2V8SV

Vti1b habc domain - epsinr enth domain complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
93
structure length
93
Chain Sequence
ASSAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN INTERACTOR 1
publication title A Snare-Adaptor Interaction is a New Mode of Cargo Recognition in Clathrin Coated Vesicles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 38
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2v8sV00
3ONLC 2V8SV 3ONJA 1VCSA 2QYWA
chains in the Genus database with same CATH superfamily
2V5DA 1GQEA 1BR0A 5JDGA 3IBPA 2LJLA 3AEGA 4YJ3E 3ZPOA 4OYKA 2XY8B 4ILBA 2QVAA 4IT4A 4DIDB 5AQHB 4GK5E 2YU2A 3ZMZB 3CX7B 1KK7A 4I50E 3ETUA 4PK6A 4ZI3C 2XQ4A 3HI2A 2CHNA 2E9XB 2IMLA 4F6RC 4JI2T 1LVFA 3AECA 3WI3A 5FY7A 3ZCJA 4JI3T 4KMCA 4MBQA 3F57A 1IAPA 3KVBA 2Q9QC 4C90A 4DVDA 2LSYA 2NW9A 3NWIA 4DR4T 2KLQA 4GYSA 3QOFA 2K9AA 2L3LA 2DCFA 2ODUA 5TAOA 3RQWA 2W0GA 3RKOA 3PV0F 2QRXA 4TV9E 3CX6B 4KBMB 1XWMA 5FYMA 2A2FX 3VRBA 5CGMA 3Q5EA 4YHHT 3RKGA 4ANJA 2VKDA 4BA9A 3N2GE 3S4UA 1G73A 5DQVA 1J1JA 4L0RA 1WCRA 5FXZA 4WBNE 5LMNT 3I0OA 1LKXA 2V8SV 2D5UA 4O2BE 1UX5A 4QXHB 3TLTA 4O4IE 4CN1A 4LMLA 4PAGA 4EAHA 3UU8A 4UEMA 4J2CA 2JRKA 1HF8A 3ONJA 4UIGA 3ZYLA 3K1SA 3AVSA 2UXXB 3RC8A 1XZYA 2DWGA 5AQNB 5FVKA 4A56A 5JDHA 2NTYA 2BBHA 2CCQA 5FP3A 5AQMB 2CPTA 4CI3B 1BR4A 3QC9A 5LBMA 2J4GA 2NR4A 4WBOA 4PJNA 5EZYE 2X67A 1OWAA 3UUNA 5AQLB 3AB3B 1M7KA 4CXYA 3ZT6A 4KUMB 4ZEYA 3PUXF 5H6RB 3RF1A 2XSAA 2ODVA 2DL1A 5JDNA 3N9LA 4IE7A 5A1LA 2P9BA 3A7MA 4WNKA 2H7VC 1VCTA 2IHR1 1N32T 5HEJA 4H63H 4AI6A 3L8RA 4HE8A 2Y48B 4HEAA 4FI5A 1WYBA 3F31A 2CMRA 1YKHB 1MNDA 4QWNB 1IJ6A 5LNKA 5CA1E 3C4XA 3ONXA 2V6XA 4JI4T 3QB5A 4DR7T 2XAGB 2VURA 4X66T 3C64A 4B3TT 4MALA 2VQET 5ABFA 3KV6A 5ADXL 4AQFC 4PJJA 4OYJA 3GN5B 4MLKA 4I55E 2WP9A 1ZOYA 3RIFA 5LJNA 5BMVE 2UUAT 1YQ3A 4X5TA 2H89A 1FEWA 4HFBA 1IBLT 4I43B 2WCAA 2X9YA 4PFPA 4ILAA 1D0ZA 1NWMX 2LE8A 2WMNA 2HH7A 2XAFB 2WAUA 4X1YE 2DI4A 2MTQA 4TZ4C 2YOEA 4O2AE 2V7KA 3AE5A 5LHHB 2K5BB 2MAWA 2K48A 2XHEB 3A5XA 5L4HA 3CIRA 2SPCA 3MZKB 3JAFA 2LOPA 1KNRA 3RC3A 3ONLC 3LFMA 2DLRA 2H7OA 4OK0A 3AA6B 3O4XE 5HXRA 5L3FB 3VKGA 4ZZBA 4P1NA 2V1DB 3ZMSB 3FHNA 3ZN1B 4LF5T 2EHOA 4ISTA 1BR1A 5AQJB 3CQGB 2NOXA 2JMKA 2V7IA 3CWZB 4ZI3D 4DV2T 4AKIA 2HPLA 4DUZT 2PFVA 2BG9E 2CXFA 3B57A 3UFGA 2W00A 3HKEE 2X66A 3NBXX 2ZM8A 2HHHT 3WAKA 1X9BA 3FBLA 2CM0A 5J0ZA 2CA5A 2WBLA 4HKAA 3PUAA 3VR9A 2Q9QD 4CXWA 1HCIA 1QSDA 3U3IA 3K3NA 4Z91A 4UELA 3RGLA 2JMHA 1UCUA 2WSSV 2E2AA 3RX6A 1ZKEA 4CI2B 2W61A 2OV9A 2WWUA 3IEEA 1Z0PA 4JBWF 2X0LB 1WYCA 3ANWA 1O3XA 2PG8A 2WY2A 3ETVA 1FJGT 5LGUB 5LGTB 2QA7A 2B1EA 4UXNB 3CQXC 3T8OA 3PUZF 1UK5A 3ZKRA 2XASB 3KV4A 3N2OA 4KP3C 1XMOT 4YTMA 2I59A 5JDFA 4DV6T 1I6ZA 3OYZA 4JYAT 1XMQT 5DQWA 2XJ7A 4V1Av 1OEDA 3ABVA 4NIQA 4LFBT 4X20E 1V9DA 4WYVA 3FB2A 5EK4A 4XZCA 2X0HA 2NWBA 4YSXA 2XQ7A 5IYZE 4UVCB 1T72A 2VL0A 2E9XC 3RYHE 2ZMAA 4YT0A 3VU7H 4IL4A 5ABGA 3RRCA 5CJ5A 4QXCB 2YK0A 3N5LA 3T1HT 2YN6A 4PJLA 3O9XA 4YTPA 1SUMB 4IGUA 4AKGA 5KX5E 2MPKA 1FMWA 4IL9A 5HAXA 5LJMA 3FZLB 2VL8A 4AISA 4CQIA 1U5PA 2LSJA 4TWFA 3K3QC 4IIJE 4LF4T 4NXNT 2UUCT 3RI5A 3I0QA 1HR0T 5AQRB 1UUSA 5ABHA 5AQQB 1MIVA 4H9RC 3P7IA 3AEFA 3FBZA 1HG2A 2BKNA 2VWAA 4EB6E 3VRAA 2V7MA 2X51A 2XQYA 2LSIA 5FXXA 2J62A 3OPCA 3E08A 2W67A 1DU2A 1CUNA 2W63A 2FBWA 3LBXA 4B3MT 3Q5WA 3SFDA 2X9XA 5F5WA 3AE7A 3N9NA 5L3CB 2D0TA 1B7TA 2WDVA 2XAHB 4IREA 4JV5T 4YY3T 4ZS2A 4OFZA 1J5ET 4DBQA 3EHZA 3AXJA 2N2NA 2RA1A 4I0UA 4TN7B 4DBRA 5LOVE 3JADA 4ZS3A 3PUGA 5HXHA 3AEAA 4JI1T 2CXDA 3EI0A 4EOZB 4EZ4A 2Y6XA 1MMGA 2JQ9A 3FXDB 4F8HA 4O4JE 1HX1B 1J5WA 3VR8A 3PU3A 5ABFB 3MACA 2ZM6T 3W15B 1H7CA 3Q5DA 1MIYA 2LHNA 3ZC1A 4P09A 1W0AA 3KDSE 4UV8B 4LF7T 5HEUA 1IZNB 5BR8T 3AAIA 3BQIA 4L5GA 1QUUA 5EK2A 2LM9A 3AE6A 2CE7A 5LMUT 2VQFT 1VRBA 2Z6EA 1JNZA 1NENA 3HA4A 3RHWA 4AKRB 3AVRA 4DR2T 1YXRA 4ILUA 4A5XA 2YU1A 4EYUA 4HGAA 4DUYT 5FY0A 4P0BA 4U72A 2UXBT 2H3RA 3P4QA 3UULA 5DJQC 2V5CA 1BR2A 3ZMUB 2FJAA 4G2AA 1MMNA 1HG5A 3HKBE 3UUBA 4C91A 3KBUA 2HN2A 5JDQA 1HNWT 5ETWA 5CFBA 2A3DA 2EHOB 3NVOA 3T1YT 1WLXA 2BS3A 2DNXA 3GA8A 4IE0A 3OJAA 1YW0A 2HN1A 3RH3A 2W62A 2X9HA 4X65T 4NUUA 4QKNA 5FMNA 4N78D 2VVSA 4X64T 5J1GA 2UUBT 3N9OA 4B3ST 3L39A 4HFHA 2B76A 3EVYA 2LRKA 4BJNA 4UV9B 2BDEA 4Z8XA 3FZHB 4CI1B 2R6GF 3E0ZA 2KWHA 3RIUC 4H9NC 2OLTA 2YDQA 4DMVA 3HKCE 5H6QB 2JIWA 5JR9A 5F3JA 5C2TA 1VCSA 2XPKA 3A8YC 4JI8T 2E5LT 4EXTA 5JQGE 4E7SA 4LF8T 4DNDA 2RPAA 2ACXA 3N9QA 4B6XA 5L3BB 4GIWA 2CWOA 3LJCA 3H37A 2JJ9A 3ANWB 4U3CA 2UU9T 3MXZA 1HNXT 3RIAA 4GK0E 4XBFB 4YHJA 2Y8DA 5CB4E 5FXVA 2JQQA 4PW8A 2E9XD 3EAMA 3P4PA 5FKYA 4QX7B 4IDNA 2LHRA 2XQAA 4Z90A 4DV7T 3P4RA 3ZN0B 2NTXA 3O1JA 2J1DG 1OEDB 2FJEA 3AE3A 2YINA 3WAJA 3CKDA 4GKKT 2V6YB 4HTEA 3NZPA 3ZCIA 2VKJA 4PK5A 4TWDA 4JEUB 3VHLA 5JRCA 4DV3T 4UVAB 1U4QA 4JEHB 5LP6E 3Q9DA 3C4WA 5GONE 4KI0F 2M67A 5HCJA 4DMWA 4NUVA 3UUXB 2Q9QA 3FZMB 2CLYC 2BKOA 4IE4A 3QUJA 1T7SA 3AE1A 4MHCA 4CXXA 2XAQB 4A98A 3AA7B 2N9DA 4EZHA 4IE5A 1ZHCA 3R6NA 2BG9C 4KHPT 3LK2B 1HS7A 3IA3A 2WWVA 2I6HA 2XZEA 3L3PA 2IW5B 4DR6T 2VK9A 1WR6A 3I9WA 3QB5K 4YSYA 3KINB 4WW0A 4LFAT 2IAKA 3TLUA 1YKEB 2DHRA 5HYAA 1UGOA 3P50A 2QGSA 3UQ7A 5JDMA 3AEBA 3DJBA 3JCFA 3V5SA 5J2TE 2LEHA 4NXMT 3G06A 4JI5T 2CXLA 1D0XA 4X1KE 3LBXB 2AXDS 3C50A 3RQUA 3PUSA 1FMVA 4AKHA 2NP9A 3P4WA 5M4YA 2A9UA 2XQ8A 4U74A 4H9PC 4B3RT 3AXJB 5LB7B 4ISSA 2CBIA 2FJBA 3CX8B 1ZEEA 5HWXA 3UUMA 4JI0T 1S94A 2LLYA 4YFSA 3LDQB 3CMLA 1MIWA 2BKPA 2N1GA 3PE0A 2C5KT 2NW8A 3FZFB 2HPJA 4UF0A 1KEYA 2VKHA 2LOSA 2MOZA 4X1IE 1HFAA 4ZI7E 3X1DA 4OHFA 2D2SA 5KDMC 5AFUL 3UTKA 1LRZA 3VKHA 2MBGA 2WQYA 4MFRA 1JNRA 3PUYF 2IDOB 5AQKB 4O4LE 3ZEFB 2L8KA 5HXEA 4XAXB 2KMFA 3AAEB 4LF6T 3Q5XA 3N9MA 3N2KE 4YJ2E 5E0OA 1N36T 1LVKA 2PBIA 4EGWA 5HEOA 3TLWA 5F8PA 3RYIE 3UT5E 4IDPA 3ZSSA 2LRLA 3I9YA 3CPZA 3PTRB 5JH7E 3ZC0A 5HWYA 2BS4A 4KHZF 5L4EA 1R8IA 4CN6A 4AQFA 5LHGB 3BQLA 5HCMA 2YKSA 4LF9T 2BZBA 2BVMA 2C0SA 4QXBB 2WZIA 5C8YE 2IC6A 1X79A 2CHOA 1VOMA 1W09A 3AEEA 1AJ3A 1WRDA 4O4HE 4AQGA 4FJOA 3M3ZB 4YLHA 3LK42 3PJAA 2GK9A 1G8XA 4ZI2C 2H88A 3OYXA 3PUVF 3ZSTA 2C5IT 4EIWA 2ES0A 3AE4A 3UU3A 2XM2A 3I1AA 1FIOA 2QYWA 4EEBA 1WR0A 3U78A 4HFVA 4LFCT 3RYCE 2G0UA 5AQUB 3EUHA 1N33T 3JC6C 3PU8A 4O8SA 2VASA 1EZ3A 4TNWA 4DV5T 4PK4A 2WU2A 3ZT7A 2XQ3A 5J2UE 4ZXLA 5AQTB 2BBJA 5JVDE 5JR9B 3J7Yq 3PUQA 4HFEA 2VVNA 1E7PA 2PTFA 3TKLB 2WDQA 2WZHA 1NAFA 1D1AA 2DWKA 1IBKT 2EHOC 2D9DA 3RYFE 3ZYMA 4QX8B 2BG9A 2CBJA 5LG3A 1Z8UA 2M6IA 5JREA 2LSGA 2I0MA 3MJXA 2WS3A 1US7B 3RLFF 4AQYT 3CK6A 2X0YA 2V7JA 5AQSB 2L9QA 4M1PA 3FXEB 1Y64B 3MK7C 4IDQA 3ZYKA 1HNZT 4TV8E 4A97A 4DV4T 3HL6A 3K3OA 1IBMT 2UXDT 4QHOA 4EEDA 5LGNB 1WFDA 2WU5A 2WDRA 5JRCB 4DR3T 3AE9A 4I4TE 5C3JA 5L3GB 4U7IA 4CZZB 3BK9A 2CEAA 2RP4A 3AE2A 1IJ5A 1KNPA 3PJAJ 2W4XA 2LT3A 4UVBB 5L47A 2Q9QB 3KVAA 3SRZA 3B5MA 4HFDA 4IE6A 4DV1T 3UU6A 4IHJE 1E1HB 3HKDE 1D0YA 1ZP0A 4IDZA 2KINB 3C4ZA 3EDVA 4HWIB 4DV0T 5FY1A 5JTGA 4GYRA 2YEVC 2XUEA 4P0AA 3C98B 3DP7A 1OEDC 5LCYA 3UU4A 1D1CA 3H3AA 1OEDE 2BS2A 2LSKA 2E9XA 1HTJF 2KSRA 5LA6E 4TWHA 1E2AA 3ESLA 3ZMVB 2VB6A 4IDOA 4LMJA 4DO0A 3L09A 2FUPA 3UFEA 2XM1A 2YDSA 3JAEA 4H9OC 3V5UA 3OBVE 2J47A 2VKOA 3AA0B 3IHRA 2IIUA 1T8BA 4U2YA 1W9RA 3TLSA 2K3WA 2KXPB 4UR9A 4ZZCA 2MYSA 2XQ5A 3CVRA 2E8IA 2JPFA 4EV6A 2AE9A 3F2EA 3ZJ1A 3HR0A 3O1HA 3DTOA 3PDYA 3TLVA 5IUXA 4YSZA 4ZHQE 4QH1A 1KFYA 3H3MA 3RPUA 2WMOA 5FXWA 4JLEA 3M65A 2WM9A 3IF8B 4UF0B 5HEGA 1XNQT 3K8PC 3SFEA 1XDOA 2LKHA 3ZMTB 4E7ZA 1XDPA 5FL1A 2E5VA 4HFCA 4EYYR 1MMAA 2FJDA 4COFA 3NRYA 1L0VA 3KBTA 2BVLA 4ILCA 5L2LA 4GOUA 3FZKB 4ZOLE 3OKQA 1W0BA 1M62A 5L3EB 2M6BA 2JQHA 1YQ4A 4PJMA 2UXCT 1N34T 2KWIB 3SOLA 1YD8G 3GMIA 5KXJA 4K0KT 4GKJT 4NPPA 3LG7A 4U7YA 3LK3B 1CHUA 4WZXA 1UURA 4ZI2D 2CRBA 1MNEA 1UX4A 5LXTE 4YXDA 3E22E 4H63V 1ZV4X 3C51A 4YTNA 2PJQA 2ZLYA 5JDLA 3D0TA 4BJMA 4HWFA 1OXZA 5HXCA 3SS1A 3CQCB 4K0UA 4X62T 2KZ7B 4KX6A 2OA5A 2F4VT 3QK6A 3NZQA 4TUYE 2NW7A 5AQFB 4OX9T 1MMDA 3JC6D 3LSVA 5KMGP 3UQ4A 3NRXA 2D0UA 2CWYA 2KT9A 3BQKA 5LBQB 5AQVB 2K24A 1KF6A 4U2ZA 3MA9A 5DABA 4LMKA 3P8CD 4TNVA 2C5JA 4HWHA 4L9IA 5CA0E 4PNIA 5LYJE 5LHIB 3AEDA 2ZM0A 5EK3A 2EHOD 3PUWF 4BAYB 2ACZA 1S35A 4HFIA 1T98A 3GN5A 5FVLA 2YDRA 4CN4A 2XTLA 4HWDA 5AQOB 3EABA 3P4SA 4JI6T 5AQPB 4ERRA 3R84B 3RRWA 5ABEA 2ZM2A 3ZJ2A 4DR5T 2CLYB 4U33A 1SE7A 2XAJB 5HXSA 2W2UA 3ZT5A 4ASKA 2IC9A 3PURA 3OTOT 3OVUA 3AE8A 4TX5A 4AIUA 3J9X1 5IHYA 2WB5A 2X9WA 4G63A 2X68A 3N9PA 2V7LA 2BG9B 2XQ9A 2KNDA 3KFWX 5FL0A 2LKGA 1D1BA 3O1IA 3QNUA 3EDUA 2V6YA 4U31A 4Q25A 5AQGB 1SHZC 2V26A 5FNVE 3B13A 1QLBA 4H9QC 4JUYA 3UU5A 3Q2MA 4QH4A 3KV9A 3MKDA 5AQIB 4AXPA 3RIUA 5IWAT 3KV5A 1NEKA 2W66A 1XNRT 4PFOA 3ZLIA 2JQKA 3NKZA 1I94T 3AAAB 1KNZA 1Y01A 4QH5A 4HN9A 3AA1B 4AKLA 2LM2A 4JI7T 5JR9C 2A72A 4HWCA 2UXNB 4ADZA 3SWHA 1SA0E 2XQ6A 4DR1T 2IUBA 5HEHA 1HX8A 4H9SE 5L3DB 3GWHA 2XSBA 5LG4A
chains in the Genus database with same CATH topology
3ONLC 2V8SV 3ONJA 1VCSA 2QYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONL C;  2V8S V;  3ONJ A;  1VCS A;  2QYW A; 
#chains in the Genus database with same CATH topology
 2V5D A;  1GQE A;  1BR0 A;  5JDG A;  3IBP A;  2LJL A;  3AEG A;  4YJ3 E;  3ZPO A;  4OYK A;  2XY8 B;  4ILB A;  2QVA A;  4IT4 A;  4DID B;  5AQH B;  4GK5 E;  2YU2 A;  3ZMZ B;  3CX7 B;  1KK7 A;  4I50 E;  3ETU A;  4PK6 A;  4ZI3 C;  2XQ4 A;  3HI2 A;  2CHN A;  2E9X B;  2IML A;  4F6R C;  4JI2 T;  1LVF A;  3AEC A;  3WI3 A;  5FY7 A;  3ZCJ A;  4JI3 T;  4KMC A;  4MBQ A;  3F57 A;  1IAP A;  3KVB A;  2Q9Q C;  4C90 A;  4DVD A;  2LSY A;  2NW9 A;  3NWI A;  4DR4 T;  2KLQ A;  4GYS A;  3QOF A;  2K9A A;  2L3L A;  2DCF A;  2ODU A;  5TAO A;  3RQW A;  2W0G A;  3RKO A;  3PV0 F;  2QRX A;  4TV9 E;  3CX6 B;  4KBM B;  1XWM A;  5FYM A;  2A2F X;  3VRB A;  5CGM A;  3Q5E A;  4YHH T;  3RKG A;  4ANJ A;  2VKD A;  4BA9 A;  3N2G E;  3S4U A;  1G73 A;  5DQV A;  1J1J A;  4L0R A;  1WCR A;  5FXZ A;  4WBN E;  5LMN T;  3I0O A;  1LKX A;  2V8S V;  2D5U A;  4O2B E;  1UX5 A;  4QXH B;  3TLT A;  4O4I E;  4CN1 A;  4LML A;  4PAG A;  4EAH A;  3UU8 A;  4UEM A;  4J2C A;  2JRK A;  1HF8 A;  3ONJ A;  4UIG A;  3ZYL A;  3K1S A;  3AVS A;  2UXX B;  3RC8 A;  1XZY A;  2DWG A;  5AQN B;  5FVK A;  4A56 A;  5JDH A;  2NTY A;  2BBH A;  2CCQ A;  5FP3 A;  5AQM B;  2CPT A;  4CI3 B;  1BR4 A;  3QC9 A;  5LBM A;  2J4G A;  2NR4 A;  4WBO A;  4PJN A;  5EZY E;  2X67 A;  1OWA A;  3UUN A;  5AQL B;  3AB3 B;  1M7K A;  4CXY A;  3ZT6 A;  4KUM B;  4ZEY A;  3PUX F;  5H6R B;  3RF1 A;  2XSA A;  2ODV A;  2DL1 A;  5JDN A;  3N9L A;  4IE7 A;  5A1L A;  2P9B A;  3A7M A;  4WNK A;  2H7V C;  1VCT A;  2IHR 1;  1N32 T;  5HEJ A;  4H63 H;  4AI6 A;  3L8R A;  4HE8 A;  2Y48 B;  4HEA A;  4FI5 A;  1WYB A;  3F31 A;  2CMR A;  1YKH B;  1MND A;  4QWN B;  1IJ6 A;  5LNK A;  5CA1 E;  3C4X A;  3ONX A;  2V6X A;  4JI4 T;  3QB5 A;  4DR7 T;  2XAG B;  2VUR A;  4X66 T;  3C64 A;  4B3T T;  4MAL A;  2VQE T;  5ABF A;  3KV6 A;  5ADX L;  4AQF C;  4PJJ A;  4OYJ A;  3GN5 B;  4MLK A;  4I55 E;  2WP9 A;  1ZOY A;  3RIF A;  5LJN A;  5BMV E;  2UUA T;  1YQ3 A;  4X5T A;  2H89 A;  1FEW A;  4HFB A;  1IBL T;  4I43 B;  2WCA A;  2X9Y A;  4PFP A;  4ILA A;  1D0Z A;  1NWM X;  2LE8 A;  2WMN A;  2HH7 A;  2XAF B;  2WAU A;  4X1Y E;  2DI4 A;  2MTQ A;  4TZ4 C;  2YOE A;  4O2A E;  2V7K A;  3AE5 A;  5LHH B;  2K5B B;  2MAW A;  2K48 A;  2XHE B;  3A5X A;  5L4H A;  3CIR A;  2SPC A;  3MZK B;  3JAF A;  2LOP A;  1KNR A;  3RC3 A;  3ONL C;  3LFM A;  2DLR A;  2H7O A;  4OK0 A;  3AA6 B;  3O4X E;  5HXR A;  5L3F B;  3VKG A;  4ZZB A;  4P1N A;  2V1D B;  3ZMS B;  3FHN A;  3ZN1 B;  4LF5 T;  2EHO A;  4IST A;  1BR1 A;  5AQJ B;  3CQG B;  2NOX A;  2JMK A;  2V7I A;  3CWZ B;  4ZI3 D;  4DV2 T;  4AKI A;  2HPL A;  4DUZ T;  2PFV A;  2BG9 E;  2CXF A;  3B57 A;  3UFG A;  2W00 A;  3HKE E;  2X66 A;  3NBX X;  2ZM8 A;  2HHH T;  3WAK A;  1X9B A;  3FBL A;  2CM0 A;  5J0Z A;  2CA5 A;  2WBL A;  4HKA A;  3PUA A;  3VR9 A;  2Q9Q D;  4CXW A;  1HCI A;  1QSD A;  3U3I A;  3K3N A;  4Z91 A;  4UEL A;  3RGL A;  2JMH A;  1UCU A;  2WSS V;  2E2A A;  3RX6 A;  1ZKE A;  4CI2 B;  2W61 A;  2OV9 A;  2WWU A;  3IEE A;  1Z0P A;  4JBW F;  2X0L B;  1WYC A;  3ANW A;  1O3X A;  2PG8 A;  2WY2 A;  3ETV A;  1FJG T;  5LGU B;  5LGT B;  2QA7 A;  2B1E A;  4UXN B;  3CQX C;  3T8O A;  3PUZ F;  1UK5 A;  3ZKR A;  2XAS B;  3KV4 A;  3N2O A;  4KP3 C;  1XMO T;  4YTM A;  2I59 A;  5JDF A;  4DV6 T;  1I6Z A;  3OYZ A;  4JYA T;  1XMQ T;  5DQW A;  2XJ7 A;  4V1A v;  1OED A;  3ABV A;  4NIQ A;  4LFB T;  4X20 E;  1V9D A;  4WYV A;  3FB2 A;  5EK4 A;  4XZC A;  2X0H A;  2NWB A;  4YSX A;  2XQ7 A;  5IYZ E;  4UVC B;  1T72 A;  2VL0 A;  2E9X C;  3RYH E;  2ZMA A;  4YT0 A;  3VU7 H;  4IL4 A;  5ABG A;  3RRC A;  5CJ5 A;  4QXC B;  2YK0 A;  3N5L A;  3T1H T;  2YN6 A;  4PJL A;  3O9X A;  4YTP A;  1SUM B;  4IGU A;  4AKG A;  5KX5 E;  2MPK A;  1FMW A;  4IL9 A;  5HAX A;  5LJM A;  3FZL B;  2VL8 A;  4AIS A;  4CQI A;  1U5P A;  2LSJ A;  4TWF A;  3K3Q C;  4IIJ E;  4LF4 T;  4NXN T;  2UUC T;  3RI5 A;  3I0Q A;  1HR0 T;  5AQR B;  1UUS A;  5ABH A;  5AQQ B;  1MIV A;  4H9R C;  3P7I A;  3AEF A;  3FBZ A;  1HG2 A;  2BKN A;  2VWA A;  4EB6 E;  3VRA A;  2V7M A;  2X51 A;  2XQY A;  2LSI A;  5FXX A;  2J62 A;  3OPC A;  3E08 A;  2W67 A;  1DU2 A;  1CUN A;  2W63 A;  2FBW A;  3LBX A;  4B3M T;  3Q5W A;  3SFD A;  2X9X A;  5F5W A;  3AE7 A;  3N9N A;  5L3C B;  2D0T A;  1B7T A;  2WDV A;  2XAH B;  4IRE A;  4JV5 T;  4YY3 T;  4ZS2 A;  4OFZ A;  1J5E T;  4DBQ A;  3EHZ A;  3AXJ A;  2N2N A;  2RA1 A;  4I0U A;  4TN7 B;  4DBR A;  5LOV E;  3JAD A;  4ZS3 A;  3PUG A;  5HXH A;  3AEA A;  4JI1 T;  2CXD A;  3EI0 A;  4EOZ B;  4EZ4 A;  2Y6X A;  1MMG A;  2JQ9 A;  3FXD B;  4F8H A;  4O4J E;  1HX1 B;  1J5W A;  3VR8 A;  3PU3 A;  5ABF B;  3MAC A;  2ZM6 T;  3W15 B;  1H7C A;  3Q5D A;  1MIY A;  2LHN A;  3ZC1 A;  4P09 A;  1W0A A;  3KDS E;  4UV8 B;  4LF7 T;  5HEU A;  1IZN B;  5BR8 T;  3AAI A;  3BQI A;  4L5G A;  1QUU A;  5EK2 A;  2LM9 A;  3AE6 A;  2CE7 A;  5LMU T;  2VQF T;  1VRB A;  2Z6E A;  1JNZ A;  1NEN A;  3HA4 A;  3RHW A;  4AKR B;  3AVR A;  4DR2 T;  1YXR A;  4ILU A;  4A5X A;  2YU1 A;  4EYU A;  4HGA A;  4DUY T;  5FY0 A;  4P0B A;  4U72 A;  2UXB T;  2H3R A;  3P4Q A;  3UUL A;  5DJQ C;  2V5C A;  1BR2 A;  3ZMU B;  2FJA A;  4G2A A;  1MMN A;  1HG5 A;  3HKB E;  3UUB A;  4C91 A;  3KBU A;  2HN2 A;  5JDQ A;  1HNW T;  5ETW A;  5CFB A;  2A3D A;  2EHO B;  3NVO A;  3T1Y T;  1WLX A;  2BS3 A;  2DNX A;  3GA8 A;  4IE0 A;  3OJA A;  1YW0 A;  2HN1 A;  3RH3 A;  2W62 A;  2X9H A;  4X65 T;  4NUU A;  4QKN A;  5FMN A;  4N78 D;  2VVS A;  4X64 T;  5J1G A;  2UUB T;  3N9O A;  4B3S T;  3L39 A;  4HFH A;  2B76 A;  3EVY A;  2LRK A;  4BJN A;  4UV9 B;  2BDE A;  4Z8X A;  3FZH B;  4CI1 B;  2R6G F;  3E0Z A;  2KWH A;  3RIU C;  4H9N C;  2OLT A;  2YDQ A;  4DMV A;  3HKC E;  5H6Q B;  2JIW A;  5JR9 A;  5F3J A;  5C2T A;  1VCS A;  2XPK A;  3A8Y C;  4JI8 T;  2E5L T;  4EXT A;  5JQG E;  4E7S A;  4LF8 T;  4DND A;  2RPA A;  2ACX A;  3N9Q A;  4B6X A;  5L3B B;  4GIW A;  2CWO A;  3LJC A;  3H37 A;  2JJ9 A;  3ANW B;  4U3C A;  2UU9 T;  3MXZ A;  1HNX T;  3RIA A;  4GK0 E;  4XBF B;  4YHJ A;  2Y8D A;  5CB4 E;  5FXV A;  2JQQ A;  4PW8 A;  2E9X D;  3EAM A;  3P4P A;  5FKY A;  4QX7 B;  4IDN A;  2LHR A;  2XQA A;  4Z90 A;  4DV7 T;  3P4R A;  3ZN0 B;  2NTX A;  3O1J A;  2J1D G;  1OED B;  2FJE A;  3AE3 A;  2YIN A;  3WAJ A;  3CKD A;  4GKK T;  2V6Y B;  4HTE A;  3NZP A;  3ZCI A;  2VKJ A;  4PK5 A;  4TWD A;  4JEU B;  3VHL A;  5JRC A;  4DV3 T;  4UVA B;  1U4Q A;  4JEH B;  5LP6 E;  3Q9D A;  3C4W A;  5GON E;  4KI0 F;  2M67 A;  5HCJ A;  4DMW A;  4NUV A;  3UUX B;  2Q9Q A;  3FZM B;  2CLY C;  2BKO A;  4IE4 A;  3QUJ A;  1T7S A;  3AE1 A;  4MHC A;  4CXX A;  2XAQ B;  4A98 A;  3AA7 B;  2N9D A;  4EZH A;  4IE5 A;  1ZHC A;  3R6N A;  2BG9 C;  4KHP T;  3LK2 B;  1HS7 A;  3IA3 A;  2WWV A;  2I6H A;  2XZE A;  3L3P A;  2IW5 B;  4DR6 T;  2VK9 A;  1WR6 A;  3I9W A;  3QB5 K;  4YSY A;  3KIN B;  4WW0 A;  4LFA T;  2IAK A;  3TLU A;  1YKE B;  2DHR A;  5HYA A;  1UGO A;  3P50 A;  2QGS A;  3UQ7 A;  5JDM A;  3AEB A;  3DJB A;  3JCF A;  3V5S A;  5J2T E;  2LEH A;  4NXM T;  3G06 A;  4JI5 T;  2CXL A;  1D0X A;  4X1K E;  3LBX B;  2AXD S;  3C50 A;  3RQU A;  3PUS A;  1FMV A;  4AKH A;  2NP9 A;  3P4W A;  5M4Y A;  2A9U A;  2XQ8 A;  4U74 A;  4H9P C;  4B3R T;  3AXJ B;  5LB7 B;  4ISS A;  2CBI A;  2FJB A;  3CX8 B;  1ZEE A;  5HWX A;  3UUM A;  4JI0 T;  1S94 A;  2LLY A;  4YFS A;  3LDQ B;  3CML A;  1MIW A;  2BKP A;  2N1G A;  3PE0 A;  2C5K T;  2NW8 A;  3FZF B;  2HPJ A;  4UF0 A;  1KEY A;  2VKH A;  2LOS A;  2MOZ A;  4X1I E;  1HFA A;  4ZI7 E;  3X1D A;  4OHF A;  2D2S A;  5KDM C;  5AFU L;  3UTK A;  1LRZ A;  3VKH A;  2MBG A;  2WQY A;  4MFR A;  1JNR A;  3PUY F;  2IDO B;  5AQK B;  4O4L E;  3ZEF B;  2L8K A;  5HXE A;  4XAX B;  2KMF A;  3AAE B;  4LF6 T;  3Q5X A;  3N9M A;  3N2K E;  4YJ2 E;  5E0O A;  1N36 T;  1LVK A;  2PBI A;  4EGW A;  5HEO A;  3TLW A;  5F8P A;  3RYI E;  3UT5 E;  4IDP A;  3ZSS A;  2LRL A;  3I9Y A;  3CPZ A;  3PTR B;  5JH7 E;  3ZC0 A;  5HWY A;  2BS4 A;  4KHZ F;  5L4E A;  1R8I A;  4CN6 A;  4AQF A;  5LHG B;  3BQL A;  5HCM A;  2YKS A;  4LF9 T;  2BZB A;  2BVM A;  2C0S A;  4QXB B;  2WZI A;  5C8Y E;  2IC6 A;  1X79 A;  2CHO A;  1VOM A;  1W09 A;  3AEE A;  1AJ3 A;  1WRD A;  4O4H E;  4AQG A;  4FJO A;  3M3Z B;  4YLH A;  3LK4 2;  3PJA A;  2GK9 A;  1G8X A;  4ZI2 C;  2H88 A;  3OYX A;  3PUV F;  3ZST A;  2C5I T;  4EIW A;  2ES0 A;  3AE4 A;  3UU3 A;  2XM2 A;  3I1A A;  1FIO A;  2QYW A;  4EEB A;  1WR0 A;  3U78 A;  4HFV A;  4LFC T;  3RYC E;  2G0U A;  5AQU B;  3EUH A;  1N33 T;  3JC6 C;  3PU8 A;  4O8S A;  2VAS A;  1EZ3 A;  4TNW A;  4DV5 T;  4PK4 A;  2WU2 A;  3ZT7 A;  2XQ3 A;  5J2U E;  4ZXL A;  5AQT B;  2BBJ A;  5JVD E;  5JR9 B;  3J7Y q;  3PUQ A;  4HFE A;  2VVN A;  1E7P A;  2PTF A;  3TKL B;  2WDQ A;  2WZH A;  1NAF A;  1D1A A;  2DWK A;  1IBK T;  2EHO C;  2D9D A;  3RYF E;  3ZYM A;  4QX8 B;  2BG9 A;  2CBJ A;  5LG3 A;  1Z8U A;  2M6I A;  5JRE A;  2LSG A;  2I0M A;  3MJX A;  2WS3 A;  1US7 B;  3RLF F;  4AQY T;  3CK6 A;  2X0Y A;  2V7J A;  5AQS B;  2L9Q A;  4M1P A;  3FXE B;  1Y64 B;  3MK7 C;  4IDQ A;  3ZYK A;  1HNZ T;  4TV8 E;  4A97 A;  4DV4 T;  3HL6 A;  3K3O A;  1IBM T;  2UXD T;  4QHO A;  4EED A;  5LGN B;  1WFD A;  2WU5 A;  2WDR A;  5JRC B;  4DR3 T;  3AE9 A;  4I4T E;  5C3J A;  5L3G B;  4U7I A;  4CZZ B;  3BK9 A;  2CEA A;  2RP4 A;  3AE2 A;  1IJ5 A;  1KNP A;  3PJA J;  2W4X A;  2LT3 A;  4UVB B;  5L47 A;  2Q9Q B;  3KVA A;  3SRZ A;  3B5M A;  4HFD A;  4IE6 A;  4DV1 T;  3UU6 A;  4IHJ E;  1E1H B;  3HKD E;  1D0Y A;  1ZP0 A;  4IDZ A;  2KIN B;  3C4Z A;  3EDV A;  4HWI B;  4DV0 T;  5FY1 A;  5JTG A;  4GYR A;  2YEV C;  2XUE A;  4P0A A;  3C98 B;  3DP7 A;  1OED C;  5LCY A;  3UU4 A;  1D1C A;  3H3A A;  1OED E;  2BS2 A;  2LSK A;  2E9X A;  1HTJ F;  2KSR A;  5LA6 E;  4TWH A;  1E2A A;  3ESL A;  3ZMV B;  2VB6 A;  4IDO A;  4LMJ A;  4DO0 A;  3L09 A;  2FUP A;  3UFE A;  2XM1 A;  2YDS A;  3JAE A;  4H9O C;  3V5U A;  3OBV E;  2J47 A;  2VKO A;  3AA0 B;  3IHR A;  2IIU A;  1T8B A;  4U2Y A;  1W9R A;  3TLS A;  2K3W A;  2KXP B;  4UR9 A;  4ZZC A;  2MYS A;  2XQ5 A;  3CVR A;  2E8I A;  2JPF A;  4EV6 A;  2AE9 A;  3F2E A;  3ZJ1 A;  3HR0 A;  3O1H A;  3DTO A;  3PDY A;  3TLV A;  5IUX A;  4YSZ A;  4ZHQ E;  4QH1 A;  1KFY A;  3H3M A;  3RPU A;  2WMO A;  5FXW A;  4JLE A;  3M65 A;  2WM9 A;  3IF8 B;  4UF0 B;  5HEG A;  1XNQ T;  3K8P C;  3SFE A;  1XDO A;  2LKH A;  3ZMT B;  4E7Z A;  1XDP A;  5FL1 A;  2E5V A;  4HFC A;  4EYY R;  1MMA A;  2FJD A;  4COF A;  3NRY A;  1L0V A;  3KBT A;  2BVL A;  4ILC A;  5L2L A;  4GOU A;  3FZK B;  4ZOL E;  3OKQ A;  1W0B A;  1M62 A;  5L3E B;  2M6B A;  2JQH A;  1YQ4 A;  4PJM A;  2UXC T;  1N34 T;  2KWI B;  3SOL A;  1YD8 G;  3GMI A;  5KXJ A;  4K0K T;  4GKJ T;  4NPP A;  3LG7 A;  4U7Y A;  3LK3 B;  1CHU A;  4WZX A;  1UUR A;  4ZI2 D;  2CRB A;  1MNE A;  1UX4 A;  5LXT E;  4YXD A;  3E22 E;  4H63 V;  1ZV4 X;  3C51 A;  4YTN A;  2PJQ A;  2ZLY A;  5JDL A;  3D0T A;  4BJM A;  4HWF A;  1OXZ A;  5HXC A;  3SS1 A;  3CQC B;  4K0U A;  4X62 T;  2KZ7 B;  4KX6 A;  2OA5 A;  2F4V T;  3QK6 A;  3NZQ A;  4TUY E;  2NW7 A;  5AQF B;  4OX9 T;  1MMD A;  3JC6 D;  3LSV A;  5KMG P;  3UQ4 A;  3NRX A;  2D0U A;  2CWY A;  2KT9 A;  3BQK A;  5LBQ B;  5AQV B;  2K24 A;  1KF6 A;  4U2Z A;  3MA9 A;  5DAB A;  4LMK A;  3P8C D;  4TNV A;  2C5J A;  4HWH A;  4L9I A;  5CA0 E;  4PNI A;  5LYJ E;  5LHI B;  3AED A;  2ZM0 A;  5EK3 A;  2EHO D;  3PUW F;  4BAY B;  2ACZ A;  1S35 A;  4HFI A;  1T98 A;  3GN5 A;  5FVL A;  2YDR A;  4CN4 A;  2XTL A;  4HWD A;  5AQO B;  3EAB A;  3P4S A;  4JI6 T;  5AQP B;  4ERR A;  3R84 B;  3RRW A;  5ABE A;  2ZM2 A;  3ZJ2 A;  4DR5 T;  2CLY B;  4U33 A;  1SE7 A;  2XAJ B;  5HXS A;  2W2U A;  3ZT5 A;  4ASK A;  2IC9 A;  3PUR A;  3OTO T;  3OVU A;  3AE8 A;  4TX5 A;  4AIU A;  3J9X 1;  5IHY A;  2WB5 A;  2X9W A;  4G63 A;  2X68 A;  3N9P A;  2V7L A;  2BG9 B;  2XQ9 A;  2KND A;  3KFW X;  5FL0 A;  2LKG A;  1D1B A;  3O1I A;  3QNU A;  3EDU A;  2V6Y A;  4U31 A;  4Q25 A;  5AQG B;  1SHZ C;  2V26 A;  5FNV E;  3B13 A;  1QLB A;  4H9Q C;  4JUY A;  3UU5 A;  3Q2M A;  4QH4 A;  3KV9 A;  3MKD A;  5AQI B;  4AXP A;  3RIU A;  5IWA T;  3KV5 A;  1NEK A;  2W66 A;  1XNR T;  4PFO A;  3ZLI A;  2JQK A;  3NKZ A;  1I94 T;  3AAA B;  1KNZ A;  1Y01 A;  4QH5 A;  4HN9 A;  3AA1 B;  4AKL A;  2LM2 A;  4JI7 T;  5JR9 C;  2A72 A;  4HWC A;  2UXN B;  4ADZ A;  3SWH A;  1SA0 E;  2XQ6 A;  4DR1 T;  2IUB A;  5HEH A;  1HX8 A;  4H9S E;  5L3D B;  3GWH A;  2XSB A;  5LG4 A; 
#chains in the Genus database with same CATH homology
 3ONL C;  2V8S V;  3ONJ A;  1VCS A;  2QYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...