4K0KT

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4k0kT00
4K0KT 4JI8T 4DV2T 4DV7T 5BR8T 3T1YT 2ZM6T 4DV6T 1IBKT 4X64T 4X62T 2F4VT 4JYAT 1IBMT 4DR5T 4LF5T 4DV4T 4DR2T 4B3RT 4LF8T 4JI4T 1HNXT 4JI1T 4KHPT 4GKKT 5IWAT 4JI7T 4DR6T 1HNWT 4X66T 1N33T 4LF6T 4YHHT 2UU9T 4OX9T 4LF4T 4GKJT 4LFBT 4LFCT 4DUZT 5LMUT 4B3TT 4LFAT 3OTOT 2VQET 2UUAT 4NXMT 2UUBT 2UXDT 4NXNT 4DV0T 1XMOT 1XNRT 4JI0T 2HHHT 4LF9T 5LMNT 1HNZT 1J5ET 1N36T 3T1HT 4AQYT 4JI2T 4B3ST 4DV3T 4DR1T 4X65T 1I94T 1XMQT 4DR7T 4JI6T 2UXCT 4DUYT 1HR0T 1IBLT 4LF7T 4DR3T 1FJGT 2E5LT 1N32T 4B3MT 1N34T 4JI5T 2UUCT 4DV1T 1XNQT 2VQFT 4YY3T 4JI3T 2UXBT 4JV5T 4DR4T 4DV5T
chains in the Genus database with same CATH superfamily
2X0LB 4UELA 2XQ5A 3RQWA 2ZM0A 3WAKA 2VL0A 4TV8E 4DV6T 4X64T 4X62T 1BR1A 4NPPA 3O4XE 4BAYB 1B7TA 5IUXA 4DV4T 2NW9A 4P09A 1T7SA 4TNVA 4AQGA 4I4TE 2YU1A 4EXTA 5CB4E 4IREA 4EAHA 1KNPA 2YDQA 1M62A 2LSKA 4DMVA 1WYBA 3ZN1B 2XAHB 4LFCT 2IIUA 2SPCA 2YOEA 3J9X1 5ABHA 4B6XA 2KWHA 2A2FX 2KXPB 1XDPA 1SA0E 4JI0T 3RC8A 4UV9B 4LF9T 2XUEA 5AQMB 3SFDA 2W66A 4IE5A 5AQGB 2KNDA 4PK5A 4OFZA 4KP3C 3ZMUB 2ACXA 2J47A 5HEHA 3PU8A 1WFDA 1KEYA 4OYKA 4FI5A 4FJOA 2DWGA 1IBLT 1W0AA 5J0ZA 2K48A 2UUCT 5AQTB 3PURA 1KNRA 3P4RA 4ZXLA 5M4YA 4DR4T 4EEBA 2XQYA 3AE2A 2IC6A 3ZPOA 3KDSE 3AA1B 3RX6A 2D9DA 4QXHB 2EHOB 3NRYA 5LBQB 4NUVA 2V6XA 5J2TE 5AQHB 3CWZB 4IE4A 3CVRA 2WM9A 1WR6A 2DHRA 4QH5A 2JQ9A 2KWIB 3ETUA 2VKJA 1ZEEA 3PUWF 5AQPB 2D0TA 2UXNB 4QH4A 4TZ4C 5L3FB 4H9PC 1MMDA 1HX8A 1UK5A 1MNDA 2LSGA 2LKGA 2BS4A 3O9XA 2IHR1 1XZYA 2UXXB 1FMWA 5EK4A 2Q9QD 3C4ZA 5JDGA 2L9QA 2VL8A 3UUMA 4UVAB 2HN2A 5HEJA 5LJMA 2CBJA 4EV6A 3L3PA 3ZT6A 5H6QB 2BDEA 2MBGA 4JI8T 3TLTA 3L39A 2G0UA 3ZKRA 4L0RA 2CXDA 5L3DB 2E2AA 1WRDA 4GOUA 3CKDA 3CX8B 2ZM2A 1HNXT 3AEDA 3EAMA 5LXTE 1J1JA 1FMVA 3LBXA 1E1HB 4X1YE 5FXWA 2LHNA 1HNWT 2XHEB 2A72A 3CX7B 3DTOA 2H88A 1AJ3A 4LF4T 2I0MA 2Q9QA 1HG5A 3K1SA 4QX8B 4LFAT 5FVLA 3N2GE 5LA6E 2IDOB 4HE8A 2JRKA 2BKOA 1XNRT 3QB5A 2VKDA 1G8XA 4KHZF 4I50E 1HNZT 1J5ET 2WY2A 3EI0A 2RA1A 5KXJA 3V5UA 2NW8A 3C98B 4IDQA 3P8CD 4IE7A 2LSIA 4N78D 4U74A 5F5WA 3F2EA 3AE8A 3PDYA 3D0TA 4YFSA 1VRBA 4EYYR 4QKNA 3C4XA 2C0SA 4PFPA 3AEBA 1WCRA 2HN1A 2WDRA 3RYCE 3AEGA 4WW0A 2LKHA 2K9AA 3GA8A 3TLSA 2X9HA 1IJ5A 4QX7B 2WCAA 5FNVE 4YTPA 2LE8A 3CQGB 2V1DB 3AVRA 4EYUA 2FJAA 1YQ4A 3FZKB 2KLQA 1GQEA 3RPUA 2CCQA 5JR9C 2B76A 1HX1B 2XAJB 2AE9A 1IZNB 1CHUA 2UUAT 4IE6A 1OWAA 3PU3A 4PW8A 3OYXA 2QGSA 3ZYLA 3KV5A 1WLXA 2CLYB 4TWHA 2QRXA 5HCMA 3UQ7A 4ISSA 5FXXA 4I0UA 2CXLA 2Y6XA 5KDMC 2X66A 3GN5A 5L3CB 2CE7A 1E2AA 2XASB 1T72A 2RP4A 3DJBA 4AKIA 2XPKA 1G73A 4KMCA 1D1BA 3IBPA 4GK0E 1N32T 3AE7A 4X20E 3AVSA 2VB6A 5HXHA 1SE7A 2J1DG 3AE6A 3ZCIA 3NWIA 2LHRA 3AEEA 3ZMZB 1OXZA 2YKSA 3KV4A 2IW5B 2WAUA 3RIUC 2BG9C 2D5UA 5ETWA 2NP9A 3TKLB 5L4HA 3AE9A 3VKHA 1FEWA 4WBOA 3UFGA 4CN4A 4DBRA 3AE5A 4DR2T 3P7IA 1CUNA 4F8HA 2E8IA 2A3DA 3H37A 5DQWA 1MIWA 4UF0B 1HS7A 3HI2A 4UF0A 2D0UA 1EZ3A 2XZEA 4X66T 1OEDE 5EZYE 4KBMB 3OVUA 2H3RA 2E9XB 3FBLA 5JDFA 4KI0F 4HEAA 3A7MA 3TLUA 5C8YE 3JADA 3PUGA 2PJQA 5HEOA 3UU4A 5LGUB 4GYRA 2VVSA 3M65A 4H9RC 5E0OA 2YEVC 4TWFA 4QWNB 3MXZA 4NUUA 4YJ3E 2C5KT 3UU5A 5JREA 2RPAA 4DR1T 1OEDA 3MK7C 3OKQA 5CGMA 2XQ9A 4JI6T 2V5DA 5C3JA 5EK2A 3AA7B 3LFMA 5HCJA 2HH7A 5AQJB 3ANWA 2CXFA 3RRWA 2KINB 4ILCA 3AA0B 3KV9A 5JDMA 4IL9A 1UX5A 4OK0A 4YTMA 2EHOC 1NAFA 2XQ8A 2ACZA 4CI3B 3M3ZB 1T8BA 4H9QC 4ZZBA 3ONJA 3VRBA 2M67A 2YDSA 3OPCA 5LHGB 1MIVA 3FZMB 1I6ZA 4LF8T 5FL1A 4HN9A 4C90A 3OJAA 3AAAB 4P1NA 2PFVA 3IEEA 2CBIA 3AAIA 3C50A 3RQUA 3RIAA 4J2CA 4AQFC 5A1LA 3PE0A 1Z0PA 4EGWA 5LMNT 3UU8A 2JQHA 3KFWX 2JQKA 4DV3T 3N9OA 2NTXA 5LHHB 2ZMAA 3FXDB 4YXDA 3I0OA 3Q5EA 3RYHE 4JUYA 2XQ3A 2XM1A 5H6RB 4QHOA 4B3MT 5CFBA 5L3GB 2VQFT 2N2NA 4UXNB 2I59A 5LCYA 4DNDA 2JJ9A 2BS2A 4K0KT 5J2UE 2IC9A 5CA1E 4DV2T 2XQ6A 5JQGE 5L4EA 5LJNA 5FXZA 3LK42 3UT5E 4PJLA 3O1IA 4O8SA 3K3OA 3JC6C 2M6IA 1V9DA 3GWHA 4IDZA 4HWDA 1D1AA 3ONXA 2VASA 4TV9E 2XM2A 4IIJE 3C51A 4E7ZA 5LMUT 5AQFB 2UUBT 2K3WA 3IA3A 2ES0A 2NWBA 2KSRA 1XWMA 3KVBA 5LP6E 4Q25A 4B3ST 2JMHA 3E22E 3DP7A 2YU2A 5JDNA 1VCSA 4A98A 4IDOA 2WWVA 4JLEA 2E5LT 4HFVA 2XQ7A 3P4QA 4AKHA 3SFEA 1YKEB 4K0UA 4UR9A 4DV5T 2QVAA 2ZLYA 2LEHA 1MNEA 3E0ZA 3ZC0A 2YN6A 3ZJ1A 3AA6B 4B3RT 4G63A 3JC6D 2X0YA 1M7KA 4DO0A 1DU2A 4EZHA 3JAEA 2C5JA 2CMRA 4ISTA 2LOPA 4PNIA 2YK0A 4YSZA 2LOSA 2V7JA 4OX9T 3W15B 5DABA 4GKJT 4MFRA 3ZLIA 2XSAA 5ABEA 5AQQB 2LM9A 3ZSSA 4O2AE 3HKDE 2CLYC 3Q5WA 3LBXB 1O3XA 5HXCA 3RYIE 3AAEB 3AXJA 1NEKA 2NR4A 4LMLA 1YQ3A 3C4WA 4U31A 3T1HT 2Q9QB 1HFAA 4ERRA 4ADZA 1W0BA 2BZBA 2WMOA 3R6NA 1YW0A 3MZKB 4IE0A 3ZSTA 1QLBA 2UXCT 3AE4A 4AXPA 1U4QA 5GONE 2OA5A 4KUMB 2HPJA 5KMGP 2J4GA 5TAOA 4IT4A 3CX6B 2OLTA 2J62A 2FJEA 3OYZA 3OBVE 4I55E 3Q9DA 4EIWA 3NZQA 4Z8XA 2QA7A 3SWHA 3NBXX 3S4UA 2CPTA 3J7Yq 4IDPA 4PK6A 1KF6A 4YLHA 3Q2MA 4DR6T 1X79A 3K3NA 4UVCB 3N2KE 4F6RC 4MBQA 3B13A 3LK3B 3PUZF 5JTGA 2V26A 2FUPA 2CRBA 4JEUB 5LGNB 3O1JA 1ZOYA 4LMKA 4L9IA 1WR0A 2DNXA 1MMAA 3JCFA 3AE1A 3N2OA 4TWDA 4ZS2A 3RC3A 3RLFF 2JMKA 4ZI7E 3VU7H 3QC9A 2FBWA 1XMQT 4XZCA 3Q5XA 1T98A 1BR4A 4DUYT 2BBJA 4TX5A 1HR0T 4ZI2C 3VR8A 2XJ7A 5F8PA 2HPLA 2NTYA 4A56A 3PUVF 5ABFA 4OHFA 2C5IT 2H7VC 3GN5B 1ZP0A 3N9NA 5HXEA 2V7MA 3QB5K 4YSXA 3K3QC 1J5WA 5BR8T 2IMLA 5HYAA 5LOVE 3AB3B 2ODUA 1IBMT 3MJXA 4MALA 4PK4A 4AISA 4KHPT 5BMVE 3NVOA 4DVDA 5IWAT 3LG7A 3UUNA 3HKBE 4PFOA 5DJQC 2L3LA 4YHHT 2DLRA 5JRCB 1LVFA 5JRCA 3RKGA 5AQLB 2CWOA 5IHYA 4TN7B 2WWUA 4ZZCA 4AIUA 2ODVA 4H9NC 1UGOA 4HFHA 4JBWF 2V7LA 2W63A 2W61A 4EB6E 2KZ7B 4DR7T 4ZI2D 2GK9A 5FY0A 1ZV4X 3LJCA 5LGTB 5HAXA 1QSDA 2LRKA 1Z8UA 1UURA 4CXXA 4U72A 5FKYA 5IYZE 2AXDS 2V8SV 4H63H 4KX6A 1FIOA 4U33A 2WU5A 4PJNA 4HWHA 3UFEA 5FL0A 3PUQA 3UTKA 3FHNA 2NOXA 1OEDB 3K8PC 4X5TA 3O1HA 3HKEE 2V6YA 3SS1A 2OV9A 3F57A 3T1YT 2LRLA 2JIWA 1IBKT 3ANWB 5LB7B 2A9UA 2YDRA 2F4VT 1U5PA 4UV8B 1SHZC 4PJJA 4CN1A 2PTFA 3BQIA 3PUXF 3ZT7A 2PG8A 1HF8A 4DR5T 1X9BA 5FMNA 4XAXB 1BR2A 1S94A 2WMNA 2VKHA 5JR9A 5JDQA 1D1CA 4U7IA 3VKGA 4X1IE 4YTNA 4PAGA 1N33T 3LSVA 4UEMA 3VHLA 4DBQA 3RKOA 2MAWA 4HFIA 4ILAA 4B3TT 2BKPA 3P4PA 4MLKA 3OTOT 3ABVA 3HA4A 4AKRB 1E7PA 5AQNB 4HGAA 1L0VA 1XMOT 3PUYF 5EK3A 2BG9E 4DIDB 2WDQA 2X0HA 3MACA 4L5GA 4NIQA 3UULA 2PBIA 5AQSB 4QXCB 1I94T 4CI2B 3ESLA 3QK6A 1UUSA 2XAFB 2N9DA 2BVLA 4CXWA 4ZS3A 4HFDA 4GYSA 4DV1T 2BG9B 3RIUA 5FYMA 2BG9A 3CQXC 3UQ4A 4UIGA 1BR0A 4EEDA 2WU2A 3FZFB 3KBUA 2R6GF 5L47A 2W4XA 3I9YA 4CXYA 4BJNA 3FZLB 3UU6A 1UX4A 3QNUA 3QOFA 1XDOA 3ZMTB 5LG3A 4ZI3C 2W2UA 3FZHB 2IUBA 3I1AA 2EHOD 1ZHCA 5HEGA 3EVYA 3A5XA 2MPKA 2XQAA 3HL6A 5HWYA 3ONLC 4U3CA 1D0YA 1MMGA 3SOLA 3V5SA 5FP3A 3B57A 3X1DA 2W00A 5AQIB 3H3MA 5AFUL 2VQET 3ETVA 4AKLA 2WBLA 3BQLA 5LHIB 3I9WA 2MTQA 4NXNT 4O4JE 2Q9QC 5LG4A 2BVMA 5JVDE 2X9WA 3PJAJ 1N36T 3NRXA 3Q5DA 5L3EB 3JAFA 3WI3A 5L2LA 3N5LA 3EDVA 2LSYA 2M6BA 4OYJA 3ZN0B 4JEHB 4O4LE 2KT9A 5J1GA 3AEAA 5JDLA 2X9XA 3NKZA 2CHOA 3U78A 2EHOA 3FBZA 2E5VA 1XNQT 2IAKA 2LT3A 2X68A 2KMFA 5F3JA 3N9PA 4Z91A 3PUSA 5FY1A 5FVKA 2JPFA 4HFBA 4DV7T 3T8OA 3MKDA 4ZI3D 4CZZB 4I43B 2YINA 1YXRA 3G06A 3EUHA 4YT0A 3PUAA 4DMWA 1HCIA 3KV6A 4AQFA 4LF6T 4YHJA 4IDNA 3GMIA 5JDHA 1W09A 2VVNA 3L8RA 1QUUA 2UXDT 4DV0T 4AKGA 4YSYA 5LNKA 2VK9A 3CQCB 4CI1B 3ZEFB 4X1KE 3EABA 4QXBB 3B5MA 1YKHB 3IHRA 5AQVB 1YD8G 3RHWA 3TLWA 4EZ4A 3IF8B 5AQUB 4QH1A 1JNZA 3NZPA 2ZM8A 3N9MA 1WYCA 1VOMA 1S35A 4TNWA 3A8YC 3AXJB 2XAQB 5CJ5A 3EHZA 3EDUA 2CHNA 3ZYMA 2XAGB 3VR9A 2XSBA 5LYJE 2K5BB 1D0XA 2UXBT 4H9OC 5ABGA 3H3AA 5FY7A 2VKOA 5HXSA 4JI5T 3UUBA 4WZXA 3HR0A 2LJLA 2H89A 4BJMA 1IJ6A 3RI5A 4JYAT 5AQOB 3HKCE 3I0QA 4O2BE 4EOZB 2WSSV 4P0BA 4LF5T 5ADXL 2VWAA 4O4HE 1MIYA 2CEAA 1VCTA 3ZT5A 3ZYKA 3FB2A 3AEFA 2CM0A 4ILBA 4ANJA 3ZC1A 2LLYA 4HWCA 4HFEA 4DUZT 2WP9A 2WZIA 2E9XC 3P4WA 2JQQA 3RYFE 2B1EA 2X9YA 1US7B 2Y48B 4YJ2E 4AQYT 4H9SE 4V1Av 2X51A 2CWYA 2NW7A 1UCUA 5L3BB 2Y8DA 3CPZA 1H7CA 2BS3A 1MMNA 1KNZA 4PJMA 3RGLA 1OEDC 5FXVA 4E7SA 3P50A 3VRAA 2WDVA 4ASKA 3AE3A 4YY3T 4JI3T 2QYWA 2I6HA 3ZMVB 2FJDA 3MA9A 4UVBB 4U2YA 3PV0F 2DCFA 1IAPA 4HWFA 4WNKA 3BQKA 3LK2B 1NENA 4IGUA 1W9RA 3RH3A 5ABFB 4U2ZA 4C91A 2CA5A 4LMJA 4GKKT 4AI6A 4XBFB 3L09A 3RF1A 4HFCA 4COFA 2W62A 2UU9T 3UUXB 4A97A 2E9XD 4A5XA 3CMLA 4TUYE 4WYVA 4ILUA 3CIRA 2HHHT 3KINB 3F31A 1LRZA 4CN6A 2Z6EA 3R84B 5HWXA 2V5CA 1Y64B 4CQIA 3BK9A 4GK5E 3SRZA 2D2SA 4IHJE 4X65T 3P4SA 1KFYA 2W0GA 5CA0E 5KX5E 3WAJA 3UU3A 1LKXA 5HXRA 3FXEB 1ZKEA 2WZHA 1Y01A 3KBTA 4LF7T 3ZMSB 1FJGT 2DL1A 1JNRA 3RIFA 4BA9A 4WBNE 4MHCA 5LBMA 3LDQB 4JV5T 4ZEYA 4HKAA 2VURA 3ZJ2A 2XY8B 4P0AA 2ZM6T 1HG2A 4G2AA 4HTEA 4O4IE 2E9XA 2K24A 2P9BA 3CK6A 1HTJF 3KVAA 4JI4T 4JI1T 4HWIB 2V6YB 2V7KA 4JI7T 1KK7A 1SUMB 3PTRB 2FJBA 3C64A 3QUJA 4U7YA 5DQVA 4LFBT 2W67A 2H7OA 4GIWA 4ZOLE 4NXMT 2BKNA 2X67A 1NWMX 2DI4A 5JR9B 1LVKA 4H63V 3ZCJA 4IL4A 2DWKA 2WS3A 3U3IA 3TLVA 3N9LA 2BBHA 2V7IA 1R8IA 4JI2T 3RRCA 2LM2A 5HEUA 5JH7E 2L8KA 3PJAA 3AECA 2WQYA 2XQ4A 3E08A 5AQRB 5C2TA 2N1GA 2XTLA 2WB5A 5AQKB 4DR3T 4Z90A 1N34T 2LSJA 2MYSA 3N9QA 4M1PA 1D0ZA 2MOZA 4ZHQE
chains in the Genus database with same CATH topology
4K0KT 4JI8T 4DV2T 4DV7T 5BR8T 3T1YT 2ZM6T 4DV6T 1IBKT 4X64T 4X62T 2F4VT 4JYAT 1IBMT 4DR5T 4LF5T 4DV4T 4DR2T 4B3RT 4LF8T 4JI4T 1HNXT 4JI1T 4KHPT 4GKKT 5IWAT 4JI7T 4DR6T 1HNWT 4X66T 1N33T 4LF6T 4YHHT 2UU9T 4OX9T 4LF4T 4GKJT 4LFBT 4LFCT 4DUZT 5LMUT 4B3TT 4LFAT 3OTOT 2VQET 2UUAT 4NXMT 2UUBT 2UXDT 4NXNT 4DV0T 1XMOT 1XNRT 4JI0T 2HHHT 4LF9T 5LMNT 1HNZT 1J5ET 1N36T 3T1HT 4AQYT 4JI2T 4B3ST 4DV3T 4DR1T 4X65T 1I94T 1XMQT 4DR7T 4JI6T 2UXCT 4DUYT 1HR0T 1IBLT 4LF7T 4DR3T 1FJGT 2E5LT 1N32T 4B3MT 1N34T 4JI5T 2UUCT 4DV1T 1XNQT 2VQFT 4YY3T 4JI3T 2UXBT 4JV5T 4DR4T 4DV5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K T;  4JI8 T;  4DV2 T;  4DV7 T;  5BR8 T;  3T1Y T;  2ZM6 T;  4DV6 T;  1IBK T;  4X64 T;  4X62 T;  2F4V T;  4JYA T;  1IBM T;  4DR5 T;  4LF5 T;  4DV4 T;  4DR2 T;  4B3R T;  4LF8 T;  4JI4 T;  1HNX T;  4JI1 T;  4KHP T;  4GKK T;  5IWA T;  4JI7 T;  4DR6 T;  1HNW T;  4X66 T;  1N33 T;  4LF6 T;  4YHH T;  2UU9 T;  4OX9 T;  4LF4 T;  4GKJ T;  4LFB T;  4LFC T;  4DUZ T;  5LMU T;  4B3T T;  4LFA T;  3OTO T;  2VQE T;  2UUA T;  4NXM T;  2UUB T;  2UXD T;  4NXN T;  4DV0 T;  1XMO T;  1XNR T;  4JI0 T;  2HHH T;  4LF9 T;  5LMN T;  1HNZ T;  1J5E T;  1N36 T;  3T1H T;  4AQY T;  4JI2 T;  4B3S T;  4DV3 T;  4DR1 T;  4X65 T;  1I94 T;  1XMQ T;  4DR7 T;  4JI6 T;  2UXC T;  4DUY T;  1HR0 T;  1IBL T;  4LF7 T;  4DR3 T;  1FJG T;  2E5L T;  1N32 T;  4B3M T;  1N34 T;  4JI5 T;  2UUC T;  4DV1 T;  1XNQ T;  2VQF T;  4YY3 T;  4JI3 T;  2UXB T;  4JV5 T;  4DR4 T;  4DV5 T; 
#chains in the Genus database with same CATH topology
 2X0L B;  4UEL A;  2XQ5 A;  3RQW A;  2ZM0 A;  3WAK A;  2VL0 A;  4TV8 E;  4DV6 T;  4X64 T;  4X62 T;  1BR1 A;  4NPP A;  3O4X E;  4BAY B;  1B7T A;  5IUX A;  4DV4 T;  2NW9 A;  4P09 A;  1T7S A;  4TNV A;  4AQG A;  4I4T E;  2YU1 A;  4EXT A;  5CB4 E;  4IRE A;  4EAH A;  1KNP A;  2YDQ A;  1M62 A;  2LSK A;  4DMV A;  1WYB A;  3ZN1 B;  2XAH B;  4LFC T;  2IIU A;  2SPC A;  2YOE A;  3J9X 1;  5ABH A;  4B6X A;  2KWH A;  2A2F X;  2KXP B;  1XDP A;  1SA0 E;  4JI0 T;  3RC8 A;  4UV9 B;  4LF9 T;  2XUE A;  5AQM B;  3SFD A;  2W66 A;  4IE5 A;  5AQG B;  2KND A;  4PK5 A;  4OFZ A;  4KP3 C;  3ZMU B;  2ACX A;  2J47 A;  5HEH A;  3PU8 A;  1WFD A;  1KEY A;  4OYK A;  4FI5 A;  4FJO A;  2DWG A;  1IBL T;  1W0A A;  5J0Z A;  2K48 A;  2UUC T;  5AQT B;  3PUR A;  1KNR A;  3P4R A;  4ZXL A;  5M4Y A;  4DR4 T;  4EEB A;  2XQY A;  3AE2 A;  2IC6 A;  3ZPO A;  3KDS E;  3AA1 B;  3RX6 A;  2D9D A;  4QXH B;  2EHO B;  3NRY A;  5LBQ B;  4NUV A;  2V6X A;  5J2T E;  5AQH B;  3CWZ B;  4IE4 A;  3CVR A;  2WM9 A;  1WR6 A;  2DHR A;  4QH5 A;  2JQ9 A;  2KWI B;  3ETU A;  2VKJ A;  1ZEE A;  3PUW F;  5AQP B;  2D0T A;  2UXN B;  4QH4 A;  4TZ4 C;  5L3F B;  4H9P C;  1MMD A;  1HX8 A;  1UK5 A;  1MND A;  2LSG A;  2LKG A;  2BS4 A;  3O9X A;  2IHR 1;  1XZY A;  2UXX B;  1FMW A;  5EK4 A;  2Q9Q D;  3C4Z A;  5JDG A;  2L9Q A;  2VL8 A;  3UUM A;  4UVA B;  2HN2 A;  5HEJ A;  5LJM A;  2CBJ A;  4EV6 A;  3L3P A;  3ZT6 A;  5H6Q B;  2BDE A;  2MBG A;  4JI8 T;  3TLT A;  3L39 A;  2G0U A;  3ZKR A;  4L0R A;  2CXD A;  5L3D B;  2E2A A;  1WRD A;  4GOU A;  3CKD A;  3CX8 B;  2ZM2 A;  1HNX T;  3AED A;  3EAM A;  5LXT E;  1J1J A;  1FMV A;  3LBX A;  1E1H B;  4X1Y E;  5FXW A;  2LHN A;  1HNW T;  2XHE B;  2A72 A;  3CX7 B;  3DTO A;  2H88 A;  1AJ3 A;  4LF4 T;  2I0M A;  2Q9Q A;  1HG5 A;  3K1S A;  4QX8 B;  4LFA T;  5FVL A;  3N2G E;  5LA6 E;  2IDO B;  4HE8 A;  2JRK A;  2BKO A;  1XNR T;  3QB5 A;  2VKD A;  1G8X A;  4KHZ F;  4I50 E;  1HNZ T;  1J5E T;  2WY2 A;  3EI0 A;  2RA1 A;  5KXJ A;  3V5U A;  2NW8 A;  3C98 B;  4IDQ A;  3P8C D;  4IE7 A;  2LSI A;  4N78 D;  4U74 A;  5F5W A;  3F2E A;  3AE8 A;  3PDY A;  3D0T A;  4YFS A;  1VRB A;  4EYY R;  4QKN A;  3C4X A;  2C0S A;  4PFP A;  3AEB A;  1WCR A;  2HN1 A;  2WDR A;  3RYC E;  3AEG A;  4WW0 A;  2LKH A;  2K9A A;  3GA8 A;  3TLS A;  2X9H A;  1IJ5 A;  4QX7 B;  2WCA A;  5FNV E;  4YTP A;  2LE8 A;  3CQG B;  2V1D B;  3AVR A;  4EYU A;  2FJA A;  1YQ4 A;  3FZK B;  2KLQ A;  1GQE A;  3RPU A;  2CCQ A;  5JR9 C;  2B76 A;  1HX1 B;  2XAJ B;  2AE9 A;  1IZN B;  1CHU A;  2UUA T;  4IE6 A;  1OWA A;  3PU3 A;  4PW8 A;  3OYX A;  2QGS A;  3ZYL A;  3KV5 A;  1WLX A;  2CLY B;  4TWH A;  2QRX A;  5HCM A;  3UQ7 A;  4ISS A;  5FXX A;  4I0U A;  2CXL A;  2Y6X A;  5KDM C;  2X66 A;  3GN5 A;  5L3C B;  2CE7 A;  1E2A A;  2XAS B;  1T72 A;  2RP4 A;  3DJB A;  4AKI A;  2XPK A;  1G73 A;  4KMC A;  1D1B A;  3IBP A;  4GK0 E;  1N32 T;  3AE7 A;  4X20 E;  3AVS A;  2VB6 A;  5HXH A;  1SE7 A;  2J1D G;  3AE6 A;  3ZCI A;  3NWI A;  2LHR A;  3AEE A;  3ZMZ B;  1OXZ A;  2YKS A;  3KV4 A;  2IW5 B;  2WAU A;  3RIU C;  2BG9 C;  2D5U A;  5ETW A;  2NP9 A;  3TKL B;  5L4H A;  3AE9 A;  3VKH A;  1FEW A;  4WBO A;  3UFG A;  4CN4 A;  4DBR A;  3AE5 A;  4DR2 T;  3P7I A;  1CUN A;  4F8H A;  2E8I A;  2A3D A;  3H37 A;  5DQW A;  1MIW A;  4UF0 B;  1HS7 A;  3HI2 A;  4UF0 A;  2D0U A;  1EZ3 A;  2XZE A;  4X66 T;  1OED E;  5EZY E;  4KBM B;  3OVU A;  2H3R A;  2E9X B;  3FBL A;  5JDF A;  4KI0 F;  4HEA A;  3A7M A;  3TLU A;  5C8Y E;  3JAD A;  3PUG A;  2PJQ A;  5HEO A;  3UU4 A;  5LGU B;  4GYR A;  2VVS A;  3M65 A;  4H9R C;  5E0O A;  2YEV C;  4TWF A;  4QWN B;  3MXZ A;  4NUU A;  4YJ3 E;  2C5K T;  3UU5 A;  5JRE A;  2RPA A;  4DR1 T;  1OED A;  3MK7 C;  3OKQ A;  5CGM A;  2XQ9 A;  4JI6 T;  2V5D A;  5C3J A;  5EK2 A;  3AA7 B;  3LFM A;  5HCJ A;  2HH7 A;  5AQJ B;  3ANW A;  2CXF A;  3RRW A;  2KIN B;  4ILC A;  3AA0 B;  3KV9 A;  5JDM A;  4IL9 A;  1UX5 A;  4OK0 A;  4YTM A;  2EHO C;  1NAF A;  2XQ8 A;  2ACZ A;  4CI3 B;  3M3Z B;  1T8B A;  4H9Q C;  4ZZB A;  3ONJ A;  3VRB A;  2M67 A;  2YDS A;  3OPC A;  5LHG B;  1MIV A;  3FZM B;  1I6Z A;  4LF8 T;  5FL1 A;  4HN9 A;  4C90 A;  3OJA A;  3AAA B;  4P1N A;  2PFV A;  3IEE A;  2CBI A;  3AAI A;  3C50 A;  3RQU A;  3RIA A;  4J2C A;  4AQF C;  5A1L A;  3PE0 A;  1Z0P A;  4EGW A;  5LMN T;  3UU8 A;  2JQH A;  3KFW X;  2JQK A;  4DV3 T;  3N9O A;  2NTX A;  5LHH B;  2ZMA A;  3FXD B;  4YXD A;  3I0O A;  3Q5E A;  3RYH E;  4JUY A;  2XQ3 A;  2XM1 A;  5H6R B;  4QHO A;  4B3M T;  5CFB A;  5L3G B;  2VQF T;  2N2N A;  4UXN B;  2I59 A;  5LCY A;  4DND A;  2JJ9 A;  2BS2 A;  4K0K T;  5J2U E;  2IC9 A;  5CA1 E;  4DV2 T;  2XQ6 A;  5JQG E;  5L4E A;  5LJN A;  5FXZ A;  3LK4 2;  3UT5 E;  4PJL A;  3O1I A;  4O8S A;  3K3O A;  3JC6 C;  2M6I A;  1V9D A;  3GWH A;  4IDZ A;  4HWD A;  1D1A A;  3ONX A;  2VAS A;  4TV9 E;  2XM2 A;  4IIJ E;  3C51 A;  4E7Z A;  5LMU T;  5AQF B;  2UUB T;  2K3W A;  3IA3 A;  2ES0 A;  2NWB A;  2KSR A;  1XWM A;  3KVB A;  5LP6 E;  4Q25 A;  4B3S T;  2JMH A;  3E22 E;  3DP7 A;  2YU2 A;  5JDN A;  1VCS A;  4A98 A;  4IDO A;  2WWV A;  4JLE A;  2E5L T;  4HFV A;  2XQ7 A;  3P4Q A;  4AKH A;  3SFE A;  1YKE B;  4K0U A;  4UR9 A;  4DV5 T;  2QVA A;  2ZLY A;  2LEH A;  1MNE A;  3E0Z A;  3ZC0 A;  2YN6 A;  3ZJ1 A;  3AA6 B;  4B3R T;  4G63 A;  3JC6 D;  2X0Y A;  1M7K A;  4DO0 A;  1DU2 A;  4EZH A;  3JAE A;  2C5J A;  2CMR A;  4IST A;  2LOP A;  4PNI A;  2YK0 A;  4YSZ A;  2LOS A;  2V7J A;  4OX9 T;  3W15 B;  5DAB A;  4GKJ T;  4MFR A;  3ZLI A;  2XSA A;  5ABE A;  5AQQ B;  2LM9 A;  3ZSS A;  4O2A E;  3HKD E;  2CLY C;  3Q5W A;  3LBX B;  1O3X A;  5HXC A;  3RYI E;  3AAE B;  3AXJ A;  1NEK A;  2NR4 A;  4LML A;  1YQ3 A;  3C4W A;  4U31 A;  3T1H T;  2Q9Q B;  1HFA A;  4ERR A;  4ADZ A;  1W0B A;  2BZB A;  2WMO A;  3R6N A;  1YW0 A;  3MZK B;  4IE0 A;  3ZST A;  1QLB A;  2UXC T;  3AE4 A;  4AXP A;  1U4Q A;  5GON E;  2OA5 A;  4KUM B;  2HPJ A;  5KMG P;  2J4G A;  5TAO A;  4IT4 A;  3CX6 B;  2OLT A;  2J62 A;  2FJE A;  3OYZ A;  3OBV E;  4I55 E;  3Q9D A;  4EIW A;  3NZQ A;  4Z8X A;  2QA7 A;  3SWH A;  3NBX X;  3S4U A;  2CPT A;  3J7Y q;  4IDP A;  4PK6 A;  1KF6 A;  4YLH A;  3Q2M A;  4DR6 T;  1X79 A;  3K3N A;  4UVC B;  3N2K E;  4F6R C;  4MBQ A;  3B13 A;  3LK3 B;  3PUZ F;  5JTG A;  2V26 A;  2FUP A;  2CRB A;  4JEU B;  5LGN B;  3O1J A;  1ZOY A;  4LMK A;  4L9I A;  1WR0 A;  2DNX A;  1MMA A;  3JCF A;  3AE1 A;  3N2O A;  4TWD A;  4ZS2 A;  3RC3 A;  3RLF F;  2JMK A;  4ZI7 E;  3VU7 H;  3QC9 A;  2FBW A;  1XMQ T;  4XZC A;  3Q5X A;  1T98 A;  1BR4 A;  4DUY T;  2BBJ A;  4TX5 A;  1HR0 T;  4ZI2 C;  3VR8 A;  2XJ7 A;  5F8P A;  2HPL A;  2NTY A;  4A56 A;  3PUV F;  5ABF A;  4OHF A;  2C5I T;  2H7V C;  3GN5 B;  1ZP0 A;  3N9N A;  5HXE A;  2V7M A;  3QB5 K;  4YSX A;  3K3Q C;  1J5W A;  5BR8 T;  2IML A;  5HYA A;  5LOV E;  3AB3 B;  2ODU A;  1IBM T;  3MJX A;  4MAL A;  4PK4 A;  4AIS A;  4KHP T;  5BMV E;  3NVO A;  4DVD A;  5IWA T;  3LG7 A;  3UUN A;  3HKB E;  4PFO A;  5DJQ C;  2L3L A;  4YHH T;  2DLR A;  5JRC B;  1LVF A;  5JRC A;  3RKG A;  5AQL B;  2CWO A;  5IHY A;  4TN7 B;  2WWU A;  4ZZC A;  4AIU A;  2ODV A;  4H9N C;  1UGO A;  4HFH A;  4JBW F;  2V7L A;  2W63 A;  2W61 A;  4EB6 E;  2KZ7 B;  4DR7 T;  4ZI2 D;  2GK9 A;  5FY0 A;  1ZV4 X;  3LJC A;  5LGT B;  5HAX A;  1QSD A;  2LRK A;  1Z8U A;  1UUR A;  4CXX A;  4U72 A;  5FKY A;  5IYZ E;  2AXD S;  2V8S V;  4H63 H;  4KX6 A;  1FIO A;  4U33 A;  2WU5 A;  4PJN A;  4HWH A;  3UFE A;  5FL0 A;  3PUQ A;  3UTK A;  3FHN A;  2NOX A;  1OED B;  3K8P C;  4X5T A;  3O1H A;  3HKE E;  2V6Y A;  3SS1 A;  2OV9 A;  3F57 A;  3T1Y T;  2LRL A;  2JIW A;  1IBK T;  3ANW B;  5LB7 B;  2A9U A;  2YDR A;  2F4V T;  1U5P A;  4UV8 B;  1SHZ C;  4PJJ A;  4CN1 A;  2PTF A;  3BQI A;  3PUX F;  3ZT7 A;  2PG8 A;  1HF8 A;  4DR5 T;  1X9B A;  5FMN A;  4XAX B;  1BR2 A;  1S94 A;  2WMN A;  2VKH A;  5JR9 A;  5JDQ A;  1D1C A;  4U7I A;  3VKG A;  4X1I E;  4YTN A;  4PAG A;  1N33 T;  3LSV A;  4UEM A;  3VHL A;  4DBQ A;  3RKO A;  2MAW A;  4HFI A;  4ILA A;  4B3T T;  2BKP A;  3P4P A;  4MLK A;  3OTO T;  3ABV A;  3HA4 A;  4AKR B;  1E7P A;  5AQN B;  4HGA A;  1L0V A;  1XMO T;  3PUY F;  5EK3 A;  2BG9 E;  4DID B;  2WDQ A;  2X0H A;  3MAC A;  4L5G A;  4NIQ A;  3UUL A;  2PBI A;  5AQS B;  4QXC B;  1I94 T;  4CI2 B;  3ESL A;  3QK6 A;  1UUS A;  2XAF B;  2N9D A;  2BVL A;  4CXW A;  4ZS3 A;  4HFD A;  4GYS A;  4DV1 T;  2BG9 B;  3RIU A;  5FYM A;  2BG9 A;  3CQX C;  3UQ4 A;  4UIG A;  1BR0 A;  4EED A;  2WU2 A;  3FZF B;  3KBU A;  2R6G F;  5L47 A;  2W4X A;  3I9Y A;  4CXY A;  4BJN A;  3FZL B;  3UU6 A;  1UX4 A;  3QNU A;  3QOF A;  1XDO A;  3ZMT B;  5LG3 A;  4ZI3 C;  2W2U A;  3FZH B;  2IUB A;  3I1A A;  2EHO D;  1ZHC A;  5HEG A;  3EVY A;  3A5X A;  2MPK A;  2XQA A;  3HL6 A;  5HWY A;  3ONL C;  4U3C A;  1D0Y A;  1MMG A;  3SOL A;  3V5S A;  5FP3 A;  3B57 A;  3X1D A;  2W00 A;  5AQI B;  3H3M A;  5AFU L;  2VQE T;  3ETV A;  4AKL A;  2WBL A;  3BQL A;  5LHI B;  3I9W A;  2MTQ A;  4NXN T;  4O4J E;  2Q9Q C;  5LG4 A;  2BVM A;  5JVD E;  2X9W A;  3PJA J;  1N36 T;  3NRX A;  3Q5D A;  5L3E B;  3JAF A;  3WI3 A;  5L2L A;  3N5L A;  3EDV A;  2LSY A;  2M6B A;  4OYJ A;  3ZN0 B;  4JEH B;  4O4L E;  2KT9 A;  5J1G A;  3AEA A;  5JDL A;  2X9X A;  3NKZ A;  2CHO A;  3U78 A;  2EHO A;  3FBZ A;  2E5V A;  1XNQ T;  2IAK A;  2LT3 A;  2X68 A;  2KMF A;  5F3J A;  3N9P A;  4Z91 A;  3PUS A;  5FY1 A;  5FVK A;  2JPF A;  4HFB A;  4DV7 T;  3T8O A;  3MKD A;  4ZI3 D;  4CZZ B;  4I43 B;  2YIN A;  1YXR A;  3G06 A;  3EUH A;  4YT0 A;  3PUA A;  4DMW A;  1HCI A;  3KV6 A;  4AQF A;  4LF6 T;  4YHJ A;  4IDN A;  3GMI A;  5JDH A;  1W09 A;  2VVN A;  3L8R A;  1QUU A;  2UXD T;  4DV0 T;  4AKG A;  4YSY A;  5LNK A;  2VK9 A;  3CQC B;  4CI1 B;  3ZEF B;  4X1K E;  3EAB A;  4QXB B;  3B5M A;  1YKH B;  3IHR A;  5AQV B;  1YD8 G;  3RHW A;  3TLW A;  4EZ4 A;  3IF8 B;  5AQU B;  4QH1 A;  1JNZ A;  3NZP A;  2ZM8 A;  3N9M A;  1WYC A;  1VOM A;  1S35 A;  4TNW A;  3A8Y C;  3AXJ B;  2XAQ B;  5CJ5 A;  3EHZ A;  3EDU A;  2CHN A;  3ZYM A;  2XAG B;  3VR9 A;  2XSB A;  5LYJ E;  2K5B B;  1D0X A;  2UXB T;  4H9O C;  5ABG A;  3H3A A;  5FY7 A;  2VKO A;  5HXS A;  4JI5 T;  3UUB A;  4WZX A;  3HR0 A;  2LJL A;  2H89 A;  4BJM A;  1IJ6 A;  3RI5 A;  4JYA T;  5AQO B;  3HKC E;  3I0Q A;  4O2B E;  4EOZ B;  2WSS V;  4P0B A;  4LF5 T;  5ADX L;  2VWA A;  4O4H E;  1MIY A;  2CEA A;  1VCT A;  3ZT5 A;  3ZYK A;  3FB2 A;  3AEF A;  2CM0 A;  4ILB A;  4ANJ A;  3ZC1 A;  2LLY A;  4HWC A;  4HFE A;  4DUZ T;  2WP9 A;  2WZI A;  2E9X C;  3P4W A;  2JQQ A;  3RYF E;  2B1E A;  2X9Y A;  1US7 B;  2Y48 B;  4YJ2 E;  4AQY T;  4H9S E;  4V1A v;  2X51 A;  2CWY A;  2NW7 A;  1UCU A;  5L3B B;  2Y8D A;  3CPZ A;  1H7C A;  2BS3 A;  1MMN A;  1KNZ A;  4PJM A;  3RGL A;  1OED C;  5FXV A;  4E7S A;  3P50 A;  3VRA A;  2WDV A;  4ASK A;  3AE3 A;  4YY3 T;  4JI3 T;  2QYW A;  2I6H A;  3ZMV B;  2FJD A;  3MA9 A;  4UVB B;  4U2Y A;  3PV0 F;  2DCF A;  1IAP A;  4HWF A;  4WNK A;  3BQK A;  3LK2 B;  1NEN A;  4IGU A;  1W9R A;  3RH3 A;  5ABF B;  4U2Z A;  4C91 A;  2CA5 A;  4LMJ A;  4GKK T;  4AI6 A;  4XBF B;  3L09 A;  3RF1 A;  4HFC A;  4COF A;  2W62 A;  2UU9 T;  3UUX B;  4A97 A;  2E9X D;  4A5X A;  3CML A;  4TUY E;  4WYV A;  4ILU A;  3CIR A;  2HHH T;  3KIN B;  3F31 A;  1LRZ A;  4CN6 A;  2Z6E A;  3R84 B;  5HWX A;  2V5C A;  1Y64 B;  4CQI A;  3BK9 A;  4GK5 E;  3SRZ A;  2D2S A;  4IHJ E;  4X65 T;  3P4S A;  1KFY A;  2W0G A;  5CA0 E;  5KX5 E;  3WAJ A;  3UU3 A;  1LKX A;  5HXR A;  3FXE B;  1ZKE A;  2WZH A;  1Y01 A;  3KBT A;  4LF7 T;  3ZMS B;  1FJG T;  2DL1 A;  1JNR A;  3RIF A;  4BA9 A;  4WBN E;  4MHC A;  5LBM A;  3LDQ B;  4JV5 T;  4ZEY A;  4HKA A;  2VUR A;  3ZJ2 A;  2XY8 B;  4P0A A;  2ZM6 T;  1HG2 A;  4G2A A;  4HTE A;  4O4I E;  2E9X A;  2K24 A;  2P9B A;  3CK6 A;  1HTJ F;  3KVA A;  4JI4 T;  4JI1 T;  4HWI B;  2V6Y B;  2V7K A;  4JI7 T;  1KK7 A;  1SUM B;  3PTR B;  2FJB A;  3C64 A;  3QUJ A;  4U7Y A;  5DQV A;  4LFB T;  2W67 A;  2H7O A;  4GIW A;  4ZOL E;  4NXM T;  2BKN A;  2X67 A;  1NWM X;  2DI4 A;  5JR9 B;  1LVK A;  4H63 V;  3ZCJ A;  4IL4 A;  2DWK A;  2WS3 A;  3U3I A;  3TLV A;  3N9L A;  2BBH A;  2V7I A;  1R8I A;  4JI2 T;  3RRC A;  2LM2 A;  5HEU A;  5JH7 E;  2L8K A;  3PJA A;  3AEC A;  2WQY A;  2XQ4 A;  3E08 A;  5AQR B;  5C2T A;  2N1G A;  2XTL A;  2WB5 A;  5AQK B;  4DR3 T;  4Z90 A;  1N34 T;  2LSJ A;  2MYS A;  3N9Q A;  4M1P A;  1D0Z A;  2MOZ A;  4ZHQ E; 
#chains in the Genus database with same CATH homology
 4K0K T;  4JI8 T;  4DV2 T;  4DV7 T;  5BR8 T;  3T1Y T;  2ZM6 T;  4DV6 T;  1IBK T;  4X64 T;  4X62 T;  2F4V T;  4JYA T;  1IBM T;  4DR5 T;  4LF5 T;  4DV4 T;  4DR2 T;  4B3R T;  4LF8 T;  4JI4 T;  1HNX T;  4JI1 T;  4KHP T;  4GKK T;  5IWA T;  4JI7 T;  4DR6 T;  1HNW T;  4X66 T;  1N33 T;  4LF6 T;  4YHH T;  2UU9 T;  4OX9 T;  4LF4 T;  4GKJ T;  4LFB T;  4LFC T;  4DUZ T;  5LMU T;  4B3T T;  4LFA T;  3OTO T;  2VQE T;  2UUA T;  4NXM T;  2UUB T;  2UXD T;  4NXN T;  4DV0 T;  1XMO T;  1XNR T;  4JI0 T;  2HHH T;  4LF9 T;  5LMN T;  1HNZ T;  1J5E T;  1N36 T;  3T1H T;  4AQY T;  4JI2 T;  4B3S T;  4DV3 T;  4DR1 T;  4X65 T;  1I94 T;  1XMQ T;  4DR7 T;  4JI6 T;  2UXC T;  4DUY T;  1HR0 T;  1IBL T;  4LF7 T;  4DR3 T;  1FJG T;  2E5L T;  1N32 T;  4B3M T;  1N34 T;  4JI5 T;  2UUC T;  4DV1 T;  1XNQ T;  2VQF T;  4YY3 T;  4JI3 T;  2UXB T;  4JV5 T;  4DR4 T;  4DV5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...