2V8SV

Vti1b habc domain - epsinr enth domain complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
93
structure length
93
Chain Sequence
ASSAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Snare-Adaptor Interaction is a New Mode of Cargo Recognition in Clathrin Coated Vesicles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords CLATHRIN INTERACTOR 1
total genus 38
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2v8sV00
3ONJA 3ONLC 1VCSA 2QYWA 2V8SV
chains in the Genus database with same CATH superfamily
2IW5B 3HKBE 4HFHA 4U72A 2G0UA 5AQUB 1BR0A 2WZIA 4OYKA 1IAPA 3JC6C 3VRAA 3PUAA 4MFRA 5CA1E 4DR6T 4KHZF 4DV6T 2ACZA 2BZBA 1NWMX 3PU3A 5DJQC 2K9AA 2KNDA 4YSXA 1WR6A 1CUNA 4ZS3A 2A9UA 3PE0A 3GN5A 4ZXLA 5DQVA 5HEGA 5JR9A 1E7PA 3UT5E 3ZMSB 2BS4A 3RPUA 3JADA 4PJJA 5H6QB 3RC8A 1N32T 3I9YA 4DBRA 3DTOA 4LMJA 5LHGB 3BQKA 2D2SA 3H3MA 1MIYA 2WMOA 1SHZC 1ZV4X 3PUVF 3VU7H 3Q5EA 2FBWA 3ZMZB 3ONJA 4UEMA 1BR2A 3LG7A 4X66T 2DWKA 3HA4A 3C98B 4XZCA 3IBPA 5EK4A 2VL8A 3N9NA 2QVAA 3KV5A 4X1YE 4DV4T 3I1AA 3KV4A 4HFEA 4O4IE 4GKKT 4ZZBA 3CK6A 2I59A 2Y8DA 3ZSSA 4ILCA 2WS3A 3KVAA 1KK7A 3VR9A 2H88A 3P7IA 1NENA 3EHZA 2J4GA 4NPPA 1XNRT 2LSIA 5HXCA 5AFUL 4HWFA 3SFDA 5C2TA 2WU5A 5HEHA 2DLRA 4KP3C 4IIJE 3VHLA 4DR1T 2DL1A 2ZM8A 4L0RA 4JI1T 1BR1A 2XSBA 3LFMA 2J62A 3ESLA 2BKOA 3SWHA 1LRZA 3UU5A 2BS3A 5ABEA 2PFVA 2LSKA 2YINA 3K8PC 3LK42 4LMKA 4O2BE 4PNIA 3UULA 4U31A 4A97A 1X9BA 4DMVA 4X65T 4ILUA 1WRDA 3FZHB 2PTFA 2VKDA 2WAUA 3AE7A 1XMOT 5AQJB 5FY0A 4QWNB 1ZKEA 3AEFA 5JR9B 5JDHA 3F31A 4ZI3D 4X62T 3FZLB 5LYJE 2X0HA 1QLBA 4IE6A 1VOMA 4EAHA 2QGSA 4H9QC 4EXTA 4AKGA 3ZT5A 5F5WA 2LRKA 4YSZA 3KV9A 4FI5A 5JQGE 5AQIB 2EHOC 2X0LB 4A56A 4CN6A 1HS7A 1MMGA 4ZI2D 5AQOB 2EHOA 2LM9A 3ZC1A 4DR3T 2D9DA 5FP3A 3PUGA 2H3RA 1KEYA 3P8CD 4ZZCA 3CWZB 1MMDA 4IE5A 3NKZA 4A98A 3ETUA 4KBMB 2MPKA 3ZN1B 3A7MA 2XAQB 3LDQB 3TLVA 3ZYLA 2VK9A 3L3PA 2CM0A 1X79A 4AISA 3UUMA 4HEAA 4IE7A 1XDPA 4JI6T 2ACXA 4DV0T 2Q9QA 3Q2MA 2FUPA 2C0SA 2CCQA 2CLYB 3C4XA 4LFAT 3T1YT 3LJCA 4EIWA 3SRZA 2FJEA 3KDSE 3RH3A 1G8XA 1V9DA 2BG9E 2HPJA 2W63A 2E9XD 2J1DG 2VKOA 3NBXX 4FJOA 4QXCB 2XQ8A 1KF6A 4HFIA 2V5CA 3DJBA 4P1NA 4TV9E 1D1BA 2L9QA 3O1HA 4UVBB 4UF0A 4UF0B 4QXBB 1EZ3A 2CXFA 2WQYA 5ABGA 4LF8T 3ZN0B 2CBJA 3AE6A 5ADXL 4TWDA 1KFYA 4F6RC 4EOZB 1NEKA 5FNVE 5JDMA 2E8IA 4I50E 1I6ZA 4DV7T 1N36T 1IJ6A 3RYIE 2XQ4A 5IHYA 2KXPB 2MAWA 4PW8A 3QK6A 3ZT6A 1N33T 3N9MA 2V8SV 2M67A 2NP9A 2XAFB 4Z91A 1MNEA 5AQHB 3RLFF 2X9WA 2DCFA 1WFDA 4DV1T 4DV3T 4DR4T 3I0QA 2PG8A 4JV5T 3N5LA 3EVYA 4GIWA 2R6GF 3ANWA 4DIDB 3CQCB 4I43B 4B3TT 3ZYMA 2C5KT 3E0ZA 3FXEB 3M3ZB 5FXXA 3FBZA 4B3ST 2KLQA 2L3LA 3BQLA 5AQFB 4ISSA 3CMLA 4UV9B 1UGOA 2FJAA 4TWHA 2MOZA 3FHNA 4UIGA 5AQVB 3ETVA 3NRYA 2I6HA 4TZ4C 4UELA 3WAKA 4UXNB 3AVRA 5L3FB 3AB3B 5LG3A 3VKHA 2LSJA 3F2EA 2LLYA 4YHJA 4YJ2E 2ZM0A 3PUXF 3V5SA 1XNQT 3I9WA 2N2NA 3J9X1 3KV6A 5HXRA 1QSDA 2BKNA 4AKHA 4X5TA 3UU8A 4IDPA 3KFWX 2ODVA 5ETWA 3RYCE 5KXJA 3OPCA 2JIWA 3UFGA 4Z8XA 3RC3A 4PJMA 4ANJA 4DUYT 4CI2B 4Q25A 4CQIA 2FJBA 4ZHQE 4XAXB 1JNZA 2UXCT 2VWAA 4OYJA 3OTOT 3UFEA 5ABFB 1WYCA 5LOVE 1YQ4A 5FXZA 3MKDA 1J5ET 4JI3T 1ZHCA 2YOEA 3SS1A 2CRBA 2W0GA 4IDQA 4DV5T 2Y48B 5EK2A 1M7KA 4N78D 1IJ5A 2IIUA 2CA5A 2LEHA 4KMCA 4YLHA 5LMNT 2IUBA 5HCMA 3AA1B 3RIUA 2XQAA 1HF8A 3RGLA 1VRBA 2JMHA 5FL0A 1FJGT 2X51A 3OYZA 4ZI3C 4DVDA 4H9NC 2OV9A 3AXJA 2VASA 2V6YA 1W0BA 4MLKA 2PBIA 3ZCIA 3ZT7A 3CKDA 3FXDB 1WCRA 5JTGA 2HN2A 1I94T 2I0MA 3WI3A 2JQKA 2JQ9A 3AE2A 5JVDE 2H89A 2C5JA 4H63H 2XQ5A 3O4XE 4HWHA 4OK0A 2MBGA 2E5VA 4U2ZA 2WBLA 1R8IA 3CQGB 3P4PA 2UUCT 1SE7A 2J47A 3VR8A 1FMWA 5F3JA 3MZKB 4E7SA 3AECA 3ZMUB 4AQFA 4B6XA 4JEHB 5H6RB 2YKSA 5C8YE 2CWYA 1OEDB 2E9XB 2H7OA 1UCUA 2WDVA 2WSSV 3FB2A 3LSVA 4HFVA 4HGAA 5DABA 3T8OA 3RQWA 5IUXA 2YDRA 1D1CA 3NRXA 4QH1A 5CFBA 3AEAA 3PV0F 4H63V 4TX5A 3K3QC 4OFZA 2BVLA 5FY1A 1D0XA 3LBXB 3X1DA 2IC6A 4CN1A 4OHFA 5EK3A 2CHNA 2NW9A 3UQ4A 5BMVE 5JDGA 5L3EB 5J2TE 4EV6A 4PJNA 4CXWA 2XUEA 4O8SA 2YN6A 2N9DA 5LG4A 2D5UA 4YFSA 3ONLC 3UU3A 2BG9C 4EYYR 4X20E 1L0VA 4QX7B 3JCFA 5HXSA 4ILBA 1HG2A 3R6NA 5L3CB 1FIOA 5BR8T 2XJ7A 3HKCE 4ZI7E 1JNRA 4H9OC 2XQ3A 5M4YA 2QA7A 4KUMB 3IHRA 2YU2A 2E2AA 3AE9A 3KBTA 5JR9C 2JJ9A 2VQET 2NR4A 4YTPA 1SUMB 4XBFB 4F8HA 2KINB 4ERRA 3GWHA 3RIFA 3H37A 2XPKA 1MNDA 3LK3B 3N2OA 4WW0A 2UU9T 4DUZT 3C50A 4TNVA 2XQ6A 4NIQA 2WCAA 5AQNB 3G06A 2X68A 5AQRB 5LA6E 1XMQT 4NXNT 1W09A 3AE1A 4K0UA 1YKHB 2WY2A 4GK0E 4U74A 3GA8A 3RX6A 3ZMVB 5ABHA 2E5LT 4H9PC 4G2AA 4QH4A 4CI3B 2Q9QB 3KBUA 4ISTA 4AQYT 4EEDA 3AEEA 3J7Yq 1YW0A 2LM2A 3NZPA 5JRCB 5HWXA 2YK0A 3HR0A 3UUBA 4TN7B 3A8YC 5LXTE 1CHUA 1J1JA 3K3NA 2V6XA 1ZOYA 4PFOA 1W0AA 2X66A 3FZFB 3NWIA 4ADZA 5FXWA 4YY3T 3SFEA 2HPLA 1YQ3A 3OBVE 4MBQA 4QX8B 1T72A 2SPCA 3R84B 1M62A 1LVKA 4GK5E 5JH7E 5AQSB 4UVCB 1OWAA 1FMVA 2PJQA 4M1PA 4PK4A 1BR4A 4AQGA 4IE4A 5FKYA 3QC9A 3UQ7A 3P50A 1XZYA 2X9XA 3RRCA 4DO0A 4WBNE 4HE8A 4G63A 4PJLA 5LNKA 4P0AA 4B3RT 2VL0A 4GKJT 4O2AE 1UX5A 2V26A 2HH7A 5KX5E 4JI4T 3C4WA 4YJ3E 2FJDA 2V7LA 4HWCA 4BJNA 5FL1A 4ZOLE 5HXHA 3F57A 4J2CA 4EZHA 2IAKA 3IF8B 1S94A 4IREA 5LMUT 3CX7B 2LJLA 5DQWA 2W00A 3CVRA 2V7MA 4MALA 5FY7A 2CE7A 2LSGA 3PUZF 3QNUA 2W61A 5CB4E 3AA0B 1Y64B 2YDQA 5HEUA 1FEWA 3ZYKA 5L3BB 3HL6A 2MYSA 2DI4A 2VVSA 2RP4A 3EABA 4X1KE 4AXPA 5LGNB 1IBKT 4LF9T 2WWVA 2V7IA 2A2FX 2BS2A 3E22E 4U3CA 3RIAA 2DWGA 2LKHA 3O9XA 4EEBA 1W9RA 2D0TA 5F8PA 4DBQA 3B13A 2XSAA 3ZC0A 3CQXC 2KZ7B 4I0UA 2ZM6T 2OLTA 3N9QA 3TLSA 3EI0A 5J0ZA 3PTRB 3PUSA 5JDNA 3OKQA 1IZNB 2KMFA 2L8KA 4U33A 4CN4A 5L47A 5AQLB 5EZYE 2BDEA 2EHOB 3CX6B 4IDZA 3RF1A 1OXZA 5LGTB 2A3DA 2WDRA 1B7TA 4EYUA 1AJ3A 5CGMA 4LFCT 5J1GA 2V7JA 2M6IA 3TKLB 2VVNA 2XAJB 2VQFT 2CMRA 4LF6T 3Q9DA 4ASKA 3P4WA 1WYBA 3HI2A 5LBMA 3ZEFB 5L3DB 3NVOA 3MACA 5CJ5A 5GONE 3UUNA 4DR2T 5LHIB 4B3MT 4UR9A 2W66A 2XAGB 2BG9A 1T8BA 1YD8G 2V5DA 5HWYA 4NUVA 1MIWA 1OEDE 2LKGA 2VURA 2M6BA 2C5IT 1XDOA 3AA6B 3LK2B 2XHEB 2ES0A 2LHRA 3Q5WA 4UVAB 5FYMA 2ZLYA 3AVSA 3TLUA 4PAGA 3CPZA 4TUYE 3RKGA 1ZP0A 2BKPA 2WU2A 3QB5A 5KMGP 2LOPA 4U7IA 4KHPT 2K3WA 4ZS2A 3PUWF 5AQKB 3T1HT 5TAOA 2YEVC 3EDVA 2JPFA 2DHRA 5E0OA 3PUQA 4E7ZA 2W2UA 5LJNA 3L39A 2IC9A 5L2LA 2XTLA 3ZCJA 5CA0E 2LSYA 3PU8A 2A72A 3PJAA 3RYHE 3UTKA 5KDMC 4X64T 4DR7T 4IT4A 2KWIB 2XQ9A 1HNWT 3JC6D 4IL4A 2UXDT 1J5WA 1GQEA 2LOSA 3QUJA 1UURA 5L4HA 1KNRA 2AE9A 3L8RA 3C51A 5ABFA 4JI7T 2UXXB 5JDFA 3TLWA 4KX6A 1D1AA 2MTQA 3LBXA 4JLEA 2K24A 4IGUA 2X0YA 5FVLA 2XASB 5IWAT 3NZQA 3ZJ2A 3WAJA 3UU6A 1MIVA 2NW8A 5L3GB 1IBMT 1E1HB 4HFDA 2BG9B 2NW7A 3OYXA 4HTEA 4L9IA 3ABVA 2VKHA 1WLXA 2BVMA 2W67A 4MHCA 4CXYA 5JDLA 4LFBT 2CLYC 4YTMA 1HFAA 4AKRB 2NTYA 4HN9A 5A1LA 3I0OA 3A5XA 1HTJF 1U5PA 2W62A 1Z8UA 2AXDS 5LJMA 2B1EA 2CXDA 2Z6EA 2XAHB 5FMNA 4TV8E 2V6YB 3VRBA 3MXZA 3K3OA 2H7VC 1HX1B 3GMIA 1KNZA 5HYAA 2LT3A 1HCIA 4GYRA 4EZ4A 5LBQB 3P4RA 4JI8T 1H7CA 1T7SA 1UX4A 4L5GA 2F4VT 2P9BA 3SOLA 4HWDA 4U7YA 1OEDA 1VCTA 2E9XA 2WMNA 3FZMB 3ZSTA 1HX8A 3EAMA 4H9SE 1HNXT 3MK7C 1US7B 4PK5A 2KWHA 1QUUA 4I4TE 5FVKA 4O4JE 2ODUA 4P09A 1UUSA 4LF5T 2Q9QD 5LGUB 5AQMB 2X67A 2QYWA 1HNZT 1YKEB 3AEDA 3C64A 4CXXA 2XM2A 4X1IE 5J2UE 2LE8A 2X9YA 3PDYA 4KI0F 4WYVA 2ZMAA 1LVFA 2V7KA 2JRKA 3BK9A 3AE3A 4O4HE 3V5UA 3AXJB 3QB5K 1Z0PA 4QXHB 1KNPA 4TNWA 4C90A 2EHOD 4YHHT 3P4QA 3C4ZA 2WWUA 5HEJA 4JEUB 4JI0T 4LF4T 4IL9A 3VKGA 1Y01A 2N1GA 3OVUA 3FZKB 2IDOB 2XQYA 4WNKA 4YT0A 3KVBA 2HN1A 1DU2A 4PK6A 1T98A 3EUHA 3MA9A 3N9OA 3M65A 4GYSA 4IHJE 2ZM2A 3AAIA 3JAFA 4JUYA 3N2KE 4HFCA 4U2YA 5HCJA 4AI6A 2XM1A 3AAEB 4EB6E 2OA5A 2RPAA 4HKAA 4YXDA 1O3XA 3K1SA 5IYZE 3RQUA 5JREA 5L4EA 5HEOA 1NAFA 2UXNB 1G73A 2CWOA 1IBLT 3AE4A 4JI5T 4COFA 3QOFA 2WDQA 4EGWA 2YU1A 2CBIA 1ZEEA 1OEDC 2DNXA 2E9XC 2IHR1 3E08A 1D0ZA 3UUXB 4CZZB 4DMWA 4YTNA 4BA9A 4CI1B 2JQHA 4LF7T 3AE5A 4O4LE 2CXLA 4V1Av 5LP6E 3N2GE 1D0YA 4HFBA 3RKOA 2KT9A 1HR0T 2BBJA 4DNDA 2XQ7A 4PFPA 2JQQA 4H9RC 2UXBT 2NWBA 2WB5A 3EDUA 3H3AA 2KSRA 3RHWA 2XZEA 3HKEE 3JAEA 3S4UA 4AKIA 1U4QA 4ZEYA 1LKXA 3ONXA 3PURA 4LMLA 2YDSA 2CEAA 3AEGA 4JBWF 4P0BA 3N9LA 5AQQB 4YSYA 2B76A 3FBLA 4DV2T 3ZKRA 2WM9A 1XWMA 3KINB 1MMNA 1WR0A 3Q5DA 4C91A 1SA0E 3RYFE 1N34T 5HAXA 4HWIB 4AQFC 5LCYA 3OJAA 4NXMT 4WZXA 3MJXA 2NTXA 3N9PA 2BBHA 5AQPB 3RRWA 3P4SA 3U78A 5JDQA 4I55E 4QKNA 5HXEA 3DP7A 3AA7B 3U3IA 3O1JA 4ILAA 3B57A 4IDNA 3ZJ1A 4Z90A 4JI2T 3PJAJ 5C3JA 4DR5T 2UUBT 5AQGB 4JYAT 3IA3A 3ANWB 2X9HA 3ZLIA 4AIUA 2HHHT 2LRLA 5FXVA 3UU4A 2WP9A 3BQIA 3W15B 5JRCA 2JMKA 4TWFA 2XY8B 2D0UA 3ZMTB 3Q5XA 3AAAB 4AKLA 2IMLA 4WBOA 2Q9QC 3L09A 1HG5A 2RA1A 2W4XA 2Y6XA 4UV8B 3AEBA 1YXRA 3CIRA 3O1IA 4NUUA 3RIUC 3TLTA 3ZPOA 4BAYB 3GN5B 4QH5A 4BJMA 3B5MA 2LHNA 3IEEA 5LB7B 4IDOA 2UUAT 2QRXA 2CPTA 4A5XA 1MMAA 1VCSA 4ZI2C 2NOXA 4QHOA 4IE0A 4GOUA 5AQTB 2VKJA 2GK9A 1E2AA 2K5BB 2WZHA 1S35A 1UK5A 3AE8A 3CX8B 3D0TA 3PUYF 2VB6A 2K48A 4K0KT 4OX9T 2V1DB 3RI5A 5LHHB 2CHOA 3HKDE
chains in the Genus database with same CATH topology
3ONJA 3ONLC 1VCSA 2QYWA 2V8SV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONJ A;  3ONL C;  1VCS A;  2QYW A;  2V8S V; 
#chains in the Genus database with same CATH topology
 2IW5 B;  3HKB E;  4HFH A;  4U72 A;  2G0U A;  5AQU B;  1BR0 A;  2WZI A;  4OYK A;  1IAP A;  3JC6 C;  3VRA A;  3PUA A;  4MFR A;  5CA1 E;  4DR6 T;  4KHZ F;  4DV6 T;  2ACZ A;  2BZB A;  1NWM X;  3PU3 A;  5DJQ C;  2K9A A;  2KND A;  4YSX A;  1WR6 A;  1CUN A;  4ZS3 A;  2A9U A;  3PE0 A;  3GN5 A;  4ZXL A;  5DQV A;  5HEG A;  5JR9 A;  1E7P A;  3UT5 E;  3ZMS B;  2BS4 A;  3RPU A;  3JAD A;  4PJJ A;  5H6Q B;  3RC8 A;  1N32 T;  3I9Y A;  4DBR A;  3DTO A;  4LMJ A;  5LHG B;  3BQK A;  2D2S A;  3H3M A;  1MIY A;  2WMO A;  1SHZ C;  1ZV4 X;  3PUV F;  3VU7 H;  3Q5E A;  2FBW A;  3ZMZ B;  3ONJ A;  4UEM A;  1BR2 A;  3LG7 A;  4X66 T;  2DWK A;  3HA4 A;  3C98 B;  4XZC A;  3IBP A;  5EK4 A;  2VL8 A;  3N9N A;  2QVA A;  3KV5 A;  4X1Y E;  4DV4 T;  3I1A A;  3KV4 A;  4HFE A;  4O4I E;  4GKK T;  4ZZB A;  3CK6 A;  2I59 A;  2Y8D A;  3ZSS A;  4ILC A;  2WS3 A;  3KVA A;  1KK7 A;  3VR9 A;  2H88 A;  3P7I A;  1NEN A;  3EHZ A;  2J4G A;  4NPP A;  1XNR T;  2LSI A;  5HXC A;  5AFU L;  4HWF A;  3SFD A;  5C2T A;  2WU5 A;  5HEH A;  2DLR A;  4KP3 C;  4IIJ E;  3VHL A;  4DR1 T;  2DL1 A;  2ZM8 A;  4L0R A;  4JI1 T;  1BR1 A;  2XSB A;  3LFM A;  2J62 A;  3ESL A;  2BKO A;  3SWH A;  1LRZ A;  3UU5 A;  2BS3 A;  5ABE A;  2PFV A;  2LSK A;  2YIN A;  3K8P C;  3LK4 2;  4LMK A;  4O2B E;  4PNI A;  3UUL A;  4U31 A;  4A97 A;  1X9B A;  4DMV A;  4X65 T;  4ILU A;  1WRD A;  3FZH B;  2PTF A;  2VKD A;  2WAU A;  3AE7 A;  1XMO T;  5AQJ B;  5FY0 A;  4QWN B;  1ZKE A;  3AEF A;  5JR9 B;  5JDH A;  3F31 A;  4ZI3 D;  4X62 T;  3FZL B;  5LYJ E;  2X0H A;  1QLB A;  4IE6 A;  1VOM A;  4EAH A;  2QGS A;  4H9Q C;  4EXT A;  4AKG A;  3ZT5 A;  5F5W A;  2LRK A;  4YSZ A;  3KV9 A;  4FI5 A;  5JQG E;  5AQI B;  2EHO C;  2X0L B;  4A56 A;  4CN6 A;  1HS7 A;  1MMG A;  4ZI2 D;  5AQO B;  2EHO A;  2LM9 A;  3ZC1 A;  4DR3 T;  2D9D A;  5FP3 A;  3PUG A;  2H3R A;  1KEY A;  3P8C D;  4ZZC A;  3CWZ B;  1MMD A;  4IE5 A;  3NKZ A;  4A98 A;  3ETU A;  4KBM B;  2MPK A;  3ZN1 B;  3A7M A;  2XAQ B;  3LDQ B;  3TLV A;  3ZYL A;  2VK9 A;  3L3P A;  2CM0 A;  1X79 A;  4AIS A;  3UUM A;  4HEA A;  4IE7 A;  1XDP A;  4JI6 T;  2ACX A;  4DV0 T;  2Q9Q A;  3Q2M A;  2FUP A;  2C0S A;  2CCQ A;  2CLY B;  3C4X A;  4LFA T;  3T1Y T;  3LJC A;  4EIW A;  3SRZ A;  2FJE A;  3KDS E;  3RH3 A;  1G8X A;  1V9D A;  2BG9 E;  2HPJ A;  2W63 A;  2E9X D;  2J1D G;  2VKO A;  3NBX X;  4FJO A;  4QXC B;  2XQ8 A;  1KF6 A;  4HFI A;  2V5C A;  3DJB A;  4P1N A;  4TV9 E;  1D1B A;  2L9Q A;  3O1H A;  4UVB B;  4UF0 A;  4UF0 B;  4QXB B;  1EZ3 A;  2CXF A;  2WQY A;  5ABG A;  4LF8 T;  3ZN0 B;  2CBJ A;  3AE6 A;  5ADX L;  4TWD A;  1KFY A;  4F6R C;  4EOZ B;  1NEK A;  5FNV E;  5JDM A;  2E8I A;  4I50 E;  1I6Z A;  4DV7 T;  1N36 T;  1IJ6 A;  3RYI E;  2XQ4 A;  5IHY A;  2KXP B;  2MAW A;  4PW8 A;  3QK6 A;  3ZT6 A;  1N33 T;  3N9M A;  2V8S V;  2M67 A;  2NP9 A;  2XAF B;  4Z91 A;  1MNE A;  5AQH B;  3RLF F;  2X9W A;  2DCF A;  1WFD A;  4DV1 T;  4DV3 T;  4DR4 T;  3I0Q A;  2PG8 A;  4JV5 T;  3N5L A;  3EVY A;  4GIW A;  2R6G F;  3ANW A;  4DID B;  3CQC B;  4I43 B;  4B3T T;  3ZYM A;  2C5K T;  3E0Z A;  3FXE B;  3M3Z B;  5FXX A;  3FBZ A;  4B3S T;  2KLQ A;  2L3L A;  3BQL A;  5AQF B;  4ISS A;  3CML A;  4UV9 B;  1UGO A;  2FJA A;  4TWH A;  2MOZ A;  3FHN A;  4UIG A;  5AQV B;  3ETV A;  3NRY A;  2I6H A;  4TZ4 C;  4UEL A;  3WAK A;  4UXN B;  3AVR A;  5L3F B;  3AB3 B;  5LG3 A;  3VKH A;  2LSJ A;  3F2E A;  2LLY A;  4YHJ A;  4YJ2 E;  2ZM0 A;  3PUX F;  3V5S A;  1XNQ T;  3I9W A;  2N2N A;  3J9X 1;  3KV6 A;  5HXR A;  1QSD A;  2BKN A;  4AKH A;  4X5T A;  3UU8 A;  4IDP A;  3KFW X;  2ODV A;  5ETW A;  3RYC E;  5KXJ A;  3OPC A;  2JIW A;  3UFG A;  4Z8X A;  3RC3 A;  4PJM A;  4ANJ A;  4DUY T;  4CI2 B;  4Q25 A;  4CQI A;  2FJB A;  4ZHQ E;  4XAX B;  1JNZ A;  2UXC T;  2VWA A;  4OYJ A;  3OTO T;  3UFE A;  5ABF B;  1WYC A;  5LOV E;  1YQ4 A;  5FXZ A;  3MKD A;  1J5E T;  4JI3 T;  1ZHC A;  2YOE A;  3SS1 A;  2CRB A;  2W0G A;  4IDQ A;  4DV5 T;  2Y48 B;  5EK2 A;  1M7K A;  4N78 D;  1IJ5 A;  2IIU A;  2CA5 A;  2LEH A;  4KMC A;  4YLH A;  5LMN T;  2IUB A;  5HCM A;  3AA1 B;  3RIU A;  2XQA A;  1HF8 A;  3RGL A;  1VRB A;  2JMH A;  5FL0 A;  1FJG T;  2X51 A;  3OYZ A;  4ZI3 C;  4DVD A;  4H9N C;  2OV9 A;  3AXJ A;  2VAS A;  2V6Y A;  1W0B A;  4MLK A;  2PBI A;  3ZCI A;  3ZT7 A;  3CKD A;  3FXD B;  1WCR A;  5JTG A;  2HN2 A;  1I94 T;  2I0M A;  3WI3 A;  2JQK A;  2JQ9 A;  3AE2 A;  5JVD E;  2H89 A;  2C5J A;  4H63 H;  2XQ5 A;  3O4X E;  4HWH A;  4OK0 A;  2MBG A;  2E5V A;  4U2Z A;  2WBL A;  1R8I A;  3CQG B;  3P4P A;  2UUC T;  1SE7 A;  2J47 A;  3VR8 A;  1FMW A;  5F3J A;  3MZK B;  4E7S A;  3AEC A;  3ZMU B;  4AQF A;  4B6X A;  4JEH B;  5H6R B;  2YKS A;  5C8Y E;  2CWY A;  1OED B;  2E9X B;  2H7O A;  1UCU A;  2WDV A;  2WSS V;  3FB2 A;  3LSV A;  4HFV A;  4HGA A;  5DAB A;  3T8O A;  3RQW A;  5IUX A;  2YDR A;  1D1C A;  3NRX A;  4QH1 A;  5CFB A;  3AEA A;  3PV0 F;  4H63 V;  4TX5 A;  3K3Q C;  4OFZ A;  2BVL A;  5FY1 A;  1D0X A;  3LBX B;  3X1D A;  2IC6 A;  4CN1 A;  4OHF A;  5EK3 A;  2CHN A;  2NW9 A;  3UQ4 A;  5BMV E;  5JDG A;  5L3E B;  5J2T E;  4EV6 A;  4PJN A;  4CXW A;  2XUE A;  4O8S A;  2YN6 A;  2N9D A;  5LG4 A;  2D5U A;  4YFS A;  3ONL C;  3UU3 A;  2BG9 C;  4EYY R;  4X20 E;  1L0V A;  4QX7 B;  3JCF A;  5HXS A;  4ILB A;  1HG2 A;  3R6N A;  5L3C B;  1FIO A;  5BR8 T;  2XJ7 A;  3HKC E;  4ZI7 E;  1JNR A;  4H9O C;  2XQ3 A;  5M4Y A;  2QA7 A;  4KUM B;  3IHR A;  2YU2 A;  2E2A A;  3AE9 A;  3KBT A;  5JR9 C;  2JJ9 A;  2VQE T;  2NR4 A;  4YTP A;  1SUM B;  4XBF B;  4F8H A;  2KIN B;  4ERR A;  3GWH A;  3RIF A;  3H37 A;  2XPK A;  1MND A;  3LK3 B;  3N2O A;  4WW0 A;  2UU9 T;  4DUZ T;  3C50 A;  4TNV A;  2XQ6 A;  4NIQ A;  2WCA A;  5AQN B;  3G06 A;  2X68 A;  5AQR B;  5LA6 E;  1XMQ T;  4NXN T;  1W09 A;  3AE1 A;  4K0U A;  1YKH B;  2WY2 A;  4GK0 E;  4U74 A;  3GA8 A;  3RX6 A;  3ZMV B;  5ABH A;  2E5L T;  4H9P C;  4G2A A;  4QH4 A;  4CI3 B;  2Q9Q B;  3KBU A;  4IST A;  4AQY T;  4EED A;  3AEE A;  3J7Y q;  1YW0 A;  2LM2 A;  3NZP A;  5JRC B;  5HWX A;  2YK0 A;  3HR0 A;  3UUB A;  4TN7 B;  3A8Y C;  5LXT E;  1CHU A;  1J1J A;  3K3N A;  2V6X A;  1ZOY A;  4PFO A;  1W0A A;  2X66 A;  3FZF B;  3NWI A;  4ADZ A;  5FXW A;  4YY3 T;  3SFE A;  2HPL A;  1YQ3 A;  3OBV E;  4MBQ A;  4QX8 B;  1T72 A;  2SPC A;  3R84 B;  1M62 A;  1LVK A;  4GK5 E;  5JH7 E;  5AQS B;  4UVC B;  1OWA A;  1FMV A;  2PJQ A;  4M1P A;  4PK4 A;  1BR4 A;  4AQG A;  4IE4 A;  5FKY A;  3QC9 A;  3UQ7 A;  3P50 A;  1XZY A;  2X9X A;  3RRC A;  4DO0 A;  4WBN E;  4HE8 A;  4G63 A;  4PJL A;  5LNK A;  4P0A A;  4B3R T;  2VL0 A;  4GKJ T;  4O2A E;  1UX5 A;  2V26 A;  2HH7 A;  5KX5 E;  4JI4 T;  3C4W A;  4YJ3 E;  2FJD A;  2V7L A;  4HWC A;  4BJN A;  5FL1 A;  4ZOL E;  5HXH A;  3F57 A;  4J2C A;  4EZH A;  2IAK A;  3IF8 B;  1S94 A;  4IRE A;  5LMU T;  3CX7 B;  2LJL A;  5DQW A;  2W00 A;  3CVR A;  2V7M A;  4MAL A;  5FY7 A;  2CE7 A;  2LSG A;  3PUZ F;  3QNU A;  2W61 A;  5CB4 E;  3AA0 B;  1Y64 B;  2YDQ A;  5HEU A;  1FEW A;  3ZYK A;  5L3B B;  3HL6 A;  2MYS A;  2DI4 A;  2VVS A;  2RP4 A;  3EAB A;  4X1K E;  4AXP A;  5LGN B;  1IBK T;  4LF9 T;  2WWV A;  2V7I A;  2A2F X;  2BS2 A;  3E22 E;  4U3C A;  3RIA A;  2DWG A;  2LKH A;  3O9X A;  4EEB A;  1W9R A;  2D0T A;  5F8P A;  4DBQ A;  3B13 A;  2XSA A;  3ZC0 A;  3CQX C;  2KZ7 B;  4I0U A;  2ZM6 T;  2OLT A;  3N9Q A;  3TLS A;  3EI0 A;  5J0Z A;  3PTR B;  3PUS A;  5JDN A;  3OKQ A;  1IZN B;  2KMF A;  2L8K A;  4U33 A;  4CN4 A;  5L47 A;  5AQL B;  5EZY E;  2BDE A;  2EHO B;  3CX6 B;  4IDZ A;  3RF1 A;  1OXZ A;  5LGT B;  2A3D A;  2WDR A;  1B7T A;  4EYU A;  1AJ3 A;  5CGM A;  4LFC T;  5J1G A;  2V7J A;  2M6I A;  3TKL B;  2VVN A;  2XAJ B;  2VQF T;  2CMR A;  4LF6 T;  3Q9D A;  4ASK A;  3P4W A;  1WYB A;  3HI2 A;  5LBM A;  3ZEF B;  5L3D B;  3NVO A;  3MAC A;  5CJ5 A;  5GON E;  3UUN A;  4DR2 T;  5LHI B;  4B3M T;  4UR9 A;  2W66 A;  2XAG B;  2BG9 A;  1T8B A;  1YD8 G;  2V5D A;  5HWY A;  4NUV A;  1MIW A;  1OED E;  2LKG A;  2VUR A;  2M6B A;  2C5I T;  1XDO A;  3AA6 B;  3LK2 B;  2XHE B;  2ES0 A;  2LHR A;  3Q5W A;  4UVA B;  5FYM A;  2ZLY A;  3AVS A;  3TLU A;  4PAG A;  3CPZ A;  4TUY E;  3RKG A;  1ZP0 A;  2BKP A;  2WU2 A;  3QB5 A;  5KMG P;  2LOP A;  4U7I A;  4KHP T;  2K3W A;  4ZS2 A;  3PUW F;  5AQK B;  3T1H T;  5TAO A;  2YEV C;  3EDV A;  2JPF A;  2DHR A;  5E0O A;  3PUQ A;  4E7Z A;  2W2U A;  5LJN A;  3L39 A;  2IC9 A;  5L2L A;  2XTL A;  3ZCJ A;  5CA0 E;  2LSY A;  3PU8 A;  2A72 A;  3PJA A;  3RYH E;  3UTK A;  5KDM C;  4X64 T;  4DR7 T;  4IT4 A;  2KWI B;  2XQ9 A;  1HNW T;  3JC6 D;  4IL4 A;  2UXD T;  1J5W A;  1GQE A;  2LOS A;  3QUJ A;  1UUR A;  5L4H A;  1KNR A;  2AE9 A;  3L8R A;  3C51 A;  5ABF A;  4JI7 T;  2UXX B;  5JDF A;  3TLW A;  4KX6 A;  1D1A A;  2MTQ A;  3LBX A;  4JLE A;  2K24 A;  4IGU A;  2X0Y A;  5FVL A;  2XAS B;  5IWA T;  3NZQ A;  3ZJ2 A;  3WAJ A;  3UU6 A;  1MIV A;  2NW8 A;  5L3G B;  1IBM T;  1E1H B;  4HFD A;  2BG9 B;  2NW7 A;  3OYX A;  4HTE A;  4L9I A;  3ABV A;  2VKH A;  1WLX A;  2BVM A;  2W67 A;  4MHC A;  4CXY A;  5JDL A;  4LFB T;  2CLY C;  4YTM A;  1HFA A;  4AKR B;  2NTY A;  4HN9 A;  5A1L A;  3I0O A;  3A5X A;  1HTJ F;  1U5P A;  2W62 A;  1Z8U A;  2AXD S;  5LJM A;  2B1E A;  2CXD A;  2Z6E A;  2XAH B;  5FMN A;  4TV8 E;  2V6Y B;  3VRB A;  3MXZ A;  3K3O A;  2H7V C;  1HX1 B;  3GMI A;  1KNZ A;  5HYA A;  2LT3 A;  1HCI A;  4GYR A;  4EZ4 A;  5LBQ B;  3P4R A;  4JI8 T;  1H7C A;  1T7S A;  1UX4 A;  4L5G A;  2F4V T;  2P9B A;  3SOL A;  4HWD A;  4U7Y A;  1OED A;  1VCT A;  2E9X A;  2WMN A;  3FZM B;  3ZST A;  1HX8 A;  3EAM A;  4H9S E;  1HNX T;  3MK7 C;  1US7 B;  4PK5 A;  2KWH A;  1QUU A;  4I4T E;  5FVK A;  4O4J E;  2ODU A;  4P09 A;  1UUS A;  4LF5 T;  2Q9Q D;  5LGU B;  5AQM B;  2X67 A;  2QYW A;  1HNZ T;  1YKE B;  3AED A;  3C64 A;  4CXX A;  2XM2 A;  4X1I E;  5J2U E;  2LE8 A;  2X9Y A;  3PDY A;  4KI0 F;  4WYV A;  2ZMA A;  1LVF A;  2V7K A;  2JRK A;  3BK9 A;  3AE3 A;  4O4H E;  3V5U A;  3AXJ B;  3QB5 K;  1Z0P A;  4QXH B;  1KNP A;  4TNW A;  4C90 A;  2EHO D;  4YHH T;  3P4Q A;  3C4Z A;  2WWU A;  5HEJ A;  4JEU B;  4JI0 T;  4LF4 T;  4IL9 A;  3VKG A;  1Y01 A;  2N1G A;  3OVU A;  3FZK B;  2IDO B;  2XQY A;  4WNK A;  4YT0 A;  3KVB A;  2HN1 A;  1DU2 A;  4PK6 A;  1T98 A;  3EUH A;  3MA9 A;  3N9O A;  3M65 A;  4GYS A;  4IHJ E;  2ZM2 A;  3AAI A;  3JAF A;  4JUY A;  3N2K E;  4HFC A;  4U2Y A;  5HCJ A;  4AI6 A;  2XM1 A;  3AAE B;  4EB6 E;  2OA5 A;  2RPA A;  4HKA A;  4YXD A;  1O3X A;  3K1S A;  5IYZ E;  3RQU A;  5JRE A;  5L4E A;  5HEO A;  1NAF A;  2UXN B;  1G73 A;  2CWO A;  1IBL T;  3AE4 A;  4JI5 T;  4COF A;  3QOF A;  2WDQ A;  4EGW A;  2YU1 A;  2CBI A;  1ZEE A;  1OED C;  2DNX A;  2E9X C;  2IHR 1;  3E08 A;  1D0Z A;  3UUX B;  4CZZ B;  4DMW A;  4YTN A;  4BA9 A;  4CI1 B;  2JQH A;  4LF7 T;  3AE5 A;  4O4L E;  2CXL A;  4V1A v;  5LP6 E;  3N2G E;  1D0Y A;  4HFB A;  3RKO A;  2KT9 A;  1HR0 T;  2BBJ A;  4DND A;  2XQ7 A;  4PFP A;  2JQQ A;  4H9R C;  2UXB T;  2NWB A;  2WB5 A;  3EDU A;  3H3A A;  2KSR A;  3RHW A;  2XZE A;  3HKE E;  3JAE A;  3S4U A;  4AKI A;  1U4Q A;  4ZEY A;  1LKX A;  3ONX A;  3PUR A;  4LML A;  2YDS A;  2CEA A;  3AEG A;  4JBW F;  4P0B A;  3N9L A;  5AQQ B;  4YSY A;  2B76 A;  3FBL A;  4DV2 T;  3ZKR A;  2WM9 A;  1XWM A;  3KIN B;  1MMN A;  1WR0 A;  3Q5D A;  4C91 A;  1SA0 E;  3RYF E;  1N34 T;  5HAX A;  4HWI B;  4AQF C;  5LCY A;  3OJA A;  4NXM T;  4WZX A;  3MJX A;  2NTX A;  3N9P A;  2BBH A;  5AQP B;  3RRW A;  3P4S A;  3U78 A;  5JDQ A;  4I55 E;  4QKN A;  5HXE A;  3DP7 A;  3AA7 B;  3U3I A;  3O1J A;  4ILA A;  3B57 A;  4IDN A;  3ZJ1 A;  4Z90 A;  4JI2 T;  3PJA J;  5C3J A;  4DR5 T;  2UUB T;  5AQG B;  4JYA T;  3IA3 A;  3ANW B;  2X9H A;  3ZLI A;  4AIU A;  2HHH T;  2LRL A;  5FXV A;  3UU4 A;  2WP9 A;  3BQI A;  3W15 B;  5JRC A;  2JMK A;  4TWF A;  2XY8 B;  2D0U A;  3ZMT B;  3Q5X A;  3AAA B;  4AKL A;  2IML A;  4WBO A;  2Q9Q C;  3L09 A;  1HG5 A;  2RA1 A;  2W4X A;  2Y6X A;  4UV8 B;  3AEB A;  1YXR A;  3CIR A;  3O1I A;  4NUU A;  3RIU C;  3TLT A;  3ZPO A;  4BAY B;  3GN5 B;  4QH5 A;  4BJM A;  3B5M A;  2LHN A;  3IEE A;  5LB7 B;  4IDO A;  2UUA T;  2QRX A;  2CPT A;  4A5X A;  1MMA A;  1VCS A;  4ZI2 C;  2NOX A;  4QHO A;  4IE0 A;  4GOU A;  5AQT B;  2VKJ A;  2GK9 A;  1E2A A;  2K5B B;  2WZH A;  1S35 A;  1UK5 A;  3AE8 A;  3CX8 B;  3D0T A;  3PUY F;  2VB6 A;  2K48 A;  4K0K T;  4OX9 T;  2V1D B;  3RI5 A;  5LHH B;  2CHO A;  3HKD E; 
#chains in the Genus database with same CATH homology
 3ONJ A;  3ONL C;  1VCS A;  2QYW A;  2V8S V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...