2V8SV

Vti1b habc domain - epsinr enth domain complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
93
structure length
93
Chain Sequence
ASSAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Snare-Adaptor Interaction is a New Mode of Cargo Recognition in Clathrin Coated Vesicles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords CLATHRIN INTERACTOR 1
total genus 38
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2v8sV00
3ONLC 2V8SV 1VCSA 3ONJA 2QYWA
chains in the Genus database with same CATH superfamily
1IBLT 1NENA 4TV9E 4DV1T 3N9MA 2MAWA 4IE7A 4UF0B 2BDEA 5HEUA 3D0TA 3FZMB 5ABGA 3VR8A 3JC6D 4IDOA 3GN5B 4IE6A 4AKRB 5L3FB 4B3ST 4U7YA 5HXRA 2WMNA 5AQHB 3JAEA 5HEHA 1SUMB 3K3QC 5CB4E 4BA9A 2WZHA 4IL9A 2V6XA 2X0LB 1KFYA 3PUSA 1W09A 4I0UA 1G73A 3UUMA 3LJCA 4QX7B 3AEEA 4G63A 1T72A 3AXJA 3DTOA 3P4WA 4I4TE 2MPKA 2P9BA 3SOLA 2M67A 1NEKA 2M6IA 3LDQB 4B3RT 4LF6T 3T1HT 4BJMA 3AE5A 2NR4A 2RA1A 3HKBE 4QH5A 4DR1T 3K3NA 4YTPA 2XQYA 2V7LA 4A5XA 2K48A 3B57A 4HWFA 5L3DB 4TNWA 4E7SA 2V5DA 4ADZA 3LBXB 5LOVE 5EK2A 3AVSA 3ZCJA 2JMKA 3G06A 4HFCA 3ZMSB 4PJMA 2Y8DA 3ZYKA 5HXHA 1HX1B 3SFEA 4HWHA 2JMHA 3RQWA 5E0OA 2Q9QC 3P7IA 5L3EB 1NAFA 1R8IA 4ILUA 1E7PA 2KINB 2UXNB 5HWYA 5LCYA 5JDLA 4AQYT 1ZHCA 2IDOB 4JUYA 5IHYA 2ZLYA 3C4ZA 4AQFC 2UUAT 3Q5DA 2UUCT 4AKHA 4IHJE 4JV5T 2E9XD 3RC3A 2K24A 3FZKB 3GWHA 2YN6A 3CMLA 3KINB 4ISSA 2LHRA 3OJAA 4COFA 3RYCE 2IMLA 3RIUC 3WI3A 3AAEB 1LVKA 3NWIA 4YFSA 3AEFA 2AXDS 1WFDA 2Y6XA 3A7MA 4V1Av 3N2OA 4ANJA 5LHGB 4DV2T 3BQKA 3ZN0B 2XQ8A 3F57A 4IE0A 1GQEA 4IDQA 4CI3B 4CQIA 2V5CA 3AA7B 3FZLB 4H63H 4MFRA 2J4GA 4HFHA 2BKNA 1IJ6A 2V6YB 2WDRA 4YSZA 3IBPA 4AISA 4FJOA 4X62T 4AQFA 3T1YT 2BG9B 5KXJA 2FBWA 1E1HB 3OYZA 2BKPA 2VKHA 3PJAA 5DQVA 5FXVA 3RIAA 4EB6E 5JR9C 4K0KT 1FMVA 2E9XC 2EHOC 5L2LA 4DV6T 4EEDA 3P4SA 3UU6A 3RH3A 1HG5A 3ZN1B 5FXXA 2LOSA 2AE9A 2EHOB 2X51A 3RPUA 3TLSA 3N5LA 1XNQT 2SPCA 4Q25A 3ZT6A 2PBIA 3Q2MA 4HE8A 2BZBA 4EAHA 1HNZT 4YSXA 3J7Yq 4DMWA 4YTNA 1UX5A 2EHOA 2OLTA 2V7IA 3P4QA 4O4IE 3ZT7A 5BR8T 4LFBT 3HI2A 1XNRT 5LJNA 2HN1A 3GN5A 5GONE 2H88A 2NOXA 3L8RA 1Y01A 1MIWA 3AAIA 4PK4A 5LG3A 4CN1A 2CHNA 2V7MA 4HWDA 3AE4A 2W63A 3OPCA 5AFUL 2CXFA 2NWBA 2UXXB 4UVBB 3TLTA 2VWAA 2IAKA 1B7TA 1Y64B 2WDQA 2K3WA 3KVAA 3KV5A 3NRXA 3P4PA 3CQXC 2WMOA 2H7OA 4F8HA 4UR9A 4JI5T 4JYAT 2V8SV 1VCSA 3ANWB 3CX8B 4K0UA 1ZEEA 2G0UA 4NIQA 4U2YA 3RYHE 4A97A 5L3BB 4EV6A 2C5JA 2C5IT 4JEHB 1OEDB 1WYBA 5F3JA 3HKCE 2B1EA 3HA4A 3I1AA 3JCFA 4OYJA 1XDOA 5TAOA 3RYIE 3FBLA 3U3IA 4LF8T 4ZI7E 2ODVA 5LJMA 1J5WA 5AQKB 1IBMT 1XDPA 2NW9A 3SWHA 2WZIA 2BG9E 5CA1E 3CX6B 1IZNB 2VQET 1WR0A 3L3PA 2NTYA 2YINA 1KNRA 1VOMA 5LBQB 3X1DA 1UK5A 1ZV4X 4DR3T 4ZI3C 2MBGA 3RX6A 2YKSA 3C4XA 2KLQA 3KBUA 5ABFB 2A72A 2M6BA 2X68A 1LVFA 1OWAA 3PV0F 1XMOT 2NP9A 2QYWA 4EEBA 4ZI2C 3KV6A 2HPJA 3N9QA 3VRAA 2LT3A 1MNDA 2LLYA 2PG8A 2W67A 4XZCA 3T8OA 5LMNT 3LG7A 5HXEA 4JI6T 1ZKEA 3HR0A 2E5LT 1MIVA 2WDVA 4YHHT 4PW8A 4B6XA 1J1JA 4P0BA 2YDSA 4E7ZA 5FNVE 1NWMX 2ES0A 4PK5A 5JDNA 2XJ7A 1HS7A 1WYCA 2I59A 2I0MA 2UXDT 3LK2B 4X1YE 5LP6E 2RPAA 4DV5T 4O4LE 5EK3A 4XBFB 2C5KT 2ACZA 4GKKT 2LSGA 1T8BA 1UX4A 2MYSA 4X5TA 5L4HA 3UULA 2VKOA 3B13A 4KI0F 3PUGA 3TLUA 3ZSSA 1T7SA 1AJ3A 2VKJA 1YQ4A 3NBXX 4X20E 1HNXT 3N2KE 4L5GA 4PJLA 1UGOA 1OEDC 2CXDA 4CN6A 2W62A 2J47A 4ASKA 5LMUT 3EUHA 4LMKA 1M7KA 1YKEB 2E9XA 3QUJA 4HFBA 3OBVE 4QX8B 2XAFB 3HKEE 4UVCB 4ZS3A 3I0QA 4CN4A 1US7B 5F5WA 2W00A 2A2FX 3AA0B 5FL0A 2CEAA 4WZXA 2YEVC 3N2GE 4JI2T 3UUXB 5LHHB 2N9DA 1KF6A 2J62A 1YW0A 4QKNA 4YTMA 4KHZF 5AQOB 3VKHA 4P0AA 2XY8B 1HR0T 2XSBA 3MZKB 5H6RB 5M4YA 4HGAA 3RC8A 4UV8B 4TX5A 3AXJB 4DV7T 4B3MT 4IDPA 4DO0A 4ZS2A 1LKXA 4HTEA 1N34T 2LE8A 2LSJA 3VRBA 4ISTA 1JNRA 3CKDA 4OX9T 4IDZA 3UT5E 3N9LA 5HEGA 5AQNB 3TLWA 4F6RC 3C50A 3PJAJ 3C64A 4PJNA 2BBHA 1O3XA 2DLRA 4U3CA 3ZMZB 3CIRA 2HHHT 4LF4T 2BS2A 2BS4A 4GIWA 3ZYLA 1X79A 3FXDB 3LBXA 3AEBA 3MJXA 3AE7A 4HKAA 4IE4A 4ZHQE 2UU9T 2FJDA 5JREA 2WQYA 3PURA 5ETWA 2KMFA 4DV4T 4DR5T 2FJEA 3ABVA 4DR6T 3O9XA 2CM0A 4P09A 2A9UA 4JI4T 2PJQA 5FMNA 3PUQA 1IAPA 4MALA 4PNIA 2V6YA 4I43B 1MMGA 1S94A 3Q5XA 4HN9A 3PDYA 2XM2A 3H3AA 4WBNE 1D0ZA 4OFZA 5IYZE 4TZ4C 3OKQA 4X66T 1IJ5A 2VURA 3I0OA 3N9PA 4HFVA 4WBOA 3R6NA 4H9OC 3MK7C 4QXBB 4DVDA 4DBQA 1N36T 3RGLA 1L0VA 4EYYR 5AQQB 2XASB 3RF1A 3PUVF 4YXDA 3JC6C 4L9IA 5HWXA 2XAJB 3AEAA 3NKZA 1D0YA 3IF8B 2W0GA 4YT0A 2LJLA 4TUYE 1FEWA 5LGNB 5FVLA 5L3GB 2JQ9A 3QNUA 4DIDB 2KXPB 5ABFA 5LGTB 3JAFA 3AA1B 4H9QC 4YHJA 5DJQC 2FJAA 2GK9A 2IHR1 2JJ9A 5KDMC 4LF7T 2L9QA 4H9SE 2VVNA 4HWCA 5C3JA 5F8PA 3NRYA 1Z0PA 2BG9A 3R84B 3IHRA 4Z91A 3ZEFB 4KMCA 4N78D 4ZI3D 1SE7A 1KNZA 2BVMA 1HX8A 2JQKA 4H63V 1U5PA 3AECA 2DWGA 2KT9A 3O1HA 4PJJA 2HH7A 2LRLA 1YKHB 3OVUA 3ONXA 4KX6A 4EOZB 2B76A 2DL1A 2CLYB 4ILBA 4OK0A 2H7VC 3KBTA 3UU5A 2WSSV 4JI7T 2KWHA 4QWNB 4DR4T 5J2UE 1FIOA 2L8KA 1CHUA 3EHZA 4H9PC 1HG2A 2X9XA 1WCRA 4IIJE 2FUPA 3CQGB 3WAKA 4QXHB 4YJ2E 4HEAA 3LK3B 4AKGA 4QH1A 2J1DG 2V7JA 2WWVA 3FZFB 3PUYF 2QA7A 2KZ7B 4KBMB 2VKDA 4YSYA 3UQ4A 4CXWA 1N33T 2UUBT 1BR2A 4UXNB 4XAXB 4O2AE 5JDHA 5IUXA 1D1AA 4KHPT 2MTQA 1YXRA 3MACA 2H89A 4EYUA 1HNWT 5LA6E 5L3CB 1BR0A 3DJBA 4NUUA 2WCAA 5C8YE 2LKGA 2V26A 1MNEA 3HL6A 3AB3B 3LSVA 4TWFA 2CWYA 3PU3A 2JPFA 5HXCA 3UTKA 5L47A 2WBLA 3J9X1 3DP7A 2IC9A 2VL8A 3L09A 2E5VA 3HKDE 4UV9B 5IWAT 4OHFA 3O1IA 4EZ4A 3UU4A 3FXEB 3ZMTB 5DABA 5ABHA 5HXSA 2YU1A 2BKOA 2VASA 3KV4A 4IL4A 3ONLC 4LMJA 5AQPB 4G2AA 3KDSE 1KK7A 1KNPA 2C0SA 2VVSA 1V9DA 3BK9A 4TN7B 4A56A 3ZT5A 4DR2T 5CA0E 3P4RA 3FBZA 2DNXA 3FZHB 4EZHA 4QHOA 5AQVB 2N1GA 1OEDE 2K9AA 3E0ZA 5ADXL 1FJGT 2XQ3A 2XQ7A 3ZC1A 3UQ7A 4JI0T 4NXMT 3AEDA 4MHCA 3UUNA 3IA3A 1QLBA 1BR1A 3Q9DA 5HEOA 1JNZA 3RI5A 4GKJT 4U72A 3SFDA 3M65A 4LF9T 4GK5E 2ZMAA 3N9OA 3PTRB 3AVRA 1D1BA 2PTFA 4ZZCA 1CUNA 2D2SA 2W61A 3CWZB 1MMDA 3W15B 3EABA 3V5SA 3A8YC 4ILCA 4O2BE 1OXZA 5LBMA 2BVLA 3C98B 2MOZA 2Q9QD 4TWHA 3VHLA 2CHOA 3C51A 4DMVA 2UXBT 4LF5T 2NTXA 3SRZA 2XM1A 1VRBA 3EDUA 2XPKA 4IREA 3WAJA 2XQ9A 4PAGA 4AIUA 3O1JA 1SA0E 2LM2A 3QC9A 2VK9A 4HWIB 3BQIA 3AE6A 4UVAB 5LXTE 4FI5A 4I50E 5JR9B 2LSIA 3MKDA 3MA9A 1LRZA 4QXCB 3P8CD 5AQGB 4WW0A 3Q5WA 3V5UA 1G8XA 3RKGA 2YU2A 4BJNA 4O4JE 5AQSB 4EGWA 2V1DB 2E2AA 3EI0A 2X9YA 2X9WA 3K1SA 1H7CA 4MLKA 5HCJA 4ZXLA 2DHRA 5KMGP 4X65T 4DR7T 2D9DA 1HFAA 2YK0A 3RYFE 1MIYA 2Q9QB 2WWUA 5FY0A 3UU8A 4YLHA 1HF8A 2W2UA 1EZ3A 2A3DA 1HTJF 2WY2A 2KWIB 3ANWA 3CVRA 3ETVA 3NZQA 1ZP0A 5JQGE 2F4VT 4AXPA 4O4HE 3OTOT 5HAXA 3VKGA 3AE2A 2CRBA 4ILAA 2N2NA 2IIUA 5AQLB 5A1LA 2CCQA 2CXLA 4DV3T 4LMLA 2LHNA 5JR9A 5KX5E 5HCMA 3BQLA 5FP3A 2WAUA 5L4EA 4LFAT 2ZM8A 3FB2A 4NUVA 3UFEA 3ZLIA 2ZM6T 4DV0T 2WU2A 2LOPA 3OYXA 2NW8A 1OEDA 2DI4A 2H3RA 4X1KE 3GMIA 5HEJA 1WRDA 2D0TA 3H3MA 5FVKA 3PUZF 4CZZB 3ZSTA 3PE0A 2NW7A 2LKHA 1W9RA 2XAQB 3EAMA 4U33A 5FKYA 4IE5A 5AQRB 2YDRA 4ZZBA 2L3LA 5FL1A 1T98A 1XWMA 4DUYT 3CQCB 4IT4A 2CMRA 5FY7A 3GA8A 4H9RC 4YJ3E 4DNDA 5ABEA 4U31A 4ERRA 4HFDA 1UURA 3N9NA 4LFCT 3K8PC 3QOFA 3KVBA 4AQGA 4PFPA 2DWKA 4X64T 4ZEYA 3U78A 5FXWA 2HN2A 4EIWA 1YQ3A 2WS3A 4CI1B 1KEYA 4X1IE 2ZM0A 5AQIB 2WP9A 4DUZT 4UIGA 2K5BB 4JI1T 5BMVE 4GOUA 4QH4A 3C4WA 2R6GF 4Z90A 1Z8UA 2LM9A 3E08A 3RRCA 2KNDA 4JLEA 5J1GA 1N32T 2W4XA 3F2EA 1HCIA 2WM9A 2OA5A 3PUAA 1VCTA 4GK0E 1SHZC 2VL0A 3AAAB 3P50A 3L39A 2Y48B 3RHWA 5JDMA 3E22E 5FXZA 3NVOA 2CA5A 2D0UA 1QUUA 4GYRA 3H37A 3RQUA 3VU7H 1ZOYA 4M1PA 3ZJ1A 2QGSA 3AA6B 3PUXF 5LB7B 2D5UA 1X9BA 4P1NA 2IW5B 5DQWA 2W66A 1FMWA 3B5MA 3SS1A 3LFMA 4JI3T 1J5ET 1XZYA 2LEHA 1D1CA 2XQAA 3MXZA 3VR9A 1WLXA 1I94T 2ACXA 2X0HA 2ZM2A 3O4XE 3I9YA 4UELA 3ZYMA 3M3ZB 2LSKA 4HFIA 2Z6EA 4AI6A 2OV9A 3RIUA 5EZYE 4GYSA 5AQTB 2IC6A 2DCFA 2HPLA 5AQMB 5JH7E 2FJBA 2IUBA 4OYKA 3ZC0A 2JRKA 2LRKA 4Z8XA 4C90A 3I9WA 4AKIA 5CJ5A 5J0ZA 2CE7A 1MMNA 2E8IA 4DBRA 1QSDA 2CLYC 4TNVA 4C91A 5JTGA 1U4QA 4U2ZA 3Q5EA 5H6QB 3ZMVB 4O8SA 4U7IA 2CBJA 3ZJ2A 1M62A 2VQFT 1W0AA 2V7KA 1BR4A 3LK42 5LYJE 1IBKT 2BG9C 4J2CA 3IEEA 3NZPA 2JQHA 3RIFA 2XAGB 3ZPOA 1WR6A 2BS3A 3FHNA 2E9XB 4IGUA 3RKOA 2XHEB 3ZCIA 5CFBA 3PUWF 2XUEA 4BAYB 2Q9QA 3JADA 4HFEA 3CK6A 4H9NC 4TWDA 3A5XA 4WYVA 4CI2B 5LHIB 4ZI2D 4CXYA 2YOEA 5FY1A 2XQ5A 2CBIA 4KP3C 5JDGA 2UXCT 1I6ZA 2XSAA 2QRXA 3EVYA 2XTLA 1MMAA 5FYMA 3RRWA 4A98A 5LNKA 5JRCB 4KUMB 4NXNT 1UCUA 1D0XA 3ESLA 2JIWA 4UEMA 3CX7B 5JVDE 2LSYA 3KV9A 5AQUB 4PFOA 2XQ6A 4JI8T 2YDQA 5JRCA 2CWOA 3RLFF 5C2TA 3AEGA 2XQ4A 3PU8A 5LGUB 4PK6A 5AQJB 4YY3T 2ODUA 4CXXA 2X67A 3UFGA 4JEUB 3ETUA 2VB6A 4EXTA 4TV8E 4B3TT 3QB5K 4UF0A 2EHOD 4I55E 3ZMUB 2PFVA 2BBJA 2WU5A 3EDVA 2I6HA 4AKLA 4MBQA 3ONJA 5AQFB 4ZOLE 3QB5A 2RP4A 4U74A 5EK4A 5JDQA 1UUSA 5JDFA 2QVAA 3KFWX 3TKLB 3F31A 5HYAA 3AE1A 3AE8A 4NPPA 3S4UA 2XAHB 2XZEA 3TLVA 5CGMA 3QK6A 2X0YA 1XMQT 1S35A 3AE9A 4JBWF 3K3OA 1W0BA 2KSRA 2CPTA 4IDNA 1E2AA 5J2TE 3CPZA 2WB5A 1DU2A 2X9HA 3UU3A 1YD8G 2JQQA 4WNKA 4L0RA 3ZKRA 3UUBA 5LG4A 2X66A 3AE3A
chains in the Genus database with same CATH topology
3ONLC 2V8SV 1VCSA 3ONJA 2QYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONL C;  2V8S V;  1VCS A;  3ONJ A;  2QYW A; 
#chains in the Genus database with same CATH topology
 1IBL T;  1NEN A;  4TV9 E;  4DV1 T;  3N9M A;  2MAW A;  4IE7 A;  4UF0 B;  2BDE A;  5HEU A;  3D0T A;  3FZM B;  5ABG A;  3VR8 A;  3JC6 D;  4IDO A;  3GN5 B;  4IE6 A;  4AKR B;  5L3F B;  4B3S T;  4U7Y A;  5HXR A;  2WMN A;  5AQH B;  3JAE A;  5HEH A;  1SUM B;  3K3Q C;  5CB4 E;  4BA9 A;  2WZH A;  4IL9 A;  2V6X A;  2X0L B;  1KFY A;  3PUS A;  1W09 A;  4I0U A;  1G73 A;  3UUM A;  3LJC A;  4QX7 B;  3AEE A;  4G63 A;  1T72 A;  3AXJ A;  3DTO A;  3P4W A;  4I4T E;  2MPK A;  2P9B A;  3SOL A;  2M67 A;  1NEK A;  2M6I A;  3LDQ B;  4B3R T;  4LF6 T;  3T1H T;  4BJM A;  3AE5 A;  2NR4 A;  2RA1 A;  3HKB E;  4QH5 A;  4DR1 T;  3K3N A;  4YTP A;  2XQY A;  2V7L A;  4A5X A;  2K48 A;  3B57 A;  4HWF A;  5L3D B;  4TNW A;  4E7S A;  2V5D A;  4ADZ A;  3LBX B;  5LOV E;  5EK2 A;  3AVS A;  3ZCJ A;  2JMK A;  3G06 A;  4HFC A;  3ZMS B;  4PJM A;  2Y8D A;  3ZYK A;  5HXH A;  1HX1 B;  3SFE A;  4HWH A;  2JMH A;  3RQW A;  5E0O A;  2Q9Q C;  3P7I A;  5L3E B;  1NAF A;  1R8I A;  4ILU A;  1E7P A;  2KIN B;  2UXN B;  5HWY A;  5LCY A;  5JDL A;  4AQY T;  1ZHC A;  2IDO B;  4JUY A;  5IHY A;  2ZLY A;  3C4Z A;  4AQF C;  2UUA T;  3Q5D A;  2UUC T;  4AKH A;  4IHJ E;  4JV5 T;  2E9X D;  3RC3 A;  2K24 A;  3FZK B;  3GWH A;  2YN6 A;  3CML A;  3KIN B;  4ISS A;  2LHR A;  3OJA A;  4COF A;  3RYC E;  2IML A;  3RIU C;  3WI3 A;  3AAE B;  1LVK A;  3NWI A;  4YFS A;  3AEF A;  2AXD S;  1WFD A;  2Y6X A;  3A7M A;  4V1A v;  3N2O A;  4ANJ A;  5LHG B;  4DV2 T;  3BQK A;  3ZN0 B;  2XQ8 A;  3F57 A;  4IE0 A;  1GQE A;  4IDQ A;  4CI3 B;  4CQI A;  2V5C A;  3AA7 B;  3FZL B;  4H63 H;  4MFR A;  2J4G A;  4HFH A;  2BKN A;  1IJ6 A;  2V6Y B;  2WDR A;  4YSZ A;  3IBP A;  4AIS A;  4FJO A;  4X62 T;  4AQF A;  3T1Y T;  2BG9 B;  5KXJ A;  2FBW A;  1E1H B;  3OYZ A;  2BKP A;  2VKH A;  3PJA A;  5DQV A;  5FXV A;  3RIA A;  4EB6 E;  5JR9 C;  4K0K T;  1FMV A;  2E9X C;  2EHO C;  5L2L A;  4DV6 T;  4EED A;  3P4S A;  3UU6 A;  3RH3 A;  1HG5 A;  3ZN1 B;  5FXX A;  2LOS A;  2AE9 A;  2EHO B;  2X51 A;  3RPU A;  3TLS A;  3N5L A;  1XNQ T;  2SPC A;  4Q25 A;  3ZT6 A;  2PBI A;  3Q2M A;  4HE8 A;  2BZB A;  4EAH A;  1HNZ T;  4YSX A;  3J7Y q;  4DMW A;  4YTN A;  1UX5 A;  2EHO A;  2OLT A;  2V7I A;  3P4Q A;  4O4I E;  3ZT7 A;  5BR8 T;  4LFB T;  3HI2 A;  1XNR T;  5LJN A;  2HN1 A;  3GN5 A;  5GON E;  2H88 A;  2NOX A;  3L8R A;  1Y01 A;  1MIW A;  3AAI A;  4PK4 A;  5LG3 A;  4CN1 A;  2CHN A;  2V7M A;  4HWD A;  3AE4 A;  2W63 A;  3OPC A;  5AFU L;  2CXF A;  2NWB A;  2UXX B;  4UVB B;  3TLT A;  2VWA A;  2IAK A;  1B7T A;  1Y64 B;  2WDQ A;  2K3W A;  3KVA A;  3KV5 A;  3NRX A;  3P4P A;  3CQX C;  2WMO A;  2H7O A;  4F8H A;  4UR9 A;  4JI5 T;  4JYA T;  2V8S V;  1VCS A;  3ANW B;  3CX8 B;  4K0U A;  1ZEE A;  2G0U A;  4NIQ A;  4U2Y A;  3RYH E;  4A97 A;  5L3B B;  4EV6 A;  2C5J A;  2C5I T;  4JEH B;  1OED B;  1WYB A;  5F3J A;  3HKC E;  2B1E A;  3HA4 A;  3I1A A;  3JCF A;  4OYJ A;  1XDO A;  5TAO A;  3RYI E;  3FBL A;  3U3I A;  4LF8 T;  4ZI7 E;  2ODV A;  5LJM A;  1J5W A;  5AQK B;  1IBM T;  1XDP A;  2NW9 A;  3SWH A;  2WZI A;  2BG9 E;  5CA1 E;  3CX6 B;  1IZN B;  2VQE T;  1WR0 A;  3L3P A;  2NTY A;  2YIN A;  1KNR A;  1VOM A;  5LBQ B;  3X1D A;  1UK5 A;  1ZV4 X;  4DR3 T;  4ZI3 C;  2MBG A;  3RX6 A;  2YKS A;  3C4X A;  2KLQ A;  3KBU A;  5ABF B;  2A72 A;  2M6B A;  2X68 A;  1LVF A;  1OWA A;  3PV0 F;  1XMO T;  2NP9 A;  2QYW A;  4EEB A;  4ZI2 C;  3KV6 A;  2HPJ A;  3N9Q A;  3VRA A;  2LT3 A;  1MND A;  2LLY A;  2PG8 A;  2W67 A;  4XZC A;  3T8O A;  5LMN T;  3LG7 A;  5HXE A;  4JI6 T;  1ZKE A;  3HR0 A;  2E5L T;  1MIV A;  2WDV A;  4YHH T;  4PW8 A;  4B6X A;  1J1J A;  4P0B A;  2YDS A;  4E7Z A;  5FNV E;  1NWM X;  2ES0 A;  4PK5 A;  5JDN A;  2XJ7 A;  1HS7 A;  1WYC A;  2I59 A;  2I0M A;  2UXD T;  3LK2 B;  4X1Y E;  5LP6 E;  2RPA A;  4DV5 T;  4O4L E;  5EK3 A;  4XBF B;  2C5K T;  2ACZ A;  4GKK T;  2LSG A;  1T8B A;  1UX4 A;  2MYS A;  4X5T A;  5L4H A;  3UUL A;  2VKO A;  3B13 A;  4KI0 F;  3PUG A;  3TLU A;  3ZSS A;  1T7S A;  1AJ3 A;  2VKJ A;  1YQ4 A;  3NBX X;  4X20 E;  1HNX T;  3N2K E;  4L5G A;  4PJL A;  1UGO A;  1OED C;  2CXD A;  4CN6 A;  2W62 A;  2J47 A;  4ASK A;  5LMU T;  3EUH A;  4LMK A;  1M7K A;  1YKE B;  2E9X A;  3QUJ A;  4HFB A;  3OBV E;  4QX8 B;  2XAF B;  3HKE E;  4UVC B;  4ZS3 A;  3I0Q A;  4CN4 A;  1US7 B;  5F5W A;  2W00 A;  2A2F X;  3AA0 B;  5FL0 A;  2CEA A;  4WZX A;  2YEV C;  3N2G E;  4JI2 T;  3UUX B;  5LHH B;  2N9D A;  1KF6 A;  2J62 A;  1YW0 A;  4QKN A;  4YTM A;  4KHZ F;  5AQO B;  3VKH A;  4P0A A;  2XY8 B;  1HR0 T;  2XSB A;  3MZK B;  5H6R B;  5M4Y A;  4HGA A;  3RC8 A;  4UV8 B;  4TX5 A;  3AXJ B;  4DV7 T;  4B3M T;  4IDP A;  4DO0 A;  4ZS2 A;  1LKX A;  4HTE A;  1N34 T;  2LE8 A;  2LSJ A;  3VRB A;  4IST A;  1JNR A;  3CKD A;  4OX9 T;  4IDZ A;  3UT5 E;  3N9L A;  5HEG A;  5AQN B;  3TLW A;  4F6R C;  3C50 A;  3PJA J;  3C64 A;  4PJN A;  2BBH A;  1O3X A;  2DLR A;  4U3C A;  3ZMZ B;  3CIR A;  2HHH T;  4LF4 T;  2BS2 A;  2BS4 A;  4GIW A;  3ZYL A;  1X79 A;  3FXD B;  3LBX A;  3AEB A;  3MJX A;  3AE7 A;  4HKA A;  4IE4 A;  4ZHQ E;  2UU9 T;  2FJD A;  5JRE A;  2WQY A;  3PUR A;  5ETW A;  2KMF A;  4DV4 T;  4DR5 T;  2FJE A;  3ABV A;  4DR6 T;  3O9X A;  2CM0 A;  4P09 A;  2A9U A;  4JI4 T;  2PJQ A;  5FMN A;  3PUQ A;  1IAP A;  4MAL A;  4PNI A;  2V6Y A;  4I43 B;  1MMG A;  1S94 A;  3Q5X A;  4HN9 A;  3PDY A;  2XM2 A;  3H3A A;  4WBN E;  1D0Z A;  4OFZ A;  5IYZ E;  4TZ4 C;  3OKQ A;  4X66 T;  1IJ5 A;  2VUR A;  3I0O A;  3N9P A;  4HFV A;  4WBO A;  3R6N A;  4H9O C;  3MK7 C;  4QXB B;  4DVD A;  4DBQ A;  1N36 T;  3RGL A;  1L0V A;  4EYY R;  5AQQ B;  2XAS B;  3RF1 A;  3PUV F;  4YXD A;  3JC6 C;  4L9I A;  5HWX A;  2XAJ B;  3AEA A;  3NKZ A;  1D0Y A;  3IF8 B;  2W0G A;  4YT0 A;  2LJL A;  4TUY E;  1FEW A;  5LGN B;  5FVL A;  5L3G B;  2JQ9 A;  3QNU A;  4DID B;  2KXP B;  5ABF A;  5LGT B;  3JAF A;  3AA1 B;  4H9Q C;  4YHJ A;  5DJQ C;  2FJA A;  2GK9 A;  2IHR 1;  2JJ9 A;  5KDM C;  4LF7 T;  2L9Q A;  4H9S E;  2VVN A;  4HWC A;  5C3J A;  5F8P A;  3NRY A;  1Z0P A;  2BG9 A;  3R84 B;  3IHR A;  4Z91 A;  3ZEF B;  4KMC A;  4N78 D;  4ZI3 D;  1SE7 A;  1KNZ A;  2BVM A;  1HX8 A;  2JQK A;  4H63 V;  1U5P A;  3AEC A;  2DWG A;  2KT9 A;  3O1H A;  4PJJ A;  2HH7 A;  2LRL A;  1YKH B;  3OVU A;  3ONX A;  4KX6 A;  4EOZ B;  2B76 A;  2DL1 A;  2CLY B;  4ILB A;  4OK0 A;  2H7V C;  3KBT A;  3UU5 A;  2WSS V;  4JI7 T;  2KWH A;  4QWN B;  4DR4 T;  5J2U E;  1FIO A;  2L8K A;  1CHU A;  3EHZ A;  4H9P C;  1HG2 A;  2X9X A;  1WCR A;  4IIJ E;  2FUP A;  3CQG B;  3WAK A;  4QXH B;  4YJ2 E;  4HEA A;  3LK3 B;  4AKG A;  4QH1 A;  2J1D G;  2V7J A;  2WWV A;  3FZF B;  3PUY F;  2QA7 A;  2KZ7 B;  4KBM B;  2VKD A;  4YSY A;  3UQ4 A;  4CXW A;  1N33 T;  2UUB T;  1BR2 A;  4UXN B;  4XAX B;  4O2A E;  5JDH A;  5IUX A;  1D1A A;  4KHP T;  2MTQ A;  1YXR A;  3MAC A;  2H89 A;  4EYU A;  1HNW T;  5LA6 E;  5L3C B;  1BR0 A;  3DJB A;  4NUU A;  2WCA A;  5C8Y E;  2LKG A;  2V26 A;  1MNE A;  3HL6 A;  3AB3 B;  3LSV A;  4TWF A;  2CWY A;  3PU3 A;  2JPF A;  5HXC A;  3UTK A;  5L47 A;  2WBL A;  3J9X 1;  3DP7 A;  2IC9 A;  2VL8 A;  3L09 A;  2E5V A;  3HKD E;  4UV9 B;  5IWA T;  4OHF A;  3O1I A;  4EZ4 A;  3UU4 A;  3FXE B;  3ZMT B;  5DAB A;  5ABH A;  5HXS A;  2YU1 A;  2BKO A;  2VAS A;  3KV4 A;  4IL4 A;  3ONL C;  4LMJ A;  5AQP B;  4G2A A;  3KDS E;  1KK7 A;  1KNP A;  2C0S A;  2VVS A;  1V9D A;  3BK9 A;  4TN7 B;  4A56 A;  3ZT5 A;  4DR2 T;  5CA0 E;  3P4R A;  3FBZ A;  2DNX A;  3FZH B;  4EZH A;  4QHO A;  5AQV B;  2N1G A;  1OED E;  2K9A A;  3E0Z A;  5ADX L;  1FJG T;  2XQ3 A;  2XQ7 A;  3ZC1 A;  3UQ7 A;  4JI0 T;  4NXM T;  3AED A;  4MHC A;  3UUN A;  3IA3 A;  1QLB A;  1BR1 A;  3Q9D A;  5HEO A;  1JNZ A;  3RI5 A;  4GKJ T;  4U72 A;  3SFD A;  3M65 A;  4LF9 T;  4GK5 E;  2ZMA A;  3N9O A;  3PTR B;  3AVR A;  1D1B A;  2PTF A;  4ZZC A;  1CUN A;  2D2S A;  2W61 A;  3CWZ B;  1MMD A;  3W15 B;  3EAB A;  3V5S A;  3A8Y C;  4ILC A;  4O2B E;  1OXZ A;  5LBM A;  2BVL A;  3C98 B;  2MOZ A;  2Q9Q D;  4TWH A;  3VHL A;  2CHO A;  3C51 A;  4DMV A;  2UXB T;  4LF5 T;  2NTX A;  3SRZ A;  2XM1 A;  1VRB A;  3EDU A;  2XPK A;  4IRE A;  3WAJ A;  2XQ9 A;  4PAG A;  4AIU A;  3O1J A;  1SA0 E;  2LM2 A;  3QC9 A;  2VK9 A;  4HWI B;  3BQI A;  3AE6 A;  4UVA B;  5LXT E;  4FI5 A;  4I50 E;  5JR9 B;  2LSI A;  3MKD A;  3MA9 A;  1LRZ A;  4QXC B;  3P8C D;  5AQG B;  4WW0 A;  3Q5W A;  3V5U A;  1G8X A;  3RKG A;  2YU2 A;  4BJN A;  4O4J E;  5AQS B;  4EGW A;  2V1D B;  2E2A A;  3EI0 A;  2X9Y A;  2X9W A;  3K1S A;  1H7C A;  4MLK A;  5HCJ A;  4ZXL A;  2DHR A;  5KMG P;  4X65 T;  4DR7 T;  2D9D A;  1HFA A;  2YK0 A;  3RYF E;  1MIY A;  2Q9Q B;  2WWU A;  5FY0 A;  3UU8 A;  4YLH A;  1HF8 A;  2W2U A;  1EZ3 A;  2A3D A;  1HTJ F;  2WY2 A;  2KWI B;  3ANW A;  3CVR A;  3ETV A;  3NZQ A;  1ZP0 A;  5JQG E;  2F4V T;  4AXP A;  4O4H E;  3OTO T;  5HAX A;  3VKG A;  3AE2 A;  2CRB A;  4ILA A;  2N2N A;  2IIU A;  5AQL B;  5A1L A;  2CCQ A;  2CXL A;  4DV3 T;  4LML A;  2LHN A;  5JR9 A;  5KX5 E;  5HCM A;  3BQL A;  5FP3 A;  2WAU A;  5L4E A;  4LFA T;  2ZM8 A;  3FB2 A;  4NUV A;  3UFE A;  3ZLI A;  2ZM6 T;  4DV0 T;  2WU2 A;  2LOP A;  3OYX A;  2NW8 A;  1OED A;  2DI4 A;  2H3R A;  4X1K E;  3GMI A;  5HEJ A;  1WRD A;  2D0T A;  3H3M A;  5FVK A;  3PUZ F;  4CZZ B;  3ZST A;  3PE0 A;  2NW7 A;  2LKH A;  1W9R A;  2XAQ B;  3EAM A;  4U33 A;  5FKY A;  4IE5 A;  5AQR B;  2YDR A;  4ZZB A;  2L3L A;  5FL1 A;  1T98 A;  1XWM A;  4DUY T;  3CQC B;  4IT4 A;  2CMR A;  5FY7 A;  3GA8 A;  4H9R C;  4YJ3 E;  4DND A;  5ABE A;  4U31 A;  4ERR A;  4HFD A;  1UUR A;  3N9N A;  4LFC T;  3K8P C;  3QOF A;  3KVB A;  4AQG A;  4PFP A;  2DWK A;  4X64 T;  4ZEY A;  3U78 A;  5FXW A;  2HN2 A;  4EIW A;  1YQ3 A;  2WS3 A;  4CI1 B;  1KEY A;  4X1I E;  2ZM0 A;  5AQI B;  2WP9 A;  4DUZ T;  4UIG A;  2K5B B;  4JI1 T;  5BMV E;  4GOU A;  4QH4 A;  3C4W A;  2R6G F;  4Z90 A;  1Z8U A;  2LM9 A;  3E08 A;  3RRC A;  2KND A;  4JLE A;  5J1G A;  1N32 T;  2W4X A;  3F2E A;  1HCI A;  2WM9 A;  2OA5 A;  3PUA A;  1VCT A;  4GK0 E;  1SHZ C;  2VL0 A;  3AAA B;  3P50 A;  3L39 A;  2Y48 B;  3RHW A;  5JDM A;  3E22 E;  5FXZ A;  3NVO A;  2CA5 A;  2D0U A;  1QUU A;  4GYR A;  3H37 A;  3RQU A;  3VU7 H;  1ZOY A;  4M1P A;  3ZJ1 A;  2QGS A;  3AA6 B;  3PUX F;  5LB7 B;  2D5U A;  1X9B A;  4P1N A;  2IW5 B;  5DQW A;  2W66 A;  1FMW A;  3B5M A;  3SS1 A;  3LFM A;  4JI3 T;  1J5E T;  1XZY A;  2LEH A;  1D1C A;  2XQA A;  3MXZ A;  3VR9 A;  1WLX A;  1I94 T;  2ACX A;  2X0H A;  2ZM2 A;  3O4X E;  3I9Y A;  4UEL A;  3ZYM A;  3M3Z B;  2LSK A;  4HFI A;  2Z6E A;  4AI6 A;  2OV9 A;  3RIU A;  5EZY E;  4GYS A;  5AQT B;  2IC6 A;  2DCF A;  2HPL A;  5AQM B;  5JH7 E;  2FJB A;  2IUB A;  4OYK A;  3ZC0 A;  2JRK A;  2LRK A;  4Z8X A;  4C90 A;  3I9W A;  4AKI A;  5CJ5 A;  5J0Z A;  2CE7 A;  1MMN A;  2E8I A;  4DBR A;  1QSD A;  2CLY C;  4TNV A;  4C91 A;  5JTG A;  1U4Q A;  4U2Z A;  3Q5E A;  5H6Q B;  3ZMV B;  4O8S A;  4U7I A;  2CBJ A;  3ZJ2 A;  1M62 A;  2VQF T;  1W0A A;  2V7K A;  1BR4 A;  3LK4 2;  5LYJ E;  1IBK T;  2BG9 C;  4J2C A;  3IEE A;  3NZP A;  2JQH A;  3RIF A;  2XAG B;  3ZPO A;  1WR6 A;  2BS3 A;  3FHN A;  2E9X B;  4IGU A;  3RKO A;  2XHE B;  3ZCI A;  5CFB A;  3PUW F;  2XUE A;  4BAY B;  2Q9Q A;  3JAD A;  4HFE A;  3CK6 A;  4H9N C;  4TWD A;  3A5X A;  4WYV A;  4CI2 B;  5LHI B;  4ZI2 D;  4CXY A;  2YOE A;  5FY1 A;  2XQ5 A;  2CBI A;  4KP3 C;  5JDG A;  2UXC T;  1I6Z A;  2XSA A;  2QRX A;  3EVY A;  2XTL A;  1MMA A;  5FYM A;  3RRW A;  4A98 A;  5LNK A;  5JRC B;  4KUM B;  4NXN T;  1UCU A;  1D0X A;  3ESL A;  2JIW A;  4UEM A;  3CX7 B;  5JVD E;  2LSY A;  3KV9 A;  5AQU B;  4PFO A;  2XQ6 A;  4JI8 T;  2YDQ A;  5JRC A;  2CWO A;  3RLF F;  5C2T A;  3AEG A;  2XQ4 A;  3PU8 A;  5LGU B;  4PK6 A;  5AQJ B;  4YY3 T;  2ODU A;  4CXX A;  2X67 A;  3UFG A;  4JEU B;  3ETU A;  2VB6 A;  4EXT A;  4TV8 E;  4B3T T;  3QB5 K;  4UF0 A;  2EHO D;  4I55 E;  3ZMU B;  2PFV A;  2BBJ A;  2WU5 A;  3EDV A;  2I6H A;  4AKL A;  4MBQ A;  3ONJ A;  5AQF B;  4ZOL E;  3QB5 A;  2RP4 A;  4U74 A;  5EK4 A;  5JDQ A;  1UUS A;  5JDF A;  2QVA A;  3KFW X;  3TKL B;  3F31 A;  5HYA A;  3AE1 A;  3AE8 A;  4NPP A;  3S4U A;  2XAH B;  2XZE A;  3TLV A;  5CGM A;  3QK6 A;  2X0Y A;  1XMQ T;  1S35 A;  3AE9 A;  4JBW F;  3K3O A;  1W0B A;  2KSR A;  2CPT A;  4IDN A;  1E2A A;  5J2T E;  3CPZ A;  2WB5 A;  1DU2 A;  2X9H A;  3UU3 A;  1YD8 G;  2JQQ A;  4WNK A;  4L0R A;  3ZKR A;  3UUB A;  5LG4 A;  2X66 A;  3AE3 A; 
#chains in the Genus database with same CATH homology
 3ONL C;  2V8S V;  1VCS A;  3ONJ A;  2QYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...