4B3TT

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3tT00
4DR3T 4JI1T 4LFCT 2ZM6T 4DR6T 1FJGT 1N36T 3T1HT 2UXBT 4DR4T 4LF5T 4DUYT 3OTOT 4DR7T 5IWAT 4DR2T 1XNRT 4YY3T 4B3RT 5BR8T 4LF8T 4LFAT 4DV1T 1HNXT 2UUCT 4GKJT 4DV4T 1HNZT 4LF6T 4X66T 2UUAT 4LF4T 1I94T 2UXDT 4DR5T 4NXNT 2F4VT 1N32T 2E5LT 4DV3T 2UUBT 4X62T 4JI2T 4DUZT 2VQFT 4DV6T 2VQET 1J5ET 4KHPT 1XMQT 2HHHT 4LF7T 1XNQT 4JI7T 4JI5T 4LF9T 1XMOT 4JI0T 4DV7T 4DR1T 1IBKT 4JYAT 4OX9T 1IBMT 2UXCT 4DV0T 3T1YT 4DV2T 4K0KT 4B3ST 5LMNT 1N34T 4JI4T 4X64T 4AQYT 4X65T 4JV5T 4GKKT 1N33T 1HNWT 1IBLT 4JI3T 2UU9T 4B3MT 4JI6T 4LFBT 4YHHT 4NXMT 1HR0T 5LMUT 4JI8T 4DV5T 4B3TT
chains in the Genus database with same CATH superfamily
4HN9A 4O2AE 4U7YA 5KX5E 2XSBA 5AQKB 5A1LA 4ZHQE 4YT0A 3FZMB 5JDNA 2VVNA 4AKRB 2MYSA 5LGTB 2ZM6T 2RPAA 4LFCT 3OYXA 5FP3A 2D9DA 2UXXB 2PG8A 2M6IA 1WYBA 3D0TA 5L4EA 2BG9B 2DNXA 4ZZCA 2D5UA 1M62A 4TX5A 3FZKB 4Z90A 2CEAA 2CXDA 3A5XA 3Q2MA 4G2AA 4JBWF 4EAHA 1MIVA 2P9BA 2VB6A 2AXDS 3E0ZA 3L09A 5JVDE 1HG2A 4KX6A 5CFBA 5LGNB 5L3FB 3HKBE 3NZPA 5FY1A 4UF0B 5HXCA 2VKJA 2CM0A 4EYYR 4EZHA 4ZS2A 3UFEA 2XQ6A 4I50E 3FBZA 5JDLA 5JH7E 3UUBA 4LFAT 4H9NC 3ZT6A 3MXZA 3RX6A 1UX5A 4C91A 3PUZF 4NUVA 2DL1A 3Q5DA 4MFRA 3FB2A 4LMKA 4EXTA 5IUXA 1UK5A 3BQLA 2CLYC 5LG3A 2WB5A 2JPFA 1X79A 3RRWA 3P4QA 3NRYA 2UUAT 1Z8UA 4X64T 4LF4T 3ZMZB 3H37A 4NXNT 5F3JA 2BVMA 5HAXA 1MIWA 1QUUA 4IL9A 2E9XB 4QX8B 3CQXC 2LOPA 3NZQA 2OLTA 2K5BB 3AECA 2ZM0A 2IDOB 4TWDA 2EHOA 2WBLA 3IA3A 4PK4A 2UUBT 2CWYA 3ZYKA 2VK9A 3LFMA 3UUXB 4KMCA 2XZEA 1OEDA 4GYRA 4ZZBA 1XNRT 2RP4A 3NBXX 1U5PA 2NTXA 3UU3A 3ZN1B 1WYCA 2LM2A 2NWBA 4C90A 2BS4A 4DUZT 2IMLA 4QH1A 1FMWA 2V5DA 3AE6A 2VQFT 4FJOA 4YTPA 1J5ET 1D0XA 2HHHT 2X0LB 3ETUA 2QYWA 5HWXA 2VL0A 3PUAA 3ZYLA 2V7JA 2WZIA 1LVFA 2XQ7A 3OYZA 3P4WA 4GYSA 4IE7A 4TNWA 2XTLA 4HFHA 2LHRA 3AE4A 2LOSA 4HWFA 3ZT5A 5AQFB 1HF8A 3UU5A 1KEYA 3W15B 3AE5A 3MKDA 3ZCJA 4JI0T 3WAKA 4DR1T 2ODVA 3N9QA 5L3EB 2W4XA 5JDGA 4JYAT 1T7SA 2H7VC 2PJQA 2CXLA 1S35A 2EHOB 5KDMC 1IJ6A 5JR9C 3CPZA 1SHZC 1IBMT 4HFIA 1ZHCA 3OJAA 4CN6A 3T1YT 2WY2A 3O1HA 2PTFA 2HH7A 2XUEA 3EHZA 3RLFF 4ZI2C 1XDPA 1XWMA 4Z91A 3ZMUB 3N2KE 3IHRA 3LK42 2MBGA 5LJMA 5HWYA 2HN2A 2LLYA 4U31A 5ABFB 4B3ST 3VKGA 3L8RA 2B76A 1UGOA 2XHEB 3AEAA 3AXJB 3AE3A 3RIAA 1N34T 4A98A 1V9DA 4WYVA 2BBJA 2N1GA 2Y8DA 3MZKB 4GOUA 2LRLA 2VASA 4IDPA 5LOVE 3ZCIA 3P4SA 4ASKA 3Q5XA 2CXFA 4AKHA 5FXWA 2NW9A 3KBTA 3QB5K 3HKDE 3C4ZA 4O2BE 5JRCA 3K3OA 4HWIB 2V6YB 4HFVA 4B3MT 1IAPA 3JC6C 2Y48B 2IC9A 2KMFA 5AQJB 4H9OC 3HKCE 5BR8T 3FHNA 4MALA 5JDQA 4HFBA 2M67A 3ANWA 5M4YA 4JI8T 4HFDA 4N78D 4CI2B 1ZKEA 2KWHA 5JTGA 5LHGB 2WAUA 2D0TA 4YTNA 2BKNA 4P0BA 4DVDA 2L8KA 2J47A 4L9IA 4UV8B 4CN4A 4DR3T 2VL8A 3EDUA 2IC6A 5LCYA 2D2SA 3GWHA 3O1IA 3PJAJ 4TZ4C 5L3GB 2WDRA 5AQLB 3T8OA 1HTJF 4OK0A 4QH5A 5JDMA 2WP9A 5AQPB 2UXBT 3AEBA 3IBPA 2K3WA 3OPCA 3RIUA 4DR4T 2LE8A 3K1SA 5L3BB 2BDEA 5F5WA 3UULA 3ZSTA 4DUYT 5CA1E 3P8CD 2WWUA 1M7KA 3KFWX 2Y6XA 2ZM8A 3OKQA 1W9RA 3KVAA 4UR9A 4EYUA 4ZEYA 5AQIB 4DR2T 3RYHE 3PDYA 3VRBA 4X5TA 5JQGE 4AQFC 3SWHA 2KNDA 4YSZA 4YHJA 1LKXA 2LEHA 2NP9A 3U3IA 1KF6A 4HWHA 5FY0A 3V5UA 2R6GF 1W0AA 2W00A 2YOEA 3N9MA 4H63H 4IE4A 3ZMVB 4YXDA 4HFEA 4ZOLE 5FNVE 4YJ2E 1QLBA 5AQQB 4U2YA 5LBQB 4WNKA 3U78A 2RA1A 2JMKA 2LSYA 1HG5A 2CBJA 2D0UA 2MPKA 4DV4T 3CX8B 3SRZA 4LF6T 4A56A 2V1DB 2LSJA 4YTMA 3KV6A 5J2TE 4IREA 3ZMTB 4X66T 4HWCA 2JQ9A 2JRKA 3C50A 4DR5T 3VU7H 3AVSA 4BJMA 3I9YA 5L3DB 5LG4A 5AQGB 4X1YE 2F4VT 1MMGA 2HN1A 3RIUC 3C98B 4HGAA 1MIYA 1WRDA 2WS3A 2XQ8A 2WWVA 3ZSSA 5L2LA 3FZHB 2YINA 2YN6A 4NUUA 3RGLA 2BS2A 1OEDE 3NVOA 4U2ZA 4IE0A 2JQHA 5LXTE 2YDSA 3EDVA 2DHRA 5IYZE 2CWOA 5LHIB 4YSXA 4ZS3A 4PFOA 2XAQB 3EVYA 2DWGA 5DJQC 4DV6T 2H88A 3AB3B 3UFGA 2DLRA 2FUPA 5JR9A 2C5KT 1BR4A 1XMQT 4KHPT 2XM2A 3VRAA 2WM9A 2LM9A 2XQ4A 2YDRA 5HEOA 5C2TA 4LF7T 5LNKA 5JDFA 4GIWA 2FJDA 4DBRA 1T8BA 4ZXLA 3SFDA 4LF9T 3C51A 4PK6A 2DWKA 2Z6EA 2WU5A 4IGUA 4TWHA 2QVAA 4YLHA 5TAOA 3V5SA 1OWAA 4AQFA 2ZLYA 1WR0A 4GK5E 2E8IA 2GK9A 2WU2A 2MAWA 4YJ3E 1YQ4A 1WFDA 3HI2A 3RH3A 1IBKT 4IDNA 2XAGB 2X68A 1YXRA 4IE5A 3X1DA 4ILCA 1US7B 3C4WA 4I55E 3N9LA 3BQIA 2WDQA 3PURA 4PW8A 3PTRB 1Z0PA 1HX8A 3CWZB 3JAFA 3MK7C 4HEAA 3PJAA 4QHOA 1VRBA 3LG7A 4TWFA 5J1GA 3RF1A 1ZV4X 5EK4A 4XBFB 4L0RA 4IDQA 3RKOA 2XM1A 1YD8G 2V7LA 3UU8A 2K48A 5ETWA 2Q9QD 3AEGA 3PV0F 5ABHA 5HYAA 4V1Av 4YSYA 2J1DG 5HEJA 2FJBA 4X65T 3RKGA 3CKDA 1D0YA 2XSAA 3UQ7A 4ISSA 5H6RB 2E9XD 1JNZA 3MJXA 4CZZB 1HNWT 2A72A 2CCQA 5AQUB 3GN5B 3B5MA 3UUMA 3L3PA 4TNVA 4ZI2D 3EABA 4CXYA 3CVRA 3GN5A 3KINB 5FXZA 1E2AA 1HS7A 1NEKA 4X20E 4OHFA 5C8YE 2WDVA 5LMUT 1HR0T 4AISA 1KNZA 2DCFA 2I59A 2L9QA 1IJ5A 1UCUA 1YKHB 2X0HA 1KK7A 5HCJA 3RI5A 4L5GA 5ABFA 2ACXA 2NR4A 4PJJA 4DV5T 3UUNA 4U74A 1W09A 3WI3A 5F8PA 3AVRA 4ISTA 2BKPA 5HEHA 4P1NA 5FY7A 2WMOA 1MMAA 4HWDA 4ZI3D 4TV8E 3B57A 3MA9A 3Q9DA 3AE7A 1VCSA 1LRZA 2NW7A 3I0OA 3ZJ1A 2BS3A 5AQSB 4BA9A 4DBQA 3VR9A 1OEDC 5CJ5A 4DR6T 4AKLA 4IL4A 1FJGT 4QWNB 3TKLB 3PUGA 2BG9C 3QUJA 3PUYF 3T1HT 4WBOA 4PJMA 2IAKA 2X9WA 3N9PA 5ABGA 5LYJE 5EK3A 3K8PC 3RC8A 5FXVA 4WW0A 2BZBA 1KNRA 3AA1B 1NAFA 4TV9E 3QB5A 2IHR1 2IIUA 1BR0A 2PBIA 3H3MA 2JJ9A 3AA0B 5AQMB 3N9NA 3NRXA 5AQRB 3AEFA 4UVBB 2LKHA 1R8IA 4UELA 3O1JA 3RC3A 5DABA 4DNDA 2V7MA 2YDQA 3P7IA 4ADZA 4EV6A 5EK2A 2JMHA 5LJNA 3OTOT 4B3RT 2W2UA 3FXEB 2W67A 1HNXT 3QNUA 3ZYMA 4COFA 3LJCA 2A3DA 2V7IA 2G0UA 3GMIA 3RRCA 3K3NA 4O4JE 4U72A 1BR1A 4DMWA 2J4GA 5JREA 4GKJT 3E08A 2JQKA 3AAIA 2H89A 2CA5A 3I1AA 4HFCA 3HR0A 2VWAA 3KVBA 5GONE 4ZI3C 4I0UA 3UU4A 2UXDT 3J7Yq 2B1EA 4ILAA 2E9XC 2NW8A 3HA4A 3IEEA 3ZN0B 1WR6A 1N32T 2E5LT 3J9X1 3RQWA 5DQWA 3ZKRA 2N9DA 4O4HE 4PFPA 1YKEB 3AE2A 5KXJA 4DV3T 3QC9A 2Q9QB 3PE0A 4CXXA 4X62T 4AKGA 3FZFB 5ADXL 4KHZF 1VOMA 3UTKA 3LK2B 2V6XA 1MNDA 3KV9A 3HL6A 2X0YA 3C64A 2KWIB 3QK6A 4U7IA 1LVKA 2BBHA 3M3ZB 5H6QB 3RHWA 1OEDB 5LA6E 5AQVB 3ZLIA 2CRBA 1MNEA 2FJAA 4PAGA 1WLXA 2XAHB 4QKNA 2VKDA 3EUHA 1AJ3A 1FMVA 4CXWA 4AIUA 2KT9A 2KZ7B 1YW0A 4ILBA 2LT3A 4JI5T 4F8HA 4IE6A 1G73A 4E7ZA 4PK5A 4O4LE 3F57A 1OXZA 2E9XA 2HPJA 3AE9A 3BQKA 1MMNA 2ODUA 2HPLA 5HEGA 4KP3C 2XQ5A 5HXEA 3ETVA 3H3AA 2QGSA 1Y01A 1ZOYA 4E7SA 1JNRA 4GK0E 1E7PA 4KUMB 2XJ7A 4H9SE 3OBVE 1CUNA 4UEMA 4OX9T 3KDSE 4A97A 1QSDA 5ABEA 4NPPA 4DV0T 4MHCA 1HCIA 3ESLA 2V26A 3JAEA 4MLKA 2QRXA 3AE1A 2LSIA 2EHOC 4HE8A 3PUQA 1B7TA 3CX7B 1Y64B 5IHYA 4ZI7E 4JEHB 5J2UE 3L39A 5FXXA 5LGUB 4DV2T 2Q9QC 2LSGA 5AFUL 4IHJE 5L3CB 3VKHA 2I0MA 2A9UA 2KSRA 2XAJB 1UURA 2YEVC 3LDQB 2YU2A 4QXHB 4UVCB 1HFAA 3A7MA 4OYJA 3CK6A 3TLWA 2K9AA 4UXNB 1SA0E 4AQYT 2KINB 3MACA 5AQHB 4JV5T 2VURA 4PJLA 1IZNB 3A8YC 3AXJA 3JADA 5CB4E 3ZPOA 4EOZB 1N33T 2LJLA 1SUMB 1IBLT 4UV9B 1KFYA 4K0UA 4JI3T 4JUYA 4X1KE 4YHHT 2CBIA 2XASB 3LBXA 2AE9A 4KI0F 4KBMB 3ONXA 4UF0A 4AI6A 5LBMA 2VVSA 4B6XA 1KNPA 3PU8A 5L47A 3P50A 4U33A 3CX6B 3PUXF 4YFSA 3UU6A 2XQ9A 5AQTB 4UIGA 1D1CA 5C3JA 2V7KA 5FMNA 1XZYA 3RYFE 3CMLA 2UXNB 2OV9A 3ZJ2A 5FVLA 2ES0A 3AE8A 3O4XE 4F6RC 4JI1T 1DU2A 4P09A 2C0SA 4TUYE 3CQCB 4M1PA 2VKHA 2EHOD 5FL1A 2KXPB 3I0QA 4CN1A 2M6BA 2NOXA 5LHHB 1N36T 2L3LA 4TN7B 2W66A 4QX7B 4O4IE 4NIQA 4EGWA 3ZEFB 4Z8XA 3N9OA 3QOFA 4MBQA 5JDHA 1XDOA 3PU3A 4QH4A 4LF5T 2OA5A 3F31A 3R84B 2ZMAA 1E1HB 2LRKA 2Q9QA 4XZCA 3SOLA 3SS1A 4H9QC 5HXHA 5IWAT 3C4XA 4P0AA 1WCRA 4DR7T 4G63A 2CPTA 3HKEE 5CA0E 3KV4A 1HX1B 2XQ3A 1BR2A 5AQNB 2XQAA 3AAAB 3OVUA 4YY3T 2V8SV 3R6NA 4AQGA 3G06A 1SE7A 1J1JA 2XY8B 2X9YA 2J62A 1D1AA 3KBUA 3ONLC 4J2CA 4LMLA 2K24A 4O8SA 4LF8T 3SFEA 5FYMA 4EEBA 4DV1T 2UUCT 2CE7A 5DQVA 4H9PC 2E5VA 3AEDA 3N2OA 2W63A 3PUSA 5AQOB 4JEUB 2H7OA 2WSSV 2YK0A 3CQGB 5HCMA 2A2FX 1HNZT 5CGMA 4DIDB 3DP7A 4AXPA 1O3XA 1X9BA 2YKSA 1H7CA 3N5LA 3Q5EA 4ILUA 4IT4A 3JCFA 3TLUA 2LKGA 2QA7A 2V6YA 3UQ4A 4EIWA 1I94T 4FI5A 4WZXA 2FBWA 2X66A 2NTYA 1CHUA 2XPKA 4LMJA 4OYKA 4EZ4A 1W0BA 3ONJA 5LP6E 5L4HA 1ZEEA 2N2NA 3B13A 3BK9A 1T72A 5EZYE 3FXDB 5FVKA 2PFVA 3LBXB 3TLSA 2C5JA 4X1IE 5JR9B 2SPCA 1UX4A 2CHOA 4I4TE 4JI2T 3M65A 3I9WA 1GQEA 4QXCB 3ZT7A 2FJEA 2BG9A 1MMDA 4BJNA 4CI1B 4DMVA 3VHLA 2VQET 1ZP0A 5FKYA 4HKAA 2ACZA 2WCAA 5J0ZA 3FZLB 4H9RC 3F2EA 5E0OA 3GA8A 1YQ3A 1VCTA 2WQYA 2BG9E 4JLEA 4EEDA 1XNQT 3Q5WA 2YU1A 4JI7T 2IW5B 3VR8A 4UVAB 3ZC1A 2JIWA 3N2GE 1XMOT 2WZHA 5HEUA 2V5CA 3FBLA 3RIFA 3TLTA 3O9XA 4OFZA 4ANJA 3ZC0A 5KMGP 2DI4A 1L0VA 5JRCB 4U3CA 3KV5A 4DV7T 2VKOA 4QXBB 4AKIA 3AA6B 4WBNE 1NENA 4ERRA 4IDZA 3CIRA 4Q25A 4B3TT 1UUSA 3LK3B 2UXCT 2W62A 2X9XA 3ZMSB 3ABVA 3NKZA 4I43B 3RPUA 3P4PA 4DO0A 5LB7B 1D1BA 4HTEA 2JQQA 4PJNA 2MOZA 2LSKA 2WMNA 3UT5E 4K0KT 3IF8B 5LMNT 2MTQA 1NWMX 2W0GA 3AEEA 5FL0A 3S4UA 2IUBA 4JI4T 1I6ZA 2C5IT 2W61A 3TLVA 1FEWA 2X51A 1FIOA 2X9HA 3E22E 4PNIA 3DTOA 5HXRA 1G8XA 3EI0A 3K3QC 2CLYB 2LHNA 2XQYA 2KLQA 3PUVF 3NWIA 4XAXB 4IDOA 4CI3B 4EB6E 3RYIE 4H63V 1EZ3A 3DJBA 2X67A 1S94A 2UU9T 4JI6T 2E2AA 4BAYB 4LFBT 3AA7B 4NXMT 2CMRA 2BVLA 1T98A 3JC6D 2I6HA 5BMVE 3P4RA 1U4QA 5HXSA 3ANWB 4A5XA 3EAMA 4CQIA 1J5WA 3RQUA 3AAEB 3LSVA 2H3RA 3RYCE 3WAJA 2ZM2A 2BKOA 4GKKT 3PUWF 4IIJE 2XAFB 2CHNA 1D0ZA
chains in the Genus database with same CATH topology
4DR3T 4JI1T 4LFCT 2ZM6T 4DR6T 1FJGT 1N36T 3T1HT 2UXBT 4DR4T 4LF5T 4DUYT 3OTOT 4DR7T 5IWAT 4DR2T 1XNRT 4YY3T 4B3RT 5BR8T 4LF8T 4LFAT 4DV1T 1HNXT 2UUCT 4GKJT 4DV4T 1HNZT 4LF6T 4X66T 2UUAT 4LF4T 1I94T 2UXDT 4DR5T 4NXNT 2F4VT 1N32T 2E5LT 4DV3T 2UUBT 4X62T 4JI2T 4DUZT 2VQFT 4DV6T 2VQET 1J5ET 4KHPT 1XMQT 2HHHT 4LF7T 1XNQT 4JI7T 4JI5T 4LF9T 1XMOT 4JI0T 4DV7T 4DR1T 1IBKT 4JYAT 4OX9T 1IBMT 2UXCT 4DV0T 3T1YT 4DV2T 4K0KT 4B3ST 5LMNT 1N34T 4JI4T 4X64T 4AQYT 4X65T 4JV5T 4GKKT 1N33T 1HNWT 1IBLT 4JI3T 2UU9T 4B3MT 4JI6T 4LFBT 4YHHT 4NXMT 1HR0T 5LMUT 4JI8T 4DV5T 4B3TT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 T;  4JI1 T;  4LFC T;  2ZM6 T;  4DR6 T;  1FJG T;  1N36 T;  3T1H T;  2UXB T;  4DR4 T;  4LF5 T;  4DUY T;  3OTO T;  4DR7 T;  5IWA T;  4DR2 T;  1XNR T;  4YY3 T;  4B3R T;  5BR8 T;  4LF8 T;  4LFA T;  4DV1 T;  1HNX T;  2UUC T;  4GKJ T;  4DV4 T;  1HNZ T;  4LF6 T;  4X66 T;  2UUA T;  4LF4 T;  1I94 T;  2UXD T;  4DR5 T;  4NXN T;  2F4V T;  1N32 T;  2E5L T;  4DV3 T;  2UUB T;  4X62 T;  4JI2 T;  4DUZ T;  2VQF T;  4DV6 T;  2VQE T;  1J5E T;  4KHP T;  1XMQ T;  2HHH T;  4LF7 T;  1XNQ T;  4JI7 T;  4JI5 T;  4LF9 T;  1XMO T;  4JI0 T;  4DV7 T;  4DR1 T;  1IBK T;  4JYA T;  4OX9 T;  1IBM T;  2UXC T;  4DV0 T;  3T1Y T;  4DV2 T;  4K0K T;  4B3S T;  5LMN T;  1N34 T;  4JI4 T;  4X64 T;  4AQY T;  4X65 T;  4JV5 T;  4GKK T;  1N33 T;  1HNW T;  1IBL T;  4JI3 T;  2UU9 T;  4B3M T;  4JI6 T;  4LFB T;  4YHH T;  4NXM T;  1HR0 T;  5LMU T;  4JI8 T;  4DV5 T;  4B3T T; 
#chains in the Genus database with same CATH topology
 4HN9 A;  4O2A E;  4U7Y A;  5KX5 E;  2XSB A;  5AQK B;  5A1L A;  4ZHQ E;  4YT0 A;  3FZM B;  5JDN A;  2VVN A;  4AKR B;  2MYS A;  5LGT B;  2ZM6 T;  2RPA A;  4LFC T;  3OYX A;  5FP3 A;  2D9D A;  2UXX B;  2PG8 A;  2M6I A;  1WYB A;  3D0T A;  5L4E A;  2BG9 B;  2DNX A;  4ZZC A;  2D5U A;  1M62 A;  4TX5 A;  3FZK B;  4Z90 A;  2CEA A;  2CXD A;  3A5X A;  3Q2M A;  4G2A A;  4JBW F;  4EAH A;  1MIV A;  2P9B A;  2VB6 A;  2AXD S;  3E0Z A;  3L09 A;  5JVD E;  1HG2 A;  4KX6 A;  5CFB A;  5LGN B;  5L3F B;  3HKB E;  3NZP A;  5FY1 A;  4UF0 B;  5HXC A;  2VKJ A;  2CM0 A;  4EYY R;  4EZH A;  4ZS2 A;  3UFE A;  2XQ6 A;  4I50 E;  3FBZ A;  5JDL A;  5JH7 E;  3UUB A;  4LFA T;  4H9N C;  3ZT6 A;  3MXZ A;  3RX6 A;  1UX5 A;  4C91 A;  3PUZ F;  4NUV A;  2DL1 A;  3Q5D A;  4MFR A;  3FB2 A;  4LMK A;  4EXT A;  5IUX A;  1UK5 A;  3BQL A;  2CLY C;  5LG3 A;  2WB5 A;  2JPF A;  1X79 A;  3RRW A;  3P4Q A;  3NRY A;  2UUA T;  1Z8U A;  4X64 T;  4LF4 T;  3ZMZ B;  3H37 A;  4NXN T;  5F3J A;  2BVM A;  5HAX A;  1MIW A;  1QUU A;  4IL9 A;  2E9X B;  4QX8 B;  3CQX C;  2LOP A;  3NZQ A;  2OLT A;  2K5B B;  3AEC A;  2ZM0 A;  2IDO B;  4TWD A;  2EHO A;  2WBL A;  3IA3 A;  4PK4 A;  2UUB T;  2CWY A;  3ZYK A;  2VK9 A;  3LFM A;  3UUX B;  4KMC A;  2XZE A;  1OED A;  4GYR A;  4ZZB A;  1XNR T;  2RP4 A;  3NBX X;  1U5P A;  2NTX A;  3UU3 A;  3ZN1 B;  1WYC A;  2LM2 A;  2NWB A;  4C90 A;  2BS4 A;  4DUZ T;  2IML A;  4QH1 A;  1FMW A;  2V5D A;  3AE6 A;  2VQF T;  4FJO A;  4YTP A;  1J5E T;  1D0X A;  2HHH T;  2X0L B;  3ETU A;  2QYW A;  5HWX A;  2VL0 A;  3PUA A;  3ZYL A;  2V7J A;  2WZI A;  1LVF A;  2XQ7 A;  3OYZ A;  3P4W A;  4GYS A;  4IE7 A;  4TNW A;  2XTL A;  4HFH A;  2LHR A;  3AE4 A;  2LOS A;  4HWF A;  3ZT5 A;  5AQF B;  1HF8 A;  3UU5 A;  1KEY A;  3W15 B;  3AE5 A;  3MKD A;  3ZCJ A;  4JI0 T;  3WAK A;  4DR1 T;  2ODV A;  3N9Q A;  5L3E B;  2W4X A;  5JDG A;  4JYA T;  1T7S A;  2H7V C;  2PJQ A;  2CXL A;  1S35 A;  2EHO B;  5KDM C;  1IJ6 A;  5JR9 C;  3CPZ A;  1SHZ C;  1IBM T;  4HFI A;  1ZHC A;  3OJA A;  4CN6 A;  3T1Y T;  2WY2 A;  3O1H A;  2PTF A;  2HH7 A;  2XUE A;  3EHZ A;  3RLF F;  4ZI2 C;  1XDP A;  1XWM A;  4Z91 A;  3ZMU B;  3N2K E;  3IHR A;  3LK4 2;  2MBG A;  5LJM A;  5HWY A;  2HN2 A;  2LLY A;  4U31 A;  5ABF B;  4B3S T;  3VKG A;  3L8R A;  2B76 A;  1UGO A;  2XHE B;  3AEA A;  3AXJ B;  3AE3 A;  3RIA A;  1N34 T;  4A98 A;  1V9D A;  4WYV A;  2BBJ A;  2N1G A;  2Y8D A;  3MZK B;  4GOU A;  2LRL A;  2VAS A;  4IDP A;  5LOV E;  3ZCI A;  3P4S A;  4ASK A;  3Q5X A;  2CXF A;  4AKH A;  5FXW A;  2NW9 A;  3KBT A;  3QB5 K;  3HKD E;  3C4Z A;  4O2B E;  5JRC A;  3K3O A;  4HWI B;  2V6Y B;  4HFV A;  4B3M T;  1IAP A;  3JC6 C;  2Y48 B;  2IC9 A;  2KMF A;  5AQJ B;  4H9O C;  3HKC E;  5BR8 T;  3FHN A;  4MAL A;  5JDQ A;  4HFB A;  2M67 A;  3ANW A;  5M4Y A;  4JI8 T;  4HFD A;  4N78 D;  4CI2 B;  1ZKE A;  2KWH A;  5JTG A;  5LHG B;  2WAU A;  2D0T A;  4YTN A;  2BKN A;  4P0B A;  4DVD A;  2L8K A;  2J47 A;  4L9I A;  4UV8 B;  4CN4 A;  4DR3 T;  2VL8 A;  3EDU A;  2IC6 A;  5LCY A;  2D2S A;  3GWH A;  3O1I A;  3PJA J;  4TZ4 C;  5L3G B;  2WDR A;  5AQL B;  3T8O A;  1HTJ F;  4OK0 A;  4QH5 A;  5JDM A;  2WP9 A;  5AQP B;  2UXB T;  3AEB A;  3IBP A;  2K3W A;  3OPC A;  3RIU A;  4DR4 T;  2LE8 A;  3K1S A;  5L3B B;  2BDE A;  5F5W A;  3UUL A;  3ZST A;  4DUY T;  5CA1 E;  3P8C D;  2WWU A;  1M7K A;  3KFW X;  2Y6X A;  2ZM8 A;  3OKQ A;  1W9R A;  3KVA A;  4UR9 A;  4EYU A;  4ZEY A;  5AQI B;  4DR2 T;  3RYH E;  3PDY A;  3VRB A;  4X5T A;  5JQG E;  4AQF C;  3SWH A;  2KND A;  4YSZ A;  4YHJ A;  1LKX A;  2LEH A;  2NP9 A;  3U3I A;  1KF6 A;  4HWH A;  5FY0 A;  3V5U A;  2R6G F;  1W0A A;  2W00 A;  2YOE A;  3N9M A;  4H63 H;  4IE4 A;  3ZMV B;  4YXD A;  4HFE A;  4ZOL E;  5FNV E;  4YJ2 E;  1QLB A;  5AQQ B;  4U2Y A;  5LBQ B;  4WNK A;  3U78 A;  2RA1 A;  2JMK A;  2LSY A;  1HG5 A;  2CBJ A;  2D0U A;  2MPK A;  4DV4 T;  3CX8 B;  3SRZ A;  4LF6 T;  4A56 A;  2V1D B;  2LSJ A;  4YTM A;  3KV6 A;  5J2T E;  4IRE A;  3ZMT B;  4X66 T;  4HWC A;  2JQ9 A;  2JRK A;  3C50 A;  4DR5 T;  3VU7 H;  3AVS A;  4BJM A;  3I9Y A;  5L3D B;  5LG4 A;  5AQG B;  4X1Y E;  2F4V T;  1MMG A;  2HN1 A;  3RIU C;  3C98 B;  4HGA A;  1MIY A;  1WRD A;  2WS3 A;  2XQ8 A;  2WWV A;  3ZSS A;  5L2L A;  3FZH B;  2YIN A;  2YN6 A;  4NUU A;  3RGL A;  2BS2 A;  1OED E;  3NVO A;  4U2Z A;  4IE0 A;  2JQH A;  5LXT E;  2YDS A;  3EDV A;  2DHR A;  5IYZ E;  2CWO A;  5LHI B;  4YSX A;  4ZS3 A;  4PFO A;  2XAQ B;  3EVY A;  2DWG A;  5DJQ C;  4DV6 T;  2H88 A;  3AB3 B;  3UFG A;  2DLR A;  2FUP A;  5JR9 A;  2C5K T;  1BR4 A;  1XMQ T;  4KHP T;  2XM2 A;  3VRA A;  2WM9 A;  2LM9 A;  2XQ4 A;  2YDR A;  5HEO A;  5C2T A;  4LF7 T;  5LNK A;  5JDF A;  4GIW A;  2FJD A;  4DBR A;  1T8B A;  4ZXL A;  3SFD A;  4LF9 T;  3C51 A;  4PK6 A;  2DWK A;  2Z6E A;  2WU5 A;  4IGU A;  4TWH A;  2QVA A;  4YLH A;  5TAO A;  3V5S A;  1OWA A;  4AQF A;  2ZLY A;  1WR0 A;  4GK5 E;  2E8I A;  2GK9 A;  2WU2 A;  2MAW A;  4YJ3 E;  1YQ4 A;  1WFD A;  3HI2 A;  3RH3 A;  1IBK T;  4IDN A;  2XAG B;  2X68 A;  1YXR A;  4IE5 A;  3X1D A;  4ILC A;  1US7 B;  3C4W A;  4I55 E;  3N9L A;  3BQI A;  2WDQ A;  3PUR A;  4PW8 A;  3PTR B;  1Z0P A;  1HX8 A;  3CWZ B;  3JAF A;  3MK7 C;  4HEA A;  3PJA A;  4QHO A;  1VRB A;  3LG7 A;  4TWF A;  5J1G A;  3RF1 A;  1ZV4 X;  5EK4 A;  4XBF B;  4L0R A;  4IDQ A;  3RKO A;  2XM1 A;  1YD8 G;  2V7L A;  3UU8 A;  2K48 A;  5ETW A;  2Q9Q D;  3AEG A;  3PV0 F;  5ABH A;  5HYA A;  4V1A v;  4YSY A;  2J1D G;  5HEJ A;  2FJB A;  4X65 T;  3RKG A;  3CKD A;  1D0Y A;  2XSA A;  3UQ7 A;  4ISS A;  5H6R B;  2E9X D;  1JNZ A;  3MJX A;  4CZZ B;  1HNW T;  2A72 A;  2CCQ A;  5AQU B;  3GN5 B;  3B5M A;  3UUM A;  3L3P A;  4TNV A;  4ZI2 D;  3EAB A;  4CXY A;  3CVR A;  3GN5 A;  3KIN B;  5FXZ A;  1E2A A;  1HS7 A;  1NEK A;  4X20 E;  4OHF A;  5C8Y E;  2WDV A;  5LMU T;  1HR0 T;  4AIS A;  1KNZ A;  2DCF A;  2I59 A;  2L9Q A;  1IJ5 A;  1UCU A;  1YKH B;  2X0H A;  1KK7 A;  5HCJ A;  3RI5 A;  4L5G A;  5ABF A;  2ACX A;  2NR4 A;  4PJJ A;  4DV5 T;  3UUN A;  4U74 A;  1W09 A;  3WI3 A;  5F8P A;  3AVR A;  4IST A;  2BKP A;  5HEH A;  4P1N A;  5FY7 A;  2WMO A;  1MMA A;  4HWD A;  4ZI3 D;  4TV8 E;  3B57 A;  3MA9 A;  3Q9D A;  3AE7 A;  1VCS A;  1LRZ A;  2NW7 A;  3I0O A;  3ZJ1 A;  2BS3 A;  5AQS B;  4BA9 A;  4DBQ A;  3VR9 A;  1OED C;  5CJ5 A;  4DR6 T;  4AKL A;  4IL4 A;  1FJG T;  4QWN B;  3TKL B;  3PUG A;  2BG9 C;  3QUJ A;  3PUY F;  3T1H T;  4WBO A;  4PJM A;  2IAK A;  2X9W A;  3N9P A;  5ABG A;  5LYJ E;  5EK3 A;  3K8P C;  3RC8 A;  5FXV A;  4WW0 A;  2BZB A;  1KNR A;  3AA1 B;  1NAF A;  4TV9 E;  3QB5 A;  2IHR 1;  2IIU A;  1BR0 A;  2PBI A;  3H3M A;  2JJ9 A;  3AA0 B;  5AQM B;  3N9N A;  3NRX A;  5AQR B;  3AEF A;  4UVB B;  2LKH A;  1R8I A;  4UEL A;  3O1J A;  3RC3 A;  5DAB A;  4DND A;  2V7M A;  2YDQ A;  3P7I A;  4ADZ A;  4EV6 A;  5EK2 A;  2JMH A;  5LJN A;  3OTO T;  4B3R T;  2W2U A;  3FXE B;  2W67 A;  1HNX T;  3QNU A;  3ZYM A;  4COF A;  3LJC A;  2A3D A;  2V7I A;  2G0U A;  3GMI A;  3RRC A;  3K3N A;  4O4J E;  4U72 A;  1BR1 A;  4DMW A;  2J4G A;  5JRE A;  4GKJ T;  3E08 A;  2JQK A;  3AAI A;  2H89 A;  2CA5 A;  3I1A A;  4HFC A;  3HR0 A;  2VWA A;  3KVB A;  5GON E;  4ZI3 C;  4I0U A;  3UU4 A;  2UXD T;  3J7Y q;  2B1E A;  4ILA A;  2E9X C;  2NW8 A;  3HA4 A;  3IEE A;  3ZN0 B;  1WR6 A;  1N32 T;  2E5L T;  3J9X 1;  3RQW A;  5DQW A;  3ZKR A;  2N9D A;  4O4H E;  4PFP A;  1YKE B;  3AE2 A;  5KXJ A;  4DV3 T;  3QC9 A;  2Q9Q B;  3PE0 A;  4CXX A;  4X62 T;  4AKG A;  3FZF B;  5ADX L;  4KHZ F;  1VOM A;  3UTK A;  3LK2 B;  2V6X A;  1MND A;  3KV9 A;  3HL6 A;  2X0Y A;  3C64 A;  2KWI B;  3QK6 A;  4U7I A;  1LVK A;  2BBH A;  3M3Z B;  5H6Q B;  3RHW A;  1OED B;  5LA6 E;  5AQV B;  3ZLI A;  2CRB A;  1MNE A;  2FJA A;  4PAG A;  1WLX A;  2XAH B;  4QKN A;  2VKD A;  3EUH A;  1AJ3 A;  1FMV A;  4CXW A;  4AIU A;  2KT9 A;  2KZ7 B;  1YW0 A;  4ILB A;  2LT3 A;  4JI5 T;  4F8H A;  4IE6 A;  1G73 A;  4E7Z A;  4PK5 A;  4O4L E;  3F57 A;  1OXZ A;  2E9X A;  2HPJ A;  3AE9 A;  3BQK A;  1MMN A;  2ODU A;  2HPL A;  5HEG A;  4KP3 C;  2XQ5 A;  5HXE A;  3ETV A;  3H3A A;  2QGS A;  1Y01 A;  1ZOY A;  4E7S A;  1JNR A;  4GK0 E;  1E7P A;  4KUM B;  2XJ7 A;  4H9S E;  3OBV E;  1CUN A;  4UEM A;  4OX9 T;  3KDS E;  4A97 A;  1QSD A;  5ABE A;  4NPP A;  4DV0 T;  4MHC A;  1HCI A;  3ESL A;  2V26 A;  3JAE A;  4MLK A;  2QRX A;  3AE1 A;  2LSI A;  2EHO C;  4HE8 A;  3PUQ A;  1B7T A;  3CX7 B;  1Y64 B;  5IHY A;  4ZI7 E;  4JEH B;  5J2U E;  3L39 A;  5FXX A;  5LGU B;  4DV2 T;  2Q9Q C;  2LSG A;  5AFU L;  4IHJ E;  5L3C B;  3VKH A;  2I0M A;  2A9U A;  2KSR A;  2XAJ B;  1UUR A;  2YEV C;  3LDQ B;  2YU2 A;  4QXH B;  4UVC B;  1HFA A;  3A7M A;  4OYJ A;  3CK6 A;  3TLW A;  2K9A A;  4UXN B;  1SA0 E;  4AQY T;  2KIN B;  3MAC A;  5AQH B;  4JV5 T;  2VUR A;  4PJL A;  1IZN B;  3A8Y C;  3AXJ A;  3JAD A;  5CB4 E;  3ZPO A;  4EOZ B;  1N33 T;  2LJL A;  1SUM B;  1IBL T;  4UV9 B;  1KFY A;  4K0U A;  4JI3 T;  4JUY A;  4X1K E;  4YHH T;  2CBI A;  2XAS B;  3LBX A;  2AE9 A;  4KI0 F;  4KBM B;  3ONX A;  4UF0 A;  4AI6 A;  5LBM A;  2VVS A;  4B6X A;  1KNP A;  3PU8 A;  5L47 A;  3P50 A;  4U33 A;  3CX6 B;  3PUX F;  4YFS A;  3UU6 A;  2XQ9 A;  5AQT B;  4UIG A;  1D1C A;  5C3J A;  2V7K A;  5FMN A;  1XZY A;  3RYF E;  3CML A;  2UXN B;  2OV9 A;  3ZJ2 A;  5FVL A;  2ES0 A;  3AE8 A;  3O4X E;  4F6R C;  4JI1 T;  1DU2 A;  4P09 A;  2C0S A;  4TUY E;  3CQC B;  4M1P A;  2VKH A;  2EHO D;  5FL1 A;  2KXP B;  3I0Q A;  4CN1 A;  2M6B A;  2NOX A;  5LHH B;  1N36 T;  2L3L A;  4TN7 B;  2W66 A;  4QX7 B;  4O4I E;  4NIQ A;  4EGW A;  3ZEF B;  4Z8X A;  3N9O A;  3QOF A;  4MBQ A;  5JDH A;  1XDO A;  3PU3 A;  4QH4 A;  4LF5 T;  2OA5 A;  3F31 A;  3R84 B;  2ZMA A;  1E1H B;  2LRK A;  2Q9Q A;  4XZC A;  3SOL A;  3SS1 A;  4H9Q C;  5HXH A;  5IWA T;  3C4X A;  4P0A A;  1WCR A;  4DR7 T;  4G63 A;  2CPT A;  3HKE E;  5CA0 E;  3KV4 A;  1HX1 B;  2XQ3 A;  1BR2 A;  5AQN B;  2XQA A;  3AAA B;  3OVU A;  4YY3 T;  2V8S V;  3R6N A;  4AQG A;  3G06 A;  1SE7 A;  1J1J A;  2XY8 B;  2X9Y A;  2J62 A;  1D1A A;  3KBU A;  3ONL C;  4J2C A;  4LML A;  2K24 A;  4O8S A;  4LF8 T;  3SFE A;  5FYM A;  4EEB A;  4DV1 T;  2UUC T;  2CE7 A;  5DQV A;  4H9P C;  2E5V A;  3AED A;  3N2O A;  2W63 A;  3PUS A;  5AQO B;  4JEU B;  2H7O A;  2WSS V;  2YK0 A;  3CQG B;  5HCM A;  2A2F X;  1HNZ T;  5CGM A;  4DID B;  3DP7 A;  4AXP A;  1O3X A;  1X9B A;  2YKS A;  1H7C A;  3N5L A;  3Q5E A;  4ILU A;  4IT4 A;  3JCF A;  3TLU A;  2LKG A;  2QA7 A;  2V6Y A;  3UQ4 A;  4EIW A;  1I94 T;  4FI5 A;  4WZX A;  2FBW A;  2X66 A;  2NTY A;  1CHU A;  2XPK A;  4LMJ A;  4OYK A;  4EZ4 A;  1W0B A;  3ONJ A;  5LP6 E;  5L4H A;  1ZEE A;  2N2N A;  3B13 A;  3BK9 A;  1T72 A;  5EZY E;  3FXD B;  5FVK A;  2PFV A;  3LBX B;  3TLS A;  2C5J A;  4X1I E;  5JR9 B;  2SPC A;  1UX4 A;  2CHO A;  4I4T E;  4JI2 T;  3M65 A;  3I9W A;  1GQE A;  4QXC B;  3ZT7 A;  2FJE A;  2BG9 A;  1MMD A;  4BJN A;  4CI1 B;  4DMV A;  3VHL A;  2VQE T;  1ZP0 A;  5FKY A;  4HKA A;  2ACZ A;  2WCA A;  5J0Z A;  3FZL B;  4H9R C;  3F2E A;  5E0O A;  3GA8 A;  1YQ3 A;  1VCT A;  2WQY A;  2BG9 E;  4JLE A;  4EED A;  1XNQ T;  3Q5W A;  2YU1 A;  4JI7 T;  2IW5 B;  3VR8 A;  4UVA B;  3ZC1 A;  2JIW A;  3N2G E;  1XMO T;  2WZH A;  5HEU A;  2V5C A;  3FBL A;  3RIF A;  3TLT A;  3O9X A;  4OFZ A;  4ANJ A;  3ZC0 A;  5KMG P;  2DI4 A;  1L0V A;  5JRC B;  4U3C A;  3KV5 A;  4DV7 T;  2VKO A;  4QXB B;  4AKI A;  3AA6 B;  4WBN E;  1NEN A;  4ERR A;  4IDZ A;  3CIR A;  4Q25 A;  4B3T T;  1UUS A;  3LK3 B;  2UXC T;  2W62 A;  2X9X A;  3ZMS B;  3ABV A;  3NKZ A;  4I43 B;  3RPU A;  3P4P A;  4DO0 A;  5LB7 B;  1D1B A;  4HTE A;  2JQQ A;  4PJN A;  2MOZ A;  2LSK A;  2WMN A;  3UT5 E;  4K0K T;  3IF8 B;  5LMN T;  2MTQ A;  1NWM X;  2W0G A;  3AEE A;  5FL0 A;  3S4U A;  2IUB A;  4JI4 T;  1I6Z A;  2C5I T;  2W61 A;  3TLV A;  1FEW A;  2X51 A;  1FIO A;  2X9H A;  3E22 E;  4PNI A;  3DTO A;  5HXR A;  1G8X A;  3EI0 A;  3K3Q C;  2CLY B;  2LHN A;  2XQY A;  2KLQ A;  3PUV F;  3NWI A;  4XAX B;  4IDO A;  4CI3 B;  4EB6 E;  3RYI E;  4H63 V;  1EZ3 A;  3DJB A;  2X67 A;  1S94 A;  2UU9 T;  4JI6 T;  2E2A A;  4BAY B;  4LFB T;  3AA7 B;  4NXM T;  2CMR A;  2BVL A;  1T98 A;  3JC6 D;  2I6H A;  5BMV E;  3P4R A;  1U4Q A;  5HXS A;  3ANW B;  4A5X A;  3EAM A;  4CQI A;  1J5W A;  3RQU A;  3AAE B;  3LSV A;  2H3R A;  3RYC E;  3WAJ A;  2ZM2 A;  2BKO A;  4GKK T;  3PUW F;  4IIJ E;  2XAF B;  2CHN A;  1D0Z A; 
#chains in the Genus database with same CATH homology
 4DR3 T;  4JI1 T;  4LFC T;  2ZM6 T;  4DR6 T;  1FJG T;  1N36 T;  3T1H T;  2UXB T;  4DR4 T;  4LF5 T;  4DUY T;  3OTO T;  4DR7 T;  5IWA T;  4DR2 T;  1XNR T;  4YY3 T;  4B3R T;  5BR8 T;  4LF8 T;  4LFA T;  4DV1 T;  1HNX T;  2UUC T;  4GKJ T;  4DV4 T;  1HNZ T;  4LF6 T;  4X66 T;  2UUA T;  4LF4 T;  1I94 T;  2UXD T;  4DR5 T;  4NXN T;  2F4V T;  1N32 T;  2E5L T;  4DV3 T;  2UUB T;  4X62 T;  4JI2 T;  4DUZ T;  2VQF T;  4DV6 T;  2VQE T;  1J5E T;  4KHP T;  1XMQ T;  2HHH T;  4LF7 T;  1XNQ T;  4JI7 T;  4JI5 T;  4LF9 T;  1XMO T;  4JI0 T;  4DV7 T;  4DR1 T;  1IBK T;  4JYA T;  4OX9 T;  1IBM T;  2UXC T;  4DV0 T;  3T1Y T;  4DV2 T;  4K0K T;  4B3S T;  5LMN T;  1N34 T;  4JI4 T;  4X64 T;  4AQY T;  4X65 T;  4JV5 T;  4GKK T;  1N33 T;  1HNW T;  1IBL T;  4JI3 T;  2UU9 T;  4B3M T;  4JI6 T;  4LFB T;  4YHH T;  4NXM T;  1HR0 T;  5LMU T;  4JI8 T;  4DV5 T;  4B3T T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...