4B3TT

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3tT00
3OTOT 4B3RT 1J5ET 2F4VT 4YHHT 2VQET 4LFCT 5BR8T 4DR4T 2UXCT 4X65T 4DV6T 4JI6T 4DV7T 4YY3T 1N32T 1IBLT 4DV4T 4OX9T 1XNQT 2VQFT 4DUZT 4LF8T 4GKJT 4JYAT 3T1YT 4JI5T 1XNRT 5IWAT 4DR6T 1N34T 2UXDT 4KHPT 4DV1T 5LMUT 4LF4T 4DV0T 4LF6T 4NXNT 2UU9T 4LFAT 2HHHT 4X66T 5LMNT 1XMQT 4LF5T 4B3MT 4K0KT 4DUYT 4GKKT 1HNWT 4LF7T 4JV5T 2UUCT 3T1HT 4DR7T 4JI8T 4X64T 1IBKT 2E5LT 1XMOT 4JI4T 4JI0T 4LFBT 4DR1T 4DR2T 1N33T 4JI2T 4X62T 4JI1T 4DR3T 2UXBT 4AQYT 4DR5T 4JI3T 1HR0T 2UUAT 2ZM6T 4JI7T 4B3TT 1FJGT 1HNZT 1N36T 4DV5T 4B3ST 1IBMT 1HNXT 1I94T 4NXMT 4DV2T 2UUBT 4LF9T 4DV3T
chains in the Genus database with same CATH superfamily
1WCRA 1BR2A 2XZEA 3Q5XA 2CRBA 4EZ4A 4ILCA 1W9RA 2LM9A 2D2SA 2JMKA 5HXCA 2LSYA 1CHUA 1T98A 2CBJA 3PUAA 2VQFT 3I0OA 2NTYA 1UGOA 3AEGA 4LF8T 4N78D 2UXNB 2ZLYA 2EHOD 2N2NA 2VB6A 2Z6EA 4PFOA 5AQFB 3ZCIA 4IE5A 2HPJA 5FY7A 2NW7A 1IJ5A 5HCJA 5AQMB 5EZYE 5LB7B 2H7OA 2ZMAA 4WZXA 2BDEA 2V6XA 2JQHA 4B6XA 5LG3A 3J7Yq 4HKAA 1M62A 1VCSA 4HFEA 2DWKA 2UXBT 3PUZF 2X0YA 3AE1A 2CXFA 3A8YC 2HPLA 4WBOA 3FZLB 2C5IT 5LJMA 1QUUA 4NXMT 3F57A 4YT0A 1L0VA 2HH7A 3UU4A 4KP3C 2F4VT 2LOSA 3ZN0B 4HFDA 3ZMSB 3AEEA 5FMNA 1SA0E 2CE7A 2XAHB 2K5BB 3N2OA 1MIWA 2W67A 2ODUA 2NW9A 5AQSB 4HWHA 2WB5A 5CJ5A 3PUGA 5AQNB 4IL4A 4DMVA 3UQ7A 1G8XA 3CQXC 2WU5A 4AKLA 4LF5T 4U3CA 3DP7A 3KV6A 4YTPA 2EHOB 5AQIB 4TZ4C 2XTLA 4YSYA 2A2FX 3UUBA 5CA0E 4EEDA 1WFDA 4CXWA 2L3LA 2E9XD 3SWHA 2CA5A 4AKHA 1ZP0A 5FY0A 1WYBA 4K0UA 4JEUB 2MTQA 3IBPA 2XQ7A 4JI3T 2WU2A 3CX6B 2N9DA 3ZPOA 3V5UA 4ZEYA 2CWYA 1HNXT 2H88A 3PJAA 3MA9A 1I6ZA 4H63V 5IHYA 3EVYA 2X9YA 2BS2A 4B3RT 2JMHA 1AJ3A 4JUYA 4AIUA 4DO0A 2B1EA 4YHHT 4MALA 4CXYA 1D1AA 2K24A 1S35A 5LG4A 5KDMC 2DWGA 4YTMA 2LSIA 3OBVE 2X66A 5DABA 3T1YT 3UUNA 4YTNA 3N5LA 4NPPA 4P0BA 4EXTA 2BBJA 3ZMZB 3KV4A 4QH1A 5GONE 1YKEB 2X68A 4CN1A 4PJLA 2E2AA 1W0AA 2DL1A 3AECA 5EK3A 4UV9B 2X67A 4DUYT 1R8IA 5LGUB 5JDMA 3U3IA 3GMIA 2LHNA 2XQ4A 3L09A 4X64T 4IL9A 4KBMB 3QB5K 3BQIA 3K8PC 2XQ3A 4X62T 4JI1T 3RRWA 3P8CD 5C8YE 1OEDB 1NEKA 5FXXA 4AQGA 1U5PA 2E9XB 4A98A 3ONXA 4OHFA 4ILAA 4A97A 4EGWA 3RPUA 3E22E 2FJDA 1WYCA 2YINA 4U31A 2VL8A 3O4XE 2I0MA 4EOZB 5JDGA 2LJLA 1WR6A 5HWYA 4QH4A 2LRKA 2QVAA 3VR9A 2XASB 1ZOYA 3FZMB 4YSXA 4UR9A 4EYYR 3N9NA 4MBQA 4KHZF 5JDQA 5HXHA 3W15B 2V6YA 2W00A 4M1PA 2LEHA 4GK5E 4EIWA 5AQHB 4IDOA 5A1LA 3C51A 5LGTB 4GKJT 2I6HA 2Q9QA 4DNDA 2YN6A 3ZC0A 3CQCB 5L2LA 1N34T 3IHRA 3AE7A 3AA7B 4ZHQE 5F3JA 3PJAJ 2XAQB 3ZMUB 3CIRA 3ZJ1A 2W61A 2RA1A 4TWFA 3QUJA 2WS3A 2XQYA 2HHHT 3C4WA 2NOXA 1YQ3A 3ZCJA 4X5TA 1GQEA 4X1IE 1X9BA 1E7PA 2CEAA 3ZMTB 2NR4A 4ZI2C 2FJAA 3UFGA 3UU8A 2BVMA 2NW8A 4XZCA 5HEHA 3AXJB 2FUPA 4JEHB 2W0GA 2N1GA 1VCTA 4KI0F 2BZBA 2RPAA 2KMFA 3RH3A 3P4SA 3DJBA 4EYUA 5HEJA 4WYVA 4PK6A 4HFCA 1SUMB 5L3GB 3M65A 5AQTB 4PJNA 5KMGP 3X1DA 2V7MA 2W4XA 2V7KA 1HS7A 2V7JA 2X9WA 3AEAA 5JQGE 3H3AA 4JI6T 4ZI3D 4YSZA 4OX9T 4AKRB 1BR0A 2BG9C 3ZT5A 3K1SA 1OEDC 4GOUA 2IMLA 4LF4T 2WQYA 2QYWA 5BMVE 2D0TA 4E7SA 3AE6A 3G06A 3P4QA 4LMJA 5LHGB 4OYJA 3EABA 3B57A 3JC6C 2OV9A 3CX8B 4HEAA 4O4HE 1HTJF 3N2KE 2LKGA 4P1NA 5HEUA 3PURA 3PUXF 1XMOT 1V9DA 3M3ZB 3PV0F 4JI2T 3VHLA 2C5JA 3Q2MA 3EAMA 2FBWA 4PW8A 3AE4A 3ETVA 3BQLA 1UCUA 4IIJE 2XUEA 1KNPA 1I94T 3S4UA 4L5GA 2DHRA 2OLTA 4ERRA 2DLRA 4MHCA 3U78A 5HAXA 5ABFB 3LBXB 2H3RA 3Q5DA 4DV4T 1MIYA 3SRZA 3AEBA 5DQVA 3P4RA 5L3FB 2V7LA 4ILBA 5FVKA 4DR6T 2V7IA 1US7B 2CHNA 3Q5WA 5FXVA 3KFWX 4PJJA 3TLVA 5EK2A 5JDNA 3MKDA 5HXEA 4EZHA 4NXNT 2ODVA 2WSSV 4Z90A 5LMNT 3AVRA 5LCYA 2YKSA 2WDRA 1D0XA 3MJXA 2QRXA 4A56A 3EHZA 3P4PA 4CXXA 4DR7T 3FHNA 3HR0A 3AE5A 5JDHA 2JJ9A 5JRCA 2LLYA 3VR8A 4FJOA 4IE6A 2UXXB 3MXZA 4ASKA 4AKGA 2CPTA 2IDOB 2WP9A 3UTKA 3L8RA 4IREA 1NWMX 2Y6XA 4KUMB 4L0RA 1N36T 2XAJB 3NVOA 2LE8A 2MYSA 3CX7B 1WR0A 4HE8A 2SPCA 3HKCE 3CVRA 4O2AE 5DQWA 5LP6E 1HX8A 4EV6A 2BKPA 4DR4T 3AAIA 2LSKA 4BJNA 3MZKB 2VVSA 2WAUA 3T8OA 5AFUL 2NWBA 3C4ZA 1MIVA 3UQ4A 3KV5A 3IEEA 4DV1T 4IDZA 4CZZB 4U7IA 2XPKA 4IDNA 5LNKA 2YDQA 5L4EA 2OA5A 3O1HA 3ANWB 4NUVA 3RRCA 4PJMA 3ZYLA 4QXHB 2IUBA 5CB4E 5ETWA 4DIDB 2VKOA 3AVSA 3C4XA 2XY8B 1MNDA 4I0UA 4P09A 4AQYT 5JH7E 4AQFC 5JDFA 5LA6E 1H7CA 3VKGA 2IC9A 1OXZA 2G0UA 2K48A 4O2BE 2AXDS 1J5WA 4C90A 1MMNA 4UF0B 2WWVA 4HN9A 4X1KE 1J5ET 1HG2A 2C5KT 4O4JE 4UV8B 4IE4A 2VQET 3IA3A 2LSJA 4TWDA 4DV6T 3QC9A 2J4GA 5H6QB 4CI2B 4O8SA 4HFIA 2A9UA 2H7VC 3F2EA 5IWAT 3N2GE 2UXDT 2KSRA 4ZXLA 2Q9QD 3RIUC 3TLSA 3LK2B 4LFAT 3I9WA 3UUMA 3FBLA 4G63A 2K3WA 5FP3A 1HX1B 4CN4A 1UUSA 3UU6A 2CMRA 1HNWT 4CI3B 3N9QA 3NWIA 4TV9E 4JV5T 1ZHCA 3ZT7A 1HF8A 1IBKT 3QNUA 3ZJ2A 2E5LT 4JI4T 3E0ZA 1ZEEA 5EK4A 2WWUA 4DR1T 4AXPA 2JQ9A 4LMLA 4U33A 2J62A 4DR3T 1CUNA 2VASA 2I59A 2D0UA 4QXBB 4HGAA 3FBZA 3TLTA 3EDVA 5JR9B 5CFBA 5FKYA 4B3TT 4B3ST 5E0OA 1BR4A 1IAPA 3HKEE 4TWHA 4BJMA 5F8PA 5AQKB 5FNVE 4X1YE 4MFRA 3P4WA 2CM0A 3PE0A 2CLYB 2BG9A 3KVBA 4X20E 1XNQT 4CQIA 3OYXA 3IF8B 2JQKA 1OEDA 4JI5T 2WM9A 3FXDB 2EHOC 5JVDE 2V6YB 4QWNB 2E8IA 4AKIA 4ZS2A 2LOPA 4PK4A 1MMAA 4WBNE 3EI0A 4TNVA 5FXZA 4U72A 3N9LA 4HWFA 3AAAB 3A7MA 3QOFA 1XWMA 2IW5B 3LSVA 2A72A 5LJNA 2XQ6A 5M4YA 4ZS3A 4C91A 4UXNB 2GK9A 4L9IA 2YOEA 4DR2T 4I4TE 5FVLA 4V1Av 3NRXA 4JLEA 3KINB 5C2TA 4ILUA 4DR5T 3RC3A 4ZOLE 1D1BA 4OFZA 3FZKB 2ACZA 5HCMA 3QK6A 4DV5T 2DNXA 2BVLA 3Q9DA 3FZFB 2VWAA 2V5DA 3HKDE 4DVDA 2V8SV 3ONJA 3RKGA 2YEVC 4BA9A 2D9DA 4U2YA 3O9XA 3AB3B 3GA8A 4IHJE 1IBLT 1FEWA 4NUUA 2CXDA 5LHHB 3VRAA 4DUZT 5IUXA 4H9RC 1UURA 3RI5A 4COFA 1JNZA 3CQGB 2BKNA 2XAGB 2KZ7B 3BK9A 4QKNA 4TN7B 5JR9C 2JRKA 1YXRA 4UELA 3AA1B 5F5WA 3JADA 3NRYA 4PFPA 2YDRA 1W09A 3NBXX 5AQUB 4UEMA 3HA4A 5KX5E 4HFVA 4I43B 5FY1A 4KX6A 2E9XC 3HKBE 4LMKA 3E08A 3FZHB 4U74A 2WY2A 3GN5B 4JI0T 3VU7H 3OYZA 2DI4A 3OPCA 4ZI7E 3AE8A 4CI1B 5L3DB 3NZQA 5ADXL 2KLQA 4Q25A 3LJCA 3VKHA 2XHEB 5LYJE 1YQ4A 5L47A 1YW0A 4Z91A 1KF6A 2D5UA 3I0QA 4A5XA 1EZ3A 1FJGT 3PUSA 2YU2A 4ZZBA 3A5XA 3OTOT 4PAGA 1T7SA 3RYCE 3EUHA 5ABHA 3C50A 5TAOA 5BR8T 2UXCT 4X65T 5HEGA 5AQGB 2LM2A 3CKDA 2AE9A 3AA6B 4HFBA 4HWIB 2PFVA 2CXLA 2ZM0A 4AISA 2MBGA 4ANJA 4QH5A 4H9PC 4H9QC 2DCFA 4DV0T 3ESLA 1VRBA 2UU9T 2XQAA 5DJQC 3AA0B 2LRLA 1FIOA 3ZLIA 1MMGA 3C98B 4B3MT 4K0KT 2VKHA 2YK0A 3P50A 3PUWF 3LK42 4ISSA 2KWHA 1LVKA 2KT9A 2XAFB 4UIGA 3ZEFB 2K9AA 2XM2A 4TV8E 1UX4A 5KXJA 3PUYF 3V5SA 3ZC1A 4YJ2E 4OYKA 2FJBA 2UUAT 4AQFA 5JRCB 3ZN1B 3F31A 2XSBA 1IBMT 5JTGA 1YD8G 2A3DA 1OWAA 5J1GA 2W66A 3OJAA 3RYHE 1LRZA 1XZYA 2IAKA 2WDQA 2L9QA 4QX8B 5AQLB 3RYIE 1WRDA 3TKLB 5LBQB 3AAEB 5LHIB 1QSDA 4DV7T 2LHRA 1N32T 4IDPA 4HWCA 1WLXA 2BBHA 1E2AA 5AQOB 2KWIB 4I55E 1JNRA 3ZYMA 2MPKA 2C0SA 4EAHA 3JAEA 4KHPT 1T8BA 3RIUA 3RGLA 3CPZA 3K3NA 3K3QC 1Y64B 1XDPA 4LF6T 5L4HA 3RIFA 3SOLA 2QA7A 1IJ6A 2VURA 2ZM8A 4O4IE 3T1HT 4U7YA 2XQ5A 3RQUA 5J2UE 1MMDA 5FXWA 4ZI2D 4XAXB 5HXRA 1U4QA 3CK6A 1G73A 3RC8A 2WMOA 3AE2A 3RKOA 3UUXB 3ZYKA 1NENA 1YKHB 2XSAA 4TUYE 1S94A 3KV9A 5LBMA 4DMWA 4KMCA 1HG5A 4GYSA 2LSGA 1D0YA 3RIAA 1D1CA 3AEFA 4DV3T 4IE7A 3ANWA 5H6RB 2YU1A 4IGUA 3ZKRA 3KBUA 4ZI3C 3LK3B 4YY3T 2X9XA 3AEDA 4ISTA 3ABVA 4H9SE 3UU3A 5IYZE 5AQRB 2XQ8A 2NTXA 3WI3A 2IIUA 2M67A 2J47A 2EHOA 2KNDA 4GYRA 2L8KA 4H63H 2WZIA 2PG8A 1FMWA 1SE7A 3SFEA 3RLFF 4X66T 2R6GF 5CGMA 3BQKA 4TNWA 4YLHA 4TX5A 3ZMVB 4GKKT 4UF0A 3R6NA 3JC6D 1VOMA 3B5MA 2UUCT 4XBFB 4JI8T 3UT5E 1DU2A 4LFBT 2FJEA 2PTFA 2VVNA 4OK0A 3PDYA 4FI5A 4HTEA 5AQPB 4GIWA 3PTRB 3RQWA 2PBIA 2XQ9A 1UK5A 3H37A 1Y01A 2IHR1 3K3OA 1KNZA 4QX7B 5FL1A 3L39A 4EB6E 2P9BA 3LDQB 2KXPB 3PU8A 2J1DG 2PJQA 2M6BA 3SS1A 2V1DB 3MK7C 5LOVE 4UVBB 1ZKEA 4U2ZA 3LG7A 2VL0A 2ZM2A 1J1JA 1D0ZA 5FL0A 2E5VA 4JBWF 3HI2A 3ZSSA 1XNRT 4DBRA 2MOZA 2NP9A 3FXEB 3D0TA 3EDUA 5LMUT 5JR9A 2BG9B 2ES0A 2HN1A 2X51A 1SHZC 3SFDA 1KNRA 3ONLC 4LF7T 5HWXA 2WBLA 3NKZA 1NAFA 2E9XA 3KDSE 5J2TE 2IC6A 3RF1A 2W2UA 4MLKA 2X0HA 2CCQA 3I9YA 4F6RC 4J2CA 3UULA 3AE3A 3TLWA 4H9NC 1B7TA 3JAFA 3KBTA 4UVCB 2Q9QB 4P0AA 3JCFA 3PUQA 2M6IA 3NZPA 3WAJA 4PK5A 1HR0T 2CBIA 4NIQA 1KK7A 3RYFE 3AE9A 4E7ZA 2UUBT 2WMNA 4CN6A 4IDQA 2BG9E 2KINB 4YFSA 2LKHA 5AQQB 2ACXA 4I50E 1OEDE 1MNEA 1W0BA 4LFCT 4O4LE 4HFHA 3MACA 3CMLA 3R84B 2MAWA 4G2AA 2W63A 1XDOA 1LVFA 2JIWA 3KVAA 4UVAB 4BAYB 1Z8UA 5LXTE 4YXDA 3TLUA 3O1IA 3RX6A 5JREA 5LGNB 2B76A 2JQQA 4H9OC 2BS4A 2X0LB 3FB2A 3O1JA 5L3EB 3AXJA 3P7IA 3C64A 4AI6A 5AQJB 2BS3A 5AQVB 3UU5A 3PU3A 2H89A 2VKDA 3L3PA 4EEBA 5HXSA 4Z8XA 4YHJA 1E1HB 1FMVA 5FYMA 2ZM6T 3GWHA 2VK9A 3LFMA 3I1AA 1O3XA 1IZNB 4DV2T 4F8HA 3QB5A 4LF9T 2LT3A 1UX5A 2CLYC 4DBQA 2HN2A 3DTOA 5J0ZA 4YJ3E 2YDSA 4QHOA 2JPFA 1KEYA 3ZSTA 2Y48B 3GN5A 3N9PA 4PNIA 4ADZA 3PUVF 1LKXA 4HWDA 4JYAT 2CWOA 3N9MA 2XM1A 2CHOA 2Q9QC 4WW0A 5CA1E 4GK0E 5L3BB 3WAKA 4QXCB 2V26A 1BR1A 3ETUA 1XMQT 2BKOA 2XJ7A 5L3CB 1QLBA 5ABGA 2X9HA 4IT4A 2Y8DA 4ZZCA 1X79A 2WCAA 1KFYA 2W62A 5HYAA 1N33T 3Q5EA 5JDLA 3B13A 4WNKA 4IE0A 3J9X1 3H3MA 2RP4A 3VRBA 3ZT6A 5HEOA 4JI7T 3HL6A 2VKJA 5C3JA 3CWZB 1Z0PA 5ABFA 3LBXA 3OVUA 2QGSA 3OKQA 1HNZT 1M7KA 1HCIA 2WZHA 3RHWA 3N9OA 1HFAA 2V5CA 2WDVA 3UFEA 5ABEA 1ZV4X 1T72A
chains in the Genus database with same CATH topology
3OTOT 4B3RT 1J5ET 2F4VT 4YHHT 2VQET 4LFCT 5BR8T 4DR4T 2UXCT 4X65T 4DV6T 4JI6T 4DV7T 4YY3T 1N32T 1IBLT 4DV4T 4OX9T 1XNQT 2VQFT 4DUZT 4LF8T 4GKJT 4JYAT 3T1YT 4JI5T 1XNRT 5IWAT 4DR6T 1N34T 2UXDT 4KHPT 4DV1T 5LMUT 4LF4T 4DV0T 4LF6T 4NXNT 2UU9T 4LFAT 2HHHT 4X66T 5LMNT 1XMQT 4LF5T 4B3MT 4K0KT 4DUYT 4GKKT 1HNWT 4LF7T 4JV5T 2UUCT 3T1HT 4DR7T 4JI8T 4X64T 1IBKT 2E5LT 1XMOT 4JI4T 4JI0T 4LFBT 4DR1T 4DR2T 1N33T 4JI2T 4X62T 4JI1T 4DR3T 2UXBT 4AQYT 4DR5T 4JI3T 1HR0T 2UUAT 2ZM6T 4JI7T 4B3TT 1FJGT 1HNZT 1N36T 4DV5T 4B3ST 1IBMT 1HNXT 1I94T 4NXMT 4DV2T 2UUBT 4LF9T 4DV3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO T;  4B3R T;  1J5E T;  2F4V T;  4YHH T;  2VQE T;  4LFC T;  5BR8 T;  4DR4 T;  2UXC T;  4X65 T;  4DV6 T;  4JI6 T;  4DV7 T;  4YY3 T;  1N32 T;  1IBL T;  4DV4 T;  4OX9 T;  1XNQ T;  2VQF T;  4DUZ T;  4LF8 T;  4GKJ T;  4JYA T;  3T1Y T;  4JI5 T;  1XNR T;  5IWA T;  4DR6 T;  1N34 T;  2UXD T;  4KHP T;  4DV1 T;  5LMU T;  4LF4 T;  4DV0 T;  4LF6 T;  4NXN T;  2UU9 T;  4LFA T;  2HHH T;  4X66 T;  5LMN T;  1XMQ T;  4LF5 T;  4B3M T;  4K0K T;  4DUY T;  4GKK T;  1HNW T;  4LF7 T;  4JV5 T;  2UUC T;  3T1H T;  4DR7 T;  4JI8 T;  4X64 T;  1IBK T;  2E5L T;  1XMO T;  4JI4 T;  4JI0 T;  4LFB T;  4DR1 T;  4DR2 T;  1N33 T;  4JI2 T;  4X62 T;  4JI1 T;  4DR3 T;  2UXB T;  4AQY T;  4DR5 T;  4JI3 T;  1HR0 T;  2UUA T;  2ZM6 T;  4JI7 T;  4B3T T;  1FJG T;  1HNZ T;  1N36 T;  4DV5 T;  4B3S T;  1IBM T;  1HNX T;  1I94 T;  4NXM T;  4DV2 T;  2UUB T;  4LF9 T;  4DV3 T; 
#chains in the Genus database with same CATH topology
 1WCR A;  1BR2 A;  2XZE A;  3Q5X A;  2CRB A;  4EZ4 A;  4ILC A;  1W9R A;  2LM9 A;  2D2S A;  2JMK A;  5HXC A;  2LSY A;  1CHU A;  1T98 A;  2CBJ A;  3PUA A;  2VQF T;  3I0O A;  2NTY A;  1UGO A;  3AEG A;  4LF8 T;  4N78 D;  2UXN B;  2ZLY A;  2EHO D;  2N2N A;  2VB6 A;  2Z6E A;  4PFO A;  5AQF B;  3ZCI A;  4IE5 A;  2HPJ A;  5FY7 A;  2NW7 A;  1IJ5 A;  5HCJ A;  5AQM B;  5EZY E;  5LB7 B;  2H7O A;  2ZMA A;  4WZX A;  2BDE A;  2V6X A;  2JQH A;  4B6X A;  5LG3 A;  3J7Y q;  4HKA A;  1M62 A;  1VCS A;  4HFE A;  2DWK A;  2UXB T;  3PUZ F;  2X0Y A;  3AE1 A;  2CXF A;  3A8Y C;  2HPL A;  4WBO A;  3FZL B;  2C5I T;  5LJM A;  1QUU A;  4NXM T;  3F57 A;  4YT0 A;  1L0V A;  2HH7 A;  3UU4 A;  4KP3 C;  2F4V T;  2LOS A;  3ZN0 B;  4HFD A;  3ZMS B;  3AEE A;  5FMN A;  1SA0 E;  2CE7 A;  2XAH B;  2K5B B;  3N2O A;  1MIW A;  2W67 A;  2ODU A;  2NW9 A;  5AQS B;  4HWH A;  2WB5 A;  5CJ5 A;  3PUG A;  5AQN B;  4IL4 A;  4DMV A;  3UQ7 A;  1G8X A;  3CQX C;  2WU5 A;  4AKL A;  4LF5 T;  4U3C A;  3DP7 A;  3KV6 A;  4YTP A;  2EHO B;  5AQI B;  4TZ4 C;  2XTL A;  4YSY A;  2A2F X;  3UUB A;  5CA0 E;  4EED A;  1WFD A;  4CXW A;  2L3L A;  2E9X D;  3SWH A;  2CA5 A;  4AKH A;  1ZP0 A;  5FY0 A;  1WYB A;  4K0U A;  4JEU B;  2MTQ A;  3IBP A;  2XQ7 A;  4JI3 T;  2WU2 A;  3CX6 B;  2N9D A;  3ZPO A;  3V5U A;  4ZEY A;  2CWY A;  1HNX T;  2H88 A;  3PJA A;  3MA9 A;  1I6Z A;  4H63 V;  5IHY A;  3EVY A;  2X9Y A;  2BS2 A;  4B3R T;  2JMH A;  1AJ3 A;  4JUY A;  4AIU A;  4DO0 A;  2B1E A;  4YHH T;  4MAL A;  4CXY A;  1D1A A;  2K24 A;  1S35 A;  5LG4 A;  5KDM C;  2DWG A;  4YTM A;  2LSI A;  3OBV E;  2X66 A;  5DAB A;  3T1Y T;  3UUN A;  4YTN A;  3N5L A;  4NPP A;  4P0B A;  4EXT A;  2BBJ A;  3ZMZ B;  3KV4 A;  4QH1 A;  5GON E;  1YKE B;  2X68 A;  4CN1 A;  4PJL A;  2E2A A;  1W0A A;  2DL1 A;  3AEC A;  5EK3 A;  4UV9 B;  2X67 A;  4DUY T;  1R8I A;  5LGU B;  5JDM A;  3U3I A;  3GMI A;  2LHN A;  2XQ4 A;  3L09 A;  4X64 T;  4IL9 A;  4KBM B;  3QB5 K;  3BQI A;  3K8P C;  2XQ3 A;  4X62 T;  4JI1 T;  3RRW A;  3P8C D;  5C8Y E;  1OED B;  1NEK A;  5FXX A;  4AQG A;  1U5P A;  2E9X B;  4A98 A;  3ONX A;  4OHF A;  4ILA A;  4A97 A;  4EGW A;  3RPU A;  3E22 E;  2FJD A;  1WYC A;  2YIN A;  4U31 A;  2VL8 A;  3O4X E;  2I0M A;  4EOZ B;  5JDG A;  2LJL A;  1WR6 A;  5HWY A;  4QH4 A;  2LRK A;  2QVA A;  3VR9 A;  2XAS B;  1ZOY A;  3FZM B;  4YSX A;  4UR9 A;  4EYY R;  3N9N A;  4MBQ A;  4KHZ F;  5JDQ A;  5HXH A;  3W15 B;  2V6Y A;  2W00 A;  4M1P A;  2LEH A;  4GK5 E;  4EIW A;  5AQH B;  4IDO A;  5A1L A;  3C51 A;  5LGT B;  4GKJ T;  2I6H A;  2Q9Q A;  4DND A;  2YN6 A;  3ZC0 A;  3CQC B;  5L2L A;  1N34 T;  3IHR A;  3AE7 A;  3AA7 B;  4ZHQ E;  5F3J A;  3PJA J;  2XAQ B;  3ZMU B;  3CIR A;  3ZJ1 A;  2W61 A;  2RA1 A;  4TWF A;  3QUJ A;  2WS3 A;  2XQY A;  2HHH T;  3C4W A;  2NOX A;  1YQ3 A;  3ZCJ A;  4X5T A;  1GQE A;  4X1I E;  1X9B A;  1E7P A;  2CEA A;  3ZMT B;  2NR4 A;  4ZI2 C;  2FJA A;  3UFG A;  3UU8 A;  2BVM A;  2NW8 A;  4XZC A;  5HEH A;  3AXJ B;  2FUP A;  4JEH B;  2W0G A;  2N1G A;  1VCT A;  4KI0 F;  2BZB A;  2RPA A;  2KMF A;  3RH3 A;  3P4S A;  3DJB A;  4EYU A;  5HEJ A;  4WYV A;  4PK6 A;  4HFC A;  1SUM B;  5L3G B;  3M65 A;  5AQT B;  4PJN A;  5KMG P;  3X1D A;  2V7M A;  2W4X A;  2V7K A;  1HS7 A;  2V7J A;  2X9W A;  3AEA A;  5JQG E;  3H3A A;  4JI6 T;  4ZI3 D;  4YSZ A;  4OX9 T;  4AKR B;  1BR0 A;  2BG9 C;  3ZT5 A;  3K1S A;  1OED C;  4GOU A;  2IML A;  4LF4 T;  2WQY A;  2QYW A;  5BMV E;  2D0T A;  4E7S A;  3AE6 A;  3G06 A;  3P4Q A;  4LMJ A;  5LHG B;  4OYJ A;  3EAB A;  3B57 A;  3JC6 C;  2OV9 A;  3CX8 B;  4HEA A;  4O4H E;  1HTJ F;  3N2K E;  2LKG A;  4P1N A;  5HEU A;  3PUR A;  3PUX F;  1XMO T;  1V9D A;  3M3Z B;  3PV0 F;  4JI2 T;  3VHL A;  2C5J A;  3Q2M A;  3EAM A;  2FBW A;  4PW8 A;  3AE4 A;  3ETV A;  3BQL A;  1UCU A;  4IIJ E;  2XUE A;  1KNP A;  1I94 T;  3S4U A;  4L5G A;  2DHR A;  2OLT A;  4ERR A;  2DLR A;  4MHC A;  3U78 A;  5HAX A;  5ABF B;  3LBX B;  2H3R A;  3Q5D A;  4DV4 T;  1MIY A;  3SRZ A;  3AEB A;  5DQV A;  3P4R A;  5L3F B;  2V7L A;  4ILB A;  5FVK A;  4DR6 T;  2V7I A;  1US7 B;  2CHN A;  3Q5W A;  5FXV A;  3KFW X;  4PJJ A;  3TLV A;  5EK2 A;  5JDN A;  3MKD A;  5HXE A;  4EZH A;  4NXN T;  2ODV A;  2WSS V;  4Z90 A;  5LMN T;  3AVR A;  5LCY A;  2YKS A;  2WDR A;  1D0X A;  3MJX A;  2QRX A;  4A56 A;  3EHZ A;  3P4P A;  4CXX A;  4DR7 T;  3FHN A;  3HR0 A;  3AE5 A;  5JDH A;  2JJ9 A;  5JRC A;  2LLY A;  3VR8 A;  4FJO A;  4IE6 A;  2UXX B;  3MXZ A;  4ASK A;  4AKG A;  2CPT A;  2IDO B;  2WP9 A;  3UTK A;  3L8R A;  4IRE A;  1NWM X;  2Y6X A;  4KUM B;  4L0R A;  1N36 T;  2XAJ B;  3NVO A;  2LE8 A;  2MYS A;  3CX7 B;  1WR0 A;  4HE8 A;  2SPC A;  3HKC E;  3CVR A;  4O2A E;  5DQW A;  5LP6 E;  1HX8 A;  4EV6 A;  2BKP A;  4DR4 T;  3AAI A;  2LSK A;  4BJN A;  3MZK B;  2VVS A;  2WAU A;  3T8O A;  5AFU L;  2NWB A;  3C4Z A;  1MIV A;  3UQ4 A;  3KV5 A;  3IEE A;  4DV1 T;  4IDZ A;  4CZZ B;  4U7I A;  2XPK A;  4IDN A;  5LNK A;  2YDQ A;  5L4E A;  2OA5 A;  3O1H A;  3ANW B;  4NUV A;  3RRC A;  4PJM A;  3ZYL A;  4QXH B;  2IUB A;  5CB4 E;  5ETW A;  4DID B;  2VKO A;  3AVS A;  3C4X A;  2XY8 B;  1MND A;  4I0U A;  4P09 A;  4AQY T;  5JH7 E;  4AQF C;  5JDF A;  5LA6 E;  1H7C A;  3VKG A;  2IC9 A;  1OXZ A;  2G0U A;  2K48 A;  4O2B E;  2AXD S;  1J5W A;  4C90 A;  1MMN A;  4UF0 B;  2WWV A;  4HN9 A;  4X1K E;  1J5E T;  1HG2 A;  2C5K T;  4O4J E;  4UV8 B;  4IE4 A;  2VQE T;  3IA3 A;  2LSJ A;  4TWD A;  4DV6 T;  3QC9 A;  2J4G A;  5H6Q B;  4CI2 B;  4O8S A;  4HFI A;  2A9U A;  2H7V C;  3F2E A;  5IWA T;  3N2G E;  2UXD T;  2KSR A;  4ZXL A;  2Q9Q D;  3RIU C;  3TLS A;  3LK2 B;  4LFA T;  3I9W A;  3UUM A;  3FBL A;  4G63 A;  2K3W A;  5FP3 A;  1HX1 B;  4CN4 A;  1UUS A;  3UU6 A;  2CMR A;  1HNW T;  4CI3 B;  3N9Q A;  3NWI A;  4TV9 E;  4JV5 T;  1ZHC A;  3ZT7 A;  1HF8 A;  1IBK T;  3QNU A;  3ZJ2 A;  2E5L T;  4JI4 T;  3E0Z A;  1ZEE A;  5EK4 A;  2WWU A;  4DR1 T;  4AXP A;  2JQ9 A;  4LML A;  4U33 A;  2J62 A;  4DR3 T;  1CUN A;  2VAS A;  2I59 A;  2D0U A;  4QXB B;  4HGA A;  3FBZ A;  3TLT A;  3EDV A;  5JR9 B;  5CFB A;  5FKY A;  4B3T T;  4B3S T;  5E0O A;  1BR4 A;  1IAP A;  3HKE E;  4TWH A;  4BJM A;  5F8P A;  5AQK B;  5FNV E;  4X1Y E;  4MFR A;  3P4W A;  2CM0 A;  3PE0 A;  2CLY B;  2BG9 A;  3KVB A;  4X20 E;  1XNQ T;  4CQI A;  3OYX A;  3IF8 B;  2JQK A;  1OED A;  4JI5 T;  2WM9 A;  3FXD B;  2EHO C;  5JVD E;  2V6Y B;  4QWN B;  2E8I A;  4AKI A;  4ZS2 A;  2LOP A;  4PK4 A;  1MMA A;  4WBN E;  3EI0 A;  4TNV A;  5FXZ A;  4U72 A;  3N9L A;  4HWF A;  3AAA B;  3A7M A;  3QOF A;  1XWM A;  2IW5 B;  3LSV A;  2A72 A;  5LJN A;  2XQ6 A;  5M4Y A;  4ZS3 A;  4C91 A;  4UXN B;  2GK9 A;  4L9I A;  2YOE A;  4DR2 T;  4I4T E;  5FVL A;  4V1A v;  3NRX A;  4JLE A;  3KIN B;  5C2T A;  4ILU A;  4DR5 T;  3RC3 A;  4ZOL E;  1D1B A;  4OFZ A;  3FZK B;  2ACZ A;  5HCM A;  3QK6 A;  4DV5 T;  2DNX A;  2BVL A;  3Q9D A;  3FZF B;  2VWA A;  2V5D A;  3HKD E;  4DVD A;  2V8S V;  3ONJ A;  3RKG A;  2YEV C;  4BA9 A;  2D9D A;  4U2Y A;  3O9X A;  3AB3 B;  3GA8 A;  4IHJ E;  1IBL T;  1FEW A;  4NUU A;  2CXD A;  5LHH B;  3VRA A;  4DUZ T;  5IUX A;  4H9R C;  1UUR A;  3RI5 A;  4COF A;  1JNZ A;  3CQG B;  2BKN A;  2XAG B;  2KZ7 B;  3BK9 A;  4QKN A;  4TN7 B;  5JR9 C;  2JRK A;  1YXR A;  4UEL A;  3AA1 B;  5F5W A;  3JAD A;  3NRY A;  4PFP A;  2YDR A;  1W09 A;  3NBX X;  5AQU B;  4UEM A;  3HA4 A;  5KX5 E;  4HFV A;  4I43 B;  5FY1 A;  4KX6 A;  2E9X C;  3HKB E;  4LMK A;  3E08 A;  3FZH B;  4U74 A;  2WY2 A;  3GN5 B;  4JI0 T;  3VU7 H;  3OYZ A;  2DI4 A;  3OPC A;  4ZI7 E;  3AE8 A;  4CI1 B;  5L3D B;  3NZQ A;  5ADX L;  2KLQ A;  4Q25 A;  3LJC A;  3VKH A;  2XHE B;  5LYJ E;  1YQ4 A;  5L47 A;  1YW0 A;  4Z91 A;  1KF6 A;  2D5U A;  3I0Q A;  4A5X A;  1EZ3 A;  1FJG T;  3PUS A;  2YU2 A;  4ZZB A;  3A5X A;  3OTO T;  4PAG A;  1T7S A;  3RYC E;  3EUH A;  5ABH A;  3C50 A;  5TAO A;  5BR8 T;  2UXC T;  4X65 T;  5HEG A;  5AQG B;  2LM2 A;  3CKD A;  2AE9 A;  3AA6 B;  4HFB A;  4HWI B;  2PFV A;  2CXL A;  2ZM0 A;  4AIS A;  2MBG A;  4ANJ A;  4QH5 A;  4H9P C;  4H9Q C;  2DCF A;  4DV0 T;  3ESL A;  1VRB A;  2UU9 T;  2XQA A;  5DJQ C;  3AA0 B;  2LRL A;  1FIO A;  3ZLI A;  1MMG A;  3C98 B;  4B3M T;  4K0K T;  2VKH A;  2YK0 A;  3P50 A;  3PUW F;  3LK4 2;  4ISS A;  2KWH A;  1LVK A;  2KT9 A;  2XAF B;  4UIG A;  3ZEF B;  2K9A A;  2XM2 A;  4TV8 E;  1UX4 A;  5KXJ A;  3PUY F;  3V5S A;  3ZC1 A;  4YJ2 E;  4OYK A;  2FJB A;  2UUA T;  4AQF A;  5JRC B;  3ZN1 B;  3F31 A;  2XSB A;  1IBM T;  5JTG A;  1YD8 G;  2A3D A;  1OWA A;  5J1G A;  2W66 A;  3OJA A;  3RYH E;  1LRZ A;  1XZY A;  2IAK A;  2WDQ A;  2L9Q A;  4QX8 B;  5AQL B;  3RYI E;  1WRD A;  3TKL B;  5LBQ B;  3AAE B;  5LHI B;  1QSD A;  4DV7 T;  2LHR A;  1N32 T;  4IDP A;  4HWC A;  1WLX A;  2BBH A;  1E2A A;  5AQO B;  2KWI B;  4I55 E;  1JNR A;  3ZYM A;  2MPK A;  2C0S A;  4EAH A;  3JAE A;  4KHP T;  1T8B A;  3RIU A;  3RGL A;  3CPZ A;  3K3N A;  3K3Q C;  1Y64 B;  1XDP A;  4LF6 T;  5L4H A;  3RIF A;  3SOL A;  2QA7 A;  1IJ6 A;  2VUR A;  2ZM8 A;  4O4I E;  3T1H T;  4U7Y A;  2XQ5 A;  3RQU A;  5J2U E;  1MMD A;  5FXW A;  4ZI2 D;  4XAX B;  5HXR A;  1U4Q A;  3CK6 A;  1G73 A;  3RC8 A;  2WMO A;  3AE2 A;  3RKO A;  3UUX B;  3ZYK A;  1NEN A;  1YKH B;  2XSA A;  4TUY E;  1S94 A;  3KV9 A;  5LBM A;  4DMW A;  4KMC A;  1HG5 A;  4GYS A;  2LSG A;  1D0Y A;  3RIA A;  1D1C A;  3AEF A;  4DV3 T;  4IE7 A;  3ANW A;  5H6R B;  2YU1 A;  4IGU A;  3ZKR A;  3KBU A;  4ZI3 C;  3LK3 B;  4YY3 T;  2X9X A;  3AED A;  4IST A;  3ABV A;  4H9S E;  3UU3 A;  5IYZ E;  5AQR B;  2XQ8 A;  2NTX A;  3WI3 A;  2IIU A;  2M67 A;  2J47 A;  2EHO A;  2KND A;  4GYR A;  2L8K A;  4H63 H;  2WZI A;  2PG8 A;  1FMW A;  1SE7 A;  3SFE A;  3RLF F;  4X66 T;  2R6G F;  5CGM A;  3BQK A;  4TNW A;  4YLH A;  4TX5 A;  3ZMV B;  4GKK T;  4UF0 A;  3R6N A;  3JC6 D;  1VOM A;  3B5M A;  2UUC T;  4XBF B;  4JI8 T;  3UT5 E;  1DU2 A;  4LFB T;  2FJE A;  2PTF A;  2VVN A;  4OK0 A;  3PDY A;  4FI5 A;  4HTE A;  5AQP B;  4GIW A;  3PTR B;  3RQW A;  2PBI A;  2XQ9 A;  1UK5 A;  3H37 A;  1Y01 A;  2IHR 1;  3K3O A;  1KNZ A;  4QX7 B;  5FL1 A;  3L39 A;  4EB6 E;  2P9B A;  3LDQ B;  2KXP B;  3PU8 A;  2J1D G;  2PJQ A;  2M6B A;  3SS1 A;  2V1D B;  3MK7 C;  5LOV E;  4UVB B;  1ZKE A;  4U2Z A;  3LG7 A;  2VL0 A;  2ZM2 A;  1J1J A;  1D0Z A;  5FL0 A;  2E5V A;  4JBW F;  3HI2 A;  3ZSS A;  1XNR T;  4DBR A;  2MOZ A;  2NP9 A;  3FXE B;  3D0T A;  3EDU A;  5LMU T;  5JR9 A;  2BG9 B;  2ES0 A;  2HN1 A;  2X51 A;  1SHZ C;  3SFD A;  1KNR A;  3ONL C;  4LF7 T;  5HWX A;  2WBL A;  3NKZ A;  1NAF A;  2E9X A;  3KDS E;  5J2T E;  2IC6 A;  3RF1 A;  2W2U A;  4MLK A;  2X0H A;  2CCQ A;  3I9Y A;  4F6R C;  4J2C A;  3UUL A;  3AE3 A;  3TLW A;  4H9N C;  1B7T A;  3JAF A;  3KBT A;  4UVC B;  2Q9Q B;  4P0A A;  3JCF A;  3PUQ A;  2M6I A;  3NZP A;  3WAJ A;  4PK5 A;  1HR0 T;  2CBI A;  4NIQ A;  1KK7 A;  3RYF E;  3AE9 A;  4E7Z A;  2UUB T;  2WMN A;  4CN6 A;  4IDQ A;  2BG9 E;  2KIN B;  4YFS A;  2LKH A;  5AQQ B;  2ACX A;  4I50 E;  1OED E;  1MNE A;  1W0B A;  4LFC T;  4O4L E;  4HFH A;  3MAC A;  3CML A;  3R84 B;  2MAW A;  4G2A A;  2W63 A;  1XDO A;  1LVF A;  2JIW A;  3KVA A;  4UVA B;  4BAY B;  1Z8U A;  5LXT E;  4YXD A;  3TLU A;  3O1I A;  3RX6 A;  5JRE A;  5LGN B;  2B76 A;  2JQQ A;  4H9O C;  2BS4 A;  2X0L B;  3FB2 A;  3O1J A;  5L3E B;  3AXJ A;  3P7I A;  3C64 A;  4AI6 A;  5AQJ B;  2BS3 A;  5AQV B;  3UU5 A;  3PU3 A;  2H89 A;  2VKD A;  3L3P A;  4EEB A;  5HXS A;  4Z8X A;  4YHJ A;  1E1H B;  1FMV A;  5FYM A;  2ZM6 T;  3GWH A;  2VK9 A;  3LFM A;  3I1A A;  1O3X A;  1IZN B;  4DV2 T;  4F8H A;  3QB5 A;  4LF9 T;  2LT3 A;  1UX5 A;  2CLY C;  4DBQ A;  2HN2 A;  3DTO A;  5J0Z A;  4YJ3 E;  2YDS A;  4QHO A;  2JPF A;  1KEY A;  3ZST A;  2Y48 B;  3GN5 A;  3N9P A;  4PNI A;  4ADZ A;  3PUV F;  1LKX A;  4HWD A;  4JYA T;  2CWO A;  3N9M A;  2XM1 A;  2CHO A;  2Q9Q C;  4WW0 A;  5CA1 E;  4GK0 E;  5L3B B;  3WAK A;  4QXC B;  2V26 A;  1BR1 A;  3ETU A;  1XMQ T;  2BKO A;  2XJ7 A;  5L3C B;  1QLB A;  5ABG A;  2X9H A;  4IT4 A;  2Y8D A;  4ZZC A;  1X79 A;  2WCA A;  1KFY A;  2W62 A;  5HYA A;  1N33 T;  3Q5E A;  5JDL A;  3B13 A;  4WNK A;  4IE0 A;  3J9X 1;  3H3M A;  2RP4 A;  3VRB A;  3ZT6 A;  5HEO A;  4JI7 T;  3HL6 A;  2VKJ A;  5C3J A;  3CWZ B;  1Z0P A;  5ABF A;  3LBX A;  3OVU A;  2QGS A;  3OKQ A;  1HNZ T;  1M7K A;  1HCI A;  2WZH A;  3RHW A;  3N9O A;  1HFA A;  2V5C A;  2WDV A;  3UFE A;  5ABE A;  1ZV4 X;  1T72 A; 
#chains in the Genus database with same CATH homology
 3OTO T;  4B3R T;  1J5E T;  2F4V T;  4YHH T;  2VQE T;  4LFC T;  5BR8 T;  4DR4 T;  2UXC T;  4X65 T;  4DV6 T;  4JI6 T;  4DV7 T;  4YY3 T;  1N32 T;  1IBL T;  4DV4 T;  4OX9 T;  1XNQ T;  2VQF T;  4DUZ T;  4LF8 T;  4GKJ T;  4JYA T;  3T1Y T;  4JI5 T;  1XNR T;  5IWA T;  4DR6 T;  1N34 T;  2UXD T;  4KHP T;  4DV1 T;  5LMU T;  4LF4 T;  4DV0 T;  4LF6 T;  4NXN T;  2UU9 T;  4LFA T;  2HHH T;  4X66 T;  5LMN T;  1XMQ T;  4LF5 T;  4B3M T;  4K0K T;  4DUY T;  4GKK T;  1HNW T;  4LF7 T;  4JV5 T;  2UUC T;  3T1H T;  4DR7 T;  4JI8 T;  4X64 T;  1IBK T;  2E5L T;  1XMO T;  4JI4 T;  4JI0 T;  4LFB T;  4DR1 T;  4DR2 T;  1N33 T;  4JI2 T;  4X62 T;  4JI1 T;  4DR3 T;  2UXB T;  4AQY T;  4DR5 T;  4JI3 T;  1HR0 T;  2UUA T;  2ZM6 T;  4JI7 T;  4B3T T;  1FJG T;  1HNZ T;  1N36 T;  4DV5 T;  4B3S T;  1IBM T;  1HNX T;  1I94 T;  4NXM T;  4DV2 T;  2UUB T;  4LF9 T;  4DV3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...