2KSRA

Nmr structures of tm domain of the n-acetylcholine receptor b2 subunit
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
140
structure length
140
Chain Sequence
RRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTPRGGGGYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal acetylcholine receptor subunit beta-2
publication title NMR structure of the transmembrane domain of the n-acetylcholine receptor beta2 subunit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 39
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2ksrA01
4HFBA 2XQ8A 4LMLA 2BG9A 1OEDC 4IL4A 3RHWA 4ILBA 3JAFA 4X5TA 4ZZCA 2LM2A 5LG3A 4HFCA 4TWDA 3P50A 2BG9E 3RQWA 5HCMA 3EHZA 3UU3A 3RIAA 4LMKA 2MAWA 3UU4A 5HEHA 2LKHA 2M6BA 2XQ3A 2XQ7A 4TWHA 4NPPA 3RI5A 4TWFA 5CFBA 5L4HA 5J0ZA 4COFA 2XQ9A 2BG9C 2XQ5A 4QH4A 5HEOA 4Z91A 4TNVA 5IUXA 3TLWA 3TLSA 3JADA 3UUBA 3UQ7A 3LSVA 4QH5A 1OEDA 2LLYA 3JAEA 4ILAA 4A98A 3UU8A 4QH1A 3UQ4A 5HEGA 2YN6A 3TLUA 2KSRA 4IREA 5HEJA 4ILCA 2XQ6A 4HFHA 2M6IA 3TLTA 4IL9A 4TNWA 2XQ4A 5L4EA 4HFIA 2XQAA 2YKSA 5HEUA 1OEDE 3P4WA 2YOEA 4Z90A 4F8HA 3UU6A 1OEDB 3EAMA 4HFDA 4A97A 3UU5A 4ZZBA 5HCJA 5L47A 2VL0A 3EI0A 3RIFA 3ZKRA 4HFEA 3RQUA 2LKGA 3TLVA 2BG9B 4LMJA
chains in the Genus database with same CATH superfamily
1YKEB 3OYZA 4UVCB 5KMGP 5AFUL 1UX5A 3N2KE 1HNXT 3VU7H 4MBQA 2DWKA 2E9XC 2W67A 1D1CA 3CQXC 2A72A 1SHZC 3PU3A 2BBHA 2CLYC 2ZMAA 2LT3A 2XAJB 5J2TE 2BKPA 1US7B 1W0BA 2XQ7A 3O4XE 4JEHB 2IHR1 1FMWA 2LM9A 3O1HA 5CFBA 2YINA 2VB6A 3ETUA 5LBMA 3CQGB 2CEAA 5AQIB 1XWMA 3VR8A 5LXTE 2WWVA 5FY1A 2RA1A 2UXNB 3TLWA 1ZHCA 3CVRA 4E7ZA 4QHOA 3NZPA 2ACXA 5AQFB 4IT4A 5LB7B 3KV5A 4QH5A 2V7MA 4I55E 3UQ4A 3I9WA 1FJGT 2M6IA 2XQAA 4I0UA 3FZMB 1WR0A 1SE7A 1M7KA 5KDMC 2IAKA 2K3WA 3ZYKA 4BJMA 5FL0A 1Y01A 3RQUA 4JV5T 3NZQA 2FJBA 2YDSA 4GKJT 4NUUA 3MACA 5JRCB 4ISTA 4P1NA 4YHHT 3CK6A 3MKDA 4KHZF 5DQVA 4HWDA 4EV6A 3RLFF 3PUQA 3P4SA 3AVRA 2CBIA 5AQNB 5EK3A 3P50A 4Q25A 3O1JA 2V8SV 5AQHB 2Q9QD 5LJNA 3B57A 4KI0F 4I50E 4Z8XA 1OXZA 3RH3A 5AQUB 2KMFA 5LNKA 2YDQA 1VRBA 2H88A 4EGWA 5J2UE 2IMLA 2ACZA 3ZMTB 1Z8UA 4CXYA 2VL8A 2DWGA 1FIOA 2RPAA 3N5LA 2N1GA 3E22E 4U7IA 1HS7A 1XDOA 1CHUA 2X66A 2NR4A 4M1PA 3E0ZA 4IL9A 3KINB 3VR9A 2KT9A 3PUWF 5FY0A 2JMHA 3UU5A 3LDQB 5L47A 2SPCA 4JI3T 2W00A 2WCAA 3TKLB 2H89A 1E2AA 1WR6A 4WBNE 5FL1A 3I0QA 4IE0A 3HA4A 2X67A 2WDVA 3OYXA 1D0ZA 4E7SA 5L3DB 3CMLA 2WQYA 3C4ZA 3G06A 3QB5K 4ZI3C 4LFCT 4JI6T 5TAOA 5FXVA 2QA7A 4PAGA 4O4LE 4XBFB 3ZJ1A 4TWFA 4GYRA 2M67A 3PUXF 2YU1A 5J0ZA 1NEKA 4LF5T 4AI6A 5LOVE 2X0LB 2CWOA 4TNVA 1NENA 4ZI7E 3W15B 3JADA 1H7CA 2WSSV 2HN1A 4LFAT 3RKGA 4DBRA 4DO0A 3SOLA 3ZYLA 4PJJA 2YN6A 3SRZA 3PJAJ 1N36T 4P0AA 2UXXB 2XQ4A 3RIUC 4EEBA 5JR9A 4GOUA 3RPUA 4CN1A 3AEEA 1HG5A 3AAIA 2OV9A 3ZN0B 4YXDA 4UIGA 4BA9A 4JI0T 5AQMB 2C5KT 4MFRA 2ZM6T 4X1YE 5GONE 3FZFB 2LEHA 2VK9A 4TV9E 4JUYA 2WMOA 4IDOA 3PUZF 2AXDS 3PUSA 3RHWA 3ZC0A 2QVAA 2DCFA 4G63A 2JJ9A 2LM2A 2D0UA 2FBWA 3ZSSA 5DABA 2X51A 4LF9T 4GYSA 5IWAT 4UXNB 1UURA 3O9XA 3AA0B 4NXMT 1Y64B 2G0UA 1NAFA 2D0TA 2EHOC 4HWHA 2BG9C 1HNWT 3I9YA 4Z91A 3EUHA 4TV8E 2XUEA 2PG8A 5LA6E 2RP4A 4HFVA 5CJ5A 2J47A 3FHNA 3Q2MA 1WLXA 5JDFA 1XMOT 1OEDA 3N9NA 5EK2A 4KHPT 3J7Yq 3WI3A 1S94A 3AECA 3TLTA 3ONLC 4CZZB 2YKSA 2DI4A 3A5XA 5AQSB 3UUMA 4UF0B 4HWCA 4UEMA 2Q9QA 4IDZA 3C4XA 3RKOA 1LKXA 1E7PA 4YLHA 3ONXA 3K1SA 5C3JA 2K48A 1HFAA 2CXLA 5F8PA 3NRXA 2BBJA 4P0BA 1MIWA 2BS3A 2XTLA 3CX8B 4C91A 4U72A 3A7MA 2MTQA 4A56A 2CWYA 4LF6T 1S35A 4ASKA 3N9PA 2JMKA 3ETVA 4EXTA 4JI1T 4DR2T 3Q9DA 3PUAA 4YSXA 2KLQA 2NW8A 4YFSA 2YEVC 4NXNT 1JNZA 4YTMA 4OYKA 2OA5A 1ZKEA 3OBVE 3N2OA 3JCFA 1YXRA 4O2AE 1ZV4X 5FYMA 2YDRA 3N9LA 2CXFA 5FVKA 2Y48B 5JTGA 4ZS2A 4JI5T 5LCYA 4U2ZA 3HKCE 3RYIE 4IE7A 1ZOYA 3AEFA 4OFZA 4HFIA 3LK42 5BMVE 4QXBB 2YOEA 1HX8A 1BR4A 5AQLB 3RIFA 1T72A 2LSYA 2V6YA 3NRYA 2BS4A 4B3TT 4A5XA 2WWUA 3PUYF 4ZI2D 3FBZA 4XZCA 3SWHA 1KNZA 4AISA 4AKRB 5ABFA 1EZ3A 4AQFA 1OWAA 4X5TA 5AQPB 4KX6A 2LSKA 3KDSE 4JI4T 4OX9T 4TWDA 3PUGA 5JDQA 1BR1A 3LG7A 4DBQA 4DV3T 4IE4A 1CUNA 2PTFA 3AXJB 3KFWX 4O8SA 2LJLA 4H63H 4TWHA 3ZMZB 3N9QA 2ZM0A 3GMIA 1W0AA 3AE8A 2XSBA 3EABA 2H7VC 4WZXA 2MPKA 5LHGB 2CHNA 3R6NA 2ES0A 3UUBA 3ANWA 3SS1A 5F3JA 4A98A 4PNIA 4U74A 3BQIA 4CQIA 1MMDA 4IREA 5ADXL 3NVOA 4I43B 3AA1B 2KWIB 4EOZB 5L3BB 4PW8A 2X9YA 5LGTB 4AKLA 5L3FB 4PK6A 2VL0A 4LF4T 4IDPA 4JI7T 3ZKRA 2LRKA 4AKIA 3QNUA 2UUAT 2X9HA 3PURA 3ZSTA 2Y6XA 2LE8A 4HFBA 4WNKA 5ABFB 2CM0A 3AAEB 3LJCA 4CI1B 2E9XD 2WP9A 3R84B 4ZHQE 4NIQA 2IC6A 2F4VT 1JNRA 1MMGA 4HFCA 2QYWA 2UUCT 2CCQA 2X68A 3ZCJA 1T8BA 3MK7C 3OKQA 2M6BA 5HXCA 4NPPA 2VKHA 4DIDB 2VKJA 4PJLA 5L4HA 4DNDA 2HHHT 4COFA 2GK9A 2XQ9A 3FZLB 3AEBA 4K0KT 2D2SA 4PJMA 5C8YE 2WU2A 2B1EA 1XNQT 3IBPA 5AQJB 2WU5A 2BKNA 4DV1T 4ILAA 1VCTA 1M62A 4BJNA 4DUZT 5EK4A 2NWBA 2HH7A 2XHEB 4DR4T 4H9QC 1D1AA 2EHOA 4EB6E 5L4EA 3UFGA 4TN7B 1YQ3A 5LG4A 3N9OA 4X65T 4LFBT 1LRZA 4HFDA 1N33T 2N2NA 3OTOT 4ZS3A 5LJMA 4YTPA 2C0SA 2ODVA 4B6XA 2WDRA 4AXPA 4JLEA 3RYCE 1YD8G 3AE1A 1UGOA 4JEUB 1HF8A 3H37A 2BZBA 1MIYA 3LBXA 2XPKA 4L9IA 3P4QA 2VQFT 4X64T 5CA1E 2CXDA 4IIJE 2LKHA 4EYYR 2JPFA 4ZOLE 3IF8B 3P4PA 1ZEEA 3RYHE 4H9OC 5AQVB 3AE4A 2XQ5A 3OJAA 4PJNA 3AEDA 1AJ3A 1KF6A 3JC6C 5FP3A 2LOPA 5IUXA 2CPTA 2L8KA 1J5WA 1MIVA 4L0RA 2FJDA 3HKEE 1IJ6A 3IA3A 4EIWA 4PFPA 5HXHA 3N2GE 3VRBA 3E08A 2WM9A 2NTXA 1D0YA 3LK3B 4X62T 5HXSA 2L3LA 4FI5A 5FXWA 4Z90A 4DR6T 3EAMA 1J5ET 3GN5A 3RC3A 3ZN1B 5HAXA 1NWMX 1HR0T 2W2UA 3RYFE 5CGMA 1QSDA 3UUXB 5AQQB 4O4IE 3O1IA 3VKGA 4TZ4C 1KFYA 4DR7T 4QXCB 5FXZA 4V1Av 3AVSA 4ZI3D 3WAJA 2BG9E 2JRKA 4YT0A 3KBTA 5ETWA 3RRCA 3EHZA 2MAWA 4G2AA 1O3XA 2D9DA 1N34T 4B3MT 3Q5EA 1KK7A 5HXEA 4JBWF 3FXDB 5IHYA 2I59A 5L2LA 3S4UA 2UXDT 2CA5A 5JQGE 1SUMB 4O4HE 1W09A 1FEWA 3FB2A 3EDVA 5LMNT 4YTNA 5IYZE 3TLSA 3ZLIA 4QH1A 3AE9A 5HEGA 2QRXA 3GWHA 2V5DA 2V6XA 3HI2A 5FY7A 5KX5E 1UCUA 2ZLYA 2V7LA 2E9XA 4TNWA 1QLBA 3KBUA 4UELA 3KV6A 1IAPA 5AQKB 4HN9A 3L09A 1MMNA 2WY2A 3ZMUB 2QGSA 2WZIA 1SA0E 4LMJA 5JR9B 4IL4A 2MBGA 2NP9A 3UT5E 4AKGA 3AAAB 2K9AA 4AKHA 5L3CB 4HE8A 4IE6A 5AQTB 3AE5A 3H3MA 4DMWA 5JREA 2EHOD 2VURA 2XQYA 4XAXB 5FXXA 2A2FX 2A3DA 3EDUA 4MHCA 2MOZA 2X9WA 2NW9A 1U4QA 5LHHB 4DV2T 4QWNB 1W9RA 2I6HA 1UX4A 3KVAA 1IBMT 1BR0A 4UVAB 3KV9A 3NWIA 3WAKA 4KUMB 2NOXA 4O4JE 3HKDE 3RC8A 2XQ6A 3B13A 3HR0A 2ZM2A 2L9QA 1FMVA 2W0GA 3ZC1A 2P9BA 5HEUA 2HPLA 4YHJA 3U78A 4X20E 4F8HA 3UU6A 1OEDB 3AEAA 3CQCB 5HCJA 5L3GB 4DV0T 1HTJF 3SFDA 2K24A 4U7YA 4GIWA 1V9DA 4H9SE 4NUVA 3CWZB 3I1AA 5A1LA 3ABVA 2Q9QB 2KNDA 1KNRA 2YU2A 4DUYT 5FKYA 5JR9C 3DP7A 3ESLA 2CRBA 4X1IE 3RIAA 2JQHA 5HEHA 2WBLA 1YW0A 3DTOA 4U31A 3V5UA 2FJEA 3EVYA 3CPZA 3T1HT 4PFOA 5L3EB 3ZMSB 3F31A 1YKHB 5FMNA 4TX5A 4HWFA 4U33A 2J62A 2CBJA 3Q5XA 2WZHA 2W4XA 1XNRT 3ZPOA 5AQRB 2C5IT 2XZEA 3RRWA 2JQQA 3D0TA 3PU8A 1HNZT 5BR8T 3JAEA 2UUBT 4KMCA 3DJBA 2W62A 3AE3A 4BAYB 4PK5A 2KSRA 5LBQB 5AQOB 4EAHA 5FNVE 2E5VA 2VVNA 3Q5DA 2E5LT 5JRCA 3P4WA 3VHLA 1YQ4A 2VQET 2OLTA 1HX1B 2HN2A 1KEYA 2X0HA 4KP3C 4EYUA 4OHFA 3P7IA 2V7IA 4TUYE 3F2EA 1D0XA 1WYCA 1Z0PA 4GK0E 4YSZA 2VKDA 1OEDC 4ADZA 1GQEA 1LVFA 2DLRA 4GK5E 2V6YB 2CE7A 3HKBE 4B3RT 1VCSA 5JDHA 1WCRA 4LMKA 5H6RB 3UU4A 2KZ7B 2LHNA 3MXZA 2Q9QC 2BVMA 4L5GA 3UFEA 4HEAA 3FBLA 4YY3T 5JDMA 4CN6A 1XDPA 5LHIB 3RIUA 1HCIA 2VKOA 3MA9A 1T7SA 4UR9A 2E2AA 1G73A 4OK0A 3MZKB 3V5SA 2IW5B 2FJAA 4UVBB 3K3NA 3A8YC 4QKNA 2BS2A 3CX6B 5C2TA 4EZHA 4DR3T 2B76A 2X9XA 3J9X1 4F6RC 4DR5T 4ANJA 1WRDA 3AE6A 2DNXA 3CIRA 3NBXX 1WFDA 4X66T 3ANWB 4K0UA 5LGNB 4A97A 1G8XA 2VASA 4DV5T 5JDGA 3KV4A 4H9NC 2V7JA 2WB5A 5ABHA 3FXEB 4MALA 3QK6A 2XAHB 1IJ5A 2KXPB 4ILUA 2XAQB 2BG9A 4LMLA 1QUUA 3L3PA 3M65A 5LP6E 3C50A 4ZZCA 2PJQA 3LK2B 2DL1A 2JQ9A 2XM2A 1L0VA 1WYBA 3I0OA 3OVUA 5KXJA 1IZNB 3B5MA 3AA6B 1KNPA 5J1GA 3C51A 4GKKT 3QB5A 4QH4A 2YK0A 4AQYT 4O2BE 4AQFC 3IHRA 1XMQT 2ZM8A 1MNEA 2J1DG 3BK9A 3LSVA 5JH7E 2PFVA 4UV9B 3UU8A 5HXRA 3ZT6A 4UV8B 2LSGA 5ABGA 4MLKA 1I94T 5HEJA 3U3IA 3Q5WA 2J4GA 2IIUA 2XY8B 3GA8A 2BKOA 3LFMA 1MNDA 3AA7B 1E1HB 4YJ2E 2R6GF 2IC9A 4ZEYA 2WDQA 4HFEA 3RX6A 2LKGA 4H9PC 2A9UA 5EZYE 3TLVA 2UXBT 2EHOB 1HG2A 2BG9B 2LRLA 3K8PC 2XQ8A 5F5WA 2UXCT 2XASB 3P8CD 4YJ3E 2BVLA 3M3ZB 4C90A 4DVDA 3KVBA 3RQWA 5HCMA 5DJQC 3PJAA 1ZP0A 3ZMVB 1X79A 3MJXA 4J2CA 3BQLA 3CX7B 3RF1A 3LBXB 4CI3B 1LVKA 3JC6D 2LOSA 4CI2B 2VWAA 2E8IA 5JDNA 3PUVF 4KBMB 2KWHA 2I0MA 3ZT5A 2HPJA 3L39A 2LSJA 1J1JA 4UF0A 4DR1T 2XM1A 4U3CA 3X1DA 3C98B 3FZHB 3ZYMA 4ILCA 2XJ7A 4WYVA 2BDEA 3AE7A 3ZT7A 1IBLT 4ERRA 2KINB 1XZYA 1UUSA 4ZXLA 5LGUB 3EI0A 4P09A 3HL6A 1BR2A 1N32T 2PBIA 4DV7T 1X9BA 5LMUT 5CA0E 3C4WA 3UUNA 2JIWA 4N78D 2W61A 3SFEA 4ILBA 4IE5A 4U2YA 4CN4A 3GN5B 4H63V 4I4TE 3ONJA 2NW7A 5FVLA 2FUPA 5LG3A 5H6QB 2V5CA 1B7TA 2W63A 4QXHB 2DHRA 2V26A 5AQGB 2XQ3A 3QUJA 2V7KA 4DMVA 4DV4T 5JDLA 3IEEA 5DQWA 2V1DB 5ABEA 3K3QC 5HWXA 5HEOA 4IDQA 2UU9T 3VRAA 3PTRB 4EEDA 4LF7T 4AQGA 3PV0F 3L8RA 3AE2A 2JQKA 1U5PA 4B3ST 4CXXA 2XAGB 3UQ7A 4ISSA 5HYAA 3QOFA 2WAUA 2NTYA 4WW0A 2MYSA 4IDNA 2IDOB 3AEGA 4HFHA 2N9DA 1IBKT 2H7OA 4AIUA 3UULA 3H3AA 3FZKB 4ZZBA 1R8IA 3AB3B 1I6ZA 3PDYA 2E9XB 2VVSA 4YSYA 3F57A 3UTKA 4OYJA 4JI2T 2CLYB 1UK5A 4JI8T 3AXJA 4ZI2C 3JAFA 4FJOA 2W66A 4HGAA 4H9RC 2Y8DA 4EZ4A 4HWIB 3RGLA 2K5BB 1D1BA 3ZCIA 3ZJ2A 1T98A 4PK4A 2CHOA 3UU3A 3NKZA 5CB4E 2Z6EA 1VOMA 3RI5A 3VKHA 2CMRA 5LYJE 4LF8T 2IUBA 3C64A 3T8OA 2C5JA 4WBOA 4X1KE 1MMAA 5JVDE 5HWYA 2WS3A 5E0OA 3K3OA 4DV6T 4HTEA 3T1YT 4JYAT 4QX8B 2LLYA 2X0YA 3BQKA 4QX7B 3TLUA 2WMNA 5M4YA 3P4RA 3QC9A 4CXWA 1DU2A 2LHRA 3CKDA 2AE9A 2XSAA 1OEDE 4IGUA 3PE0A 2D5UA 3ZEFB 2ODUA 2H3RA 3OPCA 2XAFB 2LSIA 4IHJE 3N9MA 4HKAA
chains in the Genus database with same CATH topology
4HFBA 2XQ8A 4LMLA 2BG9A 1OEDC 4IL4A 3RHWA 4ILBA 3JAFA 4X5TA 4ZZCA 2LM2A 5LG3A 4HFCA 4TWDA 3P50A 2BG9E 3RQWA 5HCMA 3EHZA 3UU3A 3RIAA 4LMKA 2MAWA 3UU4A 5HEHA 2LKHA 2M6BA 2XQ3A 2XQ7A 4TWHA 4NPPA 3RI5A 4TWFA 5CFBA 5L4HA 5J0ZA 4COFA 2XQ9A 2BG9C 2XQ5A 4QH4A 5HEOA 4Z91A 4TNVA 5IUXA 3TLWA 3TLSA 3JADA 3UUBA 3UQ7A 3LSVA 4QH5A 1OEDA 2LLYA 3JAEA 4ILAA 4A98A 3UU8A 4QH1A 3UQ4A 5HEGA 2YN6A 3TLUA 2KSRA 4IREA 5HEJA 4ILCA 2XQ6A 4HFHA 2M6IA 3TLTA 4IL9A 4TNWA 2XQ4A 5L4EA 4HFIA 2XQAA 2YKSA 5HEUA 1OEDE 3P4WA 2YOEA 4Z90A 4F8HA 3UU6A 1OEDB 3EAMA 4HFDA 4A97A 3UU5A 4ZZBA 5HCJA 5L47A 2VL0A 3EI0A 3RIFA 3ZKRA 4HFEA 3RQUA 2LKGA 3TLVA 2BG9B 4LMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFB A;  2XQ8 A;  4LML A;  2BG9 A;  1OED C;  4IL4 A;  3RHW A;  4ILB A;  3JAF A;  4X5T A;  4ZZC A;  2LM2 A;  5LG3 A;  4HFC A;  4TWD A;  3P50 A;  2BG9 E;  3RQW A;  5HCM A;  3EHZ A;  3UU3 A;  3RIA A;  4LMK A;  2MAW A;  3UU4 A;  5HEH A;  2LKH A;  2M6B A;  2XQ3 A;  2XQ7 A;  4TWH A;  4NPP A;  3RI5 A;  4TWF A;  5CFB A;  5L4H A;  5J0Z A;  4COF A;  2XQ9 A;  2BG9 C;  2XQ5 A;  4QH4 A;  5HEO A;  4Z91 A;  4TNV A;  5IUX A;  3TLW A;  3TLS A;  3JAD A;  3UUB A;  3UQ7 A;  3LSV A;  4QH5 A;  1OED A;  2LLY A;  3JAE A;  4ILA A;  4A98 A;  3UU8 A;  4QH1 A;  3UQ4 A;  5HEG A;  2YN6 A;  3TLU A;  2KSR A;  4IRE A;  5HEJ A;  4ILC A;  2XQ6 A;  4HFH A;  2M6I A;  3TLT A;  4IL9 A;  4TNW A;  2XQ4 A;  5L4E A;  4HFI A;  2XQA A;  2YKS A;  5HEU A;  1OED E;  3P4W A;  2YOE A;  4Z90 A;  4F8H A;  3UU6 A;  1OED B;  3EAM A;  4HFD A;  4A97 A;  3UU5 A;  4ZZB A;  5HCJ A;  5L47 A;  2VL0 A;  3EI0 A;  3RIF A;  3ZKR A;  4HFE A;  3RQU A;  2LKG A;  3TLV A;  2BG9 B;  4LMJ A; 
#chains in the Genus database with same CATH topology
 1YKE B;  3OYZ A;  4UVC B;  5KMG P;  5AFU L;  1UX5 A;  3N2K E;  1HNX T;  3VU7 H;  4MBQ A;  2DWK A;  2E9X C;  2W67 A;  1D1C A;  3CQX C;  2A72 A;  1SHZ C;  3PU3 A;  2BBH A;  2CLY C;  2ZMA A;  2LT3 A;  2XAJ B;  5J2T E;  2BKP A;  1US7 B;  1W0B A;  2XQ7 A;  3O4X E;  4JEH B;  2IHR 1;  1FMW A;  2LM9 A;  3O1H A;  5CFB A;  2YIN A;  2VB6 A;  3ETU A;  5LBM A;  3CQG B;  2CEA A;  5AQI B;  1XWM A;  3VR8 A;  5LXT E;  2WWV A;  5FY1 A;  2RA1 A;  2UXN B;  3TLW A;  1ZHC A;  3CVR A;  4E7Z A;  4QHO A;  3NZP A;  2ACX A;  5AQF B;  4IT4 A;  5LB7 B;  3KV5 A;  4QH5 A;  2V7M A;  4I55 E;  3UQ4 A;  3I9W A;  1FJG T;  2M6I A;  2XQA A;  4I0U A;  3FZM B;  1WR0 A;  1SE7 A;  1M7K A;  5KDM C;  2IAK A;  2K3W A;  3ZYK A;  4BJM A;  5FL0 A;  1Y01 A;  3RQU A;  4JV5 T;  3NZQ A;  2FJB A;  2YDS A;  4GKJ T;  4NUU A;  3MAC A;  5JRC B;  4IST A;  4P1N A;  4YHH T;  3CK6 A;  3MKD A;  4KHZ F;  5DQV A;  4HWD A;  4EV6 A;  3RLF F;  3PUQ A;  3P4S A;  3AVR A;  2CBI A;  5AQN B;  5EK3 A;  3P50 A;  4Q25 A;  3O1J A;  2V8S V;  5AQH B;  2Q9Q D;  5LJN A;  3B57 A;  4KI0 F;  4I50 E;  4Z8X A;  1OXZ A;  3RH3 A;  5AQU B;  2KMF A;  5LNK A;  2YDQ A;  1VRB A;  2H88 A;  4EGW A;  5J2U E;  2IML A;  2ACZ A;  3ZMT B;  1Z8U A;  4CXY A;  2VL8 A;  2DWG A;  1FIO A;  2RPA A;  3N5L A;  2N1G A;  3E22 E;  4U7I A;  1HS7 A;  1XDO A;  1CHU A;  2X66 A;  2NR4 A;  4M1P A;  3E0Z A;  4IL9 A;  3KIN B;  3VR9 A;  2KT9 A;  3PUW F;  5FY0 A;  2JMH A;  3UU5 A;  3LDQ B;  5L47 A;  2SPC A;  4JI3 T;  2W00 A;  2WCA A;  3TKL B;  2H89 A;  1E2A A;  1WR6 A;  4WBN E;  5FL1 A;  3I0Q A;  4IE0 A;  3HA4 A;  2X67 A;  2WDV A;  3OYX A;  1D0Z A;  4E7S A;  5L3D B;  3CML A;  2WQY A;  3C4Z A;  3G06 A;  3QB5 K;  4ZI3 C;  4LFC T;  4JI6 T;  5TAO A;  5FXV A;  2QA7 A;  4PAG A;  4O4L E;  4XBF B;  3ZJ1 A;  4TWF A;  4GYR A;  2M67 A;  3PUX F;  2YU1 A;  5J0Z A;  1NEK A;  4LF5 T;  4AI6 A;  5LOV E;  2X0L B;  2CWO A;  4TNV A;  1NEN A;  4ZI7 E;  3W15 B;  3JAD A;  1H7C A;  2WSS V;  2HN1 A;  4LFA T;  3RKG A;  4DBR A;  4DO0 A;  3SOL A;  3ZYL A;  4PJJ A;  2YN6 A;  3SRZ A;  3PJA J;  1N36 T;  4P0A A;  2UXX B;  2XQ4 A;  3RIU C;  4EEB A;  5JR9 A;  4GOU A;  3RPU A;  4CN1 A;  3AEE A;  1HG5 A;  3AAI A;  2OV9 A;  3ZN0 B;  4YXD A;  4UIG A;  4BA9 A;  4JI0 T;  5AQM B;  2C5K T;  4MFR A;  2ZM6 T;  4X1Y E;  5GON E;  3FZF B;  2LEH A;  2VK9 A;  4TV9 E;  4JUY A;  2WMO A;  4IDO A;  3PUZ F;  2AXD S;  3PUS A;  3RHW A;  3ZC0 A;  2QVA A;  2DCF A;  4G63 A;  2JJ9 A;  2LM2 A;  2D0U A;  2FBW A;  3ZSS A;  5DAB A;  2X51 A;  4LF9 T;  4GYS A;  5IWA T;  4UXN B;  1UUR A;  3O9X A;  3AA0 B;  4NXM T;  1Y64 B;  2G0U A;  1NAF A;  2D0T A;  2EHO C;  4HWH A;  2BG9 C;  1HNW T;  3I9Y A;  4Z91 A;  3EUH A;  4TV8 E;  2XUE A;  2PG8 A;  5LA6 E;  2RP4 A;  4HFV A;  5CJ5 A;  2J47 A;  3FHN A;  3Q2M A;  1WLX A;  5JDF A;  1XMO T;  1OED A;  3N9N A;  5EK2 A;  4KHP T;  3J7Y q;  3WI3 A;  1S94 A;  3AEC A;  3TLT A;  3ONL C;  4CZZ B;  2YKS A;  2DI4 A;  3A5X A;  5AQS B;  3UUM A;  4UF0 B;  4HWC A;  4UEM A;  2Q9Q A;  4IDZ A;  3C4X A;  3RKO A;  1LKX A;  1E7P A;  4YLH A;  3ONX A;  3K1S A;  5C3J A;  2K48 A;  1HFA A;  2CXL A;  5F8P A;  3NRX A;  2BBJ A;  4P0B A;  1MIW A;  2BS3 A;  2XTL A;  3CX8 B;  4C91 A;  4U72 A;  3A7M A;  2MTQ A;  4A56 A;  2CWY A;  4LF6 T;  1S35 A;  4ASK A;  3N9P A;  2JMK A;  3ETV A;  4EXT A;  4JI1 T;  4DR2 T;  3Q9D A;  3PUA A;  4YSX A;  2KLQ A;  2NW8 A;  4YFS A;  2YEV C;  4NXN T;  1JNZ A;  4YTM A;  4OYK A;  2OA5 A;  1ZKE A;  3OBV E;  3N2O A;  3JCF A;  1YXR A;  4O2A E;  1ZV4 X;  5FYM A;  2YDR A;  3N9L A;  2CXF A;  5FVK A;  2Y48 B;  5JTG A;  4ZS2 A;  4JI5 T;  5LCY A;  4U2Z A;  3HKC E;  3RYI E;  4IE7 A;  1ZOY A;  3AEF A;  4OFZ A;  4HFI A;  3LK4 2;  5BMV E;  4QXB B;  2YOE A;  1HX8 A;  1BR4 A;  5AQL B;  3RIF A;  1T72 A;  2LSY A;  2V6Y A;  3NRY A;  2BS4 A;  4B3T T;  4A5X A;  2WWU A;  3PUY F;  4ZI2 D;  3FBZ A;  4XZC A;  3SWH A;  1KNZ A;  4AIS A;  4AKR B;  5ABF A;  1EZ3 A;  4AQF A;  1OWA A;  4X5T A;  5AQP B;  4KX6 A;  2LSK A;  3KDS E;  4JI4 T;  4OX9 T;  4TWD A;  3PUG A;  5JDQ A;  1BR1 A;  3LG7 A;  4DBQ A;  4DV3 T;  4IE4 A;  1CUN A;  2PTF A;  3AXJ B;  3KFW X;  4O8S A;  2LJL A;  4H63 H;  4TWH A;  3ZMZ B;  3N9Q A;  2ZM0 A;  3GMI A;  1W0A A;  3AE8 A;  2XSB A;  3EAB A;  2H7V C;  4WZX A;  2MPK A;  5LHG B;  2CHN A;  3R6N A;  2ES0 A;  3UUB A;  3ANW A;  3SS1 A;  5F3J A;  4A98 A;  4PNI A;  4U74 A;  3BQI A;  4CQI A;  1MMD A;  4IRE A;  5ADX L;  3NVO A;  4I43 B;  3AA1 B;  2KWI B;  4EOZ B;  5L3B B;  4PW8 A;  2X9Y A;  5LGT B;  4AKL A;  5L3F B;  4PK6 A;  2VL0 A;  4LF4 T;  4IDP A;  4JI7 T;  3ZKR A;  2LRK A;  4AKI A;  3QNU A;  2UUA T;  2X9H A;  3PUR A;  3ZST A;  2Y6X A;  2LE8 A;  4HFB A;  4WNK A;  5ABF B;  2CM0 A;  3AAE B;  3LJC A;  4CI1 B;  2E9X D;  2WP9 A;  3R84 B;  4ZHQ E;  4NIQ A;  2IC6 A;  2F4V T;  1JNR A;  1MMG A;  4HFC A;  2QYW A;  2UUC T;  2CCQ A;  2X68 A;  3ZCJ A;  1T8B A;  3MK7 C;  3OKQ A;  2M6B A;  5HXC A;  4NPP A;  2VKH A;  4DID B;  2VKJ A;  4PJL A;  5L4H A;  4DND A;  2HHH T;  4COF A;  2GK9 A;  2XQ9 A;  3FZL B;  3AEB A;  4K0K T;  2D2S A;  4PJM A;  5C8Y E;  2WU2 A;  2B1E A;  1XNQ T;  3IBP A;  5AQJ B;  2WU5 A;  2BKN A;  4DV1 T;  4ILA A;  1VCT A;  1M62 A;  4BJN A;  4DUZ T;  5EK4 A;  2NWB A;  2HH7 A;  2XHE B;  4DR4 T;  4H9Q C;  1D1A A;  2EHO A;  4EB6 E;  5L4E A;  3UFG A;  4TN7 B;  1YQ3 A;  5LG4 A;  3N9O A;  4X65 T;  4LFB T;  1LRZ A;  4HFD A;  1N33 T;  2N2N A;  3OTO T;  4ZS3 A;  5LJM A;  4YTP A;  2C0S A;  2ODV A;  4B6X A;  2WDR A;  4AXP A;  4JLE A;  3RYC E;  1YD8 G;  3AE1 A;  1UGO A;  4JEU B;  1HF8 A;  3H37 A;  2BZB A;  1MIY A;  3LBX A;  2XPK A;  4L9I A;  3P4Q A;  2VQF T;  4X64 T;  5CA1 E;  2CXD A;  4IIJ E;  2LKH A;  4EYY R;  2JPF A;  4ZOL E;  3IF8 B;  3P4P A;  1ZEE A;  3RYH E;  4H9O C;  5AQV B;  3AE4 A;  2XQ5 A;  3OJA A;  4PJN A;  3AED A;  1AJ3 A;  1KF6 A;  3JC6 C;  5FP3 A;  2LOP A;  5IUX A;  2CPT A;  2L8K A;  1J5W A;  1MIV A;  4L0R A;  2FJD A;  3HKE E;  1IJ6 A;  3IA3 A;  4EIW A;  4PFP A;  5HXH A;  3N2G E;  3VRB A;  3E08 A;  2WM9 A;  2NTX A;  1D0Y A;  3LK3 B;  4X62 T;  5HXS A;  2L3L A;  4FI5 A;  5FXW A;  4Z90 A;  4DR6 T;  3EAM A;  1J5E T;  3GN5 A;  3RC3 A;  3ZN1 B;  5HAX A;  1NWM X;  1HR0 T;  2W2U A;  3RYF E;  5CGM A;  1QSD A;  3UUX B;  5AQQ B;  4O4I E;  3O1I A;  3VKG A;  4TZ4 C;  1KFY A;  4DR7 T;  4QXC B;  5FXZ A;  4V1A v;  3AVS A;  4ZI3 D;  3WAJ A;  2BG9 E;  2JRK A;  4YT0 A;  3KBT A;  5ETW A;  3RRC A;  3EHZ A;  2MAW A;  4G2A A;  1O3X A;  2D9D A;  1N34 T;  4B3M T;  3Q5E A;  1KK7 A;  5HXE A;  4JBW F;  3FXD B;  5IHY A;  2I59 A;  5L2L A;  3S4U A;  2UXD T;  2CA5 A;  5JQG E;  1SUM B;  4O4H E;  1W09 A;  1FEW A;  3FB2 A;  3EDV A;  5LMN T;  4YTN A;  5IYZ E;  3TLS A;  3ZLI A;  4QH1 A;  3AE9 A;  5HEG A;  2QRX A;  3GWH A;  2V5D A;  2V6X A;  3HI2 A;  5FY7 A;  5KX5 E;  1UCU A;  2ZLY A;  2V7L A;  2E9X A;  4TNW A;  1QLB A;  3KBU A;  4UEL A;  3KV6 A;  1IAP A;  5AQK B;  4HN9 A;  3L09 A;  1MMN A;  2WY2 A;  3ZMU B;  2QGS A;  2WZI A;  1SA0 E;  4LMJ A;  5JR9 B;  4IL4 A;  2MBG A;  2NP9 A;  3UT5 E;  4AKG A;  3AAA B;  2K9A A;  4AKH A;  5L3C B;  4HE8 A;  4IE6 A;  5AQT B;  3AE5 A;  3H3M A;  4DMW A;  5JRE A;  2EHO D;  2VUR A;  2XQY A;  4XAX B;  5FXX A;  2A2F X;  2A3D A;  3EDU A;  4MHC A;  2MOZ A;  2X9W A;  2NW9 A;  1U4Q A;  5LHH B;  4DV2 T;  4QWN B;  1W9R A;  2I6H A;  1UX4 A;  3KVA A;  1IBM T;  1BR0 A;  4UVA B;  3KV9 A;  3NWI A;  3WAK A;  4KUM B;  2NOX A;  4O4J E;  3HKD E;  3RC8 A;  2XQ6 A;  3B13 A;  3HR0 A;  2ZM2 A;  2L9Q A;  1FMV A;  2W0G A;  3ZC1 A;  2P9B A;  5HEU A;  2HPL A;  4YHJ A;  3U78 A;  4X20 E;  4F8H A;  3UU6 A;  1OED B;  3AEA A;  3CQC B;  5HCJ A;  5L3G B;  4DV0 T;  1HTJ F;  3SFD A;  2K24 A;  4U7Y A;  4GIW A;  1V9D A;  4H9S E;  4NUV A;  3CWZ B;  3I1A A;  5A1L A;  3ABV A;  2Q9Q B;  2KND A;  1KNR A;  2YU2 A;  4DUY T;  5FKY A;  5JR9 C;  3DP7 A;  3ESL A;  2CRB A;  4X1I E;  3RIA A;  2JQH A;  5HEH A;  2WBL A;  1YW0 A;  3DTO A;  4U31 A;  3V5U A;  2FJE A;  3EVY A;  3CPZ A;  3T1H T;  4PFO A;  5L3E B;  3ZMS B;  3F31 A;  1YKH B;  5FMN A;  4TX5 A;  4HWF A;  4U33 A;  2J62 A;  2CBJ A;  3Q5X A;  2WZH A;  2W4X A;  1XNR T;  3ZPO A;  5AQR B;  2C5I T;  2XZE A;  3RRW A;  2JQQ A;  3D0T A;  3PU8 A;  1HNZ T;  5BR8 T;  3JAE A;  2UUB T;  4KMC A;  3DJB A;  2W62 A;  3AE3 A;  4BAY B;  4PK5 A;  2KSR A;  5LBQ B;  5AQO B;  4EAH A;  5FNV E;  2E5V A;  2VVN A;  3Q5D A;  2E5L T;  5JRC A;  3P4W A;  3VHL A;  1YQ4 A;  2VQE T;  2OLT A;  1HX1 B;  2HN2 A;  1KEY A;  2X0H A;  4KP3 C;  4EYU A;  4OHF A;  3P7I A;  2V7I A;  4TUY E;  3F2E A;  1D0X A;  1WYC A;  1Z0P A;  4GK0 E;  4YSZ A;  2VKD A;  1OED C;  4ADZ A;  1GQE A;  1LVF A;  2DLR A;  4GK5 E;  2V6Y B;  2CE7 A;  3HKB E;  4B3R T;  1VCS A;  5JDH A;  1WCR A;  4LMK A;  5H6R B;  3UU4 A;  2KZ7 B;  2LHN A;  3MXZ A;  2Q9Q C;  2BVM A;  4L5G A;  3UFE A;  4HEA A;  3FBL A;  4YY3 T;  5JDM A;  4CN6 A;  1XDP A;  5LHI B;  3RIU A;  1HCI A;  2VKO A;  3MA9 A;  1T7S A;  4UR9 A;  2E2A A;  1G73 A;  4OK0 A;  3MZK B;  3V5S A;  2IW5 B;  2FJA A;  4UVB B;  3K3N A;  3A8Y C;  4QKN A;  2BS2 A;  3CX6 B;  5C2T A;  4EZH A;  4DR3 T;  2B76 A;  2X9X A;  3J9X 1;  4F6R C;  4DR5 T;  4ANJ A;  1WRD A;  3AE6 A;  2DNX A;  3CIR A;  3NBX X;  1WFD A;  4X66 T;  3ANW B;  4K0U A;  5LGN B;  4A97 A;  1G8X A;  2VAS A;  4DV5 T;  5JDG A;  3KV4 A;  4H9N C;  2V7J A;  2WB5 A;  5ABH A;  3FXE B;  4MAL A;  3QK6 A;  2XAH B;  1IJ5 A;  2KXP B;  4ILU A;  2XAQ B;  2BG9 A;  4LML A;  1QUU A;  3L3P A;  3M65 A;  5LP6 E;  3C50 A;  4ZZC A;  2PJQ A;  3LK2 B;  2DL1 A;  2JQ9 A;  2XM2 A;  1L0V A;  1WYB A;  3I0O A;  3OVU A;  5KXJ A;  1IZN B;  3B5M A;  3AA6 B;  1KNP A;  5J1G A;  3C51 A;  4GKK T;  3QB5 A;  4QH4 A;  2YK0 A;  4AQY T;  4O2B E;  4AQF C;  3IHR A;  1XMQ T;  2ZM8 A;  1MNE A;  2J1D G;  3BK9 A;  3LSV A;  5JH7 E;  2PFV A;  4UV9 B;  3UU8 A;  5HXR A;  3ZT6 A;  4UV8 B;  2LSG A;  5ABG A;  4MLK A;  1I94 T;  5HEJ A;  3U3I A;  3Q5W A;  2J4G A;  2IIU A;  2XY8 B;  3GA8 A;  2BKO A;  3LFM A;  1MND A;  3AA7 B;  1E1H B;  4YJ2 E;  2R6G F;  2IC9 A;  4ZEY A;  2WDQ A;  4HFE A;  3RX6 A;  2LKG A;  4H9P C;  2A9U A;  5EZY E;  3TLV A;  2UXB T;  2EHO B;  1HG2 A;  2BG9 B;  2LRL A;  3K8P C;  2XQ8 A;  5F5W A;  2UXC T;  2XAS B;  3P8C D;  4YJ3 E;  2BVL A;  3M3Z B;  4C90 A;  4DVD A;  3KVB A;  3RQW A;  5HCM A;  5DJQ C;  3PJA A;  1ZP0 A;  3ZMV B;  1X79 A;  3MJX A;  4J2C A;  3BQL A;  3CX7 B;  3RF1 A;  3LBX B;  4CI3 B;  1LVK A;  3JC6 D;  2LOS A;  4CI2 B;  2VWA A;  2E8I A;  5JDN A;  3PUV F;  4KBM B;  2KWH A;  2I0M A;  3ZT5 A;  2HPJ A;  3L39 A;  2LSJ A;  1J1J A;  4UF0 A;  4DR1 T;  2XM1 A;  4U3C A;  3X1D A;  3C98 B;  3FZH B;  3ZYM A;  4ILC A;  2XJ7 A;  4WYV A;  2BDE A;  3AE7 A;  3ZT7 A;  1IBL T;  4ERR A;  2KIN B;  1XZY A;  1UUS A;  4ZXL A;  5LGU B;  3EI0 A;  4P09 A;  3HL6 A;  1BR2 A;  1N32 T;  2PBI A;  4DV7 T;  1X9B A;  5LMU T;  5CA0 E;  3C4W A;  3UUN A;  2JIW A;  4N78 D;  2W61 A;  3SFE A;  4ILB A;  4IE5 A;  4U2Y A;  4CN4 A;  3GN5 B;  4H63 V;  4I4T E;  3ONJ A;  2NW7 A;  5FVL A;  2FUP A;  5LG3 A;  5H6Q B;  2V5C A;  1B7T A;  2W63 A;  4QXH B;  2DHR A;  2V26 A;  5AQG B;  2XQ3 A;  3QUJ A;  2V7K A;  4DMV A;  4DV4 T;  5JDL A;  3IEE A;  5DQW A;  2V1D B;  5ABE A;  3K3Q C;  5HWX A;  5HEO A;  4IDQ A;  2UU9 T;  3VRA A;  3PTR B;  4EED A;  4LF7 T;  4AQG A;  3PV0 F;  3L8R A;  3AE2 A;  2JQK A;  1U5P A;  4B3S T;  4CXX A;  2XAG B;  3UQ7 A;  4ISS A;  5HYA A;  3QOF A;  2WAU A;  2NTY A;  4WW0 A;  2MYS A;  4IDN A;  2IDO B;  3AEG A;  4HFH A;  2N9D A;  1IBK T;  2H7O A;  4AIU A;  3UUL A;  3H3A A;  3FZK B;  4ZZB A;  1R8I A;  3AB3 B;  1I6Z A;  3PDY A;  2E9X B;  2VVS A;  4YSY A;  3F57 A;  3UTK A;  4OYJ A;  4JI2 T;  2CLY B;  1UK5 A;  4JI8 T;  3AXJ A;  4ZI2 C;  3JAF A;  4FJO A;  2W66 A;  4HGA A;  4H9R C;  2Y8D A;  4EZ4 A;  4HWI B;  3RGL A;  2K5B B;  1D1B A;  3ZCI A;  3ZJ2 A;  1T98 A;  4PK4 A;  2CHO A;  3UU3 A;  3NKZ A;  5CB4 E;  2Z6E A;  1VOM A;  3RI5 A;  3VKH A;  2CMR A;  5LYJ E;  4LF8 T;  2IUB A;  3C64 A;  3T8O A;  2C5J A;  4WBO A;  4X1K E;  1MMA A;  5JVD E;  5HWY A;  2WS3 A;  5E0O A;  3K3O A;  4DV6 T;  4HTE A;  3T1Y T;  4JYA T;  4QX8 B;  2LLY A;  2X0Y A;  3BQK A;  4QX7 B;  3TLU A;  2WMN A;  5M4Y A;  3P4R A;  3QC9 A;  4CXW A;  1DU2 A;  2LHR A;  3CKD A;  2AE9 A;  2XSA A;  1OED E;  4IGU A;  3PE0 A;  2D5U A;  3ZEF B;  2ODU A;  2H3R A;  3OPC A;  2XAF B;  2LSI A;  4IHJ E;  3N9M A;  4HKA A; 
#chains in the Genus database with same CATH homology
 4HFB A;  2XQ8 A;  4LML A;  2BG9 A;  1OED C;  4IL4 A;  3RHW A;  4ILB A;  3JAF A;  4X5T A;  4ZZC A;  2LM2 A;  5LG3 A;  4HFC A;  4TWD A;  3P50 A;  2BG9 E;  3RQW A;  5HCM A;  3EHZ A;  3UU3 A;  3RIA A;  4LMK A;  2MAW A;  3UU4 A;  5HEH A;  2LKH A;  2M6B A;  2XQ3 A;  2XQ7 A;  4TWH A;  4NPP A;  3RI5 A;  4TWF A;  5CFB A;  5L4H A;  5J0Z A;  4COF A;  2XQ9 A;  2BG9 C;  2XQ5 A;  4QH4 A;  5HEO A;  4Z91 A;  4TNV A;  5IUX A;  3TLW A;  3TLS A;  3JAD A;  3UUB A;  3UQ7 A;  3LSV A;  4QH5 A;  1OED A;  2LLY A;  3JAE A;  4ILA A;  4A98 A;  3UU8 A;  4QH1 A;  3UQ4 A;  5HEG A;  2YN6 A;  3TLU A;  2KSR A;  4IRE A;  5HEJ A;  4ILC A;  2XQ6 A;  4HFH A;  2M6I A;  3TLT A;  4IL9 A;  4TNW A;  2XQ4 A;  5L4E A;  4HFI A;  2XQA A;  2YKS A;  5HEU A;  1OED E;  3P4W A;  2YOE A;  4Z90 A;  4F8H A;  3UU6 A;  1OED B;  3EAM A;  4HFD A;  4A97 A;  3UU5 A;  4ZZB A;  5HCJ A;  5L47 A;  2VL0 A;  3EI0 A;  3RIF A;  3ZKR A;  4HFE A;  3RQU A;  2LKG A;  3TLV A;  2BG9 B;  4LMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...