4B3TT

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3tT00
4JV5T 4GKJT 4JI1T 4DV1T 4NXNT 4DUZT 4JI4T 1FJGT 4X62T 2ZM6T 4B3ST 4DR5T 4DV3T 4K0KT 4DV0T 1XNQT 1XMOT 4DR4T 4LF6T 2VQFT 4JI5T 2UU9T 5LMNT 3T1HT 4JI7T 4JI3T 4B3TT 2UXCT 4LFBT 4DV2T 1IBLT 5BR8T 4GKKT 1HNXT 5LMUT 1J5ET 4DR1T 4DV7T 4DR2T 1N32T 4LF7T 3T1YT 4JI6T 1HNZT 1HNWT 4AQYT 2UUBT 4DUYT 4JI2T 4DR6T 2F4VT 4JYAT 1IBKT 1I94T 4LF8T 1IBMT 3OTOT 4LFAT 1HR0T 1N34T 4LF5T 4LFCT 4DV5T 4KHPT 4B3MT 2UUCT 2HHHT 1XMQT 4X66T 2UXBT 4OX9T 2E5LT 4X65T 4LF9T 4DV6T 1N33T 4LF4T 4DR3T 1N36T 4NXMT 4JI0T 4YY3T 4YHHT 4DR7T 2VQET 4DV4T 2UXDT 1XNRT 4B3RT 4JI8T 2UUAT 4X64T 5IWAT
chains in the Genus database with same CATH superfamily
4AKHA 4DUZT 3RKOA 3X1DA 4JI4T 3Q2MA 1W09A 4PK4A 1CUNA 3VU7H 4DR4T 1UURA 2RP4A 3HKBE 3RC3A 3ZYMA 3UU5A 2Y8DA 1UGOA 4WZXA 2CWOA 4U7IA 5HEUA 2V7JA 4DNDA 4GOUA 1T98A 4H9SE 3T1YT 3I1AA 3Q5EA 1DU2A 3OYXA 4QX8B 1LVFA 1S35A 2WMNA 5ETWA 4MHCA 3A7MA 3RIFA 4P0AA 4DVDA 2EHOA 3PU3A 4U33A 2X9WA 2XSAA 1D1AA 1X9BA 3AVRA 3UU8A 4TWDA 5L3BB 3CQXC 1MMDA 5HXRA 1WR6A 4COFA 4ISSA 4JEUB 2BS4A 2MBGA 3AE1A 2E5LT 3VKGA 2ZMAA 3ZSTA 5HWYA 3EABA 3N2OA 2KNDA 2WDRA 3KDSE 4CI2B 3EAMA 4B3RT 2XHEB 2CXFA 4G2AA 4ASKA 4NUUA 5CB4E 4GKJT 3C64A 1FMWA 4L5GA 3F2EA 4CN1A 4AQFC 4X62T 3UFGA 2V6YA 2LRLA 5JDLA 2LM2A 5ABFB 4LF6T 5DQVA 2W2UA 2ES0A 2ZM2A 2J62A 5FXVA 4B6XA 1HNXT 1UK5A 2V1DB 5KDMC 4I0UA 3ZMUB 3AEDA 3CWZB 3ZT7A 3C98B 3B57A 1M7KA 4AQYT 4KI0F 4JI2T 3KFWX 3C4WA 2WBLA 2ZM0A 5CFBA 1YKEB 5FMNA 2EHOD 3AXJA 3UUMA 1H7CA 2LSGA 4M1PA 3AVSA 5HXEA 4F6RC 4X66T 3AE3A 4HN9A 5AQOB 3N9PA 4JEHB 3EUHA 4MLKA 2N9DA 1VOMA 4AISA 4JI0T 2H88A 5AQIB 4EB6E 3CIRA 2W0GA 1SUMB 2JQKA 4I4TE 2E9XC 2CE7A 2WWUA 3NZPA 3AAAB 4JV5T 2MOZA 1QLBA 1YQ4A 1HTJF 5HXCA 1O3XA 1WR0A 4CXWA 2XZEA 4KUMB 2XAGB 4YJ2E 3W15B 2B76A 3ZYKA 4CI3B 3JAEA 2I0MA 1WCRA 4B3TT 2N1GA 3KBUA 1IAPA 2NR4A 2ODVA 3C50A 2LKHA 2WP9A 3PTRB 2OLTA 3P7IA 2BS3A 3H37A 4O4IE 3AEBA 2B1EA 3MACA 4AQFA 4JYAT 3FHNA 4NPPA 3AE4A 3JADA 2PTFA 5AQLB 1E2AA 3PV0F 2CLYB 2X0LB 5FL1A 1U5PA 2K9AA 3JCFA 3QB5A 3AE6A 1HG2A 3ZN1B 3RRCA 5TAOA 1XMQT 2WY2A 3PUVF 2UXBT 2XM1A 4ZI2C 4LMKA 4LF9T 1XDOA 2XUEA 4ZXLA 1MIWA 5L3CB 4KMCA 4E7SA 5HEGA 3IF8B 2EHOB 4CQIA 1UCUA 5JR9A 5LGTB 4IDQA 3ZPOA 3AE5A 3TKLB 4PJNA 2DI4A 3F57A 1NEKA 4YHJA 3GN5A 3RI5A 3RQUA 3TLSA 2XQ5A 3VKHA 2JQQA 4IE6A 4PJJA 4I50E 3ZJ2A 3R84B 3RYCE 2VK9A 3I9YA 3Q5DA 5LGNB 2KXPB 5JREA 4I43B 2C5IT 2JQ9A 4OFZA 1D1CA 4YTMA 1QUUA 2BZBA 2XQ3A 4OHFA 2KWHA 2V6YB 3IA3A 2SPCA 5JQGE 3M65A 3SRZA 4XBFB 2XQ8A 5LNKA 4TNVA 3AEGA 2BBJA 3SFDA 3EDUA 4LMLA 2UUCT 2DWKA 5L4HA 3ZT5A 4EV6A 2W63A 3I0QA 2KT9A 4ZS2A 2PJQA 2BG9E 2BBHA 3FXEB 4NIQA 4IDPA 4DR3T 1QSDA 1UX4A 4YY3T 5JTGA 2BVLA 4HFEA 5ADXL 2V5DA 2H7VC 5FVKA 5J1GA 1FMVA 3EVYA 2LLYA 1UUSA 4GK5E 1XWMA 4O2BE 4CXYA 2LE8A 4EZ4A 3MA9A 2X0HA 3RYHE 2CEAA 2CHOA 3UU4A 4U74A 1Y01A 4Z90A 5LYJE 4HFHA 2XAJB 3NBXX 4UF0A 4HFDA 4A56A 1HS7A 5AQKB 5LMNT 1G73A 3FZMB 2CXLA 2J1DG 3PJAA 4UV8B 3PUYF 2CHNA 5EK3A 4HWDA 4YT0A 5FY0A 2WM9A 1ZKEA 2V7LA 4TWFA 1HNWT 4DUYT 3LBXA 3OYZA 3BK9A 3FBLA 4TV9E 5FL0A 5HEJA 3RHWA 4UR9A 4HWCA 4I55E 3RIUC 2CBJA 5C3JA 2NW9A 5L3GB 2XQ4A 3VR8A 2CWYA 4H9PC 2WU2A 1OEDC 3O1IA 3LJCA 4X1YE 2V6XA 4FJOA 1KF6A 4O2AE 5HEHA 2YEVC 4CN6A 4FI5A 2W67A 1XZYA 3KV4A 4OYJA 5AQUB 4O4JE 4UIGA 2QYWA 2UUAT 5CGMA 1AJ3A 2NTXA 4J2CA 2LJLA 4IL9A 4AI6A 4QX7B 5AQHB 3BQKA 1W0BA 3N9MA 5AQMB 2UXXB 2PFVA 1KNPA 4DMWA 1M62A 2MYSA 5LGUB 4PW8A 4U2ZA 5L4EA 3EI0A 2X66A 3HA4A 1ZHCA 3AEAA 1N32T 1OXZA 3HI2A 4WYVA 4LF7T 3IHRA 5LB7B 5JRCA 5JR9B 3ZMVB 3ZC1A 3M3ZB 3ZMTB 4WNKA 3H3MA 3K3NA 2IC9A 3N9OA 2K3WA 3GN5B 3PURA 1IJ5A 2X51A 3U78A 2BKNA 2Q9QC 4U2YA 1ZV4X 2A9UA 4X65T 2VKOA 3FZHB 1MMAA 3SFEA 1N33T 2OV9A 4MALA 4TZ4C 4F8HA 4ILCA 3AA6B 2XAHB 2IMLA 3J9X1 2I6HA 2IDOB 2C5KT 4H9NC 3D0TA 4B3ST 1OEDA 2NOXA 2JPFA 1OEDE 3AA7B 2BG9B 2UU9T 1Y64B 4DO0A 2QVAA 2A72A 2WB5A 3JC6D 2WMOA 3PUZF 4DR1T 3GA8A 2KMFA 1Z0PA 4DV7T 4EAHA 3FZLB 2DNXA 2HPJA 3RKGA 3RPUA 5C8YE 4UELA 3PUXF 1I94T 4LF8T 3O4XE 1J5WA 4ZI3C 5AQGB 1VCSA 1BR1A 2YDQA 2CM0A 4YSYA 4UF0B 4WW0A 2FUPA 2HHHT 1HFAA 3ZYLA 4JUYA 4KHZF 3PU8A 4HWHA 2BS2A 3KVAA 4X1IE 5FP3A 4G63A 5LXTE 4LF4T 4IT4A 3ETVA 5HWXA 5ABHA 5L3EB 2CRBA 3ZJ1A 2FJEA 2WZHA 3OKQA 3T8OA 5AQTB 3EHZA 2IHR1 4GYRA 4TNWA 5L2LA 1W0AA 2BDEA 3N5LA 5FXZA 4DBRA 3F31A 4AKRB 3BQIA 2Q9QA 5JVDE 2FJAA 3RGLA 2X68A 5F8PA 5F3JA 3O9XA 5AQPB 3IBPA 1XNQT 1XMOT 2XQ6A 4JI5T 3DTOA 2VVSA 3FZFB 4H63V 4WBNE 5BR8T 4JLEA 1S94A 3N9NA 1J5ET 4U3CA 5JDNA 5JDFA 2BKPA 2VVNA 4YFSA 1HNZT 5AFUL 2CA5A 5HCJA 2IC6A 1WRDA 2LHRA 5J2UE 1HX8A 3TLWA 1NWMX 4PFOA 4OYKA 4YSZA 2D0UA 5LG3A 4EEBA 1MNDA 2YU1A 1E1HB 4LMJA 4LF5T 2DHRA 4PK6A 3KBTA 4AKIA 5FY1A 4QWNB 2G0UA 2OA5A 3TLVA 3N9QA 2A2FX 4H63H 3QUJA 2XY8B 3ETUA 3LDQB 5DJQC 3PUAA 3L3PA 3C51A 4YTPA 3L8RA 3K3OA 2XQ9A 3RLFF 2DCFA 4YHHT 3DJBA 3QNUA 1HCIA 3ZCIA 4DV4T 2FJBA 2Y48B 2LM9A 2QA7A 1R8IA 4IHJE 4ANJA 2YU2A 2WS3A 4C91A 3C4ZA 3ZC0A 5KX5E 1FJGT 2IUBA 4H9RC 4EEDA 4CN4A 4DV3T 2ACXA 2XTLA 2V7KA 2VQFT 5GONE 2YN6A 2JQHA 4JI3T 3ANWA 4DV2T 3I9WA 2VB6A 1IBLT 2I59A 4QH4A 1YW0A 3R6NA 3QOFA 4MBQA 4TN7B 5ABEA 4HE8A 1YKHB 3P4PA 4QKNA 2NW7A 2UUBT 1HF8A 1ZOYA 3E0ZA 2KWIB 2VURA 1OEDB 1SE7A 1FEWA 2YKSA 2ZM8A 2E9XA 2YDSA 2XQAA 4YJ3E 3V5UA 3LK2B 2LSIA 4O4LE 4ILUA 1SHZC 4ZEYA 2RA1A 4PJLA 4HGAA 3WI3A 4AKGA 3P4WA 4OK0A 4QH1A 4IE7A 2K24A 3AAEB 1N36T 2D0TA 3AE9A 3ONLC 2WZIA 5JDHA 4KBMB 4XZCA 3P4RA 3L09A 4L0RA 1JNRA 2WSSV 2VKHA 3HKCE 1XDPA 1W9RA 1VCTA 2ACZA 3ONJA 3SS1A 4V1Av 3KINB 4UXNB 1J1JA 3NVOA 2CBIA 4C90A 1D0YA 3N2GE 5AQVB 4IE4A 3AXJB 3EDVA 3AA0B 5CJ5A 4KP3C 4PNIA 2V5CA 3FXDB 3UUNA 3MXZA 1MMGA 2X9XA 2W66A 3RYIE 1OWAA 2FBWA 3KV6A 2XSBA 2V7MA 1D1BA 4HTEA 2CLYC 3PDYA 4GYSA 1IBKT 2YOEA 1BR2A 4X5TA 4CZZB 5LOVE 1MIYA 4ZI7E 2M6IA 2LSYA 3K8PC 4BAYB 5HAXA 4LFCT 3MKDA 3QK6A 4MFRA 5FKYA 5DQWA 5HEOA 2W61A 3BQLA 3N2KE 2V26A 4E7ZA 3E08A 2EHOC 4CXXA 4HWFA 3P8CD 3AE8A 5IYZE 4K0UA 2L9QA 2UXDT 2E2AA 1XNRT 3RC8A 1US7B 2X9YA 4X64T 5IWAT 3UQ4A 2NW8A 4X20E 1CHUA 2XPKA 3AE2A 1VRBA 1EZ3A 5LA6E 3T1HT 2HN1A 4X1KE 3ESLA 3AE7A 5LMUT 4PK5A 4A5XA 3H3AA 4DR2T 3B5MA 3CX8B 2HH7A 2D5UA 4TUYE 2E8IA 4QH5A 4ZI2D 3ZMSB 4N78D 4DIDB 3QB5K 1I6ZA 3OPCA 3P4QA 4IE0A 4AKLA 3HKEE 2X9HA 1IZNB 1U4QA 3CK6A 1T7SA 4EYYR 4BA9A 1LKXA 3MK7C 5CA0E 4AQGA 5HXHA 4DMVA 3TLUA 2NTYA 3Q5XA 4P1NA 5KXJA 3E22E 4EXTA 3VR9A 4IDZA 4YTNA 4UV9B 5LHGB 2ZLYA 5E0OA 3CPZA 3V5SA 2X67A 4PAGA 5LHIB 3OBVE 4QXCB 4NXNT 3UT5E 2E9XB 3UU6A 3CVRA 3CX6B 3RH3A 4ZS3A 2XASB 4UVCB 2KZ7B 4AXPA 1HX1B 2W00A 5BMVE 4Q25A 3WAJA 2QGSA 3Q9DA 3FB2A 2WWVA 3MZKB 3OVUA 3RIUA 3RIAA 4GKKT 2KSRA 1T72A 3QC9A 3VRBA 5L47A 1Z8UA 1WYBA 5AQFB 3PE0A 1NENA 3RQWA 4O8SA 5AQRB 2V8SV 3AECA 4TX5A 4IDOA 5LJMA 2MTQA 3NRYA 2IAKA 3LFMA 3UUBA 1BR4A 1KFYA 3FZKB 2E5VA 4H9QC 1GQEA 2XM2A 2Y6XA 1HG5A 3KV5A 2Z6EA 4BJNA 1D0ZA 1G8XA 3A8YC 4QXHB 2WDVA 4ILBA 4HFIA 2JMHA 2LOPA 4IDNA 2K5BB 3KV9A 3B13A 4AIUA 2CPTA 2VKDA 3GWHA 4QHOA 1IJ6A 2CMRA 2C5JA 2D2SA 4EOZB 5FYMA 3PUGA 3NWIA 2AXDS 4DV1T 3CMLA 1YD8G 2VKJA 2JJ9A 5LBQB 5C2TA 2ZM6T 3O1HA 2P9BA 4U31A 5J0ZA 3LBXB 4PJMA 1WLXA 3C4XA 4LFBT 4GK0E 5EZYE 3LSVA 3ZMZB 2LSJA 5JR9C 3SOLA 2WCAA 2W62A 5H6RB 4JBWF 2PG8A 2AE9A 4HFVA 4IREA 2K48A 4ILAA 2YINA 2D9DA 3OTOT 3J7Yq 1HR0T 1D0XA 5IUXA 2NP9A 4O4HE 3AAIA 2YK0A 5H6QB 3KVBA 3NKZA 5LCYA 2WQYA 5AQQB 3RF1A 5JDMA 5IHYA 5FXWA 5AQJB 1FIOA 3UUXB 1ZEEA 3P50A 3TLTA 5JDQA 3CX7B 2W4XA 2VQET 5LG4A 1X79A 2XQYA 3K1SA 1MMNA 3N9LA 4ZOLE 2H7OA 3K3QC 5F5WA 3LG7A 2R6GF 2X0YA 1BR0A 3GMIA 2BG9C 4HFCA 3PJAJ 3FBZA 1V9DA 5JRCB 4DV0T 3IEEA 4PFPA 2WU5A 4JI7T 5LP6E 2VASA 2VL0A 2CCQA 3S4UA 4UEMA 4IIJE 2LT3A 2LOSA 4A97A 2DL1A 1SA0E 2HN2A 5FNVE 5M4YA 2VL8A 5HYAA 3RRWA 4YLHA 2H3RA 2C0SA 2Q9QD 4DR6T 3DP7A 2GK9A 4HWIB 2A3DA 3RX6A 3ZKRA 2UXNB 3CKDA 3UTKA 4IL4A 2LKGA 3LK42 2H89A 2L8KA 5HCMA 2RPAA 2FJDA 5FVLA 3UFEA 4DV6T 2BKOA 3ZEFB 4P0BA 1YXRA 2L3LA 5L3DB 4HKAA 3ZCJA 3AB3B 3WAKA 4UVAB 2IW5B 2BVMA 2ODUA 2XQ7A 2KINB 4JI1T 3G06A 3ZLIA 4IE5A 5ABGA 4DBQA 4U7YA 2JRKA 5FXXA 4EGWA 4DR5T 4K0KT 5JH7E 4TV8E 3RYFE 5A1LA 2UXCT 2J47A 5LJNA 2JMKA 4ERRA 1NAFA 4ZI3D 1LRZA 2MPKA 4YSXA 4JI6T 3PUWF 4Z8XA 2LEHA 1KEYA 2DLRA 5JDGA 4KX6A 2F4VT 5AQSB 3AEFA 2BG9A 2LHNA 3HL6A 1IBMT 3JC6C 3VRAA 3L39A 4NUVA 4LFAT 2XAQB 5LBMA 3ZT6A 4L9IA 3ZSSA 1KNRA 1L0VA 1N34T 3PUQA 2WDQA 4Z91A 4DV5T 5HXSA 5CA1E 4ZZBA 2LRKA 3A5XA 3PUSA 5ABFA 3SWHA 3UU3A 4EYUA 3HR0A 1T8BA 2Q9QB 4CI1B 1LVKA 4A98A 1KK7A 1YQ3A 3AEEA 4DR7T 4YXDA 2MAWA 3NRXA 3I0OA 4XAXB 3U3IA 2HPLA 5KMGP 4JI8T 2E9XD 2JIWA 5FY7A 3HKDE 3UQ7A 2QRXA 2VWAA 1E7PA 3ABVA 2M6BA 1B7TA 4HEAA 4WBOA 1KNZA 1ZP0A 5EK4A 3MJXA 4EZHA 3OJAA 2M67A 1MIVA 4GIWA 3NZQA 1WFDA 2XJ7A 4ZHQE 4P09A 2YDRA 1WYCA 3P4SA 2PBIA 3ONXA 4ADZA 4ISTA 3CQCB 2KLQA 2XAFB 4QXBB 5LHHB 4UVBB 4HFBA 2LSKA 4EIWA 2IIUA 5J2TE 5EK2A 3AA1B 2CXDA 4KHPT 3UULA 4B3MT 2NWBA 3LK3B 3JAFA 1MNEA 3O1JA 4U72A 5AQNB 2J4GA 4OX9T 3Q5WA 2V7IA 4TWHA 4BJMA 1UX5A 1JNZA 2DWGA 2WAUA 4NXMT 3CQGB 3ZN0B 5L3FB 4H9OC 2N2NA 3VHLA 3ANWB 4ZZCA 4IGUA 5DABA
chains in the Genus database with same CATH topology
4JV5T 4GKJT 4JI1T 4DV1T 4NXNT 4DUZT 4JI4T 1FJGT 4X62T 2ZM6T 4B3ST 4DR5T 4DV3T 4K0KT 4DV0T 1XNQT 1XMOT 4DR4T 4LF6T 2VQFT 4JI5T 2UU9T 5LMNT 3T1HT 4JI7T 4JI3T 4B3TT 2UXCT 4LFBT 4DV2T 1IBLT 5BR8T 4GKKT 1HNXT 5LMUT 1J5ET 4DR1T 4DV7T 4DR2T 1N32T 4LF7T 3T1YT 4JI6T 1HNZT 1HNWT 4AQYT 2UUBT 4DUYT 4JI2T 4DR6T 2F4VT 4JYAT 1IBKT 1I94T 4LF8T 1IBMT 3OTOT 4LFAT 1HR0T 1N34T 4LF5T 4LFCT 4DV5T 4KHPT 4B3MT 2UUCT 2HHHT 1XMQT 4X66T 2UXBT 4OX9T 2E5LT 4X65T 4LF9T 4DV6T 1N33T 4LF4T 4DR3T 1N36T 4NXMT 4JI0T 4YY3T 4YHHT 4DR7T 2VQET 4DV4T 2UXDT 1XNRT 4B3RT 4JI8T 2UUAT 4X64T 5IWAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 T;  4GKJ T;  4JI1 T;  4DV1 T;  4NXN T;  4DUZ T;  4JI4 T;  1FJG T;  4X62 T;  2ZM6 T;  4B3S T;  4DR5 T;  4DV3 T;  4K0K T;  4DV0 T;  1XNQ T;  1XMO T;  4DR4 T;  4LF6 T;  2VQF T;  4JI5 T;  2UU9 T;  5LMN T;  3T1H T;  4JI7 T;  4JI3 T;  4B3T T;  2UXC T;  4LFB T;  4DV2 T;  1IBL T;  5BR8 T;  4GKK T;  1HNX T;  5LMU T;  1J5E T;  4DR1 T;  4DV7 T;  4DR2 T;  1N32 T;  4LF7 T;  3T1Y T;  4JI6 T;  1HNZ T;  1HNW T;  4AQY T;  2UUB T;  4DUY T;  4JI2 T;  4DR6 T;  2F4V T;  4JYA T;  1IBK T;  1I94 T;  4LF8 T;  1IBM T;  3OTO T;  4LFA T;  1HR0 T;  1N34 T;  4LF5 T;  4LFC T;  4DV5 T;  4KHP T;  4B3M T;  2UUC T;  2HHH T;  1XMQ T;  4X66 T;  2UXB T;  4OX9 T;  2E5L T;  4X65 T;  4LF9 T;  4DV6 T;  1N33 T;  4LF4 T;  4DR3 T;  1N36 T;  4NXM T;  4JI0 T;  4YY3 T;  4YHH T;  4DR7 T;  2VQE T;  4DV4 T;  2UXD T;  1XNR T;  4B3R T;  4JI8 T;  2UUA T;  4X64 T;  5IWA T; 
#chains in the Genus database with same CATH topology
 4AKH A;  4DUZ T;  3RKO A;  3X1D A;  4JI4 T;  3Q2M A;  1W09 A;  4PK4 A;  1CUN A;  3VU7 H;  4DR4 T;  1UUR A;  2RP4 A;  3HKB E;  3RC3 A;  3ZYM A;  3UU5 A;  2Y8D A;  1UGO A;  4WZX A;  2CWO A;  4U7I A;  5HEU A;  2V7J A;  4DND A;  4GOU A;  1T98 A;  4H9S E;  3T1Y T;  3I1A A;  3Q5E A;  1DU2 A;  3OYX A;  4QX8 B;  1LVF A;  1S35 A;  2WMN A;  5ETW A;  4MHC A;  3A7M A;  3RIF A;  4P0A A;  4DVD A;  2EHO A;  3PU3 A;  4U33 A;  2X9W A;  2XSA A;  1D1A A;  1X9B A;  3AVR A;  3UU8 A;  4TWD A;  5L3B B;  3CQX C;  1MMD A;  5HXR A;  1WR6 A;  4COF A;  4ISS A;  4JEU B;  2BS4 A;  2MBG A;  3AE1 A;  2E5L T;  3VKG A;  2ZMA A;  3ZST A;  5HWY A;  3EAB A;  3N2O A;  2KND A;  2WDR A;  3KDS E;  4CI2 B;  3EAM A;  4B3R T;  2XHE B;  2CXF A;  4G2A A;  4ASK A;  4NUU A;  5CB4 E;  4GKJ T;  3C64 A;  1FMW A;  4L5G A;  3F2E A;  4CN1 A;  4AQF C;  4X62 T;  3UFG A;  2V6Y A;  2LRL A;  5JDL A;  2LM2 A;  5ABF B;  4LF6 T;  5DQV A;  2W2U A;  2ES0 A;  2ZM2 A;  2J62 A;  5FXV A;  4B6X A;  1HNX T;  1UK5 A;  2V1D B;  5KDM C;  4I0U A;  3ZMU B;  3AED A;  3CWZ B;  3ZT7 A;  3C98 B;  3B57 A;  1M7K A;  4AQY T;  4KI0 F;  4JI2 T;  3KFW X;  3C4W A;  2WBL A;  2ZM0 A;  5CFB A;  1YKE B;  5FMN A;  2EHO D;  3AXJ A;  3UUM A;  1H7C A;  2LSG A;  4M1P A;  3AVS A;  5HXE A;  4F6R C;  4X66 T;  3AE3 A;  4HN9 A;  5AQO B;  3N9P A;  4JEH B;  3EUH A;  4MLK A;  2N9D A;  1VOM A;  4AIS A;  4JI0 T;  2H88 A;  5AQI B;  4EB6 E;  3CIR A;  2W0G A;  1SUM B;  2JQK A;  4I4T E;  2E9X C;  2CE7 A;  2WWU A;  3NZP A;  3AAA B;  4JV5 T;  2MOZ A;  1QLB A;  1YQ4 A;  1HTJ F;  5HXC A;  1O3X A;  1WR0 A;  4CXW A;  2XZE A;  4KUM B;  2XAG B;  4YJ2 E;  3W15 B;  2B76 A;  3ZYK A;  4CI3 B;  3JAE A;  2I0M A;  1WCR A;  4B3T T;  2N1G A;  3KBU A;  1IAP A;  2NR4 A;  2ODV A;  3C50 A;  2LKH A;  2WP9 A;  3PTR B;  2OLT A;  3P7I A;  2BS3 A;  3H37 A;  4O4I E;  3AEB A;  2B1E A;  3MAC A;  4AQF A;  4JYA T;  3FHN A;  4NPP A;  3AE4 A;  3JAD A;  2PTF A;  5AQL B;  1E2A A;  3PV0 F;  2CLY B;  2X0L B;  5FL1 A;  1U5P A;  2K9A A;  3JCF A;  3QB5 A;  3AE6 A;  1HG2 A;  3ZN1 B;  3RRC A;  5TAO A;  1XMQ T;  2WY2 A;  3PUV F;  2UXB T;  2XM1 A;  4ZI2 C;  4LMK A;  4LF9 T;  1XDO A;  2XUE A;  4ZXL A;  1MIW A;  5L3C B;  4KMC A;  4E7S A;  5HEG A;  3IF8 B;  2EHO B;  4CQI A;  1UCU A;  5JR9 A;  5LGT B;  4IDQ A;  3ZPO A;  3AE5 A;  3TKL B;  4PJN A;  2DI4 A;  3F57 A;  1NEK A;  4YHJ A;  3GN5 A;  3RI5 A;  3RQU A;  3TLS A;  2XQ5 A;  3VKH A;  2JQQ A;  4IE6 A;  4PJJ A;  4I50 E;  3ZJ2 A;  3R84 B;  3RYC E;  2VK9 A;  3I9Y A;  3Q5D A;  5LGN B;  2KXP B;  5JRE A;  4I43 B;  2C5I T;  2JQ9 A;  4OFZ A;  1D1C A;  4YTM A;  1QUU A;  2BZB A;  2XQ3 A;  4OHF A;  2KWH A;  2V6Y B;  3IA3 A;  2SPC A;  5JQG E;  3M65 A;  3SRZ A;  4XBF B;  2XQ8 A;  5LNK A;  4TNV A;  3AEG A;  2BBJ A;  3SFD A;  3EDU A;  4LML A;  2UUC T;  2DWK A;  5L4H A;  3ZT5 A;  4EV6 A;  2W63 A;  3I0Q A;  2KT9 A;  4ZS2 A;  2PJQ A;  2BG9 E;  2BBH A;  3FXE B;  4NIQ A;  4IDP A;  4DR3 T;  1QSD A;  1UX4 A;  4YY3 T;  5JTG A;  2BVL A;  4HFE A;  5ADX L;  2V5D A;  2H7V C;  5FVK A;  5J1G A;  1FMV A;  3EVY A;  2LLY A;  1UUS A;  4GK5 E;  1XWM A;  4O2B E;  4CXY A;  2LE8 A;  4EZ4 A;  3MA9 A;  2X0H A;  3RYH E;  2CEA A;  2CHO A;  3UU4 A;  4U74 A;  1Y01 A;  4Z90 A;  5LYJ E;  4HFH A;  2XAJ B;  3NBX X;  4UF0 A;  4HFD A;  4A56 A;  1HS7 A;  5AQK B;  5LMN T;  1G73 A;  3FZM B;  2CXL A;  2J1D G;  3PJA A;  4UV8 B;  3PUY F;  2CHN A;  5EK3 A;  4HWD A;  4YT0 A;  5FY0 A;  2WM9 A;  1ZKE A;  2V7L A;  4TWF A;  1HNW T;  4DUY T;  3LBX A;  3OYZ A;  3BK9 A;  3FBL A;  4TV9 E;  5FL0 A;  5HEJ A;  3RHW A;  4UR9 A;  4HWC A;  4I55 E;  3RIU C;  2CBJ A;  5C3J A;  2NW9 A;  5L3G B;  2XQ4 A;  3VR8 A;  2CWY A;  4H9P C;  2WU2 A;  1OED C;  3O1I A;  3LJC A;  4X1Y E;  2V6X A;  4FJO A;  1KF6 A;  4O2A E;  5HEH A;  2YEV C;  4CN6 A;  4FI5 A;  2W67 A;  1XZY A;  3KV4 A;  4OYJ A;  5AQU B;  4O4J E;  4UIG A;  2QYW A;  2UUA T;  5CGM A;  1AJ3 A;  2NTX A;  4J2C A;  2LJL A;  4IL9 A;  4AI6 A;  4QX7 B;  5AQH B;  3BQK A;  1W0B A;  3N9M A;  5AQM B;  2UXX B;  2PFV A;  1KNP A;  4DMW A;  1M62 A;  2MYS A;  5LGU B;  4PW8 A;  4U2Z A;  5L4E A;  3EI0 A;  2X66 A;  3HA4 A;  1ZHC A;  3AEA A;  1N32 T;  1OXZ A;  3HI2 A;  4WYV A;  4LF7 T;  3IHR A;  5LB7 B;  5JRC A;  5JR9 B;  3ZMV B;  3ZC1 A;  3M3Z B;  3ZMT B;  4WNK A;  3H3M A;  3K3N A;  2IC9 A;  3N9O A;  2K3W A;  3GN5 B;  3PUR A;  1IJ5 A;  2X51 A;  3U78 A;  2BKN A;  2Q9Q C;  4U2Y A;  1ZV4 X;  2A9U A;  4X65 T;  2VKO A;  3FZH B;  1MMA A;  3SFE A;  1N33 T;  2OV9 A;  4MAL A;  4TZ4 C;  4F8H A;  4ILC A;  3AA6 B;  2XAH B;  2IML A;  3J9X 1;  2I6H A;  2IDO B;  2C5K T;  4H9N C;  3D0T A;  4B3S T;  1OED A;  2NOX A;  2JPF A;  1OED E;  3AA7 B;  2BG9 B;  2UU9 T;  1Y64 B;  4DO0 A;  2QVA A;  2A72 A;  2WB5 A;  3JC6 D;  2WMO A;  3PUZ F;  4DR1 T;  3GA8 A;  2KMF A;  1Z0P A;  4DV7 T;  4EAH A;  3FZL B;  2DNX A;  2HPJ A;  3RKG A;  3RPU A;  5C8Y E;  4UEL A;  3PUX F;  1I94 T;  4LF8 T;  3O4X E;  1J5W A;  4ZI3 C;  5AQG B;  1VCS A;  1BR1 A;  2YDQ A;  2CM0 A;  4YSY A;  4UF0 B;  4WW0 A;  2FUP A;  2HHH T;  1HFA A;  3ZYL A;  4JUY A;  4KHZ F;  3PU8 A;  4HWH A;  2BS2 A;  3KVA A;  4X1I E;  5FP3 A;  4G63 A;  5LXT E;  4LF4 T;  4IT4 A;  3ETV A;  5HWX A;  5ABH A;  5L3E B;  2CRB A;  3ZJ1 A;  2FJE A;  2WZH A;  3OKQ A;  3T8O A;  5AQT B;  3EHZ A;  2IHR 1;  4GYR A;  4TNW A;  5L2L A;  1W0A A;  2BDE A;  3N5L A;  5FXZ A;  4DBR A;  3F31 A;  4AKR B;  3BQI A;  2Q9Q A;  5JVD E;  2FJA A;  3RGL A;  2X68 A;  5F8P A;  5F3J A;  3O9X A;  5AQP B;  3IBP A;  1XNQ T;  1XMO T;  2XQ6 A;  4JI5 T;  3DTO A;  2VVS A;  3FZF B;  4H63 V;  4WBN E;  5BR8 T;  4JLE A;  1S94 A;  3N9N A;  1J5E T;  4U3C A;  5JDN A;  5JDF A;  2BKP A;  2VVN A;  4YFS A;  1HNZ T;  5AFU L;  2CA5 A;  5HCJ A;  2IC6 A;  1WRD A;  2LHR A;  5J2U E;  1HX8 A;  3TLW A;  1NWM X;  4PFO A;  4OYK A;  4YSZ A;  2D0U A;  5LG3 A;  4EEB A;  1MND A;  2YU1 A;  1E1H B;  4LMJ A;  4LF5 T;  2DHR A;  4PK6 A;  3KBT A;  4AKI A;  5FY1 A;  4QWN B;  2G0U A;  2OA5 A;  3TLV A;  3N9Q A;  2A2F X;  4H63 H;  3QUJ A;  2XY8 B;  3ETU A;  3LDQ B;  5DJQ C;  3PUA A;  3L3P A;  3C51 A;  4YTP A;  3L8R A;  3K3O A;  2XQ9 A;  3RLF F;  2DCF A;  4YHH T;  3DJB A;  3QNU A;  1HCI A;  3ZCI A;  4DV4 T;  2FJB A;  2Y48 B;  2LM9 A;  2QA7 A;  1R8I A;  4IHJ E;  4ANJ A;  2YU2 A;  2WS3 A;  4C91 A;  3C4Z A;  3ZC0 A;  5KX5 E;  1FJG T;  2IUB A;  4H9R C;  4EED A;  4CN4 A;  4DV3 T;  2ACX A;  2XTL A;  2V7K A;  2VQF T;  5GON E;  2YN6 A;  2JQH A;  4JI3 T;  3ANW A;  4DV2 T;  3I9W A;  2VB6 A;  1IBL T;  2I59 A;  4QH4 A;  1YW0 A;  3R6N A;  3QOF A;  4MBQ A;  4TN7 B;  5ABE A;  4HE8 A;  1YKH B;  3P4P A;  4QKN A;  2NW7 A;  2UUB T;  1HF8 A;  1ZOY A;  3E0Z A;  2KWI B;  2VUR A;  1OED B;  1SE7 A;  1FEW A;  2YKS A;  2ZM8 A;  2E9X A;  2YDS A;  2XQA A;  4YJ3 E;  3V5U A;  3LK2 B;  2LSI A;  4O4L E;  4ILU A;  1SHZ C;  4ZEY A;  2RA1 A;  4PJL A;  4HGA A;  3WI3 A;  4AKG A;  3P4W A;  4OK0 A;  4QH1 A;  4IE7 A;  2K24 A;  3AAE B;  1N36 T;  2D0T A;  3AE9 A;  3ONL C;  2WZI A;  5JDH A;  4KBM B;  4XZC A;  3P4R A;  3L09 A;  4L0R A;  1JNR A;  2WSS V;  2VKH A;  3HKC E;  1XDP A;  1W9R A;  1VCT A;  2ACZ A;  3ONJ A;  3SS1 A;  4V1A v;  3KIN B;  4UXN B;  1J1J A;  3NVO A;  2CBI A;  4C90 A;  1D0Y A;  3N2G E;  5AQV B;  4IE4 A;  3AXJ B;  3EDV A;  3AA0 B;  5CJ5 A;  4KP3 C;  4PNI A;  2V5C A;  3FXD B;  3UUN A;  3MXZ A;  1MMG A;  2X9X A;  2W66 A;  3RYI E;  1OWA A;  2FBW A;  3KV6 A;  2XSB A;  2V7M A;  1D1B A;  4HTE A;  2CLY C;  3PDY A;  4GYS A;  1IBK T;  2YOE A;  1BR2 A;  4X5T A;  4CZZ B;  5LOV E;  1MIY A;  4ZI7 E;  2M6I A;  2LSY A;  3K8P C;  4BAY B;  5HAX A;  4LFC T;  3MKD A;  3QK6 A;  4MFR A;  5FKY A;  5DQW A;  5HEO A;  2W61 A;  3BQL A;  3N2K E;  2V26 A;  4E7Z A;  3E08 A;  2EHO C;  4CXX A;  4HWF A;  3P8C D;  3AE8 A;  5IYZ E;  4K0U A;  2L9Q A;  2UXD T;  2E2A A;  1XNR T;  3RC8 A;  1US7 B;  2X9Y A;  4X64 T;  5IWA T;  3UQ4 A;  2NW8 A;  4X20 E;  1CHU A;  2XPK A;  3AE2 A;  1VRB A;  1EZ3 A;  5LA6 E;  3T1H T;  2HN1 A;  4X1K E;  3ESL A;  3AE7 A;  5LMU T;  4PK5 A;  4A5X A;  3H3A A;  4DR2 T;  3B5M A;  3CX8 B;  2HH7 A;  2D5U A;  4TUY E;  2E8I A;  4QH5 A;  4ZI2 D;  3ZMS B;  4N78 D;  4DID B;  3QB5 K;  1I6Z A;  3OPC A;  3P4Q A;  4IE0 A;  4AKL A;  3HKE E;  2X9H A;  1IZN B;  1U4Q A;  3CK6 A;  1T7S A;  4EYY R;  4BA9 A;  1LKX A;  3MK7 C;  5CA0 E;  4AQG A;  5HXH A;  4DMV A;  3TLU A;  2NTY A;  3Q5X A;  4P1N A;  5KXJ A;  3E22 E;  4EXT A;  3VR9 A;  4IDZ A;  4YTN A;  4UV9 B;  5LHG B;  2ZLY A;  5E0O A;  3CPZ A;  3V5S A;  2X67 A;  4PAG A;  5LHI B;  3OBV E;  4QXC B;  4NXN T;  3UT5 E;  2E9X B;  3UU6 A;  3CVR A;  3CX6 B;  3RH3 A;  4ZS3 A;  2XAS B;  4UVC B;  2KZ7 B;  4AXP A;  1HX1 B;  2W00 A;  5BMV E;  4Q25 A;  3WAJ A;  2QGS A;  3Q9D A;  3FB2 A;  2WWV A;  3MZK B;  3OVU A;  3RIU A;  3RIA A;  4GKK T;  2KSR A;  1T72 A;  3QC9 A;  3VRB A;  5L47 A;  1Z8U A;  1WYB A;  5AQF B;  3PE0 A;  1NEN A;  3RQW A;  4O8S A;  5AQR B;  2V8S V;  3AEC A;  4TX5 A;  4IDO A;  5LJM A;  2MTQ A;  3NRY A;  2IAK A;  3LFM A;  3UUB A;  1BR4 A;  1KFY A;  3FZK B;  2E5V A;  4H9Q C;  1GQE A;  2XM2 A;  2Y6X A;  1HG5 A;  3KV5 A;  2Z6E A;  4BJN A;  1D0Z A;  1G8X A;  3A8Y C;  4QXH B;  2WDV A;  4ILB A;  4HFI A;  2JMH A;  2LOP A;  4IDN A;  2K5B B;  3KV9 A;  3B13 A;  4AIU A;  2CPT A;  2VKD A;  3GWH A;  4QHO A;  1IJ6 A;  2CMR A;  2C5J A;  2D2S A;  4EOZ B;  5FYM A;  3PUG A;  3NWI A;  2AXD S;  4DV1 T;  3CML A;  1YD8 G;  2VKJ A;  2JJ9 A;  5LBQ B;  5C2T A;  2ZM6 T;  3O1H A;  2P9B A;  4U31 A;  5J0Z A;  3LBX B;  4PJM A;  1WLX A;  3C4X A;  4LFB T;  4GK0 E;  5EZY E;  3LSV A;  3ZMZ B;  2LSJ A;  5JR9 C;  3SOL A;  2WCA A;  2W62 A;  5H6R B;  4JBW F;  2PG8 A;  2AE9 A;  4HFV A;  4IRE A;  2K48 A;  4ILA A;  2YIN A;  2D9D A;  3OTO T;  3J7Y q;  1HR0 T;  1D0X A;  5IUX A;  2NP9 A;  4O4H E;  3AAI A;  2YK0 A;  5H6Q B;  3KVB A;  3NKZ A;  5LCY A;  2WQY A;  5AQQ B;  3RF1 A;  5JDM A;  5IHY A;  5FXW A;  5AQJ B;  1FIO A;  3UUX B;  1ZEE A;  3P50 A;  3TLT A;  5JDQ A;  3CX7 B;  2W4X A;  2VQE T;  5LG4 A;  1X79 A;  2XQY A;  3K1S A;  1MMN A;  3N9L A;  4ZOL E;  2H7O A;  3K3Q C;  5F5W A;  3LG7 A;  2R6G F;  2X0Y A;  1BR0 A;  3GMI A;  2BG9 C;  4HFC A;  3PJA J;  3FBZ A;  1V9D A;  5JRC B;  4DV0 T;  3IEE A;  4PFP A;  2WU5 A;  4JI7 T;  5LP6 E;  2VAS A;  2VL0 A;  2CCQ A;  3S4U A;  4UEM A;  4IIJ E;  2LT3 A;  2LOS A;  4A97 A;  2DL1 A;  1SA0 E;  2HN2 A;  5FNV E;  5M4Y A;  2VL8 A;  5HYA A;  3RRW A;  4YLH A;  2H3R A;  2C0S A;  2Q9Q D;  4DR6 T;  3DP7 A;  2GK9 A;  4HWI B;  2A3D A;  3RX6 A;  3ZKR A;  2UXN B;  3CKD A;  3UTK A;  4IL4 A;  2LKG A;  3LK4 2;  2H89 A;  2L8K A;  5HCM A;  2RPA A;  2FJD A;  5FVL A;  3UFE A;  4DV6 T;  2BKO A;  3ZEF B;  4P0B A;  1YXR A;  2L3L A;  5L3D B;  4HKA A;  3ZCJ A;  3AB3 B;  3WAK A;  4UVA B;  2IW5 B;  2BVM A;  2ODU A;  2XQ7 A;  2KIN B;  4JI1 T;  3G06 A;  3ZLI A;  4IE5 A;  5ABG A;  4DBQ A;  4U7Y A;  2JRK A;  5FXX A;  4EGW A;  4DR5 T;  4K0K T;  5JH7 E;  4TV8 E;  3RYF E;  5A1L A;  2UXC T;  2J47 A;  5LJN A;  2JMK A;  4ERR A;  1NAF A;  4ZI3 D;  1LRZ A;  2MPK A;  4YSX A;  4JI6 T;  3PUW F;  4Z8X A;  2LEH A;  1KEY A;  2DLR A;  5JDG A;  4KX6 A;  2F4V T;  5AQS B;  3AEF A;  2BG9 A;  2LHN A;  3HL6 A;  1IBM T;  3JC6 C;  3VRA A;  3L39 A;  4NUV A;  4LFA T;  2XAQ B;  5LBM A;  3ZT6 A;  4L9I A;  3ZSS A;  1KNR A;  1L0V A;  1N34 T;  3PUQ A;  2WDQ A;  4Z91 A;  4DV5 T;  5HXS A;  5CA1 E;  4ZZB A;  2LRK A;  3A5X A;  3PUS A;  5ABF A;  3SWH A;  3UU3 A;  4EYU A;  3HR0 A;  1T8B A;  2Q9Q B;  4CI1 B;  1LVK A;  4A98 A;  1KK7 A;  1YQ3 A;  3AEE A;  4DR7 T;  4YXD A;  2MAW A;  3NRX A;  3I0O A;  4XAX B;  3U3I A;  2HPL A;  5KMG P;  4JI8 T;  2E9X D;  2JIW A;  5FY7 A;  3HKD E;  3UQ7 A;  2QRX A;  2VWA A;  1E7P A;  3ABV A;  2M6B A;  1B7T A;  4HEA A;  4WBO A;  1KNZ A;  1ZP0 A;  5EK4 A;  3MJX A;  4EZH A;  3OJA A;  2M67 A;  1MIV A;  4GIW A;  3NZQ A;  1WFD A;  2XJ7 A;  4ZHQ E;  4P09 A;  2YDR A;  1WYC A;  3P4S A;  2PBI A;  3ONX A;  4ADZ A;  4IST A;  3CQC B;  2KLQ A;  2XAF B;  4QXB B;  5LHH B;  4UVB B;  4HFB A;  2LSK A;  4EIW A;  2IIU A;  5J2T E;  5EK2 A;  3AA1 B;  2CXD A;  4KHP T;  3UUL A;  4B3M T;  2NWB A;  3LK3 B;  3JAF A;  1MNE A;  3O1J A;  4U72 A;  5AQN B;  2J4G A;  4OX9 T;  3Q5W A;  2V7I A;  4TWH A;  4BJM A;  1UX5 A;  1JNZ A;  2DWG A;  2WAU A;  4NXM T;  3CQG B;  3ZN0 B;  5L3F B;  4H9O C;  2N2N A;  3VHL A;  3ANW B;  4ZZC A;  4IGU A;  5DAB A; 
#chains in the Genus database with same CATH homology
 4JV5 T;  4GKJ T;  4JI1 T;  4DV1 T;  4NXN T;  4DUZ T;  4JI4 T;  1FJG T;  4X62 T;  2ZM6 T;  4B3S T;  4DR5 T;  4DV3 T;  4K0K T;  4DV0 T;  1XNQ T;  1XMO T;  4DR4 T;  4LF6 T;  2VQF T;  4JI5 T;  2UU9 T;  5LMN T;  3T1H T;  4JI7 T;  4JI3 T;  4B3T T;  2UXC T;  4LFB T;  4DV2 T;  1IBL T;  5BR8 T;  4GKK T;  1HNX T;  5LMU T;  1J5E T;  4DR1 T;  4DV7 T;  4DR2 T;  1N32 T;  4LF7 T;  3T1Y T;  4JI6 T;  1HNZ T;  1HNW T;  4AQY T;  2UUB T;  4DUY T;  4JI2 T;  4DR6 T;  2F4V T;  4JYA T;  1IBK T;  1I94 T;  4LF8 T;  1IBM T;  3OTO T;  4LFA T;  1HR0 T;  1N34 T;  4LF5 T;  4LFC T;  4DV5 T;  4KHP T;  4B3M T;  2UUC T;  2HHH T;  1XMQ T;  4X66 T;  2UXB T;  4OX9 T;  2E5L T;  4X65 T;  4LF9 T;  4DV6 T;  1N33 T;  4LF4 T;  4DR3 T;  1N36 T;  4NXM T;  4JI0 T;  4YY3 T;  4YHH T;  4DR7 T;  2VQE T;  4DV4 T;  2UXD T;  1XNR T;  4B3R T;  4JI8 T;  2UUA T;  4X64 T;  5IWA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...