4B3TT

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3tT00
4X64T 2VQET 4DV6T 4YHHT 1N36T 2UUAT 4DV2T 4DR5T 4X66T 3OTOT 5LMNT 4GKKT 4DUZT 2ZM6T 4JI4T 4DV5T 4LFCT 1FJGT 4JYAT 1I94T 4DV4T 4NXNT 3T1HT 4AQYT 5IWAT 4B3RT 4KHPT 4DR2T 4LFAT 1N33T 4DV0T 2E5LT 4LF5T 2UXDT 1XMQT 1N34T 4JI0T 4K0KT 4DR1T 2F4VT 4JV5T 1J5ET 4JI5T 4DR7T 4JI6T 1IBKT 1IBLT 1IBMT 4LF9T 1XMOT 4GKJT 2UXBT 1HR0T 5LMUT 4OX9T 4X65T 2UXCT 4LFBT 4JI3T 4LF6T 4DR4T 4B3TT 5BR8T 3T1YT 4LF8T 2UU9T 2HHHT 4LF7T 4YY3T 4DV3T 1HNWT 4JI7T 4DV7T 4DR6T 4DR3T 4LF4T 1N32T 1HNXT 1XNRT 4B3MT 4DV1T 4JI8T 2VQFT 4X62T 4B3ST 2UUBT 2UUCT 1HNZT 1XNQT 4JI1T 4NXMT 4DUYT 4JI2T
chains in the Genus database with same CATH superfamily
3VR9A 2J62A 2LOPA 3OPCA 2BVLA 2Q9QA 2KMFA 3ZMSB 5IYZE 3WAJA 3EVYA 4ZHQE 2LRKA 2D2SA 3ZMTB 2N9DA 4ASKA 4HWCA 3UT5E 4IDPA 3T8OA 4TNVA 3BK9A 3SS1A 2IUBA 2C5KT 4PW8A 2V26A 1MIYA 4QH4A 1M7KA 4EOZB 2Q9QB 4TN7B 2EHOC 3SFEA 1IBLT 5KX5E 2XQ5A 2LKHA 2W4XA 3M3ZB 1DU2A 1UX4A 5IUXA 4WBNE 4JEUB 4IE4A 2BBHA 2ODUA 3M65A 3LK42 1OXZA 1WR6A 2L3LA 4LF8T 2HPLA 3RF1A 5C3JA 4YY3T 3AEFA 1O3XA 2CBIA 1H7CA 3CPZA 2X9HA 1U4QA 1HNXT 2YU1A 2ZM2A 2YKSA 3KDSE 2X67A 4UEMA 4QXHB 3C4WA 5J2UE 2VURA 3UU5A 4ANJA 3KBTA 2X0LB 3HI2A 3EABA 4BA9A 5FL1A 5L47A 3IF8B 5AQNB 3TLVA 4U7IA 5LHGB 5HXHA 1W0AA 4K0UA 3QC9A 5F8PA 4N78D 2XHEB 3KV4A 4TV8E 1EZ3A 2JRKA 5FXZA 2XQ6A 3QB5A 1WR0A 2V7KA 3UU3A 3TLSA 3IBPA 4HWHA 3AA7B 1HX1B 4P0AA 2FJEA 2VK9A 4ISTA 3J7Yq 2LJLA 3N2OA 4ZZCA 4TNWA 2VVNA 4V1Av 1T7SA 3PUXF 2A3DA 5EZYE 4EEBA 3RPUA 5HXRA 3UULA 2M67A 4IE5A 4LFBT 3ZYMA 2ZLYA 4QX8B 5AQVB 4JI3T 4P1NA 3GA8A 2BS2A 2PG8A 3E08A 1Y01A 4AQFA 4YSYA 1HS7A 2A72A 3I0OA 5LG4A 2K24A 3EDUA 5FXWA 2LSIA 5KMGP 4AKGA 5AQJB 2VL0A 4H9NC 4X1YE 2KWIB 1D0YA 4PJJA 4U74A 4XZCA 3CQXC 4CI3B 1XNQT 4NXMT 5AQIB 1L0VA 1JNZA 3NZPA 2X66A 4XBFB 3N2KE 3LK2B 5L3FB 4FI5A 3P4SA 1KK7A 2WQYA 4H9OC 4FJOA 4GK0E 1AJ3A 5HWYA 2CEAA 2DHRA 5J2TE 3PUYF 3OYXA 4UVBB 2GK9A 2H88A 2PBIA 4HWDA 4LFAT 4YSXA 3MKDA 2BVMA 2LHRA 4X5TA 2V1DB 5C2TA 1IJ5A 4CI1B 2OLTA 4PFOA 5KDMC 1VCTA 3PURA 4O4HE 1FMVA 1XMOT 2UXBT 1HR0T 4OX9T 5HXSA 4OK0A 1LVFA 2Z6EA 4YHJA 2UXCT 5CA0E 2VKJA 4ZOLE 4B3TT 3MJXA 2BS4A 3ZMZB 2D0TA 2CWYA 3TLWA 1HNWT 4AKRB 4DR3T 3ZJ1A 4EYUA 4O4IE 3MACA 3GN5B 2CBJA 1HFAA 2IW5B 2XQYA 1HTJF 2QRXA 2XTLA 3AEBA 2E8IA 3RGLA 1BR2A 4JI2T 4ZS3A 1T72A 1J5WA 3WAKA 4HWFA 5HEGA 2NTXA 2XAQB 3RHWA 2VKOA 3KFWX 4LMJA 2Y48B 2VKDA 5AQHB 3RYHE 3H3AA 3NWIA 3ABVA 4PFPA 4UR9A 3ZT5A 5ABEA 2YDSA 2FJAA 2N1GA 4XAXB 1ZHCA 4EEDA 3PJAA 4DV0T 5JRCA 3NBXX 3A8YC 3KV9A 2IC9A 4C90A 3AA0B 4JI5T 3KVBA 1YQ4A 3AEDA 2DWKA 3KINB 2V6YB 3AE7A 3OBVE 2ODVA 2LSKA 4MALA 3SRZA 3LDQB 3HR0A 3U78A 5DQVA 2LSYA 4YJ3E 4ZI3D 2DI4A 4HEAA 2G0UA 3AEGA 3ZSTA 4ADZA 3W15B 3C50A 2LKGA 1OEDC 2CMRA 4DV1T 2LLYA 3P4QA 3OJAA 2BG9C 3VRAA 3VRBA 1I6ZA 1NENA 2NP9A 5JTGA 2C5JA 4DV6T 2XSBA 2CHOA 5ABFB 2BDEA 2EHOA 3RYCE 3RRCA 2L9QA 4TWDA 3IA3A 5HWXA 2YDRA 4PJNA 5DJQC 2MYSA 1VRBA 2XM2A 2J4GA 4WZXA 4ZXLA 3NRYA 3PUSA 3NRXA 2W2UA 2X9XA 2ES0A 3AAAB 5IHYA 4UVAB 2X0YA 3RC8A 2AXDS 4YTMA 3CVRA 1V9DA 4U2YA 4DBRA 5ABGA 2MOZA 4ILUA 3RIFA 2BKPA 2V5CA 4CN4A 3OKQA 4JBWF 3ZMVB 2WP9A 5LHIB 5L3BB 2OV9A 4YLHA 3P8CD 4IE6A 3R84B 3PV0F 3OYZA 1YW0A 2CE7A 4DR6T 1X79A 1XNRT 4AISA 4YTNA 2VL8A 4E7SA 3NKZA 1KNPA 2XSAA 1YKEB 3H37A 4WBOA 5LGUB 2VASA 3ZT7A 2KSRA 5FXXA 5FMNA 3AE6A 4A56A 2LEHA 4MLKA 3D0TA 3P50A 5LB7B 3AECA 4GYSA 2E5VA 4YSZA 4H9RC 3AB3B 5LBMA 2CWOA 5CB4E 3AE3A 1Y64B 2X9WA 4UIGA 2MPKA 4HFVA 4H9PC 3A5XA 5AQTB 1FEWA 4AXPA 3U3IA 4M1PA 2NTYA 3HA4A 4HWIB 1GQEA 1SUMB 4BAYB 4KUMB 1D0ZA 3RIUC 4YJ2E 2JJ9A 2X0HA 3UQ7A 3C51A 4GKJT 2E9XD 2MTQA 2NW7A 4OFZA 4AI6A 3AXJA 3TLUA 3P4PA 3NZQA 1JNRA 2IIUA 4IDOA 3J9X1 4G63A 2JQQA 2LSGA 4U7YA 4IIJE 4PK5A 3RLFF 4A98A 5J1GA 3RH3A 5FVKA 1N32T 5LCYA 3FBLA 3B5MA 4CXWA 3N9OA 5FP3A 3AXJB 3GMIA 2WDVA 3HKEE 2XAHB 5HXCA 5ADXL 4QH5A 4DIDB 3P4RA 4UELA 1N36T 4MFRA 3AEEA 4QHOA 4X66T 1HG5A 5HEHA 3GWHA 3Q5DA 3JADA 5FYMA 2ZM6T 2JMHA 4O4JE 5L4HA 2J1DG 4ZZBA 1XDPA 3AE5A 5A1LA 5LNKA 5H6RB 3K8PC 2CLYC 5IWAT 1E1HB 3EAMA 2AE9A 4L9IA 3FZHB 1Z0PA 1N33T 4HGAA 4I0UA 3MA9A 1SE7A 2I59A 1XDOA 4DVDA 3JAEA 4X1IE 2WZHA 2UXDT 4DNDA 2F4VT 5L4EA 3N9MA 4ILAA 2WY2A 4I4TE 4O2BE 4DR7T 2YN6A 4ILBA 1IBKT 2P9BA 3UUXB 4Z8XA 3V5UA 4KP3C 2K3WA 4PAGA 4GIWA 1NAFA 4IDQA 4HFHA 3CQGB 2XQ7A 2BKOA 2R6GF 3T1YT 4P0BA 3PTRB 5AQRB 3LBXA 3WI3A 4EIWA 4KBMB 4NUVA 3PJAJ 2B1EA 2W62A 2D9DA 2WMNA 3AVSA 5L3DB 3BQLA 4U72A 2RA1A 2LT3A 4MHCA 5AQSB 1FIOA 2DWGA 4HKAA 3ZYKA 2KXPB 2VB6A 1WYBA 2SPCA 5FY7A 3B13A 4DR5T 3LJCA 4DUZT 3LBXB 2V7MA 3ETUA 5JREA 5GONE 2PFVA 2W00A 2H7VC 3AAEB 5ABHA 4AKHA 1WYCA 3PU3A 1CUNA 2Q9QC 3FZFB 5KXJA 1CHUA 3C98B 1BR0A 5AQMB 5CJ5A 3CMLA 4DR2T 1MMNA 4H63V 1T98A 2WZIA 5HEJA 2LOSA 3N9LA 5LOVE 3CX7B 4UXNB 2QVAA 2JQ9A 3AVRA 1OEDA 2FUPA 1KFYA 4U31A 4WNKA 1IBMT 4LF9T 3FZMB 2E2AA 1HG2A 2BG9A 2CPTA 3FZKB 4PK6A 2X51A 1NEKA 4G2AA 5H6QB 3PUAA 1S94A 4EAHA 4KHZF 4OYJA 3AE2A 3CQCB 2W63A 2ACZA 1OEDB 3A7MA 3AE8A 3PUQA 1MMAA 5HXEA 5LA6E 4H63H 3AE9A 2Q9QD 3IHRA 3N2GE 2D0UA 2BG9B 3ZC0A 1HX8A 4WYVA 3ANWA 2XAJB 4AKIA 2DL1A 2HPJA 2ZMAA 3RIAA 3ZYLA 4AQGA 2DCFA 1WCRA 4GKKT 1D1AA 3BQKA 1QSDA 4JI4T 4PK4A 1D0XA 2LM9A 2WB5A 1FJGT 2XM1A 3T1HT 4IDNA 3F31A 3UU8A 1HF8A 3TKLB 2JPFA 2KLQA 1U5PA 2HN1A 4TX5A 4UV9B 2VVSA 4WW0A 2Y6XA 4ZI3C 4LMLA 5AQFB 3UUMA 5LJMA 1UGOA 1SHZC 2V5DA 5AQUB 4HFDA 5LHHB 5BMVE 1B7TA 4DMWA 3QUJA 2HN2A 3Q5EA 4HTEA 2JIWA 3LSVA 3ZEFB 2X68A 3UQ4A 3BQIA 5AQPB 2MBGA 3F57A 1YD8G 2UXNB 2I0MA 4LF7T 4CXYA 2CXDA 5HEOA 3N5LA 4YFSA 4JI7T 4MBQA 3UFEA 1UURA 3ZN0B 4HN9A 3UFGA 4J2CA 5LGTB 2WM9A 5JRCB 5E0OA 3FXDB 1BR4A 2CHNA 2K48A 1QUUA 2XAGB 2JQHA 4EZHA 3RIUA 5AQLB 4UF0A 4I50E 5DABA 3OVUA 3ZT6A 3SFDA 3B57A 5JQGE 1ZOYA 4GYRA 3AAIA 1YQ3A 3DP7A 3UUNA 2FJDA 3AEAA 3JC6D 5AQGB 4OHFA 2WS3A 2XPKA 1ZV4X 3EDVA 3Q2MA 4IL4A 4UF0B 2JQKA 5HYAA 3N9PA 4HE8A 4CQIA 3CX6B 1WRDA 1UCUA 1Z8UA 2IC6A 2YDQA 1US7B 3MZKB 2YEVC 4DR4T 4O8SA 1ZP0A 2EHOB 2HHHT 2CXLA 5HCJA 4LF4T 2LM2A 4X1KE 2K9AA 2VWAA 2UUCT 5LP6E 4IL9A 1LRZA 3L3PA 5CFBA 1MMDA 4A97A 3MXZA 4X64T 2XQ8A 3ZC1A 4ZI7E 2WSSV 5EK3A 3QK6A 3ZCJA 5JR9C 4X20E 2LSJA 2V7JA 5M4YA 4LFCT 3DJBA 1D1CA 1I94T 2CLYB 2E9XC 3AA6B 4NXNT 3K3QC 4ZEYA 2QA7A 4PJMA 5L3EB 5LYJE 4KHPT 3PE0A 3I1AA 4IGUA 4IE0A 4LF5T 3RYIE 5CGMA 1XMQT 1UX5A 4JI0T 3H3MA 4CXXA 3ONXA 5HCMA 4JI6T 4QKNA 4U33A 3CWZB 4X65T 3PUWF 3KV6A 4UVCB 3LG7A 2V8SV 2N2NA 5LXTE 4COFA 5F3JA 3FZLB 2UU9T 4YT0A 3MK7C 4NIQA 3SOLA 4TZ4C 3ZMUB 1ZEEA 2BZBA 5HEUA 3RKGA 3VKGA 1MIWA 4IDZA 5FVLA 4JI8T 4KI0F 3CIRA 2VQFT 5C8YE 1QLBA 3KV5A 5LJNA 4CZZB 2WAUA 4QH1A 3G06A 3S4UA 4EZ4A 5JDLA 5JDGA 3ZSSA 4Z90A 2NOXA 2DLRA 2PJQA 4IE7A 1M62A 3IEEA 4U3CA 2MAWA 4HFBA 4JEHB 3QNUA 2C0SA 3N9NA 2OA5A 2KNDA 2WU5A 1IJ6A 1SA0E 3CKDA 3ZKRA 4CN1A 1J5ET 1MMGA 3L09A 3C4XA 1KEYA 2CCQA 2L8KA 3HKCE 5AQOB 5AFUL 2I6HA 2ZM0A 4TUYE 3Q9DA 5JDQA 4EB6E 2WU2A 2XQAA 3X1DA 2XAFB 4HFCA 4O4LE 2M6BA 3QB5K 2KINB 2EHOD 2YU2A 4YTPA 4TWHA 4X62T 1OWAA 2IMLA 5J0ZA 4I43B 2QGSA 3F2EA 5EK4A 1XWMA 3UTKA 4YHHT 2UUAT 1UK5A 4LMKA 5JDHA 2ZM8A 4IT4A 4BJMA 4QXCB 4P09A 4L0RA 2IAKA 4KMCA 2WWUA 3K3OA 2XZEA 1XZYA 5L2LA 1OEDE 3RQUA 1VCSA 2W67A 2CA5A 3I0QA 4TWFA 2XASB 4EXTA 2BS3A 4GK5E 2BG9E 3E0ZA 5JDNA 3O9XA 2V7LA 1X9BA 1KF6A 4DO0A 4K0KT 5ETWA 4GOUA 2Y8DA 2RP4A 4JLEA 4ILCA 1KNRA 3LK3B 1WLXA 3EUHA 4A5XA 3LFMA 1D1BA 2YK0A 4IHJE 3EHZA 3HL6A 2NWBA 4EV6A 2H89A 1WFDA 5L3GB 5L3CB 4ERRA 2X9YA 2HH7A 4B3MT 5FY0A 2J47A 4HFIA 3TLTA 2W61A 2WDQA 3EI0A 4JI1T 2VKHA 3SWHA 2FJBA 4ZI2C 2ACXA 1YXRA 5FKYA 4DMVA 2XJ7A 5JDMA 3ZPOA 5EK2A 3OTOT 4DV5T 2QYWA 3ZN1B 4JUYA 5LBQB 3HKBE 2FBWA 4JYAT 1S35A 2BKNA 4DV4T 2YOEA 1R8IA 3L39A 3RQWA 2IHR1 4AQYT 3GN5A 2V7IA 1G73A 1KNZA 2K5BB 3PUZF 3R6NA 2E5LT 1MNDA 3AE1A 3V5SA 3I9YA 3C64A 2RPAA 2UXXB 3RKOA 4DR1T 2CRBA 4JV5T 3ZLIA 5JVDE 4AKLA 3FXEB 5HAXA 3ANWB 1MIVA 4NUUA 2XQ4A 4ZI2D 1J1JA 4ISSA 3ESLA 4LF6T 3E22E 3P7IA 5JR9A 3ETVA 2CM0A 3RX6A 4DV7T 2NW8A 2V6XA 4KX6A 2E9XA 4HFEA 5FNVE 4QXBB 4Z91A 1LVKA 2W0GA 1G8XA 3FB2A 2A2FX 1FMWA 2PTFA 2DNXA 3CX8B 4U2ZA 2WMOA 3DTOA 2V6YA 3JC6C 3UU4A 3CK6A 1VOMA 3O1IA 2WCAA 4Q25A 3RC3A 4YXDA 3FBZA 4F6RC 5JR9B 4ZS2A 4AIUA 4AQFC 3ONJA 1T8BA 1W9RA 5LGNB 2E9XB 2YINA 3VKHA 3I9WA 2KZ7B 2KWHA 3O4XE 3HKDE 3PUVF 2XQ3A 5FY1A 5LG3A 1HCIA 3O1HA 4E7ZA 4DBQA 3ZJ2A 3UUBA 2D5UA 4PNIA 1N34T 1YKHB 3JCFA 5ABFA 3P4WA 4B6XA 5F5WA 2LRLA 5LMUT 2W66A 4L5GA 3NVOA 3PDYA 3UU6A 5JDFA 1E2AA 1W09A 2CXFA 2H3RA 5FXVA 5BR8T 2KT9A 3ONLC 3PU8A 4DV3T 2NW9A 3QOFA 4C91A 5CA1E 2BBJA 4IREA 3VR8A 3Q5WA 1MNEA 2JMKA 4B3ST 1HNZT 1E7PA 2LE8A 3Q5XA 2VQET 1ZKEA 4H9QC 4DV2T 4F8HA 3AA1B 5LMNT 5TAOA 1IZNB 2XUEA 3AE4A 5DQWA 4QX7B 2B76A 3JAFA 3O1JA 3K3NA 4UV8B 4EYYR 4B3RT 4O2AE 4TV9E 4H9SE 3RI5A 4BJNA 2H7OA 5AQQB 2XY8B 2XQ9A 3VHLA 3KVAA 2A9UA 2LHNA 1W0BA 3KBUA 3C4ZA 2WDRA 3ZCIA 4OYKA 3L8RA 3K1SA 5JH7E 5AQKB 4CI2B 1UUSA 2M6IA 4CN6A 2WWVA 3PUGA 4NPPA 2IDOB 2WBLA 5FL0A 4PJLA 3RRWA 2C5IT 4I55E 3FHNA 1IAPA 3VU7H 1LKXA 2NR4A 2UUBT 1BR1A 3N9QA 4DUYT 1NWMX 4QWNB 4EGWA 3RYFE
chains in the Genus database with same CATH topology
4X64T 2VQET 4DV6T 4YHHT 1N36T 2UUAT 4DV2T 4DR5T 4X66T 3OTOT 5LMNT 4GKKT 4DUZT 2ZM6T 4JI4T 4DV5T 4LFCT 1FJGT 4JYAT 1I94T 4DV4T 4NXNT 3T1HT 4AQYT 5IWAT 4B3RT 4KHPT 4DR2T 4LFAT 1N33T 4DV0T 2E5LT 4LF5T 2UXDT 1XMQT 1N34T 4JI0T 4K0KT 4DR1T 2F4VT 4JV5T 1J5ET 4JI5T 4DR7T 4JI6T 1IBKT 1IBLT 1IBMT 4LF9T 1XMOT 4GKJT 2UXBT 1HR0T 5LMUT 4OX9T 4X65T 2UXCT 4LFBT 4JI3T 4LF6T 4DR4T 4B3TT 5BR8T 3T1YT 4LF8T 2UU9T 2HHHT 4LF7T 4YY3T 4DV3T 1HNWT 4JI7T 4DV7T 4DR6T 4DR3T 4LF4T 1N32T 1HNXT 1XNRT 4B3MT 4DV1T 4JI8T 2VQFT 4X62T 4B3ST 2UUBT 2UUCT 1HNZT 1XNQT 4JI1T 4NXMT 4DUYT 4JI2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 T;  2VQE T;  4DV6 T;  4YHH T;  1N36 T;  2UUA T;  4DV2 T;  4DR5 T;  4X66 T;  3OTO T;  5LMN T;  4GKK T;  4DUZ T;  2ZM6 T;  4JI4 T;  4DV5 T;  4LFC T;  1FJG T;  4JYA T;  1I94 T;  4DV4 T;  4NXN T;  3T1H T;  4AQY T;  5IWA T;  4B3R T;  4KHP T;  4DR2 T;  4LFA T;  1N33 T;  4DV0 T;  2E5L T;  4LF5 T;  2UXD T;  1XMQ T;  1N34 T;  4JI0 T;  4K0K T;  4DR1 T;  2F4V T;  4JV5 T;  1J5E T;  4JI5 T;  4DR7 T;  4JI6 T;  1IBK T;  1IBL T;  1IBM T;  4LF9 T;  1XMO T;  4GKJ T;  2UXB T;  1HR0 T;  5LMU T;  4OX9 T;  4X65 T;  2UXC T;  4LFB T;  4JI3 T;  4LF6 T;  4DR4 T;  4B3T T;  5BR8 T;  3T1Y T;  4LF8 T;  2UU9 T;  2HHH T;  4LF7 T;  4YY3 T;  4DV3 T;  1HNW T;  4JI7 T;  4DV7 T;  4DR6 T;  4DR3 T;  4LF4 T;  1N32 T;  1HNX T;  1XNR T;  4B3M T;  4DV1 T;  4JI8 T;  2VQF T;  4X62 T;  4B3S T;  2UUB T;  2UUC T;  1HNZ T;  1XNQ T;  4JI1 T;  4NXM T;  4DUY T;  4JI2 T; 
#chains in the Genus database with same CATH topology
 3VR9 A;  2J62 A;  2LOP A;  3OPC A;  2BVL A;  2Q9Q A;  2KMF A;  3ZMS B;  5IYZ E;  3WAJ A;  3EVY A;  4ZHQ E;  2LRK A;  2D2S A;  3ZMT B;  2N9D A;  4ASK A;  4HWC A;  3UT5 E;  4IDP A;  3T8O A;  4TNV A;  3BK9 A;  3SS1 A;  2IUB A;  2C5K T;  4PW8 A;  2V26 A;  1MIY A;  4QH4 A;  1M7K A;  4EOZ B;  2Q9Q B;  4TN7 B;  2EHO C;  3SFE A;  1IBL T;  5KX5 E;  2XQ5 A;  2LKH A;  2W4X A;  3M3Z B;  1DU2 A;  1UX4 A;  5IUX A;  4WBN E;  4JEU B;  4IE4 A;  2BBH A;  2ODU A;  3M65 A;  3LK4 2;  1OXZ A;  1WR6 A;  2L3L A;  4LF8 T;  2HPL A;  3RF1 A;  5C3J A;  4YY3 T;  3AEF A;  1O3X A;  2CBI A;  1H7C A;  3CPZ A;  2X9H A;  1U4Q A;  1HNX T;  2YU1 A;  2ZM2 A;  2YKS A;  3KDS E;  2X67 A;  4UEM A;  4QXH B;  3C4W A;  5J2U E;  2VUR A;  3UU5 A;  4ANJ A;  3KBT A;  2X0L B;  3HI2 A;  3EAB A;  4BA9 A;  5FL1 A;  5L47 A;  3IF8 B;  5AQN B;  3TLV A;  4U7I A;  5LHG B;  5HXH A;  1W0A A;  4K0U A;  3QC9 A;  5F8P A;  4N78 D;  2XHE B;  3KV4 A;  4TV8 E;  1EZ3 A;  2JRK A;  5FXZ A;  2XQ6 A;  3QB5 A;  1WR0 A;  2V7K A;  3UU3 A;  3TLS A;  3IBP A;  4HWH A;  3AA7 B;  1HX1 B;  4P0A A;  2FJE A;  2VK9 A;  4IST A;  3J7Y q;  2LJL A;  3N2O A;  4ZZC A;  4TNW A;  2VVN A;  4V1A v;  1T7S A;  3PUX F;  2A3D A;  5EZY E;  4EEB A;  3RPU A;  5HXR A;  3UUL A;  2M67 A;  4IE5 A;  4LFB T;  3ZYM A;  2ZLY A;  4QX8 B;  5AQV B;  4JI3 T;  4P1N A;  3GA8 A;  2BS2 A;  2PG8 A;  3E08 A;  1Y01 A;  4AQF A;  4YSY A;  1HS7 A;  2A72 A;  3I0O A;  5LG4 A;  2K24 A;  3EDU A;  5FXW A;  2LSI A;  5KMG P;  4AKG A;  5AQJ B;  2VL0 A;  4H9N C;  4X1Y E;  2KWI B;  1D0Y A;  4PJJ A;  4U74 A;  4XZC A;  3CQX C;  4CI3 B;  1XNQ T;  4NXM T;  5AQI B;  1L0V A;  1JNZ A;  3NZP A;  2X66 A;  4XBF B;  3N2K E;  3LK2 B;  5L3F B;  4FI5 A;  3P4S A;  1KK7 A;  2WQY A;  4H9O C;  4FJO A;  4GK0 E;  1AJ3 A;  5HWY A;  2CEA A;  2DHR A;  5J2T E;  3PUY F;  3OYX A;  4UVB B;  2GK9 A;  2H88 A;  2PBI A;  4HWD A;  4LFA T;  4YSX A;  3MKD A;  2BVM A;  2LHR A;  4X5T A;  2V1D B;  5C2T A;  1IJ5 A;  4CI1 B;  2OLT A;  4PFO A;  5KDM C;  1VCT A;  3PUR A;  4O4H E;  1FMV A;  1XMO T;  2UXB T;  1HR0 T;  4OX9 T;  5HXS A;  4OK0 A;  1LVF A;  2Z6E A;  4YHJ A;  2UXC T;  5CA0 E;  2VKJ A;  4ZOL E;  4B3T T;  3MJX A;  2BS4 A;  3ZMZ B;  2D0T A;  2CWY A;  3TLW A;  1HNW T;  4AKR B;  4DR3 T;  3ZJ1 A;  4EYU A;  4O4I E;  3MAC A;  3GN5 B;  2CBJ A;  1HFA A;  2IW5 B;  2XQY A;  1HTJ F;  2QRX A;  2XTL A;  3AEB A;  2E8I A;  3RGL A;  1BR2 A;  4JI2 T;  4ZS3 A;  1T72 A;  1J5W A;  3WAK A;  4HWF A;  5HEG A;  2NTX A;  2XAQ B;  3RHW A;  2VKO A;  3KFW X;  4LMJ A;  2Y48 B;  2VKD A;  5AQH B;  3RYH E;  3H3A A;  3NWI A;  3ABV A;  4PFP A;  4UR9 A;  3ZT5 A;  5ABE A;  2YDS A;  2FJA A;  2N1G A;  4XAX B;  1ZHC A;  4EED A;  3PJA A;  4DV0 T;  5JRC A;  3NBX X;  3A8Y C;  3KV9 A;  2IC9 A;  4C90 A;  3AA0 B;  4JI5 T;  3KVB A;  1YQ4 A;  3AED A;  2DWK A;  3KIN B;  2V6Y B;  3AE7 A;  3OBV E;  2ODV A;  2LSK A;  4MAL A;  3SRZ A;  3LDQ B;  3HR0 A;  3U78 A;  5DQV A;  2LSY A;  4YJ3 E;  4ZI3 D;  2DI4 A;  4HEA A;  2G0U A;  3AEG A;  3ZST A;  4ADZ A;  3W15 B;  3C50 A;  2LKG A;  1OED C;  2CMR A;  4DV1 T;  2LLY A;  3P4Q A;  3OJA A;  2BG9 C;  3VRA A;  3VRB A;  1I6Z A;  1NEN A;  2NP9 A;  5JTG A;  2C5J A;  4DV6 T;  2XSB A;  2CHO A;  5ABF B;  2BDE A;  2EHO A;  3RYC E;  3RRC A;  2L9Q A;  4TWD A;  3IA3 A;  5HWX A;  2YDR A;  4PJN A;  5DJQ C;  2MYS A;  1VRB A;  2XM2 A;  2J4G A;  4WZX A;  4ZXL A;  3NRY A;  3PUS A;  3NRX A;  2W2U A;  2X9X A;  2ES0 A;  3AAA B;  5IHY A;  4UVA B;  2X0Y A;  3RC8 A;  2AXD S;  4YTM A;  3CVR A;  1V9D A;  4U2Y A;  4DBR A;  5ABG A;  2MOZ A;  4ILU A;  3RIF A;  2BKP A;  2V5C A;  4CN4 A;  3OKQ A;  4JBW F;  3ZMV B;  2WP9 A;  5LHI B;  5L3B B;  2OV9 A;  4YLH A;  3P8C D;  4IE6 A;  3R84 B;  3PV0 F;  3OYZ A;  1YW0 A;  2CE7 A;  4DR6 T;  1X79 A;  1XNR T;  4AIS A;  4YTN A;  2VL8 A;  4E7S A;  3NKZ A;  1KNP A;  2XSA A;  1YKE B;  3H37 A;  4WBO A;  5LGU B;  2VAS A;  3ZT7 A;  2KSR A;  5FXX A;  5FMN A;  3AE6 A;  4A56 A;  2LEH A;  4MLK A;  3D0T A;  3P50 A;  5LB7 B;  3AEC A;  4GYS A;  2E5V A;  4YSZ A;  4H9R C;  3AB3 B;  5LBM A;  2CWO A;  5CB4 E;  3AE3 A;  1Y64 B;  2X9W A;  4UIG A;  2MPK A;  4HFV A;  4H9P C;  3A5X A;  5AQT B;  1FEW A;  4AXP A;  3U3I A;  4M1P A;  2NTY A;  3HA4 A;  4HWI B;  1GQE A;  1SUM B;  4BAY B;  4KUM B;  1D0Z A;  3RIU C;  4YJ2 E;  2JJ9 A;  2X0H A;  3UQ7 A;  3C51 A;  4GKJ T;  2E9X D;  2MTQ A;  2NW7 A;  4OFZ A;  4AI6 A;  3AXJ A;  3TLU A;  3P4P A;  3NZQ A;  1JNR A;  2IIU A;  4IDO A;  3J9X 1;  4G63 A;  2JQQ A;  2LSG A;  4U7Y A;  4IIJ E;  4PK5 A;  3RLF F;  4A98 A;  5J1G A;  3RH3 A;  5FVK A;  1N32 T;  5LCY A;  3FBL A;  3B5M A;  4CXW A;  3N9O A;  5FP3 A;  3AXJ B;  3GMI A;  2WDV A;  3HKE E;  2XAH B;  5HXC A;  5ADX L;  4QH5 A;  4DID B;  3P4R A;  4UEL A;  1N36 T;  4MFR A;  3AEE A;  4QHO A;  4X66 T;  1HG5 A;  5HEH A;  3GWH A;  3Q5D A;  3JAD A;  5FYM A;  2ZM6 T;  2JMH A;  4O4J E;  5L4H A;  2J1D G;  4ZZB A;  1XDP A;  3AE5 A;  5A1L A;  5LNK A;  5H6R B;  3K8P C;  2CLY C;  5IWA T;  1E1H B;  3EAM A;  2AE9 A;  4L9I A;  3FZH B;  1Z0P A;  1N33 T;  4HGA A;  4I0U A;  3MA9 A;  1SE7 A;  2I59 A;  1XDO A;  4DVD A;  3JAE A;  4X1I E;  2WZH A;  2UXD T;  4DND A;  2F4V T;  5L4E A;  3N9M A;  4ILA A;  2WY2 A;  4I4T E;  4O2B E;  4DR7 T;  2YN6 A;  4ILB A;  1IBK T;  2P9B A;  3UUX B;  4Z8X A;  3V5U A;  4KP3 C;  2K3W A;  4PAG A;  4GIW A;  1NAF A;  4IDQ A;  4HFH A;  3CQG B;  2XQ7 A;  2BKO A;  2R6G F;  3T1Y T;  4P0B A;  3PTR B;  5AQR B;  3LBX A;  3WI3 A;  4EIW A;  4KBM B;  4NUV A;  3PJA J;  2B1E A;  2W62 A;  2D9D A;  2WMN A;  3AVS A;  5L3D B;  3BQL A;  4U72 A;  2RA1 A;  2LT3 A;  4MHC A;  5AQS B;  1FIO A;  2DWG A;  4HKA A;  3ZYK A;  2KXP B;  2VB6 A;  1WYB A;  2SPC A;  5FY7 A;  3B13 A;  4DR5 T;  3LJC A;  4DUZ T;  3LBX B;  2V7M A;  3ETU A;  5JRE A;  5GON E;  2PFV A;  2W00 A;  2H7V C;  3AAE B;  5ABH A;  4AKH A;  1WYC A;  3PU3 A;  1CUN A;  2Q9Q C;  3FZF B;  5KXJ A;  1CHU A;  3C98 B;  1BR0 A;  5AQM B;  5CJ5 A;  3CML A;  4DR2 T;  1MMN A;  4H63 V;  1T98 A;  2WZI A;  5HEJ A;  2LOS A;  3N9L A;  5LOV E;  3CX7 B;  4UXN B;  2QVA A;  2JQ9 A;  3AVR A;  1OED A;  2FUP A;  1KFY A;  4U31 A;  4WNK A;  1IBM T;  4LF9 T;  3FZM B;  2E2A A;  1HG2 A;  2BG9 A;  2CPT A;  3FZK B;  4PK6 A;  2X51 A;  1NEK A;  4G2A A;  5H6Q B;  3PUA A;  1S94 A;  4EAH A;  4KHZ F;  4OYJ A;  3AE2 A;  3CQC B;  2W63 A;  2ACZ A;  1OED B;  3A7M A;  3AE8 A;  3PUQ A;  1MMA A;  5HXE A;  5LA6 E;  4H63 H;  3AE9 A;  2Q9Q D;  3IHR A;  3N2G E;  2D0U A;  2BG9 B;  3ZC0 A;  1HX8 A;  4WYV A;  3ANW A;  2XAJ B;  4AKI A;  2DL1 A;  2HPJ A;  2ZMA A;  3RIA A;  3ZYL A;  4AQG A;  2DCF A;  1WCR A;  4GKK T;  1D1A A;  3BQK A;  1QSD A;  4JI4 T;  4PK4 A;  1D0X A;  2LM9 A;  2WB5 A;  1FJG T;  2XM1 A;  3T1H T;  4IDN A;  3F31 A;  3UU8 A;  1HF8 A;  3TKL B;  2JPF A;  2KLQ A;  1U5P A;  2HN1 A;  4TX5 A;  4UV9 B;  2VVS A;  4WW0 A;  2Y6X A;  4ZI3 C;  4LML A;  5AQF B;  3UUM A;  5LJM A;  1UGO A;  1SHZ C;  2V5D A;  5AQU B;  4HFD A;  5LHH B;  5BMV E;  1B7T A;  4DMW A;  3QUJ A;  2HN2 A;  3Q5E A;  4HTE A;  2JIW A;  3LSV A;  3ZEF B;  2X68 A;  3UQ4 A;  3BQI A;  5AQP B;  2MBG A;  3F57 A;  1YD8 G;  2UXN B;  2I0M A;  4LF7 T;  4CXY A;  2CXD A;  5HEO A;  3N5L A;  4YFS A;  4JI7 T;  4MBQ A;  3UFE A;  1UUR A;  3ZN0 B;  4HN9 A;  3UFG A;  4J2C A;  5LGT B;  2WM9 A;  5JRC B;  5E0O A;  3FXD B;  1BR4 A;  2CHN A;  2K48 A;  1QUU A;  2XAG B;  2JQH A;  4EZH A;  3RIU A;  5AQL B;  4UF0 A;  4I50 E;  5DAB A;  3OVU A;  3ZT6 A;  3SFD A;  3B57 A;  5JQG E;  1ZOY A;  4GYR A;  3AAI A;  1YQ3 A;  3DP7 A;  3UUN A;  2FJD A;  3AEA A;  3JC6 D;  5AQG B;  4OHF A;  2WS3 A;  2XPK A;  1ZV4 X;  3EDV A;  3Q2M A;  4IL4 A;  4UF0 B;  2JQK A;  5HYA A;  3N9P A;  4HE8 A;  4CQI A;  3CX6 B;  1WRD A;  1UCU A;  1Z8U A;  2IC6 A;  2YDQ A;  1US7 B;  3MZK B;  2YEV C;  4DR4 T;  4O8S A;  1ZP0 A;  2EHO B;  2HHH T;  2CXL A;  5HCJ A;  4LF4 T;  2LM2 A;  4X1K E;  2K9A A;  2VWA A;  2UUC T;  5LP6 E;  4IL9 A;  1LRZ A;  3L3P A;  5CFB A;  1MMD A;  4A97 A;  3MXZ A;  4X64 T;  2XQ8 A;  3ZC1 A;  4ZI7 E;  2WSS V;  5EK3 A;  3QK6 A;  3ZCJ A;  5JR9 C;  4X20 E;  2LSJ A;  2V7J A;  5M4Y A;  4LFC T;  3DJB A;  1D1C A;  1I94 T;  2CLY B;  2E9X C;  3AA6 B;  4NXN T;  3K3Q C;  4ZEY A;  2QA7 A;  4PJM A;  5L3E B;  5LYJ E;  4KHP T;  3PE0 A;  3I1A A;  4IGU A;  4IE0 A;  4LF5 T;  3RYI E;  5CGM A;  1XMQ T;  1UX5 A;  4JI0 T;  3H3M A;  4CXX A;  3ONX A;  5HCM A;  4JI6 T;  4QKN A;  4U33 A;  3CWZ B;  4X65 T;  3PUW F;  3KV6 A;  4UVC B;  3LG7 A;  2V8S V;  2N2N A;  5LXT E;  4COF A;  5F3J A;  3FZL B;  2UU9 T;  4YT0 A;  3MK7 C;  4NIQ A;  3SOL A;  4TZ4 C;  3ZMU B;  1ZEE A;  2BZB A;  5HEU A;  3RKG A;  3VKG A;  1MIW A;  4IDZ A;  5FVL A;  4JI8 T;  4KI0 F;  3CIR A;  2VQF T;  5C8Y E;  1QLB A;  3KV5 A;  5LJN A;  4CZZ B;  2WAU A;  4QH1 A;  3G06 A;  3S4U A;  4EZ4 A;  5JDL A;  5JDG A;  3ZSS A;  4Z90 A;  2NOX A;  2DLR A;  2PJQ A;  4IE7 A;  1M62 A;  3IEE A;  4U3C A;  2MAW A;  4HFB A;  4JEH B;  3QNU A;  2C0S A;  3N9N A;  2OA5 A;  2KND A;  2WU5 A;  1IJ6 A;  1SA0 E;  3CKD A;  3ZKR A;  4CN1 A;  1J5E T;  1MMG A;  3L09 A;  3C4X A;  1KEY A;  2CCQ A;  2L8K A;  3HKC E;  5AQO B;  5AFU L;  2I6H A;  2ZM0 A;  4TUY E;  3Q9D A;  5JDQ A;  4EB6 E;  2WU2 A;  2XQA A;  3X1D A;  2XAF B;  4HFC A;  4O4L E;  2M6B A;  3QB5 K;  2KIN B;  2EHO D;  2YU2 A;  4YTP A;  4TWH A;  4X62 T;  1OWA A;  2IML A;  5J0Z A;  4I43 B;  2QGS A;  3F2E A;  5EK4 A;  1XWM A;  3UTK A;  4YHH T;  2UUA T;  1UK5 A;  4LMK A;  5JDH A;  2ZM8 A;  4IT4 A;  4BJM A;  4QXC B;  4P09 A;  4L0R A;  2IAK A;  4KMC A;  2WWU A;  3K3O A;  2XZE A;  1XZY A;  5L2L A;  1OED E;  3RQU A;  1VCS A;  2W67 A;  2CA5 A;  3I0Q A;  4TWF A;  2XAS B;  4EXT A;  2BS3 A;  4GK5 E;  2BG9 E;  3E0Z A;  5JDN A;  3O9X A;  2V7L A;  1X9B A;  1KF6 A;  4DO0 A;  4K0K T;  5ETW A;  4GOU A;  2Y8D A;  2RP4 A;  4JLE A;  4ILC A;  1KNR A;  3LK3 B;  1WLX A;  3EUH A;  4A5X A;  3LFM A;  1D1B A;  2YK0 A;  4IHJ E;  3EHZ A;  3HL6 A;  2NWB A;  4EV6 A;  2H89 A;  1WFD A;  5L3G B;  5L3C B;  4ERR A;  2X9Y A;  2HH7 A;  4B3M T;  5FY0 A;  2J47 A;  4HFI A;  3TLT A;  2W61 A;  2WDQ A;  3EI0 A;  4JI1 T;  2VKH A;  3SWH A;  2FJB A;  4ZI2 C;  2ACX A;  1YXR A;  5FKY A;  4DMV A;  2XJ7 A;  5JDM A;  3ZPO A;  5EK2 A;  3OTO T;  4DV5 T;  2QYW A;  3ZN1 B;  4JUY A;  5LBQ B;  3HKB E;  2FBW A;  4JYA T;  1S35 A;  2BKN A;  4DV4 T;  2YOE A;  1R8I A;  3L39 A;  3RQW A;  2IHR 1;  4AQY T;  3GN5 A;  2V7I A;  1G73 A;  1KNZ A;  2K5B B;  3PUZ F;  3R6N A;  2E5L T;  1MND A;  3AE1 A;  3V5S A;  3I9Y A;  3C64 A;  2RPA A;  2UXX B;  3RKO A;  4DR1 T;  2CRB A;  4JV5 T;  3ZLI A;  5JVD E;  4AKL A;  3FXE B;  5HAX A;  3ANW B;  1MIV A;  4NUU A;  2XQ4 A;  4ZI2 D;  1J1J A;  4ISS A;  3ESL A;  4LF6 T;  3E22 E;  3P7I A;  5JR9 A;  3ETV A;  2CM0 A;  3RX6 A;  4DV7 T;  2NW8 A;  2V6X A;  4KX6 A;  2E9X A;  4HFE A;  5FNV E;  4QXB B;  4Z91 A;  1LVK A;  2W0G A;  1G8X A;  3FB2 A;  2A2F X;  1FMW A;  2PTF A;  2DNX A;  3CX8 B;  4U2Z A;  2WMO A;  3DTO A;  2V6Y A;  3JC6 C;  3UU4 A;  3CK6 A;  1VOM A;  3O1I A;  2WCA A;  4Q25 A;  3RC3 A;  4YXD A;  3FBZ A;  4F6R C;  5JR9 B;  4ZS2 A;  4AIU A;  4AQF C;  3ONJ A;  1T8B A;  1W9R A;  5LGN B;  2E9X B;  2YIN A;  3VKH A;  3I9W A;  2KZ7 B;  2KWH A;  3O4X E;  3HKD E;  3PUV F;  2XQ3 A;  5FY1 A;  5LG3 A;  1HCI A;  3O1H A;  4E7Z A;  4DBQ A;  3ZJ2 A;  3UUB A;  2D5U A;  4PNI A;  1N34 T;  1YKH B;  3JCF A;  5ABF A;  3P4W A;  4B6X A;  5F5W A;  2LRL A;  5LMU T;  2W66 A;  4L5G A;  3NVO A;  3PDY A;  3UU6 A;  5JDF A;  1E2A A;  1W09 A;  2CXF A;  2H3R A;  5FXV A;  5BR8 T;  2KT9 A;  3ONL C;  3PU8 A;  4DV3 T;  2NW9 A;  3QOF A;  4C91 A;  5CA1 E;  2BBJ A;  4IRE A;  3VR8 A;  3Q5W A;  1MNE A;  2JMK A;  4B3S T;  1HNZ T;  1E7P A;  2LE8 A;  3Q5X A;  2VQE T;  1ZKE A;  4H9Q C;  4DV2 T;  4F8H A;  3AA1 B;  5LMN T;  5TAO A;  1IZN B;  2XUE A;  3AE4 A;  5DQW A;  4QX7 B;  2B76 A;  3JAF A;  3O1J A;  3K3N A;  4UV8 B;  4EYY R;  4B3R T;  4O2A E;  4TV9 E;  4H9S E;  3RI5 A;  4BJN A;  2H7O A;  5AQQ B;  2XY8 B;  2XQ9 A;  3VHL A;  3KVA A;  2A9U A;  2LHN A;  1W0B A;  3KBU A;  3C4Z A;  2WDR A;  3ZCI A;  4OYK A;  3L8R A;  3K1S A;  5JH7 E;  5AQK B;  4CI2 B;  1UUS A;  2M6I A;  4CN6 A;  2WWV A;  3PUG A;  4NPP A;  2IDO B;  2WBL A;  5FL0 A;  4PJL A;  3RRW A;  2C5I T;  4I55 E;  3FHN A;  1IAP A;  3VU7 H;  1LKX A;  2NR4 A;  2UUB T;  1BR1 A;  3N9Q A;  4DUY T;  1NWM X;  4QWN B;  4EGW A;  3RYF E; 
#chains in the Genus database with same CATH homology
 4X64 T;  2VQE T;  4DV6 T;  4YHH T;  1N36 T;  2UUA T;  4DV2 T;  4DR5 T;  4X66 T;  3OTO T;  5LMN T;  4GKK T;  4DUZ T;  2ZM6 T;  4JI4 T;  4DV5 T;  4LFC T;  1FJG T;  4JYA T;  1I94 T;  4DV4 T;  4NXN T;  3T1H T;  4AQY T;  5IWA T;  4B3R T;  4KHP T;  4DR2 T;  4LFA T;  1N33 T;  4DV0 T;  2E5L T;  4LF5 T;  2UXD T;  1XMQ T;  1N34 T;  4JI0 T;  4K0K T;  4DR1 T;  2F4V T;  4JV5 T;  1J5E T;  4JI5 T;  4DR7 T;  4JI6 T;  1IBK T;  1IBL T;  1IBM T;  4LF9 T;  1XMO T;  4GKJ T;  2UXB T;  1HR0 T;  5LMU T;  4OX9 T;  4X65 T;  2UXC T;  4LFB T;  4JI3 T;  4LF6 T;  4DR4 T;  4B3T T;  5BR8 T;  3T1Y T;  4LF8 T;  2UU9 T;  2HHH T;  4LF7 T;  4YY3 T;  4DV3 T;  1HNW T;  4JI7 T;  4DV7 T;  4DR6 T;  4DR3 T;  4LF4 T;  1N32 T;  1HNX T;  1XNR T;  4B3M T;  4DV1 T;  4JI8 T;  2VQF T;  4X62 T;  4B3S T;  2UUB T;  2UUC T;  1HNZ T;  1XNQ T;  4JI1 T;  4NXM T;  4DUY T;  4JI2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...