4K0KT

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4k0kT00
4JI7T 4K0KT 1N33T 4DV2T 4DR4T 4DR5T 1XMOT 1HNWT 4JI2T 4X62T 4B3ST 2E5LT 4LF9T 4DUYT 4DV6T 1IBLT 3OTOT 1XMQT 4LF8T 1XNQT 4LFAT 4JI5T 1N34T 4B3TT 1XNRT 4DV1T 3T1HT 1HR0T 2UU9T 4AQYT 4X64T 1HNXT 1IBMT 2ZM6T 4GKJT 4JV5T 2UUBT 4X65T 5LMNT 2UUAT 4JI1T 4DV0T 1N36T 4LF7T 5BR8T 4DV4T 3T1YT 1I94T 4DR2T 4DR3T 4NXNT 4JYAT 4YY3T 4DR1T 4YHHT 4DV7T 4OX9T 4LF4T 1N32T 4X66T 4LFCT 4DR7T 2UUCT 5IWAT 1FJGT 4JI0T 4JI4T 4GKKT 2UXBT 2VQET 4JI8T 4NXMT 1J5ET 4DUZT 4DV3T 4LF6T 4JI3T 2UXDT 2UXCT 4KHPT 4LF5T 4DV5T 4DR6T 2F4VT 4JI6T 4LFBT 2VQFT 5LMUT 2HHHT 1HNZT 4B3MT 4B3RT 1IBKT
chains in the Genus database with same CATH superfamily
5C8YE 5EK2A 2BG9A 4IE7A 2V6YB 3S4UA 2LSIA 2V6YA 4TZ4C 2PTFA 3CPZA 4UVAB 1VCSA 5CB4E 4A56A 2LKHA 1WR0A 4EYUA 2RP4A 3ZJ2A 3RRCA 2CA5A 2W66A 3PJAJ 2YDSA 2W62A 3IF8B 1X79A 3RIUC 3JAEA 3LBXA 1D0YA 2FJBA 4KMCA 4EB6E 3LBXB 1W0AA 4X62T 3HR0A 5ABGA 2Q9QD 3AEGA 3O4XE 3EUHA 3F2EA 3P50A 2BVMA 3JCFA 4MLKA 4B3ST 3TLSA 4WNKA 5HCMA 1XDPA 2ODUA 3H3MA 3DP7A 4PK6A 2X0LB 5H6QB 2BS3A 3C50A 4LF9T 2KINB 1R8IA 2XQYA 4WW0A 2CXDA 4N78D 4PK5A 4XZCA 2V7LA 3J9X1 4YJ3E 4WBOA 1XDOA 4HFDA 4GOUA 2ODVA 1T7SA 3L09A 4ISTA 5HCJA 2MAWA 2IAKA 3AEAA 3PURA 4AXPA 3RGLA 2W0GA 4OFZA 2LE8A 5LNKA 4L5GA 4MALA 1SHZC 4TN7B 3ONXA 2WB5A 2XZEA 4OYKA 3K3OA 5LG4A 4B3TT 2PG8A 3CMLA 3FXEB 3TLUA 3ZJ1A 2D5UA 2UU9T 2X9XA 4YFSA 3C64A 2M6IA 4GIWA 2Q9QC 2I59A 4CN4A 2KSRA 2WP9A 4ZI7E 5HYAA 2V7IA 3NRXA 4E7SA 5L3CB 5LGUB 5HEJA 5LGTB 1I6ZA 4H9PC 4IDPA 2YDQA 5JDQA 1T72A 2YOEA 4AISA 5H6RB 3X1DA 4ZI2D 1G73A 3O1JA 3LJCA 3U78A 3RYCE 4U33A 1T8BA 2WDQA 4AQFC 4CI3B 1U4QA 4TV8E 1NEKA 2NTYA 4UV8B 1MIWA 4X65T 4J2CA 2DWGA 3UQ4A 3N9QA 1MNEA 4YSZA 5IUXA 5LHIB 4ISSA 2WS3A 2J1DG 5LMNT 4ZI2C 2NW9A 3Q5DA 3KV5A 4YTPA 4DV0T 3AE7A 4P09A 4QKNA 5F8PA 1WFDA 2E9XB 2CLYC 2EHOB 3PUYF 4LF7T 5L3EB 3ZKRA 5DJQC 3N9MA 3PU8A 1BR2A 4ZZCA 3AA0B 3ZC1A 4JUYA 3T1YT 2XJ7A 3NKZA 1WYBA 3AXJA 3O1IA 1UGOA 4DR2T 1OEDB 3FXDB 3NBXX 5HEHA 4DR3T 4IE6A 3P4QA 4NXNT 2JIWA 2ES0A 3OYXA 3AE9A 4PJLA 5ADXL 5CGMA 3UTKA 4UELA 2PBIA 4AQFA 4I50E 3UQ7A 4DV7T 5HWYA 3A5XA 1UUSA 2BBHA 2W61A 3KDSE 5AQTB 5AQKB 2C5IT 2XSAA 4DO0A 3VKHA 2W4XA 4IT4A 5LA6E 5TAOA 1MNDA 3P4PA 1FJGT 1BR4A 3W15B 3ZMTB 4EV6A 1UX5A 4YJ2E 5L47A 4XBFB 1XMQT 2ZM2A 2OLTA 2XAHB 2XHEB 3FB2A 4JI4T 2WWUA 1HG5A 3PJAA 4QX8B 4UVCB 2X67A 4DIDB 3LK2B 4IL4A 4PFPA 4ZS3A 4BJMA 1MMAA 3HI2A 3UUMA 4JI8T 2YU2A 3IHRA 2JJ9A 3C4XA 5FY0A 5F5WA 3PUSA 5HXCA 3VR9A 3UUNA 2CCQA 2XQ8A 4QWNB 4ZOLE 3ZEFB 4YLHA 4Z91A 2BG9C 3OBVE 4DV3T 4LF6T 1WYCA 2VVSA 3N9LA 4CI1B 3P4RA 4JI3T 4GK0E 1T98A 2V26A 2UXDT 2IHR1 2VKHA 2X0YA 3E0ZA 3GN5A 4NPPA 3V5SA 3FBZA 3RKGA 3PUGA 4H63V 4H9NC 3UFEA 3UUBA 1Z0PA 5HXRA 4DR6T 2Y48B 3EHZA 2N2NA 4AKLA 1Z8UA 2VQFT 5HEUA 3O9XA 4AKIA 5AQNB 1KNZA 3ZMVB 1OWAA 3FZKB 2V1DB 4C90A 3RIFA 2BS4A 3MJXA 1IBKT 2YKSA 1ZHCA 5J2TE 4O2AE 4BJNA 3AE1A 4GYSA 4U2YA 2IMLA 2FUPA 3AAIA 3MZKB 4K0KT 5L2LA 4UVBB 3VRAA 1N33T 1HTJF 5LCYA 3KV6A 4DR5T 3LG7A 1VCTA 2KWIB 2X0HA 5JDNA 2J47A 3UU3A 2A2FX 2DLRA 1JNRA 2A9UA 3CQGB 3EABA 4Q25A 4DBQA 5FMNA 1J1JA 4PFOA 3ETVA 4I0UA 5IYZE 5LOVE 1HNWT 5JRCB 3CX8B 2FJDA 3UU4A 4CXWA 2BS2A 1ZP0A 2ACXA 4IDOA 3CIRA 3PUXF 3AE6A 3QC9A 3M3ZB 2V8SV 2WDRA 3LDQB 2WY2A 1B7TA 5FKYA 5FVKA 5HEOA 2IC9A 4I4TE 3TLWA 2I6HA 3OTOT 1ZOYA 5JR9B 3HKDE 2MBGA 1NENA 4H63H 3Q5WA 4DMVA 4F6RC 3ONJA 4MFRA 4LFAT 3GWHA 3HA4A 3ZT7A 4UF0B 2HPJA 2NR4A 3I9WA 4TUYE 4DNDA 4EIWA 4G2AA 5HXSA 2XTLA 3HL6A 3JADA 3VHLA 4DV1T 1XNRT 3CQXC 4AQYT 3AEEA 2NW7A 2MTQA 5AQJB 3ZSTA 4KBMB 1DU2A 4WYVA 4O2BE 4TWDA 2XAQB 3WAKA 1ZEEA 2ZM6T 1KNRA 3PV0F 1FIOA 4GKJT 2V7MA 4CZZB 1FMVA 2LEHA 5ABEA 2KNDA 4JV5T 1BR1A 1W0BA 2Q9QB 2UUBT 4AI6A 3EVYA 4GK5E 1NWMX 5HXHA 4X1YE 1G8XA 3UULA 1U5PA 4TNWA 3KBTA 3QNUA 4KHZF 2PJQA 3RQUA 3VKGA 5JDMA 2CHOA 4IE0A 5KX5E 3MK7C 2QYWA 2RA1A 2XQ9A 2A72A 4UV9B 3RIAA 5JH7E 1N36T 2V7KA 5CFBA 3FZFB 5JDFA 4ILBA 4IDZA 2BDEA 5L4HA 5HEGA 4A5XA 4UEMA 2JRKA 5AQLB 4HWDA 1H7CA 1S94A 1UURA 3N5LA 2EHOC 2WBLA 5LBQB 4YY3T 4HFVA 4ZS2A 4HTEA 1WCRA 1W9RA 3IEEA 4NUVA 1ZV4X 4DR1T 4P0AA 3PE0A 3AVSA 3ZLIA 2CE7A 2FJEA 3LK3B 5CA0E 3SFEA 3CVRA 4X66T 1XZYA 2LT3A 3AEFA 4EZHA 1O3XA 5J2UE 5LJMA 2XY8B 5AQPB 3AE8A 3L3PA 2QA7A 2LOSA 4JI0T 4JEUB 5EK3A 3BK9A 3ZN0B 2DHRA 4CN6A 2FBWA 2VWAA 4X1KE 3RYIE 4X5TA 4ERRA 3RC8A 3SS1A 2RPAA 3BQKA 4TWHA 1IZNB 2C5JA 3C51A 2IW5B 2H3RA 1M7KA 4YTNA 5HWXA 2UXBT 4ZI3C 3P7IA 3TLTA 5JDGA 2JMKA 4YSXA 4HWIB 1D0ZA 3Q2MA 2E8IA 2XSBA 1YXRA 3PUQA 2CEAA 4HFEA 4EXTA 3RKOA 1IAPA 1J5ET 2CBIA 4KUMB 2X9YA 3PUZF 2A3DA 2JQHA 2Z6EA 4QH1A 3UU8A 2K9AA 2H88A 1WR6A 3ZMSB 4LMJA 1UK5A 1MMDA 3ANWB 4YTMA 1MIVA 4ILAA 3ZMUB 4LF5T 3AB3B 2C5KT 4DV5T 4OK0A 2BG9E 2K5BB 2NOXA 3Q5XA 4ILCA 3K3NA 4JEHB 1HG2A 4P0BA 4U3CA 3VU7H 4Z90A 3SFDA 4CXXA 4PNIA 5JR9C 4HFIA 1MIYA 1FEWA 2XAFB 3N2GE 4B3MT 2H89A 5AQQB 3F31A 2Y6XA 3I1AA 5JVDE 3E08A 3CX6B 3MACA 5CJ5A 2XQ5A 4UIGA 5JRCA 2Q9QA 5LP6E 5M4YA 2KWHA 3QOFA 4O8SA 4YXDA 5AQMB 1J5WA 2LSYA 2LRLA 1D1CA 4IDQA 5AQVB 3BQLA 4H9OC 3IA3A 2LJLA 4OHFA 3B57A 5ETWA 1XMOT 2ZM8A 5L3DB 4CI2B 2LSGA 2M67A 1X9BA 4TX5A 2LRKA 2X9HA 4UXNB 5JDLA 3U3IA 5FP3A 4CN1A 1AJ3A 3ZYKA 2WU5A 4HE8A 4MHCA 3K1SA 4ZI3D 3AA1B 4EOZB 1KK7A 4E7ZA 4HWFA 3QUJA 1CUNA 3RF1A 2XQ3A 4DUYT 2E9XC 4DV6T 3OYZA 3I9YA 2X68A 4FJOA 3KFWX 4MBQA 3AEBA 2DWKA 4NIQA 3WI3A 4EEBA 1QUUA 1QLBA 3ABVA 4QXBB 5IHYA 3LFMA 4KP3C 2VB6A 2CM0A 3EI0A 5GONE 3SWHA 4AQGA 1D0XA 4JI5T 4PJMA 2HN1A 4ILUA 4CQIA 1LKXA 3T1HT 3L39A 1IJ5A 2LSJA 1D1BA 2YINA 1KEYA 1HCIA 2E9XD 3PDYA 3PUWF 4H9RC 3KBUA 4TNVA 1HNXT 1IBMT 4ZXLA 3VR8A 3TLVA 2E9XA 2W63A 5FL0A 2W2UA 2WQYA 3T8OA 3NZQA 2D9DA 3RX6A 5AQRB 3ZPOA 2BZBA 2E2AA 5FXWA 2D0TA 4HWCA 5FXVA 2WMOA 3ZMZB 3PUAA 5L4EA 2VASA 3E22E 1LVKA 2I0MA 3KVAA 3AA6B 3N2KE 3UU5A 3NVOA 2XAGB 2UUAT 3GMIA 5L3BB 1HF8A 2IIUA 4LMKA 5FVLA 2SPCA 4UF0A 3AECA 4IREA 2XPKA 1YKHB 3PTRB 3KV4A 5AQFB 1E1HB 3H3AA 2YK0A 4HFHA 4F8HA 5BR8T 4DV4T 2HN2A 3R6NA 1UCUA 5AQOB 1OEDE 3DTOA 3LSVA 2HPLA 4O4LE 5KMGP 4KI0F 3O1HA 3N9OA 2UXNB 5KXJA 3FZMB 3ZC0A 2AXDS 4EGWA 3AAAB 4AKHA 4QX7B 2QGSA 4U2ZA 3HKEE 4UR9A 3ZT6A 1HX1B 3P4WA 3K3QC 2WMNA 4PAGA 3A8YC 1OEDC 4BA9A 1N32T 4LFCT 1US7B 5FY7A 2VKJA 2UUCT 4X1IE 5E0OA 3N2OA 4I43B 1VOMA 3RYFE 5LHHB 3CX7B 3B5MA 5IWAT 4U74A 2N9DA 2LHNA 4DMWA 4AKRB 3RLFF 4GKKT 2EHOD 3FZHB 1SUMB 2JQQA 4WZXA 3MXZA 1YD8G 3Q5EA 1HX8A 1W09A 1GQEA 5DQWA 2WCAA 3QB5K 5LYJE 4TWFA 2D2SA 4BAYB 4K0UA 2XUEA 2VKDA 2CLYB 3AE4A 2XQ4A 3AA7B 4IHJE 5LXTE 1XWMA 1OXZA 4DUZT 1HS7A 3QB5A 1E2AA 3AVRA 4L0RA 1L0VA 5C2TA 2ZM0A 3FHNA 2UXCT 5CA1E 5DQVA 3CWZB 4PK4A 1YW0A 2NW8A 2V6XA 5AQGB 5LGNB 2E5VA 3RPUA 5ABFB 1YKEB 2BKOA 4ZEYA 4EYYR 1VRBA 2W67A 2F4VT 4QXHB 2B1EA 3OPCA 2H7VC 2YDRA 4O4IE 4QH5A 3SRZA 4EAHA 4JI6T 4HWHA 2DNXA 3I0QA 5JREA 3IBPA 2HHHT 2K3WA 5A1LA 2X9WA 2KT9A 2YU1A 1HNZT 1FMWA 1UX4A 2LOPA 2VK9A 3C98B 4GYRA 4HFBA 2WAUA 4I55E 4ASKA 2EHOA 3PUVF 2BKPA 4HN9A 3V5UA 3J7Yq 1QSDA 2L8KA 1SA0E 2C0SA 2H7OA 3EDUA 3RIUA 2CMRA 2MOZA 4JI7T 1BR0A 3CQCB 3OJAA 3UFGA 2OV9A 2CXLA 4DV2T 4DR4T 4A98A 1YQ4A 4M1PA 2XQ7A 5FXXA 2OA5A 4H9SE 3ESLA 4HGAA 5EK4A 1Y01A 5FYMA 5JR9A 4A97A 3H37A 3MA9A 1E7PA 3UU6A 2N1GA 2G0UA 3C4ZA 3ZCIA 5L3FB 4V1Av 4QHOA 4JI2T 2Y8DA 3AE3A 3A7MA 1LRZA 3AEDA 2L9QA 4PW8A 4IIJE 5ABFA 1IJ6A 1SE7A 2V5CA 4OYJA 4ZZBA 2BBJA 5JTGA 2E5LT 3EDVA 1IBLT 2CWOA 3F57A 4KX6A 4QH4A 3RYHE 3M65A 1KFYA 4O4JE 4Z8XA 2LSKA 3KV9A 4LF8T 3RI5A 2CHNA 4AKGA 3D0TA 2LM2A 2CRBA 2DCFA 2LKGA 2MYSA 4H9QC 2JMHA 2KLQA 3ETUA 1XNQT 2WWVA 2YEVC 2WZHA 2XASB 3L8RA 3NWIA 4YHJA 5AFUL 2XM2A 3B13A 1N34T 4X20E 4JLEA 3UT5E 3AAEB 4HFCA 1HR0T 2K24A 2VL8A 5LB7B 2NTXA 3MKDA 3RC3A 4X64T 2HH7A 1JNZA 3AXJB 2J62A 4JBWF 2JQKA 2WDVA 3EAMA 4U7YA 3ZSSA 4B6XA 3LK42 5J1GA 4CXYA 3QK6A 2V5DA 4DVDA 3CKDA 4ANJA 5EZYE 2CWYA 2LLYA 2NWBA 3FBLA 3JC6C 1MMNA 3R84B 3KVBA 5AQIB 2DL1A 3HKBE 4HKAA 4LMLA 4PJJA 3RRWA 3ZCJA 3ZT5A 5BMVE 2D0UA 3DJBA 2MPKA 4EZ4A 3CK6A 4NUUA 2VKOA 5JDHA 2WSSV 5AQHB 3UUXB 2V7JA 4JI1T 3ZYMA 3TKLB 5HAXA 3OKQA 1HFAA 2WU2A 2JQ9A 1D1AA 3AE2A 2J4GA 5AQSB 3VRBA 3JC6D 3ZN1B 3P4SA 5LJNA 1I94T 2VURA 2W00A 3NRYA 3RQWA 4IDNA 3K8PC 4HEAA 2GK9A 2M6BA 2R6GF 4ADZA 2AE9A 2ZMAA 5LBMA 4ZHQE 2CBJA 4JYAT 2JPFA 3NZPA 2K48A 2KZ7B 3ZYLA 4FI5A 5ABHA 3BQIA 4YHHT 5LHGB 3I0OA 4U7IA 2WZIA 4OX9T 5FXZA 3AE5A 3G06A 3N9NA 3ONLC 3SOLA 4DBRA 5LG3A 4LF4T 3GN5B 3KINB 2X66A 4YSYA 4DR7T 4QXCB 4L9IA 1M62A 4XAXB 2BVLA 2WM9A 3P8CD 4IGUA 4AIUA 2VL0A 5FNVE 2X51A 4IE5A 4IL9A 2UXXB 3PU3A 4U72A 2QVAA 3RH3A 2ZLYA 2VQET 2BG9B 3N9PA 1CHUA 1WRDA 2IC6A 2L3LA 1YQ3A 1V9DA 2QRXA 2LHRA 3RHWA 1ZKEA 5FL1A 1LVFA 1Y64B 3Q9DA 1MMGA 5C3JA 4O4HE 4NXMT 2BKNA 2LM9A 3GA8A 2NP9A 3HKCE 2XM1A 2YN6A 2FJAA 2DI4A 4P1NA 4YT0A 2B76A 4C91A 1KNPA 3FZLB 2IUBA 4U31A 2IDOB 4PJNA 4KHPT 2KMFA 2P9BA 2XQ6A 1NAFA 2ACZA 1S35A 3JAFA 4WBNE 2XQAA 2VVNA 3WAJA 3C4WA 5DABA 2CXFA 5AQUB 5JQGE 4TV9E 4COFA 4G63A 5L3GB 5HXEA 1OEDA 4LFBT 2KXPB 4EEDA 5LMUT 2XAJB 1KF6A 1WLXA 5J0ZA 5F3JA 2PFVA 3OVUA 4IE4A 4B3RT 2CPTA 5FY1A 3ANWA 5KDMC 1EZ3A
chains in the Genus database with same CATH topology
4JI7T 4K0KT 1N33T 4DV2T 4DR4T 4DR5T 1XMOT 1HNWT 4JI2T 4X62T 4B3ST 2E5LT 4LF9T 4DUYT 4DV6T 1IBLT 3OTOT 1XMQT 4LF8T 1XNQT 4LFAT 4JI5T 1N34T 4B3TT 1XNRT 4DV1T 3T1HT 1HR0T 2UU9T 4AQYT 4X64T 1HNXT 1IBMT 2ZM6T 4GKJT 4JV5T 2UUBT 4X65T 5LMNT 2UUAT 4JI1T 4DV0T 1N36T 4LF7T 5BR8T 4DV4T 3T1YT 1I94T 4DR2T 4DR3T 4NXNT 4JYAT 4YY3T 4DR1T 4YHHT 4DV7T 4OX9T 4LF4T 1N32T 4X66T 4LFCT 4DR7T 2UUCT 5IWAT 1FJGT 4JI0T 4JI4T 4GKKT 2UXBT 2VQET 4JI8T 4NXMT 1J5ET 4DUZT 4DV3T 4LF6T 4JI3T 2UXDT 2UXCT 4KHPT 4LF5T 4DV5T 4DR6T 2F4VT 4JI6T 4LFBT 2VQFT 5LMUT 2HHHT 1HNZT 4B3MT 4B3RT 1IBKT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 T;  4K0K T;  1N33 T;  4DV2 T;  4DR4 T;  4DR5 T;  1XMO T;  1HNW T;  4JI2 T;  4X62 T;  4B3S T;  2E5L T;  4LF9 T;  4DUY T;  4DV6 T;  1IBL T;  3OTO T;  1XMQ T;  4LF8 T;  1XNQ T;  4LFA T;  4JI5 T;  1N34 T;  4B3T T;  1XNR T;  4DV1 T;  3T1H T;  1HR0 T;  2UU9 T;  4AQY T;  4X64 T;  1HNX T;  1IBM T;  2ZM6 T;  4GKJ T;  4JV5 T;  2UUB T;  4X65 T;  5LMN T;  2UUA T;  4JI1 T;  4DV0 T;  1N36 T;  4LF7 T;  5BR8 T;  4DV4 T;  3T1Y T;  1I94 T;  4DR2 T;  4DR3 T;  4NXN T;  4JYA T;  4YY3 T;  4DR1 T;  4YHH T;  4DV7 T;  4OX9 T;  4LF4 T;  1N32 T;  4X66 T;  4LFC T;  4DR7 T;  2UUC T;  5IWA T;  1FJG T;  4JI0 T;  4JI4 T;  4GKK T;  2UXB T;  2VQE T;  4JI8 T;  4NXM T;  1J5E T;  4DUZ T;  4DV3 T;  4LF6 T;  4JI3 T;  2UXD T;  2UXC T;  4KHP T;  4LF5 T;  4DV5 T;  4DR6 T;  2F4V T;  4JI6 T;  4LFB T;  2VQF T;  5LMU T;  2HHH T;  1HNZ T;  4B3M T;  4B3R T;  1IBK T; 
#chains in the Genus database with same CATH topology
 5C8Y E;  5EK2 A;  2BG9 A;  4IE7 A;  2V6Y B;  3S4U A;  2LSI A;  2V6Y A;  4TZ4 C;  2PTF A;  3CPZ A;  4UVA B;  1VCS A;  5CB4 E;  4A56 A;  2LKH A;  1WR0 A;  4EYU A;  2RP4 A;  3ZJ2 A;  3RRC A;  2CA5 A;  2W66 A;  3PJA J;  2YDS A;  2W62 A;  3IF8 B;  1X79 A;  3RIU C;  3JAE A;  3LBX A;  1D0Y A;  2FJB A;  4KMC A;  4EB6 E;  3LBX B;  1W0A A;  4X62 T;  3HR0 A;  5ABG A;  2Q9Q D;  3AEG A;  3O4X E;  3EUH A;  3F2E A;  3P50 A;  2BVM A;  3JCF A;  4MLK A;  4B3S T;  3TLS A;  4WNK A;  5HCM A;  1XDP A;  2ODU A;  3H3M A;  3DP7 A;  4PK6 A;  2X0L B;  5H6Q B;  2BS3 A;  3C50 A;  4LF9 T;  2KIN B;  1R8I A;  2XQY A;  4WW0 A;  2CXD A;  4N78 D;  4PK5 A;  4XZC A;  2V7L A;  3J9X 1;  4YJ3 E;  4WBO A;  1XDO A;  4HFD A;  4GOU A;  2ODV A;  1T7S A;  3L09 A;  4IST A;  5HCJ A;  2MAW A;  2IAK A;  3AEA A;  3PUR A;  4AXP A;  3RGL A;  2W0G A;  4OFZ A;  2LE8 A;  5LNK A;  4L5G A;  4MAL A;  1SHZ C;  4TN7 B;  3ONX A;  2WB5 A;  2XZE A;  4OYK A;  3K3O A;  5LG4 A;  4B3T T;  2PG8 A;  3CML A;  3FXE B;  3TLU A;  3ZJ1 A;  2D5U A;  2UU9 T;  2X9X A;  4YFS A;  3C64 A;  2M6I A;  4GIW A;  2Q9Q C;  2I59 A;  4CN4 A;  2KSR A;  2WP9 A;  4ZI7 E;  5HYA A;  2V7I A;  3NRX A;  4E7S A;  5L3C B;  5LGU B;  5HEJ A;  5LGT B;  1I6Z A;  4H9P C;  4IDP A;  2YDQ A;  5JDQ A;  1T72 A;  2YOE A;  4AIS A;  5H6R B;  3X1D A;  4ZI2 D;  1G73 A;  3O1J A;  3LJC A;  3U78 A;  3RYC E;  4U33 A;  1T8B A;  2WDQ A;  4AQF C;  4CI3 B;  1U4Q A;  4TV8 E;  1NEK A;  2NTY A;  4UV8 B;  1MIW A;  4X65 T;  4J2C A;  2DWG A;  3UQ4 A;  3N9Q A;  1MNE A;  4YSZ A;  5IUX A;  5LHI B;  4ISS A;  2WS3 A;  2J1D G;  5LMN T;  4ZI2 C;  2NW9 A;  3Q5D A;  3KV5 A;  4YTP A;  4DV0 T;  3AE7 A;  4P09 A;  4QKN A;  5F8P A;  1WFD A;  2E9X B;  2CLY C;  2EHO B;  3PUY F;  4LF7 T;  5L3E B;  3ZKR A;  5DJQ C;  3N9M A;  3PU8 A;  1BR2 A;  4ZZC A;  3AA0 B;  3ZC1 A;  4JUY A;  3T1Y T;  2XJ7 A;  3NKZ A;  1WYB A;  3AXJ A;  3O1I A;  1UGO A;  4DR2 T;  1OED B;  3FXD B;  3NBX X;  5HEH A;  4DR3 T;  4IE6 A;  3P4Q A;  4NXN T;  2JIW A;  2ES0 A;  3OYX A;  3AE9 A;  4PJL A;  5ADX L;  5CGM A;  3UTK A;  4UEL A;  2PBI A;  4AQF A;  4I50 E;  3UQ7 A;  4DV7 T;  5HWY A;  3A5X A;  1UUS A;  2BBH A;  2W61 A;  3KDS E;  5AQT B;  5AQK B;  2C5I T;  2XSA A;  4DO0 A;  3VKH A;  2W4X A;  4IT4 A;  5LA6 E;  5TAO A;  1MND A;  3P4P A;  1FJG T;  1BR4 A;  3W15 B;  3ZMT B;  4EV6 A;  1UX5 A;  4YJ2 E;  5L47 A;  4XBF B;  1XMQ T;  2ZM2 A;  2OLT A;  2XAH B;  2XHE B;  3FB2 A;  4JI4 T;  2WWU A;  1HG5 A;  3PJA A;  4QX8 B;  4UVC B;  2X67 A;  4DID B;  3LK2 B;  4IL4 A;  4PFP A;  4ZS3 A;  4BJM A;  1MMA A;  3HI2 A;  3UUM A;  4JI8 T;  2YU2 A;  3IHR A;  2JJ9 A;  3C4X A;  5FY0 A;  5F5W A;  3PUS A;  5HXC A;  3VR9 A;  3UUN A;  2CCQ A;  2XQ8 A;  4QWN B;  4ZOL E;  3ZEF B;  4YLH A;  4Z91 A;  2BG9 C;  3OBV E;  4DV3 T;  4LF6 T;  1WYC A;  2VVS A;  3N9L A;  4CI1 B;  3P4R A;  4JI3 T;  4GK0 E;  1T98 A;  2V26 A;  2UXD T;  2IHR 1;  2VKH A;  2X0Y A;  3E0Z A;  3GN5 A;  4NPP A;  3V5S A;  3FBZ A;  3RKG A;  3PUG A;  4H63 V;  4H9N C;  3UFE A;  3UUB A;  1Z0P A;  5HXR A;  4DR6 T;  2Y48 B;  3EHZ A;  2N2N A;  4AKL A;  1Z8U A;  2VQF T;  5HEU A;  3O9X A;  4AKI A;  5AQN B;  1KNZ A;  3ZMV B;  1OWA A;  3FZK B;  2V1D B;  4C90 A;  3RIF A;  2BS4 A;  3MJX A;  1IBK T;  2YKS A;  1ZHC A;  5J2T E;  4O2A E;  4BJN A;  3AE1 A;  4GYS A;  4U2Y A;  2IML A;  2FUP A;  3AAI A;  3MZK B;  4K0K T;  5L2L A;  4UVB B;  3VRA A;  1N33 T;  1HTJ F;  5LCY A;  3KV6 A;  4DR5 T;  3LG7 A;  1VCT A;  2KWI B;  2X0H A;  5JDN A;  2J47 A;  3UU3 A;  2A2F X;  2DLR A;  1JNR A;  2A9U A;  3CQG B;  3EAB A;  4Q25 A;  4DBQ A;  5FMN A;  1J1J A;  4PFO A;  3ETV A;  4I0U A;  5IYZ E;  5LOV E;  1HNW T;  5JRC B;  3CX8 B;  2FJD A;  3UU4 A;  4CXW A;  2BS2 A;  1ZP0 A;  2ACX A;  4IDO A;  3CIR A;  3PUX F;  3AE6 A;  3QC9 A;  3M3Z B;  2V8S V;  2WDR A;  3LDQ B;  2WY2 A;  1B7T A;  5FKY A;  5FVK A;  5HEO A;  2IC9 A;  4I4T E;  3TLW A;  2I6H A;  3OTO T;  1ZOY A;  5JR9 B;  3HKD E;  2MBG A;  1NEN A;  4H63 H;  3Q5W A;  4DMV A;  4F6R C;  3ONJ A;  4MFR A;  4LFA T;  3GWH A;  3HA4 A;  3ZT7 A;  4UF0 B;  2HPJ A;  2NR4 A;  3I9W A;  4TUY E;  4DND A;  4EIW A;  4G2A A;  5HXS A;  2XTL A;  3HL6 A;  3JAD A;  3VHL A;  4DV1 T;  1XNR T;  3CQX C;  4AQY T;  3AEE A;  2NW7 A;  2MTQ A;  5AQJ B;  3ZST A;  4KBM B;  1DU2 A;  4WYV A;  4O2B E;  4TWD A;  2XAQ B;  3WAK A;  1ZEE A;  2ZM6 T;  1KNR A;  3PV0 F;  1FIO A;  4GKJ T;  2V7M A;  4CZZ B;  1FMV A;  2LEH A;  5ABE A;  2KND A;  4JV5 T;  1BR1 A;  1W0B A;  2Q9Q B;  2UUB T;  4AI6 A;  3EVY A;  4GK5 E;  1NWM X;  5HXH A;  4X1Y E;  1G8X A;  3UUL A;  1U5P A;  4TNW A;  3KBT A;  3QNU A;  4KHZ F;  2PJQ A;  3RQU A;  3VKG A;  5JDM A;  2CHO A;  4IE0 A;  5KX5 E;  3MK7 C;  2QYW A;  2RA1 A;  2XQ9 A;  2A72 A;  4UV9 B;  3RIA A;  5JH7 E;  1N36 T;  2V7K A;  5CFB A;  3FZF B;  5JDF A;  4ILB A;  4IDZ A;  2BDE A;  5L4H A;  5HEG A;  4A5X A;  4UEM A;  2JRK A;  5AQL B;  4HWD A;  1H7C A;  1S94 A;  1UUR A;  3N5L A;  2EHO C;  2WBL A;  5LBQ B;  4YY3 T;  4HFV A;  4ZS2 A;  4HTE A;  1WCR A;  1W9R A;  3IEE A;  4NUV A;  1ZV4 X;  4DR1 T;  4P0A A;  3PE0 A;  3AVS A;  3ZLI A;  2CE7 A;  2FJE A;  3LK3 B;  5CA0 E;  3SFE A;  3CVR A;  4X66 T;  1XZY A;  2LT3 A;  3AEF A;  4EZH A;  1O3X A;  5J2U E;  5LJM A;  2XY8 B;  5AQP B;  3AE8 A;  3L3P A;  2QA7 A;  2LOS A;  4JI0 T;  4JEU B;  5EK3 A;  3BK9 A;  3ZN0 B;  2DHR A;  4CN6 A;  2FBW A;  2VWA A;  4X1K E;  3RYI E;  4X5T A;  4ERR A;  3RC8 A;  3SS1 A;  2RPA A;  3BQK A;  4TWH A;  1IZN B;  2C5J A;  3C51 A;  2IW5 B;  2H3R A;  1M7K A;  4YTN A;  5HWX A;  2UXB T;  4ZI3 C;  3P7I A;  3TLT A;  5JDG A;  2JMK A;  4YSX A;  4HWI B;  1D0Z A;  3Q2M A;  2E8I A;  2XSB A;  1YXR A;  3PUQ A;  2CEA A;  4HFE A;  4EXT A;  3RKO A;  1IAP A;  1J5E T;  2CBI A;  4KUM B;  2X9Y A;  3PUZ F;  2A3D A;  2JQH A;  2Z6E A;  4QH1 A;  3UU8 A;  2K9A A;  2H88 A;  1WR6 A;  3ZMS B;  4LMJ A;  1UK5 A;  1MMD A;  3ANW B;  4YTM A;  1MIV A;  4ILA A;  3ZMU B;  4LF5 T;  3AB3 B;  2C5K T;  4DV5 T;  4OK0 A;  2BG9 E;  2K5B B;  2NOX A;  3Q5X A;  4ILC A;  3K3N A;  4JEH B;  1HG2 A;  4P0B A;  4U3C A;  3VU7 H;  4Z90 A;  3SFD A;  4CXX A;  4PNI A;  5JR9 C;  4HFI A;  1MIY A;  1FEW A;  2XAF B;  3N2G E;  4B3M T;  2H89 A;  5AQQ B;  3F31 A;  2Y6X A;  3I1A A;  5JVD E;  3E08 A;  3CX6 B;  3MAC A;  5CJ5 A;  2XQ5 A;  4UIG A;  5JRC A;  2Q9Q A;  5LP6 E;  5M4Y A;  2KWH A;  3QOF A;  4O8S A;  4YXD A;  5AQM B;  1J5W A;  2LSY A;  2LRL A;  1D1C A;  4IDQ A;  5AQV B;  3BQL A;  4H9O C;  3IA3 A;  2LJL A;  4OHF A;  3B57 A;  5ETW A;  1XMO T;  2ZM8 A;  5L3D B;  4CI2 B;  2LSG A;  2M67 A;  1X9B A;  4TX5 A;  2LRK A;  2X9H A;  4UXN B;  5JDL A;  3U3I A;  5FP3 A;  4CN1 A;  1AJ3 A;  3ZYK A;  2WU5 A;  4HE8 A;  4MHC A;  3K1S A;  4ZI3 D;  3AA1 B;  4EOZ B;  1KK7 A;  4E7Z A;  4HWF A;  3QUJ A;  1CUN A;  3RF1 A;  2XQ3 A;  4DUY T;  2E9X C;  4DV6 T;  3OYZ A;  3I9Y A;  2X68 A;  4FJO A;  3KFW X;  4MBQ A;  3AEB A;  2DWK A;  4NIQ A;  3WI3 A;  4EEB A;  1QUU A;  1QLB A;  3ABV A;  4QXB B;  5IHY A;  3LFM A;  4KP3 C;  2VB6 A;  2CM0 A;  3EI0 A;  5GON E;  3SWH A;  4AQG A;  1D0X A;  4JI5 T;  4PJM A;  2HN1 A;  4ILU A;  4CQI A;  1LKX A;  3T1H T;  3L39 A;  1IJ5 A;  2LSJ A;  1D1B A;  2YIN A;  1KEY A;  1HCI A;  2E9X D;  3PDY A;  3PUW F;  4H9R C;  3KBU A;  4TNV A;  1HNX T;  1IBM T;  4ZXL A;  3VR8 A;  3TLV A;  2E9X A;  2W63 A;  5FL0 A;  2W2U A;  2WQY A;  3T8O A;  3NZQ A;  2D9D A;  3RX6 A;  5AQR B;  3ZPO A;  2BZB A;  2E2A A;  5FXW A;  2D0T A;  4HWC A;  5FXV A;  2WMO A;  3ZMZ B;  3PUA A;  5L4E A;  2VAS A;  3E22 E;  1LVK A;  2I0M A;  3KVA A;  3AA6 B;  3N2K E;  3UU5 A;  3NVO A;  2XAG B;  2UUA T;  3GMI A;  5L3B B;  1HF8 A;  2IIU A;  4LMK A;  5FVL A;  2SPC A;  4UF0 A;  3AEC A;  4IRE A;  2XPK A;  1YKH B;  3PTR B;  3KV4 A;  5AQF B;  1E1H B;  3H3A A;  2YK0 A;  4HFH A;  4F8H A;  5BR8 T;  4DV4 T;  2HN2 A;  3R6N A;  1UCU A;  5AQO B;  1OED E;  3DTO A;  3LSV A;  2HPL A;  4O4L E;  5KMG P;  4KI0 F;  3O1H A;  3N9O A;  2UXN B;  5KXJ A;  3FZM B;  3ZC0 A;  2AXD S;  4EGW A;  3AAA B;  4AKH A;  4QX7 B;  2QGS A;  4U2Z A;  3HKE E;  4UR9 A;  3ZT6 A;  1HX1 B;  3P4W A;  3K3Q C;  2WMN A;  4PAG A;  3A8Y C;  1OED C;  4BA9 A;  1N32 T;  4LFC T;  1US7 B;  5FY7 A;  2VKJ A;  2UUC T;  4X1I E;  5E0O A;  3N2O A;  4I43 B;  1VOM A;  3RYF E;  5LHH B;  3CX7 B;  3B5M A;  5IWA T;  4U74 A;  2N9D A;  2LHN A;  4DMW A;  4AKR B;  3RLF F;  4GKK T;  2EHO D;  3FZH B;  1SUM B;  2JQQ A;  4WZX A;  3MXZ A;  1YD8 G;  3Q5E A;  1HX8 A;  1W09 A;  1GQE A;  5DQW A;  2WCA A;  3QB5 K;  5LYJ E;  4TWF A;  2D2S A;  4BAY B;  4K0U A;  2XUE A;  2VKD A;  2CLY B;  3AE4 A;  2XQ4 A;  3AA7 B;  4IHJ E;  5LXT E;  1XWM A;  1OXZ A;  4DUZ T;  1HS7 A;  3QB5 A;  1E2A A;  3AVR A;  4L0R A;  1L0V A;  5C2T A;  2ZM0 A;  3FHN A;  2UXC T;  5CA1 E;  5DQV A;  3CWZ B;  4PK4 A;  1YW0 A;  2NW8 A;  2V6X A;  5AQG B;  5LGN B;  2E5V A;  3RPU A;  5ABF B;  1YKE B;  2BKO A;  4ZEY A;  4EYY R;  1VRB A;  2W67 A;  2F4V T;  4QXH B;  2B1E A;  3OPC A;  2H7V C;  2YDR A;  4O4I E;  4QH5 A;  3SRZ A;  4EAH A;  4JI6 T;  4HWH A;  2DNX A;  3I0Q A;  5JRE A;  3IBP A;  2HHH T;  2K3W A;  5A1L A;  2X9W A;  2KT9 A;  2YU1 A;  1HNZ T;  1FMW A;  1UX4 A;  2LOP A;  2VK9 A;  3C98 B;  4GYR A;  4HFB A;  2WAU A;  4I55 E;  4ASK A;  2EHO A;  3PUV F;  2BKP A;  4HN9 A;  3V5U A;  3J7Y q;  1QSD A;  2L8K A;  1SA0 E;  2C0S A;  2H7O A;  3EDU A;  3RIU A;  2CMR A;  2MOZ A;  4JI7 T;  1BR0 A;  3CQC B;  3OJA A;  3UFG A;  2OV9 A;  2CXL A;  4DV2 T;  4DR4 T;  4A98 A;  1YQ4 A;  4M1P A;  2XQ7 A;  5FXX A;  2OA5 A;  4H9S E;  3ESL A;  4HGA A;  5EK4 A;  1Y01 A;  5FYM A;  5JR9 A;  4A97 A;  3H37 A;  3MA9 A;  1E7P A;  3UU6 A;  2N1G A;  2G0U A;  3C4Z A;  3ZCI A;  5L3F B;  4V1A v;  4QHO A;  4JI2 T;  2Y8D A;  3AE3 A;  3A7M A;  1LRZ A;  3AED A;  2L9Q A;  4PW8 A;  4IIJ E;  5ABF A;  1IJ6 A;  1SE7 A;  2V5C A;  4OYJ A;  4ZZB A;  2BBJ A;  5JTG A;  2E5L T;  3EDV A;  1IBL T;  2CWO A;  3F57 A;  4KX6 A;  4QH4 A;  3RYH E;  3M65 A;  1KFY A;  4O4J E;  4Z8X A;  2LSK A;  3KV9 A;  4LF8 T;  3RI5 A;  2CHN A;  4AKG A;  3D0T A;  2LM2 A;  2CRB A;  2DCF A;  2LKG A;  2MYS A;  4H9Q C;  2JMH A;  2KLQ A;  3ETU A;  1XNQ T;  2WWV A;  2YEV C;  2WZH A;  2XAS B;  3L8R A;  3NWI A;  4YHJ A;  5AFU L;  2XM2 A;  3B13 A;  1N34 T;  4X20 E;  4JLE A;  3UT5 E;  3AAE B;  4HFC A;  1HR0 T;  2K24 A;  2VL8 A;  5LB7 B;  2NTX A;  3MKD A;  3RC3 A;  4X64 T;  2HH7 A;  1JNZ A;  3AXJ B;  2J62 A;  4JBW F;  2JQK A;  2WDV A;  3EAM A;  4U7Y A;  3ZSS A;  4B6X A;  3LK4 2;  5J1G A;  4CXY A;  3QK6 A;  2V5D A;  4DVD A;  3CKD A;  4ANJ A;  5EZY E;  2CWY A;  2LLY A;  2NWB A;  3FBL A;  3JC6 C;  1MMN A;  3R84 B;  3KVB A;  5AQI B;  2DL1 A;  3HKB E;  4HKA A;  4LML A;  4PJJ A;  3RRW A;  3ZCJ A;  3ZT5 A;  5BMV E;  2D0U A;  3DJB A;  2MPK A;  4EZ4 A;  3CK6 A;  4NUU A;  2VKO A;  5JDH A;  2WSS V;  5AQH B;  3UUX B;  2V7J A;  4JI1 T;  3ZYM A;  3TKL B;  5HAX A;  3OKQ A;  1HFA A;  2WU2 A;  2JQ9 A;  1D1A A;  3AE2 A;  2J4G A;  5AQS B;  3VRB A;  3JC6 D;  3ZN1 B;  3P4S A;  5LJN A;  1I94 T;  2VUR A;  2W00 A;  3NRY A;  3RQW A;  4IDN A;  3K8P C;  4HEA A;  2GK9 A;  2M6B A;  2R6G F;  4ADZ A;  2AE9 A;  2ZMA A;  5LBM A;  4ZHQ E;  2CBJ A;  4JYA T;  2JPF A;  3NZP A;  2K48 A;  2KZ7 B;  3ZYL A;  4FI5 A;  5ABH A;  3BQI A;  4YHH T;  5LHG B;  3I0O A;  4U7I A;  2WZI A;  4OX9 T;  5FXZ A;  3AE5 A;  3G06 A;  3N9N A;  3ONL C;  3SOL A;  4DBR A;  5LG3 A;  4LF4 T;  3GN5 B;  3KIN B;  2X66 A;  4YSY A;  4DR7 T;  4QXC B;  4L9I A;  1M62 A;  4XAX B;  2BVL A;  2WM9 A;  3P8C D;  4IGU A;  4AIU A;  2VL0 A;  5FNV E;  2X51 A;  4IE5 A;  4IL9 A;  2UXX B;  3PU3 A;  4U72 A;  2QVA A;  3RH3 A;  2ZLY A;  2VQE T;  2BG9 B;  3N9P A;  1CHU A;  1WRD A;  2IC6 A;  2L3L A;  1YQ3 A;  1V9D A;  2QRX A;  2LHR A;  3RHW A;  1ZKE A;  5FL1 A;  1LVF A;  1Y64 B;  3Q9D A;  1MMG A;  5C3J A;  4O4H E;  4NXM T;  2BKN A;  2LM9 A;  3GA8 A;  2NP9 A;  3HKC E;  2XM1 A;  2YN6 A;  2FJA A;  2DI4 A;  4P1N A;  4YT0 A;  2B76 A;  4C91 A;  1KNP A;  3FZL B;  2IUB A;  4U31 A;  2IDO B;  4PJN A;  4KHP T;  2KMF A;  2P9B A;  2XQ6 A;  1NAF A;  2ACZ A;  1S35 A;  3JAF A;  4WBN E;  2XQA A;  2VVN A;  3WAJ A;  3C4W A;  5DAB A;  2CXF A;  5AQU B;  5JQG E;  4TV9 E;  4COF A;  4G63 A;  5L3G B;  5HXE A;  1OED A;  4LFB T;  2KXP B;  4EED A;  5LMU T;  2XAJ B;  1KF6 A;  1WLX A;  5J0Z A;  5F3J A;  2PFV A;  3OVU A;  4IE4 A;  4B3R T;  2CPT A;  5FY1 A;  3ANW A;  5KDM C;  1EZ3 A; 
#chains in the Genus database with same CATH homology
 4JI7 T;  4K0K T;  1N33 T;  4DV2 T;  4DR4 T;  4DR5 T;  1XMO T;  1HNW T;  4JI2 T;  4X62 T;  4B3S T;  2E5L T;  4LF9 T;  4DUY T;  4DV6 T;  1IBL T;  3OTO T;  1XMQ T;  4LF8 T;  1XNQ T;  4LFA T;  4JI5 T;  1N34 T;  4B3T T;  1XNR T;  4DV1 T;  3T1H T;  1HR0 T;  2UU9 T;  4AQY T;  4X64 T;  1HNX T;  1IBM T;  2ZM6 T;  4GKJ T;  4JV5 T;  2UUB T;  4X65 T;  5LMN T;  2UUA T;  4JI1 T;  4DV0 T;  1N36 T;  4LF7 T;  5BR8 T;  4DV4 T;  3T1Y T;  1I94 T;  4DR2 T;  4DR3 T;  4NXN T;  4JYA T;  4YY3 T;  4DR1 T;  4YHH T;  4DV7 T;  4OX9 T;  4LF4 T;  1N32 T;  4X66 T;  4LFC T;  4DR7 T;  2UUC T;  5IWA T;  1FJG T;  4JI0 T;  4JI4 T;  4GKK T;  2UXB T;  2VQE T;  4JI8 T;  4NXM T;  1J5E T;  4DUZ T;  4DV3 T;  4LF6 T;  4JI3 T;  2UXD T;  2UXC T;  4KHP T;  4LF5 T;  4DV5 T;  4DR6 T;  2F4V T;  4JI6 T;  4LFB T;  2VQF T;  5LMU T;  2HHH T;  1HNZ T;  4B3M T;  4B3R T;  1IBK T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...