4B3TT

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3tT00
3T1HT 1HNZT 1XNRT 4B3MT 4DR1T 4JV5T 1N36T 2VQET 4X65T 4DUZT 1HNWT 4DR5T 1FJGT 1N33T 4X66T 4DV4T 4NXNT 2UXCT 4DR2T 4JI7T 2E5LT 4JI1T 1XNQT 4LF4T 4DV5T 2UUBT 4DV7T 4GKJT 4DV0T 4DR6T 2F4VT 1I94T 4JI4T 4GKKT 1XMQT 4LF7T 4OX9T 1XMOT 4DR3T 4DUYT 4K0KT 1IBLT 5IWAT 2HHHT 4YHHT 4JI3T 2UUAT 5LMUT 2UU9T 1N32T 4JI8T 4KHPT 4JI5T 4B3TT 4LF6T 4LFAT 4JYAT 1N34T 5LMNT 5BR8T 1J5ET 4LFBT 4B3RT 3OTOT 2VQFT 4DV6T 1IBKT 4AQYT 4LFCT 4X62T 4DV3T 1IBMT 3T1YT 4DR4T 4DV2T 4LF8T 2ZM6T 2UUCT 4B3ST 4LF9T 4JI6T 2UXBT 1HNXT 4YY3T 4NXMT 4X64T 2UXDT 4JI0T 4LF5T 4DV1T 4DR7T 4JI2T 1HR0T
chains in the Genus database with same CATH superfamily
2V7LA 2BS4A 2DL1A 4YJ2E 2VKJA 1G8XA 1MMDA 2C5JA 4OYJA 1HNWT 1MNDA 3J7Yq 2XM2A 3F2EA 2WWVA 5IYZE 2CXLA 4PFOA 3N9PA 3C4ZA 4WBNE 2LSJA 4H9SE 2VKDA 4QX7B 5JDHA 3I9WA 4HFCA 2C5IT 3PUQA 5KX5E 3PUGA 3PU3A 4LF4T 2IIUA 3UFGA 3NRYA 4TV8E 2LSGA 5HXSA 3LFMA 1XMQT 4YTMA 1YQ3A 2XAGB 2YK0A 4DVDA 2W00A 2N2NA 4GK0E 4U33A 3UULA 2ACXA 4EZ4A 5LGUB 5LMUT 4UVCB 1KF6A 3FZHB 3C4WA 3AE1A 1MIVA 1N34T 3MKDA 2LT3A 3QOFA 4UV9B 4I4TE 3CQCB 4ZS2A 5KMGP 2CRBA 4PFPA 2CM0A 2A72A 3CQXC 2NW8A 2DLRA 4QH5A 3PV0F 2UUCT 1R8IA 4WBOA 1SUMB 2X9XA 1FMVA 4I50E 3Q5EA 1VCTA 3HA4A 3FHNA 5HEGA 1HNZT 3Q5XA 4IE6A 3KBTA 1N36T 2JPFA 4O4IE 2CWYA 2W61A 3AE8A 3P4RA 3AEAA 5FVKA 3ETVA 5FY7A 4ANJA 4X20E 2CEAA 4H63V 5L3CB 1WR6A 2W2UA 5L3DB 3QUJA 3I0QA 5CGMA 1HX1B 1XDOA 3EVYA 4YXDA 3AECA 1Z8UA 2WCAA 3QC9A 2F4VT 3G06A 2JQ9A 2E5VA 3RKOA 4ZS3A 2X0HA 4LMLA 3E08A 3QB5K 5LGTB 2BKOA 3GN5A 2LHRA 1D0YA 5J0ZA 2H7OA 2N9DA 2PTFA 2BVMA 1YQ4A 4YJ3E 2LRKA 1QLBA 4JYAT 3ZMSB 2X9YA 1G73A 2WDVA 4PJLA 4CXYA 2V7MA 2NOXA 3PUXF 2MBGA 3QNUA 2A3DA 3NWIA 3T1HT 4OYKA 4CN1A 4EEDA 3C98B 2XQYA 2RP4A 1NWMX 2OA5A 3PU8A 4FJOA 3UT5E 2XQ5A 1LKXA 4H9RC 3FB2A 3UQ7A 3MA9A 4DR2T 5DJQC 3L39A 2H89A 5JVDE 3PURA 2OV9A 1BR2A 1WLXA 5JTGA 4CXWA 4IE0A 3SRZA 2XHEB 4O2BE 2XAFB 5JDMA 3AEGA 4XZCA 2YEVC 2KWIB 3ZMTB 5LCYA 3SWHA 2K48A 4KUMB 2Z6EA 4LF7T 5HCJA 4DNDA 3CKDA 4JBWF 5LHHB 3RI5A 4LMJA 1IBLT 3WAKA 3ZLIA 4MBQA 3I9YA 1UX5A 4JI3T 2XAJB 2W63A 3ONLC 3ESLA 2IAKA 4GYSA 3BQLA 4ILAA 4ASKA 5JDLA 2W0GA 4PAGA 5CA1E 4YHJA 3RQWA 3PUSA 5TAOA 4PK6A 3TLWA 5C2TA 5JDGA 3JC6D 4KMCA 4AKGA 3EI0A 3H37A 4BJMA 3KV4A 3PJAJ 4LF9T 3UTKA 1HNXT 4YY3T 5CJ5A 5JQGE 1LRZA 1YKEB 1ZKEA 2VASA 3RPUA 3OBVE 2WP9A 3JC6C 3C50A 4CI1B 4JEUB 4H9NC 1WYBA 2V6YB 1SA0E 2C0SA 4O4JE 3K8PC 4ISSA 2WU5A 4DIDB 2X0LB 3UFEA 2HPJA 2KMFA 3JAEA 1O3XA 1HF8A 3SFEA 1NENA 5AFUL 4DV5T 2IC6A 5LJMA 4OK0A 4EEBA 4CI2B 3NZPA 3N9OA 1IJ6A 3RYHE 3KV9A 4X5TA 2IDOB 3DP7A 2WQYA 4YTPA 3KFWX 1CUNA 3K1SA 3ZT6A 2M6BA 2V6XA 2M6IA 4TV9E 2VL8A 2MPKA 4DBRA 4O2AE 3IHRA 3IA3A 2BKNA 3RLFF 3A5XA 5AQOB 3T8OA 3AE5A 3WAJA 3T1YT 3FZFB 4X1KE 2AE9A 1BR1A 3UUXB 2UXBT 1B7TA 2DCFA 2UXNB 4DV1T 4HFVA 1UCUA 4QH4A 2K3WA 3ZN0B 4X65T 3OPCA 2NW7A 4DV4T 2UXCT 3UU8A 3UUMA 2ZMAA 3V5UA 3FXDB 4BAYB 2EHOA 1XNQT 4DO0A 4U2YA 3A8YC 4UXNB 1I6ZA 2D0UA 1I94T 5ADXL 3D0TA 2MYSA 3I1AA 4EYUA 4XBFB 4JLEA 4L0RA 3TLVA 4HWIB 4HFBA 3ZCIA 2LOSA 4DUYT 4ZEYA 4K0UA 4NIQA 5L4EA 4EXTA 2UU9T 4P09A 5HXEA 3P7IA 1D1AA 4B6XA 2HN2A 5HEHA 2BVLA 4PK5A 3B57A 4DR4T 4DV2T 3ZC1A 4ZZBA 4LF8T 2MOZA 3SOLA 1U4QA 4X64T 2V7IA 3L09A 5A1LA 2CHOA 5DABA 4HFIA 1X9BA 4I55E 5AQJB 3Q5WA 5HXHA 5J2UE 3R84B 2CXFA 4G63A 4DR5T 5FKYA 5ABFB 3AVRA 5FXXA 4UELA 4DBQA 4YLHA 4L9IA 4JI7T 5ABHA 3VKGA 5AQTB 2FJAA 2WDRA 5F5WA 3NVOA 2LSKA 4EOZB 4DV0T 4KI0F 3JADA 2V7JA 2X9HA 4ZXLA 2MTQA 2ZLYA 1Z0PA 4GOUA 3AE9A 2BG9B 5ABFA 2GK9A 4ZI7E 1MMAA 4KX6A 3RH3A 5IWAT 2NW9A 2LE8A 4QH1A 4IDPA 4GIWA 2WZIA 5FXZA 1X79A 1N32T 5LMNT 5ETWA 2EHOC 3LDQB 4AKHA 1IBKT 3CIRA 4X62T 2BG9A 1YD8G 1W9RA 4QKNA 4EGWA 2NR4A 3SFDA 2KINB 5E0OA 2AXDS 1M7KA 3ZN1B 2QVAA 3ZJ1A 2JIWA 3N2KE 4HFDA 3UU4A 5AQHB 2FJBA 2C5KT 5EK4A 3PJAA 4HTEA 4U7YA 4FI5A 4EB6E 4C90A 5L3EB 5DQWA 2NTXA 4HN9A 2W66A 2MAWA 3CMLA 5FY0A 5DQVA 4PW8A 3R6NA 3RF1A 4UVBB 4HKAA 4O8SA 2J47A 2LSIA 5FMNA 3M65A 5H6QB 3FZMB 3GN5B 1SE7A 2HN1A 4TWHA 4XAXB 1NAFA 5HCMA 3ONXA 4EYYR 2UUAT 2B1EA 4IL4A 4ERRA 3O1JA 3RYFE 1HX8A 5JR9A 2YINA 1BR4A 5BR8T 2XZEA 3MXZA 2JMHA 4KP3C 1IBMT 3CVRA 2CA5A 3ZYLA 3LG7A 4TX5A 2H7VC 2JQHA 3P4PA 1IJ5A 3RYCE 3BQKA 3N5LA 3AA6B 3RKGA 3ZSTA 3B5MA 2P9BA 2Q9QB 4WZXA 1WR0A 1ZHCA 2FBWA 2D9DA 5JDNA 5LOVE 4WYVA 3J9X1 3CWZB 1L0VA 2BG9C 3OKQA 2OLTA 2XAQB 3ZKRA 3KV6A 3HI2A 4GKKT 1UUSA 2PFVA 2Q9QA 2JQKA 3ZJ2A 1V9DA 3N2OA 4P1NA 3AE2A 2HHHT 4IDZA 3K3QC 1OEDA 2BBJA 2XQ4A 5LB7B 4ZZCA 2YDSA 4LFAT 4TNVA 3HKDE 4CN4A 3AAAB 2M67A 2V1DB 1WYCA 4U72A 3TLSA 1YKHB 1BR0A 4QX8B 5HEOA 3CK6A 3EDVA 3O1IA 1AJ3A 5LA6E 5FL1A 3NRXA 2L8KA 2JMKA 1NEKA 1XNRT 3ZYKA 2WWUA 4EV6A 3UUNA 2Y48B 4B3MT 3P4WA 4DR1T 4EIWA 2BDEA 4A56A 4WW0A 4ZI2D 2KZ7B 1U5PA 4COFA 1LVFA 5JR9C 5CA0E 4QHOA 2FUPA 4H9OC 4QXBB 3AA1B 2XUEA 5CFBA 4ZHQE 2WU2A 2LRLA 4IREA 4CI3B 2VURA 4ZI2C 1VOMA 5AQIB 4GK5E 3RIFA 1W0BA 2YU1A 3RQUA 3KVAA 4H9QC 1HFAA 2ODVA 3ETUA 3AVSA 3ZMVB 3RX6A 1HTJF 2CPTA 2LKGA 5AQVB 4O4LE 1M62A 3RHWA 2XJ7A 3PUAA 3HKEE 2VKOA 3VR9A 1YW0A 2JQQA 4YHHT 2LKHA 3LJCA 3AEFA 2E9XA 5LBQB 2ZM2A 4U2ZA 4JI8T 3ZMUB 2LHNA 4KHPT 4LF6T 1E1HB 1W0AA 2Q9QD 2IUBA 1J5ET 5C3JA 3CX6B 4LFBT 1JNRA 5H6RB 4CXXA 3RGLA 3ANWB 2UXXB 5FYMA 1ZOYA 2Q9QC 1D0ZA 3VR8A 2IW5B 1FMWA 3AAIA 2L9QA 3C64A 5CB4E 2CBJA 2XM1A 1OEDC 5AQNB 4PJMA 4UEMA 3RRCA 5JRCB 5KXJA 1ZP0A 1OWAA 4X66T 2I0MA 2YU2A 3L8RA 2EHOB 5JREA 2K9AA 3CX7B 3ANWA 2E5LT 3MACA 5AQKB 4UVAB 4MFRA 3TLUA 5LHIB 2YN6A 3AE6A 3EDUA 2B76A 1UX4A 4H63H 2CLYC 3PE0A 5AQGB 1IAPA 1HG2A 2CMRA 2VVSA 3KDSE 2X0YA 5JRCA 3UU5A 4K0KT 3Q5DA 5LJNA 1XDPA 2WY2A 2VKHA 2XTLA 2K5BB 2J62A 1J5WA 2WDQA 5LG3A 4BA9A 4UF0A 3ABVA 4YFSA 3JCFA 3S4UA 3EAMA 3MK7C 4P0BA 5AQRB 4NXMT 4Z8XA 2FJDA 4AKLA 3LK42 3HR0A 4E7ZA 4JI2T 3LBXB 2QA7A 3HKCE 3VU7H 3ZYMA 4JUYA 3NBXX 4JEHB 4A5XA 2ES0A 5EZYE 2WMNA 3EHZA 2LSYA 2VQET 2E9XC 4CN6A 1MMNA 4F8HA 3N9LA 3IBPA 4AQFA 4HEAA 2IHR1 2CXDA 4KHZF 1UURA 2KNDA 2KWHA 1OXZA 3AB3B 5JDFA 5LXTE 1KNPA 3LBXA 3SS1A 3AXJA 4UR9A 4DR6T 1QUUA 2A9UA 5AQMB 1S35A 3AE7A 4ADZA 4Q25A 3KBUA 1HG5A 2D0TA 4PJJA 2RA1A 3AEDA 2XQ6A 3K3OA 4YTNA 2XQ3A 3ONJA 2XQAA 5J2TE 4ILCA 4GYRA 2CE7A 2KLQA 2SPCA 3GWHA 2ACZA 3RIAA 4IDQA 4U74A 3HL6A 2X66A 2VQFT 3OTOT 3LK2B 4M1PA 2W67A 2EHOD 1T98A 1FIOA 3OVUA 2W62A 4PJNA 2QRXA 2NP9A 2XQ8A 2YDRA 1W09A 4UV8B 3OJAA 2X9WA 4AIUA 1J1JA 2BS3A 2V5DA 3H3MA 4YSYA 4O4HE 4LMKA 2W4XA 2WS3A 1MIYA 3H3AA 1LVKA 1FJGT 2LM9A 4Z91A 4NXNT 3VRAA 2V8SV 2YDQA 3C4XA 3O1HA 3UUBA 3UU3A 4AKRB 4JI1T 4F6RC 1MIWA 2KSRA 4AISA 4ZI3D 4HGAA 4DV7T 4JI4T 3RRWA 2XSBA 1JNZA 5KDMC 4YSXA 4CQIA 2ODUA 4DR3T 4ZI3C 2V7KA 3AA0B 3AE4A 3FBLA 2IMLA 5JR9B 3ZCJA 4AQFC 3GA8A 1ZV4X 3RC8A 3PUVF 3U3IA 2K24A 1D1BA 1DU2A 3PDYA 2H3RA 4DV6T 2Y8DA 4TWDA 4YT0A 5JDQA 2KT9A 3VRBA 5L3FB 4AI6A 3CX8B 4H9PC 1US7B 4JI6T 2V5CA 1WCRA 4HWHA 2J1DG 2CHNA 3KVBA 4IDNA 1XWMA 4JV5T 4EZHA 3BK9A 3ZC0A 4HFHA 5LP6E 4IE5A 2HPLA 3BQIA 2LJLA 3N2GE 1E7PA 2VVNA 1KEYA 5LNKA 1HS7A 5BMVE 1MMGA 3EUHA 2KXPB 5FNVE 1MNEA 1ZEEA 4HWCA 3LK3B 4X1YE 5LGNB 1H7CA 5F3JA 2X51A 4AQGA 5HYAA 4OX9T 5EK2A 5JH7E 1XMOT 3PTRB 5ABGA 2R6GF 4HFEA 4QXCB 5FXVA 1OEDB 4TN7B 3E0ZA 4MHCA 4L5GA 5LYJE 2BG9E 4JI5T 2BKPA 3LSVA 1Y64B 5LHGB 1GQEA 5EK3A 3PUWF 4I43B 2DHRA 2Y6XA 2E8IA 4LFCT 2A2FX 4QXHB 4ILBA 4IT4A 3GMIA 2VK9A 5FL0A 2CLYB 4IIJE 1T72A 3U78A 2UXDT 4JI0T 2HH7A 3OYZA 4E7SA 3CQGB 4WNKA 3IEEA 1E2AA 4CZZB 2N1GA 4IE4A 4PK4A 1S94A 2RPAA 3A7MA 3C51A 3F31A 3B13A 5GONE 2ZM8A 3L3PA 3AE3A 3P8CD 3UQ4A 1FEWA 2VL0A 2ZM0A 4AXPA 4IGUA 5IHYA 5L4HA 4GKJT 1SHZC 2X68A 4ZOLE 1CHUA 2WB5A 5HAXA 1EZ3A 1T7SA 2CWOA 5LBMA 2CBIA 4HE8A 3DJBA 3RIUA 5L2LA 3AEBA 3AA7B 4QWNB 5AQPB 2E9XB 1KNRA 2XPKA 3E22E 4YSZA 3TKLB 5M4YA 4U3CA 5AQUB 1HCIA 3AAEB 3OYXA 3V5SA 3ZT7A 2WSSV 4ILUA 4NUVA 5HWYA 4B3TT 4MLKA 5HXRA 2I59A 4AKIA 3N9MA 2H88A 2I6HA 1UK5A 4B3RT 2IC9A 3N9QA 4AQYT 5AQLB 4KBMB 2JRKA 4IE7A 3MZKB 4TNWA 5F8PA 5FP3A 4OHFA 5J1GA 2DWGA 4B3ST 3ZSSA 2D5UA 3PUZF 4DMVA 5AQSB 1WRDA 2YOEA 2LEHA 2NTYA 4G2AA 4A98A 4IL9A 4IDOA 2XY8B 1QSDA 5HWXA 3F57A 1D1CA 2BS2A 1UGOA 2CCQA 4DUZT 1KNZA 2V6YA 1N33T 4TZ4C 3KV5A 2PBIA 2V26A 4TUYE 5L47A 3Q2MA 3AEEA 3JAFA 2VWAA 5FXWA 2YKSA 3Q9DA 5FVLA 4I0UA 3ZPOA 2QGSA 2UUBT 3N9NA 3RYIE 5C8YE 1D0XA 2XAHB 4OFZA 3ZEFB 5L3BB 2WZHA 1OEDE 5IUXA 4Z90A 3FXEB 3EABA 3ZMZB 4DMWA 1WFDA 5LG4A 2BBHA 2J4GA 5AQQB 4UF0B 3MJXA 2VB6A 3DTOA 4HWFA 3O4XE 2WAUA 3I0OA 4IHJE 2L3LA 2NWBA 4J2CA 2BZBA 2ZM6T 4P0AA 3VKHA 4LF5T 4DR7T 2DI4A 3PUYF 4X1IE 3RIUC 5HEUA 3UU6A 3QK6A 3KINB 2D2SA 3WI3A 2XQ7A 4HWDA 3FZKB 2WBLA 2E9XD 1T8BA 5FY1A 4N78D 2G0UA 4PNIA 3AXJB 5HXCA 3W15B 2XQ9A 3X1DA 1VCSA 4NUUA 2JJ9A 4U7IA 2QYWA 5AQFB 3QB5A 3NKZA 5L3GB 2DNXA 4V1Av 1KK7A 3HKBE 2X67A 3NZQA 2LOPA 3O9XA 3TLTA 1VRBA 4TWFA 4NPPA 4ISTA 4MALA 4A97A 4EAHA 3CPZA 2XSAA 5ABEA 2E2AA 2DWKA 4UIGA 3K3NA 5HEJA 2WM9A 3IF8B 3VHLA 4BJNA 2LLYA 3P4QA 1KFYA 1Y01A 2WMOA 3ZT5A 4DV3T 2PG8A 3FZLB 3P4SA 3P50A 3M3ZB 2PJQA 3FBZA 3RC3A 4C91A 2XASB 1YXRA 1XZYA 1IZNB 2LM2A 4U31A 2FJEA 1HR0T
chains in the Genus database with same CATH topology
3T1HT 1HNZT 1XNRT 4B3MT 4DR1T 4JV5T 1N36T 2VQET 4X65T 4DUZT 1HNWT 4DR5T 1FJGT 1N33T 4X66T 4DV4T 4NXNT 2UXCT 4DR2T 4JI7T 2E5LT 4JI1T 1XNQT 4LF4T 4DV5T 2UUBT 4DV7T 4GKJT 4DV0T 4DR6T 2F4VT 1I94T 4JI4T 4GKKT 1XMQT 4LF7T 4OX9T 1XMOT 4DR3T 4DUYT 4K0KT 1IBLT 5IWAT 2HHHT 4YHHT 4JI3T 2UUAT 5LMUT 2UU9T 1N32T 4JI8T 4KHPT 4JI5T 4B3TT 4LF6T 4LFAT 4JYAT 1N34T 5LMNT 5BR8T 1J5ET 4LFBT 4B3RT 3OTOT 2VQFT 4DV6T 1IBKT 4AQYT 4LFCT 4X62T 4DV3T 1IBMT 3T1YT 4DR4T 4DV2T 4LF8T 2ZM6T 2UUCT 4B3ST 4LF9T 4JI6T 2UXBT 1HNXT 4YY3T 4NXMT 4X64T 2UXDT 4JI0T 4LF5T 4DV1T 4DR7T 4JI2T 1HR0T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H T;  1HNZ T;  1XNR T;  4B3M T;  4DR1 T;  4JV5 T;  1N36 T;  2VQE T;  4X65 T;  4DUZ T;  1HNW T;  4DR5 T;  1FJG T;  1N33 T;  4X66 T;  4DV4 T;  4NXN T;  2UXC T;  4DR2 T;  4JI7 T;  2E5L T;  4JI1 T;  1XNQ T;  4LF4 T;  4DV5 T;  2UUB T;  4DV7 T;  4GKJ T;  4DV0 T;  4DR6 T;  2F4V T;  1I94 T;  4JI4 T;  4GKK T;  1XMQ T;  4LF7 T;  4OX9 T;  1XMO T;  4DR3 T;  4DUY T;  4K0K T;  1IBL T;  5IWA T;  2HHH T;  4YHH T;  4JI3 T;  2UUA T;  5LMU T;  2UU9 T;  1N32 T;  4JI8 T;  4KHP T;  4JI5 T;  4B3T T;  4LF6 T;  4LFA T;  4JYA T;  1N34 T;  5LMN T;  5BR8 T;  1J5E T;  4LFB T;  4B3R T;  3OTO T;  2VQF T;  4DV6 T;  1IBK T;  4AQY T;  4LFC T;  4X62 T;  4DV3 T;  1IBM T;  3T1Y T;  4DR4 T;  4DV2 T;  4LF8 T;  2ZM6 T;  2UUC T;  4B3S T;  4LF9 T;  4JI6 T;  2UXB T;  1HNX T;  4YY3 T;  4NXM T;  4X64 T;  2UXD T;  4JI0 T;  4LF5 T;  4DV1 T;  4DR7 T;  4JI2 T;  1HR0 T; 
#chains in the Genus database with same CATH topology
 2V7L A;  2BS4 A;  2DL1 A;  4YJ2 E;  2VKJ A;  1G8X A;  1MMD A;  2C5J A;  4OYJ A;  1HNW T;  1MND A;  3J7Y q;  2XM2 A;  3F2E A;  2WWV A;  5IYZ E;  2CXL A;  4PFO A;  3N9P A;  3C4Z A;  4WBN E;  2LSJ A;  4H9S E;  2VKD A;  4QX7 B;  5JDH A;  3I9W A;  4HFC A;  2C5I T;  3PUQ A;  5KX5 E;  3PUG A;  3PU3 A;  4LF4 T;  2IIU A;  3UFG A;  3NRY A;  4TV8 E;  2LSG A;  5HXS A;  3LFM A;  1XMQ T;  4YTM A;  1YQ3 A;  2XAG B;  2YK0 A;  4DVD A;  2W00 A;  2N2N A;  4GK0 E;  4U33 A;  3UUL A;  2ACX A;  4EZ4 A;  5LGU B;  5LMU T;  4UVC B;  1KF6 A;  3FZH B;  3C4W A;  3AE1 A;  1MIV A;  1N34 T;  3MKD A;  2LT3 A;  3QOF A;  4UV9 B;  4I4T E;  3CQC B;  4ZS2 A;  5KMG P;  2CRB A;  4PFP A;  2CM0 A;  2A72 A;  3CQX C;  2NW8 A;  2DLR A;  4QH5 A;  3PV0 F;  2UUC T;  1R8I A;  4WBO A;  1SUM B;  2X9X A;  1FMV A;  4I50 E;  3Q5E A;  1VCT A;  3HA4 A;  3FHN A;  5HEG A;  1HNZ T;  3Q5X A;  4IE6 A;  3KBT A;  1N36 T;  2JPF A;  4O4I E;  2CWY A;  2W61 A;  3AE8 A;  3P4R A;  3AEA A;  5FVK A;  3ETV A;  5FY7 A;  4ANJ A;  4X20 E;  2CEA A;  4H63 V;  5L3C B;  1WR6 A;  2W2U A;  5L3D B;  3QUJ A;  3I0Q A;  5CGM A;  1HX1 B;  1XDO A;  3EVY A;  4YXD A;  3AEC A;  1Z8U A;  2WCA A;  3QC9 A;  2F4V T;  3G06 A;  2JQ9 A;  2E5V A;  3RKO A;  4ZS3 A;  2X0H A;  4LML A;  3E08 A;  3QB5 K;  5LGT B;  2BKO A;  3GN5 A;  2LHR A;  1D0Y A;  5J0Z A;  2H7O A;  2N9D A;  2PTF A;  2BVM A;  1YQ4 A;  4YJ3 E;  2LRK A;  1QLB A;  4JYA T;  3ZMS B;  2X9Y A;  1G73 A;  2WDV A;  4PJL A;  4CXY A;  2V7M A;  2NOX A;  3PUX F;  2MBG A;  3QNU A;  2A3D A;  3NWI A;  3T1H T;  4OYK A;  4CN1 A;  4EED A;  3C98 B;  2XQY A;  2RP4 A;  1NWM X;  2OA5 A;  3PU8 A;  4FJO A;  3UT5 E;  2XQ5 A;  1LKX A;  4H9R C;  3FB2 A;  3UQ7 A;  3MA9 A;  4DR2 T;  5DJQ C;  3L39 A;  2H89 A;  5JVD E;  3PUR A;  2OV9 A;  1BR2 A;  1WLX A;  5JTG A;  4CXW A;  4IE0 A;  3SRZ A;  2XHE B;  4O2B E;  2XAF B;  5JDM A;  3AEG A;  4XZC A;  2YEV C;  2KWI B;  3ZMT B;  5LCY A;  3SWH A;  2K48 A;  4KUM B;  2Z6E A;  4LF7 T;  5HCJ A;  4DND A;  3CKD A;  4JBW F;  5LHH B;  3RI5 A;  4LMJ A;  1IBL T;  3WAK A;  3ZLI A;  4MBQ A;  3I9Y A;  1UX5 A;  4JI3 T;  2XAJ B;  2W63 A;  3ONL C;  3ESL A;  2IAK A;  4GYS A;  3BQL A;  4ILA A;  4ASK A;  5JDL A;  2W0G A;  4PAG A;  5CA1 E;  4YHJ A;  3RQW A;  3PUS A;  5TAO A;  4PK6 A;  3TLW A;  5C2T A;  5JDG A;  3JC6 D;  4KMC A;  4AKG A;  3EI0 A;  3H37 A;  4BJM A;  3KV4 A;  3PJA J;  4LF9 T;  3UTK A;  1HNX T;  4YY3 T;  5CJ5 A;  5JQG E;  1LRZ A;  1YKE B;  1ZKE A;  2VAS A;  3RPU A;  3OBV E;  2WP9 A;  3JC6 C;  3C50 A;  4CI1 B;  4JEU B;  4H9N C;  1WYB A;  2V6Y B;  1SA0 E;  2C0S A;  4O4J E;  3K8P C;  4ISS A;  2WU5 A;  4DID B;  2X0L B;  3UFE A;  2HPJ A;  2KMF A;  3JAE A;  1O3X A;  1HF8 A;  3SFE A;  1NEN A;  5AFU L;  4DV5 T;  2IC6 A;  5LJM A;  4OK0 A;  4EEB A;  4CI2 B;  3NZP A;  3N9O A;  1IJ6 A;  3RYH E;  3KV9 A;  4X5T A;  2IDO B;  3DP7 A;  2WQY A;  4YTP A;  3KFW X;  1CUN A;  3K1S A;  3ZT6 A;  2M6B A;  2V6X A;  2M6I A;  4TV9 E;  2VL8 A;  2MPK A;  4DBR A;  4O2A E;  3IHR A;  3IA3 A;  2BKN A;  3RLF F;  3A5X A;  5AQO B;  3T8O A;  3AE5 A;  3WAJ A;  3T1Y T;  3FZF B;  4X1K E;  2AE9 A;  1BR1 A;  3UUX B;  2UXB T;  1B7T A;  2DCF A;  2UXN B;  4DV1 T;  4HFV A;  1UCU A;  4QH4 A;  2K3W A;  3ZN0 B;  4X65 T;  3OPC A;  2NW7 A;  4DV4 T;  2UXC T;  3UU8 A;  3UUM A;  2ZMA A;  3V5U A;  3FXD B;  4BAY B;  2EHO A;  1XNQ T;  4DO0 A;  4U2Y A;  3A8Y C;  4UXN B;  1I6Z A;  2D0U A;  1I94 T;  5ADX L;  3D0T A;  2MYS A;  3I1A A;  4EYU A;  4XBF B;  4JLE A;  4L0R A;  3TLV A;  4HWI B;  4HFB A;  3ZCI A;  2LOS A;  4DUY T;  4ZEY A;  4K0U A;  4NIQ A;  5L4E A;  4EXT A;  2UU9 T;  4P09 A;  5HXE A;  3P7I A;  1D1A A;  4B6X A;  2HN2 A;  5HEH A;  2BVL A;  4PK5 A;  3B57 A;  4DR4 T;  4DV2 T;  3ZC1 A;  4ZZB A;  4LF8 T;  2MOZ A;  3SOL A;  1U4Q A;  4X64 T;  2V7I A;  3L09 A;  5A1L A;  2CHO A;  5DAB A;  4HFI A;  1X9B A;  4I55 E;  5AQJ B;  3Q5W A;  5HXH A;  5J2U E;  3R84 B;  2CXF A;  4G63 A;  4DR5 T;  5FKY A;  5ABF B;  3AVR A;  5FXX A;  4UEL A;  4DBQ A;  4YLH A;  4L9I A;  4JI7 T;  5ABH A;  3VKG A;  5AQT B;  2FJA A;  2WDR A;  5F5W A;  3NVO A;  2LSK A;  4EOZ B;  4DV0 T;  4KI0 F;  3JAD A;  2V7J A;  2X9H A;  4ZXL A;  2MTQ A;  2ZLY A;  1Z0P A;  4GOU A;  3AE9 A;  2BG9 B;  5ABF A;  2GK9 A;  4ZI7 E;  1MMA A;  4KX6 A;  3RH3 A;  5IWA T;  2NW9 A;  2LE8 A;  4QH1 A;  4IDP A;  4GIW A;  2WZI A;  5FXZ A;  1X79 A;  1N32 T;  5LMN T;  5ETW A;  2EHO C;  3LDQ B;  4AKH A;  1IBK T;  3CIR A;  4X62 T;  2BG9 A;  1YD8 G;  1W9R A;  4QKN A;  4EGW A;  2NR4 A;  3SFD A;  2KIN B;  5E0O A;  2AXD S;  1M7K A;  3ZN1 B;  2QVA A;  3ZJ1 A;  2JIW A;  3N2K E;  4HFD A;  3UU4 A;  5AQH B;  2FJB A;  2C5K T;  5EK4 A;  3PJA A;  4HTE A;  4U7Y A;  4FI5 A;  4EB6 E;  4C90 A;  5L3E B;  5DQW A;  2NTX A;  4HN9 A;  2W66 A;  2MAW A;  3CML A;  5FY0 A;  5DQV A;  4PW8 A;  3R6N A;  3RF1 A;  4UVB B;  4HKA A;  4O8S A;  2J47 A;  2LSI A;  5FMN A;  3M65 A;  5H6Q B;  3FZM B;  3GN5 B;  1SE7 A;  2HN1 A;  4TWH A;  4XAX B;  1NAF A;  5HCM A;  3ONX A;  4EYY R;  2UUA T;  2B1E A;  4IL4 A;  4ERR A;  3O1J A;  3RYF E;  1HX8 A;  5JR9 A;  2YIN A;  1BR4 A;  5BR8 T;  2XZE A;  3MXZ A;  2JMH A;  4KP3 C;  1IBM T;  3CVR A;  2CA5 A;  3ZYL A;  3LG7 A;  4TX5 A;  2H7V C;  2JQH A;  3P4P A;  1IJ5 A;  3RYC E;  3BQK A;  3N5L A;  3AA6 B;  3RKG A;  3ZST A;  3B5M A;  2P9B A;  2Q9Q B;  4WZX A;  1WR0 A;  1ZHC A;  2FBW A;  2D9D A;  5JDN A;  5LOV E;  4WYV A;  3J9X 1;  3CWZ B;  1L0V A;  2BG9 C;  3OKQ A;  2OLT A;  2XAQ B;  3ZKR A;  3KV6 A;  3HI2 A;  4GKK T;  1UUS A;  2PFV A;  2Q9Q A;  2JQK A;  3ZJ2 A;  1V9D A;  3N2O A;  4P1N A;  3AE2 A;  2HHH T;  4IDZ A;  3K3Q C;  1OED A;  2BBJ A;  2XQ4 A;  5LB7 B;  4ZZC A;  2YDS A;  4LFA T;  4TNV A;  3HKD E;  4CN4 A;  3AAA B;  2M67 A;  2V1D B;  1WYC A;  4U72 A;  3TLS A;  1YKH B;  1BR0 A;  4QX8 B;  5HEO A;  3CK6 A;  3EDV A;  3O1I A;  1AJ3 A;  5LA6 E;  5FL1 A;  3NRX A;  2L8K A;  2JMK A;  1NEK A;  1XNR T;  3ZYK A;  2WWU A;  4EV6 A;  3UUN A;  2Y48 B;  4B3M T;  3P4W A;  4DR1 T;  4EIW A;  2BDE A;  4A56 A;  4WW0 A;  4ZI2 D;  2KZ7 B;  1U5P A;  4COF A;  1LVF A;  5JR9 C;  5CA0 E;  4QHO A;  2FUP A;  4H9O C;  4QXB B;  3AA1 B;  2XUE A;  5CFB A;  4ZHQ E;  2WU2 A;  2LRL A;  4IRE A;  4CI3 B;  2VUR A;  4ZI2 C;  1VOM A;  5AQI B;  4GK5 E;  3RIF A;  1W0B A;  2YU1 A;  3RQU A;  3KVA A;  4H9Q C;  1HFA A;  2ODV A;  3ETU A;  3AVS A;  3ZMV B;  3RX6 A;  1HTJ F;  2CPT A;  2LKG A;  5AQV B;  4O4L E;  1M62 A;  3RHW A;  2XJ7 A;  3PUA A;  3HKE E;  2VKO A;  3VR9 A;  1YW0 A;  2JQQ A;  4YHH T;  2LKH A;  3LJC A;  3AEF A;  2E9X A;  5LBQ B;  2ZM2 A;  4U2Z A;  4JI8 T;  3ZMU B;  2LHN A;  4KHP T;  4LF6 T;  1E1H B;  1W0A A;  2Q9Q D;  2IUB A;  1J5E T;  5C3J A;  3CX6 B;  4LFB T;  1JNR A;  5H6R B;  4CXX A;  3RGL A;  3ANW B;  2UXX B;  5FYM A;  1ZOY A;  2Q9Q C;  1D0Z A;  3VR8 A;  2IW5 B;  1FMW A;  3AAI A;  2L9Q A;  3C64 A;  5CB4 E;  2CBJ A;  2XM1 A;  1OED C;  5AQN B;  4PJM A;  4UEM A;  3RRC A;  5JRC B;  5KXJ A;  1ZP0 A;  1OWA A;  4X66 T;  2I0M A;  2YU2 A;  3L8R A;  2EHO B;  5JRE A;  2K9A A;  3CX7 B;  3ANW A;  2E5L T;  3MAC A;  5AQK B;  4UVA B;  4MFR A;  3TLU A;  5LHI B;  2YN6 A;  3AE6 A;  3EDU A;  2B76 A;  1UX4 A;  4H63 H;  2CLY C;  3PE0 A;  5AQG B;  1IAP A;  1HG2 A;  2CMR A;  2VVS A;  3KDS E;  2X0Y A;  5JRC A;  3UU5 A;  4K0K T;  3Q5D A;  5LJN A;  1XDP A;  2WY2 A;  2VKH A;  2XTL A;  2K5B B;  2J62 A;  1J5W A;  2WDQ A;  5LG3 A;  4BA9 A;  4UF0 A;  3ABV A;  4YFS A;  3JCF A;  3S4U A;  3EAM A;  3MK7 C;  4P0B A;  5AQR B;  4NXM T;  4Z8X A;  2FJD A;  4AKL A;  3LK4 2;  3HR0 A;  4E7Z A;  4JI2 T;  3LBX B;  2QA7 A;  3HKC E;  3VU7 H;  3ZYM A;  4JUY A;  3NBX X;  4JEH B;  4A5X A;  2ES0 A;  5EZY E;  2WMN A;  3EHZ A;  2LSY A;  2VQE T;  2E9X C;  4CN6 A;  1MMN A;  4F8H A;  3N9L A;  3IBP A;  4AQF A;  4HEA A;  2IHR 1;  2CXD A;  4KHZ F;  1UUR A;  2KND A;  2KWH A;  1OXZ A;  3AB3 B;  5JDF A;  5LXT E;  1KNP A;  3LBX A;  3SS1 A;  3AXJ A;  4UR9 A;  4DR6 T;  1QUU A;  2A9U A;  5AQM B;  1S35 A;  3AE7 A;  4ADZ A;  4Q25 A;  3KBU A;  1HG5 A;  2D0T A;  4PJJ A;  2RA1 A;  3AED A;  2XQ6 A;  3K3O A;  4YTN A;  2XQ3 A;  3ONJ A;  2XQA A;  5J2T E;  4ILC A;  4GYR A;  2CE7 A;  2KLQ A;  2SPC A;  3GWH A;  2ACZ A;  3RIA A;  4IDQ A;  4U74 A;  3HL6 A;  2X66 A;  2VQF T;  3OTO T;  3LK2 B;  4M1P A;  2W67 A;  2EHO D;  1T98 A;  1FIO A;  3OVU A;  2W62 A;  4PJN A;  2QRX A;  2NP9 A;  2XQ8 A;  2YDR A;  1W09 A;  4UV8 B;  3OJA A;  2X9W A;  4AIU A;  1J1J A;  2BS3 A;  2V5D A;  3H3M A;  4YSY A;  4O4H E;  4LMK A;  2W4X A;  2WS3 A;  1MIY A;  3H3A A;  1LVK A;  1FJG T;  2LM9 A;  4Z91 A;  4NXN T;  3VRA A;  2V8S V;  2YDQ A;  3C4X A;  3O1H A;  3UUB A;  3UU3 A;  4AKR B;  4JI1 T;  4F6R C;  1MIW A;  2KSR A;  4AIS A;  4ZI3 D;  4HGA A;  4DV7 T;  4JI4 T;  3RRW A;  2XSB A;  1JNZ A;  5KDM C;  4YSX A;  4CQI A;  2ODU A;  4DR3 T;  4ZI3 C;  2V7K A;  3AA0 B;  3AE4 A;  3FBL A;  2IML A;  5JR9 B;  3ZCJ A;  4AQF C;  3GA8 A;  1ZV4 X;  3RC8 A;  3PUV F;  3U3I A;  2K24 A;  1D1B A;  1DU2 A;  3PDY A;  2H3R A;  4DV6 T;  2Y8D A;  4TWD A;  4YT0 A;  5JDQ A;  2KT9 A;  3VRB A;  5L3F B;  4AI6 A;  3CX8 B;  4H9P C;  1US7 B;  4JI6 T;  2V5C A;  1WCR A;  4HWH A;  2J1D G;  2CHN A;  3KVB A;  4IDN A;  1XWM A;  4JV5 T;  4EZH A;  3BK9 A;  3ZC0 A;  4HFH A;  5LP6 E;  4IE5 A;  2HPL A;  3BQI A;  2LJL A;  3N2G E;  1E7P A;  2VVN A;  1KEY A;  5LNK A;  1HS7 A;  5BMV E;  1MMG A;  3EUH A;  2KXP B;  5FNV E;  1MNE A;  1ZEE A;  4HWC A;  3LK3 B;  4X1Y E;  5LGN B;  1H7C A;  5F3J A;  2X51 A;  4AQG A;  5HYA A;  4OX9 T;  5EK2 A;  5JH7 E;  1XMO T;  3PTR B;  5ABG A;  2R6G F;  4HFE A;  4QXC B;  5FXV A;  1OED B;  4TN7 B;  3E0Z A;  4MHC A;  4L5G A;  5LYJ E;  2BG9 E;  4JI5 T;  2BKP A;  3LSV A;  1Y64 B;  5LHG B;  1GQE A;  5EK3 A;  3PUW F;  4I43 B;  2DHR A;  2Y6X A;  2E8I A;  4LFC T;  2A2F X;  4QXH B;  4ILB A;  4IT4 A;  3GMI A;  2VK9 A;  5FL0 A;  2CLY B;  4IIJ E;  1T72 A;  3U78 A;  2UXD T;  4JI0 T;  2HH7 A;  3OYZ A;  4E7S A;  3CQG B;  4WNK A;  3IEE A;  1E2A A;  4CZZ B;  2N1G A;  4IE4 A;  4PK4 A;  1S94 A;  2RPA A;  3A7M A;  3C51 A;  3F31 A;  3B13 A;  5GON E;  2ZM8 A;  3L3P A;  3AE3 A;  3P8C D;  3UQ4 A;  1FEW A;  2VL0 A;  2ZM0 A;  4AXP A;  4IGU A;  5IHY A;  5L4H A;  4GKJ T;  1SHZ C;  2X68 A;  4ZOL E;  1CHU A;  2WB5 A;  5HAX A;  1EZ3 A;  1T7S A;  2CWO A;  5LBM A;  2CBI A;  4HE8 A;  3DJB A;  3RIU A;  5L2L A;  3AEB A;  3AA7 B;  4QWN B;  5AQP B;  2E9X B;  1KNR A;  2XPK A;  3E22 E;  4YSZ A;  3TKL B;  5M4Y A;  4U3C A;  5AQU B;  1HCI A;  3AAE B;  3OYX A;  3V5S A;  3ZT7 A;  2WSS V;  4ILU A;  4NUV A;  5HWY A;  4B3T T;  4MLK A;  5HXR A;  2I59 A;  4AKI A;  3N9M A;  2H88 A;  2I6H A;  1UK5 A;  4B3R T;  2IC9 A;  3N9Q A;  4AQY T;  5AQL B;  4KBM B;  2JRK A;  4IE7 A;  3MZK B;  4TNW A;  5F8P A;  5FP3 A;  4OHF A;  5J1G A;  2DWG A;  4B3S T;  3ZSS A;  2D5U A;  3PUZ F;  4DMV A;  5AQS B;  1WRD A;  2YOE A;  2LEH A;  2NTY A;  4G2A A;  4A98 A;  4IL9 A;  4IDO A;  2XY8 B;  1QSD A;  5HWX A;  3F57 A;  1D1C A;  2BS2 A;  1UGO A;  2CCQ A;  4DUZ T;  1KNZ A;  2V6Y A;  1N33 T;  4TZ4 C;  3KV5 A;  2PBI A;  2V26 A;  4TUY E;  5L47 A;  3Q2M A;  3AEE A;  3JAF A;  2VWA A;  5FXW A;  2YKS A;  3Q9D A;  5FVL A;  4I0U A;  3ZPO A;  2QGS A;  2UUB T;  3N9N A;  3RYI E;  5C8Y E;  1D0X A;  2XAH B;  4OFZ A;  3ZEF B;  5L3B B;  2WZH A;  1OED E;  5IUX A;  4Z90 A;  3FXE B;  3EAB A;  3ZMZ B;  4DMW A;  1WFD A;  5LG4 A;  2BBH A;  2J4G A;  5AQQ B;  4UF0 B;  3MJX A;  2VB6 A;  3DTO A;  4HWF A;  3O4X E;  2WAU A;  3I0O A;  4IHJ E;  2L3L A;  2NWB A;  4J2C A;  2BZB A;  2ZM6 T;  4P0A A;  3VKH A;  4LF5 T;  4DR7 T;  2DI4 A;  3PUY F;  4X1I E;  3RIU C;  5HEU A;  3UU6 A;  3QK6 A;  3KIN B;  2D2S A;  3WI3 A;  2XQ7 A;  4HWD A;  3FZK B;  2WBL A;  2E9X D;  1T8B A;  5FY1 A;  4N78 D;  2G0U A;  4PNI A;  3AXJ B;  5HXC A;  3W15 B;  2XQ9 A;  3X1D A;  1VCS A;  4NUU A;  2JJ9 A;  4U7I A;  2QYW A;  5AQF B;  3QB5 A;  3NKZ A;  5L3G B;  2DNX A;  4V1A v;  1KK7 A;  3HKB E;  2X67 A;  3NZQ A;  2LOP A;  3O9X A;  3TLT A;  1VRB A;  4TWF A;  4NPP A;  4IST A;  4MAL A;  4A97 A;  4EAH A;  3CPZ A;  2XSA A;  5ABE A;  2E2A A;  2DWK A;  4UIG A;  3K3N A;  5HEJ A;  2WM9 A;  3IF8 B;  3VHL A;  4BJN A;  2LLY A;  3P4Q A;  1KFY A;  1Y01 A;  2WMO A;  3ZT5 A;  4DV3 T;  2PG8 A;  3FZL B;  3P4S A;  3P50 A;  3M3Z B;  2PJQ A;  3FBZ A;  3RC3 A;  4C91 A;  2XAS B;  1YXR A;  1XZY A;  1IZN B;  2LM2 A;  4U31 A;  2FJE A;  1HR0 T; 
#chains in the Genus database with same CATH homology
 3T1H T;  1HNZ T;  1XNR T;  4B3M T;  4DR1 T;  4JV5 T;  1N36 T;  2VQE T;  4X65 T;  4DUZ T;  1HNW T;  4DR5 T;  1FJG T;  1N33 T;  4X66 T;  4DV4 T;  4NXN T;  2UXC T;  4DR2 T;  4JI7 T;  2E5L T;  4JI1 T;  1XNQ T;  4LF4 T;  4DV5 T;  2UUB T;  4DV7 T;  4GKJ T;  4DV0 T;  4DR6 T;  2F4V T;  1I94 T;  4JI4 T;  4GKK T;  1XMQ T;  4LF7 T;  4OX9 T;  1XMO T;  4DR3 T;  4DUY T;  4K0K T;  1IBL T;  5IWA T;  2HHH T;  4YHH T;  4JI3 T;  2UUA T;  5LMU T;  2UU9 T;  1N32 T;  4JI8 T;  4KHP T;  4JI5 T;  4B3T T;  4LF6 T;  4LFA T;  4JYA T;  1N34 T;  5LMN T;  5BR8 T;  1J5E T;  4LFB T;  4B3R T;  3OTO T;  2VQF T;  4DV6 T;  1IBK T;  4AQY T;  4LFC T;  4X62 T;  4DV3 T;  1IBM T;  3T1Y T;  4DR4 T;  4DV2 T;  4LF8 T;  2ZM6 T;  2UUC T;  4B3S T;  4LF9 T;  4JI6 T;  2UXB T;  1HNX T;  4YY3 T;  4NXM T;  4X64 T;  2UXD T;  4JI0 T;  4LF5 T;  4DV1 T;  4DR7 T;  4JI2 T;  1HR0 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...