2V8SV

Vti1b habc domain - epsinr enth domain complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
93
structure length
93
Chain Sequence
b'ASSAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN INTERACTOR 1
publication title A Snare-Adaptor Interaction is a New Mode of Cargo Recognition in Clathrin Coated Vesicles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 38
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2v8sV00
1VCSA 3ONLC 3ONJA 2V8SV 2QYWA
chains in the Genus database with same CATH superfamily
3DP7A 3K1SA 1J1JA 2HN1A 1HF8A 2X0HA 2NP9A 3ZT6A 1MIYA 4PJJA 3NKZA 3Q5XA 3MKDA 1UX5A 3ZN0B 2X9WA 2V7JA 3FBZA 3NRYA 2BS3A 5HEHA 2VK9A 2EHOA 1Z0PA 2XTLA 2SPCA 4DV7T 5JQGE 5JDNA 3AEBA 4CZZB 2Y6XA 4X5TA 3ZT7A 4TNWA 3UUBA 4A97A 2Q9QA 1SHZC 2V7KA 2E5VA 2BDEA 4CXWA 3MJXA 1MMAA 5M4YA 3BQLA 1LVKA 4TZ4C 1SA0E 2LE8A 1XNQT 3ZJ1A 5JDHA 4P1NA 1XWMA 3N2OA 3PUZF 1ZOYA 2A2FX 3P8CD 1L0VA 1T98A 2V5CA 3RYIE 5FL0A 2IIUA 2H3RA 5LHHB 2FJBA 3CWZB 4GOUA 2M6IA 3OVUA 5FMNA 5JR9C 1UK5A 4DBRA 4UF0B 5FKYA 4KHZF 3VU7H 2WP9A 1WYCA 3PUYF 4DV5T 2QVAA 3RIFA 4DR1T 3BK9A 3RC8A 3AE8A 4C90A 4UXNB 4ILBA 5EK3A 2KT9A 2XZEA 2Z6EA 4TV9E 4TWHA 3B5MA 2Y48B 4HTEA 4B3MT 3AE9A 2C0SA 4DR2T 5FY7A 3KV5A 2N1GA 4B6XA 3ESLA 2YINA 3JAEA 1HNZT 2NW9A 2JRKA 3LDQB 5L4EA 2WDVA 1V9DA 4DR7T 3RYHE 3KVAA 2NW8A 5JR9A 3PUGA 3OYZA 3RX6A 3W15B 1AJ3A 2RP4A 4L9IA 4LF4T 4IE6A 1IAPA 5BMVE 4DUYT 1B7TA 4PJNA 3GA8A 2QGSA 4BAYB 2V7IA 1BR1A 2PTFA 2C5IT 4G63A 5TAOA 4U7IA 3ONJA 1NEKA 3P50A 1WRDA 3X1DA 2B76A 4X1KE 2LSIA 3C4ZA 1KNPA 4YSXA 4HKAA 4CXYA 2CA5A 2V7LA 2ZLYA 2KXPB 1ZV4X 1D0ZA 4M1PA 4LF6T 2KNDA 1QLBA 3AA7B 2HPLA 3ZMUB 5L3BB 2WDRA 2PFVA 1T8BA 3UU6A 5AQLB 3WAKA 2WMNA 1T7SA 4ZZBA 1O3XA 1HFAA 3HKEE 2MAWA 4P0AA 2D5UA 2XQ5A 2WQYA 3RPUA 5LJNA 2BS4A 5HEJA 2H7OA 4AISA 1T72A 1LVFA 2CM0A 2RPAA 4UR9A 2H88A 1WLXA 2X0LB 2IAKA 4YTNA 3S4UA 2KSRA 4ILAA 4DMVA 1D1CA 2BBJA 4QXBB 3AVSA 3AE3A 3P4QA 2C5JA 3N2KE 4X62T 3ZYKA 5HXRA 5CA1E 3KDSE 4I50E 4TWDA 4IL9A 3ZMTB 2AE9A 4O4IE 2XM2A 4MFRA 2JQQA 2YN6A 1HCIA 5FY0A 2ACXA 4DVDA 2LLYA 1XZYA 4DV2T 3ZC1A 4FI5A 1N33T 2IW5B 1KNZA 2LSKA 2VB6A 2CE7A 1E7PA 3F31A 3N9OA 3P4RA 4LF8T 2HH7A 1W9RA 3A5XA 4WBNE 3FXDB 2CBJA 3PE0A 4EOZB 5LGUB 3N9LA 5ABHA 1DU2A 3PUQA 2WU5A 2CEAA 4H63H 3C98B 2WSSV 2WAUA 2E5LT 2WZHA 3U3IA 4HN9A 4BJNA 2UXXB 2JQHA 3RQUA 3PU8A 2VKHA 2J4GA 4PNIA 4COFA 5ETWA 4TX5A 4I55E 2WZIA 1ZHCA 2DNXA 3RLFF 4PJMA 2W4XA 3AEEA 2XQ4A 2XSAA 3AA0B 4IREA 5DQVA 2XAQB 5FY1A 4EEDA 4G2AA 3AE4A 2BG9C 5HEUA 4EB6E 5FXXA 1D1AA 1UX4A 4TUYE 4V1Av 3Q5WA 3AEDA 3CQGB 5C2TA 5AQHB 1ZKEA 3VRBA 4DBQA 2HN2A 3RIUC 4QKNA 4DR6T 3IEEA 5HCMA 4HEAA 2B1EA 1MNDA 5LHIB 2X51A 3N5LA 1LKXA 4HGAA 5AQKB 2XAJB 2BBHA 3O1JA 3J9X1 2HPJA 1NENA 5J2UE 4ZI3D 2ZM0A 5JDMA 3HI2A 3SOLA 3AAEB 3NWIA 3N9MA 1IBKT 3MXZA 5AQIB 1M62A 1WFDA 2Q9QB 2WU2A 5AQRB 2DWKA 3LG7A 2CHOA 1R8IA 5LMUT 2XQ6A 5AQNB 1BR0A 3RIUA 5HYAA 1FIOA 3UU5A 2CXDA 4HFEA 2BVMA 2K3WA 2BS2A 2IMLA 4IE5A 2V5DA 4O2BE 2XAGB 4KUMB 4YSZA 4LF7T 3VR9A 3UQ4A 3KFWX 3Q2MA 5LP6E 3K3NA 2JPFA 4P0BA 4H63V 2E9XC 4OYKA 3DJBA 2LSJA 4CI2B 2W62A 3L09A 4X66T 2BG9E 2D0TA 2DWGA 4IE4A 2VVSA 4AQYT 5ADXL 2H7VC 3IHRA 3CKDA 4YSYA 2XHEB 3AAIA 4I4TE 2W2UA 2ZM6T 3FZMB 1NWMX 4A98A 2OV9A 2CWYA 5J2TE 4K0UA 3H3MA 1HG5A 4A5XA 3DTOA 2QRXA 3TLTA 1ZEEA 3LK2B 4UVAB 3WI3A 3UU3A 2DHRA 2VKJA 5IYZE 4I43B 5LG4A 5AQMB 4BJMA 4U3CA 2NTXA 3FBLA 2UU9T 2WDQA 2E9XA 2ZM2A 3CK6A 5FP3A 5JDFA 5EK2A 2C5KT 4NXMT 5FVKA 5F3JA 1UUSA 3CX8B 2XQAA 3RYCE 2NWBA 2CMRA 4MALA 5F8PA 4JI5T 4JI1T 2XQ3A 2LEHA 3FZLB 3QB5K 3UU4A 3OBVE 4Z8XA 3O9XA 1KFYA 2I59A 1N34T 4X1IE 4ZI7E 5LMNT 5FNVE 2LM2A 2L9QA 3AE5A 2JJ9A 4PK5A 4HFBA 4JLEA 3VHLA 4JI6T 2JIWA 1HTJF 2D9DA 3ZN1B 1WCRA 3AA6B 2XPKA 4EGWA 1NAFA 4O2AE 5LBQB 2DL1A 1HR0T 2LSGA 2NTYA 2LKGA 2ZM8A 3HL6A 2D2SA 3QUJA 1N36T 1OEDC 4QXHB 4UELA 4CQIA 3L8RA 4EZHA 2V6XA 2UXCT 3PU3A 2DLRA 4EIWA 3UT5E 5L3CB 1CHUA 4UVBB 4TN7B 4HFHA 3IA3A 4MHCA 3AEFA 4X64T 4WW0A 1XDOA 3O4XE 2YDSA 2FJAA 3ONXA 3PUWF 4ASKA 3AE1A 1I94T 4ZI2D 3I0OA 3ETVA 4QH1A 5A1LA 3KV9A 2JQ9A 3UUXB 3VKGA 2VVNA 2ODUA 4PFPA 3LSVA 1OEDA 4EYYR 3C4WA 4IE7A 3P7IA 2CHNA 1J5WA 3CQCB 5AQSB 2R6GF 2K9AA 4DV6T 2K5BB 5HXCA 4J2CA 4PK4A 1BR2A 3QNUA 5CJ5A 4HWCA 4ZXLA 5LBMA 2WY2A 2VASA 5F5WA 5JTGA 4C91A 2XQYA 5HCJA 3UU8A 5FXWA 4ERRA 5LCYA 3HA4A 1D0XA 3Q5EA 4HFVA 4HWHA 3JC6D 3VR8A 1MMGA 1YKHB 3EHZA 1UGOA 5AQOB 4JI2T 3HKDE 5DABA 1BR4A 3C4XA 1OEDE 2EHOD 3WAJA 3A8YC 2WS3A 3ZT5A 4MLKA 2ES0A 3ETUA 5IUXA 5L3EB 1YW0A 2Q9QD 1UCUA 1YD8G 3PDYA 3Q9DA 4DR3T 3CPZA 4CI3B 2J47A 2X67A 3GMIA 2BG9B 2BVLA 4ZS2A 5EZYE 1GQEA 2YU1A 3AEAA 3SRZA 3UFEA 2KMFA 2LKHA 2QA7A 5L47A 4HE8A 2VKOA 1IBLT 5JRCB 1YQ3A 1HG2A 5LOVE 5L3GB 4U74A 4IIJE 4YY3T 3ZCIA 1US7B 3ZYLA 2JMKA 2YKSA 2X66A 3HR0A 2LHRA 4IDZA 4WZXA 2OLTA 4JEUB 5JDLA 2E2AA 2LHNA 2WWVA 4DR5T 3GWHA 3MACA 3AE2A 4UV9B 3EDUA 4IDOA 1UURA 3LBXA 1ZP0A 1N32T 4O4HE 4Q25A 1FMWA 1FMVA 2A9UA 1U5PA 1MIVA 1MIWA 5EK4A 3KBUA 4IL4A 4YHHT 3PUVF 4ZS3A 4QX8B 3QOFA 4AKLA 3JADA 4K0KT 3C50A 1JNRA 4CXXA 4HWIB 4KP3C 1S35A 2CPTA 4DR4T 4PFOA 4ZZCA 4DUZT 2WWUA 3RKOA 5HWXA 3ZSTA 4YJ2E 2WMOA 2WBLA 2CWOA 3HKCE 2E9XB 3R84B 2J62A 3B57A 3V5UA 5HAXA 4YLHA 2L8KA 5HEGA 4DV3T 3RRWA 4O8SA 3GN5B 4HFDA 1MMDA 4F8HA 4OHFA 2IDOB 4YHJA 5JVDE 4JI7T 3FHNA 5LG3A 1FJGT 1HS7A 3ZYMA 2KLQA 4LFBT 2UXDT 3PUAA 2GK9A 2IHR1 2BG9A 4JEHB 3VRAA 2XM1A 2YDQA 2DCFA 4QHOA 5CGMA 4JYAT 4OYJA 4NXNT 1W0BA 5JRCA 2UXBT 2PJQA 4AKIA 1QSDA 1WYBA 2AXDS 2UUAT 4DV1T 3UTKA 3ZPOA 3RI5A 3PURA 2DI4A 3EDVA 4ZOLE 3EUHA 2YOEA 3AE6A 2X68A 2XJ7A 3KBTA 2ACZA 4EV6A 2J1DG 4H9NC 5ABGA 2UUCT 3OKQA 3ZJ2A 5IWAT 3N2GE 5AQVB 3ZEFB 1W0AA 1J5ET 1E2AA 4OFZA 4QX7B 4X20E 1VOMA 3PTRB 3ZMSB 4I0UA 3K8PC 3FZFB 3ANWB 2KWIB 3TLUA 4DNDA 3O1HA 4E7SA 4HFCA 4U2ZA 3ZMVB 3RF1A 5AQJB 4LFCT 3MZKB 2YDRA 3OJAA 3AAAB 3FZKB 3KV6A 4IHJE 4UVCB 3PJAA 2K48A 5LB7B 1KK7A 2LSYA 1G8XA 2PBIA 3RC3A 1YKEB 5JDQA 3CQXC 4BA9A 4IGUA 5DQWA 2WCAA 1OEDB 3UUMA 3GN5A 3NVOA 2Y8DA 3CMLA 2P9BA 5CA0E 2YU2A 2N9DA 4E7ZA 3ZCJA 1IJ6A 5HXEA 3ZC0A 3N9QA 1E1HB 4TNVA 2CRBA 5L2LA 4AQGA 4DIDB 2IC6A 3FB2A 2UUBT 1X79A 3T1HT 3AXJB 2VQET 4DV4T 4UV8B 3E22E 4DO0A 4U2YA 3SS1A 4OX9T 3F57A 5J0ZA 4QH5A 3G06A 3SFDA 5CB4E 4WBOA 3EVYA 1W09A 2W00A 2FBWA 3ZSSA 4GKJT 2MYSA 2X0YA 2FJDA 1SE7A 2X9XA 5ABEA 2V6YA 4YTMA 5KMGP 2V8SV 1HX1B 4O4LE 4LFAT 2H89A 1QUUA 1Y64B 3C64A 3KINB 4B3TT 3RRCA 4N78D 3PV0F 3MK7C 4JI4T 3AE7A 3UFGA 1CUNA 2MPKA 2YK0A 4WNKA 2KINB 5JREA 3EABA 4ADZA 3AEGA 3EAMA 5AQGB 4U7YA 3RKGA 1WR0A 4ILCA 4OK0A 1VCSA 2CBIA 4GK0E 3ANWA 2E8IA 4NUUA 4KHPT 3OPCA 1MMNA 4EEBA 1FEWA 4U31A 2N2NA 4MBQA 1SUMB 5KX5E 3TLSA 2M67A 3H3AA 4Z91A 3B13A 1XNRT 3TLVA 3BQKA 2LRLA 4AIUA 2XY8B 2G0UA 3TLWA 3R6NA 4AXPA 1OWAA 4O4JE 3E08A 4ZI3C 4Z90A 4U33A 3RH3A 2VURA 3LBXB 4DMWA 4ZHQE 4L0RA 2OA5A 4AKHA 1KF6A 3RGLA 2I0MA 3T1YT 3OTOT 1HNWT 3M65A 4IDQA 4KMCA 4CN4A 2V7MA 2BKNA 4ISTA 2VWAA 4YTPA 3PJAJ 4QXCB 4JBWF 4LMKA 3A7MA 3AXJA 3KVBA 2E9XD 5AQFB 2BKOA 4ANJA 4AKRB 3N9PA 4NPPA 2ODVA 4XAXB 3NRXA 5FXVA 2K24A 1HX8A 4YXDA 4FJOA 2V1DB 2CXFA 3HKBE 4KBMB 2W63A 3CX7B 3NZPA 4QH4A 4YFSA 3D0TA 2IUBA 5LA6E 3OYXA 2CCQA 3O1IA 5FYMA 3NZQA 1XDPA 3H37A 2XSBA 5AQQB 5KXJA 3T8OA 3ZKRA 1EZ3A 4GKKT 4GK5E 4QWNB 5L4HA 5H6QB 4H9QC 4UF0A 5C3JA 2W67A 2QYWA 3ONLC 2XQ9A 3UQ7A 2X9YA 4HWFA 2LM9A 4PK6A 4LF9T 5AQTB 1D1BA 1VCTA 4H9PC 4KX6A 3QC9A 3TKLB 3AA1B 1Z8UA 5JH7E 4X65T 3E0ZA 3JAFA 4IDPA 2JQKA 5JDGA 3F2EA 2LJLA 4HFIA 3UUNA 5C8YE 2NR4A 4PW8A 5HWYA 2WB5A 2HHHT 3FXEB 5LYJE 4IT4A 2UXNB 1XMOT 2XQ7A 4F6RC 3FZHB 5DJQC 4AQFC 3ZLIA 4EYUA 5HXSA 4CI1B 2JMHA 2VQFT 4LF5T 2MOZA 3SFEA 5FL1A 2YEVC 3K3QC 2L3LA 3KV4A 3Q5DA 5GONE 1M7KA 4P09A 2IC9A 2V26A 1HNXT 5LGNB 4IDNA 3ZMZB 4JV5T 5FVLA 4ZEYA 1JNZA 3NBXX 4UEMA 2FJEA 5LHGB 4GYSA 4JI8T 3UULA 2I6HA 1LRZA 2NW7A 5ABFB 1S94A 3QK6A 2RA1A 3LK3B 5LXTE 4A56A 5AQUB 3RHWA 2BKPA 2W61A 3AECA 1OXZA 3IBPA 2A3DA 2D0UA 3QB5A 5KDMC 4AQFA 2VL8A 4IE0A 3ABVA 3L39A 2ZMAA 2W0GA 4JI0T 4YT0A 1X9BA 3J7Yq 1IJ5A 5AFUL 4JI3T 3V5SA 3K3OA 1I6ZA 4LMJA 3I9WA 3PUXF 5CFBA 3LJCA 3LK42 3LFMA 5L3FB 4AI6A 4NUVA 4CN6A 3I0QA 2EHOB 3IF8B 4XZCA 2VL0A 3PUSA 2M6BA 4AKGA 4ZI2C 2VKDA 2NOXA 4CN1A 4GYRA 1IZNB 4X1YE 5LNKA 5IHYA 4B3RT 2CLYB 1IBMT 2V6YB 4UIGA 4GIWA 5LGTB 3U78A 1D0YA 3L3PA 2A72A 2XUEA 1H7CA 3JCFA 3VKHA 2LT3A 4ILUA 5LJMA 4H9RC 3P4WA 2WM9A 1YQ4A 4L5GA 3M3ZB 4HWDA 4EXTA 2MBGA 5FXZA 4TV8E 1WR6A 2LOSA 2LRKA 4TWFA 1Y01A 1U4QA 5HXHA 1XMQT 4LMLA 2LOPA 5J1GA 4PJLA 4ISSA 3P4SA 2FUPA 4DV0T 3N9NA 1VRBA 2F4VT 3CIRA 2W66A 5H6RB 3RQWA 3SWHA 3I1AA 2XQ8A 4PAGA 2XASB 3CVRA 5BR8T 4XBFB 3RYFE 3EI0A 3AB3B 4EZ4A 4YJ3E 3JC6C 3RIAA 3CX6B 1G73A 2XAFB 3BQIA 2KZ7B 1MNEA 1KEYA 3MA9A 2PG8A 2EHOC 5ABFA 3C51A 5L3DB 3AVRA 4JUYA 4EAHA 4H9OC 3P4PA 4KI0F 2BZBA 4B3ST 2X9HA 2Q9QC 4NIQA 3I9YA 2CXLA 4U72A 4WYVA 2XAHB 5AQPB 2CLYC 1KNRA 5E0OA 4H9SE 1YXRA 5JR9B 2KWHA 2MTQA 5HEOA
chains in the Genus database with same CATH topology
1VCSA 3ONLC 3ONJA 2V8SV 2QYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCS A;  3ONL C;  3ONJ A;  2V8S V;  2QYW A; 
#chains in the Genus database with same CATH topology
 3DP7 A;  3K1S A;  1J1J A;  2HN1 A;  1HF8 A;  2X0H A;  2NP9 A;  3ZT6 A;  1MIY A;  4PJJ A;  3NKZ A;  3Q5X A;  3MKD A;  1UX5 A;  3ZN0 B;  2X9W A;  2V7J A;  3FBZ A;  3NRY A;  2BS3 A;  5HEH A;  2VK9 A;  2EHO A;  1Z0P A;  2XTL A;  2SPC A;  4DV7 T;  5JQG E;  5JDN A;  3AEB A;  4CZZ B;  2Y6X A;  4X5T A;  3ZT7 A;  4TNW A;  3UUB A;  4A97 A;  2Q9Q A;  1SHZ C;  2V7K A;  2E5V A;  2BDE A;  4CXW A;  3MJX A;  1MMA A;  5M4Y A;  3BQL A;  1LVK A;  4TZ4 C;  1SA0 E;  2LE8 A;  1XNQ T;  3ZJ1 A;  5JDH A;  4P1N A;  1XWM A;  3N2O A;  3PUZ F;  1ZOY A;  2A2F X;  3P8C D;  1L0V A;  1T98 A;  2V5C A;  3RYI E;  5FL0 A;  2IIU A;  2H3R A;  5LHH B;  2FJB A;  3CWZ B;  4GOU A;  2M6I A;  3OVU A;  5FMN A;  5JR9 C;  1UK5 A;  4DBR A;  4UF0 B;  5FKY A;  4KHZ F;  3VU7 H;  2WP9 A;  1WYC A;  3PUY F;  4DV5 T;  2QVA A;  3RIF A;  4DR1 T;  3BK9 A;  3RC8 A;  3AE8 A;  4C90 A;  4UXN B;  4ILB A;  5EK3 A;  2KT9 A;  2XZE A;  2Z6E A;  4TV9 E;  4TWH A;  3B5M A;  2Y48 B;  4HTE A;  4B3M T;  3AE9 A;  2C0S A;  4DR2 T;  5FY7 A;  3KV5 A;  2N1G A;  4B6X A;  3ESL A;  2YIN A;  3JAE A;  1HNZ T;  2NW9 A;  2JRK A;  3LDQ B;  5L4E A;  2WDV A;  1V9D A;  4DR7 T;  3RYH E;  3KVA A;  2NW8 A;  5JR9 A;  3PUG A;  3OYZ A;  3RX6 A;  3W15 B;  1AJ3 A;  2RP4 A;  4L9I A;  4LF4 T;  4IE6 A;  1IAP A;  5BMV E;  4DUY T;  1B7T A;  4PJN A;  3GA8 A;  2QGS A;  4BAY B;  2V7I A;  1BR1 A;  2PTF A;  2C5I T;  4G63 A;  5TAO A;  4U7I A;  3ONJ A;  1NEK A;  3P50 A;  1WRD A;  3X1D A;  2B76 A;  4X1K E;  2LSI A;  3C4Z A;  1KNP A;  4YSX A;  4HKA A;  4CXY A;  2CA5 A;  2V7L A;  2ZLY A;  2KXP B;  1ZV4 X;  1D0Z A;  4M1P A;  4LF6 T;  2KND A;  1QLB A;  3AA7 B;  2HPL A;  3ZMU B;  5L3B B;  2WDR A;  2PFV A;  1T8B A;  3UU6 A;  5AQL B;  3WAK A;  2WMN A;  1T7S A;  4ZZB A;  1O3X A;  1HFA A;  3HKE E;  2MAW A;  4P0A A;  2D5U A;  2XQ5 A;  2WQY A;  3RPU A;  5LJN A;  2BS4 A;  5HEJ A;  2H7O A;  4AIS A;  1T72 A;  1LVF A;  2CM0 A;  2RPA A;  4UR9 A;  2H88 A;  1WLX A;  2X0L B;  2IAK A;  4YTN A;  3S4U A;  2KSR A;  4ILA A;  4DMV A;  1D1C A;  2BBJ A;  4QXB B;  3AVS A;  3AE3 A;  3P4Q A;  2C5J A;  3N2K E;  4X62 T;  3ZYK A;  5HXR A;  5CA1 E;  3KDS E;  4I50 E;  4TWD A;  4IL9 A;  3ZMT B;  2AE9 A;  4O4I E;  2XM2 A;  4MFR A;  2JQQ A;  2YN6 A;  1HCI A;  5FY0 A;  2ACX A;  4DVD A;  2LLY A;  1XZY A;  4DV2 T;  3ZC1 A;  4FI5 A;  1N33 T;  2IW5 B;  1KNZ A;  2LSK A;  2VB6 A;  2CE7 A;  1E7P A;  3F31 A;  3N9O A;  3P4R A;  4LF8 T;  2HH7 A;  1W9R A;  3A5X A;  4WBN E;  3FXD B;  2CBJ A;  3PE0 A;  4EOZ B;  5LGU B;  3N9L A;  5ABH A;  1DU2 A;  3PUQ A;  2WU5 A;  2CEA A;  4H63 H;  3C98 B;  2WSS V;  2WAU A;  2E5L T;  2WZH A;  3U3I A;  4HN9 A;  4BJN A;  2UXX B;  2JQH A;  3RQU A;  3PU8 A;  2VKH A;  2J4G A;  4PNI A;  4COF A;  5ETW A;  4TX5 A;  4I55 E;  2WZI A;  1ZHC A;  2DNX A;  3RLF F;  4PJM A;  2W4X A;  3AEE A;  2XQ4 A;  2XSA A;  3AA0 B;  4IRE A;  5DQV A;  2XAQ B;  5FY1 A;  4EED A;  4G2A A;  3AE4 A;  2BG9 C;  5HEU A;  4EB6 E;  5FXX A;  1D1A A;  1UX4 A;  4TUY E;  4V1A v;  3Q5W A;  3AED A;  3CQG B;  5C2T A;  5AQH B;  1ZKE A;  3VRB A;  4DBQ A;  2HN2 A;  3RIU C;  4QKN A;  4DR6 T;  3IEE A;  5HCM A;  4HEA A;  2B1E A;  1MND A;  5LHI B;  2X51 A;  3N5L A;  1LKX A;  4HGA A;  5AQK B;  2XAJ B;  2BBH A;  3O1J A;  3J9X 1;  2HPJ A;  1NEN A;  5J2U E;  4ZI3 D;  2ZM0 A;  5JDM A;  3HI2 A;  3SOL A;  3AAE B;  3NWI A;  3N9M A;  1IBK T;  3MXZ A;  5AQI B;  1M62 A;  1WFD A;  2Q9Q B;  2WU2 A;  5AQR B;  2DWK A;  3LG7 A;  2CHO A;  1R8I A;  5LMU T;  2XQ6 A;  5AQN B;  1BR0 A;  3RIU A;  5HYA A;  1FIO A;  3UU5 A;  2CXD A;  4HFE A;  2BVM A;  2K3W A;  2BS2 A;  2IML A;  4IE5 A;  2V5D A;  4O2B E;  2XAG B;  4KUM B;  4YSZ A;  4LF7 T;  3VR9 A;  3UQ4 A;  3KFW X;  3Q2M A;  5LP6 E;  3K3N A;  2JPF A;  4P0B A;  4H63 V;  2E9X C;  4OYK A;  3DJB A;  2LSJ A;  4CI2 B;  2W62 A;  3L09 A;  4X66 T;  2BG9 E;  2D0T A;  2DWG A;  4IE4 A;  2VVS A;  4AQY T;  5ADX L;  2H7V C;  3IHR A;  3CKD A;  4YSY A;  2XHE B;  3AAI A;  4I4T E;  2W2U A;  2ZM6 T;  3FZM B;  1NWM X;  4A98 A;  2OV9 A;  2CWY A;  5J2T E;  4K0U A;  3H3M A;  1HG5 A;  4A5X A;  3DTO A;  2QRX A;  3TLT A;  1ZEE A;  3LK2 B;  4UVA B;  3WI3 A;  3UU3 A;  2DHR A;  2VKJ A;  5IYZ E;  4I43 B;  5LG4 A;  5AQM B;  4BJM A;  4U3C A;  2NTX A;  3FBL A;  2UU9 T;  2WDQ A;  2E9X A;  2ZM2 A;  3CK6 A;  5FP3 A;  5JDF A;  5EK2 A;  2C5K T;  4NXM T;  5FVK A;  5F3J A;  1UUS A;  3CX8 B;  2XQA A;  3RYC E;  2NWB A;  2CMR A;  4MAL A;  5F8P A;  4JI5 T;  4JI1 T;  2XQ3 A;  2LEH A;  3FZL B;  3QB5 K;  3UU4 A;  3OBV E;  4Z8X A;  3O9X A;  1KFY A;  2I59 A;  1N34 T;  4X1I E;  4ZI7 E;  5LMN T;  5FNV E;  2LM2 A;  2L9Q A;  3AE5 A;  2JJ9 A;  4PK5 A;  4HFB A;  4JLE A;  3VHL A;  4JI6 T;  2JIW A;  1HTJ F;  2D9D A;  3ZN1 B;  1WCR A;  3AA6 B;  2XPK A;  4EGW A;  1NAF A;  4O2A E;  5LBQ B;  2DL1 A;  1HR0 T;  2LSG A;  2NTY A;  2LKG A;  2ZM8 A;  3HL6 A;  2D2S A;  3QUJ A;  1N36 T;  1OED C;  4QXH B;  4UEL A;  4CQI A;  3L8R A;  4EZH A;  2V6X A;  2UXC T;  3PU3 A;  2DLR A;  4EIW A;  3UT5 E;  5L3C B;  1CHU A;  4UVB B;  4TN7 B;  4HFH A;  3IA3 A;  4MHC A;  3AEF A;  4X64 T;  4WW0 A;  1XDO A;  3O4X E;  2YDS A;  2FJA A;  3ONX A;  3PUW F;  4ASK A;  3AE1 A;  1I94 T;  4ZI2 D;  3I0O A;  3ETV A;  4QH1 A;  5A1L A;  3KV9 A;  2JQ9 A;  3UUX B;  3VKG A;  2VVN A;  2ODU A;  4PFP A;  3LSV A;  1OED A;  4EYY R;  3C4W A;  4IE7 A;  3P7I A;  2CHN A;  1J5W A;  3CQC B;  5AQS B;  2R6G F;  2K9A A;  4DV6 T;  2K5B B;  5HXC A;  4J2C A;  4PK4 A;  1BR2 A;  3QNU A;  5CJ5 A;  4HWC A;  4ZXL A;  5LBM A;  2WY2 A;  2VAS A;  5F5W A;  5JTG A;  4C91 A;  2XQY A;  5HCJ A;  3UU8 A;  5FXW A;  4ERR A;  5LCY A;  3HA4 A;  1D0X A;  3Q5E A;  4HFV A;  4HWH A;  3JC6 D;  3VR8 A;  1MMG A;  1YKH B;  3EHZ A;  1UGO A;  5AQO B;  4JI2 T;  3HKD E;  5DAB A;  1BR4 A;  3C4X A;  1OED E;  2EHO D;  3WAJ A;  3A8Y C;  2WS3 A;  3ZT5 A;  4MLK A;  2ES0 A;  3ETU A;  5IUX A;  5L3E B;  1YW0 A;  2Q9Q D;  1UCU A;  1YD8 G;  3PDY A;  3Q9D A;  4DR3 T;  3CPZ A;  4CI3 B;  2J47 A;  2X67 A;  3GMI A;  2BG9 B;  2BVL A;  4ZS2 A;  5EZY E;  1GQE A;  2YU1 A;  3AEA A;  3SRZ A;  3UFE A;  2KMF A;  2LKH A;  2QA7 A;  5L47 A;  4HE8 A;  2VKO A;  1IBL T;  5JRC B;  1YQ3 A;  1HG2 A;  5LOV E;  5L3G B;  4U74 A;  4IIJ E;  4YY3 T;  3ZCI A;  1US7 B;  3ZYL A;  2JMK A;  2YKS A;  2X66 A;  3HR0 A;  2LHR A;  4IDZ A;  4WZX A;  2OLT A;  4JEU B;  5JDL A;  2E2A A;  2LHN A;  2WWV A;  4DR5 T;  3GWH A;  3MAC A;  3AE2 A;  4UV9 B;  3EDU A;  4IDO A;  1UUR A;  3LBX A;  1ZP0 A;  1N32 T;  4O4H E;  4Q25 A;  1FMW A;  1FMV A;  2A9U A;  1U5P A;  1MIV A;  1MIW A;  5EK4 A;  3KBU A;  4IL4 A;  4YHH T;  3PUV F;  4ZS3 A;  4QX8 B;  3QOF A;  4AKL A;  3JAD A;  4K0K T;  3C50 A;  1JNR A;  4CXX A;  4HWI B;  4KP3 C;  1S35 A;  2CPT A;  4DR4 T;  4PFO A;  4ZZC A;  4DUZ T;  2WWU A;  3RKO A;  5HWX A;  3ZST A;  4YJ2 E;  2WMO A;  2WBL A;  2CWO A;  3HKC E;  2E9X B;  3R84 B;  2J62 A;  3B57 A;  3V5U A;  5HAX A;  4YLH A;  2L8K A;  5HEG A;  4DV3 T;  3RRW A;  4O8S A;  3GN5 B;  4HFD A;  1MMD A;  4F8H A;  4OHF A;  2IDO B;  4YHJ A;  5JVD E;  4JI7 T;  3FHN A;  5LG3 A;  1FJG T;  1HS7 A;  3ZYM A;  2KLQ A;  4LFB T;  2UXD T;  3PUA A;  2GK9 A;  2IHR 1;  2BG9 A;  4JEH B;  3VRA A;  2XM1 A;  2YDQ A;  2DCF A;  4QHO A;  5CGM A;  4JYA T;  4OYJ A;  4NXN T;  1W0B A;  5JRC A;  2UXB T;  2PJQ A;  4AKI A;  1QSD A;  1WYB A;  2AXD S;  2UUA T;  4DV1 T;  3UTK A;  3ZPO A;  3RI5 A;  3PUR A;  2DI4 A;  3EDV A;  4ZOL E;  3EUH A;  2YOE A;  3AE6 A;  2X68 A;  2XJ7 A;  3KBT A;  2ACZ A;  4EV6 A;  2J1D G;  4H9N C;  5ABG A;  2UUC T;  3OKQ A;  3ZJ2 A;  5IWA T;  3N2G E;  5AQV B;  3ZEF B;  1W0A A;  1J5E T;  1E2A A;  4OFZ A;  4QX7 B;  4X20 E;  1VOM A;  3PTR B;  3ZMS B;  4I0U A;  3K8P C;  3FZF B;  3ANW B;  2KWI B;  3TLU A;  4DND A;  3O1H A;  4E7S A;  4HFC A;  4U2Z A;  3ZMV B;  3RF1 A;  5AQJ B;  4LFC T;  3MZK B;  2YDR A;  3OJA A;  3AAA B;  3FZK B;  3KV6 A;  4IHJ E;  4UVC B;  3PJA A;  2K48 A;  5LB7 B;  1KK7 A;  2LSY A;  1G8X A;  2PBI A;  3RC3 A;  1YKE B;  5JDQ A;  3CQX C;  4BA9 A;  4IGU A;  5DQW A;  2WCA A;  1OED B;  3UUM A;  3GN5 A;  3NVO A;  2Y8D A;  3CML A;  2P9B A;  5CA0 E;  2YU2 A;  2N9D A;  4E7Z A;  3ZCJ A;  1IJ6 A;  5HXE A;  3ZC0 A;  3N9Q A;  1E1H B;  4TNV A;  2CRB A;  5L2L A;  4AQG A;  4DID B;  2IC6 A;  3FB2 A;  2UUB T;  1X79 A;  3T1H T;  3AXJ B;  2VQE T;  4DV4 T;  4UV8 B;  3E22 E;  4DO0 A;  4U2Y A;  3SS1 A;  4OX9 T;  3F57 A;  5J0Z A;  4QH5 A;  3G06 A;  3SFD A;  5CB4 E;  4WBO A;  3EVY A;  1W09 A;  2W00 A;  2FBW A;  3ZSS A;  4GKJ T;  2MYS A;  2X0Y A;  2FJD A;  1SE7 A;  2X9X A;  5ABE A;  2V6Y A;  4YTM A;  5KMG P;  2V8S V;  1HX1 B;  4O4L E;  4LFA T;  2H89 A;  1QUU A;  1Y64 B;  3C64 A;  3KIN B;  4B3T T;  3RRC A;  4N78 D;  3PV0 F;  3MK7 C;  4JI4 T;  3AE7 A;  3UFG A;  1CUN A;  2MPK A;  2YK0 A;  4WNK A;  2KIN B;  5JRE A;  3EAB A;  4ADZ A;  3AEG A;  3EAM A;  5AQG B;  4U7Y A;  3RKG A;  1WR0 A;  4ILC A;  4OK0 A;  1VCS A;  2CBI A;  4GK0 E;  3ANW A;  2E8I A;  4NUU A;  4KHP T;  3OPC A;  1MMN A;  4EEB A;  1FEW A;  4U31 A;  2N2N A;  4MBQ A;  1SUM B;  5KX5 E;  3TLS A;  2M67 A;  3H3A A;  4Z91 A;  3B13 A;  1XNR T;  3TLV A;  3BQK A;  2LRL A;  4AIU A;  2XY8 B;  2G0U A;  3TLW A;  3R6N A;  4AXP A;  1OWA A;  4O4J E;  3E08 A;  4ZI3 C;  4Z90 A;  4U33 A;  3RH3 A;  2VUR A;  3LBX B;  4DMW A;  4ZHQ E;  4L0R A;  2OA5 A;  4AKH A;  1KF6 A;  3RGL A;  2I0M A;  3T1Y T;  3OTO T;  1HNW T;  3M65 A;  4IDQ A;  4KMC A;  4CN4 A;  2V7M A;  2BKN A;  4IST A;  2VWA A;  4YTP A;  3PJA J;  4QXC B;  4JBW F;  4LMK A;  3A7M A;  3AXJ A;  3KVB A;  2E9X D;  5AQF B;  2BKO A;  4ANJ A;  4AKR B;  3N9P A;  4NPP A;  2ODV A;  4XAX B;  3NRX A;  5FXV A;  2K24 A;  1HX8 A;  4YXD A;  4FJO A;  2V1D B;  2CXF A;  3HKB E;  4KBM B;  2W63 A;  3CX7 B;  3NZP A;  4QH4 A;  4YFS A;  3D0T A;  2IUB A;  5LA6 E;  3OYX A;  2CCQ A;  3O1I A;  5FYM A;  3NZQ A;  1XDP A;  3H37 A;  2XSB A;  5AQQ B;  5KXJ A;  3T8O A;  3ZKR A;  1EZ3 A;  4GKK T;  4GK5 E;  4QWN B;  5L4H A;  5H6Q B;  4H9Q C;  4UF0 A;  5C3J A;  2W67 A;  2QYW A;  3ONL C;  2XQ9 A;  3UQ7 A;  2X9Y A;  4HWF A;  2LM9 A;  4PK6 A;  4LF9 T;  5AQT B;  1D1B A;  1VCT A;  4H9P C;  4KX6 A;  3QC9 A;  3TKL B;  3AA1 B;  1Z8U A;  5JH7 E;  4X65 T;  3E0Z A;  3JAF A;  4IDP A;  2JQK A;  5JDG A;  3F2E A;  2LJL A;  4HFI A;  3UUN A;  5C8Y E;  2NR4 A;  4PW8 A;  5HWY A;  2WB5 A;  2HHH T;  3FXE B;  5LYJ E;  4IT4 A;  2UXN B;  1XMO T;  2XQ7 A;  4F6R C;  3FZH B;  5DJQ C;  4AQF C;  3ZLI A;  4EYU A;  5HXS A;  4CI1 B;  2JMH A;  2VQF T;  4LF5 T;  2MOZ A;  3SFE A;  5FL1 A;  2YEV C;  3K3Q C;  2L3L A;  3KV4 A;  3Q5D A;  5GON E;  1M7K A;  4P09 A;  2IC9 A;  2V26 A;  1HNX T;  5LGN B;  4IDN A;  3ZMZ B;  4JV5 T;  5FVL A;  4ZEY A;  1JNZ A;  3NBX X;  4UEM A;  2FJE A;  5LHG B;  4GYS A;  4JI8 T;  3UUL A;  2I6H A;  1LRZ A;  2NW7 A;  5ABF B;  1S94 A;  3QK6 A;  2RA1 A;  3LK3 B;  5LXT E;  4A56 A;  5AQU B;  3RHW A;  2BKP A;  2W61 A;  3AEC A;  1OXZ A;  3IBP A;  2A3D A;  2D0U A;  3QB5 A;  5KDM C;  4AQF A;  2VL8 A;  4IE0 A;  3ABV A;  3L39 A;  2ZMA A;  2W0G A;  4JI0 T;  4YT0 A;  1X9B A;  3J7Y q;  1IJ5 A;  5AFU L;  4JI3 T;  3V5S A;  3K3O A;  1I6Z A;  4LMJ A;  3I9W A;  3PUX F;  5CFB A;  3LJC A;  3LK4 2;  3LFM A;  5L3F B;  4AI6 A;  4NUV A;  4CN6 A;  3I0Q A;  2EHO B;  3IF8 B;  4XZC A;  2VL0 A;  3PUS A;  2M6B A;  4AKG A;  4ZI2 C;  2VKD A;  2NOX A;  4CN1 A;  4GYR A;  1IZN B;  4X1Y E;  5LNK A;  5IHY A;  4B3R T;  2CLY B;  1IBM T;  2V6Y B;  4UIG A;  4GIW A;  5LGT B;  3U78 A;  1D0Y A;  3L3P A;  2A72 A;  2XUE A;  1H7C A;  3JCF A;  3VKH A;  2LT3 A;  4ILU A;  5LJM A;  4H9R C;  3P4W A;  2WM9 A;  1YQ4 A;  4L5G A;  3M3Z B;  4HWD A;  4EXT A;  2MBG A;  5FXZ A;  4TV8 E;  1WR6 A;  2LOS A;  2LRK A;  4TWF A;  1Y01 A;  1U4Q A;  5HXH A;  1XMQ T;  4LML A;  2LOP A;  5J1G A;  4PJL A;  4ISS A;  3P4S A;  2FUP A;  4DV0 T;  3N9N A;  1VRB A;  2F4V T;  3CIR A;  2W66 A;  5H6R B;  3RQW A;  3SWH A;  3I1A A;  2XQ8 A;  4PAG A;  2XAS B;  3CVR A;  5BR8 T;  4XBF B;  3RYF E;  3EI0 A;  3AB3 B;  4EZ4 A;  4YJ3 E;  3JC6 C;  3RIA A;  3CX6 B;  1G73 A;  2XAF B;  3BQI A;  2KZ7 B;  1MNE A;  1KEY A;  3MA9 A;  2PG8 A;  2EHO C;  5ABF A;  3C51 A;  5L3D B;  3AVR A;  4JUY A;  4EAH A;  4H9O C;  3P4P A;  4KI0 F;  2BZB A;  4B3S T;  2X9H A;  2Q9Q C;  4NIQ A;  3I9Y A;  2CXL A;  4U72 A;  4WYV A;  2XAH B;  5AQP B;  2CLY C;  1KNR A;  5E0O A;  4H9S E;  1YXR A;  5JR9 B;  2KWH A;  2MTQ A;  5HEO A; 
#chains in the Genus database with same CATH homology
 1VCS A;  3ONL C;  3ONJ A;  2V8S V;  2QYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...