4K0KT

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4k0kT00
1J5ET 3T1HT 4NXMT 1XNQT 4JI2T 1N36T 5IWAT 4YHHT 1HNXT 4LF4T 2UUCT 4X64T 1HNWT 4JI0T 4JI4T 4DV2T 4DV0T 4X66T 4GKKT 4JI3T 4DV1T 4DR6T 1N34T 5LMUT 4DR5T 4JI6T 4LF9T 4YY3T 2UXCT 1XMQT 2HHHT 4LF8T 4LFAT 4DUYT 4JI5T 4X62T 1IBKT 4DV7T 4K0KT 2UXBT 5BR8T 2ZM6T 4KHPT 4DUZT 4LF7T 5LMNT 4DR4T 3T1YT 4LFCT 4B3ST 4NXNT 4OX9T 4DV3T 4AQYT 1IBLT 2UXDT 2E5LT 2VQET 1I94T 4JYAT 4DV4T 2UUBT 4LFBT 1XNRT 4GKJT 4DR2T 3OTOT 1N33T 4DR7T 1IBMT 4X65T 4DV5T 4LF5T 1HNZT 1HR0T 4DV6T 2UU9T 4B3TT 4B3RT 4JI8T 4LF6T 4DR3T 1N32T 1XMOT 4JV5T 4JI1T 1FJGT 4JI7T 2F4VT 4DR1T 2UUAT 4B3MT 2VQFT
chains in the Genus database with same CATH superfamily
4NXMT 1HG5A 3CIRA 5HEUA 2OV9A 4ADZA 5JDNA 2M6BA 4QHOA 3ZMVB 2XSBA 3L3PA 1Z8UA 5C2TA 4JI0T 2MAWA 3SFDA 4EZ4A 1N34T 5LMUT 3J7Yq 3UUNA 4DBRA 1OEDC 2W61A 3HR0A 4KBMB 2BBHA 3PUAA 4IL4A 5FY1A 1WYBA 2PTFA 3GN5A 2JPFA 2BKOA 3MK7C 1KEYA 5DABA 3U78A 4HFDA 4H9RC 3K3NA 3L8RA 5HXSA 1XDPA 2XZEA 1VCSA 2WU5A 4XBFB 2XPKA 5KX5E 5HXRA 2LLYA 4AKRB 3ZSSA 4A5XA 4TV9E 5DJQC 3ZMSB 4GK5E 2DLRA 3FXEB 4IT4A 2KINB 3AE9A 3EDVA 3RQUA 3AE8A 2VKHA 3VKHA 2VVNA 3N9OA 4HWFA 1UURA 1E7PA 3ZN0B 1J5ET 3AECA 1Z0PA 5JDFA 3ZMUB 4TNVA 4GIWA 3L09A 4PNIA 4EZHA 3W15B 4Z91A 1OXZA 2FBWA 3RH3A 5KMGP 4KMCA 3AE1A 3M3ZB 5L4EA 4KUMB 4JBWF 4OK0A 2YK0A 3CMLA 5LCYA 2ZMAA 5AQJB 3GWHA 4DMVA 3ZT7A 5F3JA 3C4XA 3P7IA 5EK4A 3FBZA 3SOLA 4QKNA 3RKOA 4F8HA 3AEBA 3KINB 5CA0E 3HI2A 1U4QA 3PJAA 5AQTB 4CXXA 4U33A 5LGNB 2E5LT 3ZJ2A 1I94T 1XZYA 2DNXA 3SS1A 2Q9QD 1KK7A 2J4GA 4PJMA 4ZOLE 4EGWA 3EAMA 3JADA 4C91A 1GQEA 2J1DG 4TZ4C 2Z6EA 2J62A 4ASKA 2L8KA 4H9SE 4B3RT 3C51A 2IC9A 4U74A 3VU7H 3AEAA 4JI7T 3QOFA 2VASA 1XDOA 3LK2B 2XAFB 3PU8A 3FXDB 3T1HT 2NR4A 3AE3A 3P4SA 3GA8A 5J0ZA 4MHCA 4HWHA 1MIYA 5LNKA 5IHYA 3N2GE 3ETUA 3RX6A 4CN6A 2D2SA 5FVLA 3PU3A 2D0UA 5LJNA 1BR0A 3P50A 3G06A 1T98A 2CBIA 4YTNA 2UXCT 2V26A 3Q2MA 1HX8A 2QA7A 3AA0B 5AFUL 2PG8A 1FEWA 2B76A 2LE8A 4A97A 1ZP0A 3AEFA 4IHJE 1IBKT 3LBXA 2B1EA 2UXBT 2XQ9A 3F2EA 1DU2A 3LG7A 2XASB 3PDYA 4MFRA 4E7SA 2A3DA 2HN2A 4COFA 2UXXB 2UUBT 4HKAA 3ZPOA 4LMLA 4QX7B 4I0UA 2NW8A 2HN1A 3D0TA 1WLXA 4Z8XA 3UUBA 1KF6A 4ZI2D 3ETVA 3AE2A 1YKEB 2WDVA 2VURA 2D5UA 4JV5T 4IDOA 2IDOB 5EK3A 3AE6A 2C5IT 3LFMA 2JIWA 2DWKA 4WYVA 3ZMTB 3BQLA 3O1JA 2LRKA 1HX1B 3LJCA 4H9QC 2LSIA 2RPAA 2V6YA 3AB3B 1SE7A 1SA0E 2I59A 2AE9A 2Y48B 2LKHA 3HA4A 3A8YC 3RPUA 3F57A 2X0YA 2WCAA 2W67A 5JR9A 4O2BE 3AEDA 3N5LA 4AKHA 1FMVA 3PUGA 3RIUA 4YSYA 5LG4A 4DUZT 2KT9A 3QB5A 4HWDA 1UCUA 3ZC1A 5ABHA 3I0QA 2IW5B 4X5TA 3K3OA 4LFBT 1X79A 1S94A 5HEHA 2YU1A 1HCIA 3CQCB 2X66A 5BMVE 2DCFA 5FXWA 3X1DA 4UVAB 1ZV4X 3JAEA 5ABGA 4IREA 5L3EB 2QYWA 1XMOT 1W9RA 3DTOA 4YTMA 2ODVA 3P4QA 5IUXA 2JQKA 2IC6A 3AA1B 4HTEA 3JCFA 3ZEFB 2XM1A 3ZCIA 2IHR1 2CHNA 4DV2T 4NIQA 3UQ7A 1FIOA 5CFBA 3NBXX 4JI6T 1QSDA 3N2OA 4CN4A 1SUMB 4P0AA 3UU8A 3P4WA 2WB5A 1R8IA 1OEDA 4JI5T 4PAGA 3VRAA 2DHRA 4YLHA 5AQOB 5FP3A 2VB6A 3C64A 1MIVA 5LP6E 4TWDA 4PW8A 2X67A 2EHOC 2H89A 4V1Av 3LDQB 3A5XA 4ANJA 4K0UA 5TAOA 5CB4E 5HEGA 3OTOT 2LSGA 2Y6XA 4IGUA 4ZZBA 2KWHA 5HXEA 3K3QC 3QB5K 3K8PC 3LSVA 4HEAA 3PTRB 3IF8B 3QUJA 3IBPA 3RC3A 1X9BA 1KNPA 4EYYR 2YN6A 5AQHB 4EOZB 3UUXB 4GK0E 2AXDS 1IJ6A 2WWUA 3I9YA 4JEUB 1G8XA 4PJJA 5JRCA 2A2FX 3P4RA 5AQRB 3UFEA 1XMQT 3TLUA 5FXVA 4DVDA 2ODUA 4H9OC 2H7VC 3KV5A 4KHZF 1U5PA 4KP3C 3RYHE 3ANWB 4LMKA 2ACXA 2XTLA 4LF7T 3RRCA 5LMNT 3ZKRA 2K5BB 4B3ST 5LHHB 2IIUA 1CUNA 2XQ3A 3H3MA 2UXDT 1YKHB 2I6HA 5FNVE 3NWIA 3EHZA 1VOMA 3ZT6A 4UVCB 1IJ5A 1HR0T 1NAFA 2NOXA 2UU9T 3UULA 4QX8B 2ZM2A 4O4LE 1YW0A 1FJGT 3Q9DA 5L3GB 5L3FB 3PUYF 2BBJA 5L3CB 2YU2A 4JI2T 3K1SA 1KNRA 4WNKA 2H88A 1YQ4A 3EABA 3O4XE 3UUMA 4LF4T 1BR2A 2MOZA 1UK5A 4UVBB 1HNWT 5JTGA 4DNDA 2FUPA 4TV8E 4HWIB 2V5CA 2CE7A 4QXCB 3BQIA 5DQVA 1WYCA 3FZMB 2E9XB 4AKIA 3FHNA 5JDHA 2HPLA 2M6IA 3PV0F 3VHLA 5FY0A 1D1AA 2IMLA 2QGSA 3E22E 2WBLA 4DR4T 4ZI3D 3CX6B 3KV9A 1HS7A 4AXPA 4DBQA 2WDRA 3J9X1 5ADXL 1UX4A 4U72A 2VQET 4YSZA 5L47A 1WCRA 2G0UA 1JNZA 3KV6A 1NEKA 3ONXA 3OYXA 2CWYA 2XQAA 1HF8A 3Q5WA 4H63V 4KX6A 4TUYE 3PURA 4AI6A 1UX5A 3N2KE 4ILCA 2XAGB 2X68A 4HFHA 4CI1B 3UU4A 2OA5A 2MPKA 5FYMA 5CA1E 3CQXC 5LYJE 2CXLA 4AISA 3PUXF 4IDZA 4EAHA 3LBXB 3RI5A 2WS3A 3PUZF 1ZOYA 4HFBA 2IUBA 2K9AA 3QNUA 4X20E 3ZYLA 5FY7A 3JC6D 2WZHA 2JQ9A 4IDQA 2HHHT 4TWHA 4LF8T 3NZPA 4ZEYA 2Q9QB 4C90A 3KVAA 2L9QA 4XZCA 3SFEA 3KDSE 5HWXA 5AQQB 1WFDA 3H3AA 4NXNT 3AEGA 3PJAJ 4I55E 3E08A 2DI4A 4IE0A 3P4PA 3RYCE 3OYZA 2EHOD 1HG2A 4ZS3A 2XQ5A 4EEDA 2MBGA 2OLTA 3N9LA 4DR2T 4U7YA 5F5WA 4BAYB 4FJOA 3RLFF 4DR7T 4UELA 5LXTE 2R6GF 3I9WA 2W0GA 4HE8A 1Y01A 5LOVE 1G73A 2PBIA 5FL1A 4G63A 2FJDA 2W66A 2UUAT 4B3MT 1W0AA 4GKJT 1YD8G 2LKGA 1XNQT 1B7TA 3KV4A 4YHHT 3EDUA 1LVFA 4X1KE 4UV9B 2W00A 4PJLA 3MKDA 4MALA 5JR9B 1WR6A 2K48A 2V7IA 3B5MA 4JLEA 3BK9A 5JH7E 4L9IA 4IIJE 2E9XC 1D1CA 4ZS2A 2KMFA 1YXRA 4QWNB 2CXDA 2KZ7B 4MBQA 2JJ9A 2I0MA 1AJ3A 4DUYT 3UU6A 3VKGA 4HN9A 4O2AE 2NWBA 4JEHB 2BDEA 2BKNA 4ILBA 5CGMA 4OHFA 4YFSA 4EB6E 5KDMC 3U3IA 5EK2A 4JYAT 3TLWA 3MXZA 5ABFB 2EHOA 3OKQA 3P8CD 4PFOA 2VKOA 1S35A 1J5WA 2XY8B 3KBUA 1IBMT 3WAKA 3CX8B 2BVLA 3TLTA 2C5KT 3AVRA 1CHUA 4F6RC 2LSYA 1HFAA 2NW7A 4WBOA 4ERRA 2W2UA 2GK9A 4EIWA 4HFCA 4YJ3E 1M7KA 2KWIB 4ZZCA 3VR9A 1W0BA 4ISSA 2W63A 2ES0A 4FI5A 4LMJA 1OEDB 2J47A 3QK6A 3FZLB 4UF0B 2N2NA 2P9BA 4DR5T 2WQYA 3UU3A 4AQFC 5E0OA 4YY3T 3ZMZB 1E2AA 2Q9QC 2X0HA 2YDRA 2HH7A 4U2ZA 4O4JE 5J1GA 5LB7B 4YTPA 2CA5A 3ZYMA 2XQ6A 1ZEEA 4YXDA 3RYFE 3OVUA 3UT5E 4DV7T 3M65A 3F31A 4EV6A 5CJ5A 4BA9A 4H9PC 2XQ8A 4I4TE 2X9WA 4KI0F 2V7KA 2VKDA 3NRXA 1XWMA 2LM9A 1L0VA 2K3WA 5LA6E 2YKSA 3RF1A 2H3RA 3NVOA 2BG9B 3EUHA 3CQGB 2JRKA 4O4HE 2LHNA 4A56A 3IHRA 5DQWA 1HNZT 3IEEA 4GOUA 1V9DA 5KXJA 3QC9A 4HWCA 2V8SV 4B6XA 1BR1A 2N1GA 5J2TE 4JI8T 2XJ7A 3ZJ1A 3RHWA 2MYSA 2NTXA 2VKJA 3O1IA 3AVSA 3I0OA 3RRWA 1MIWA 4P09A 4ISTA 3UTKA 3SRZA 1HTJF 1MNEA 4DV1T 5HWYA 4QXHB 5JDGA 2KXPB 3RC8A 2QVAA 4H9NC 4IE5A 1WRDA 2XHEB 2LOPA 1H7CA 2WMOA 3C50A 2BZBA 2LSKA 3GN5B 5BR8T 4ZI2C 1D0YA 4EYUA 3ZLIA 5AQSB 2XAQB 3MA9A 4PFPA 3BQKA 3V5UA 2XQYA 3CVRA 3VR8A 4UIGA 3A7MA 4DV4T 3CKDA 3AXJA 3RIFA 4CQIA 2XM2A 2FJEA 4PJNA 4DV6T 2ZLYA 4DIDB 4H63H 3AEEA 3AA6B 2WM9A 4GYRA 3UFGA 4E7ZA 1NENA 3RKGA 4DR3T 2XQ7A 4G2AA 1D1BA 5GONE 2WSSV 3N9NA 5JDMA 2KNDA 2XQ4A 2CMRA 2XAHB 4IE7A 4U31A 4UV8B 2X9XA 3DJBA 4YSXA 1LVKA 3MJXA 4DR6T 2E8IA 2LSJA 4IDNA 2UXNB 5FXZA 3FB2A 3PUVF 4LF9T 2A72A 2DWGA 1LKXA 4WBNE 4M1PA 1ZKEA 2E9XD 3I1AA 2YEVC 2PFVA 4NUUA 3AAIA 5JREA 4ILAA 2ZM6T 2JMHA 3ANWA 1EZ3A 2D9DA 1T8BA 3EVYA 2CWOA 2X9HA 3CK6A 2JQHA 4AQYT 2BG9C 3GMIA 5LG3A 3TLSA 3ONLC 5ETWA 2LJLA 4X1YE 4EEBA 2X51A 2YOEA 4YJ2E 5LGUB 3LK42 2DL1A 2WWVA 2V7MA 2KLQA 1FMWA 3AE4A 3HKDE 4HFIA 5LGTB 2D0TA 4TN7B 2F4VT 5AQUB 1NWMX 2LM2A 2N9DA 2NP9A 4XAXB 1T7SA 2X9YA 1N36T 2WMNA 5HYAA 1MMDA 3UQ4A 2WAUA 2V7JA 1YQ3A 1MNDA 4DV0T 4IE6A 3OJAA 1O3XA 5AQPB 4L5GA 3TKLB 3RQWA 3ZCJA 4QXBB 3HKCE 3DP7A 3ZN1B 2CLYB 3AAAB 3SWHA 3AAEB 1KNZA 2E9XA 3ONJA 3MACA 4GYSA 5L2LA 1BR4A 4MLKA 4QH5A 3ESLA 5HXHA 1Y64B 2CBJA 2WY2A 1US7B 2NTYA 1MMNA 1LRZA 2LHRA 4OYJA 5JQGE 2RP4A 4DV3T 4U3CA 3NRYA 3N9MA 2W4XA 1M62A 5L4HA 1XNRT 4BJMA 2ACZA 5AQIB 1T72A 4ZXLA 2SPCA 3N9PA 1D0XA 5L3BB 4YT0A 3HKEE 3NZQA 5JVDE 4LF5T 5AQFB 4AKGA 3WAJA 5HAXA 2E5VA 4EXTA 1J1JA 4TNWA 4LF6T 3O9XA 3RGLA 5FXXA 3CX7B 3ZC0A 4DR1T 4ZHQE 3ZT5A 1IZNB 2BS3A 4Q25A 5HEOA 4OFZA 2MTQA 4AIUA 2H7OA 4I43B 2V6YB 4QH1A 3TLVA 4WW0A 4UEMA 5LHGB 5A1LA 3RYIE 3T8OA 4JI3T 4AKLA 3KBTA 2BVMA 3HL6A 5IYZE 4TWFA 3C98B 4J2CA 3KFWX 2V1DB 1VRBA 3O1HA 3RIAA 1I6ZA 4AQFA 3Q5EA 2Y8DA 5AQVB 1VCTA 4OYKA 3PUSA 4YHJA 5JDLA 4X62T 2EHOB 2Q9QA 3CPZA 5M4YA 2XAJB 2PJQA 2LOSA 4TX5A 3R6NA 2CXFA 2KSRA 3C4WA 5FL0A 4U7IA 1D0ZA 3C4ZA 5F8PA 2CHOA 2WP9A 2YINA 2C0SA 3NKZA 4IE4A 5AQGB 4NPPA 4PK6A 3FZHB 4N78D 2QRXA 3CWZB 2YDQA 4CXYA 1N33T 4IL9A 4X1IE 2V6XA 5HXCA 4X65T 3PUWF 3ABVA 3PE0A 3OBVE 3ZYKA 4CI2B 3E0ZA 2IAKA 5FVKA 2LT3A 4P0BA 3N9QA 2CEAA 4O8SA 1QLBA 1ZHCA 5IWAT 1OWAA 4PK5A 4CN1A 1HNXT 3IA3A 4HFEA 1UUSA 2BKPA 5HCMA 2VWAA 4UXNB 5AQNB 4X64T 5C3JA 1IAPA 3MZKB 4X66T 2CRBA 5HCJA 4ZI3C 2CLYC 3KVBA 2WZIA 3JAFA 4NUVA 2HPJA 5FKYA 2VL0A 4DO0A 3L39A 1E1HB 2VK9A 2M67A 2X0LB 3V5SA 5LJMA 2L3LA 4LFAT 4UR9A 2LRLA 4A98A 5L3DB 2RA1A 2WDQA 4ZI7E 5LBQB 4KHPT 3FBLA 2CPTA 2BS2A 3T1YT 3AE7A 4LFCT 1UGOA 1KFYA 4OX9T 1IBLT 4ILUA 2C5JA 2FJBA 4L0RA 2A9UA 4CZZB 2LEHA 4HGAA 4U2YA 1MMGA 3LK3B 5AQMB 5ABFA 3FZFB 4DMWA 4I50E 3Q5XA 2V7LA 5C8YE 2YDSA 3Q5DA 2E2AA 3R84B 5J2UE 4BJNA 3VRBA 1N32T 5AQKB 4JI1T 4WZXA 4PK4A 3JC6C 5FMNA 1JNRA 2CM0A 2V5DA 3AA7B 3HKBE 3UU5A 4O4IE 2NW9A 2K24A 1W09A 2BS4A 2ZM0A 2UUCT 4CXWA 1OEDE 2W62A 4JI4T 5H6QB 2ZM8A 4GKKT 2FJAA 4UF0A 4AQGA 3B13A 5JRCB 1WR0A 4JUYA 5JR9C 3PUQA 4IDPA 5ABEA 5LBMA 3RIUC 3AXJB 3ZSTA 5H6RB 5EZYE 4K0KT 3B57A 2JMKA 2VVSA 2WU2A 3OPCA 3WI3A 5HEJA 4HFVA 3EI0A 1QUUA 3FZKB 3AE5A 2BG9E 2BG9A 1MMAA 1SHZC 2XSAA 5JDQA 2XUEA 3H37A 4DV5T 4QH4A 4B3TT 2CCQA 2JQQA 5AQLB 5LHIB 4Z90A 4CI3B 3S4UA 2VL8A 2VQFT 4P1NA
chains in the Genus database with same CATH topology
1J5ET 3T1HT 4NXMT 1XNQT 4JI2T 1N36T 5IWAT 4YHHT 1HNXT 4LF4T 2UUCT 4X64T 1HNWT 4JI0T 4JI4T 4DV2T 4DV0T 4X66T 4GKKT 4JI3T 4DV1T 4DR6T 1N34T 5LMUT 4DR5T 4JI6T 4LF9T 4YY3T 2UXCT 1XMQT 2HHHT 4LF8T 4LFAT 4DUYT 4JI5T 4X62T 1IBKT 4DV7T 4K0KT 2UXBT 5BR8T 2ZM6T 4KHPT 4DUZT 4LF7T 5LMNT 4DR4T 3T1YT 4LFCT 4B3ST 4NXNT 4OX9T 4DV3T 4AQYT 1IBLT 2UXDT 2E5LT 2VQET 1I94T 4JYAT 4DV4T 2UUBT 4LFBT 1XNRT 4GKJT 4DR2T 3OTOT 1N33T 4DR7T 1IBMT 4X65T 4DV5T 4LF5T 1HNZT 1HR0T 4DV6T 2UU9T 4B3TT 4B3RT 4JI8T 4LF6T 4DR3T 1N32T 1XMOT 4JV5T 4JI1T 1FJGT 4JI7T 2F4VT 4DR1T 2UUAT 4B3MT 2VQFT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E T;  3T1H T;  4NXM T;  1XNQ T;  4JI2 T;  1N36 T;  5IWA T;  4YHH T;  1HNX T;  4LF4 T;  2UUC T;  4X64 T;  1HNW T;  4JI0 T;  4JI4 T;  4DV2 T;  4DV0 T;  4X66 T;  4GKK T;  4JI3 T;  4DV1 T;  4DR6 T;  1N34 T;  5LMU T;  4DR5 T;  4JI6 T;  4LF9 T;  4YY3 T;  2UXC T;  1XMQ T;  2HHH T;  4LF8 T;  4LFA T;  4DUY T;  4JI5 T;  4X62 T;  1IBK T;  4DV7 T;  4K0K T;  2UXB T;  5BR8 T;  2ZM6 T;  4KHP T;  4DUZ T;  4LF7 T;  5LMN T;  4DR4 T;  3T1Y T;  4LFC T;  4B3S T;  4NXN T;  4OX9 T;  4DV3 T;  4AQY T;  1IBL T;  2UXD T;  2E5L T;  2VQE T;  1I94 T;  4JYA T;  4DV4 T;  2UUB T;  4LFB T;  1XNR T;  4GKJ T;  4DR2 T;  3OTO T;  1N33 T;  4DR7 T;  1IBM T;  4X65 T;  4DV5 T;  4LF5 T;  1HNZ T;  1HR0 T;  4DV6 T;  2UU9 T;  4B3T T;  4B3R T;  4JI8 T;  4LF6 T;  4DR3 T;  1N32 T;  1XMO T;  4JV5 T;  4JI1 T;  1FJG T;  4JI7 T;  2F4V T;  4DR1 T;  2UUA T;  4B3M T;  2VQF T; 
#chains in the Genus database with same CATH topology
 4NXM T;  1HG5 A;  3CIR A;  5HEU A;  2OV9 A;  4ADZ A;  5JDN A;  2M6B A;  4QHO A;  3ZMV B;  2XSB A;  3L3P A;  1Z8U A;  5C2T A;  4JI0 T;  2MAW A;  3SFD A;  4EZ4 A;  1N34 T;  5LMU T;  3J7Y q;  3UUN A;  4DBR A;  1OED C;  2W61 A;  3HR0 A;  4KBM B;  2BBH A;  3PUA A;  4IL4 A;  5FY1 A;  1WYB A;  2PTF A;  3GN5 A;  2JPF A;  2BKO A;  3MK7 C;  1KEY A;  5DAB A;  3U78 A;  4HFD A;  4H9R C;  3K3N A;  3L8R A;  5HXS A;  1XDP A;  2XZE A;  1VCS A;  2WU5 A;  4XBF B;  2XPK A;  5KX5 E;  5HXR A;  2LLY A;  4AKR B;  3ZSS A;  4A5X A;  4TV9 E;  5DJQ C;  3ZMS B;  4GK5 E;  2DLR A;  3FXE B;  4IT4 A;  2KIN B;  3AE9 A;  3EDV A;  3RQU A;  3AE8 A;  2VKH A;  3VKH A;  2VVN A;  3N9O A;  4HWF A;  1UUR A;  1E7P A;  3ZN0 B;  1J5E T;  3AEC A;  1Z0P A;  5JDF A;  3ZMU B;  4TNV A;  4GIW A;  3L09 A;  4PNI A;  4EZH A;  3W15 B;  4Z91 A;  1OXZ A;  2FBW A;  3RH3 A;  5KMG P;  4KMC A;  3AE1 A;  3M3Z B;  5L4E A;  4KUM B;  4JBW F;  4OK0 A;  2YK0 A;  3CML A;  5LCY A;  2ZMA A;  5AQJ B;  3GWH A;  4DMV A;  3ZT7 A;  5F3J A;  3C4X A;  3P7I A;  5EK4 A;  3FBZ A;  3SOL A;  4QKN A;  3RKO A;  4F8H A;  3AEB A;  3KIN B;  5CA0 E;  3HI2 A;  1U4Q A;  3PJA A;  5AQT B;  4CXX A;  4U33 A;  5LGN B;  2E5L T;  3ZJ2 A;  1I94 T;  1XZY A;  2DNX A;  3SS1 A;  2Q9Q D;  1KK7 A;  2J4G A;  4PJM A;  4ZOL E;  4EGW A;  3EAM A;  3JAD A;  4C91 A;  1GQE A;  2J1D G;  4TZ4 C;  2Z6E A;  2J62 A;  4ASK A;  2L8K A;  4H9S E;  4B3R T;  3C51 A;  2IC9 A;  4U74 A;  3VU7 H;  3AEA A;  4JI7 T;  3QOF A;  2VAS A;  1XDO A;  3LK2 B;  2XAF B;  3PU8 A;  3FXD B;  3T1H T;  2NR4 A;  3AE3 A;  3P4S A;  3GA8 A;  5J0Z A;  4MHC A;  4HWH A;  1MIY A;  5LNK A;  5IHY A;  3N2G E;  3ETU A;  3RX6 A;  4CN6 A;  2D2S A;  5FVL A;  3PU3 A;  2D0U A;  5LJN A;  1BR0 A;  3P50 A;  3G06 A;  1T98 A;  2CBI A;  4YTN A;  2UXC T;  2V26 A;  3Q2M A;  1HX8 A;  2QA7 A;  3AA0 B;  5AFU L;  2PG8 A;  1FEW A;  2B76 A;  2LE8 A;  4A97 A;  1ZP0 A;  3AEF A;  4IHJ E;  1IBK T;  3LBX A;  2B1E A;  2UXB T;  2XQ9 A;  3F2E A;  1DU2 A;  3LG7 A;  2XAS B;  3PDY A;  4MFR A;  4E7S A;  2A3D A;  2HN2 A;  4COF A;  2UXX B;  2UUB T;  4HKA A;  3ZPO A;  4LML A;  4QX7 B;  4I0U A;  2NW8 A;  2HN1 A;  3D0T A;  1WLX A;  4Z8X A;  3UUB A;  1KF6 A;  4ZI2 D;  3ETV A;  3AE2 A;  1YKE B;  2WDV A;  2VUR A;  2D5U A;  4JV5 T;  4IDO A;  2IDO B;  5EK3 A;  3AE6 A;  2C5I T;  3LFM A;  2JIW A;  2DWK A;  4WYV A;  3ZMT B;  3BQL A;  3O1J A;  2LRK A;  1HX1 B;  3LJC A;  4H9Q C;  2LSI A;  2RPA A;  2V6Y A;  3AB3 B;  1SE7 A;  1SA0 E;  2I59 A;  2AE9 A;  2Y48 B;  2LKH A;  3HA4 A;  3A8Y C;  3RPU A;  3F57 A;  2X0Y A;  2WCA A;  2W67 A;  5JR9 A;  4O2B E;  3AED A;  3N5L A;  4AKH A;  1FMV A;  3PUG A;  3RIU A;  4YSY A;  5LG4 A;  4DUZ T;  2KT9 A;  3QB5 A;  4HWD A;  1UCU A;  3ZC1 A;  5ABH A;  3I0Q A;  2IW5 B;  4X5T A;  3K3O A;  4LFB T;  1X79 A;  1S94 A;  5HEH A;  2YU1 A;  1HCI A;  3CQC B;  2X66 A;  5BMV E;  2DCF A;  5FXW A;  3X1D A;  4UVA B;  1ZV4 X;  3JAE A;  5ABG A;  4IRE A;  5L3E B;  2QYW A;  1XMO T;  1W9R A;  3DTO A;  4YTM A;  2ODV A;  3P4Q A;  5IUX A;  2JQK A;  2IC6 A;  3AA1 B;  4HTE A;  3JCF A;  3ZEF B;  2XM1 A;  3ZCI A;  2IHR 1;  2CHN A;  4DV2 T;  4NIQ A;  3UQ7 A;  1FIO A;  5CFB A;  3NBX X;  4JI6 T;  1QSD A;  3N2O A;  4CN4 A;  1SUM B;  4P0A A;  3UU8 A;  3P4W A;  2WB5 A;  1R8I A;  1OED A;  4JI5 T;  4PAG A;  3VRA A;  2DHR A;  4YLH A;  5AQO B;  5FP3 A;  2VB6 A;  3C64 A;  1MIV A;  5LP6 E;  4TWD A;  4PW8 A;  2X67 A;  2EHO C;  2H89 A;  4V1A v;  3LDQ B;  3A5X A;  4ANJ A;  4K0U A;  5TAO A;  5CB4 E;  5HEG A;  3OTO T;  2LSG A;  2Y6X A;  4IGU A;  4ZZB A;  2KWH A;  5HXE A;  3K3Q C;  3QB5 K;  3K8P C;  3LSV A;  4HEA A;  3PTR B;  3IF8 B;  3QUJ A;  3IBP A;  3RC3 A;  1X9B A;  1KNP A;  4EYY R;  2YN6 A;  5AQH B;  4EOZ B;  3UUX B;  4GK0 E;  2AXD S;  1IJ6 A;  2WWU A;  3I9Y A;  4JEU B;  1G8X A;  4PJJ A;  5JRC A;  2A2F X;  3P4R A;  5AQR B;  3UFE A;  1XMQ T;  3TLU A;  5FXV A;  4DVD A;  2ODU A;  4H9O C;  2H7V C;  3KV5 A;  4KHZ F;  1U5P A;  4KP3 C;  3RYH E;  3ANW B;  4LMK A;  2ACX A;  2XTL A;  4LF7 T;  3RRC A;  5LMN T;  3ZKR A;  2K5B B;  4B3S T;  5LHH B;  2IIU A;  1CUN A;  2XQ3 A;  3H3M A;  2UXD T;  1YKH B;  2I6H A;  5FNV E;  3NWI A;  3EHZ A;  1VOM A;  3ZT6 A;  4UVC B;  1IJ5 A;  1HR0 T;  1NAF A;  2NOX A;  2UU9 T;  3UUL A;  4QX8 B;  2ZM2 A;  4O4L E;  1YW0 A;  1FJG T;  3Q9D A;  5L3G B;  5L3F B;  3PUY F;  2BBJ A;  5L3C B;  2YU2 A;  4JI2 T;  3K1S A;  1KNR A;  4WNK A;  2H88 A;  1YQ4 A;  3EAB A;  3O4X E;  3UUM A;  4LF4 T;  1BR2 A;  2MOZ A;  1UK5 A;  4UVB B;  1HNW T;  5JTG A;  4DND A;  2FUP A;  4TV8 E;  4HWI B;  2V5C A;  2CE7 A;  4QXC B;  3BQI A;  5DQV A;  1WYC A;  3FZM B;  2E9X B;  4AKI A;  3FHN A;  5JDH A;  2HPL A;  2M6I A;  3PV0 F;  3VHL A;  5FY0 A;  1D1A A;  2IML A;  2QGS A;  3E22 E;  2WBL A;  4DR4 T;  4ZI3 D;  3CX6 B;  3KV9 A;  1HS7 A;  4AXP A;  4DBQ A;  2WDR A;  3J9X 1;  5ADX L;  1UX4 A;  4U72 A;  2VQE T;  4YSZ A;  5L47 A;  1WCR A;  2G0U A;  1JNZ A;  3KV6 A;  1NEK A;  3ONX A;  3OYX A;  2CWY A;  2XQA A;  1HF8 A;  3Q5W A;  4H63 V;  4KX6 A;  4TUY E;  3PUR A;  4AI6 A;  1UX5 A;  3N2K E;  4ILC A;  2XAG B;  2X68 A;  4HFH A;  4CI1 B;  3UU4 A;  2OA5 A;  2MPK A;  5FYM A;  5CA1 E;  3CQX C;  5LYJ E;  2CXL A;  4AIS A;  3PUX F;  4IDZ A;  4EAH A;  3LBX B;  3RI5 A;  2WS3 A;  3PUZ F;  1ZOY A;  4HFB A;  2IUB A;  2K9A A;  3QNU A;  4X20 E;  3ZYL A;  5FY7 A;  3JC6 D;  2WZH A;  2JQ9 A;  4IDQ A;  2HHH T;  4TWH A;  4LF8 T;  3NZP A;  4ZEY A;  2Q9Q B;  4C90 A;  3KVA A;  2L9Q A;  4XZC A;  3SFE A;  3KDS E;  5HWX A;  5AQQ B;  1WFD A;  3H3A A;  4NXN T;  3AEG A;  3PJA J;  4I55 E;  3E08 A;  2DI4 A;  4IE0 A;  3P4P A;  3RYC E;  3OYZ A;  2EHO D;  1HG2 A;  4ZS3 A;  2XQ5 A;  4EED A;  2MBG A;  2OLT A;  3N9L A;  4DR2 T;  4U7Y A;  5F5W A;  4BAY B;  4FJO A;  3RLF F;  4DR7 T;  4UEL A;  5LXT E;  2R6G F;  3I9W A;  2W0G A;  4HE8 A;  1Y01 A;  5LOV E;  1G73 A;  2PBI A;  5FL1 A;  4G63 A;  2FJD A;  2W66 A;  2UUA T;  4B3M T;  1W0A A;  4GKJ T;  1YD8 G;  2LKG A;  1XNQ T;  1B7T A;  3KV4 A;  4YHH T;  3EDU A;  1LVF A;  4X1K E;  4UV9 B;  2W00 A;  4PJL A;  3MKD A;  4MAL A;  5JR9 B;  1WR6 A;  2K48 A;  2V7I A;  3B5M A;  4JLE A;  3BK9 A;  5JH7 E;  4L9I A;  4IIJ E;  2E9X C;  1D1C A;  4ZS2 A;  2KMF A;  1YXR A;  4QWN B;  2CXD A;  2KZ7 B;  4MBQ A;  2JJ9 A;  2I0M A;  1AJ3 A;  4DUY T;  3UU6 A;  3VKG A;  4HN9 A;  4O2A E;  2NWB A;  4JEH B;  2BDE A;  2BKN A;  4ILB A;  5CGM A;  4OHF A;  4YFS A;  4EB6 E;  5KDM C;  3U3I A;  5EK2 A;  4JYA T;  3TLW A;  3MXZ A;  5ABF B;  2EHO A;  3OKQ A;  3P8C D;  4PFO A;  2VKO A;  1S35 A;  1J5W A;  2XY8 B;  3KBU A;  1IBM T;  3WAK A;  3CX8 B;  2BVL A;  3TLT A;  2C5K T;  3AVR A;  1CHU A;  4F6R C;  2LSY A;  1HFA A;  2NW7 A;  4WBO A;  4ERR A;  2W2U A;  2GK9 A;  4EIW A;  4HFC A;  4YJ3 E;  1M7K A;  2KWI B;  4ZZC A;  3VR9 A;  1W0B A;  4ISS A;  2W63 A;  2ES0 A;  4FI5 A;  4LMJ A;  1OED B;  2J47 A;  3QK6 A;  3FZL B;  4UF0 B;  2N2N A;  2P9B A;  4DR5 T;  2WQY A;  3UU3 A;  4AQF C;  5E0O A;  4YY3 T;  3ZMZ B;  1E2A A;  2Q9Q C;  2X0H A;  2YDR A;  2HH7 A;  4U2Z A;  4O4J E;  5J1G A;  5LB7 B;  4YTP A;  2CA5 A;  3ZYM A;  2XQ6 A;  1ZEE A;  4YXD A;  3RYF E;  3OVU A;  3UT5 E;  4DV7 T;  3M65 A;  3F31 A;  4EV6 A;  5CJ5 A;  4BA9 A;  4H9P C;  2XQ8 A;  4I4T E;  2X9W A;  4KI0 F;  2V7K A;  2VKD A;  3NRX A;  1XWM A;  2LM9 A;  1L0V A;  2K3W A;  5LA6 E;  2YKS A;  3RF1 A;  2H3R A;  3NVO A;  2BG9 B;  3EUH A;  3CQG B;  2JRK A;  4O4H E;  2LHN A;  4A56 A;  3IHR A;  5DQW A;  1HNZ T;  3IEE A;  4GOU A;  1V9D A;  5KXJ A;  3QC9 A;  4HWC A;  2V8S V;  4B6X A;  1BR1 A;  2N1G A;  5J2T E;  4JI8 T;  2XJ7 A;  3ZJ1 A;  3RHW A;  2MYS A;  2NTX A;  2VKJ A;  3O1I A;  3AVS A;  3I0O A;  3RRW A;  1MIW A;  4P09 A;  4IST A;  3UTK A;  3SRZ A;  1HTJ F;  1MNE A;  4DV1 T;  5HWY A;  4QXH B;  5JDG A;  2KXP B;  3RC8 A;  2QVA A;  4H9N C;  4IE5 A;  1WRD A;  2XHE B;  2LOP A;  1H7C A;  2WMO A;  3C50 A;  2BZB A;  2LSK A;  3GN5 B;  5BR8 T;  4ZI2 C;  1D0Y A;  4EYU A;  3ZLI A;  5AQS B;  2XAQ B;  3MA9 A;  4PFP A;  3BQK A;  3V5U A;  2XQY A;  3CVR A;  3VR8 A;  4UIG A;  3A7M A;  4DV4 T;  3CKD A;  3AXJ A;  3RIF A;  4CQI A;  2XM2 A;  2FJE A;  4PJN A;  4DV6 T;  2ZLY A;  4DID B;  4H63 H;  3AEE A;  3AA6 B;  2WM9 A;  4GYR A;  3UFG A;  4E7Z A;  1NEN A;  3RKG A;  4DR3 T;  2XQ7 A;  4G2A A;  1D1B A;  5GON E;  2WSS V;  3N9N A;  5JDM A;  2KND A;  2XQ4 A;  2CMR A;  2XAH B;  4IE7 A;  4U31 A;  4UV8 B;  2X9X A;  3DJB A;  4YSX A;  1LVK A;  3MJX A;  4DR6 T;  2E8I A;  2LSJ A;  4IDN A;  2UXN B;  5FXZ A;  3FB2 A;  3PUV F;  4LF9 T;  2A72 A;  2DWG A;  1LKX A;  4WBN E;  4M1P A;  1ZKE A;  2E9X D;  3I1A A;  2YEV C;  2PFV A;  4NUU A;  3AAI A;  5JRE A;  4ILA A;  2ZM6 T;  2JMH A;  3ANW A;  1EZ3 A;  2D9D A;  1T8B A;  3EVY A;  2CWO A;  2X9H A;  3CK6 A;  2JQH A;  4AQY T;  2BG9 C;  3GMI A;  5LG3 A;  3TLS A;  3ONL C;  5ETW A;  2LJL A;  4X1Y E;  4EEB A;  2X51 A;  2YOE A;  4YJ2 E;  5LGU B;  3LK4 2;  2DL1 A;  2WWV A;  2V7M A;  2KLQ A;  1FMW A;  3AE4 A;  3HKD E;  4HFI A;  5LGT B;  2D0T A;  4TN7 B;  2F4V T;  5AQU B;  1NWM X;  2LM2 A;  2N9D A;  2NP9 A;  4XAX B;  1T7S A;  2X9Y A;  1N36 T;  2WMN A;  5HYA A;  1MMD A;  3UQ4 A;  2WAU A;  2V7J A;  1YQ3 A;  1MND A;  4DV0 T;  4IE6 A;  3OJA A;  1O3X A;  5AQP B;  4L5G A;  3TKL B;  3RQW A;  3ZCJ A;  4QXB B;  3HKC E;  3DP7 A;  3ZN1 B;  2CLY B;  3AAA B;  3SWH A;  3AAE B;  1KNZ A;  2E9X A;  3ONJ A;  3MAC A;  4GYS A;  5L2L A;  1BR4 A;  4MLK A;  4QH5 A;  3ESL A;  5HXH A;  1Y64 B;  2CBJ A;  2WY2 A;  1US7 B;  2NTY A;  1MMN A;  1LRZ A;  2LHR A;  4OYJ A;  5JQG E;  2RP4 A;  4DV3 T;  4U3C A;  3NRY A;  3N9M A;  2W4X A;  1M62 A;  5L4H A;  1XNR T;  4BJM A;  2ACZ A;  5AQI B;  1T72 A;  4ZXL A;  2SPC A;  3N9P A;  1D0X A;  5L3B B;  4YT0 A;  3HKE E;  3NZQ A;  5JVD E;  4LF5 T;  5AQF B;  4AKG A;  3WAJ A;  5HAX A;  2E5V A;  4EXT A;  1J1J A;  4TNW A;  4LF6 T;  3O9X A;  3RGL A;  5FXX A;  3CX7 B;  3ZC0 A;  4DR1 T;  4ZHQ E;  3ZT5 A;  1IZN B;  2BS3 A;  4Q25 A;  5HEO A;  4OFZ A;  2MTQ A;  4AIU A;  2H7O A;  4I43 B;  2V6Y B;  4QH1 A;  3TLV A;  4WW0 A;  4UEM A;  5LHG B;  5A1L A;  3RYI E;  3T8O A;  4JI3 T;  4AKL A;  3KBT A;  2BVM A;  3HL6 A;  5IYZ E;  4TWF A;  3C98 B;  4J2C A;  3KFW X;  2V1D B;  1VRB A;  3O1H A;  3RIA A;  1I6Z A;  4AQF A;  3Q5E A;  2Y8D A;  5AQV B;  1VCT A;  4OYK A;  3PUS A;  4YHJ A;  5JDL A;  4X62 T;  2EHO B;  2Q9Q A;  3CPZ A;  5M4Y A;  2XAJ B;  2PJQ A;  2LOS A;  4TX5 A;  3R6N A;  2CXF A;  2KSR A;  3C4W A;  5FL0 A;  4U7I A;  1D0Z A;  3C4Z A;  5F8P A;  2CHO A;  2WP9 A;  2YIN A;  2C0S A;  3NKZ A;  4IE4 A;  5AQG B;  4NPP A;  4PK6 A;  3FZH B;  4N78 D;  2QRX A;  3CWZ B;  2YDQ A;  4CXY A;  1N33 T;  4IL9 A;  4X1I E;  2V6X A;  5HXC A;  4X65 T;  3PUW F;  3ABV A;  3PE0 A;  3OBV E;  3ZYK A;  4CI2 B;  3E0Z A;  2IAK A;  5FVK A;  2LT3 A;  4P0B A;  3N9Q A;  2CEA A;  4O8S A;  1QLB A;  1ZHC A;  5IWA T;  1OWA A;  4PK5 A;  4CN1 A;  1HNX T;  3IA3 A;  4HFE A;  1UUS A;  2BKP A;  5HCM A;  2VWA A;  4UXN B;  5AQN B;  4X64 T;  5C3J A;  1IAP A;  3MZK B;  4X66 T;  2CRB A;  5HCJ A;  4ZI3 C;  2CLY C;  3KVB A;  2WZI A;  3JAF A;  4NUV A;  2HPJ A;  5FKY A;  2VL0 A;  4DO0 A;  3L39 A;  1E1H B;  2VK9 A;  2M67 A;  2X0L B;  3V5S A;  5LJM A;  2L3L A;  4LFA T;  4UR9 A;  2LRL A;  4A98 A;  5L3D B;  2RA1 A;  2WDQ A;  4ZI7 E;  5LBQ B;  4KHP T;  3FBL A;  2CPT A;  2BS2 A;  3T1Y T;  3AE7 A;  4LFC T;  1UGO A;  1KFY A;  4OX9 T;  1IBL T;  4ILU A;  2C5J A;  2FJB A;  4L0R A;  2A9U A;  4CZZ B;  2LEH A;  4HGA A;  4U2Y A;  1MMG A;  3LK3 B;  5AQM B;  5ABF A;  3FZF B;  4DMW A;  4I50 E;  3Q5X A;  2V7L A;  5C8Y E;  2YDS A;  3Q5D A;  2E2A A;  3R84 B;  5J2U E;  4BJN A;  3VRB A;  1N32 T;  5AQK B;  4JI1 T;  4WZX A;  4PK4 A;  3JC6 C;  5FMN A;  1JNR A;  2CM0 A;  2V5D A;  3AA7 B;  3HKB E;  3UU5 A;  4O4I E;  2NW9 A;  2K24 A;  1W09 A;  2BS4 A;  2ZM0 A;  2UUC T;  4CXW A;  1OED E;  2W62 A;  4JI4 T;  5H6Q B;  2ZM8 A;  4GKK T;  2FJA A;  4UF0 A;  4AQG A;  3B13 A;  5JRC B;  1WR0 A;  4JUY A;  5JR9 C;  3PUQ A;  4IDP A;  5ABE A;  5LBM A;  3RIU C;  3AXJ B;  3ZST A;  5H6R B;  5EZY E;  4K0K T;  3B57 A;  2JMK A;  2VVS A;  2WU2 A;  3OPC A;  3WI3 A;  5HEJ A;  4HFV A;  3EI0 A;  1QUU A;  3FZK B;  3AE5 A;  2BG9 E;  2BG9 A;  1MMA A;  1SHZ C;  2XSA A;  5JDQ A;  2XUE A;  3H37 A;  4DV5 T;  4QH4 A;  4B3T T;  2CCQ A;  2JQQ A;  5AQL B;  5LHI B;  4Z90 A;  4CI3 B;  3S4U A;  2VL8 A;  2VQF T;  4P1N A; 
#chains in the Genus database with same CATH homology
 1J5E T;  3T1H T;  4NXM T;  1XNQ T;  4JI2 T;  1N36 T;  5IWA T;  4YHH T;  1HNX T;  4LF4 T;  2UUC T;  4X64 T;  1HNW T;  4JI0 T;  4JI4 T;  4DV2 T;  4DV0 T;  4X66 T;  4GKK T;  4JI3 T;  4DV1 T;  4DR6 T;  1N34 T;  5LMU T;  4DR5 T;  4JI6 T;  4LF9 T;  4YY3 T;  2UXC T;  1XMQ T;  2HHH T;  4LF8 T;  4LFA T;  4DUY T;  4JI5 T;  4X62 T;  1IBK T;  4DV7 T;  4K0K T;  2UXB T;  5BR8 T;  2ZM6 T;  4KHP T;  4DUZ T;  4LF7 T;  5LMN T;  4DR4 T;  3T1Y T;  4LFC T;  4B3S T;  4NXN T;  4OX9 T;  4DV3 T;  4AQY T;  1IBL T;  2UXD T;  2E5L T;  2VQE T;  1I94 T;  4JYA T;  4DV4 T;  2UUB T;  4LFB T;  1XNR T;  4GKJ T;  4DR2 T;  3OTO T;  1N33 T;  4DR7 T;  1IBM T;  4X65 T;  4DV5 T;  4LF5 T;  1HNZ T;  1HR0 T;  4DV6 T;  2UU9 T;  4B3T T;  4B3R T;  4JI8 T;  4LF6 T;  4DR3 T;  1N32 T;  1XMO T;  4JV5 T;  4JI1 T;  1FJG T;  4JI7 T;  2F4V T;  4DR1 T;  2UUA T;  4B3M T;  2VQF T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...