2V8SV

Vti1b habc domain - epsinr enth domain complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
93
structure length
93
Chain Sequence
ASSAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords CLATHRIN INTERACTOR 1
publication title A Snare-Adaptor Interaction is a New Mode of Cargo Recognition in Clathrin Coated Vesicles
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2v8sV00
2QYWA 1VCSA 3ONJA 2V8SV 3ONLC
chains in the Genus database with same CATH superfamily
1YKEB 4TWFA 4GK5E 2A9UA 3KBUA 4AI6A 4U33A 3FZMB 5FXXA 4EEBA 4YSYA 1ZV4X 2LLYA 3ANWA 5FMNA 4JI0T 2DLRA 4H9SE 5JDMA 4BJMA 4KI0F 5JR9C 5L3BB 4GYSA 1IBKT 4U2YA 3P50A 1IJ5A 1J5WA 1HCIA 2I6HA 2B1EA 4OHFA 1UCUA 5L3DB 1G73A 1T7SA 4LFBT 5JRCB 4U72A 3ZC0A 2QYWA 3B13A 3RH3A 2OLTA 4K0UA 5EK3A 5TAOA 2X0HA 3QUJA 1NWMX 3HKBE 4EB6E 2W63A 3HKCE 1MIWA 1W09A 3CX6B 4X5TA 2XQ5A 5AQUB 4JEHB 3ZPOA 3ZKRA 1JNZA 2IAKA 5LCYA 5F8PA 4FI5A 4O8SA 4PK4A 2C0SA 1HG2A 1WFDA 2CA5A 4TNWA 2E5VA 2V6YA 3LBXB 3EABA 3PUWF 2R6GF 4A97A 4PK5A 1VCSA 3EI0A 3AA1B 3FBZA 3AE7A 4AQYT 2I0MA 4WBNE 5E0OA 5HEJA 4QH1A 2QA7A 2M6IA 4MLKA 3JCFA 4B6XA 2KWIB 5J1GA 4YY3T 5AQRB 3P4PA 2WU2A 5F3JA 5L3FB 3AE5A 3ETVA 4DV1T 3I1AA 3UUMA 2LRLA 3LK42 2PTFA 4EEDA 2MTQA 4P0BA 3K3OA 4LF5T 5HEGA 3UQ7A 2A2FX 2Q9QD 2KXPB 4YJ2E 3FB2A 4HWIB 4UV8B 4ZEYA 1M7KA 1MNEA 4IE7A 3P4RA 4A98A 4DV4T 5L2LA 4DO0A 3EAMA 3C64A 1IJ6A 1V9DA 2QGSA 4UIGA 4AKGA 2JIWA 5HEOA 2KLQA 1HX1B 3AE2A 3ZJ2A 3NZPA 1MNDA 2CCQA 2HN2A 4TWHA 4WBOA 5C8YE 5LBMA 1I94T 2WWVA 4IDZA 5HYAA 5AQGB 3PJAA 4AKHA 3KFWX 4H9PC 3P4SA 4HKAA 4X20E 4JI4T 4Z91A 4X1IE 5AQNB 1HFAA 3RYFE 2UXCT 1WYCA 2OA5A 3ZT7A 4TUYE 2X67A 5KX5E 3A7MA 4U74A 2X51A 1XDOA 3W15B 4P09A 3AEBA 1NEKA 3AA0B 2CEAA 4MALA 2KMFA 1WLXA 3NRXA 3ZMTB 4CXWA 3UFEA 4O4JE 2KZ7B 3LBXA 2Q9QA 3NRYA 5AQMB 5LGNB 2H88A 2WMOA 3E0ZA 3PUZF 3SWHA 5C3JA 2UXNB 3KV4A 2X66A 2LSJA 2B76A 4EXTA 5H6QB 2YK0A 2W61A 3RGLA 2E9XC 3GWHA 2YEVC 2CLYC 3PUYF 5LHIB 3ZLIA 3QOFA 3B5MA 2Z6EA 4L0RA 3I9WA 3MKDA 4IREA 3D0TA 2XSAA 5CGMA 4HFBA 2CLYB 4WNKA 3O1IA 4HFEA 4ZHQE 3RC8A 2VURA 3OTOT 1LVFA 5HXCA 4DVDA 4ZI3C 4J2CA 5DQWA 4ZI7E 4F8HA 2J62A 3AEGA 3IA3A 5FY1A 4TZ4C 4ISTA 4L5GA 5EZYE 3VKGA 2LT3A 3ESLA 4H63V 2VKDA 2F4VT 1WRDA 1B7TA 4HFVA 3N2KE 4PJMA 3ZYLA 2W67A 3C4WA 1LRZA 2JJ9A 5L3CB 2WMNA 2X9YA 5AQQB 1OWAA 2WU5A 4YFSA 3LFMA 1HF8A 5LG3A 2YOEA 2YDQA 4AKLA 2WM9A 1N32T 4NUUA 3KV9A 4B3TT 5HCJA 4Z90A 3I9YA 3CMLA 4QH4A 2BKOA 1KNZA 3P7IA 2BS3A 5LHGB 3Q5XA 4ZZBA 1CUNA 5JVDE 1D1CA 2LHNA 2ES0A 3TLWA 3RYHE 3EUHA 3I0OA 4TNVA 2M6BA 1SA0E 5LG4A 3HKEE 3UTKA 3UQ4A 2FJAA 2BG9C 4MHCA 2MPKA 5FXWA 1XDPA 2W62A 2C5JA 2V7LA 1D0YA 3VKHA 2ZMAA 1Y64B 1WCRA 2EHOC 3WAJA 4ZS2A 4EAHA 4B3ST 4GKKT 5EK2A 5ABFA 2NW8A 1X9BA 4KUMB 3IBPA 4PAGA 1E1HB 3AXJA 2D5UA 3BK9A 4GOUA 1W0BA 2XAJB 4G63A 2CWYA 5JTGA 3FZKB 2RP4A 1N34T 2V8SV 4LF9T 3N5LA 2ZM2A 3ZT5A 1UX4A 3ONXA 3N2GE 2XUEA 4OYJA 2H7VC 2YINA 2XQYA 2YDRA 5LP6E 5LHHB 3FXEB 4ZOLE 4CI3B 1US7B 5LNKA 3AE3A 5JDFA 4HGAA 5AQOB 4MFRA 5AQIB 3TLUA 4JLEA 4H9RC 3IF8B 4YXDA 3L8RA 3O9XA 2KSRA 2LSYA 1N36T 4UVBB 5DJQC 2XQ4A 2IHR1 4X62T 3AE4A 5HXEA 3KINB 3UUBA 2CHNA 1I6ZA 1MMNA 2CXLA 2IIUA 3UUNA 4OX9T 4U7YA 2WAUA 2PJQA 3V5UA 3UFGA 4AKIA 1X79A 3LSVA 4YT0A 2W00A 4CN6A 3F31A 2PBIA 5CJ5A 4B3MT 3BQLA 4JEUB 3CK6A 1YKHB 4N78D 3SS1A 1S94A 1Z0PA 4UXNB 3T1HT 3SFEA 4F6RC 5FL1A 2XZEA 4GYRA 3RF1A 3ZC1A 2UXXB 2IMLA 5JR9B 5IWAT 4JBWF 1OEDC 2BBJA 2WY2A 3FXDB 4YTNA 2YN6A 3RKOA 3FZHB 3RX6A 2V7IA 2JMHA 5M4YA 3U78A 3MACA 4ISSA 3AVSA 4YJ3E 3H3MA 3UU6A 2VKOA 4EYUA 2LM9A 3AAAB 4LMJA 3SRZA 3LG7A 5JDHA 4U31A 2MOZA 2LJLA 2XAQB 2L9QA 2KT9A 2Q9QC 2XQAA 2NP9A 2VB6A 3JAFA 1MMAA 1XNQT 5J2UE 5GONE 2BKNA 3ZMZB 2BS4A 2AE9A 2X9WA 3AB3B 2W2UA 3Q5WA 2JQKA 5AQPB 2DWGA 1E2AA 2WB5A 5BR8T 3CX7B 2W66A 4AKRB 4BJNA 4GK0E 4WW0A 3ZYMA 2CE7A 3R84B 3RLFF 2K48A 4IE0A 1MMGA 3AECA 2ZLYA 4JYAT 2HN1A 3EDVA 3P4WA 4HFCA 4KX6A 3ONJA 4ZS3A 5JDGA 4HN9A 4PFOA 4CN4A 2LKHA 4DV3T 4GKJT 5CB4E 3RHWA 4DR7T 4IDQA 4JI6T 5JDQA 5LGTB 2XSBA 4DV6T 3K8PC 2NWBA 2QRXA 2CWOA 4PJJA 3S4UA 5J0ZA 4V1Av 1XMQT 5FKYA 2VK9A 2XAHB 3RIUA 4H9QC 2C5IT 1R8IA 2YU1A 2JQ9A 4AQFC 3G06A 3B57A 3A8YC 5JR9A 5JRCA 2H3RA 4OK0A 3RYIE 2V7KA 4DIDB 3BQIA 2MYSA 2Y8DA 3N2OA 3RRWA 2LSIA 1MIVA 2G0UA 2V5DA 2NW9A 4TV8E 2VKHA 2XY8B 1ZOYA 4EIWA 4DR5T 4ADZA 1KEYA 3OBVE 3M3ZB 3PUVF 2UUCT 3X1DA 2DNXA 4JUYA 5ETWA 4DUYT 2WCAA 1O3XA 3PURA 1U4QA 2WDVA 2FUPA 3AE6A 4IL9A 4DV0T 5H6RB 2DCFA 2D0UA 1FEWA 1WR6A 1WR0A 5EK4A 5C2TA 2WBLA 4AIUA 1D1AA 4IL4A 3AAIA 2DHRA 4A56A 1NENA 3AVRA 2LSKA 4JI2T 4CXXA 4I55E 1CHUA 3HA4A 3UUXB 2LSGA 3RQUA 3AEEA 4XBFB 4IDNA 4PJNA 5F5WA 2XAGB 3CQGB 2X9HA 4QXBB 5AQVB 1ZHCA 3RPUA 4YTMA 2WQYA 4LFCT 1NAFA 2YKSA 4AQGA 3E08A 4JI5T 2E5LT 1E7PA 2BS2A 2E9XB 1D1BA 2L3LA 5LGUB 3HL6A 4P1NA 4EGWA 5CA1E 3ZMUB 3K1SA 4I0UA 2V26A 2PFVA 5LMNT 3JADA 4DBRA 4KBMB 2ACZA 5JQGE 4O2BE 4PNIA 1HG5A 4DBQA 2XQ3A 3SOLA 4DUZT 4P0AA 4U7IA 5JH7E 1SE7A 3MJXA 4QHOA 5AQHB 3CPZA 1T98A 1EZ3A 4DR4T 3ZMSB 4HWFA 2CBJA 5L4EA 1J1JA 3MK7C 3Q5DA 2MAWA 4OFZA 3ZJ1A 5KMGP 4ZI2D 3RIAA 2ZM8A 5LYJE 2XQ7A 4G2AA 2RPAA 4I4TE 2UU9T 1MIYA 1OEDE 2XJ7A 4X65T 2V5CA 4HFDA 4CI2B 4EZHA 2XTLA 1J5ET 3N9LA 1T72A 3ZCIA 5L3GB 3MA9A 3LDQB 2A3DA 3WAKA 2YDSA 4ILCA 4UF0B 3AEFA 3CWZB 1FMVA 5JREA 2LRKA 1OXZA 3GMIA 4A5XA 5HXSA 4QKNA 4DV2T 2RA1A 3AE9A 4PW8A 3LK2B 3FHNA 1YD8G 4XAXB 4DV7T 5L4HA 1XWMA 3OYXA 2N9DA 1D0ZA 4HFHA 2UUBT 1QUUA 5JDLA 2BG9B 3L09A 2MBGA 4DR1T 4LF4T 2CRBA 3CQCB 2E9XA 3NWIA 2A72A 5AFUL 4NUVA 4BA9A 4UV9B 5LBQB 2BKPA 5LB7B 1S35A 3GN5B 4HWHA 1KNRA 5DQVA 4ANJA 4UELA 2EHOB 5HEUA 2BDEA 4JI1T 2K3WA 3AEDA 3RYCE 2PG8A 2KWHA 2XPKA 3GA8A 4KHPT 2HHHT 3PJAJ 3ETUA 4U3CA 2WSSV 1ZKEA 1YW0A 4CI1B 4H63H 3UULA 4EYYR 4I50E 3CX8B 4B3RT 5A1LA 5FY0A 3CKDA 4HTEA 3O1JA 4CN1A 1KK7A 1YXRA 2NTYA 2IC9A 2FJDA 1XZYA 2K5BB 3CVRA 2IC6A 1FMWA 3TKLB 2CXDA 2UXDT 4U2ZA 2BZBA 2ZM0A 3KBTA 3KV5A 3SFDA 2LEHA 2XM2A 4KHZF 5HWYA 4HFIA 3F2EA 3JC6D 3U3IA 4XZCA 4YSXA 1U5PA 3OKQA 5FP3A 2W4XA 5FVKA 4COFA 3DP7A 3KDSE 2VVSA 3O4XE 2WZHA 2Y48B 4HEAA 2HPLA 3ZT6A 4NXMT 3N9NA 1ZP0A 2LOSA 3VR8A 2FJEA 5DABA 3KV6A 4EOZB 5FYMA 4NXNT 5HWXA 4PK6A 3F57A 3L3PA 4IE4A 4BAYB 2XAFB 3VHLA 3ZN1B 3DTOA 2XQ8A 4C90A 4UEMA 4JI7T 4IT4A 2BG9A 4IHJE 5L3EB 4QWNB 3PV0F 3QC9A 5FXZA 2CHOA 4LMKA 3RIUC 3FZFB 3PTRB 2OV9A 4X66T 3R6NA 4NIQA 4TWDA 3GN5A 1M62A 1LKXA 2NOXA 2EHOA 3IHRA 1W9RA 4O2AE 1L0VA 3PU8A 3M65A 2NTXA 2ODUA 5LJMA 3RIFA 1OEDB 1N33T 4E7SA 4YHHT 4MBQA 3H3AA 3QNUA 4CQIA 1BR1A 2NR4A 2CBIA 4DV5T 1VRBA 4EV6A 4LF8T 2WS3A 2FBWA 2X68A 1XNRT 4ILBA 2D2SA 3NKZA 5LJNA 2M67A 4LFAT 2SPCA 4DNDA 3TLTA 2C5KT 1SHZC 2DWKA 3LJCA 3PDYA 2X0YA 4DMVA 2Q9QB 4CZZB 3EVYA 4JI3T 4QH5A 1UUSA 3AAEB 2H89A 3UU4A 4YHJA 4H9OC 3ZSSA 5LMUT 1Z8UA 2IUBA 3AE8A 2J1DG 2IDOB 2XQ9A 4Q25A 3AA6B 1KFYA 3AA7B 3K3NA 1GQEA 5FVLA 3PUSA 4UR9A 5HXRA 3ZN0B 3T1YT 4CXYA 5IUXA 3AEAA 4X1KE 1HR0T 3IEEA 2H7OA 4TV9E 3RKGA 1JNRA 3N9OA 5IHYA 5L47A 3C51A 3JAEA 2ODVA 3NZQA 1QLBA 2BG9E 4IIJE 2JQQA 4M1PA 2WDQA 4YTPA 5J2TE 2K24A 2Y6XA 5LOVE 2GK9A 3OYZA 4ILAA 3QK6A 5BMVE 4OYKA 3VR9A 2CMRA 5AQSB 4HWDA 4LF6T 3E22E 2V7MA 4IE6A 4AXPA 4X1YE 3I0QA 4HE8A 2BVMA 3ZCJA 4TX5A 3N9PA 1OEDA 4AISA 1BR2A 2V7JA 2NW7A 2E2AA 3C4ZA 3WI3A 4IDOA 1KNPA 4WZXA 5HEHA 5LA6E 3L39A 2LHRA 2D0TA 3VRAA 3PUGA 3O1HA 4PJLA 4FJOA 4KMCA 2JRKA 4ERRA 2WP9A 2BVLA 3H37A 5KDMC 5HXHA 2I59A 5LXTE 3P8CD 2LM2A 5HCMA 2VQET 5HAXA 2UUAT 3HKDE 3OJAA 3Q2MA 2N1GA 3QB5A 5IYZE 3C98B 5ADXL 2VQFT 3J7Yq 4TN7B 1G8XA 4ZI2C 2CM0A 2VWAA 1QSDA 3VRBA 5AQTB 3Q5EA 3J9X1 4O4IE 2HPJA 2E8IA 3P4QA 4QX7B 1KF6A 5ABFB 5CFBA 1IBMT 1WYBA 4ZXLA 2JQHA 3AXJB 4LMLA 3ONLC 2V6XA 5KXJA 3RC3A 2HH7A 4IDPA 4H9NC 5AQKB 4GIWA 2E9XD 2XM1A 5FNVE 2N2NA 4AQFA 3V5SA 5JDNA 1DU2A 2XQ6A 3ZEFB 2XASB 1YQ4A 4K0KT 3TLSA 4QXCB 4ZI3D 4ILUA 3KVAA 2LE8A 3KVBA 1HNWT 4Z8XA 2YU2A 4WYVA 1VCTA 4O4HE 4ZZCA 4DR2T 2ZM6T 2IW5B 3OVUA 1UK5A 3T8OA 1IZNB 3UU8A 1T8BA 4E7ZA 3N9MA 3OPCA 1UURA 5FL0A 3UT5E 4DR6T 3FBLA 3MXZA 1VOMA 2J47A 3A5XA 3CQXC 2ACXA 2QVAA 5FXVA 3N9QA 4ASKA 2D9DA 3ABVA 2VL8A 5AQFB 2XHEB 3NBXX 4C91A 3Q9DA 4YSZA 3PUAA 3EDUA 2BBHA 1FJGT 2J4GA 4QX8B 4O4LE 5ABGA 1HNXT 3ANWB 1HTJF 4QXHB 3PUQA 2WWUA 2X0LB 4DMWA 1D0XA 1H7CA 4DR3T 1SUMB 1Y01A 1LVKA 3QB5K 1XMOT 2KNDA 3C50A 1UGOA 4X64T 2L8KA 4JI8T 4EZ4A 2JMKA 5ABHA 3AE1A 2JPFA 5ABEA 2FJBA 4YLHA 2V1DB 3RQWA 3EHZA 3JC6C 2VL0A 1HS7A 4HWCA 2WDRA 4PFPA 1MMDA 4UVAB 2DI4A 4NPPA 4IGUA 5AQJB 1HX8A 2P9BA 4I43B 4UVCB 1IBLT 3ZYKA 3LK3B 4KP3C 2CXFA 3MZKB 4L9IA 2LKGA 1FIOA 2EHOD 2K9AA 3C4XA 3ZSTA 5FY7A 2V6YB 3PUXF 1ZEEA 2X9XA 2UXBT 3K3QC 3HR0A 4IE5A 2DL1A 2AXDS 1IAPA 3RRCA 3NVOA 2VASA 4LF7T 1AJ3A 4JV5T 3CIRA 1UX5A 3HI2A 2W0GA 3RI5A 3UU3A 3PU3A 3ZMVB 4UF0A 2KINB 3UU5A 1HNZT 3VU7H 3FZLB 3PE0A 2LOPA 1BR4A 1W0AA 1BR0A 5CA0E 2VKJA 1YQ3A 3BQKA 2VVNA 3TLVA 3DJBA 2CPTA 2WZIA 5AQLB
chains in the Genus database with same CATH topology
2QYWA 1VCSA 3ONJA 2V8SV 3ONLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYW A;  1VCS A;  3ONJ A;  2V8S V;  3ONL C; 
#chains in the Genus database with same CATH topology
 1YKE B;  4TWF A;  4GK5 E;  2A9U A;  3KBU A;  4AI6 A;  4U33 A;  3FZM B;  5FXX A;  4EEB A;  4YSY A;  1ZV4 X;  2LLY A;  3ANW A;  5FMN A;  4JI0 T;  2DLR A;  4H9S E;  5JDM A;  4BJM A;  4KI0 F;  5JR9 C;  5L3B B;  4GYS A;  1IBK T;  4U2Y A;  3P50 A;  1IJ5 A;  1J5W A;  1HCI A;  2I6H A;  2B1E A;  4OHF A;  1UCU A;  5L3D B;  1G73 A;  1T7S A;  4LFB T;  5JRC B;  4U72 A;  3ZC0 A;  2QYW A;  3B13 A;  3RH3 A;  2OLT A;  4K0U A;  5EK3 A;  5TAO A;  2X0H A;  3QUJ A;  1NWM X;  3HKB E;  4EB6 E;  2W63 A;  3HKC E;  1MIW A;  1W09 A;  3CX6 B;  4X5T A;  2XQ5 A;  5AQU B;  4JEH B;  3ZPO A;  3ZKR A;  1JNZ A;  2IAK A;  5LCY A;  5F8P A;  4FI5 A;  4O8S A;  4PK4 A;  2C0S A;  1HG2 A;  1WFD A;  2CA5 A;  4TNW A;  2E5V A;  2V6Y A;  3LBX B;  3EAB A;  3PUW F;  2R6G F;  4A97 A;  4PK5 A;  1VCS A;  3EI0 A;  3AA1 B;  3FBZ A;  3AE7 A;  4AQY T;  2I0M A;  4WBN E;  5E0O A;  5HEJ A;  4QH1 A;  2QA7 A;  2M6I A;  4MLK A;  3JCF A;  4B6X A;  2KWI B;  5J1G A;  4YY3 T;  5AQR B;  3P4P A;  2WU2 A;  5F3J A;  5L3F B;  3AE5 A;  3ETV A;  4DV1 T;  3I1A A;  3UUM A;  2LRL A;  3LK4 2;  2PTF A;  4EED A;  2MTQ A;  4P0B A;  3K3O A;  4LF5 T;  5HEG A;  3UQ7 A;  2A2F X;  2Q9Q D;  2KXP B;  4YJ2 E;  3FB2 A;  4HWI B;  4UV8 B;  4ZEY A;  1M7K A;  1MNE A;  4IE7 A;  3P4R A;  4A98 A;  4DV4 T;  5L2L A;  4DO0 A;  3EAM A;  3C64 A;  1IJ6 A;  1V9D A;  2QGS A;  4UIG A;  4AKG A;  2JIW A;  5HEO A;  2KLQ A;  1HX1 B;  3AE2 A;  3ZJ2 A;  3NZP A;  1MND A;  2CCQ A;  2HN2 A;  4TWH A;  4WBO A;  5C8Y E;  5LBM A;  1I94 T;  2WWV A;  4IDZ A;  5HYA A;  5AQG B;  3PJA A;  4AKH A;  3KFW X;  4H9P C;  3P4S A;  4HKA A;  4X20 E;  4JI4 T;  4Z91 A;  4X1I E;  5AQN B;  1HFA A;  3RYF E;  2UXC T;  1WYC A;  2OA5 A;  3ZT7 A;  4TUY E;  2X67 A;  5KX5 E;  3A7M A;  4U74 A;  2X51 A;  1XDO A;  3W15 B;  4P09 A;  3AEB A;  1NEK A;  3AA0 B;  2CEA A;  4MAL A;  2KMF A;  1WLX A;  3NRX A;  3ZMT B;  4CXW A;  3UFE A;  4O4J E;  2KZ7 B;  3LBX A;  2Q9Q A;  3NRY A;  5AQM B;  5LGN B;  2H88 A;  2WMO A;  3E0Z A;  3PUZ F;  3SWH A;  5C3J A;  2UXN B;  3KV4 A;  2X66 A;  2LSJ A;  2B76 A;  4EXT A;  5H6Q B;  2YK0 A;  2W61 A;  3RGL A;  2E9X C;  3GWH A;  2YEV C;  2CLY C;  3PUY F;  5LHI B;  3ZLI A;  3QOF A;  3B5M A;  2Z6E A;  4L0R A;  3I9W A;  3MKD A;  4IRE A;  3D0T A;  2XSA A;  5CGM A;  4HFB A;  2CLY B;  4WNK A;  3O1I A;  4HFE A;  4ZHQ E;  3RC8 A;  2VUR A;  3OTO T;  1LVF A;  5HXC A;  4DVD A;  4ZI3 C;  4J2C A;  5DQW A;  4ZI7 E;  4F8H A;  2J62 A;  3AEG A;  3IA3 A;  5FY1 A;  4TZ4 C;  4IST A;  4L5G A;  5EZY E;  3VKG A;  2LT3 A;  3ESL A;  4H63 V;  2VKD A;  2F4V T;  1WRD A;  1B7T A;  4HFV A;  3N2K E;  4PJM A;  3ZYL A;  2W67 A;  3C4W A;  1LRZ A;  2JJ9 A;  5L3C B;  2WMN A;  2X9Y A;  5AQQ B;  1OWA A;  2WU5 A;  4YFS A;  3LFM A;  1HF8 A;  5LG3 A;  2YOE A;  2YDQ A;  4AKL A;  2WM9 A;  1N32 T;  4NUU A;  3KV9 A;  4B3T T;  5HCJ A;  4Z90 A;  3I9Y A;  3CML A;  4QH4 A;  2BKO A;  1KNZ A;  3P7I A;  2BS3 A;  5LHG B;  3Q5X A;  4ZZB A;  1CUN A;  5JVD E;  1D1C A;  2LHN A;  2ES0 A;  3TLW A;  3RYH E;  3EUH A;  3I0O A;  4TNV A;  2M6B A;  1SA0 E;  5LG4 A;  3HKE E;  3UTK A;  3UQ4 A;  2FJA A;  2BG9 C;  4MHC A;  2MPK A;  5FXW A;  1XDP A;  2W62 A;  2C5J A;  2V7L A;  1D0Y A;  3VKH A;  2ZMA A;  1Y64 B;  1WCR A;  2EHO C;  3WAJ A;  4ZS2 A;  4EAH A;  4B3S T;  4GKK T;  5EK2 A;  5ABF A;  2NW8 A;  1X9B A;  4KUM B;  3IBP A;  4PAG A;  1E1H B;  3AXJ A;  2D5U A;  3BK9 A;  4GOU A;  1W0B A;  2XAJ B;  4G63 A;  2CWY A;  5JTG A;  3FZK B;  2RP4 A;  1N34 T;  2V8S V;  4LF9 T;  3N5L A;  2ZM2 A;  3ZT5 A;  1UX4 A;  3ONX A;  3N2G E;  2XUE A;  4OYJ A;  2H7V C;  2YIN A;  2XQY A;  2YDR A;  5LP6 E;  5LHH B;  3FXE B;  4ZOL E;  4CI3 B;  1US7 B;  5LNK A;  3AE3 A;  5JDF A;  4HGA A;  5AQO B;  4MFR A;  5AQI B;  3TLU A;  4JLE A;  4H9R C;  3IF8 B;  4YXD A;  3L8R A;  3O9X A;  2KSR A;  2LSY A;  1N36 T;  4UVB B;  5DJQ C;  2XQ4 A;  2IHR 1;  4X62 T;  3AE4 A;  5HXE A;  3KIN B;  3UUB A;  2CHN A;  1I6Z A;  1MMN A;  2CXL A;  2IIU A;  3UUN A;  4OX9 T;  4U7Y A;  2WAU A;  2PJQ A;  3V5U A;  3UFG A;  4AKI A;  1X79 A;  3LSV A;  4YT0 A;  2W00 A;  4CN6 A;  3F31 A;  2PBI A;  5CJ5 A;  4B3M T;  3BQL A;  4JEU B;  3CK6 A;  1YKH B;  4N78 D;  3SS1 A;  1S94 A;  1Z0P A;  4UXN B;  3T1H T;  3SFE A;  4F6R C;  5FL1 A;  2XZE A;  4GYR A;  3RF1 A;  3ZC1 A;  2UXX B;  2IML A;  5JR9 B;  5IWA T;  4JBW F;  1OED C;  2BBJ A;  2WY2 A;  3FXD B;  4YTN A;  2YN6 A;  3RKO A;  3FZH B;  3RX6 A;  2V7I A;  2JMH A;  5M4Y A;  3U78 A;  3MAC A;  4ISS A;  3AVS A;  4YJ3 E;  3H3M A;  3UU6 A;  2VKO A;  4EYU A;  2LM9 A;  3AAA B;  4LMJ A;  3SRZ A;  3LG7 A;  5JDH A;  4U31 A;  2MOZ A;  2LJL A;  2XAQ B;  2L9Q A;  2KT9 A;  2Q9Q C;  2XQA A;  2NP9 A;  2VB6 A;  3JAF A;  1MMA A;  1XNQ T;  5J2U E;  5GON E;  2BKN A;  3ZMZ B;  2BS4 A;  2AE9 A;  2X9W A;  3AB3 B;  2W2U A;  3Q5W A;  2JQK A;  5AQP B;  2DWG A;  1E2A A;  2WB5 A;  5BR8 T;  3CX7 B;  2W66 A;  4AKR B;  4BJN A;  4GK0 E;  4WW0 A;  3ZYM A;  2CE7 A;  3R84 B;  3RLF F;  2K48 A;  4IE0 A;  1MMG A;  3AEC A;  2ZLY A;  4JYA T;  2HN1 A;  3EDV A;  3P4W A;  4HFC A;  4KX6 A;  3ONJ A;  4ZS3 A;  5JDG A;  4HN9 A;  4PFO A;  4CN4 A;  2LKH A;  4DV3 T;  4GKJ T;  5CB4 E;  3RHW A;  4DR7 T;  4IDQ A;  4JI6 T;  5JDQ A;  5LGT B;  2XSB A;  4DV6 T;  3K8P C;  2NWB A;  2QRX A;  2CWO A;  4PJJ A;  3S4U A;  5J0Z A;  4V1A v;  1XMQ T;  5FKY A;  2VK9 A;  2XAH B;  3RIU A;  4H9Q C;  2C5I T;  1R8I A;  2YU1 A;  2JQ9 A;  4AQF C;  3G06 A;  3B57 A;  3A8Y C;  5JR9 A;  5JRC A;  2H3R A;  4OK0 A;  3RYI E;  2V7K A;  4DID B;  3BQI A;  2MYS A;  2Y8D A;  3N2O A;  3RRW A;  2LSI A;  1MIV A;  2G0U A;  2V5D A;  2NW9 A;  4TV8 E;  2VKH A;  2XY8 B;  1ZOY A;  4EIW A;  4DR5 T;  4ADZ A;  1KEY A;  3OBV E;  3M3Z B;  3PUV F;  2UUC T;  3X1D A;  2DNX A;  4JUY A;  5ETW A;  4DUY T;  2WCA A;  1O3X A;  3PUR A;  1U4Q A;  2WDV A;  2FUP A;  3AE6 A;  4IL9 A;  4DV0 T;  5H6R B;  2DCF A;  2D0U A;  1FEW A;  1WR6 A;  1WR0 A;  5EK4 A;  5C2T A;  2WBL A;  4AIU A;  1D1A A;  4IL4 A;  3AAI A;  2DHR A;  4A56 A;  1NEN A;  3AVR A;  2LSK A;  4JI2 T;  4CXX A;  4I55 E;  1CHU A;  3HA4 A;  3UUX B;  2LSG A;  3RQU A;  3AEE A;  4XBF B;  4IDN A;  4PJN A;  5F5W A;  2XAG B;  3CQG B;  2X9H A;  4QXB B;  5AQV B;  1ZHC A;  3RPU A;  4YTM A;  2WQY A;  4LFC T;  1NAF A;  2YKS A;  4AQG A;  3E08 A;  4JI5 T;  2E5L T;  1E7P A;  2BS2 A;  2E9X B;  1D1B A;  2L3L A;  5LGU B;  3HL6 A;  4P1N A;  4EGW A;  5CA1 E;  3ZMU B;  3K1S A;  4I0U A;  2V26 A;  2PFV A;  5LMN T;  3JAD A;  4DBR A;  4KBM B;  2ACZ A;  5JQG E;  4O2B E;  4PNI A;  1HG5 A;  4DBQ A;  2XQ3 A;  3SOL A;  4DUZ T;  4P0A A;  4U7I A;  5JH7 E;  1SE7 A;  3MJX A;  4QHO A;  5AQH B;  3CPZ A;  1T98 A;  1EZ3 A;  4DR4 T;  3ZMS B;  4HWF A;  2CBJ A;  5L4E A;  1J1J A;  3MK7 C;  3Q5D A;  2MAW A;  4OFZ A;  3ZJ1 A;  5KMG P;  4ZI2 D;  3RIA A;  2ZM8 A;  5LYJ E;  2XQ7 A;  4G2A A;  2RPA A;  4I4T E;  2UU9 T;  1MIY A;  1OED E;  2XJ7 A;  4X65 T;  2V5C A;  4HFD A;  4CI2 B;  4EZH A;  2XTL A;  1J5E T;  3N9L A;  1T72 A;  3ZCI A;  5L3G B;  3MA9 A;  3LDQ B;  2A3D A;  3WAK A;  2YDS A;  4ILC A;  4UF0 B;  3AEF A;  3CWZ B;  1FMV A;  5JRE A;  2LRK A;  1OXZ A;  3GMI A;  4A5X A;  5HXS A;  4QKN A;  4DV2 T;  2RA1 A;  3AE9 A;  4PW8 A;  3LK2 B;  3FHN A;  1YD8 G;  4XAX B;  4DV7 T;  5L4H A;  1XWM A;  3OYX A;  2N9D A;  1D0Z A;  4HFH A;  2UUB T;  1QUU A;  5JDL A;  2BG9 B;  3L09 A;  2MBG A;  4DR1 T;  4LF4 T;  2CRB A;  3CQC B;  2E9X A;  3NWI A;  2A72 A;  5AFU L;  4NUV A;  4BA9 A;  4UV9 B;  5LBQ B;  2BKP A;  5LB7 B;  1S35 A;  3GN5 B;  4HWH A;  1KNR A;  5DQV A;  4ANJ A;  4UEL A;  2EHO B;  5HEU A;  2BDE A;  4JI1 T;  2K3W A;  3AED A;  3RYC E;  2PG8 A;  2KWH A;  2XPK A;  3GA8 A;  4KHP T;  2HHH T;  3PJA J;  3ETU A;  4U3C A;  2WSS V;  1ZKE A;  1YW0 A;  4CI1 B;  4H63 H;  3UUL A;  4EYY R;  4I50 E;  3CX8 B;  4B3R T;  5A1L A;  5FY0 A;  3CKD A;  4HTE A;  3O1J A;  4CN1 A;  1KK7 A;  1YXR A;  2NTY A;  2IC9 A;  2FJD A;  1XZY A;  2K5B B;  3CVR A;  2IC6 A;  1FMW A;  3TKL B;  2CXD A;  2UXD T;  4U2Z A;  2BZB A;  2ZM0 A;  3KBT A;  3KV5 A;  3SFD A;  2LEH A;  2XM2 A;  4KHZ F;  5HWY A;  4HFI A;  3F2E A;  3JC6 D;  3U3I A;  4XZC A;  4YSX A;  1U5P A;  3OKQ A;  5FP3 A;  2W4X A;  5FVK A;  4COF A;  3DP7 A;  3KDS E;  2VVS A;  3O4X E;  2WZH A;  2Y48 B;  4HEA A;  2HPL A;  3ZT6 A;  4NXM T;  3N9N A;  1ZP0 A;  2LOS A;  3VR8 A;  2FJE A;  5DAB A;  3KV6 A;  4EOZ B;  5FYM A;  4NXN T;  5HWX A;  4PK6 A;  3F57 A;  3L3P A;  4IE4 A;  4BAY B;  2XAF B;  3VHL A;  3ZN1 B;  3DTO A;  2XQ8 A;  4C90 A;  4UEM A;  4JI7 T;  4IT4 A;  2BG9 A;  4IHJ E;  5L3E B;  4QWN B;  3PV0 F;  3QC9 A;  5FXZ A;  2CHO A;  4LMK A;  3RIU C;  3FZF B;  3PTR B;  2OV9 A;  4X66 T;  3R6N A;  4NIQ A;  4TWD A;  3GN5 A;  1M62 A;  1LKX A;  2NOX A;  2EHO A;  3IHR A;  1W9R A;  4O2A E;  1L0V A;  3PU8 A;  3M65 A;  2NTX A;  2ODU A;  5LJM A;  3RIF A;  1OED B;  1N33 T;  4E7S A;  4YHH T;  4MBQ A;  3H3A A;  3QNU A;  4CQI A;  1BR1 A;  2NR4 A;  2CBI A;  4DV5 T;  1VRB A;  4EV6 A;  4LF8 T;  2WS3 A;  2FBW A;  2X68 A;  1XNR T;  4ILB A;  2D2S A;  3NKZ A;  5LJN A;  2M67 A;  4LFA T;  2SPC A;  4DND A;  3TLT A;  2C5K T;  1SHZ C;  2DWK A;  3LJC A;  3PDY A;  2X0Y A;  4DMV A;  2Q9Q B;  4CZZ B;  3EVY A;  4JI3 T;  4QH5 A;  1UUS A;  3AAE B;  2H89 A;  3UU4 A;  4YHJ A;  4H9O C;  3ZSS A;  5LMU T;  1Z8U A;  2IUB A;  3AE8 A;  2J1D G;  2IDO B;  2XQ9 A;  4Q25 A;  3AA6 B;  1KFY A;  3AA7 B;  3K3N A;  1GQE A;  5FVL A;  3PUS A;  4UR9 A;  5HXR A;  3ZN0 B;  3T1Y T;  4CXY A;  5IUX A;  3AEA A;  4X1K E;  1HR0 T;  3IEE A;  2H7O A;  4TV9 E;  3RKG A;  1JNR A;  3N9O A;  5IHY A;  5L47 A;  3C51 A;  3JAE A;  2ODV A;  3NZQ A;  1QLB A;  2BG9 E;  4IIJ E;  2JQQ A;  4M1P A;  2WDQ A;  4YTP A;  5J2T E;  2K24 A;  2Y6X A;  5LOV E;  2GK9 A;  3OYZ A;  4ILA A;  3QK6 A;  5BMV E;  4OYK A;  3VR9 A;  2CMR A;  5AQS B;  4HWD A;  4LF6 T;  3E22 E;  2V7M A;  4IE6 A;  4AXP A;  4X1Y E;  3I0Q A;  4HE8 A;  2BVM A;  3ZCJ A;  4TX5 A;  3N9P A;  1OED A;  4AIS A;  1BR2 A;  2V7J A;  2NW7 A;  2E2A A;  3C4Z A;  3WI3 A;  4IDO A;  1KNP A;  4WZX A;  5HEH A;  5LA6 E;  3L39 A;  2LHR A;  2D0T A;  3VRA A;  3PUG A;  3O1H A;  4PJL A;  4FJO A;  4KMC A;  2JRK A;  4ERR A;  2WP9 A;  2BVL A;  3H37 A;  5KDM C;  5HXH A;  2I59 A;  5LXT E;  3P8C D;  2LM2 A;  5HCM A;  2VQE T;  5HAX A;  2UUA T;  3HKD E;  3OJA A;  3Q2M A;  2N1G A;  3QB5 A;  5IYZ E;  3C98 B;  5ADX L;  2VQF T;  3J7Y q;  4TN7 B;  1G8X A;  4ZI2 C;  2CM0 A;  2VWA A;  1QSD A;  3VRB A;  5AQT B;  3Q5E A;  3J9X 1;  4O4I E;  2HPJ A;  2E8I A;  3P4Q A;  4QX7 B;  1KF6 A;  5ABF B;  5CFB A;  1IBM T;  1WYB A;  4ZXL A;  2JQH A;  3AXJ B;  4LML A;  3ONL C;  2V6X A;  5KXJ A;  3RC3 A;  2HH7 A;  4IDP A;  4H9N C;  5AQK B;  4GIW A;  2E9X D;  2XM1 A;  5FNV E;  2N2N A;  4AQF A;  3V5S A;  5JDN A;  1DU2 A;  2XQ6 A;  3ZEF B;  2XAS B;  1YQ4 A;  4K0K T;  3TLS A;  4QXC B;  4ZI3 D;  4ILU A;  3KVA A;  2LE8 A;  3KVB A;  1HNW T;  4Z8X A;  2YU2 A;  4WYV A;  1VCT A;  4O4H E;  4ZZC A;  4DR2 T;  2ZM6 T;  2IW5 B;  3OVU A;  1UK5 A;  3T8O A;  1IZN B;  3UU8 A;  1T8B A;  4E7Z A;  3N9M A;  3OPC A;  1UUR A;  5FL0 A;  3UT5 E;  4DR6 T;  3FBL A;  3MXZ A;  1VOM A;  2J47 A;  3A5X A;  3CQX C;  2ACX A;  2QVA A;  5FXV A;  3N9Q A;  4ASK A;  2D9D A;  3ABV A;  2VL8 A;  5AQF B;  2XHE B;  3NBX X;  4C91 A;  3Q9D A;  4YSZ A;  3PUA A;  3EDU A;  2BBH A;  1FJG T;  2J4G A;  4QX8 B;  4O4L E;  5ABG A;  1HNX T;  3ANW B;  1HTJ F;  4QXH B;  3PUQ A;  2WWU A;  2X0L B;  4DMW A;  1D0X A;  1H7C A;  4DR3 T;  1SUM B;  1Y01 A;  1LVK A;  3QB5 K;  1XMO T;  2KND A;  3C50 A;  1UGO A;  4X64 T;  2L8K A;  4JI8 T;  4EZ4 A;  2JMK A;  5ABH A;  3AE1 A;  2JPF A;  5ABE A;  2FJB A;  4YLH A;  2V1D B;  3RQW A;  3EHZ A;  3JC6 C;  2VL0 A;  1HS7 A;  4HWC A;  2WDR A;  4PFP A;  1MMD A;  4UVA B;  2DI4 A;  4NPP A;  4IGU A;  5AQJ B;  1HX8 A;  2P9B A;  4I43 B;  4UVC B;  1IBL T;  3ZYK A;  3LK3 B;  4KP3 C;  2CXF A;  3MZK B;  4L9I A;  2LKG A;  1FIO A;  2EHO D;  2K9A A;  3C4X A;  3ZST A;  5FY7 A;  2V6Y B;  3PUX F;  1ZEE A;  2X9X A;  2UXB T;  3K3Q C;  3HR0 A;  4IE5 A;  2DL1 A;  2AXD S;  1IAP A;  3RRC A;  3NVO A;  2VAS A;  4LF7 T;  1AJ3 A;  4JV5 T;  3CIR A;  1UX5 A;  3HI2 A;  2W0G A;  3RI5 A;  3UU3 A;  3PU3 A;  3ZMV B;  4UF0 A;  2KIN B;  3UU5 A;  1HNZ T;  3VU7 H;  3FZL B;  3PE0 A;  2LOP A;  1BR4 A;  1W0A A;  1BR0 A;  5CA0 E;  2VKJ A;  1YQ3 A;  3BQK A;  2VVN A;  3TLV A;  3DJB A;  2CPT A;  2WZI A;  5AQL B; 
#chains in the Genus database with same CATH homology
 2QYW A;  1VCS A;  3ONJ A;  2V8S V;  3ONL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...