4K0KT

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4k0kT00
4JI5T 1IBKT 4JI8T 4LFBT 4X66T 4DUZT 4LFAT 4JI3T 2UUBT 4LF4T 1XMOT 2UXDT 3T1HT 2HHHT 4JI4T 4JI7T 5LMNT 4LFCT 4AQYT 2F4VT 2UUCT 1IBMT 1HR0T 4YY3T 4YHHT 4LF9T 1IBLT 3OTOT 2ZM6T 4DR7T 1N33T 4DR3T 4JI0T 5LMUT 4DV6T 4GKKT 4JI2T 4B3RT 4X64T 4DR5T 4DV3T 1HNWT 4X62T 4DV4T 4KHPT 1XNQT 2UUAT 4DV0T 4JI1T 4JYAT 1XMQT 2UU9T 2VQET 4DUYT 3T1YT 4B3ST 4NXMT 4LF8T 4DV7T 4JV5T 4X65T 1HNZT 4GKJT 5IWAT 4B3MT 1FJGT 1HNXT 4JI6T 2UXCT 4LF5T 5BR8T 1N36T 4DR6T 4B3TT 4LF7T 4DR4T 4K0KT 1N34T 4DR2T 1I94T 1XNRT 1J5ET 1N32T 4LF6T 4NXNT 4DV5T 4OX9T 4DR1T 2UXBT 4DV1T 2VQFT 4DV2T 2E5LT
chains in the Genus database with same CATH superfamily
3AE8A 1D0ZA 2MTQA 1D1CA 3EHZA 4TX5A 1LRZA 2C5JA 4JI8T 4LFBT 3M65A 2L9QA 2XAGB 3ZC1A 4ERRA 1CHUA 2XQYA 2X68A 4LF4T 2FJAA 1HFAA 4IDNA 2VVNA 1UCUA 5J1GA 4H63V 2E2AA 5L3GB 2E8IA 3RC3A 2H89A 3AEGA 3MXZA 1E1HB 3IEEA 4CXXA 4AKIA 4BAYB 1SE7A 5FYMA 2LSIA 3MZKB 5LMNT 5FY1A 3H3AA 4JI7T 2A72A 5CA0E 2UXCT 3C4XA 2F4VT 2IAKA 4NUVA 3ZN1B 3B5MA 3P4WA 3SFDA 2YINA 2IC9A 2R6GF 2WB5A 4U2YA 1J1JA 1WYBA 5C8YE 1HS7A 3AE3A 2M6BA 2W67A 4MFRA 2CBJA 1YQ4A 2QGSA 2SPCA 3OBVE 4ILAA 5CGMA 4YY3T 4AQFC 2V26A 2PFVA 2WDQA 2WM9A 2X9HA 5JDHA 2NR4A 1IBLT 3LK42 2KLQA 3IHRA 3AE2A 3NVOA 2BDEA 5HCMA 3PDYA 5ABFA 3DJBA 3Q5DA 2OA5A 3JADA 5AFUL 4X1IE 1QLBA 5AQSB 3BQKA 4H9OC 5LJNA 4U7YA 2MBGA 3WAJA 2M67A 4QH4A 4O4HE 2EHOB 5ADXL 1AJ3A 2JIWA 2H7VC 3I9YA 3UTKA 2LOPA 3NRXA 4PNIA 3WI3A 2X66A 3BK9A 5L4HA 2IDOB 1FMVA 4DR3T 1YQ3A 2UXNB 4UV9B 3DP7A 5L3BB 1UGOA 3JC6D 2CRBA 4TWFA 5C2TA 2KMFA 3ONXA 3CX7B 1HF8A 3ZLIA 2XQ9A 2X9XA 3HKBE 3Q2MA 4I0UA 4ZS2A 4C91A 2BG9C 2X0HA 4HWFA 5J2UE 5LHHB 2X67A 3OVUA 5LHGB 4DR5T 1E7PA 1KNRA 3PUYF 5IHYA 3HA4A 4CI3B 2CE7A 3E0ZA 2KNDA 4TN7B 3RH3A 3RIAA 4EB6E 2W63A 2IHR1 3P4PA 2IW5B 3K3QC 3MA9A 2LEHA 4X1YE 4JI1T 3FB2A 2K24A 3CWZB 3OPCA 4ZI2D 2DWKA 4KBMB 5FXWA 3LDQB 1MMNA 2DL1A 4IE7A 2UU9T 4AKHA 2G0UA 2YU2A 4Z8XA 2VQET 4DUYT 3RF1A 4F8HA 2FJEA 2VKOA 1V9DA 4WNKA 5ABHA 1X9BA 2X51A 5HXEA 3F31A 3O1JA 4DVDA 1XWMA 2J62A 2WQYA 1U4QA 4EEDA 1BR1A 2IC6A 5H6QB 3UU5A 4JBWF 1KEYA 3GMIA 4ILCA 4UVBB 4DBQA 4P0AA 4DMVA 4PFOA 3A8YC 4DV7T 3UFGA 2W00A 3N9NA 5EZYE 3ZT6A 5AQUB 3ZMZB 4YSXA 3EUHA 4ZI3C 4UF0B 3QUJA 4JEHB 2I0MA 2W66A 5AQTB 3RQWA 2UXBT 1WRDA 4IE6A 4JI6T 2NW8A 2P9BA 1S35A 4JLEA 2LOSA 3UT5E 5LXTE 1IZNB 1D0YA 2YDSA 3CIRA 4QXBB 5HXRA 2MYSA 5F5WA 3UUMA 3FHNA 3FZMB 2N1GA 3ZYKA 1KF6A 4ZEYA 3UUNA 5JR9C 2WMOA 3K3NA 4DR2T 2NWBA 2ZM0A 4F6RC 4HTEA 3Q9DA 4AI6A 1D0XA 3PE0A 2FBWA 1N32T 1D1BA 5IUXA 3RYIE 4QKNA 2CHOA 3N2OA 4ZZBA 4A98A 4TV9E 1NWMX 3PUSA 1W9RA 3SRZA 2ACZA 5L47A 5KXJA 3EVYA 4HFEA 4HGAA 4P09A 4HN9A 3AE1A 3K8PC 2OV9A 4H9NC 5JR9B 4CN1A 1J5WA 2DNXA 5DQVA 5CB4E 2I6HA 5L3EB 2QVAA 2LE8A 2HN1A 2YU1A 5J2TE 5KX5E 2H3RA 1B7TA 3MJXA 1KFYA 4YJ2E 1DU2A 4X66T 1OEDB 2V7MA 2VVSA 4JI3T 3CX6B 3VKHA 5LGUB 2UUBT 2RP4A 2BKPA 2VKHA 3AE4A 4C90A 4QH5A 3T1HT 3T8OA 5AQJB 3C51A 2VKDA 4BJNA 5JDLA 3GWHA 3C4WA 4ZXLA 3WAKA 3AVRA 2BKNA 4CN6A 4O2AE 2VURA 2XM2A 3AB3B 1HX1B 3B13A 3ONJA 4Q25A 5EK2A 5FNVE 4ASKA 4FJOA 2WWUA 4EGWA 3LFMA 2C0SA 3P50A 4IIJE 5DQWA 5LOVE 5EK3A 2UUCT 4GYSA 1VCSA 2W0GA 3ESLA 3CK6A 4PJMA 3SFEA 1LVFA 1HR0T 5HCJA 2CBIA 3AA0B 2V6YA 3C4ZA 4ANJA 3AEDA 5L3DB 4UEMA 4CN4A 3RRWA 1O3XA 4TZ4C 1L0VA 2V1DB 3J9X1 2KINB 3HI2A 3N9QA 2Y6XA 4WYVA 3PU8A 3U3IA 2XPKA 5JQGE 3AXJB 4Z91A 3HR0A 2A3DA 1T7SA 3ZYLA 4YT0A 1W09A 2ZM6T 3ZYMA 4CZZB 4G63A 4X20E 3FZLB 4HE8A 2V6XA 2LRKA 4AISA 3OJAA 5JVDE 2LM9A 3FXDB 5J0ZA 5LCYA 2XHEB 1MIVA 3EDVA 3PUGA 2LHRA 3IBPA 3RIFA 2LJLA 4COFA 4EIWA 5HWYA 1Y01A 1VCTA 4U31A 2L3LA 2XZEA 4TWHA 3LG7A 5LMUT 1SUMB 1WR0A 4K0UA 4IE0A 5JDNA 3RC8A 3Q5XA 3I9WA 4N78D 4O2BE 4JI2T 3UFEA 1XDPA 2E9XA 2Q9QC 4G2AA 5DJQC 4JEUB 5KMGP 3AEEA 3FBLA 1MMDA 1OEDA 3HKEE 4O4LE 4YTPA 5ETWA 4KHZF 4EZ4A 1HNWT 3AECA 3EI0A 3L39A 4X62T 5HEOA 3TKLB 4EV6A 5FMNA 2B1EA 3ZMVB 2JMKA 3I0QA 4IREA 2JQ9A 4KP3C 2Q9QB 4IE5A 1UX5A 5ABGA 5FP3A 3GN5A 3RPUA 1MMGA 3G06A 2CCQA 3H3MA 5JDQA 2KSRA 3AA6B 1LVKA 2ACXA 3CMLA 4TNWA 3RKOA 5FL1A 1OXZA 1WR6A 1YD8G 2D2SA 2LHNA 2MOZA 3AEAA 2LRLA 1MMAA 3F2EA 4YSZA 5HEJA 5HYAA 2XAJB 4H63H 3EDUA 2YDQA 4JUYA 4LF8T 5JDMA 4EYYR 2WU2A 3AA7B 4TV8E 2BS2A 3TLWA 3ZCIA 3O4XE 4H9QC 2X0LB 2MAWA 5CA1E 2H88A 2J1DG 5ABFB 4X65T 3RRCA 4GK0E 4I50E 3AA1B 5EK4A 2ES0A 4JV5T 4B3MT 3LBXB 4J2CA 2XASB 1EZ3A 3AE9A 2IMLA 3PUAA 2B76A 2XQ3A 5AQLB 1FJGT 3CVRA 5ABEA 5M4YA 4YSYA 1E2AA 2BZBA 2XQ7A 2ZM2A 3PURA 3QB5K 5LGTB 1N36T 4LF5T 3OKQA 3QNUA 4DR4T 2MPKA 2BBHA 1JNZA 2CXDA 1D1AA 2K9AA 2WAUA 3NKZA 5FKYA 4A5XA 4DIDB 2NTXA 4IDQA 2V7JA 1HX8A 3C50A 1VOMA 1SA0E 2VWAA 3JAFA 3A5XA 2AXDS 2BBJA 3C98B 3HL6A 3P8CD 4YHJA 1ZKEA 4NXNT 2WZHA 4DV5T 3A7MA 2W62A 4TUYE 4OX9T 2DI4A 2WU5A 4I4TE 3PUWF 4MBQA 2C5IT 2J4GA 4GK5E 3VRBA 5AQFB 2LSJA 3KINB 3CQCB 5LA6E 4DR1T 3KV4A 2WBLA 2DLRA 5LBMA 3UQ7A 2WP9A 2VQFT 4DV2T 1YW0A 1UK5A 4M1PA 2QA7A 4JI5T 3RLFF 2E5LT 1BR0A 3H37A 1QSDA 3W15B 4DBRA 1X79A 1UURA 3LSVA 4DUZT 2E5VA 1MIYA 4L0RA 4GYRA 4HFCA 4PK4A 3P4SA 4UVAB 1OEDE 2LM2A 3RGLA 4WBOA 1XMOT 2CMRA 2UXDT 2HHHT 4NUUA 2CWYA 1VRBA 1SHZC 4AKGA 3DTOA 1UUSA 2JJ9A 3BQIA 1GQEA 4UVCB 4EZHA 2BG9E 4WBNE 5JH7E 1FEWA 3E08A 4JI4T 5GONE 3X1DA 4LFCT 4CXWA 2VK9A 4AQYT 2VKJA 3PJAJ 5LNKA 5FVLA 2Y8DA 4O8SA 4AKRB 2KZ7B 5FY0A 2YEVC 4UXNB 1W0BA 3C64A 5JDGA 4EEBA 1I6ZA 3VKGA 2H7OA 2ZMAA 3HKDE 5HXCA 2PBIA 1MNDA 1Z8UA 2HPJA 2JQKA 3ABVA 3P4QA 4IT4A 4NPPA 3R84B 3SS1A 1IBMT 2FJDA 1W0AA 4CI2B 5IYZE 2ODVA 4LF9T 4PJNA 3ZT5A 5BMVE 3QC9A 2WMNA 2CA5A 2V6YB 5LG3A 2CXLA 3PTRB 1WCRA 3NBXX 2ZM8A 2X9WA 5AQQB 3ETVA 3EAMA 3L8RA 3PJAA 4O4JE 2LSGA 3E22E 3U78A 4XZCA 1T98A 2KXPB 2VL0A 3TLSA 2XUEA 2ODUA 4ZS3A 4AXPA 3AAEB 3FXEB 3VHLA 5TAOA 1S94A 1T72A 2WY2A 4KUMB 4L5GA 4QH1A 2K5BB 2EHOC 2VB6A 4JI0T 2QRXA 1ZEEA 1ZV4X 4DV6T 3EABA 5LP6E 4GKKT 4OYKA 3BQLA 5HAXA 2W4XA 4AIUA 2JQHA 4PFPA 4DNDA 3AE6A 1BR4A 2KWHA 3MKDA 5JRCA 2XY8B 4OFZA 5FXVA 4A97A 4DO0A 4DV3T 2AE9A 4DV4T 4KHPT 4U3CA 1FMWA 2NW7A 2CPTA 5JREA 2BS4A 2BVLA 3CPZA 2W2UA 5HEHA 4BJMA 4DV0T 2PTFA 2BG9B 3FZHB 4KX6A 4GIWA 4QX8B 3JCFA 2XTLA 1WYCA 4TNVA 1QUUA 2NW9A 4WW0A 5HWXA 2BKOA 3PU3A 4B6XA 1HTJF 3S4UA 2PJQA 3AEBA 3KDSE 5HEGA 4YTNA 5L2LA 3T1YT 2X9YA 5DABA 2WSSV 2XAQB 4NXMT 4OK0A 4QXHB 3PUZF 4HWDA 2YDRA 3I1AA 1FIOA 3RQUA 3AXJA 3GA8A 3FZFB 4U7IA 3M3ZB 3PUXF 4PJLA 2YKSA 1HNZT 4LMLA 4H9RC 5IWAT 4H9SE 4GKJT 3OYZA 2KWIB 4IHJE 2I59A 3UU3A 4ZI3D 5C3JA 2UXXB 4IL4A 4MALA 3LBXA 1HNXT 2XSBA 5HXSA 1BR2A 3QOFA 4U74A 4YFSA 4GOUA 4EOZB 5L4EA 3F57A 5BR8T 4DR6T 3ZMSB 3IF8B 4B3TT 4AQFA 4K0KT 5F8PA 4ZHQE 1N34T 3UUXB 3TLUA 4Z90A 2CXFA 3ZSSA 4I43B 2X0YA 4V1Av 2RA1A 4PJJA 2K48A 5FL0A 1KNZA 3NRYA 4HWHA 3ZPOA 2LLYA 1KK7A 4X5TA 5LB7B 4ADZA 4YLHA 3AAIA 5AQIB 1OEDC 3GN5B 3N9LA 3KBTA 5AQPB 2Q9QA 4P0BA 2EHOA 2BG9A 2WWVA 3O1HA 4UR9A 4DV1T 1YKHB 1G8XA 4AQGA 4IE4A 4YJ3E 4HEAA 3ZC0A 2NTYA 3ZJ2A 5AQRB 5LYJE 5FXXA 2IUBA 3J7Yq 3ANWB 1IBKT 3VR8A 4HFHA 2DWGA 5AQOB 4LFAT 3N9MA 1XDOA 3N9PA 2JQQA 1G73A 2WCAA 3N2KE 2V5DA 1WFDA 2HN2A 2IIUA 3KVAA 3P4RA 4ZOLE 4XAXB 3ZCJA 3UQ4A 3ZN0B 2LT3A 4ILBA 2CHNA 1HCIA 2KT9A 2Z6EA 2A9UA 4L9IA 1IJ5A 3N5LA 3RHWA 3UU8A 3PUQA 3UULA 1NEKA 5E0OA 2CM0A 3NZQA 3R6NA 3LJCA 2LSYA 3PUVF 2BVMA 1CUNA 2JPFA 2V7KA 3AE7A 3RYHE 2A2FX 3VRAA 5AQVB 3O1IA 2XJ7A 3UU4A 2XQAA 1H7CA 3RI5A 4KMCA 5JDFA 2OLTA 3LK2B 4WZXA 5F3JA 2V7LA 3KV6A 5CFBA 2K3WA 4IL9A 4P1NA 3CX8B 4LMKA 4A56A 4IDPA 1HG2A 1ZOYA 3CQXC 5A1LA 3KFWX 1HG5A 4YHHT 4CI1B 4HWIB 2LSKA 2XQ5A 4ISSA 2N9DA 3KV9A 4HFDA 2NP9A 1ZHCA 2YOEA 3ZJ1A 3TLTA 4BA9A 3KBUA 2CWOA 2V7IA 3HKCE 3B57A 3ZMTB 3JAEA 2V5CA 4PK6A 3OTOT 3VU7H 2D0TA 2V8SV 3MK7C 4IDOA 3ZMUB 4OYJA 4AKLA 4PW8A 2E9XD 3D0TA 1T8BA 2HPLA 2XM1A 4YTMA 2J47A 4IGUA 2EHOD 4DR7T 3RYCE 2LKHA 3ZEFB 3JC6C 3NZPA 2XSAA 3ANWA 3PV0F 2JMHA 3QK6A 1M62A 2WDVA 3AEFA 5H6RB 5LHIB 1N33T 2CEAA 1JNRA 1NAFA 4ISTA 2Q9QD 4UF0A 2XQ4A 3AE5A 4E7SA 1IJ6A 3Q5WA 4OHFA 3RX6A 2E9XB 3L09A 2WZIA 2ZLYA 3MACA 3OYXA 4H9PC 4HFIA 3SWHA 2XAHB 5JTGA 2D9DA 2DCFA 3KV5A 4X64T 2LKGA 3SOLA 4B3RT 1U5PA 2GK9A 4I55E 2CLYC 3P7IA 2XQ6A 4ILUA 1US7B 3IA3A 5JRCB 1XNQT 2QYWA 4X1KE 5FXZA 2YN6A 5L3FB 2E9XC 4EXTA 3FZKB 5AQHB 3UUBA 4YXDA 2UUAT 1YKEB 2D0UA 4ZI7E 3RKGA 2XQ8A 4JYAT 5AQGB 1XMQT 5CJ5A 1KNPA 2CLYB 3CQGB 2WS3A 4HFVA 1YXRA 1Z0PA 5LBQB 4IDZA 3TLVA 3ZT7A 2W61A 2NOXA 3K1SA 4O4IE 4UELA 4ZZCA 3UU6A 4DMWA 1ZP0A 5KDMC 4LMJA 5L3CB 3ZSTA 2C5KT 4B3ST 4MHCA 3NWIA 5LGNB 1Y64B 2D5UA 2PG8A 4XBFB 4CXYA 1OWAA 2JRKA 2N2NA 3KVBA 3QB5A 4PAGA 4TWDA 3RIUA 5FY7A 2RPAA 4QXCB 5AQMB 4U2ZA 5AQKB 3RIUC 5HXHA 1NENA 2WDRA 3LK3B 2L8KA 4FI5A 4E7ZA 1LKXA 2HH7A 3O9XA 1UX4A 3Q5EA 3AAAB 5LJMA 3VR9A 1M7KA 2FUPA 3I0OA 4CQIA 2BS3A 3ETUA 4EYUA 3K3OA 4LF7T 1IAPA 5JR9A 3N9OA 5FVKA 4PK5A 4UV8B 4HFBA 4ZI2C 5LG4A 4U72A 3V5SA 1MNEA 4QHOA 1WLXA 4KI0F 4U33A 4QWNB 5HEUA 1J5ET 1I94T 4UIGA 4LF6T 3ONLC 1XNRT 3V5UA 3FBZA 1MIWA 2FJBA 4MLKA 2VL8A 2VASA 2XAFB 3N2GE 4NIQA 2Y48B 3L3PA 2DHRA 4HKAA 3RYFE 4EAHA 1R8IA 1XZYA 3CKDA 2M6IA 3ZKRA 2YK0A 5AQNB 4HWCA 4QX7B 3AVSA
chains in the Genus database with same CATH topology
4JI5T 1IBKT 4JI8T 4LFBT 4X66T 4DUZT 4LFAT 4JI3T 2UUBT 4LF4T 1XMOT 2UXDT 3T1HT 2HHHT 4JI4T 4JI7T 5LMNT 4LFCT 4AQYT 2F4VT 2UUCT 1IBMT 1HR0T 4YY3T 4YHHT 4LF9T 1IBLT 3OTOT 2ZM6T 4DR7T 1N33T 4DR3T 4JI0T 5LMUT 4DV6T 4GKKT 4JI2T 4B3RT 4X64T 4DR5T 4DV3T 1HNWT 4X62T 4DV4T 4KHPT 1XNQT 2UUAT 4DV0T 4JI1T 4JYAT 1XMQT 2UU9T 2VQET 4DUYT 3T1YT 4B3ST 4NXMT 4LF8T 4DV7T 4JV5T 4X65T 1HNZT 4GKJT 5IWAT 4B3MT 1FJGT 1HNXT 4JI6T 2UXCT 4LF5T 5BR8T 1N36T 4DR6T 4B3TT 4LF7T 4DR4T 4K0KT 1N34T 4DR2T 1I94T 1XNRT 1J5ET 1N32T 4LF6T 4NXNT 4DV5T 4OX9T 4DR1T 2UXBT 4DV1T 2VQFT 4DV2T 2E5LT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 T;  1IBK T;  4JI8 T;  4LFB T;  4X66 T;  4DUZ T;  4LFA T;  4JI3 T;  2UUB T;  4LF4 T;  1XMO T;  2UXD T;  3T1H T;  2HHH T;  4JI4 T;  4JI7 T;  5LMN T;  4LFC T;  4AQY T;  2F4V T;  2UUC T;  1IBM T;  1HR0 T;  4YY3 T;  4YHH T;  4LF9 T;  1IBL T;  3OTO T;  2ZM6 T;  4DR7 T;  1N33 T;  4DR3 T;  4JI0 T;  5LMU T;  4DV6 T;  4GKK T;  4JI2 T;  4B3R T;  4X64 T;  4DR5 T;  4DV3 T;  1HNW T;  4X62 T;  4DV4 T;  4KHP T;  1XNQ T;  2UUA T;  4DV0 T;  4JI1 T;  4JYA T;  1XMQ T;  2UU9 T;  2VQE T;  4DUY T;  3T1Y T;  4B3S T;  4NXM T;  4LF8 T;  4DV7 T;  4JV5 T;  4X65 T;  1HNZ T;  4GKJ T;  5IWA T;  4B3M T;  1FJG T;  1HNX T;  4JI6 T;  2UXC T;  4LF5 T;  5BR8 T;  1N36 T;  4DR6 T;  4B3T T;  4LF7 T;  4DR4 T;  4K0K T;  1N34 T;  4DR2 T;  1I94 T;  1XNR T;  1J5E T;  1N32 T;  4LF6 T;  4NXN T;  4DV5 T;  4OX9 T;  4DR1 T;  2UXB T;  4DV1 T;  2VQF T;  4DV2 T;  2E5L T; 
#chains in the Genus database with same CATH topology
 3AE8 A;  1D0Z A;  2MTQ A;  1D1C A;  3EHZ A;  4TX5 A;  1LRZ A;  2C5J A;  4JI8 T;  4LFB T;  3M65 A;  2L9Q A;  2XAG B;  3ZC1 A;  4ERR A;  1CHU A;  2XQY A;  2X68 A;  4LF4 T;  2FJA A;  1HFA A;  4IDN A;  2VVN A;  1UCU A;  5J1G A;  4H63 V;  2E2A A;  5L3G B;  2E8I A;  3RC3 A;  2H89 A;  3AEG A;  3MXZ A;  1E1H B;  3IEE A;  4CXX A;  4AKI A;  4BAY B;  1SE7 A;  5FYM A;  2LSI A;  3MZK B;  5LMN T;  5FY1 A;  3H3A A;  4JI7 T;  2A72 A;  5CA0 E;  2UXC T;  3C4X A;  2F4V T;  2IAK A;  4NUV A;  3ZN1 B;  3B5M A;  3P4W A;  3SFD A;  2YIN A;  2IC9 A;  2R6G F;  2WB5 A;  4U2Y A;  1J1J A;  1WYB A;  5C8Y E;  1HS7 A;  3AE3 A;  2M6B A;  2W67 A;  4MFR A;  2CBJ A;  1YQ4 A;  2QGS A;  2SPC A;  3OBV E;  4ILA A;  5CGM A;  4YY3 T;  4AQF C;  2V26 A;  2PFV A;  2WDQ A;  2WM9 A;  2X9H A;  5JDH A;  2NR4 A;  1IBL T;  3LK4 2;  2KLQ A;  3IHR A;  3AE2 A;  3NVO A;  2BDE A;  5HCM A;  3PDY A;  5ABF A;  3DJB A;  3Q5D A;  2OA5 A;  3JAD A;  5AFU L;  4X1I E;  1QLB A;  5AQS B;  3BQK A;  4H9O C;  5LJN A;  4U7Y A;  2MBG A;  3WAJ A;  2M67 A;  4QH4 A;  4O4H E;  2EHO B;  5ADX L;  1AJ3 A;  2JIW A;  2H7V C;  3I9Y A;  3UTK A;  2LOP A;  3NRX A;  4PNI A;  3WI3 A;  2X66 A;  3BK9 A;  5L4H A;  2IDO B;  1FMV A;  4DR3 T;  1YQ3 A;  2UXN B;  4UV9 B;  3DP7 A;  5L3B B;  1UGO A;  3JC6 D;  2CRB A;  4TWF A;  5C2T A;  2KMF A;  3ONX A;  3CX7 B;  1HF8 A;  3ZLI A;  2XQ9 A;  2X9X A;  3HKB E;  3Q2M A;  4I0U A;  4ZS2 A;  4C91 A;  2BG9 C;  2X0H A;  4HWF A;  5J2U E;  5LHH B;  2X67 A;  3OVU A;  5LHG B;  4DR5 T;  1E7P A;  1KNR A;  3PUY F;  5IHY A;  3HA4 A;  4CI3 B;  2CE7 A;  3E0Z A;  2KND A;  4TN7 B;  3RH3 A;  3RIA A;  4EB6 E;  2W63 A;  2IHR 1;  3P4P A;  2IW5 B;  3K3Q C;  3MA9 A;  2LEH A;  4X1Y E;  4JI1 T;  3FB2 A;  2K24 A;  3CWZ B;  3OPC A;  4ZI2 D;  2DWK A;  4KBM B;  5FXW A;  3LDQ B;  1MMN A;  2DL1 A;  4IE7 A;  2UU9 T;  4AKH A;  2G0U A;  2YU2 A;  4Z8X A;  2VQE T;  4DUY T;  3RF1 A;  4F8H A;  2FJE A;  2VKO A;  1V9D A;  4WNK A;  5ABH A;  1X9B A;  2X51 A;  5HXE A;  3F31 A;  3O1J A;  4DVD A;  1XWM A;  2J62 A;  2WQY A;  1U4Q A;  4EED A;  1BR1 A;  2IC6 A;  5H6Q B;  3UU5 A;  4JBW F;  1KEY A;  3GMI A;  4ILC A;  4UVB B;  4DBQ A;  4P0A A;  4DMV A;  4PFO A;  3A8Y C;  4DV7 T;  3UFG A;  2W00 A;  3N9N A;  5EZY E;  3ZT6 A;  5AQU B;  3ZMZ B;  4YSX A;  3EUH A;  4ZI3 C;  4UF0 B;  3QUJ A;  4JEH B;  2I0M A;  2W66 A;  5AQT B;  3RQW A;  2UXB T;  1WRD A;  4IE6 A;  4JI6 T;  2NW8 A;  2P9B A;  1S35 A;  4JLE A;  2LOS A;  3UT5 E;  5LXT E;  1IZN B;  1D0Y A;  2YDS A;  3CIR A;  4QXB B;  5HXR A;  2MYS A;  5F5W A;  3UUM A;  3FHN A;  3FZM B;  2N1G A;  3ZYK A;  1KF6 A;  4ZEY A;  3UUN A;  5JR9 C;  2WMO A;  3K3N A;  4DR2 T;  2NWB A;  2ZM0 A;  4F6R C;  4HTE A;  3Q9D A;  4AI6 A;  1D0X A;  3PE0 A;  2FBW A;  1N32 T;  1D1B A;  5IUX A;  3RYI E;  4QKN A;  2CHO A;  3N2O A;  4ZZB A;  4A98 A;  4TV9 E;  1NWM X;  3PUS A;  1W9R A;  3SRZ A;  2ACZ A;  5L47 A;  5KXJ A;  3EVY A;  4HFE A;  4HGA A;  4P09 A;  4HN9 A;  3AE1 A;  3K8P C;  2OV9 A;  4H9N C;  5JR9 B;  4CN1 A;  1J5W A;  2DNX A;  5DQV A;  5CB4 E;  2I6H A;  5L3E B;  2QVA A;  2LE8 A;  2HN1 A;  2YU1 A;  5J2T E;  5KX5 E;  2H3R A;  1B7T A;  3MJX A;  1KFY A;  4YJ2 E;  1DU2 A;  4X66 T;  1OED B;  2V7M A;  2VVS A;  4JI3 T;  3CX6 B;  3VKH A;  5LGU B;  2UUB T;  2RP4 A;  2BKP A;  2VKH A;  3AE4 A;  4C90 A;  4QH5 A;  3T1H T;  3T8O A;  5AQJ B;  3C51 A;  2VKD A;  4BJN A;  5JDL A;  3GWH A;  3C4W A;  4ZXL A;  3WAK A;  3AVR A;  2BKN A;  4CN6 A;  4O2A E;  2VUR A;  2XM2 A;  3AB3 B;  1HX1 B;  3B13 A;  3ONJ A;  4Q25 A;  5EK2 A;  5FNV E;  4ASK A;  4FJO A;  2WWU A;  4EGW A;  3LFM A;  2C0S A;  3P50 A;  4IIJ E;  5DQW A;  5LOV E;  5EK3 A;  2UUC T;  4GYS A;  1VCS A;  2W0G A;  3ESL A;  3CK6 A;  4PJM A;  3SFE A;  1LVF A;  1HR0 T;  5HCJ A;  2CBI A;  3AA0 B;  2V6Y A;  3C4Z A;  4ANJ A;  3AED A;  5L3D B;  4UEM A;  4CN4 A;  3RRW A;  1O3X A;  4TZ4 C;  1L0V A;  2V1D B;  3J9X 1;  2KIN B;  3HI2 A;  3N9Q A;  2Y6X A;  4WYV A;  3PU8 A;  3U3I A;  2XPK A;  5JQG E;  3AXJ B;  4Z91 A;  3HR0 A;  2A3D A;  1T7S A;  3ZYL A;  4YT0 A;  1W09 A;  2ZM6 T;  3ZYM A;  4CZZ B;  4G63 A;  4X20 E;  3FZL B;  4HE8 A;  2V6X A;  2LRK A;  4AIS A;  3OJA A;  5JVD E;  2LM9 A;  3FXD B;  5J0Z A;  5LCY A;  2XHE B;  1MIV A;  3EDV A;  3PUG A;  2LHR A;  3IBP A;  3RIF A;  2LJL A;  4COF A;  4EIW A;  5HWY A;  1Y01 A;  1VCT A;  4U31 A;  2L3L A;  2XZE A;  4TWH A;  3LG7 A;  5LMU T;  1SUM B;  1WR0 A;  4K0U A;  4IE0 A;  5JDN A;  3RC8 A;  3Q5X A;  3I9W A;  4N78 D;  4O2B E;  4JI2 T;  3UFE A;  1XDP A;  2E9X A;  2Q9Q C;  4G2A A;  5DJQ C;  4JEU B;  5KMG P;  3AEE A;  3FBL A;  1MMD A;  1OED A;  3HKE E;  4O4L E;  4YTP A;  5ETW A;  4KHZ F;  4EZ4 A;  1HNW T;  3AEC A;  3EI0 A;  3L39 A;  4X62 T;  5HEO A;  3TKL B;  4EV6 A;  5FMN A;  2B1E A;  3ZMV B;  2JMK A;  3I0Q A;  4IRE A;  2JQ9 A;  4KP3 C;  2Q9Q B;  4IE5 A;  1UX5 A;  5ABG A;  5FP3 A;  3GN5 A;  3RPU A;  1MMG A;  3G06 A;  2CCQ A;  3H3M A;  5JDQ A;  2KSR A;  3AA6 B;  1LVK A;  2ACX A;  3CML A;  4TNW A;  3RKO A;  5FL1 A;  1OXZ A;  1WR6 A;  1YD8 G;  2D2S A;  2LHN A;  2MOZ A;  3AEA A;  2LRL A;  1MMA A;  3F2E A;  4YSZ A;  5HEJ A;  5HYA A;  2XAJ B;  4H63 H;  3EDU A;  2YDQ A;  4JUY A;  4LF8 T;  5JDM A;  4EYY R;  2WU2 A;  3AA7 B;  4TV8 E;  2BS2 A;  3TLW A;  3ZCI A;  3O4X E;  4H9Q C;  2X0L B;  2MAW A;  5CA1 E;  2H88 A;  2J1D G;  5ABF B;  4X65 T;  3RRC A;  4GK0 E;  4I50 E;  3AA1 B;  5EK4 A;  2ES0 A;  4JV5 T;  4B3M T;  3LBX B;  4J2C A;  2XAS B;  1EZ3 A;  3AE9 A;  2IML A;  3PUA A;  2B76 A;  2XQ3 A;  5AQL B;  1FJG T;  3CVR A;  5ABE A;  5M4Y A;  4YSY A;  1E2A A;  2BZB A;  2XQ7 A;  2ZM2 A;  3PUR A;  3QB5 K;  5LGT B;  1N36 T;  4LF5 T;  3OKQ A;  3QNU A;  4DR4 T;  2MPK A;  2BBH A;  1JNZ A;  2CXD A;  1D1A A;  2K9A A;  2WAU A;  3NKZ A;  5FKY A;  4A5X A;  4DID B;  2NTX A;  4IDQ A;  2V7J A;  1HX8 A;  3C50 A;  1VOM A;  1SA0 E;  2VWA A;  3JAF A;  3A5X A;  2AXD S;  2BBJ A;  3C98 B;  3HL6 A;  3P8C D;  4YHJ A;  1ZKE A;  4NXN T;  2WZH A;  4DV5 T;  3A7M A;  2W62 A;  4TUY E;  4OX9 T;  2DI4 A;  2WU5 A;  4I4T E;  3PUW F;  4MBQ A;  2C5I T;  2J4G A;  4GK5 E;  3VRB A;  5AQF B;  2LSJ A;  3KIN B;  3CQC B;  5LA6 E;  4DR1 T;  3KV4 A;  2WBL A;  2DLR A;  5LBM A;  3UQ7 A;  2WP9 A;  2VQF T;  4DV2 T;  1YW0 A;  1UK5 A;  4M1P A;  2QA7 A;  4JI5 T;  3RLF F;  2E5L T;  1BR0 A;  3H37 A;  1QSD A;  3W15 B;  4DBR A;  1X79 A;  1UUR A;  3LSV A;  4DUZ T;  2E5V A;  1MIY A;  4L0R A;  4GYR A;  4HFC A;  4PK4 A;  3P4S A;  4UVA B;  1OED E;  2LM2 A;  3RGL A;  4WBO A;  1XMO T;  2CMR A;  2UXD T;  2HHH T;  4NUU A;  2CWY A;  1VRB A;  1SHZ C;  4AKG A;  3DTO A;  1UUS A;  2JJ9 A;  3BQI A;  1GQE A;  4UVC B;  4EZH A;  2BG9 E;  4WBN E;  5JH7 E;  1FEW A;  3E08 A;  4JI4 T;  5GON E;  3X1D A;  4LFC T;  4CXW A;  2VK9 A;  4AQY T;  2VKJ A;  3PJA J;  5LNK A;  5FVL A;  2Y8D A;  4O8S A;  4AKR B;  2KZ7 B;  5FY0 A;  2YEV C;  4UXN B;  1W0B A;  3C64 A;  5JDG A;  4EEB A;  1I6Z A;  3VKG A;  2H7O A;  2ZMA A;  3HKD E;  5HXC A;  2PBI A;  1MND A;  1Z8U A;  2HPJ A;  2JQK A;  3ABV A;  3P4Q A;  4IT4 A;  4NPP A;  3R84 B;  3SS1 A;  1IBM T;  2FJD A;  1W0A A;  4CI2 B;  5IYZ E;  2ODV A;  4LF9 T;  4PJN A;  3ZT5 A;  5BMV E;  3QC9 A;  2WMN A;  2CA5 A;  2V6Y B;  5LG3 A;  2CXL A;  3PTR B;  1WCR A;  3NBX X;  2ZM8 A;  2X9W A;  5AQQ B;  3ETV A;  3EAM A;  3L8R A;  3PJA A;  4O4J E;  2LSG A;  3E22 E;  3U78 A;  4XZC A;  1T98 A;  2KXP B;  2VL0 A;  3TLS A;  2XUE A;  2ODU A;  4ZS3 A;  4AXP A;  3AAE B;  3FXE B;  3VHL A;  5TAO A;  1S94 A;  1T72 A;  2WY2 A;  4KUM B;  4L5G A;  4QH1 A;  2K5B B;  2EHO C;  2VB6 A;  4JI0 T;  2QRX A;  1ZEE A;  1ZV4 X;  4DV6 T;  3EAB A;  5LP6 E;  4GKK T;  4OYK A;  3BQL A;  5HAX A;  2W4X A;  4AIU A;  2JQH A;  4PFP A;  4DND A;  3AE6 A;  1BR4 A;  2KWH A;  3MKD A;  5JRC A;  2XY8 B;  4OFZ A;  5FXV A;  4A97 A;  4DO0 A;  4DV3 T;  2AE9 A;  4DV4 T;  4KHP T;  4U3C A;  1FMW A;  2NW7 A;  2CPT A;  5JRE A;  2BS4 A;  2BVL A;  3CPZ A;  2W2U A;  5HEH A;  4BJM A;  4DV0 T;  2PTF A;  2BG9 B;  3FZH B;  4KX6 A;  4GIW A;  4QX8 B;  3JCF A;  2XTL A;  1WYC A;  4TNV A;  1QUU A;  2NW9 A;  4WW0 A;  5HWX A;  2BKO A;  3PU3 A;  4B6X A;  1HTJ F;  3S4U A;  2PJQ A;  3AEB A;  3KDS E;  5HEG A;  4YTN A;  5L2L A;  3T1Y T;  2X9Y A;  5DAB A;  2WSS V;  2XAQ B;  4NXM T;  4OK0 A;  4QXH B;  3PUZ F;  4HWD A;  2YDR A;  3I1A A;  1FIO A;  3RQU A;  3AXJ A;  3GA8 A;  3FZF B;  4U7I A;  3M3Z B;  3PUX F;  4PJL A;  2YKS A;  1HNZ T;  4LML A;  4H9R C;  5IWA T;  4H9S E;  4GKJ T;  3OYZ A;  2KWI B;  4IHJ E;  2I59 A;  3UU3 A;  4ZI3 D;  5C3J A;  2UXX B;  4IL4 A;  4MAL A;  3LBX A;  1HNX T;  2XSB A;  5HXS A;  1BR2 A;  3QOF A;  4U74 A;  4YFS A;  4GOU A;  4EOZ B;  5L4E A;  3F57 A;  5BR8 T;  4DR6 T;  3ZMS B;  3IF8 B;  4B3T T;  4AQF A;  4K0K T;  5F8P A;  4ZHQ E;  1N34 T;  3UUX B;  3TLU A;  4Z90 A;  2CXF A;  3ZSS A;  4I43 B;  2X0Y A;  4V1A v;  2RA1 A;  4PJJ A;  2K48 A;  5FL0 A;  1KNZ A;  3NRY A;  4HWH A;  3ZPO A;  2LLY A;  1KK7 A;  4X5T A;  5LB7 B;  4ADZ A;  4YLH A;  3AAI A;  5AQI B;  1OED C;  3GN5 B;  3N9L A;  3KBT A;  5AQP B;  2Q9Q A;  4P0B A;  2EHO A;  2BG9 A;  2WWV A;  3O1H A;  4UR9 A;  4DV1 T;  1YKH B;  1G8X A;  4AQG A;  4IE4 A;  4YJ3 E;  4HEA A;  3ZC0 A;  2NTY A;  3ZJ2 A;  5AQR B;  5LYJ E;  5FXX A;  2IUB A;  3J7Y q;  3ANW B;  1IBK T;  3VR8 A;  4HFH A;  2DWG A;  5AQO B;  4LFA T;  3N9M A;  1XDO A;  3N9P A;  2JQQ A;  1G73 A;  2WCA A;  3N2K E;  2V5D A;  1WFD A;  2HN2 A;  2IIU A;  3KVA A;  3P4R A;  4ZOL E;  4XAX B;  3ZCJ A;  3UQ4 A;  3ZN0 B;  2LT3 A;  4ILB A;  2CHN A;  1HCI A;  2KT9 A;  2Z6E A;  2A9U A;  4L9I A;  1IJ5 A;  3N5L A;  3RHW A;  3UU8 A;  3PUQ A;  3UUL A;  1NEK A;  5E0O A;  2CM0 A;  3NZQ A;  3R6N A;  3LJC A;  2LSY A;  3PUV F;  2BVM A;  1CUN A;  2JPF A;  2V7K A;  3AE7 A;  3RYH E;  2A2F X;  3VRA A;  5AQV B;  3O1I A;  2XJ7 A;  3UU4 A;  2XQA A;  1H7C A;  3RI5 A;  4KMC A;  5JDF A;  2OLT A;  3LK2 B;  4WZX A;  5F3J A;  2V7L A;  3KV6 A;  5CFB A;  2K3W A;  4IL9 A;  4P1N A;  3CX8 B;  4LMK A;  4A56 A;  4IDP A;  1HG2 A;  1ZOY A;  3CQX C;  5A1L A;  3KFW X;  1HG5 A;  4YHH T;  4CI1 B;  4HWI B;  2LSK A;  2XQ5 A;  4ISS A;  2N9D A;  3KV9 A;  4HFD A;  2NP9 A;  1ZHC A;  2YOE A;  3ZJ1 A;  3TLT A;  4BA9 A;  3KBU A;  2CWO A;  2V7I A;  3HKC E;  3B57 A;  3ZMT B;  3JAE A;  2V5C A;  4PK6 A;  3OTO T;  3VU7 H;  2D0T A;  2V8S V;  3MK7 C;  4IDO A;  3ZMU B;  4OYJ A;  4AKL A;  4PW8 A;  2E9X D;  3D0T A;  1T8B A;  2HPL A;  2XM1 A;  4YTM A;  2J47 A;  4IGU A;  2EHO D;  4DR7 T;  3RYC E;  2LKH A;  3ZEF B;  3JC6 C;  3NZP A;  2XSA A;  3ANW A;  3PV0 F;  2JMH A;  3QK6 A;  1M62 A;  2WDV A;  3AEF A;  5H6R B;  5LHI B;  1N33 T;  2CEA A;  1JNR A;  1NAF A;  4IST A;  2Q9Q D;  4UF0 A;  2XQ4 A;  3AE5 A;  4E7S A;  1IJ6 A;  3Q5W A;  4OHF A;  3RX6 A;  2E9X B;  3L09 A;  2WZI A;  2ZLY A;  3MAC A;  3OYX A;  4H9P C;  4HFI A;  3SWH A;  2XAH B;  5JTG A;  2D9D A;  2DCF A;  3KV5 A;  4X64 T;  2LKG A;  3SOL A;  4B3R T;  1U5P A;  2GK9 A;  4I55 E;  2CLY C;  3P7I A;  2XQ6 A;  4ILU A;  1US7 B;  3IA3 A;  5JRC B;  1XNQ T;  2QYW A;  4X1K E;  5FXZ A;  2YN6 A;  5L3F B;  2E9X C;  4EXT A;  3FZK B;  5AQH B;  3UUB A;  4YXD A;  2UUA T;  1YKE B;  2D0U A;  4ZI7 E;  3RKG A;  2XQ8 A;  4JYA T;  5AQG B;  1XMQ T;  5CJ5 A;  1KNP A;  2CLY B;  3CQG B;  2WS3 A;  4HFV A;  1YXR A;  1Z0P A;  5LBQ B;  4IDZ A;  3TLV A;  3ZT7 A;  2W61 A;  2NOX A;  3K1S A;  4O4I E;  4UEL A;  4ZZC A;  3UU6 A;  4DMW A;  1ZP0 A;  5KDM C;  4LMJ A;  5L3C B;  3ZST A;  2C5K T;  4B3S T;  4MHC A;  3NWI A;  5LGN B;  1Y64 B;  2D5U A;  2PG8 A;  4XBF B;  4CXY A;  1OWA A;  2JRK A;  2N2N A;  3KVB A;  3QB5 A;  4PAG A;  4TWD A;  3RIU A;  5FY7 A;  2RPA A;  4QXC B;  5AQM B;  4U2Z A;  5AQK B;  3RIU C;  5HXH A;  1NEN A;  2WDR A;  3LK3 B;  2L8K A;  4FI5 A;  4E7Z A;  1LKX A;  2HH7 A;  3O9X A;  1UX4 A;  3Q5E A;  3AAA B;  5LJM A;  3VR9 A;  1M7K A;  2FUP A;  3I0O A;  4CQI A;  2BS3 A;  3ETU A;  4EYU A;  3K3O A;  4LF7 T;  1IAP A;  5JR9 A;  3N9O A;  5FVK A;  4PK5 A;  4UV8 B;  4HFB A;  4ZI2 C;  5LG4 A;  4U72 A;  3V5S A;  1MNE A;  4QHO A;  1WLX A;  4KI0 F;  4U33 A;  4QWN B;  5HEU A;  1J5E T;  1I94 T;  4UIG A;  4LF6 T;  3ONL C;  1XNR T;  3V5U A;  3FBZ A;  1MIW A;  2FJB A;  4MLK A;  2VL8 A;  2VAS A;  2XAF B;  3N2G E;  4NIQ A;  2Y48 B;  3L3P A;  2DHR A;  4HKA A;  3RYF E;  4EAH A;  1R8I A;  1XZY A;  3CKD A;  2M6I A;  3ZKR A;  2YK0 A;  5AQN B;  4HWC A;  4QX7 B;  3AVS A; 
#chains in the Genus database with same CATH homology
 4JI5 T;  1IBK T;  4JI8 T;  4LFB T;  4X66 T;  4DUZ T;  4LFA T;  4JI3 T;  2UUB T;  4LF4 T;  1XMO T;  2UXD T;  3T1H T;  2HHH T;  4JI4 T;  4JI7 T;  5LMN T;  4LFC T;  4AQY T;  2F4V T;  2UUC T;  1IBM T;  1HR0 T;  4YY3 T;  4YHH T;  4LF9 T;  1IBL T;  3OTO T;  2ZM6 T;  4DR7 T;  1N33 T;  4DR3 T;  4JI0 T;  5LMU T;  4DV6 T;  4GKK T;  4JI2 T;  4B3R T;  4X64 T;  4DR5 T;  4DV3 T;  1HNW T;  4X62 T;  4DV4 T;  4KHP T;  1XNQ T;  2UUA T;  4DV0 T;  4JI1 T;  4JYA T;  1XMQ T;  2UU9 T;  2VQE T;  4DUY T;  3T1Y T;  4B3S T;  4NXM T;  4LF8 T;  4DV7 T;  4JV5 T;  4X65 T;  1HNZ T;  4GKJ T;  5IWA T;  4B3M T;  1FJG T;  1HNX T;  4JI6 T;  2UXC T;  4LF5 T;  5BR8 T;  1N36 T;  4DR6 T;  4B3T T;  4LF7 T;  4DR4 T;  4K0K T;  1N34 T;  4DR2 T;  1I94 T;  1XNR T;  1J5E T;  1N32 T;  4LF6 T;  4NXN T;  4DV5 T;  4OX9 T;  4DR1 T;  2UXB T;  4DV1 T;  2VQF T;  4DV2 T;  2E5L T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...