2V8SV

Vti1b habc domain - epsinr enth domain complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
93
structure length
93
Chain Sequence
b'ASSAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN INTERACTOR 1
molecule tags Protein transport
source organism Homo sapiens
publication title A Snare-Adaptor Interaction is a New Mode of Cargo Recognition in Clathrin Coated Vesicles
pubmed doi rcsb
total genus 38
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2v8sV00
3ONLC 2QYWA 1VCSA 3ONJA 2V8SV
chains in the Genus database with same CATH superfamily
3OYZA 3IF8B 4EAHA 2PBIA 3OTOT 1GQEA 5LYJE 3WAJA 4DR6T 5LXTE 3VRAA 1HNWT 5H6RB 1OWAA 2XQ6A 3OVUA 2YINA 4CN4A 1MIYA 2MBGA 4DV0T 2E5LT 3LDQB 4B3ST 2W4XA 3Q5XA 3SS1A 4OX9T 1SHZC 2MPKA 2N1GA 2PG8A 1E1HB 3MJXA 2NW9A 4EZ4A 3LK3B 3ZT7A 4TV8E 5JR9C 3HKCE 4HFHA 2UU9T 5AQNB 5AQUB 1H7CA 2LLYA 5JDQA 4GYSA 2BKPA 3P4QA 2JJ9A 2Y48B 3AXJB 3DTOA 3GMIA 5JDFA 4AIUA 3PUQA 1M7KA 5FYMA 3SFEA 3ZCJA 2J1DG 4M1PA 5AQIB 5JRCB 2BVMA 3I0QA 2V8SV 3AEGA 3AEDA 5FY0A 5HXCA 2WWUA 2WU2A 1FMVA 3HKEE 4UVAB 4BJNA 2B1EA 2V7LA 4IE6A 2VQET 1J1JA 2EHOA 3CKDA 5LP6E 4IE5A 4WNKA 2JPFA 1WFDA 2FJDA 2Q9QA 3AVSA 4HEAA 4QKNA 5FY7A 4ZI2D 4QH4A 2MOZA 3EI0A 1XMOT 1SA0E 2DI4A 5M4YA 2XQ7A 2GK9A 2KXPB 2V5DA 4O2BE 2WCAA 3UUMA 4TWDA 2BS3A 2WDQA 5EZYE 1XWMA 4UV8B 4JI2T 5JDNA 2CEAA 4KBMB 3C4XA 5LOVE 2A9UA 2NTXA 4IDPA 3ZPOA 4YJ2E 2DWGA 2R6GF 2KMFA 2E9XB 3F2EA 4IL4A 2X0LB 2N2NA 2NW8A 3FBLA 3MACA 4L9IA 4JI5T 3RRCA 4YSXA 1HG5A 5L47A 2LSYA 2L8KA 4AXPA 5F3JA 2IIUA 3EDVA 4H9SE 3TKLB 4WBOA 1WCRA 3L8RA 3ETUA 5FXWA 5L3EB 3UUNA 3ZYKA 5HXSA 2JQHA 1IBLT 2VB6A 3U78A 4B3MT 4U74A 1E7PA 3P4SA 2KINB 5FXXA 2XTLA 4IREA 5J1GA 2W63A 4GKJT 2IHR1 1UUSA 2J47A 3ESLA 3I9YA 3TLVA 2JIWA 3O1HA 2MYSA 1B7TA 2LKGA 3BQIA 3KV5A 5FXVA 2YU1A 3IHRA 3UUXB 2P9BA 4A97A 1WYBA 2HHHT 4AKGA 4UVCB 4ILBA 2CA5A 2WU5A 3IEEA 3QUJA 3TLUA 2NP9A 4EXTA 1LVKA 2C5JA 4OYKA 2JQ9A 3AAIA 4KI0F 4KX6A 3ZEFB 5LHGB 2WP9A 2YU2A 3N9OA 5ABHA 5HXRA 5LJMA 4BA9A 3LJCA 2WBLA 1T8BA 2WMNA 5HEOA 2AE9A 2NR4A 3C4ZA 3VRBA 4DV6T 3TLWA 2F4VT 3AVRA 2BDEA 2LRKA 4WYVA 4DV7T 4MALA 2H3RA 5HEGA 2Y8DA 5IHYA 1ZEEA 4YXDA 5JVDE 5LNKA 2X0HA 4CXWA 2CWYA 4GIWA 2RA1A 4ZI2C 2YDQA 5LHHB 5ADXL 3I0OA 4XBFB 4TWFA 4ILCA 4DNDA 4PNIA 2VL8A 4PAGA 2CLYB 1O3XA 1V9DA 2RPAA 3ONJA 4H9OC 5AQOB 1MMNA 4KUMB 3AEEA 5AQTB 3UT5E 4HFBA 4FI5A 2OA5A 4IGUA 4YHJA 4JI1T 2Q9QD 5HYAA 3HL6A 1Y64B 1VCSA 5JREA 1T98A 2EHOB 3C64A 3PUAA 3VHLA 4IE0A 4A98A 2QA7A 4AQFA 4CQIA 1KNPA 2CBJA 3CIRA 3EHZA 2WMOA 3AE8A 3GN5A 4JEHB 2E9XA 5FP3A 3QB5A 4O4HE 4OYJA 5TAOA 3KVAA 4OFZA 2H88A 2Z6EA 2CLYC 4ZI3C 4ADZA 2DNXA 2W2UA 3JC6D 3ZJ1A 1NAFA 2XQ4A 3F57A 2XZEA 2YEVC 3GN5B 3AE2A 4U33A 4HWDA 4X1IE 3UFGA 4Z8XA 2X0YA 4DO0A 4DMVA 4EB6E 1YD8G 2W62A 2UXDT 2E2AA 2EHOC 1JNZA 4G2AA 4HWIB 4PJNA 3RIFA 3C50A 3ZMZB 4NUUA 2E5VA 4JI8T 5J0ZA 3SFDA 4QX8B 5DQVA 1CHUA 4K0KT 2JQQA 4GOUA 3ZSTA 4IDZA 2CHOA 2M67A 5L3FB 2I6HA 2BG9B 2VWAA 3FXDB 2PFVA 3AECA 3OPCA 3QB5K 3KVBA 4P09A 5E0OA 4LF6T 3B5MA 4EYYR 1IJ6A 5EK3A 2PTFA 3ETVA 3N9PA 2LOSA 4QWNB 3ZT6A 4I43B 5JDHA 3LBXB 2UUBT 3AE4A 4HFVA 2XQ3A 3RRWA 3N2OA 4HWHA 3VR8A 3HR0A 2XAFB 2D2SA 3AAEB 3AB3B 4JUYA 4UXNB 5L3GB 2QRXA 5CB4E 3KV6A 4EZHA 1FIOA 2BG9C 3F31A 5FNVE 5FL1A 4X65T 3RF1A 4BAYB 3T1HT 4P1NA 2I59A 3W15B 4DVDA 3JCFA 2HPJA 2ZMAA 3AEFA 3KBUA 3Q5DA 1XNQT 5L3BB 4CN6A 2NW7A 2WS3A 3ZYLA 2UUCT 2IW5B 5LG3A 2ZM0A 3S4UA 5L3CB 4KHZF 4IT4A 4NIQA 3Q5EA 3JADA 5DJQC 5LJNA 2KT9A 4IE7A 5DQWA 4ASKA 1E2AA 2KWHA 4AKHA 1D0XA 1XDOA 2DHRA 2UXNB 2LE8A 2W00A 3BK9A 1S35A 4Q25A 1ZOYA 3PURA 3QNUA 2X68A 3JC6C 2XQ5A 3P4RA 3ZCIA 3Q9DA 5LHIB 1KF6A 4DBRA 5EK4A 4X62T 5BR8T 2UUAT 5L4HA 5JR9B 2VKHA 3HKDE 2KWIB 3OBVE 3K3OA 3UQ7A 1T72A 4H9NC 5IWAT 4DR1T 2LSGA 2W67A 3N9QA 2VQFT 3L3PA 5A1LA 3ONXA 2ODUA 2YK0A 4DV5T 2YN6A 3SRZA 2K24A 4O4IE 4LMKA 1VCTA 3KINB 5IYZE 1NWMX 2LJLA 4QHOA 4JEUB 3K3NA 5ETWA 4PFOA 3RKGA 5HWXA 5C3JA 1S94A 1MMGA 1Z0PA 1OXZA 2VK9A 3FZFB 1EZ3A 3N2KE 2IMLA 2V6YA 2N9DA 4I4TE 5AQGB 4TX5A 2YDSA 4ISSA 1AJ3A 3GA8A 3I9WA 2W61A 3D0TA 4IDOA 5H6QB 4EOZB 2JMHA 3DJBA 3H3AA 4U3CA 5BMVE 5JH7E 2Y6XA 4LF4T 3IBPA 5GONE 3RYHE 3UUBA 1G73A 1Y01A 2WDVA 1LVFA 2LSJA 1KEYA 4OHFA 3LK42 4HKAA 2K9AA 4CI1B 4ZI3D 1KFYA 1W09A 2KLQA 4O4LE 2LOPA 4DR3T 3ZC0A 3UQ4A 4ZZBA 4DV1T 2XM2A 5JTGA 3QK6A 3IA3A 2BBJA 3ZJ2A 3N9MA 3AA1B 5F5WA 4X66T 5CGMA 4TWHA 5AQLB 4DV3T 3Q5WA 4UF0A 4X20E 4YSYA 2KZ7B 2BZBA 1HFAA 2D5UA 1WRDA 2Q9QB 2V26A 3EUHA 4YSZA 5CA1E 5HCJA 1DU2A 1J5WA 3N9NA 3N5LA 5LMUT 3UULA 2BKNA 4PK6A 4A56A 3CX6B 2HN1A 4LMJA 4YJ3E 3BQLA 4MHCA 2X9XA 3ABVA 4F8HA 4O8SA 4I50E 4ZXLA 3R6NA 4ZS3A 3NKZA 4ZZCA 3NVOA 3H37A 4DUZT 1W0BA 4LFBT 3R84B 4CI3B 1IAPA 3BQKA 4PK5A 2XSAA 4NUVA 4PJJA 2J62A 2L3LA 3G06A 2D0TA 1HX8A 3K1SA 1SE7A 2IDOB 4JLEA 4TUYE 4UVBB 4YTNA 4TN7B 2WY2A 4AQYT 3UU4A 1R8IA 2IC6A 2NTYA 4X1KE 1D1BA 3UU8A 3A5XA 4ZHQE 2CXLA 4WZXA 2VASA 3A7MA 2MAWA 1FEWA 3NRXA 3NRYA 3ZT5A 4YTMA 5C2TA 1OEDC 1IBMT 2WAUA 2JMKA 2WB5A 2X9HA 2A3DA 2ES0A 2XM1A 2ZM2A 4U7IA 5LA6E 4N78D 3E0ZA 5FKYA 5AQVB 3NZPA 3PU3A 2QYWA 2FBWA 3ZN1B 3VKGA 4EGWA 3JAEA 4NPPA 3L39A 3MK7C 4PJMA 4XAXB 3HI2A 1JNRA 2CE7A 2HH7A 1LKXA 2KNDA 3J9X1 2WWVA 3ZYMA 4YT0A 3CK6A 3MZKB 3JAFA 2BG9A 5LBMA 4COFA 4CZZB 1N33T 3AE6A 4AKIA 1X79A 3RPUA 3MKDA 4EIWA 5L4EA 1HR0T 3EABA 1UK5A 1ZHCA 2CXDA 3ONLC 5C8YE 2CMRA 3P4WA 4JI6T 3CQGB 4BJMA 1D1CA 1N36T 2IAKA 2K5BB 3FBZA 2C5IT 2WZIA 4DR2T 5HAXA 2HN2A 1UGOA 4J2CA 5HXHA 2JQKA 3U3IA 5KMGP 2HPLA 4P0BA 5HXEA 3FHNA 5ABEA 3AE5A 1KNZA 1SUMB 3P50A 4HFCA 2BS4A 3LK2B 3E08A 4NXNT 5LGTB 3CPZA 3CX7B 4DR5T 5ABFB 3UU3A 1UX4A 5HEHA 1D0ZA 2XQAA 2LT3A 2QVAA 5DABA 4HTEA 1KNRA 2KSRA 3V5SA 4CI2B 4KHPT 1US7B 5HWYA 2CRBA 1KK7A 4JI0T 2LEHA 2H7VC 4GYRA 4Z90A 3UTKA 5EK2A 3LFMA 2CXFA 2XAJB 1W9RA 5KX5E 4NXMT 3O1JA 4JI4T 4HN9A 4LF8T 5LBQB 2I0MA 4ERRA 1G8XA 2K3WA 2X66A 2VL0A 4QH1A 5LCYA 5LB7B 1MNDA 2V7MA 2XQ8A 3ZN0B 5LGUB 4LFCT 2E9XD 5AQJB 2A72A 2CPTA 3PUSA 4B3TT 3EDUA 3ANWB 5L3DB 2LRLA 4H9RC 3LG7A 1U4QA 4PW8A 1MIVA 2XASB 5JDMA 1MNEA 1OEDE 4PFPA 1WR0A 1VOMA 3KV4A 1HX1B 2CM0A 4K0UA 3X1DA 2UXCT 1VRBA 5AQSB 3E22E 3CX8B 4G63A 4WBNE 3I1AA 1NEKA 2V7JA 3M3ZB 1WLXA 3QOFA 1D0YA 1XZYA 3K3QC 2VVNA 2XY8B 4IIJE 2K48A 4QH5A 4UELA 3RQUA 3B57A 4HWFA 5CA0E 3B13A 3AEAA 4X64T 1IBKT 4JV5T 2D0UA 2NWBA 3LBXA 2WM9A 2XHEB 2AXDS 3PJAJ 4O2AE 4U2YA 4CXXA 2XQYA 2XJ7A 3AA7B 4HFIA 2VKOA 2XSBA 4PK4A 4TZ4C 3TLTA 4DV4T 1U5PA 3ZMTB 3PE0A 5IUXA 5LGNB 1BR4A 2LM9A 2LSIA 3AE9A 1NENA 4HGAA 1HTJF 4GK5E 3AE1A 3NZQA 4I0UA 4IHJE 2LKHA 3RH3A 1I94T 3KV9A 1UURA 2BG9E 5HCMA 3RYFE 1MIWA 2DLRA 3KFWX 4QXCB 4X5TA 2V7IA 2IUBA 2X51A 1HF8A 2YOEA 5FVKA 3VKHA 4XZCA 4UIGA 2XAHB 3OJAA 5HEUA 4AQFC 3QC9A 4L0RA 3EAMA 3OYXA 3PUYF 1XNRT 4QXHB 2ZM8A 4DUYT 4H9PC 2WDRA 4IDQA 2X9WA 2LHNA 1LRZA 3RIUC 2NOXA 4EEBA 3RQWA 2CBIA 1J5ET 3ZKRA 5LG4A 2DCFA 4V1Av 4E7SA 5FVLA 2FJBA 3KBTA 1HS7A 2XQ9A 2M6BA 3RC3A 4FJOA 4P0AA 4HE8A 4TV9E 4DIDB 3NWIA 3MXZA 2G0UA 4ZI7E 3J7Yq 1Z8UA 2FJAA 3ZMUB 2BVLA 4CXYA 4U2ZA 1IJ5A 1QUUA 1W0AA 2E9XC 2W0GA 5AQHB 4DMWA 3P4PA 3PUZF 4EV6A 5AFUL 1YKHB 3L09A 3RIUA 2V5CA 2FJEA 2ZLYA 3RIAA 3UU6A 4DBQA 3WI3A 5J2UE 5JDLA 4GKKT 4LMLA 1UX5A 5AQRB 2H89A 3CMLA 4MBQA 2YKSA 3M65A 4C90A 4DV2T 5FXZA 3O9XA 1QLBA 5AQPB 2FUPA 4UV9B 5JRCA 1YKEB 2CHNA 2WZHA 4HFEA 2C5KT 2MTQA 3N9LA 3PUGA 5AQFB 3KDSE 1WR6A 4YY3T 5CJ5A 2X67A 2ACXA 3OKQA 4YLHA 3FZMB 3O4XE 2Q9QC 2A2FX 4ILUA 3CVRA 3T8OA 4AISA 5LMNT 1BR2A 1CUNA 1HCIA 2WQYA 1N34T 2UXBT 3PTRB 5FL0A 3C4WA 4YHHT 2V1DB 4JI3T 2OLTA 1L0VA 3RKOA 3AE3A 2DWKA 3CWZB 3MA9A 4IDNA 4IE4A 4OK0A 4YFSA 2RP4A 1IZNB 2DL1A 3HKBE 3P8CD 4HWCA 1WYCA 4ILAA 2B76A 4QX7B 4X1YE 4EEDA 1FJGT 5JQGE 4JYAT 4MFRA 4U31A 4JBWF 3V5UA 5AQMB 2ACZA 4UF0B 3WAKA 3ZC1A 4LF7T 3AA6B 2CWOA 3A8YC 5AQQB 2YDRA 5FY1A 2J4GA 4UEMA 2BKOA 3GWHA 1M62A 4B6XA 3AE7A 4H9QC 4H63H 4WW0A 5KXJA 3RX6A 1YXRA 3UU5A 4LF5T 1HG2A 1UCUA 2L9QA 3AAAB 3O1IA 3AA0B 2C0SA 2LM2A 1OEDB 3VR9A 5AQKB 3RHWA 2IC9A 2ODVA 2V7KA 3P7IA 3ZMVB 3C98B 3SOLA 4KMCA 3ZSSA 2X9YA 5ABGA 2VKJA 1HNXT 2ZM6T 3PUVF 4CN1A 4GK0E 3HA4A 3C51A 4F6RC 1N32T 1MMAA 2D9DA 2OV9A 3PUXF 1ZV4X 4H63V 5J2TE 3ANWA 4U72A 2XAGB 2XPKA 2BS2A 3FZKB 3FZHB 4O4JE 5ABFA 4HFDA 4L5GA 4DR7T 2VKDA 1YQ4A 1XMQT 1YQ3A 2XUEA 3N2GE 4YTPA 1ZP0A 1ZKEA 2VURA 2QGSA 3EVYA 3LSVA 3AEBA 4ZEYA 1QSDA 4TNWA 2PJQA 2W66A 3CQCB 3PJAA 2EHOD 1HNZT 1D1AA 3T1YT 5JR9A 3PV0F 2JRKA 1FMWA 1YW0A 4MLKA 1BR1A 2V6YB 4TNVA 4AQGA 1OEDA 5HEJA 3RC8A 3TLSA 5L2LA 2LHRA 4ANJA 3ZMSB 2VVSA 2E8IA 4C91A 1T7SA 2LSKA 4ZOLE 3RYIE 3SWHA 1X9BA 2WSSV 3PDYA 4QXBB 4DR4T 1I6ZA 3RGLA 3CQXC 3RI5A 3RYCE 4E7ZA 3K8PC 4Z91A 3ZLIA 2XAQB 4AKRB 4UR9A 4EYUA 3H3MA 3RLFF 3FB2A 2SPCA 3Q2MA 3UFEA 2BBHA 3PUWF 4ISTA 3VU7H 4IL9A 4LF9T 3DP7A 5KDMC 5F8PA 5JDGA 4B3RT 4LFAT 4AKLA 1BR0A 4JI7T 5CFBA 4U7YA 2UXXB 4I55E 2H7OA 4AI6A 2CCQA 4PJLA 4A5XA 1MMDA 3FXEB 4ZS2A 5FMNA 1XDPA 3NBXX 2M6IA 3AXJA 3FZLB 2V6XA 4KP3C 3PU8A
chains in the Genus database with same CATH topology
3ONLC 2QYWA 1VCSA 3ONJA 2V8SV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONL C;  2QYW A;  1VCS A;  3ONJ A;  2V8S V; 
#chains in the Genus database with same CATH topology
 3OYZ A;  3IF8 B;  4EAH A;  2PBI A;  3OTO T;  1GQE A;  5LYJ E;  3WAJ A;  4DR6 T;  5LXT E;  3VRA A;  1HNW T;  5H6R B;  1OWA A;  2XQ6 A;  3OVU A;  2YIN A;  4CN4 A;  1MIY A;  2MBG A;  4DV0 T;  2E5L T;  3LDQ B;  4B3S T;  2W4X A;  3Q5X A;  3SS1 A;  4OX9 T;  1SHZ C;  2MPK A;  2N1G A;  2PG8 A;  1E1H B;  3MJX A;  2NW9 A;  4EZ4 A;  3LK3 B;  3ZT7 A;  4TV8 E;  5JR9 C;  3HKC E;  4HFH A;  2UU9 T;  5AQN B;  5AQU B;  1H7C A;  2LLY A;  5JDQ A;  4GYS A;  2BKP A;  3P4Q A;  2JJ9 A;  2Y48 B;  3AXJ B;  3DTO A;  3GMI A;  5JDF A;  4AIU A;  3PUQ A;  1M7K A;  5FYM A;  3SFE A;  3ZCJ A;  2J1D G;  4M1P A;  5AQI B;  5JRC B;  2BVM A;  3I0Q A;  2V8S V;  3AEG A;  3AED A;  5FY0 A;  5HXC A;  2WWU A;  2WU2 A;  1FMV A;  3HKE E;  4UVA B;  4BJN A;  2B1E A;  2V7L A;  4IE6 A;  2VQE T;  1J1J A;  2EHO A;  3CKD A;  5LP6 E;  4IE5 A;  4WNK A;  2JPF A;  1WFD A;  2FJD A;  2Q9Q A;  3AVS A;  4HEA A;  4QKN A;  5FY7 A;  4ZI2 D;  4QH4 A;  2MOZ A;  3EI0 A;  1XMO T;  1SA0 E;  2DI4 A;  5M4Y A;  2XQ7 A;  2GK9 A;  2KXP B;  2V5D A;  4O2B E;  2WCA A;  3UUM A;  4TWD A;  2BS3 A;  2WDQ A;  5EZY E;  1XWM A;  4UV8 B;  4JI2 T;  5JDN A;  2CEA A;  4KBM B;  3C4X A;  5LOV E;  2A9U A;  2NTX A;  4IDP A;  3ZPO A;  4YJ2 E;  2DWG A;  2R6G F;  2KMF A;  2E9X B;  3F2E A;  4IL4 A;  2X0L B;  2N2N A;  2NW8 A;  3FBL A;  3MAC A;  4L9I A;  4JI5 T;  3RRC A;  4YSX A;  1HG5 A;  5L47 A;  2LSY A;  2L8K A;  4AXP A;  5F3J A;  2IIU A;  3EDV A;  4H9S E;  3TKL B;  4WBO A;  1WCR A;  3L8R A;  3ETU A;  5FXW A;  5L3E B;  3UUN A;  3ZYK A;  5HXS A;  2JQH A;  1IBL T;  2VB6 A;  3U78 A;  4B3M T;  4U74 A;  1E7P A;  3P4S A;  2KIN B;  5FXX A;  2XTL A;  4IRE A;  5J1G A;  2W63 A;  4GKJ T;  2IHR 1;  1UUS A;  2J47 A;  3ESL A;  3I9Y A;  3TLV A;  2JIW A;  3O1H A;  2MYS A;  1B7T A;  2LKG A;  3BQI A;  3KV5 A;  5FXV A;  2YU1 A;  3IHR A;  3UUX B;  2P9B A;  4A97 A;  1WYB A;  2HHH T;  4AKG A;  4UVC B;  4ILB A;  2CA5 A;  2WU5 A;  3IEE A;  3QUJ A;  3TLU A;  2NP9 A;  4EXT A;  1LVK A;  2C5J A;  4OYK A;  2JQ9 A;  3AAI A;  4KI0 F;  4KX6 A;  3ZEF B;  5LHG B;  2WP9 A;  2YU2 A;  3N9O A;  5ABH A;  5HXR A;  5LJM A;  4BA9 A;  3LJC A;  2WBL A;  1T8B A;  2WMN A;  5HEO A;  2AE9 A;  2NR4 A;  3C4Z A;  3VRB A;  4DV6 T;  3TLW A;  2F4V T;  3AVR A;  2BDE A;  2LRK A;  4WYV A;  4DV7 T;  4MAL A;  2H3R A;  5HEG A;  2Y8D A;  5IHY A;  1ZEE A;  4YXD A;  5JVD E;  5LNK A;  2X0H A;  4CXW A;  2CWY A;  4GIW A;  2RA1 A;  4ZI2 C;  2YDQ A;  5LHH B;  5ADX L;  3I0O A;  4XBF B;  4TWF A;  4ILC A;  4DND A;  4PNI A;  2VL8 A;  4PAG A;  2CLY B;  1O3X A;  1V9D A;  2RPA A;  3ONJ A;  4H9O C;  5AQO B;  1MMN A;  4KUM B;  3AEE A;  5AQT B;  3UT5 E;  4HFB A;  4FI5 A;  2OA5 A;  4IGU A;  4YHJ A;  4JI1 T;  2Q9Q D;  5HYA A;  3HL6 A;  1Y64 B;  1VCS A;  5JRE A;  1T98 A;  2EHO B;  3C64 A;  3PUA A;  3VHL A;  4IE0 A;  4A98 A;  2QA7 A;  4AQF A;  4CQI A;  1KNP A;  2CBJ A;  3CIR A;  3EHZ A;  2WMO A;  3AE8 A;  3GN5 A;  4JEH B;  2E9X A;  5FP3 A;  3QB5 A;  4O4H E;  4OYJ A;  5TAO A;  3KVA A;  4OFZ A;  2H88 A;  2Z6E A;  2CLY C;  4ZI3 C;  4ADZ A;  2DNX A;  2W2U A;  3JC6 D;  3ZJ1 A;  1NAF A;  2XQ4 A;  3F57 A;  2XZE A;  2YEV C;  3GN5 B;  3AE2 A;  4U33 A;  4HWD A;  4X1I E;  3UFG A;  4Z8X A;  2X0Y A;  4DO0 A;  4DMV A;  4EB6 E;  1YD8 G;  2W62 A;  2UXD T;  2E2A A;  2EHO C;  1JNZ A;  4G2A A;  4HWI B;  4PJN A;  3RIF A;  3C50 A;  3ZMZ B;  4NUU A;  2E5V A;  4JI8 T;  5J0Z A;  3SFD A;  4QX8 B;  5DQV A;  1CHU A;  4K0K T;  2JQQ A;  4GOU A;  3ZST A;  4IDZ A;  2CHO A;  2M67 A;  5L3F B;  2I6H A;  2BG9 B;  2VWA A;  3FXD B;  2PFV A;  3AEC A;  3OPC A;  3QB5 K;  3KVB A;  4P09 A;  5E0O A;  4LF6 T;  3B5M A;  4EYY R;  1IJ6 A;  5EK3 A;  2PTF A;  3ETV A;  3N9P A;  2LOS A;  4QWN B;  3ZT6 A;  4I43 B;  5JDH A;  3LBX B;  2UUB T;  3AE4 A;  4HFV A;  2XQ3 A;  3RRW A;  3N2O A;  4HWH A;  3VR8 A;  3HR0 A;  2XAF B;  2D2S A;  3AAE B;  3AB3 B;  4JUY A;  4UXN B;  5L3G B;  2QRX A;  5CB4 E;  3KV6 A;  4EZH A;  1FIO A;  2BG9 C;  3F31 A;  5FNV E;  5FL1 A;  4X65 T;  3RF1 A;  4BAY B;  3T1H T;  4P1N A;  2I59 A;  3W15 B;  4DVD A;  3JCF A;  2HPJ A;  2ZMA A;  3AEF A;  3KBU A;  3Q5D A;  1XNQ T;  5L3B B;  4CN6 A;  2NW7 A;  2WS3 A;  3ZYL A;  2UUC T;  2IW5 B;  5LG3 A;  2ZM0 A;  3S4U A;  5L3C B;  4KHZ F;  4IT4 A;  4NIQ A;  3Q5E A;  3JAD A;  5DJQ C;  5LJN A;  2KT9 A;  4IE7 A;  5DQW A;  4ASK A;  1E2A A;  2KWH A;  4AKH A;  1D0X A;  1XDO A;  2DHR A;  2UXN B;  2LE8 A;  2W00 A;  3BK9 A;  1S35 A;  4Q25 A;  1ZOY A;  3PUR A;  3QNU A;  2X68 A;  3JC6 C;  2XQ5 A;  3P4R A;  3ZCI A;  3Q9D A;  5LHI B;  1KF6 A;  4DBR A;  5EK4 A;  4X62 T;  5BR8 T;  2UUA T;  5L4H A;  5JR9 B;  2VKH A;  3HKD E;  2KWI B;  3OBV E;  3K3O A;  3UQ7 A;  1T72 A;  4H9N C;  5IWA T;  4DR1 T;  2LSG A;  2W67 A;  3N9Q A;  2VQF T;  3L3P A;  5A1L A;  3ONX A;  2ODU A;  2YK0 A;  4DV5 T;  2YN6 A;  3SRZ A;  2K24 A;  4O4I E;  4LMK A;  1VCT A;  3KIN B;  5IYZ E;  1NWM X;  2LJL A;  4QHO A;  4JEU B;  3K3N A;  5ETW A;  4PFO A;  3RKG A;  5HWX A;  5C3J A;  1S94 A;  1MMG A;  1Z0P A;  1OXZ A;  2VK9 A;  3FZF B;  1EZ3 A;  3N2K E;  2IML A;  2V6Y A;  2N9D A;  4I4T E;  5AQG B;  4TX5 A;  2YDS A;  4ISS A;  1AJ3 A;  3GA8 A;  3I9W A;  2W61 A;  3D0T A;  4IDO A;  5H6Q B;  4EOZ B;  2JMH A;  3DJB A;  3H3A A;  4U3C A;  5BMV E;  5JH7 E;  2Y6X A;  4LF4 T;  3IBP A;  5GON E;  3RYH E;  3UUB A;  1G73 A;  1Y01 A;  2WDV A;  1LVF A;  2LSJ A;  1KEY A;  4OHF A;  3LK4 2;  4HKA A;  2K9A A;  4CI1 B;  4ZI3 D;  1KFY A;  1W09 A;  2KLQ A;  4O4L E;  2LOP A;  4DR3 T;  3ZC0 A;  3UQ4 A;  4ZZB A;  4DV1 T;  2XM2 A;  5JTG A;  3QK6 A;  3IA3 A;  2BBJ A;  3ZJ2 A;  3N9M A;  3AA1 B;  5F5W A;  4X66 T;  5CGM A;  4TWH A;  5AQL B;  4DV3 T;  3Q5W A;  4UF0 A;  4X20 E;  4YSY A;  2KZ7 B;  2BZB A;  1HFA A;  2D5U A;  1WRD A;  2Q9Q B;  2V26 A;  3EUH A;  4YSZ A;  5CA1 E;  5HCJ A;  1DU2 A;  1J5W A;  3N9N A;  3N5L A;  5LMU T;  3UUL A;  2BKN A;  4PK6 A;  4A56 A;  3CX6 B;  2HN1 A;  4LMJ A;  4YJ3 E;  3BQL A;  4MHC A;  2X9X A;  3ABV A;  4F8H A;  4O8S A;  4I50 E;  4ZXL A;  3R6N A;  4ZS3 A;  3NKZ A;  4ZZC A;  3NVO A;  3H37 A;  4DUZ T;  1W0B A;  4LFB T;  3R84 B;  4CI3 B;  1IAP A;  3BQK A;  4PK5 A;  2XSA A;  4NUV A;  4PJJ A;  2J62 A;  2L3L A;  3G06 A;  2D0T A;  1HX8 A;  3K1S A;  1SE7 A;  2IDO B;  4JLE A;  4TUY E;  4UVB B;  4YTN A;  4TN7 B;  2WY2 A;  4AQY T;  3UU4 A;  1R8I A;  2IC6 A;  2NTY A;  4X1K E;  1D1B A;  3UU8 A;  3A5X A;  4ZHQ E;  2CXL A;  4WZX A;  2VAS A;  3A7M A;  2MAW A;  1FEW A;  3NRX A;  3NRY A;  3ZT5 A;  4YTM A;  5C2T A;  1OED C;  1IBM T;  2WAU A;  2JMK A;  2WB5 A;  2X9H A;  2A3D A;  2ES0 A;  2XM1 A;  2ZM2 A;  4U7I A;  5LA6 E;  4N78 D;  3E0Z A;  5FKY A;  5AQV B;  3NZP A;  3PU3 A;  2QYW A;  2FBW A;  3ZN1 B;  3VKG A;  4EGW A;  3JAE A;  4NPP A;  3L39 A;  3MK7 C;  4PJM A;  4XAX B;  3HI2 A;  1JNR A;  2CE7 A;  2HH7 A;  1LKX A;  2KND A;  3J9X 1;  2WWV A;  3ZYM A;  4YT0 A;  3CK6 A;  3MZK B;  3JAF A;  2BG9 A;  5LBM A;  4COF A;  4CZZ B;  1N33 T;  3AE6 A;  4AKI A;  1X79 A;  3RPU A;  3MKD A;  4EIW A;  5L4E A;  1HR0 T;  3EAB A;  1UK5 A;  1ZHC A;  2CXD A;  3ONL C;  5C8Y E;  2CMR A;  3P4W A;  4JI6 T;  3CQG B;  4BJM A;  1D1C A;  1N36 T;  2IAK A;  2K5B B;  3FBZ A;  2C5I T;  2WZI A;  4DR2 T;  5HAX A;  2HN2 A;  1UGO A;  4J2C A;  5HXH A;  2JQK A;  3U3I A;  5KMG P;  2HPL A;  4P0B A;  5HXE A;  3FHN A;  5ABE A;  3AE5 A;  1KNZ A;  1SUM B;  3P50 A;  4HFC A;  2BS4 A;  3LK2 B;  3E08 A;  4NXN T;  5LGT B;  3CPZ A;  3CX7 B;  4DR5 T;  5ABF B;  3UU3 A;  1UX4 A;  5HEH A;  1D0Z A;  2XQA A;  2LT3 A;  2QVA A;  5DAB A;  4HTE A;  1KNR A;  2KSR A;  3V5S A;  4CI2 B;  4KHP T;  1US7 B;  5HWY A;  2CRB A;  1KK7 A;  4JI0 T;  2LEH A;  2H7V C;  4GYR A;  4Z90 A;  3UTK A;  5EK2 A;  3LFM A;  2CXF A;  2XAJ B;  1W9R A;  5KX5 E;  4NXM T;  3O1J A;  4JI4 T;  4HN9 A;  4LF8 T;  5LBQ B;  2I0M A;  4ERR A;  1G8X A;  2K3W A;  2X66 A;  2VL0 A;  4QH1 A;  5LCY A;  5LB7 B;  1MND A;  2V7M A;  2XQ8 A;  3ZN0 B;  5LGU B;  4LFC T;  2E9X D;  5AQJ B;  2A72 A;  2CPT A;  3PUS A;  4B3T T;  3EDU A;  3ANW B;  5L3D B;  2LRL A;  4H9R C;  3LG7 A;  1U4Q A;  4PW8 A;  1MIV A;  2XAS B;  5JDM A;  1MNE A;  1OED E;  4PFP A;  1WR0 A;  1VOM A;  3KV4 A;  1HX1 B;  2CM0 A;  4K0U A;  3X1D A;  2UXC T;  1VRB A;  5AQS B;  3E22 E;  3CX8 B;  4G63 A;  4WBN E;  3I1A A;  1NEK A;  2V7J A;  3M3Z B;  1WLX A;  3QOF A;  1D0Y A;  1XZY A;  3K3Q C;  2VVN A;  2XY8 B;  4IIJ E;  2K48 A;  4QH5 A;  4UEL A;  3RQU A;  3B57 A;  4HWF A;  5CA0 E;  3B13 A;  3AEA A;  4X64 T;  1IBK T;  4JV5 T;  2D0U A;  2NWB A;  3LBX A;  2WM9 A;  2XHE B;  2AXD S;  3PJA J;  4O2A E;  4U2Y A;  4CXX A;  2XQY A;  2XJ7 A;  3AA7 B;  4HFI A;  2VKO A;  2XSB A;  4PK4 A;  4TZ4 C;  3TLT A;  4DV4 T;  1U5P A;  3ZMT B;  3PE0 A;  5IUX A;  5LGN B;  1BR4 A;  2LM9 A;  2LSI A;  3AE9 A;  1NEN A;  4HGA A;  1HTJ F;  4GK5 E;  3AE1 A;  3NZQ A;  4I0U A;  4IHJ E;  2LKH A;  3RH3 A;  1I94 T;  3KV9 A;  1UUR A;  2BG9 E;  5HCM A;  3RYF E;  1MIW A;  2DLR A;  3KFW X;  4QXC B;  4X5T A;  2V7I A;  2IUB A;  2X51 A;  1HF8 A;  2YOE A;  5FVK A;  3VKH A;  4XZC A;  4UIG A;  2XAH B;  3OJA A;  5HEU A;  4AQF C;  3QC9 A;  4L0R A;  3EAM A;  3OYX A;  3PUY F;  1XNR T;  4QXH B;  2ZM8 A;  4DUY T;  4H9P C;  2WDR A;  4IDQ A;  2X9W A;  2LHN A;  1LRZ A;  3RIU C;  2NOX A;  4EEB A;  3RQW A;  2CBI A;  1J5E T;  3ZKR A;  5LG4 A;  2DCF A;  4V1A v;  4E7S A;  5FVL A;  2FJB A;  3KBT A;  1HS7 A;  2XQ9 A;  2M6B A;  3RC3 A;  4FJO A;  4P0A A;  4HE8 A;  4TV9 E;  4DID B;  3NWI A;  3MXZ A;  2G0U A;  4ZI7 E;  3J7Y q;  1Z8U A;  2FJA A;  3ZMU B;  2BVL A;  4CXY A;  4U2Z A;  1IJ5 A;  1QUU A;  1W0A A;  2E9X C;  2W0G A;  5AQH B;  4DMW A;  3P4P A;  3PUZ F;  4EV6 A;  5AFU L;  1YKH B;  3L09 A;  3RIU A;  2V5C A;  2FJE A;  2ZLY A;  3RIA A;  3UU6 A;  4DBQ A;  3WI3 A;  5J2U E;  5JDL A;  4GKK T;  4LML A;  1UX5 A;  5AQR B;  2H89 A;  3CML A;  4MBQ A;  2YKS A;  3M65 A;  4C90 A;  4DV2 T;  5FXZ A;  3O9X A;  1QLB A;  5AQP B;  2FUP A;  4UV9 B;  5JRC A;  1YKE B;  2CHN A;  2WZH A;  4HFE A;  2C5K T;  2MTQ A;  3N9L A;  3PUG A;  5AQF B;  3KDS E;  1WR6 A;  4YY3 T;  5CJ5 A;  2X67 A;  2ACX A;  3OKQ A;  4YLH A;  3FZM B;  3O4X E;  2Q9Q C;  2A2F X;  4ILU A;  3CVR A;  3T8O A;  4AIS A;  5LMN T;  1BR2 A;  1CUN A;  1HCI A;  2WQY A;  1N34 T;  2UXB T;  3PTR B;  5FL0 A;  3C4W A;  4YHH T;  2V1D B;  4JI3 T;  2OLT A;  1L0V A;  3RKO A;  3AE3 A;  2DWK A;  3CWZ B;  3MA9 A;  4IDN A;  4IE4 A;  4OK0 A;  4YFS A;  2RP4 A;  1IZN B;  2DL1 A;  3HKB E;  3P8C D;  4HWC A;  1WYC A;  4ILA A;  2B76 A;  4QX7 B;  4X1Y E;  4EED A;  1FJG T;  5JQG E;  4JYA T;  4MFR A;  4U31 A;  4JBW F;  3V5U A;  5AQM B;  2ACZ A;  4UF0 B;  3WAK A;  3ZC1 A;  4LF7 T;  3AA6 B;  2CWO A;  3A8Y C;  5AQQ B;  2YDR A;  5FY1 A;  2J4G A;  4UEM A;  2BKO A;  3GWH A;  1M62 A;  4B6X A;  3AE7 A;  4H9Q C;  4H63 H;  4WW0 A;  5KXJ A;  3RX6 A;  1YXR A;  3UU5 A;  4LF5 T;  1HG2 A;  1UCU A;  2L9Q A;  3AAA B;  3O1I A;  3AA0 B;  2C0S A;  2LM2 A;  1OED B;  3VR9 A;  5AQK B;  3RHW A;  2IC9 A;  2ODV A;  2V7K A;  3P7I A;  3ZMV B;  3C98 B;  3SOL A;  4KMC A;  3ZSS A;  2X9Y A;  5ABG A;  2VKJ A;  1HNX T;  2ZM6 T;  3PUV F;  4CN1 A;  4GK0 E;  3HA4 A;  3C51 A;  4F6R C;  1N32 T;  1MMA A;  2D9D A;  2OV9 A;  3PUX F;  1ZV4 X;  4H63 V;  5J2T E;  3ANW A;  4U72 A;  2XAG B;  2XPK A;  2BS2 A;  3FZK B;  3FZH B;  4O4J E;  5ABF A;  4HFD A;  4L5G A;  4DR7 T;  2VKD A;  1YQ4 A;  1XMQ T;  1YQ3 A;  2XUE A;  3N2G E;  4YTP A;  1ZP0 A;  1ZKE A;  2VUR A;  2QGS A;  3EVY A;  3LSV A;  3AEB A;  4ZEY A;  1QSD A;  4TNW A;  2PJQ A;  2W66 A;  3CQC B;  3PJA A;  2EHO D;  1HNZ T;  1D1A A;  3T1Y T;  5JR9 A;  3PV0 F;  2JRK A;  1FMW A;  1YW0 A;  4MLK A;  1BR1 A;  2V6Y B;  4TNV A;  4AQG A;  1OED A;  5HEJ A;  3RC8 A;  3TLS A;  5L2L A;  2LHR A;  4ANJ A;  3ZMS B;  2VVS A;  2E8I A;  4C91 A;  1T7S A;  2LSK A;  4ZOL E;  3RYI E;  3SWH A;  1X9B A;  2WSS V;  3PDY A;  4QXB B;  4DR4 T;  1I6Z A;  3RGL A;  3CQX C;  3RI5 A;  3RYC E;  4E7Z A;  3K8P C;  4Z91 A;  3ZLI A;  2XAQ B;  4AKR B;  4UR9 A;  4EYU A;  3H3M A;  3RLF F;  3FB2 A;  2SPC A;  3Q2M A;  3UFE A;  2BBH A;  3PUW F;  4IST A;  3VU7 H;  4IL9 A;  4LF9 T;  3DP7 A;  5KDM C;  5F8P A;  5JDG A;  4B3R T;  4LFA T;  4AKL A;  1BR0 A;  4JI7 T;  5CFB A;  4U7Y A;  2UXX B;  4I55 E;  2H7O A;  4AI6 A;  2CCQ A;  4PJL A;  4A5X A;  1MMD A;  3FXE B;  4ZS2 A;  5FMN A;  1XDP A;  3NBX X;  2M6I A;  3AXJ A;  3FZL B;  2V6X A;  4KP3 C;  3PU8 A; 
#chains in the Genus database with same CATH homology
 3ONL C;  2QYW A;  1VCS A;  3ONJ A;  2V8S V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...