7VC 2ODVA 4HWHA 2RP4A 1VOMA 5FXXA 4XBFB 3RH3A 3AECA 3UUMA 2HH7A 2N1GA 1UX4A 2W00A 4KUMB 4G2AA 2WDQA 4HWDA 3B13A 2X66A 2BKPA 5JTGA 1E1HB 5KMGP 3HA4A 5LA6E 4WZXA 3R6NA 1L0VA 2BVLA 5DQVA 2UUCT 3AE4A 3OPCA 3EDUA 4E7SA 5C8YE 3VR8A 3CWZB 3RIUA 4DBRA 2HN2A 1HF8A 2EHOC 2UXCT 5JR9A 2MAWA 2BG9B 3V5SA 4CN4A 3C64A 5FY0A 3RKOA 4DR6T 3PUSA 2K24A 4YY3T 4CXYA 4FJOA 2VK9A 2YKSA 1Z8UA 4DR2T 4ADZA 4YXDA 4J2CA 2D0UA 2CM0A 4LFAT 3M65A 4GK5E 5JREA 2H88A 2XQ7A 2CE7A 5FL1A 2CHOA 2M6IA 4TN7B 2MBGA 4LF4T 3VU7H 4YLHA 5AQQB 5LHIB 4KMCA 5JDFA 1D1CA 2K5BB 3Q5EA 3AXJA 3ZSTA 5ABHA 3IHRA 3K3QC 5CGMA 4YTPA 2BBJA 4GOUA 4Q25A 3Q2MA 4I0UA 2H3RA 4WW0A 2E9XB 2BG9A 1YD8G 3RC8A 1G73A 4H9RC 4ZS2A 4EV6A 3O1IA 3JCFA 1M62A 3N9OA 3Q5WA 3K1SA 2IC9A 3UU5A 1KF6A 1G8XA 1V9DA 3HKBE 3SWHA 3C50A 5HXSA 3ZMVB 2IAKA 2XQ6A 2CA5A 4PFOA 4ZI3C 5FNVE 4ERRA 2VWAA 5C3JA 2M6BA 4HFDA 4HEAA 3PU8A 4TZ4C 5JDLA 2Y8DA 5ADXL 4DR5T 1HTJF 2N2NA 4NXMT 2IDOB 3NZPA 2JIWA 3UU6A 1HX8A 4CZZB 3CVRA 2X0HA 3P8CD 3IF8B 2C5IT 4LMJA 2XM1A 4EEDA 2CLYC 5HEHA 4GIWA 3L8RA 4A5XA 4PJJA 4UF0B 3B5MA 2X9HA 5FY7A 2XJ7A 2E9XA 5E0OA 2IUBA 1FEWA 2E8IA 3Q9DA 2XAJB 3UUBA 3J9X1 4AKRB 5LBQB 4CN6A 5M4YA 4DO0A 2D0TA 2LE8A 2WB5A 1HX1B 5LOVE 3AEGA 1T7SA 1UUSA 3LK3B 4ZHQE 3I9YA 4BAYB 4ZZCA 4PK6A 4B3ST 1J1JA 4CN1A 4E7ZA 4ANJA 5LYJE 1OEDB 3U3IA 4QXHB 3PUQA 2Q9QC 5JDMA 3RQWA 5AQIB 3ETVA 4LF6T 3HKCE 4DIDB 1MMNA 4P09A 3LDQB 2Z6EA 4DR1T 2VKDA 2LSJA 4UIGA 5AQUB 3ZYLA 4AQFA 3GN5B 4K0KT 4IDNA 3OYZA 3PE0A 5FXWA 2VB6A 5C2TA 4MALA 1WFDA 4IGUA 4KHZF 1R8IA 4DR3T 4UF0A 2BBHA 4DBQA 4KI0F 1Y64B 4AISA 1LRZA 4IIJE 3AB3B 2V7JA 3UU4A 3ABVA 5DABA 5H6QB 4DV2T 4AKIA 3I0OA 2PJQA 4YTNA 2YEVC 1QSDA 3N9LA 2HHHT 4P0BA 4ZS3A 1MIVA 5AQJB 4JLEA 4IT4A 4UVCB 5L4EA 5DQWA 3T1HT 5A1LA 1OEDA 5LNKA 4GKJT 3CX7B 5AQHB 3VRBA 5LGUB 4WBNE 4QXBB 3EVYA 3ANWB 1FJGT 4HFEA 4U74A 2LM9A 3T8OA 1NENA 3TLUA 1GQEA 4HWFA 3GN5A 1KK7A 5HWXA 1O3XA 3GA8A 2DNXA 5TAOA 4AXPA 1S35A 3N5LA 2XAFB 1J5ET 4IHJE 2JMKA 4Z90A 2ZLYA 2XM2A 3P4SA 4X1IE 3L3PA 3VR9A 3HKDE 3ZYKA 3A8YC 2IW5B 3RC3A 3HKEE 1HS7A 4YTMA 5L2LA 2XQ8A 2KSRA 2MPKA 2FJDA 5AQKB 1XWMA 3UFGA 3ZMZB 4JUYA 3E08A 4PNIA 4TV9E 3NBXX 4I43B 4ZI2D 3O1JA 5LP6E 4AKGA 3I9WA 2JRKA 1Z0PA 3T1YT 2BZBA 2CCQA 2WY2A 3VHLA 3K3OA 3UUNA 1BR2A 2WQYA 3ANWA 2LRKA 2VVSA 4DV4T 2YDQA 3RKGA 3F31A 3C51A 3AAIA 2V7KA 4K0UA 2DI4A 5IWAT 1XDOA 3JAFA 5H6RB 2VASA 3CX6B 3AA6B 4GYSA 2CPTA 4AI6A 3N2KE 3N9NA 2ZM2A 3PUWF 5LJMA 1BR0A 2W62A 1I94T 2ZMAA 4LF9T 5JH7E 4JI4T 3FXDB 1FIOA 3RRWA 5FKYA 3KV9A 3TLTA 4AKHA 3M3ZB 2XAQB 3RX6A 1N32T 5LG3A 2XZEA 3I0QA 4X1KE 5AQMB 2LEHA 1N33T 1FMWA 3RHWA 3MA9A 3RYHE 3KBUA 2WU5A 1EZ3A 2C5JA 3MK7C 1HNWT 1MIYA 5HEOA 2DCFA 5FYMA 5AQSB 2LSIA 4IE7A 3SS1A 2KXPB 1US7B 5ABEA 1XNRT 3AEEA 3VKGA 3KINB 1JNZA 1SE7A 2D5UA 2NWBA 3BQIA 1SHZC 4A56A 2L8KA 4ASKA 3C4ZA 4Z91A 1B7TA 3PUXF 4H9NC 3KVAA 3D0TA 5CB4E 4DV7T 3FZFB 5JDQA 5LMNT 4MHCA 3LK2B 3PTRB 2NP9A 4H9OC 3CK6A 1IJ6A 5EK4A 4GYRA 2X0LB 2A3DA 4U72A 5J2UE 5KXJA 1E7PA 4BA9A 3P4PA 4IDZA 2XPKA 1UGOA 4TNVA 1SA0E 2V7IA 2J1DG 5CFBA 3AXJB 4KHPT 2XAHB 2CWYA 4KX6A 1D1AA 1XNQT 3PV0F 1KFYA 4JI6T 4EYYR 4IDQA 4TWDA 2V26A 4IE4A 1WRDA 4ILCA 2Y48B 1YXRA 3AE7A 2KWHA 3QC9A 2WZIA 4JBWF 2X9YA 1ZEEA 1ZP0A 1W0BA 2V5DA 5BMVE 5L4HA 4JV5T 1LVKA 4HWIB 3OVUA 1T72A 4ILBA 4COFA 3PUVF 2D9DA 4DNDA 2E9XC 3DP7A 3EUHA 5GONE 3JAEA 3PUYF 4EZHA 1WCRA 3LJCA 2WM9A 1YKHB 2J4GA 3UTKA 3UT5E 4EGWA 2HPLA 2BS3A 2LSYA 4G63A 3RYCE 2NR4A 2WDRA 2NW8A 4NPPA 4O4JE 1YQ3A 4PJLA 4TUYE 4CXXA 1KNZA 1IAPA 2V5CA 1YW0A 2EHOB 4O2AE 4MLKA 2EHOD 2W67A 4GK0E 4PK5A 3ZC1A 5EK2A 5HXHA 5AQRB 5JDHA 4AQFC 2L3LA 4LF8T 3PUGA 4I4TE 4O8SA 4C90A 5LGTB 4HFIA 4DV5T 5HAXA 3OTOT 3ZJ1A 1NEKA 2X68A 2JQKA 2V7LA 3ZMTB 2XQ5A 4H9PC 4UXNB 4HFCA 2VVNA 4JI5T 3UQ7A 4IL4A 2FJAA 5LG4A 3ZPOA 1X79A 1VCSA 1M7KA 2UU9T 4QX7B 3EABA 2YDRA 4PJMA 1D1BA 4CI1B 5HYAA 2LKHA 2X51A 2FUPA 5AQPB 3AEBA 4KBMB 1OEDC 4OYJA 2E2AA 3ZMUB 3I1AA 3NRYA 3UUXB 2EHOA 5F3JA 3O9XA 4X5TA 2G0UA 3N9MA 4ZI7E 3JADA 5EK3A 5FVLA 3OJAA 4U33A 5L47A 1XMQT 4H9SE 2CRBA 4HE8A 4ZI3D 4DR7T 2WWUA 3P4RA 2WCAA 3ONLC 5HCMA 3FZKB 4KP3C 4UV9B 3RIAA 3KVBA 4U7IA 5HEGA 2DWGA 4IE6A 3L09A 5FY1A 4U2YA 1H7CA 2BS4A 5HWYA 1FMVA 4DMVA 3RLFF 3CQGB 4P1NA 2E5VA 2IHR1 2OLTA 4PJNA 4WBOA 4HN9A 1YKEB 3JC6C 2VKHA 5J1GA 1D0XA 3LG7A 4X1YE 1BR4A 5KX5E 2BS2A 5LB7B 4LF5T 2KMFA 3HL6A 3NZQA 2XQAA 4L0RA 5EZYE 3E22E 2X9XA 3AEAA 3PURA 5CA1E 3J7Yq 2F4VT 2WZHA 1IBLT 1QLBA 3ZCJA 4LF7T 4HTEA 5BR8T 2YN6A 5CJ5A 3N9PA 4IDPA 2JJ9A 3FZLB 2BKOA 1DU2A 3QK6A 2I59A 4HWCA 4JI8T 2NOXA 3O1HA 2VQET 1NWMX 4JI0T 3KBTA 1U5PA 4EB6E 1HG5A 2UXBT 2JQHA 4QXCB 2XAGB 3F57A 2YK0A 2JPFA 4X65T 3PU3A 3V5UA 4H63H 5HEUA 4ZI2C 4O4LE 5F8PA 4HGAA 3FZHB 2YU1A 3ESLA 1W0AA 3UFEA 4B3MT 3LK42 5LXTE 4I50E 4IDOA 3AAAB 2CBIA 3EDVA 4U7YA 4BJNA 5HEJA 2XQ3A 4DV0T 2A72A 5KDMC 2XY8B 3OBVE 1T8BA 1XZYA 1UCUA 2NW7A 2R6GF 4MBQA 2CHNA 4ZEYA 5HXRA 2XUEA 4DV1T 3ETUA 4UV8B 2HPJA 2X9WA 4OFZA 3IA3A 2V8SV 2CBJA 4X20E 3B57A 3HR0A 1WLXA 4X64T 4X62T 2B76A 2ACXA 2RPAA 4P0AA 2GK9A 3CQCB 3AE8A 1OXZA 2YU2A 3QOFA 3AE6A 4ZZBA 2VKJA 3CX8B 3EI0A 4JI3T 2WDVA 2LHRA 1MMAA 2W61A 5ETWA 4CI3B 2KINB 3AE3A 3H3AA 2XQ9A 2NW9A 2PBIA 3RIFA 1JNRA 2V6YA 2V6XA 3U78A 3PJAJ 3AEFA 5CA0E 3RIUC 2YINA 4O4HE 2CXLA 2KLQA 5JR9C 2LJLA 3ZYMA 2QVAA 4WNKA 2H89A 4ISSA 4LFCT 4U2ZA 2NTXA 4UELA 4XZCA 3F2EA 2FJEA 2YDSA 5ABGA 4QH4A 5FMNA 3BQKA 3NKZA 4UEMA 5LJNA 4IREA 2ACZA 3RQUA 3ZN0B 3AVRA 5L3CB 2I0MA 4TWHA 5LGNB 3QNUA 4A97A 5AFUL 3PJAA 4B3TT 1MMGA 2DLRA 4YSXA 2JMHA 2IMLA 3O4XE 5IHYA 3ZJ2A 2Y6XA 3A5XA 2DHRA 3MXZA 1OEDE 2PTFA 2L9QA 4NIQA 5AQLB 4EEBA 3AEDA 3P4WA 5IYZE 2BG9C 3AA7B 3NRXA 4WYVA 5HXCA 4AQGA 4U3CA 4XAXB 3N2GE 4JI2T 5LCYA 5FVKA 4MFRA 1CUNA 3UU8A 1N34T 3W15B 5AQTB 3LSVA 5JRCB 3FB2A 4JYAT 2QGSA 2KZ7B 2D2SA 3MZKB 4UR9A 3QUJA 3CPZA 4EAHA 3ZEFB 4N78D 1WR6A 5FP3A 1LKXA 4NUUA 2LKGA 4TWFA 5J2TE 4PFPA 2LOSA 3PDYA 3MJXA 3ZSSA 2WMOA 5LBMA 3FXEB 2NTYA 2V7MA 2XTLA 2ODUA 2MYSA 4EZ4A 1UK5A 2XSAA 3SRZA 1NAFA 3BQLA 3AE5A 3PUZF 2LRLA 5LHGB 4JI1T 4U31A 4AIUA 3WI3A 2LLYA 2BVMA 2LM2A 3P4QA 5JVDE 2UUBT 2PG8A 3AAEB 2C0SA 2LHNA 2QYWA 4QH5A 5IUXA 4CQIA 1S94A 4C91A 2QA7A 2M67A 3SFDA 2XASB 2VL0A 5JRCA 3HI2A 3CMLA 3GWHA 5AQFB 1OWAA 3FZMB 3ZCIA 3MKDA 4ILUA 4DV3T 3A7MA 2RA1A 5HCJA 1SUMB 3NWIA 4IL9A 2K9AA 1KNPA 4LMLA 3OYXA 1D0YA 1IBKT 4YT0A 1E2AA 2PFVA 4CXWA 3ZT6A 3KDSE 4HFVA 1XDPA 3PUAA 1MNDA 2ES0A 3CKDA 3CQXC 4YFSA 1MIWA 2E9XD 1T98A 1X9BA 2VURA 1WYCA 2I6HA 3QB5A 1HCIA 4JI7T 3FBZA 2OA5A 2VKOA 3IEEA 3RYFE 2MTQA 2KWIB 1LVFA 2LT3A 5ABFB 2XHEB 4L5GA 2J62A 4HFHA 3TLWA 2ZM8A 1W9RA 4EXTA 2E5LT 3R84B 3CIRA 3KV6A 4Z8XA 5LHHB 2OV9A 5AQNB 1ZKEA 3RPUA 4YJ3E 1BR1A 2CEAA 3C98B 4O4IE 2CXDA 2KT9A 2WBLA 1HG2A 1HNXT 1KNRA 3OKQA 3KV4A 4BJMA 3H3MA 4OHFA 4F6RC 2YOEA 3AE1A 3AVSA 4TNWA 4EIWA 5HXEA 2WS3A 3KFWX 2WMNA 4NXNT 2VQFT 2KNDA 5DJQC 1HFAA 2QRXA 1HR0T 4OK0A 4YJ2E 5FXVA 4QX8B 3ZMSB 3RYIE 3Q5XA 3GMIA 1IBMT 3KV5A 4FI5A 2WP9A 3AE2A 4GKKT 2C5KT 5ABFA 3ONXA 2WSSV 2K48A 3X1DA 4DVDA 2CMRA 4DMWA 5L3DB 2IC6A 2CLYB 2UUAT 4QKNA 1IZNB 2XQ4A 1QUUA 4TX5A 1UX5A 2W2UA 3WAJA 2X0YA 1MMDA 2CXFA 3K8PC 3QB5K 4YHJA 3TKLB 2SPCA 4IE5A 2WAUA 2JQ9A 3G06A 3ZLIA 2IIUA 3WAKA 4AKLA 5AQVB 3DJBA 2Q9QB 4JEUB 3EAMA 2Q9QD 3Q5DA
chains in the Genus database with same CATH topology
3UU8A 5HCJA 2YKSA 4TWDA 5HEOA 4IL9A 3LSVA 4LMLA 5HEJA 3UU6A 2YOEA 2XQ3A 4TNWA 2XQ5A 4HFCA 4ILCA 3UQ7A 4IL4A 3UU4A 2LKGA 4TWFA 2BG9E 3TLVA 4LMJA 3UQ4A 5HEHA 4F8HA 4QH4A 2XQ7A 2XQAA 5L4HA 4Z91A 3TLSA 4ILBA 2M6IA 4COFA 4QH1A 4IREA 2LKHA 3RQUA 4HFBA 5L4EA 3JAEA 1OEDA 1OEDC 2YN6A 4TWHA 3JAFA 3UUBA 4X5TA 2XQ4A 4A97A 5J0ZA 4HFEA 4LMKA 3RI5A 2BG9A 3JADA 4ZZCA 3TLUA 2LLYA 2LM2A 3P50A 4HFHA 4NPPA 3TLWA 4ILAA 1OEDB 4ZZBA 3EI0A 5L47A 4A98A 4QH5A 5IUXA 3RQWA 1OEDE 3UU5A 3TLTA 3EHZA 4Z90A 4TNVA 2VL0A 2XQ6A 2XQ9A 2MAWA 5LG3A 2BG9B 3P4WA 5CFBA 2BG9C 5HEUA 3RIFA 2M6BA 5HCMA 4HFDA 3RHWA 2XQ8A 2KSRA 3RIAA 4HFIA 5HEGA 3ZKRA 3EAMA 3UU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU8 A;  5HCJ A;  2YKS A;  4TWD A;  5HEO A;  4IL9 A;  3LSV A;  4LML A;  5HEJ A;  3UU6 A;  2YOE A;  2XQ3 A;  4TNW A;  2XQ5 A;  4HFC A;  4ILC A;  3UQ7 A;  4IL4 A;  3UU4 A;  2LKG A;  4TWF A;  2BG9 E;  3TLV A;  4LMJ A;  3UQ4 A;  5HEH A;  4F8H A;  4QH4 A;  2XQ7 A;  2XQA A;  5L4H A;  4Z91 A;  3TLS A;  4ILB A;  2M6I A;  4COF A;  4QH1 A;  4IRE A;  2LKH A;  3RQU A;  4HFB A;  5L4E A;  3JAE A;  1OED A;  1OED C;  2YN6 A;  4TWH A;  3JAF A;  3UUB A;  4X5T A;  2XQ4 A;  4A97 A;  5J0Z A;  4HFE A;  4LMK A;  3RI5 A;  2BG9 A;  3JAD A;  4ZZC A;  3TLU A;  2LLY A;  2LM2 A;  3P50 A;  4HFH A;  4NPP A;  3TLW A;  4ILA A;  1OED B;  4ZZB A;  3EI0 A;  5L47 A;  4A98 A;  4QH5 A;  5IUX A;  3RQW A;  1OED E;  3UU5 A;  3TLT A;  3EHZ A;  4Z90 A;  4TNV A;  2VL0 A;  2XQ6 A;  2XQ9 A;  2MAW A;  5LG3 A;  2BG9 B;  3P4W A;  5CFB A;  2BG9 C;  5HEU A;  3RIF A;  2M6B A;  5HCM A;  4HFD A;  3RHW A;  2XQ8 A;  2KSR A;  3RIA A;  4HFI A;  5HEG A;  3ZKR A;  3EAM A;  3UU3 A; 
#chains in the Genus database with same CATH topology
 2FBW A;  1IJ5 A;  4DR4 T;  4TV8 E;  2UXD T;  4DUY T;  2H7O A;  4I55 E;  2WU2 A;  1WYB A;  1CHU A;  3IBP A;  5L3F B;  2BKN A;  1W09 A;  1MNE A;  2W4X A;  3AA1 B;  2BG9 E;  2ZM0 A;  3JC6 D;  3FHN A;  3E0Z A;  4ZXL A;  2XSB A;  4EYU A;  4L9I A;  3FBL A;  4QH1 A;  3AA0 B;  1VCT A;  1Y01 A;  5L3G B;  4HFB A;  3ZT5 A;  5F5W A;  2V6Y B;  1UUR A;  3SOL A;  2HN1 A;  3UUL A;  4H9Q C;  3RRC A;  4PK4 A;  5AQG B;  5L3B B;  2WWV A;  5J0Z A;  2JQQ A;  1HNZ T;  3ZC0 A;  3RI5 A;  4JEH B;  2B1E A;  1KEY A;  4M1P A;  3ZN1 B;  4ILA A;  3RGL A;  2XQY A;  2Q9Q A;  2UXN B;  2W66 A;  3SFE A;  4A98 A;  4UVB B;  3LFM A;  1AJ3 A;  4YSZ A;  1ZV4 X;  5JQG E;  2UXX B;  4O2B E;  4AQY T;  2P9B A;  4DUZ T;  2J47 A;  3LBX B;  2DWK A;  2MOZ A;  4DV6 T;  3ZKR A;  3S4U A;  4B3R T;  3C4X A;  2AE9 A;  4PW8 A;  3K3N A;  3MAC A;  2BDE A;  4CI2 B;  4YSY A;  3NVO A;  1D0Z A;  5LMU T;  4EOZ B;  2W63 A;  3TLV A;  3UQ4 A;  1J5W A;  4LFB T;  4F8H A;  3L39 A;  1ZOY A;  1N36 T;  1WR0 A;  2N9D A;  2W0G A;  3TLS A;  2LSK A;  4IE0 A;  3RF1 A;  1VRB A;  2X67 A;  2LSG A;  5FXZ A;  4OX9 T;  5JDN A;  1XMO T;  3N9Q A;  3AE9 A;  2ZM6 T;  3P7I A;  4PAG A;  5JDG A;  4QHO A;  4NUV A;  2A9U A;  4LMK A;  1YQ4 A;  4IST A;  4HKA A;  3P50 A;  3LBX A;  4ZOL E;  3VKH A;  3N2O A;  4H63 V;  3C4W A;  3BK9 A;  4V1A v;  4X66 T;  3EHZ A;  5L3E B;  4YHH T;  3DTO A;  2AXD S;  5FL0 A;  2A2F X;  2FJB A;  1I6Z A;  4OYK A;  3VRA A;  4QWN B;  4B6X A;  2V1D B;  2VL8 A;  1ZHC A;  4UVA B;  2K3W A;  3ZT7 A;  3H37 A;  3UU3 A;  5AQO B;  3ONJ A;  5JR9 B;  2DL1 A;  1U4Q A;  2LOP A;  2CWO A;  2H7V C;  2ODV A;  4HWH A;  2RP4 A;  1VOM A;  5FXX A;  4XBF B;  3RH3 A;  3AEC A;  3UUM A;  2HH7 A;  2N1G A;  1UX4 A;  2W00 A;  4KUM B;  4G2A A;  2WDQ A;  4HWD A;  3B13 A;  2X66 A;  2BKP A;  5JTG A;  1E1H B;  5KMG P;  3HA4 A;  5LA6 E;  4WZX A;  3R6N A;  1L0V A;  2BVL A;  5DQV A;  2UUC T;  3AE4 A;  3OPC A;  3EDU A;  4E7S A;  5C8Y E;  3VR8 A;  3CWZ B;  3RIU A;  4DBR A;  2HN2 A;  1HF8 A;  2EHO C;  2UXC T;  5JR9 A;  2MAW A;  2BG9 B;  3V5S A;  4CN4 A;  3C64 A;  5FY0 A;  3RKO A;  4DR6 T;  3PUS A;  2K24 A;  4YY3 T;  4CXY A;  4FJO A;  2VK9 A;  2YKS A;  1Z8U A;  4DR2 T;  4ADZ A;  4YXD A;  4J2C A;  2D0U A;  2CM0 A;  4LFA T;  3M65 A;  4GK5 E;  5JRE A;  2H88 A;  2XQ7 A;  2CE7 A;  5FL1 A;  2CHO A;  2M6I A;  4TN7 B;  2MBG A;  4LF4 T;  3VU7 H;  4YLH A;  5AQQ B;  5LHI B;  4KMC A;  5JDF A;  1D1C A;  2K5B B;  3Q5E A;  3AXJ A;  3ZST A;  5ABH A;  3IHR A;  3K3Q C;  5CGM A;  4YTP A;  2BBJ A;  4GOU A;  4Q25 A;  3Q2M A;  4I0U A;  2H3R A;  4WW0 A;  2E9X B;  2BG9 A;  1YD8 G;  3RC8 A;  1G73 A;  4H9R C;  4ZS2 A;  4EV6 A;  3O1I A;  3JCF A;  1M62 A;  3N9O A;  3Q5W A;  3K1S A;  2IC9 A;  3UU5 A;  1KF6 A;  1G8X A;  1V9D A;  3HKB E;  3SWH A;  3C50 A;  5HXS A;  3ZMV B;  2IAK A;  2XQ6 A;  2CA5 A;  4PFO A;  4ZI3 C;  5FNV E;  4ERR A;  2VWA A;  5C3J A;  2M6B A;  4HFD A;  4HEA A;  3PU8 A;  4TZ4 C;  5JDL A;  2Y8D A;  5ADX L;  4DR5 T;  1HTJ F;  2N2N A;  4NXM T;  2IDO B;  3NZP A;  2JIW A;  3UU6 A;  1HX8 A;  4CZZ B;  3CVR A;  2X0H A;  3P8C D;  3IF8 B;  2C5I T;  4LMJ A;  2XM1 A;  4EED A;  2CLY C;  5HEH A;  4GIW A;  3L8R A;  4A5X A;  4PJJ A;  4UF0 B;  3B5M A;  2X9H A;  5FY7 A;  2XJ7 A;  2E9X A;  5E0O A;  2IUB A;  1FEW A;  2E8I A;  3Q9D A;  2XAJ B;  3UUB A;  3J9X 1;  4AKR B;  5LBQ B;  4CN6 A;  5M4Y A;  4DO0 A;  2D0T A;  2LE8 A;  2WB5 A;  1HX1 B;  5LOV E;  3AEG A;  1T7S A;  1UUS A;  3LK3 B;  4ZHQ E;  3I9Y A;  4BAY B;  4ZZC A;  4PK6 A;  4B3S T;  1J1J A;  4CN1 A;  4E7Z A;  4ANJ A;  5LYJ E;  1OED B;  3U3I A;  4QXH B;  3PUQ A;  2Q9Q C;  5JDM A;  3RQW A;  5AQI B;  3ETV A;  4LF6 T;  3HKC E;  4DID B;  1MMN A;  4P09 A;  3LDQ B;  2Z6E A;  4DR1 T;  2VKD A;  2LSJ A;  4UIG A;  5AQU B;  3ZYL A;  4AQF A;  3GN5 B;  4K0K T;  4IDN A;  3OYZ A;  3PE0 A;  5FXW A;  2VB6 A;  5C2T A;  4MAL A;  1WFD A;  4IGU A;  4KHZ F;  1R8I A;  4DR3 T;  4UF0 A;  2BBH A;  4DBQ A;  4KI0 F;  1Y64 B;  4AIS A;  1LRZ A;  4IIJ E;  3AB3 B;  2V7J A;  3UU4 A;  3ABV A;  5DAB A;  5H6Q B;  4DV2 T;  4AKI A;  3I0O A;  2PJQ A;  4YTN A;  2YEV C;  1QSD A;  3N9L A;  2HHH T;  4P0B A;  4ZS3 A;  1MIV A;  5AQJ B;  4JLE A;  4IT4 A;  4UVC B;  5L4E A;  5DQW A;  3T1H T;  5A1L A;  1OED A;  5LNK A;  4GKJ T;  3CX7 B;  5AQH B;  3VRB A;  5LGU B;  4WBN E;  4QXB B;  3EVY A;  3ANW B;  1FJG T;  4HFE A;  4U74 A;  2LM9 A;  3T8O A;  1NEN A;  3TLU A;  1GQE A;  4HWF A;  3GN5 A;  1KK7 A;  5HWX A;  1O3X A;  3GA8 A;  2DNX A;  5TAO A;  4AXP A;  1S35 A;  3N5L A;  2XAF B;  1J5E T;  4IHJ E;  2JMK A;  4Z90 A;  2ZLY A;  2XM2 A;  3P4S A;  4X1I E;  3L3P A;  3VR9 A;  3HKD E;  3ZYK A;  3A8Y C;  2IW5 B;  3RC3 A;  3HKE E;  1HS7 A;  4YTM A;  5L2L A;  2XQ8 A;  2KSR A;  2MPK A;  2FJD A;  5AQK B;  1XWM A;  3UFG A;  3ZMZ B;  4JUY A;  3E08 A;  4PNI A;  4TV9 E;  3NBX X;  4I43 B;  4ZI2 D;  3O1J A;  5LP6 E;  4AKG A;  3I9W A;  2JRK A;  1Z0P A;  3T1Y T;  2BZB A;  2CCQ A;  2WY2 A;  3VHL A;  3K3O A;  3UUN A;  1BR2 A;  2WQY A;  3ANW A;  2LRK A;  2VVS A;  4DV4 T;  2YDQ A;  3RKG A;  3F31 A;  3C51 A;  3AAI A;  2V7K A;  4K0U A;  2DI4 A;  5IWA T;  1XDO A;  3JAF A;  5H6R B;  2VAS A;  3CX6 B;  3AA6 B;  4GYS A;  2CPT A;  4AI6 A;  3N2K E;  3N9N A;  2ZM2 A;  3PUW F;  5LJM A;  1BR0 A;  2W62 A;  1I94 T;  2ZMA A;  4LF9 T;  5JH7 E;  4JI4 T;  3FXD B;  1FIO A;  3RRW A;  5FKY A;  3KV9 A;  3TLT A;  4AKH A;  3M3Z B;  2XAQ B;  3RX6 A;  1N32 T;  5LG3 A;  2XZE A;  3I0Q A;  4X1K E;  5AQM B;  2LEH A;  1N33 T;  1FMW A;  3RHW A;  3MA9 A;  3RYH E;  3KBU A;  2WU5 A;  1EZ3 A;  2C5J A;  3MK7 C;  1HNW T;  1MIY A;  5HEO A;  2DCF A;  5FYM A;  5AQS B;  2LSI A;  4IE7 A;  3SS1 A;  2KXP B;  1US7 B;  5ABE A;  1XNR T;  3AEE A;  3VKG A;  3KIN B;  1JNZ A;  1SE7 A;  2D5U A;  2NWB A;  3BQI A;  1SHZ C;  4A56 A;  2L8K A;  4ASK A;  3C4Z A;  4Z91 A;  1B7T A;  3PUX F;  4H9N C;  3KVA A;  3D0T A;  5CB4 E;  4DV7 T;  3FZF B;  5JDQ A;  5LMN T;  4MHC A;  3LK2 B;  3PTR B;  2NP9 A;  4H9O C;  3CK6 A;  1IJ6 A;  5EK4 A;  4GYR A;  2X0L B;  2A3D A;  4U72 A;  5J2U E;  5KXJ A;  1E7P A;  4BA9 A;  3P4P A;  4IDZ A;  2XPK A;  1UGO A;  4TNV A;  1SA0 E;  2V7I A;  2J1D G;  5CFB A;  3AXJ B;  4KHP T;  2XAH B;  2CWY A;  4KX6 A;  1D1A A;  1XNQ T;  3PV0 F;  1KFY A;  4JI6 T;  4EYY R;  4IDQ A;  4TWD A;  2V26 A;  4IE4 A;  1WRD A;  4ILC A;  2Y48 B;  1YXR A;  3AE7 A;  2KWH A;  3QC9 A;  2WZI A;  4JBW F;  2X9Y A;  1ZEE A;  1ZP0 A;  1W0B A;  2V5D A;  5BMV E;  5L4H A;  4JV5 T;  1LVK A;  4HWI B;  3OVU A;  1T72 A;  4ILB A;  4COF A;  3PUV F;  2D9D A;  4DND A;  2E9X C;  3DP7 A;  3EUH A;  5GON E;  3JAE A;  3PUY F;  4EZH A;  1WCR A;  3LJC A;  2WM9 A;  1YKH B;  2J4G A;  3UTK A;  3UT5 E;  4EGW A;  2HPL A;  2BS3 A;  2LSY A;  4G63 A;  3RYC E;  2NR4 A;  2WDR A;  2NW8 A;  4NPP A;  4O4J E;  1YQ3 A;  4PJL A;  4TUY E;  4CXX A;  1KNZ A;  1IAP A;  2V5C A;  1YW0 A;  2EHO B;  4O2A E;  4MLK A;  2EHO D;  2W67 A;  4GK0 E;  4PK5 A;  3ZC1 A;  5EK2 A;  5HXH A;  5AQR B;  5JDH A;  4AQF C;  2L3L A;  4LF8 T;  3PUG A;  4I4T E;  4O8S A;  4C90 A;  5LGT B;  4HFI A;  4DV5 T;  5HAX A;  3OTO T;  3ZJ1 A;  1NEK A;  2X68 A;  2JQK A;  2V7L A;  3ZMT B;  2XQ5 A;  4H9P C;  4UXN B;  4HFC A;  2VVN A;  4JI5 T;  3UQ7 A;  4IL4 A;  2FJA A;  5LG4 A;  3ZPO A;  1X79 A;  1VCS A;  1M7K A;  2UU9 T;  4QX7 B;  3EAB A;  2YDR A;  4PJM A;  1D1B A;  4CI1 B;  5HYA A;  2LKH A;  2X51 A;  2FUP A;  5AQP B;  3AEB A;  4KBM B;  1OED C;  4OYJ A;  2E2A A;  3ZMU B;  3I1A A;  3NRY A;  3UUX B;  2EHO A;  5F3J A;  3O9X A;  4X5T A;  2G0U A;  3N9M A;  4ZI7 E;  3JAD A;  5EK3 A;  5FVL A;  3OJA A;  4U33 A;  5L47 A;  1XMQ T;  4H9S E;  2CRB A;  4HE8 A;  4ZI3 D;  4DR7 T;  2WWU A;  3P4R A;  2WCA A;  3ONL C;  5HCM A;  3FZK B;  4KP3 C;  4UV9 B;  3RIA A;  3KVB A;  4U7I A;  5HEG A;  2DWG A;  4IE6 A;  3L09 A;  5FY1 A;  4U2Y A;  1H7C A;  2BS4 A;  5HWY A;  1FMV A;  4DMV A;  3RLF F;  3CQG B;  4P1N A;  2E5V A;  2IHR 1;  2OLT A;  4PJN A;  4WBO A;  4HN9 A;  1YKE B;  3JC6 C;  2VKH A;  5J1G A;  1D0X A;  3LG7 A;  4X1Y E;  1BR4 A;  5KX5 E;  2BS2 A;  5LB7 B;  4LF5 T;  2KMF A;  3HL6 A;  3NZQ A;  2XQA A;  4L0R A;  5EZY E;  3E22 E;  2X9X A;  3AEA A;  3PUR A;  5CA1 E;  3J7Y q;  2F4V T;  2WZH A;  1IBL T;  1QLB A;  3ZCJ A;  4LF7 T;  4HTE A;  5BR8 T;  2YN6 A;  5CJ5 A;  3N9P A;  4IDP A;  2JJ9 A;  3FZL B;  2BKO A;  1DU2 A;  3QK6 A;  2I59 A;  4HWC A;  4JI8 T;  2NOX A;  3O1H A;  2VQE T;  1NWM X;  4JI0 T;  3KBT A;  1U5P A;  4EB6 E;  1HG5 A;  2UXB T;  2JQH A;  4QXC B;  2XAG B;  3F57 A;  2YK0 A;  2JPF A;  4X65 T;  3PU3 A;  3V5U A;  4H63 H;  5HEU A;  4ZI2 C;  4O4L E;  5F8P A;  4HGA A;  3FZH B;  2YU1 A;  3ESL A;  1W0A A;  3UFE A;  4B3M T;  3LK4 2;  5LXT E;  4I50 E;  4IDO A;  3AAA B;  2CBI A;  3EDV A;  4U7Y A;  4BJN A;  5HEJ A;  2XQ3 A;  4DV0 T;  2A72 A;  5KDM C;  2XY8 B;  3OBV E;  1T8B A;  1XZY A;  1UCU A;  2NW7 A;  2R6G F;  4MBQ A;  2CHN A;  4ZEY A;  5HXR A;  2XUE A;  4DV1 T;  3ETU A;  4UV8 B;  2HPJ A;  2X9W A;  4OFZ A;  3IA3 A;  2V8S V;  2CBJ A;  4X20 E;  3B57 A;  3HR0 A;  1WLX A;  4X64 T;  4X62 T;  2B76 A;  2ACX A;  2RPA A;  4P0A A;  2GK9 A;  3CQC B;  3AE8 A;  1OXZ A;  2YU2 A;  3QOF A;  3AE6 A;  4ZZB A;  2VKJ A;  3CX8 B;  3EI0 A;  4JI3 T;  2WDV A;  2LHR A;  1MMA A;  2W61 A;  5ETW A;  4CI3 B;  2KIN B;  3AE3 A;  3H3A A;  2XQ9 A;  2NW9 A;  2PBI A;  3RIF A;  1JNR A;  2V6Y A;  2V6X A;  3U78 A;  3PJA J;  3AEF A;  5CA0 E;  3RIU C;  2YIN A;  4O4H E;  2CXL A;  2KLQ A;  5JR9 C;  2LJL A;  3ZYM A;  2QVA A;  4WNK A;  2H89 A;  4ISS A;  4LFC T;  4U2Z A;  2NTX A;  4UEL A;  4XZC A;  3F2E A;  2FJE A;  2YDS A;  5ABG A;  4QH4 A;  5FMN A;  3BQK A;  3NKZ A;  4UEM A;  5LJN A;  4IRE A;  2ACZ A;  3RQU A;  3ZN0 B;  3AVR A;  5L3C B;  2I0M A;  4TWH A;  5LGN B;  3QNU A;  4A97 A;  5AFU L;  3PJA A;  4B3T T;  1MMG A;  2DLR A;  4YSX A;  2JMH A;  2IML A;  3O4X E;  5IHY A;  3ZJ2 A;  2Y6X A;  3A5X A;  2DHR A;  3MXZ A;  1OED E;  2PTF A;  2L9Q A;  4NIQ A;  5AQL B;  4EEB A;  3AED A;  3P4W A;  5IYZ E;  2BG9 C;  3AA7 B;  3NRX A;  4WYV A;  5HXC A;  4AQG A;  4U3C A;  4XAX B;  3N2G E;  4JI2 T;  5LCY A;  5FVK A;  4MFR A;  1CUN A;  3UU8 A;  1N34 T;  3W15 B;  5AQT B;  3LSV A;  5JRC B;  3FB2 A;  4JYA T;  2QGS A;  2KZ7 B;  2D2S A;  3MZK B;  4UR9 A;  3QUJ A;  3CPZ A;  4EAH A;  3ZEF B;  4N78 D;  1WR6 A;  5FP3 A;  1LKX A;  4NUU A;  2LKG A;  4TWF A;  5J2T E;  4PFP A;  2LOS A;  3PDY A;  3MJX A;  3ZSS A;  2WMO A;  5LBM A;  3FXE B;  2NTY A;  2V7M A;  2XTL A;  2ODU A;  2MYS A;  4EZ4 A;  1UK5 A;  2XSA A;  3SRZ A;  1NAF A;  3BQL A;  3AE5 A;  3PUZ F;  2LRL A;  5LHG B;  4JI1 T;  4U31 A;  4AIU A;  3WI3 A;  2LLY A;  2BVM A;  2LM2 A;  3P4Q A;  5JVD E;  2UUB T;  2PG8 A;  3AAE B;  2C0S A;  2LHN A;  2QYW A;  4QH5 A;  5IUX A;  4CQI A;  1S94 A;  4C91 A;  2QA7 A;  2M67 A;  3SFD A;  2XAS B;  2VL0 A;  5JRC A;  3HI2 A;  3CML A;  3GWH A;  5AQF B;  1OWA A;  3FZM B;  3ZCI A;  3MKD A;  4ILU A;  4DV3 T;  3A7M A;  2RA1 A;  5HCJ A;  1SUM B;  3NWI A;  4IL9 A;  2K9A A;  1KNP A;  4LML A;  3OYX A;  1D0Y A;  1IBK T;  4YT0 A;  1E2A A;  2PFV A;  4CXW A;  3ZT6 A;  3KDS E;  4HFV A;  1XDP A;  3PUA A;  1MND A;  2ES0 A;  3CKD A;  3CQX C;  4YFS A;  1MIW A;  2E9X D;  1T98 A;  1X9B A;  2VUR A;  1WYC A;  2I6H A;  3QB5 A;  1HCI A;  4JI7 T;  3FBZ A;  2OA5 A;  2VKO A;  3IEE A;  3RYF E;  2MTQ A;  2KWI B;  1LVF A;  2LT3 A;  5ABF B;  2XHE B;  4L5G A;  2J62 A;  4HFH A;  3TLW A;  2ZM8 A;  1W9R A;  4EXT A;  2E5L T;  3R84 B;  3CIR A;  3KV6 A;  4Z8X A;  5LHH B;  2OV9 A;  5AQN B;  1ZKE A;  3RPU A;  4YJ3 E;  1BR1 A;  2CEA A;  3C98 B;  4O4I E;  2CXD A;  2KT9 A;  2WBL A;  1HG2 A;  1HNX T;  1KNR A;  3OKQ A;  3KV4 A;  4BJM A;  3H3M A;  4OHF A;  4F6R C;  2YOE A;  3AE1 A;  3AVS A;  4TNW A;  4EIW A;  5HXE A;  2WS3 A;  3KFW X;  2WMN A;  4NXN T;  2VQF T;  2KND A;  5DJQ C;  1HFA A;  2QRX A;  1HR0 T;  4OK0 A;  4YJ2 E;  5FXV A;  4QX8 B;  3ZMS B;  3RYI E;  3Q5X A;  3GMI A;  1IBM T;  3KV5 A;  4FI5 A;  2WP9 A;  3AE2 A;  4GKK T;  2C5K T;  5ABF A;  3ONX A;  2WSS V;  2K48 A;  3X1D A;  4DVD A;  2CMR A;  4DMW A;  5L3D B;  2IC6 A;  2CLY B;  2UUA T;  4QKN A;  1IZN B;  2XQ4 A;  1QUU A;  4TX5 A;  1UX5 A;  2W2U A;  3WAJ A;  2X0Y A;  1MMD A;  2CXF A;  3K8P C;  3QB5 K;  4YHJ A;  3TKL B;  2SPC A;  4IE5 A;  2WAU A;  2JQ9 A;  3G06 A;  3ZLI A;  2IIU A;  3WAK A;  4AKL A;  5AQV B;  3DJB A;  2Q9Q B;  4JEU B;  3EAM A;  2Q9Q D;  3Q5D A; 
#chains in the Genus database with same CATH homology
 3UU8 A;  5HCJ A;  2YKS A;  4TWD A;  5HEO A;  4IL9 A;  3LSV A;  4LML A;  5HEJ A;  3UU6 A;  2YOE A;  2XQ3 A;  4TNW A;  2XQ5 A;  4HFC A;  4ILC A;  3UQ7 A;  4IL4 A;  3UU4 A;  2LKG A;  4TWF A;  2BG9 E;  3TLV A;  4LMJ A;  3UQ4 A;  5HEH A;  4F8H A;  4QH4 A;  2XQ7 A;  2XQA A;  5L4H A;  4Z91 A;  3TLS A;  4ILB A;  2M6I A;  4COF A;  4QH1 A;  4IRE A;  2LKH A;  3RQU A;  4HFB A;  5L4E A;  3JAE A;  1OED A;  1OED C;  2YN6 A;  4TWH A;  3JAF A;  3UUB A;  4X5T A;  2XQ4 A;  4A97 A;  5J0Z A;  4HFE A;  4LMK A;  3RI5 A;  2BG9 A;  3JAD A;  4ZZC A;  3TLU A;  2LLY A;  2LM2 A;  3P50 A;  4HFH A;  4NPP A;  3TLW A;  4ILA A;  1OED B;  4ZZB A;  3EI0 A;  5L47 A;  4A98 A;  4QH5 A;  5IUX A;  3RQW A;  1OED E;  3UU5 A;  3TLT A;  3EHZ A;  4Z90 A;  4TNV A;  2VL0 A;  2XQ6 A;  2XQ9 A;  2MAW A;  5LG3 A;  2BG9 B;  3P4W A;  5CFB A;  2BG9 C;  5HEU A;  3RIF A;  2M6B A;  5HCM A;  4HFD A;  3RHW A;  2XQ8 A;  2KSR A;  3RIA A;  4HFI A;  5HEG A;  3ZKR A;  3EAM A;  3UU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...