4K0KT

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4k0kT00
5LMNT 3T1YT 4DV1T 3T1HT 1HR0T 1FJGT 1IBKT 1HNWT 4DR3T 1XMOT 1HNXT 2UXCT 1IBLT 4DR5T 4DV5T 4LF5T 4DR6T 4X62T 3OTOT 4JYAT 4DV2T 4K0KT 4YHHT 2UXBT 4LF7T 4DV0T 4LF8T 2VQFT 4NXNT 5IWAT 4DUYT 4GKJT 4JI8T 4LF6T 1N36T 4B3RT 4DV7T 4LFCT 4LF4T 2ZM6T 4X65T 2F4VT 4NXMT 4GKKT 1IBMT 4DR2T 4DR1T 1I94T 4B3TT 4DV3T 5BR8T 4LF9T 4KHPT 4OX9T 2VQET 4JV5T 2UU9T 4X66T 2UUCT 5LMUT 4JI1T 1XMQT 1J5ET 4DR4T 1N32T 4DV6T 1N33T 1N34T 2UXDT 4LFAT 2HHHT 4JI3T 4JI5T 2E5LT 4DUZT 4JI4T 4JI0T 4JI7T 4DV4T 4JI2T 2UUBT 1XNQT 4JI6T 4X64T 1HNZT 4LFBT 4B3ST 4AQYT 2UUAT 4DR7T 4YY3T 1XNRT 4B3MT
chains in the Genus database with same CATH superfamily
2OV9A 2MBGA 2W00A 4IDNA 3ONXA 2BKNA 2CLYC 1HNXT 1S35A 4L0RA 4DR5T 2WMNA 2XPKA 3PUSA 3PU3A 1VOMA 3MA9A 4LF8T 3EI0A 4PFOA 2L9QA 5CA1E 3Q9DA 3ZMVB 1FMWA 3RYIE 3PUGA 5CFBA 2XQ9A 3CIRA 4IE4A 1XDOA 4QX8B 2C5IT 5AQSB 2WS3A 2VK9A 3ZN0B 1HCIA 2LOSA 2V8SV 2UUCT 5LMUT 2XSBA 4ADZA 4AKLA 1X79A 4JI0T 2XY8B 3FZMB 1R8IA 2VL0A 2XAJB 4ZEYA 3N9QA 2EHOC 2CBJA 2BZBA 3PTRB 2W63A 3RYCE 2JIWA 2LKHA 4AQYT 4X1IE 2WQYA 2XQ5A 3CKDA 4B3MT 4YJ3E 1GQEA 4F6RC 3F31A 3T1YT 1IBKT 2M67A 3C98B 2KNDA 2VKDA 3P4SA 3NZQA 4GIWA 5AQHB 2XAFB 3ZJ2A 4AIUA 4U2YA 3ZYMA 2XAQB 3AEFA 3RH3A 4AXPA 1I6ZA 4LF7T 1UCUA 2E9XB 2N2NA 3UUBA 2CXLA 5JRCB 3A5XA 2BKOA 2UXXB 3RLFF 4IGUA 4OYJA 1MMGA 5JDNA 3UU8A 2E9XD 5LHIB 3LK2B 3AVSA 3NZPA 3UU6A 4JI8T 2CWYA 3N9NA 4PK4A 4HKAA 4PW8A 3N2OA 1IJ6A 4JBWF 4TWDA 4HFEA 2B76A 4EZ4A 3O9XA 3IBPA 1MIWA 4LF9T 5HAXA 3VRBA 4O4JE 3LSVA 1MNDA 4V1Av 2YK0A 4CN4A 2UXDT 4NPPA 4JI3T 4DIDB 4JI4T 5HEUA 3IHRA 1HX8A 1OEDC 1KEYA 3HKCE 2VVSA 4F8HA 3OBVE 4P0BA 5JQGE 3ZCJA 4O2AE 4HN9A 2LLYA 2D0UA 2XQ3A 2B1EA 2IUBA 4J2CA 2AE9A 2V5CA 3R84B 2I6HA 5DQWA 3AEDA 5L4EA 3UU4A 3AE5A 2X68A 4DR6T 1MIYA 5HWYA 2A9UA 1WLXA 2PBIA 4HEAA 2DI4A 4EIWA 5LXTE 1MMDA 2FJAA 3PDYA 5IWAT 3AEGA 4U33A 1G73A 3AA1B 1NAFA 3Q5DA 3FHNA 2YU1A 2M6IA 3ZLIA 5LOVE 3IA3A 3A7MA 3E08A 2MPKA 2KINB 3EUHA 1G8XA 1WYCA 2YKSA 3ZMTB 2E9XA 2W61A 3ZT7A 5FXWA 3WAJA 5JRCA 2NW7A 3KV4A 2PJQA 2V6YA 3UUMA 4DUZT 3PE0A 5E0OA 2LRKA 3ZYLA 4MBQA 3UUXB 5JDFA 3PUYF 2KMFA 4COFA 5FL1A 4PJJA 4QH5A 4P0AA 4JEUB 4XBFB 5LG3A 1W0BA 5HCMA 3LG7A 2WMOA 2WP9A 4GOUA 3TLWA 4TV8E 4H9QC 5C3JA 3DTOA 2W66A 2LSYA 5H6RB 2XASB 2XQYA 3PUVF 3RF1A 3OTOT 2X0HA 3ANWB 4EXTA 2ZMAA 3VR9A 3FBZA 1W9RA 5AFUL 2PG8A 3C4ZA 4X20E 1D0XA 5L3DB 5LJNA 3EAMA 4ZI2D 4UF0B 3Q5WA 4PNIA 4LFCT 2XM2A 2J4GA 3RIAA 1KK7A 2DHRA 5L3BB 2A2FX 2XAHB 3KV9A 2GK9A 2KWIB 4GYSA 4ILBA 1ZKEA 2CXDA 2X51A 3MKDA 3GMIA 2JMHA 4KMCA 2E8IA 1D1BA 2Q9QD 5EK2A 2C0SA 3N9OA 3J9X1 2WU2A 2XSAA 3T8OA 3RKOA 2VB6A 2K3WA 2IAKA 5LCYA 2ZLYA 5EZYE 3C4WA 2BS4A 4DMWA 4QHOA 3ETVA 2IMLA 4AKIA 3GA8A 4K0UA 4EYYR 2DCFA 3PJAJ 1HR0T 5HEJA 4AKGA 5J2TE 2VASA 3AB3B 3HI2A 3RYFE 2CPTA 2I0MA 2NP9A 5LHHB 3DJBA 5ABHA 4X62T 3AE8A 4HE8A 2LM2A 2BVMA 2CHOA 4TWHA 4YHHT 5F5WA 4EZHA 1T8BA 4X1YE 2ZM2A 1OXZA 1VCSA 4NUUA 2HPJA 2FJBA 3RX6A 3TLVA 4UIGA 3M65A 2V7LA 4UVAB 4YFSA 4ISSA 4H63V 2VVNA 1HX1B 3KV5A 2CRBA 4U72A 2ZM6T 2K9AA 2H89A 2BS3A 2JQQA 3K3OA 4JV5T 3ANWA 4KX6A 3ZMSB 3BQLA 3NRYA 5ABGA 2E9XC 3RQWA 1MMNA 2HH7A 4U7IA 4UF0A 2D2SA 4ANJA 1UX5A 4KHZF 2VURA 1HNZT 4LFBT 4B3ST 5AQPB 3RIFA 1IJ5A 4OYKA 4UVBB 2X0YA 4YXDA 3O4XE 4H9PC 5IYZE 3BQIA 4QKNA 3B57A 2VKOA 3HKBE 3AECA 3LFMA 4I43B 2V7KA 4A56A 1XWMA 3L3PA 1SA0E 3TLTA 1WR6A 4LMJA 5HXHA 2PTFA 4ZOLE 1LVFA 4PJLA 3L39A 4AQFC 1AJ3A 3JC6D 2Y6XA 2X67A 1NEKA 1LRZA 1US7B 4XZCA 2DNXA 3RPUA 3NVOA 1XZYA 3CQXC 3KBUA 5LYJE 2JRKA 4ZZBA 4C90A 5EK4A 5CGMA 4B3RT 4YT0A 1QSDA 3I1AA 4A5XA 2E5VA 4DMVA 1X9BA 1H7CA 4ILCA 2WBLA 3RKGA 4B3TT 2FBWA 2N9DA 5BR8T 4OX9T 4WNKA 1WYBA 4QWNB 1W0AA 2CEAA 3L8RA 1SE7A 3VR8A 4HWFA 5J1GA 4ILAA 3ZC1A 2CWOA 4DV4T 5IHYA 3AXJB 1HS7A 2H88A 5HYAA 5FKYA 5L2LA 2LJLA 2WDVA 2WY2A 3B13A 1FJGT 2V5DA 1WFDA 2HPLA 3I0QA 4AQGA 5KMGP 5AQJB 2R6GF 3N2KE 3EDVA 3AEEA 2PFVA 2ODVA 3KVBA 2RA1A 5KDMC 4KUMB 2OLTA 3IEEA 2H3RA 2QRXA 2UXBT 4U7YA 3EVYA 2NW9A 3K3NA 3BQKA 4DV0T 4QXBB 2E2AA 3SFDA 5CA0E 3CX7B 4Q25A 1KF6A 5FMNA 3WI3A 5ETWA 2NTYA 1UX4A 1YXRA 5LBMA 2BVLA 2L8KA 4UELA 1JNZA 2LT3A 4CI2B 1D0ZA 4YJ2E 2V6YB 3TLSA 2IW5B 4JI1T 3H37A 3D0TA 2YDRA 2E5LT 2V7MA 1QLBA 2LSJA 3AAEB 4HWIB 2LHNA 3LK3B 4NIQA 2HN1A 2X9HA 2KXPB 2VWAA 4JI6T 4A97A 4DVDA 3KFWX 2NOXA 3AE1A 5JH7E 4YY3T 4BJNA 1NWMX 3ZC0A 4AISA 1YKEB 4CN1A 4TNWA 4KI0F 2MOZA 4Z91A 1E7PA 3RIUA 4TWFA 3P4WA 4HWHA 3PURA 1IBLT 2W67A 4I0UA 3MK7C 2YDQA 3AXJA 1UUSA 4IE0A 4H9RC 4ZI7E 3LDQB 2OA5A 4P09A 5FXXA 5HEGA 3AE4A 1U5PA 2VQFT 3RRWA 2LHRA 3MJXA 3CX6B 2YINA 5LA6E 4NXNT 4QXCB 1E1HB 3AA7B 3SS1A 5JREA 5LNKA 2MYSA 5JR9B 2F4VT 3IF8B 3KV6A 1FMVA 4DBRA 2CM0A 4EV6A 1D0YA 2Z6EA 3ESLA 2H7OA 4JI5T 3U78A 4PAGA 1LKXA 4ZI3C 3ZT6A 1YKHB 1W09A 3AVRA 4DO0A 4IE6A 5EK3A 4HFDA 2XQAA 5DQVA 3LBXB 1LVKA 3T1HT 4X5TA 1HFAA 1HNWT 2FUPA 2D5UA 2UXNB 3AEBA 4QXHB 4YTPA 1T98A 2ACZA 4KP3C 4UXNB 3P4PA 4HTEA 2JQ9A 3C50A 1BR4A 5HXRA 2W4XA 3UU5A 2VKJA 2EHOD 3CQGB 2W2UA 2V7IA 3ZMUB 2CA5A 3S4UA 3UQ7A 2BS2A 5ABFB 4UR9A 3K3QC 3FZLB 3QNUA 3AAIA 2C5JA 3HA4A 3C4XA 5F3JA 1BR0A 1Y01A 1YQ4A 5KX5E 2JJ9A 2XHEB 3JCFA 5IUXA 3SFEA 1YW0A 2C5KT 2DL1A 5L3EB 2RP4A 2YEVC 5FYMA 5LB7B 5HEOA 3VKHA 1J5ET 3A8YC 4CI3B 1N33T 2WZIA 3VRAA 5CB4E 3NKZA 2XQ6A 2Q9QB 3N9PA 3N2GE 4QH4A 2LEHA 3ABVA 2JMKA 3FZHB 4EEDA 4X64T 5HEHA 5JR9A 5LJMA 3RC8A 2NW8A 5J2UE 3AA6B 3AE9A 3RC3A 5HCJA 5HXSA 3HKEE 1CUNA 1Y64B 1M62A 5CJ5A 2XZEA 4MHCA 3E0ZA 4IDOA 3RHWA 5AQLB 1OEDB 4NUVA 4TV9E 4ZHQE 4L9IA 3ETUA 3HL6A 4GK5E 3RIUC 5JDGA 4DNDA 4IDQA 3K8PC 4O2BE 4IDZA 4IL9A 2DWKA 2LM9A 3FZFB 2SPCA 1O3XA 3LBXA 4DBQA 3QK6A 5C8YE 2QVAA 3KDSE 5AQQB 5H6QB 2LSGA 1MIVA 4DUYT 2XAGB 2X9WA 3B5MA 5TAOA 5JDQA 1T7SA 1WRDA 4UV8B 5JVDE 2ACXA 1BR2A 1UURA 2WB5A 4CXYA 3FXDB 4MFRA 1JNRA 1NENA 1I94T 2XUEA 2X9XA 4KHPT 4E7SA 2BG9B 2XJ7A 2N1GA 5ABFA 1N34T 4CZZB 4LFAT 2HHHT 4LMKA 1FIOA 4EB6E 4TUYE 3AEAA 4JI7T 2QYWA 2WWUA 5JTGA 2JQHA 5AQUB 3VHLA 5C2TA 3L09A 2A72A 2UUAT 2KZ7B 4UVCB 4EAHA 1QUUA 4B6XA 2HN2A 4HFVA 5LMNT 4Z90A 2L3LA 5JDLA 5KXJA 3U3IA 3G06A 4E7ZA 2CCQA 3H3AA 4WYVA 2J62A 3ZJ1A 4MALA 3DP7A 2QGSA 4KBMB 5LBQB 3ZYKA 3P7IA 3AA0B 2Q9QA 2ZM8A 4U3CA 4TX5A 4JYAT 4G63A 2KWHA 2XQ8A 4O4LE 4ISTA 3Q5XA 4OHFA 1IAPA 3ZT5A 3RGLA 5LGTB 5FXVA 3TLUA 3KINB 4H9SE 4EYUA 1D1AA 5HXEA 1OEDA 2XQ7A 4O4HE 4ZXLA 4DV7T 4IDPA 3QC9A 1B7TA 2WDRA 4O4IE 2Y48B 4DR2T 4DV3T 4BAYB 4C91A 2D0TA 3X1DA 3W15B 2UU9T 4EGWA 1XMQT 4DR4T 2ZM0A 3CQCB 4JUYA 2XQ4A 4ZS2A 3CX8B 3O1HA 5FY0A 5F8PA 2MAWA 5AQKB 2V6XA 4ERRA 3FBLA 5HXCA 4TZ4C 4YSXA 4U2ZA 3UTKA 5JR9C 1U4QA 1VCTA 2BG9A 4IT4A 2CBIA 4PK6A 1SUMB 3PV0F 4YLHA 4IHJE 3NBXX 5L3FB 5FY7A 1MMAA 3I0OA 4CI1B 5FP3A 4DV5T 3EHZA 1YQ3A 4LF5T 2J1DG 3I9WA 5AQVB 2CXFA 5FY1A 3I9YA 1V9DA 4IL4A 1T72A 4CN6A 2KLQA 3AE3A 2J47A 1HF8A 2H7VC 2NWBA 1Z8UA 1OWAA 3N9LA 4WBOA 3MXZA 2CMRA 4I55E 4YTNA 1KNPA 4X65T 1D1CA 4I50E 5BMVE 2LE8A 3AE2A 4OK0A 4GKKT 4HGAA 5M4YA 4PJNA 4DR1T 1EZ3A 1S94A 5FVKA 5LHGB 1KNZA 1L0VA 4HFHA 3ZKRA 2XTLA 4H9OC 4DV6T 2W0GA 3NWIA 2Y8DA 2MTQA 3CPZA 4AKRB 2A3DA 4G2AA 3F57A 2LRLA 3E22E 1XNQT 2W62A 3BK9A 5J0ZA 2BDEA 4A98A 3PUWF 4TN7B 3P50A 3UULA 4DR7T 2X9YA 3P4QA 2JQKA 1OEDE 3SOLA 3QB5K 4CXXA 4DV1T 4HFBA 4ZI2C 3C51A 3KBTA 2V7JA 3OPCA 5A1LA 1UGOA 4YTMA 3V5SA 3ZCIA 1BR1A 4DV2T 2WU5A 2Q9QC 3FZKB 4IE5A 1FEWA 1M7KA 1KFYA 2X66A 4FJOA 4OFZA 5FVLA 1N36T 4CQIA 2LSIA 3GN5B 1DU2A 2AXDS 2BG9E 1ZEEA 2CLYB 4HWDA 3CK6A 3V5UA 3NRXA 2BKPA 2V1DB 5AQFB 4X66T 2YOEA 2DLRA 2WSSV 2XM1A 5LP6E 4HFCA 4UV9B 4ASKA 4EEBA 3RYHE 2FJEA 3UQ4A 1HG5A 3EDUA 4AI6A 5AQIB 1IZNB 4GK0E 3P8CD 4O8SA 4P1NA 4PJMA 3AE7A 3PUAA 3LK42 2QA7A 3Q2MA 3PJAA 3J7Yq 4TNVA 3UU3A 2K5BB 1Z0PA 5DJQC 3JAEA 3H3MA 4DR3T 1XMOT 1KNRA 2BG9C 1XDPA 5AQMB 4UEMA 3VU7H 2VL8A 5HWXA 1HTJF 2IC9A 1WR0A 2LSKA 3KVAA 2YDSA 2FJDA 2WAUA 3QB5A 2EHOB 3UUNA 4WW0A 3SRZA 4LMLA 3PUZF 4LF6T 3C64A 3N5LA 3AE6A 4L5GA 3MACA 2DWGA 1WCRA 4H63H 3ONJA 3OYZA 3ZSSA 3CMLA 4H9NC 3CVRA 3OYXA 2NR4A 4GYRA 4PFPA 4WBNE 3QOFA 1N32T 5LGUB 5L4HA 3N9MA 2X0LB 2KSRA 4XAXB 3RRCA 4AQFA 3JC6C 5L3CB 1VRBA 5JDMA 3SWHA 4CXWA 3GN5A 4I4TE 2CE7A 4JLEA 3QUJA 3ZMZB 2BBJA 1J5WA 5L47A 5JDHA 1XNRT 3GWHA 5AQTB 3CWZB 2UXCT 3PUQA 3HKDE 3R6NA 1E2AA 4HWCA 3TKLB 2CHNA 4QX7B 3UFGA 3Q5EA 2VKHA 1ZOYA 4AKHA 1HG2A 2ES0A 4PK5A 2NTXA 1J1JA 4EOZB 3MZKB 3ZEFB 4BJMA 1YD8G 4NXMT 2WCAA 5AQOB 3RQUA 2IC6A 1ZP0A 1IBMT 2WDQA 1UK5A 3OKQA 2I59A 2VQET 4ILUA 2YN6A 4HFIA 3VKGA 4YHJA 4YSYA 1CHUA 3AAAB 2D9DA 4JEHB 3K1SA 1ZV4X 2WZHA 1ZHCA 2EHOA 4N78D 4IREA 3P4RA 4YSZA 4JI2T 3FXEB 3OVUA 2UUBT 3ZPOA 5AQGB 5AQNB 2K24A 5LGNB 3ZSTA 3HR0A 3OJAA 3UT5E 2YU2A 3RI5A 2IIUA 2WM9A 4U74A 2LKGA 1MNEA 3WAKA 2P9BA 5ABEA 2JPFA 3JAFA 3ONLC 3PU8A 4FI5A 4ZI3D 4IE7A 5FXZA 3F2EA 1SHZC 3M3ZB 5FL0A 2K48A 4K0KT 5LG4A 5DABA 4Z8XA 3EABA 5AQRB 4BA9A 2G0UA 3FB2A 4M1PA 4IIJE 2ODUA 4MLKA 4ZZCA 4GKJT 5GONE 2WWVA 5L3GB 3O1JA 3PUXF 2V26A 4LF4T 2M6BA 4WZXA 2IDOB 2LOPA 4ZS3A 3LJCA 5ADXL 5FNVE 4U31A 4X1KE 2KT9A 3UFEA 2BBHA 3JADA 3O1IA 4QH1A 2RPAA 2IHR1 3ZN1B
chains in the Genus database with same CATH topology
5LMNT 3T1YT 4DV1T 3T1HT 1HR0T 1FJGT 1IBKT 1HNWT 4DR3T 1XMOT 1HNXT 2UXCT 1IBLT 4DR5T 4DV5T 4LF5T 4DR6T 4X62T 3OTOT 4JYAT 4DV2T 4K0KT 4YHHT 2UXBT 4LF7T 4DV0T 4LF8T 2VQFT 4NXNT 5IWAT 4DUYT 4GKJT 4JI8T 4LF6T 1N36T 4B3RT 4DV7T 4LFCT 4LF4T 2ZM6T 4X65T 2F4VT 4NXMT 4GKKT 1IBMT 4DR2T 4DR1T 1I94T 4B3TT 4DV3T 5BR8T 4LF9T 4KHPT 4OX9T 2VQET 4JV5T 2UU9T 4X66T 2UUCT 5LMUT 4JI1T 1XMQT 1J5ET 4DR4T 1N32T 4DV6T 1N33T 1N34T 2UXDT 4LFAT 2HHHT 4JI3T 4JI5T 2E5LT 4DUZT 4JI4T 4JI0T 4JI7T 4DV4T 4JI2T 2UUBT 1XNQT 4JI6T 4X64T 1HNZT 4LFBT 4B3ST 4AQYT 2UUAT 4DR7T 4YY3T 1XNRT 4B3MT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN T;  3T1Y T;  4DV1 T;  3T1H T;  1HR0 T;  1FJG T;  1IBK T;  1HNW T;  4DR3 T;  1XMO T;  1HNX T;  2UXC T;  1IBL T;  4DR5 T;  4DV5 T;  4LF5 T;  4DR6 T;  4X62 T;  3OTO T;  4JYA T;  4DV2 T;  4K0K T;  4YHH T;  2UXB T;  4LF7 T;  4DV0 T;  4LF8 T;  2VQF T;  4NXN T;  5IWA T;  4DUY T;  4GKJ T;  4JI8 T;  4LF6 T;  1N36 T;  4B3R T;  4DV7 T;  4LFC T;  4LF4 T;  2ZM6 T;  4X65 T;  2F4V T;  4NXM T;  4GKK T;  1IBM T;  4DR2 T;  4DR1 T;  1I94 T;  4B3T T;  4DV3 T;  5BR8 T;  4LF9 T;  4KHP T;  4OX9 T;  2VQE T;  4JV5 T;  2UU9 T;  4X66 T;  2UUC T;  5LMU T;  4JI1 T;  1XMQ T;  1J5E T;  4DR4 T;  1N32 T;  4DV6 T;  1N33 T;  1N34 T;  2UXD T;  4LFA T;  2HHH T;  4JI3 T;  4JI5 T;  2E5L T;  4DUZ T;  4JI4 T;  4JI0 T;  4JI7 T;  4DV4 T;  4JI2 T;  2UUB T;  1XNQ T;  4JI6 T;  4X64 T;  1HNZ T;  4LFB T;  4B3S T;  4AQY T;  2UUA T;  4DR7 T;  4YY3 T;  1XNR T;  4B3M T; 
#chains in the Genus database with same CATH topology
 2OV9 A;  2MBG A;  2W00 A;  4IDN A;  3ONX A;  2BKN A;  2CLY C;  1HNX T;  1S35 A;  4L0R A;  4DR5 T;  2WMN A;  2XPK A;  3PUS A;  3PU3 A;  1VOM A;  3MA9 A;  4LF8 T;  3EI0 A;  4PFO A;  2L9Q A;  5CA1 E;  3Q9D A;  3ZMV B;  1FMW A;  3RYI E;  3PUG A;  5CFB A;  2XQ9 A;  3CIR A;  4IE4 A;  1XDO A;  4QX8 B;  2C5I T;  5AQS B;  2WS3 A;  2VK9 A;  3ZN0 B;  1HCI A;  2LOS A;  2V8S V;  2UUC T;  5LMU T;  2XSB A;  4ADZ A;  4AKL A;  1X79 A;  4JI0 T;  2XY8 B;  3FZM B;  1R8I A;  2VL0 A;  2XAJ B;  4ZEY A;  3N9Q A;  2EHO C;  2CBJ A;  2BZB A;  3PTR B;  2W63 A;  3RYC E;  2JIW A;  2LKH A;  4AQY T;  4X1I E;  2WQY A;  2XQ5 A;  3CKD A;  4B3M T;  4YJ3 E;  1GQE A;  4F6R C;  3F31 A;  3T1Y T;  1IBK T;  2M67 A;  3C98 B;  2KND A;  2VKD A;  3P4S A;  3NZQ A;  4GIW A;  5AQH B;  2XAF B;  3ZJ2 A;  4AIU A;  4U2Y A;  3ZYM A;  2XAQ B;  3AEF A;  3RH3 A;  4AXP A;  1I6Z A;  4LF7 T;  1UCU A;  2E9X B;  2N2N A;  3UUB A;  2CXL A;  5JRC B;  3A5X A;  2BKO A;  2UXX B;  3RLF F;  4IGU A;  4OYJ A;  1MMG A;  5JDN A;  3UU8 A;  2E9X D;  5LHI B;  3LK2 B;  3AVS A;  3NZP A;  3UU6 A;  4JI8 T;  2CWY A;  3N9N A;  4PK4 A;  4HKA A;  4PW8 A;  3N2O A;  1IJ6 A;  4JBW F;  4TWD A;  4HFE A;  2B76 A;  4EZ4 A;  3O9X A;  3IBP A;  1MIW A;  4LF9 T;  5HAX A;  3VRB A;  4O4J E;  3LSV A;  1MND A;  4V1A v;  2YK0 A;  4CN4 A;  2UXD T;  4NPP A;  4JI3 T;  4DID B;  4JI4 T;  5HEU A;  3IHR A;  1HX8 A;  1OED C;  1KEY A;  3HKC E;  2VVS A;  4F8H A;  3OBV E;  4P0B A;  5JQG E;  3ZCJ A;  4O2A E;  4HN9 A;  2LLY A;  2D0U A;  2XQ3 A;  2B1E A;  2IUB A;  4J2C A;  2AE9 A;  2V5C A;  3R84 B;  2I6H A;  5DQW A;  3AED A;  5L4E A;  3UU4 A;  3AE5 A;  2X68 A;  4DR6 T;  1MIY A;  5HWY A;  2A9U A;  1WLX A;  2PBI A;  4HEA A;  2DI4 A;  4EIW A;  5LXT E;  1MMD A;  2FJA A;  3PDY A;  5IWA T;  3AEG A;  4U33 A;  1G73 A;  3AA1 B;  1NAF A;  3Q5D A;  3FHN A;  2YU1 A;  2M6I A;  3ZLI A;  5LOV E;  3IA3 A;  3A7M A;  3E08 A;  2MPK A;  2KIN B;  3EUH A;  1G8X A;  1WYC A;  2YKS A;  3ZMT B;  2E9X A;  2W61 A;  3ZT7 A;  5FXW A;  3WAJ A;  5JRC A;  2NW7 A;  3KV4 A;  2PJQ A;  2V6Y A;  3UUM A;  4DUZ T;  3PE0 A;  5E0O A;  2LRK A;  3ZYL A;  4MBQ A;  3UUX B;  5JDF A;  3PUY F;  2KMF A;  4COF A;  5FL1 A;  4PJJ A;  4QH5 A;  4P0A A;  4JEU B;  4XBF B;  5LG3 A;  1W0B A;  5HCM A;  3LG7 A;  2WMO A;  2WP9 A;  4GOU A;  3TLW A;  4TV8 E;  4H9Q C;  5C3J A;  3DTO A;  2W66 A;  2LSY A;  5H6R B;  2XAS B;  2XQY A;  3PUV F;  3RF1 A;  3OTO T;  2X0H A;  3ANW B;  4EXT A;  2ZMA A;  3VR9 A;  3FBZ A;  1W9R A;  5AFU L;  2PG8 A;  3C4Z A;  4X20 E;  1D0X A;  5L3D B;  5LJN A;  3EAM A;  4ZI2 D;  4UF0 B;  3Q5W A;  4PNI A;  4LFC T;  2XM2 A;  2J4G A;  3RIA A;  1KK7 A;  2DHR A;  5L3B B;  2A2F X;  2XAH B;  3KV9 A;  2GK9 A;  2KWI B;  4GYS A;  4ILB A;  1ZKE A;  2CXD A;  2X51 A;  3MKD A;  3GMI A;  2JMH A;  4KMC A;  2E8I A;  1D1B A;  2Q9Q D;  5EK2 A;  2C0S A;  3N9O A;  3J9X 1;  2WU2 A;  2XSA A;  3T8O A;  3RKO A;  2VB6 A;  2K3W A;  2IAK A;  5LCY A;  2ZLY A;  5EZY E;  3C4W A;  2BS4 A;  4DMW A;  4QHO A;  3ETV A;  2IML A;  4AKI A;  3GA8 A;  4K0U A;  4EYY R;  2DCF A;  3PJA J;  1HR0 T;  5HEJ A;  4AKG A;  5J2T E;  2VAS A;  3AB3 B;  3HI2 A;  3RYF E;  2CPT A;  2I0M A;  2NP9 A;  5LHH B;  3DJB A;  5ABH A;  4X62 T;  3AE8 A;  4HE8 A;  2LM2 A;  2BVM A;  2CHO A;  4TWH A;  4YHH T;  5F5W A;  4EZH A;  1T8B A;  4X1Y E;  2ZM2 A;  1OXZ A;  1VCS A;  4NUU A;  2HPJ A;  2FJB A;  3RX6 A;  3TLV A;  4UIG A;  3M65 A;  2V7L A;  4UVA B;  4YFS A;  4ISS A;  4H63 V;  2VVN A;  1HX1 B;  3KV5 A;  2CRB A;  4U72 A;  2ZM6 T;  2K9A A;  2H89 A;  2BS3 A;  2JQQ A;  3K3O A;  4JV5 T;  3ANW A;  4KX6 A;  3ZMS B;  3BQL A;  3NRY A;  5ABG A;  2E9X C;  3RQW A;  1MMN A;  2HH7 A;  4U7I A;  4UF0 A;  2D2S A;  4ANJ A;  1UX5 A;  4KHZ F;  2VUR A;  1HNZ T;  4LFB T;  4B3S T;  5AQP B;  3RIF A;  1IJ5 A;  4OYK A;  4UVB B;  2X0Y A;  4YXD A;  3O4X E;  4H9P C;  5IYZ E;  3BQI A;  4QKN A;  3B57 A;  2VKO A;  3HKB E;  3AEC A;  3LFM A;  4I43 B;  2V7K A;  4A56 A;  1XWM A;  3L3P A;  1SA0 E;  3TLT A;  1WR6 A;  4LMJ A;  5HXH A;  2PTF A;  4ZOL E;  1LVF A;  4PJL A;  3L39 A;  4AQF C;  1AJ3 A;  3JC6 D;  2Y6X A;  2X67 A;  1NEK A;  1LRZ A;  1US7 B;  4XZC A;  2DNX A;  3RPU A;  3NVO A;  1XZY A;  3CQX C;  3KBU A;  5LYJ E;  2JRK A;  4ZZB A;  4C90 A;  5EK4 A;  5CGM A;  4B3R T;  4YT0 A;  1QSD A;  3I1A A;  4A5X A;  2E5V A;  4DMV A;  1X9B A;  1H7C A;  4ILC A;  2WBL A;  3RKG A;  4B3T T;  2FBW A;  2N9D A;  5BR8 T;  4OX9 T;  4WNK A;  1WYB A;  4QWN B;  1W0A A;  2CEA A;  3L8R A;  1SE7 A;  3VR8 A;  4HWF A;  5J1G A;  4ILA A;  3ZC1 A;  2CWO A;  4DV4 T;  5IHY A;  3AXJ B;  1HS7 A;  2H88 A;  5HYA A;  5FKY A;  5L2L A;  2LJL A;  2WDV A;  2WY2 A;  3B13 A;  1FJG T;  2V5D A;  1WFD A;  2HPL A;  3I0Q A;  4AQG A;  5KMG P;  5AQJ B;  2R6G F;  3N2K E;  3EDV A;  3AEE A;  2PFV A;  2ODV A;  3KVB A;  2RA1 A;  5KDM C;  4KUM B;  2OLT A;  3IEE A;  2H3R A;  2QRX A;  2UXB T;  4U7Y A;  3EVY A;  2NW9 A;  3K3N A;  3BQK A;  4DV0 T;  4QXB B;  2E2A A;  3SFD A;  5CA0 E;  3CX7 B;  4Q25 A;  1KF6 A;  5FMN A;  3WI3 A;  5ETW A;  2NTY A;  1UX4 A;  1YXR A;  5LBM A;  2BVL A;  2L8K A;  4UEL A;  1JNZ A;  2LT3 A;  4CI2 B;  1D0Z A;  4YJ2 E;  2V6Y B;  3TLS A;  2IW5 B;  4JI1 T;  3H37 A;  3D0T A;  2YDR A;  2E5L T;  2V7M A;  1QLB A;  2LSJ A;  3AAE B;  4HWI B;  2LHN A;  3LK3 B;  4NIQ A;  2HN1 A;  2X9H A;  2KXP B;  2VWA A;  4JI6 T;  4A97 A;  4DVD A;  3KFW X;  2NOX A;  3AE1 A;  5JH7 E;  4YY3 T;  4BJN A;  1NWM X;  3ZC0 A;  4AIS A;  1YKE B;  4CN1 A;  4TNW A;  4KI0 F;  2MOZ A;  4Z91 A;  1E7P A;  3RIU A;  4TWF A;  3P4W A;  4HWH A;  3PUR A;  1IBL T;  2W67 A;  4I0U A;  3MK7 C;  2YDQ A;  3AXJ A;  1UUS A;  4IE0 A;  4H9R C;  4ZI7 E;  3LDQ B;  2OA5 A;  4P09 A;  5FXX A;  5HEG A;  3AE4 A;  1U5P A;  2VQF T;  3RRW A;  2LHR A;  3MJX A;  3CX6 B;  2YIN A;  5LA6 E;  4NXN T;  4QXC B;  1E1H B;  3AA7 B;  3SS1 A;  5JRE A;  5LNK A;  2MYS A;  5JR9 B;  2F4V T;  3IF8 B;  3KV6 A;  1FMV A;  4DBR A;  2CM0 A;  4EV6 A;  1D0Y A;  2Z6E A;  3ESL A;  2H7O A;  4JI5 T;  3U78 A;  4PAG A;  1LKX A;  4ZI3 C;  3ZT6 A;  1YKH B;  1W09 A;  3AVR A;  4DO0 A;  4IE6 A;  5EK3 A;  4HFD A;  2XQA A;  5DQV A;  3LBX B;  1LVK A;  3T1H T;  4X5T A;  1HFA A;  1HNW T;  2FUP A;  2D5U A;  2UXN B;  3AEB A;  4QXH B;  4YTP A;  1T98 A;  2ACZ A;  4KP3 C;  4UXN B;  3P4P A;  4HTE A;  2JQ9 A;  3C50 A;  1BR4 A;  5HXR A;  2W4X A;  3UU5 A;  2VKJ A;  2EHO D;  3CQG B;  2W2U A;  2V7I A;  3ZMU B;  2CA5 A;  3S4U A;  3UQ7 A;  2BS2 A;  5ABF B;  4UR9 A;  3K3Q C;  3FZL B;  3QNU A;  3AAI A;  2C5J A;  3HA4 A;  3C4X A;  5F3J A;  1BR0 A;  1Y01 A;  1YQ4 A;  5KX5 E;  2JJ9 A;  2XHE B;  3JCF A;  5IUX A;  3SFE A;  1YW0 A;  2C5K T;  2DL1 A;  5L3E B;  2RP4 A;  2YEV C;  5FYM A;  5LB7 B;  5HEO A;  3VKH A;  1J5E T;  3A8Y C;  4CI3 B;  1N33 T;  2WZI A;  3VRA A;  5CB4 E;  3NKZ A;  2XQ6 A;  2Q9Q B;  3N9P A;  3N2G E;  4QH4 A;  2LEH A;  3ABV A;  2JMK A;  3FZH B;  4EED A;  4X64 T;  5HEH A;  5JR9 A;  5LJM A;  3RC8 A;  2NW8 A;  5J2U E;  3AA6 B;  3AE9 A;  3RC3 A;  5HCJ A;  5HXS A;  3HKE E;  1CUN A;  1Y64 B;  1M62 A;  5CJ5 A;  2XZE A;  4MHC A;  3E0Z A;  4IDO A;  3RHW A;  5AQL B;  1OED B;  4NUV A;  4TV9 E;  4ZHQ E;  4L9I A;  3ETU A;  3HL6 A;  4GK5 E;  3RIU C;  5JDG A;  4DND A;  4IDQ A;  3K8P C;  4O2B E;  4IDZ A;  4IL9 A;  2DWK A;  2LM9 A;  3FZF B;  2SPC A;  1O3X A;  3LBX A;  4DBQ A;  3QK6 A;  5C8Y E;  2QVA A;  3KDS E;  5AQQ B;  5H6Q B;  2LSG A;  1MIV A;  4DUY T;  2XAG B;  2X9W A;  3B5M A;  5TAO A;  5JDQ A;  1T7S A;  1WRD A;  4UV8 B;  5JVD E;  2ACX A;  1BR2 A;  1UUR A;  2WB5 A;  4CXY A;  3FXD B;  4MFR A;  1JNR A;  1NEN A;  1I94 T;  2XUE A;  2X9X A;  4KHP T;  4E7S A;  2BG9 B;  2XJ7 A;  2N1G A;  5ABF A;  1N34 T;  4CZZ B;  4LFA T;  2HHH T;  4LMK A;  1FIO A;  4EB6 E;  4TUY E;  3AEA A;  4JI7 T;  2QYW A;  2WWU A;  5JTG A;  2JQH A;  5AQU B;  3VHL A;  5C2T A;  3L09 A;  2A72 A;  2UUA T;  2KZ7 B;  4UVC B;  4EAH A;  1QUU A;  4B6X A;  2HN2 A;  4HFV A;  5LMN T;  4Z90 A;  2L3L A;  5JDL A;  5KXJ A;  3U3I A;  3G06 A;  4E7Z A;  2CCQ A;  3H3A A;  4WYV A;  2J62 A;  3ZJ1 A;  4MAL A;  3DP7 A;  2QGS A;  4KBM B;  5LBQ B;  3ZYK A;  3P7I A;  3AA0 B;  2Q9Q A;  2ZM8 A;  4U3C A;  4TX5 A;  4JYA T;  4G63 A;  2KWH A;  2XQ8 A;  4O4L E;  4IST A;  3Q5X A;  4OHF A;  1IAP A;  3ZT5 A;  3RGL A;  5LGT B;  5FXV A;  3TLU A;  3KIN B;  4H9S E;  4EYU A;  1D1A A;  5HXE A;  1OED A;  2XQ7 A;  4O4H E;  4ZXL A;  4DV7 T;  4IDP A;  3QC9 A;  1B7T A;  2WDR A;  4O4I E;  2Y48 B;  4DR2 T;  4DV3 T;  4BAY B;  4C91 A;  2D0T A;  3X1D A;  3W15 B;  2UU9 T;  4EGW A;  1XMQ T;  4DR4 T;  2ZM0 A;  3CQC B;  4JUY A;  2XQ4 A;  4ZS2 A;  3CX8 B;  3O1H A;  5FY0 A;  5F8P A;  2MAW A;  5AQK B;  2V6X A;  4ERR A;  3FBL A;  5HXC A;  4TZ4 C;  4YSX A;  4U2Z A;  3UTK A;  5JR9 C;  1U4Q A;  1VCT A;  2BG9 A;  4IT4 A;  2CBI A;  4PK6 A;  1SUM B;  3PV0 F;  4YLH A;  4IHJ E;  3NBX X;  5L3F B;  5FY7 A;  1MMA A;  3I0O A;  4CI1 B;  5FP3 A;  4DV5 T;  3EHZ A;  1YQ3 A;  4LF5 T;  2J1D G;  3I9W A;  5AQV B;  2CXF A;  5FY1 A;  3I9Y A;  1V9D A;  4IL4 A;  1T72 A;  4CN6 A;  2KLQ A;  3AE3 A;  2J47 A;  1HF8 A;  2H7V C;  2NWB A;  1Z8U A;  1OWA A;  3N9L A;  4WBO A;  3MXZ A;  2CMR A;  4I55 E;  4YTN A;  1KNP A;  4X65 T;  1D1C A;  4I50 E;  5BMV E;  2LE8 A;  3AE2 A;  4OK0 A;  4GKK T;  4HGA A;  5M4Y A;  4PJN A;  4DR1 T;  1EZ3 A;  1S94 A;  5FVK A;  5LHG B;  1KNZ A;  1L0V A;  4HFH A;  3ZKR A;  2XTL A;  4H9O C;  4DV6 T;  2W0G A;  3NWI A;  2Y8D A;  2MTQ A;  3CPZ A;  4AKR B;  2A3D A;  4G2A A;  3F57 A;  2LRL A;  3E22 E;  1XNQ T;  2W62 A;  3BK9 A;  5J0Z A;  2BDE A;  4A98 A;  3PUW F;  4TN7 B;  3P50 A;  3UUL A;  4DR7 T;  2X9Y A;  3P4Q A;  2JQK A;  1OED E;  3SOL A;  3QB5 K;  4CXX A;  4DV1 T;  4HFB A;  4ZI2 C;  3C51 A;  3KBT A;  2V7J A;  3OPC A;  5A1L A;  1UGO A;  4YTM A;  3V5S A;  3ZCI A;  1BR1 A;  4DV2 T;  2WU5 A;  2Q9Q C;  3FZK B;  4IE5 A;  1FEW A;  1M7K A;  1KFY A;  2X66 A;  4FJO A;  4OFZ A;  5FVL A;  1N36 T;  4CQI A;  2LSI A;  3GN5 B;  1DU2 A;  2AXD S;  2BG9 E;  1ZEE A;  2CLY B;  4HWD A;  3CK6 A;  3V5U A;  3NRX A;  2BKP A;  2V1D B;  5AQF B;  4X66 T;  2YOE A;  2DLR A;  2WSS V;  2XM1 A;  5LP6 E;  4HFC A;  4UV9 B;  4ASK A;  4EEB A;  3RYH E;  2FJE A;  3UQ4 A;  1HG5 A;  3EDU A;  4AI6 A;  5AQI B;  1IZN B;  4GK0 E;  3P8C D;  4O8S A;  4P1N A;  4PJM A;  3AE7 A;  3PUA A;  3LK4 2;  2QA7 A;  3Q2M A;  3PJA A;  3J7Y q;  4TNV A;  3UU3 A;  2K5B B;  1Z0P A;  5DJQ C;  3JAE A;  3H3M A;  4DR3 T;  1XMO T;  1KNR A;  2BG9 C;  1XDP A;  5AQM B;  4UEM A;  3VU7 H;  2VL8 A;  5HWX A;  1HTJ F;  2IC9 A;  1WR0 A;  2LSK A;  3KVA A;  2YDS A;  2FJD A;  2WAU A;  3QB5 A;  2EHO B;  3UUN A;  4WW0 A;  3SRZ A;  4LML A;  3PUZ F;  4LF6 T;  3C64 A;  3N5L A;  3AE6 A;  4L5G A;  3MAC A;  2DWG A;  1WCR A;  4H63 H;  3ONJ A;  3OYZ A;  3ZSS A;  3CML A;  4H9N C;  3CVR A;  3OYX A;  2NR4 A;  4GYR A;  4PFP A;  4WBN E;  3QOF A;  1N32 T;  5LGU B;  5L4H A;  3N9M A;  2X0L B;  2KSR A;  4XAX B;  3RRC A;  4AQF A;  3JC6 C;  5L3C B;  1VRB A;  5JDM A;  3SWH A;  4CXW A;  3GN5 A;  4I4T E;  2CE7 A;  4JLE A;  3QUJ A;  3ZMZ B;  2BBJ A;  1J5W A;  5L47 A;  5JDH A;  1XNR T;  3GWH A;  5AQT B;  3CWZ B;  2UXC T;  3PUQ A;  3HKD E;  3R6N A;  1E2A A;  4HWC A;  3TKL B;  2CHN A;  4QX7 B;  3UFG A;  3Q5E A;  2VKH A;  1ZOY A;  4AKH A;  1HG2 A;  2ES0 A;  4PK5 A;  2NTX A;  1J1J A;  4EOZ B;  3MZK B;  3ZEF B;  4BJM A;  1YD8 G;  4NXM T;  2WCA A;  5AQO B;  3RQU A;  2IC6 A;  1ZP0 A;  1IBM T;  2WDQ A;  1UK5 A;  3OKQ A;  2I59 A;  2VQE T;  4ILU A;  2YN6 A;  4HFI A;  3VKG A;  4YHJ A;  4YSY A;  1CHU A;  3AAA B;  2D9D A;  4JEH B;  3K1S A;  1ZV4 X;  2WZH A;  1ZHC A;  2EHO A;  4N78 D;  4IRE A;  3P4R A;  4YSZ A;  4JI2 T;  3FXE B;  3OVU A;  2UUB T;  3ZPO A;  5AQG B;  5AQN B;  2K24 A;  5LGN B;  3ZST A;  3HR0 A;  3OJA A;  3UT5 E;  2YU2 A;  3RI5 A;  2IIU A;  2WM9 A;  4U74 A;  2LKG A;  1MNE A;  3WAK A;  2P9B A;  5ABE A;  2JPF A;  3JAF A;  3ONL C;  3PU8 A;  4FI5 A;  4ZI3 D;  4IE7 A;  5FXZ A;  3F2E A;  1SHZ C;  3M3Z B;  5FL0 A;  2K48 A;  4K0K T;  5LG4 A;  5DAB A;  4Z8X A;  3EAB A;  5AQR B;  4BA9 A;  2G0U A;  3FB2 A;  4M1P A;  4IIJ E;  2ODU A;  4MLK A;  4ZZC A;  4GKJ T;  5GON E;  2WWV A;  5L3G B;  3O1J A;  3PUX F;  2V26 A;  4LF4 T;  2M6B A;  4WZX A;  2IDO B;  2LOP A;  4ZS3 A;  3LJC A;  5ADX L;  5FNV E;  4U31 A;  4X1K E;  2KT9 A;  3UFE A;  2BBH A;  3JAD A;  3O1I A;  4QH1 A;  2RPA A;  2IHR 1;  3ZN1 B; 
#chains in the Genus database with same CATH homology
 5LMN T;  3T1Y T;  4DV1 T;  3T1H T;  1HR0 T;  1FJG T;  1IBK T;  1HNW T;  4DR3 T;  1XMO T;  1HNX T;  2UXC T;  1IBL T;  4DR5 T;  4DV5 T;  4LF5 T;  4DR6 T;  4X62 T;  3OTO T;  4JYA T;  4DV2 T;  4K0K T;  4YHH T;  2UXB T;  4LF7 T;  4DV0 T;  4LF8 T;  2VQF T;  4NXN T;  5IWA T;  4DUY T;  4GKJ T;  4JI8 T;  4LF6 T;  1N36 T;  4B3R T;  4DV7 T;  4LFC T;  4LF4 T;  2ZM6 T;  4X65 T;  2F4V T;  4NXM T;  4GKK T;  1IBM T;  4DR2 T;  4DR1 T;  1I94 T;  4B3T T;  4DV3 T;  5BR8 T;  4LF9 T;  4KHP T;  4OX9 T;  2VQE T;  4JV5 T;  2UU9 T;  4X66 T;  2UUC T;  5LMU T;  4JI1 T;  1XMQ T;  1J5E T;  4DR4 T;  1N32 T;  4DV6 T;  1N33 T;  1N34 T;  2UXD T;  4LFA T;  2HHH T;  4JI3 T;  4JI5 T;  2E5L T;  4DUZ T;  4JI4 T;  4JI0 T;  4JI7 T;  4DV4 T;  4JI2 T;  2UUB T;  1XNQ T;  4JI6 T;  4X64 T;  1HNZ T;  4LFB T;  4B3S T;  4AQY T;  2UUA T;  4DR7 T;  4YY3 T;  1XNR T;  4B3M T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...