4B3TT

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3tT00
4X64T 4JI5T 2VQET 4JI8T 3T1HT 2UXBT 2E5LT 4DR2T 1N33T 1FJGT 4JI2T 4DR1T 4K0KT 5LMUT 4DV4T 5LMNT 2VQFT 4KHPT 1N32T 4X65T 4YHHT 4JI1T 4DR7T 4GKJT 4DV5T 2UXCT 4JI4T 4LF6T 4X62T 4DUYT 4JYAT 4OX9T 2UUAT 5BR8T 1HNXT 1IBMT 4LF5T 1XMQT 1HR0T 1IBLT 4LF4T 2HHHT 2UUBT 4LFAT 4DR5T 1N34T 4B3MT 4NXMT 4LFCT 4DR6T 4JI0T 4JI6T 4JI3T 4JI7T 4B3RT 4DR3T 4LF9T 2F4VT 1I94T 1IBKT 4B3ST 5IWAT 3OTOT 1J5ET 2ZM6T 4DUZT 4X66T 4DR4T 4LFBT 4B3TT 4DV2T 4JV5T 1N36T 4GKKT 4DV1T 1XNRT 4LF7T 4DV3T 4DV0T 4AQYT 4LF8T 1XMOT 2UUCT 1HNZT 1XNQT 2UU9T 3T1YT 4YY3T 4DV6T 2UXDT 1HNWT 4NXNT 4DV7T
chains in the Genus database with same CATH superfamily
3UT5E 3W15B 4X64T 2LOPA 4JI8T 4UR9A 2UXBT 2AXDS 5C2TA 4DR2T 2WP9A 2E5LT 2OA5A 1HG5A 2J62A 3ANWB 4ZI7E 1FJGT 2CA5A 2W63A 3NKZA 3P7IA 3A5XA 3CQGB 2CXLA 3K3NA 2M67A 2I59A 3RI5A 1M7KA 1QSDA 3HR0A 3MACA 2IAKA 2BKPA 3ZT6A 4WBNE 2X68A 3L09A 2D2SA 2DWKA 3AAIA 2LKGA 2X0HA 3C4WA 3HA4A 1WYBA 3P50A 3P4QA 3NWIA 3RX6A 1E2AA 3ZSTA 2DL1A 2ZM2A 2BG9A 1O3XA 2QGSA 3LK42 2GK9A 2YDQA 3N9OA 5AQGB 4EEDA 4ZOLE 3RYIE 2HPJA 2W62A 4QH5A 5AQLB 5HEOA 5LMNT 3RHWA 2W66A 3H37A 2WWVA 5LHGB 2VB6A 5FXWA 4AQFA 4JI1T 3IEEA 2NTYA 4DR7T 3FBLA 3FZHB 4QXCB 5J0ZA 1WYCA 4GKJT 3PJAJ 2LLYA 5L2LA 4EAHA 4GOUA 5ETWA 5FXZA 2ODVA 2W61A 4LF6T 3TLSA 3AE7A 4DUYT 4Z91A 4WW0A 1V9DA 1UURA 4HWIB 5HCMA 1WLXA 2CHOA 4NUUA 3EDUA 5EK2A 3I1AA 1LVFA 2X0YA 4KMCA 4WBOA 1MIVA 2IDOB 1LRZA 2XZEA 2VKOA 3LG7A 2VWAA 3C4ZA 4HFDA 2J4GA 3SOLA 1HS7A 2L3LA 2X9XA 2W00A 4EV6A 4NUVA 4NXMT 3GA8A 2W2UA 4KUMB 4LMKA 5LGNB 2X51A 2ZMAA 3K3OA 2X9WA 4JI3T 2H7OA 3TLWA 3JC6C 2A3DA 2XHEB 3PU8A 3P4PA 3E08A 4PK5A 3UU8A 4JI7T 3AE4A 4L9IA 2EHOA 2VK9A 2J47A 2LSJA 2MAWA 4UIGA 3Q5EA 5FKYA 2IC9A 3PTRB 3AEEA 3C50A 2ZM0A 5CA1E 5AQSB 2VKJA 5ABFA 3OKQA 5LB7B 1MMNA 4LF9T 2KWHA 3B13A 5AQHB 1I94T 3FB2A 3FXDB 3Q5DA 2LJLA 2WDQA 3EHZA 1MMAA 5IWAT 3IHRA 3RYCE 3RRWA 2KLQA 5IHYA 2IW5B 5JTGA 5KXJA 1KNZA 4HFHA 2NP9A 5CB4E 2N1GA 3RIUC 2BBJA 2V6YA 4IE5A 1G8XA 4TV9E 4OFZA 4HFIA 4DR4T 5FVLA 2P9BA 3G06A 4B3TT 4DV2T 1I6ZA 3DP7A 5HXSA 3FZKB 5IUXA 3AA0B 4I0UA 2WBLA 4EIWA 3QOFA 2YDRA 4P1NA 3UU5A 2YINA 4GKKT 3AE3A 2CPTA 1CHUA 3FZFB 3VR8A 2NR4A 2LSYA 3R6NA 3DTOA 3SS1A 4CN6A 5JDMA 1YKHB 4DV1T 2BS3A 3RLFF 3ESLA 4LF7T 3VKHA 4EGWA 1D1AA 4XAXB 3P8CD 4I4TE 3O9XA 2CM0A 4DV3T 5ABFB 2JQHA 5J2TE 2A72A 1KEYA 2KMFA 3KVAA 5FNVE 3NRYA 3BQIA 5AFUL 2Y8DA 1UGOA 3CQCB 1W09A 3LBXB 3UQ7A 4UVAB 2J1DG 2JQQA 3JCFA 1NENA 5FYMA 1VRBA 4C90A 3ZMTB 1HTJF 1UX5A 4UV8B 1JNRA 4X5TA 1FMVA 3WAJA 2C0SA 2V7LA 1HX1B 2RPAA 1VCSA 2CBJA 2XQYA 3DJBA 3EI0A 5J1GA 2NW7A 1W0BA 1WFDA 5AQRB 3ZJ2A 3KV5A 5AQVB 4HTEA 2XAHB 4JUYA 4CN4A 2WMOA 5DQWA 2HN1A 2V5CA 1OEDB 3N9MA 2D0UA 3QNUA 4Z90A 4PJNA 2RP4A 4K0UA 4OYKA 3RQUA 5J2UE 3PDYA 3RPUA 1ZKEA 2JIWA 2X9YA 2ES0A 4COFA 1IJ6A 1LVKA 3AE5A 1BR4A 1N33T 3K3QC 2I6HA 4HN9A 4PK6A 4Z8XA 2CEAA 4DIDB 4DVDA 2EHOB 3U78A 5L3BB 2NWBA 1ZV4X 4JI2T 2VKDA 4FI5A 3L3PA 3QUJA 4PJMA 2AE9A 2LHRA 3O1JA 1D1BA 3PJAA 5F5WA 2PTFA 5H6QB 2BKNA 5HCJA 3U3IA 5LMUT 4DV4T 2WDVA 5AQUB 1T98A 1HF8A 4HWHA 5AQPB 3ZMSB 4YTNA 5JDLA 3PE0A 1HX8A 2MPKA 1SE7A 2YDSA 3N9PA 2XAQB 3CIRA 2VL0A 4AKGA 4ZI3D 2XQ7A 4KHPT 2WM9A 3FXEB 4ZEYA 2WB5A 5EZYE 2YU2A 3K8PC 5JRCA 3RYHE 4ERRA 2EHOD 1OWAA 1OXZA 3JAFA 3ZJ1A 5L3DB 2A9UA 4DV5T 3ZLIA 4ILCA 3AVSA 1YQ4A 3CX7B 4XZCA 1HG2A 2YEVC 4PAGA 4ANJA 4A5XA 1VOMA 4X62T 4IL9A 1QLBA 3HKBE 3LK2B 5LG3A 2CHNA 4CQIA 4DO0A 4O2BE 4P0AA 4X1YE 3ZC1A 3P4SA 4EOZB 5L3GB 5HYAA 5LG4A 2OV9A 3HKEE 1Z8UA 1J5WA 2E9XA 3B57A 3BK9A 2LRKA 2HHHT 1X9BA 4M1PA 3PURA 4PNIA 5F8PA 4LFAT 4L5GA 4JEHB 3UQ4A 1CUNA 4MHCA 4O8SA 4U31A 4H9RC 1HFAA 4I50E 3V5SA 3D0TA 4JI6T 4JI0T 1YQ3A 2FUPA 3CVRA 4TWHA 1YW0A 2CMRA 4TX5A 5M4YA 2E8IA 2MBGA 3LDQB 2IUBA 2XUEA 3IBPA 4H9QC 3TLUA 4B3RT 1E7PA 4UXNB 3UUBA 5LXTE 2BDEA 3P4RA 2CWYA 5FY0A 3AE2A 3OYXA 1GQEA 2WAUA 5CA0E 2A2FX 3RYFE 2ACXA 4QKNA 3Q2MA 3X1DA 4I55E 2BVMA 1QUUA 4TNWA 3UUXB 3CX8B 4QHOA 3ZMZB 2YN6A 4J2CA 2PFVA 3GN5A 3T8OA 2JPFA 2Y48B 2ACZA 3GWHA 3RH3A 4LF4T 2DNXA 3ZYKA 3PUXF 4AQGA 4H9SE 3ZPOA 4P0BA 2V8SV 3N9LA 4H9NC 1ZOYA 3AEBA 4ZZBA 3E22E 2KWIB 1XWMA 2XQ5A 4IDOA 4CXYA 2V6YB 3N2OA 2KINB 2UUBT 4C91A 1WR6A 4ZI3C 4EYYR 5F3JA 4AIUA 3AVRA 4KI0F 5CFBA 4QX7B 2WZIA 4IL4A 5C8YE 2N2NA 5JDQA 5AQFB 2K9AA 1MMDA 2ODUA 5JDHA 4O4IE 5JDFA 3AAEB 3KV6A 2V26A 4QXBB 4MLKA 3CX6B 4AISA 2XQ8A 3AE6A 1EZ3A 2V7MA 1NAFA 2D9DA 2QA7A 4G2AA 5JVDE 3F31A 3KINB 4ZZCA 4AQYT 2LEHA 4NPPA 4YT0A 5LGTB 1S94A 5JREA 2BVLA 1US7B 2V1DB 3KV4A 3C51A 4DNDA 1YXRA 3F2EA 2KT9A 2ZLYA 4YJ3E 3LSVA 5L47A 3H3MA 4QX8B 1X79A 3MZKB 2LSGA 2LSKA 2XAJB 2CXFA 2XAGB 4PFOA 1OEDC 3BQKA 3I9WA 5HXEA 3ZSSA 4CXWA 4EXTA 2C5IT 2WY2A 4JLEA 3ONLC 4X20E 4EZ4A 4YSZA 1MMGA 5CGMA 4H63H 4DBQA 1U4QA 1FIOA 4HFEA 3AEAA 5ADXL 2B76A 3K1SA 4JI5T 2VQET 2E9XB 3AXJB 4BA9A 4X1KE 5BMVE 2FJDA 2YOEA 5DABA 3FBZA 5A1LA 3PV0F 4KX6A 5LOVE 1SHZC 4EEBA 3Q5XA 5EK3A 5AQOB 2JQ9A 4ILBA 5EK4A 3PUYF 4ZS2A 1YD8G 2BS4A 4BAYB 2Q9QA 3ZCJA 1KNPA 4TNVA 4K0KT 2W4XA 3O4XE 3S4UA 3UUNA 3NZQA 1D0ZA 5AQQB 4ZI2D 3V5UA 5KDMC 1BR1A 2LM9A 2XQ9A 1G73A 3UULA 2H3RA 4O4JE 5TAOA 3RRCA 2N9DA 2VQFT 3RF1A 4L0RA 1N32T 1XZYA 4AXPA 3SFEA 4YHHT 3HKCE 4H9PC 2C5KT 2JMHA 2L9QA 5LA6E 3L8RA 1IZNB 3PUQA 2DLRA 2WWUA 4QXHB 4YSXA 5LGUB 5FY1A 4HWFA 4GK0E 4JYAT 4OX9T 2XASB 5LHIB 1HNXT 3ZN1B 4LF5T 4GYRA 4IDNA 2FJBA 2IC6A 2NTXA 4U7YA 2XJ7A 3LJCA 1XMQT 1HR0T 4AI6A 1XDOA 2UXNB 5AQTB 3I0OA 3N2GE 4IT4A 3R84B 3UUMA 3VU7H 3SRZA 3ZN0B 4ADZA 2LHNA 2CCQA 2HPLA 4G63A 4UF0B 2YU1A 3N5LA 4JEUB 3ZCIA 4PJJA 3JAEA 2E5VA 3I0QA 4QH1A 4X1IE 3B5MA 2QVAA 3LK3B 2NW9A 5HAXA 3UU6A 4YJ2E 4DR5T 3QB5K 4LFCT 4DR6T 2RA1A 1KNRA 1B7TA 3O1IA 4TV8E 2BG9C 4B3MT 4Q25A 5E0OA 5ABEA 1WRDA 4ISTA 3QK6A 4QH4A 2NW8A 2WQYA 2W0GA 3JC6D 4IIJE 5DJQC 2ZM8A 5JR9A 4UVCB 5AQNB 2I0MA 4CN1A 4DMWA 4DR3T 2CXDA 1ZP0A 2H7VC 3MJXA 3PUAA 4YSYA 5HEHA 5FVKA 5FMNA 2H89A 4YXDA 5LCYA 2VVNA 2F4VT 3HKDE 3AEDA 3KV9A 4LMLA 3RQWA 1IBKT 2D0TA 2XSBA 5FXVA 5GONE 4GIWA 3QB5A 4U7IA 2IMLA 3OTOT 5HWYA 5L3CB 4ILAA 1J5ET 2ZM6T 5L3FB 4PJLA 4DUZT 3ONXA 4IGUA 2LSIA 1T72A 2YKSA 3A7MA 3AE9A 3AE1A 1MNDA 3AA1B 4JBWF 4LFBT 3C4XA 5JH7E 2IIUA 2DCFA 4OHFA 1D0XA 2HN2A 4JV5T 1VCTA 3CQXC 2CLYC 2XQ3A 3AA6B 2PG8A 1N36T 3ANWA 1XDPA 2UXXB 3UU3A 3EABA 2CLYB 4HFCA 2WCAA 2E2AA 4TN7B 4A56A 4HEAA 5LHHB 5KX5E 3UFEA 1SA0E 3UFGA 4A98A 3KFWX 4HKAA 3AECA 5AQKB 5LP6E 3IA3A 3RIFA 4MBQA 5H6RB 3OBVE 1R8IA 2WDRA 4BJNA 3PUZF 5HEUA 3J7Yq 1UUSA 2JRKA 2FJAA 2KZ7B 3VR9A 4U33A 3VKGA 3C64A 5L4HA 4AQFC 4LF8T 3ZYMA 1XMOT 1IJ5A 2X0LB 3KBUA 2XM2A 5JDNA 5JRCB 2IHR1 2V5DA 3FHNA 3CPZA 2KXPB 2W67A 2K5BB 4N78D 4QWNB 4A97A 3AEFA 3RGLA 2VASA 1DU2A 1UCUA 4AKRB 2LM2A 2XM1A 2UU9T 2PBIA 4ZI2C 2Z6EA 4I43B 3T1YT 2R6GF 1ZHCA 2CE7A 2WU5A 4WNKA 4DV6T 3PUSA 1SUMB 2UXDT 3WI3A 4F8HA 4GYSA 5AQMB 2PJQA 4DV7T 4IHJE 1T8BA 3CMLA 4ASKA 4ZHQE 1KFYA 2XY8B 4E7ZA 1BR2A 4HGAA 3ZEFB 1MNEA 4IDZA 3T1HT 3RC8A 1OEDE 2VL8A 3Q9DA 4IDPA 3SFDA 3TLTA 1OEDA 2MYSA 4B3ST 2KSRA 2E9XC 5L4EA 4HWCA 2XQAA 4TWFA 4WYVA 1FEWA 3N9QA 3RIAA 2QYWA 4KP3C 3HI2A 2CWOA 2E9XD 4UVBB 2V6XA 2WU2A 5HXCA 5ABGA 3CK6A 1U5PA 4IE6A 2JMKA 3M65A 4PFPA 2EHOC 2XPKA 4U2YA 4DR1T 3O1HA 4H9OC 2X9HA 3EUHA 4IE7A 3ZYLA 5LYJE 3MA9A 5LJMA 1Y64B 3LFMA 4LMJA 4CI2B 4EZHA 1JNZA 5L3EB 2DWGA 2Q9QB 5DQVA 3NBXX 1NEKA 3GMIA 3CWZB 1H7CA 2BBHA 3AB3B 4IREA 5FL1A 2FJEA 2K24A 2DI4A 3ZT7A 3WAKA 2Q9QC 2Y6XA 4EYUA 3MXZA 4X65T 3OJAA 4HFBA 3VRAA 4CI1B 5JDGA 4V1Av 2JJ9A 2UXCT 3KVBA 2LOSA 2MTQA 3TLVA 5JQGE 4JI4T 3RIUA 3OPCA 4ISSA 4P09A 2X66A 5FY7A 2UUAT 5BR8T 1IBMT 2FBWA 2XQ6A 1NWMX 4U2ZA 3VRBA 3NZPA 4PK4A 3AXJA 1WR0A 2YK0A 3F57A 2DHRA 3ZT5A 1IBLT 3HL6A 3AEGA 2CRBA 3ZKRA 4CI3B 2X67A 3AAAB 2LT3A 3L39A 3AA7B 4FJOA 4HWDA 1KK7A 3CKDA 3PUWF 3RC3A 4YTPA 2BG9B 4OK0A 1L0VA 4O2AE 4HE8A 2BKOA 3FZMB 3BQLA 3OYZA 4MFRA 3OVUA 4NIQA 4BJMA 1N34T 1W9RA 3N2KE 2SPCA 5LBQB 4XBFB 2H88A 4PW8A 4ZXLA 1Y01A 3FZLB 3EVYA 4YFSA 3J9X1 2VKHA 2JQKA 2WS3A 2OLTA 2V7IA 3A8YC 4AKLA 3PU3A 4YHJA 4UV9B 4CXXA 2K3WA 4KBMB 2LKHA 2XQ4A 1HCIA 3Q5WA 4UF0A 3VHLA 2XTLA 4MALA 1LKXA 4U74A 3UTKA 5LJNA 4YTMA 2NOXA 4YLHA 1UK5A 2KNDA 4O4HE 5IYZE 5JR9B 1IAPA 3TKLB 4H63V 3PUGA 4HFVA 3ONJA 2M6IA 3ABVA 5FXXA 3MKDA 2QRXA 2V7KA 3N9NA 5HXRA 1WCRA 5LBMA 4ILUA 4EB6E 3I9YA 3KDSE 5C3JA 4TUYE 5JR9C 2VURA 3JADA 4CZZB 3IF8B 1MIYA 3ETVA 3QC9A 4IE0A 1D1CA 2Q9QD 4O4LE 4UELA 2G0UA 2B1EA 4B6XA 4X66T 3ZC0A 4DBRA 3MK7C 3EDVA 2VVSA 4IDQA 3RKOA 5KMGP 1M62A 1AJ3A 4AKIA 1KF6A 4DMVA 5LNKA 2BZBA 3NVOA 4KHZF 2WZHA 3ZMUB 3ZMVB 1E1HB 3LBXA 3P4WA 1UX4A 4AKHA 4UEMA 2K48A 4IE4A 2L8KA 2LE8A 2D5UA 1S35A 1XNRT 3M3ZB 4OYJA 3AE8A 3UU4A 1Z0PA 2BG9E 1D0YA 1W0AA 3PUVF 4GK5E 5AQIB 5AQJB 2C5JA 3H3AA 5ABHA 4F6RC 4DV0T 5FP3A 2LRLA 5FL0A 5HWXA 4ZS3A 2HH7A 3NRXA 2V7JA 5CJ5A 4TWDA 2UUCT 2M6BA 2WMNA 4U3CA 3SWHA 2CBIA 1ZEEA 2XSAA 3C98B 2BS2A 1J1JA 5HEJA 3ETUA 1YKEB 1FMWA 3E0ZA 1HNZT 1XNQT 4WZXA 5HEGA 4E7SA 5HXHA 1BR0A 2XAFB 2WSSV 4U72A 3GN5B 2MOZA 3KBTA 1MIWA 3EAMA 3RKGA 1HNWT 4NXNT 4TZ4C 4YY3T 1T7SA
chains in the Genus database with same CATH topology
4X64T 4JI5T 2VQET 4JI8T 3T1HT 2UXBT 2E5LT 4DR2T 1N33T 1FJGT 4JI2T 4DR1T 4K0KT 5LMUT 4DV4T 5LMNT 2VQFT 4KHPT 1N32T 4X65T 4YHHT 4JI1T 4DR7T 4GKJT 4DV5T 2UXCT 4JI4T 4LF6T 4X62T 4DUYT 4JYAT 4OX9T 2UUAT 5BR8T 1HNXT 1IBMT 4LF5T 1XMQT 1HR0T 1IBLT 4LF4T 2HHHT 2UUBT 4LFAT 4DR5T 1N34T 4B3MT 4NXMT 4LFCT 4DR6T 4JI0T 4JI6T 4JI3T 4JI7T 4B3RT 4DR3T 4LF9T 2F4VT 1I94T 1IBKT 4B3ST 5IWAT 3OTOT 1J5ET 2ZM6T 4DUZT 4X66T 4DR4T 4LFBT 4B3TT 4DV2T 4JV5T 1N36T 4GKKT 4DV1T 1XNRT 4LF7T 4DV3T 4DV0T 4AQYT 4LF8T 1XMOT 2UUCT 1HNZT 1XNQT 2UU9T 3T1YT 4YY3T 4DV6T 2UXDT 1HNWT 4NXNT 4DV7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 T;  4JI5 T;  2VQE T;  4JI8 T;  3T1H T;  2UXB T;  2E5L T;  4DR2 T;  1N33 T;  1FJG T;  4JI2 T;  4DR1 T;  4K0K T;  5LMU T;  4DV4 T;  5LMN T;  2VQF T;  4KHP T;  1N32 T;  4X65 T;  4YHH T;  4JI1 T;  4DR7 T;  4GKJ T;  4DV5 T;  2UXC T;  4JI4 T;  4LF6 T;  4X62 T;  4DUY T;  4JYA T;  4OX9 T;  2UUA T;  5BR8 T;  1HNX T;  1IBM T;  4LF5 T;  1XMQ T;  1HR0 T;  1IBL T;  4LF4 T;  2HHH T;  2UUB T;  4LFA T;  4DR5 T;  1N34 T;  4B3M T;  4NXM T;  4LFC T;  4DR6 T;  4JI0 T;  4JI6 T;  4JI3 T;  4JI7 T;  4B3R T;  4DR3 T;  4LF9 T;  2F4V T;  1I94 T;  1IBK T;  4B3S T;  5IWA T;  3OTO T;  1J5E T;  2ZM6 T;  4DUZ T;  4X66 T;  4DR4 T;  4LFB T;  4B3T T;  4DV2 T;  4JV5 T;  1N36 T;  4GKK T;  4DV1 T;  1XNR T;  4LF7 T;  4DV3 T;  4DV0 T;  4AQY T;  4LF8 T;  1XMO T;  2UUC T;  1HNZ T;  1XNQ T;  2UU9 T;  3T1Y T;  4YY3 T;  4DV6 T;  2UXD T;  1HNW T;  4NXN T;  4DV7 T; 
#chains in the Genus database with same CATH topology
 3UT5 E;  3W15 B;  4X64 T;  2LOP A;  4JI8 T;  4UR9 A;  2UXB T;  2AXD S;  5C2T A;  4DR2 T;  2WP9 A;  2E5L T;  2OA5 A;  1HG5 A;  2J62 A;  3ANW B;  4ZI7 E;  1FJG T;  2CA5 A;  2W63 A;  3NKZ A;  3P7I A;  3A5X A;  3CQG B;  2CXL A;  3K3N A;  2M67 A;  2I59 A;  3RI5 A;  1M7K A;  1QSD A;  3HR0 A;  3MAC A;  2IAK A;  2BKP A;  3ZT6 A;  4WBN E;  2X68 A;  3L09 A;  2D2S A;  2DWK A;  3AAI A;  2LKG A;  2X0H A;  3C4W A;  3HA4 A;  1WYB A;  3P50 A;  3P4Q A;  3NWI A;  3RX6 A;  1E2A A;  3ZST A;  2DL1 A;  2ZM2 A;  2BG9 A;  1O3X A;  2QGS A;  3LK4 2;  2GK9 A;  2YDQ A;  3N9O A;  5AQG B;  4EED A;  4ZOL E;  3RYI E;  2HPJ A;  2W62 A;  4QH5 A;  5AQL B;  5HEO A;  5LMN T;  3RHW A;  2W66 A;  3H37 A;  2WWV A;  5LHG B;  2VB6 A;  5FXW A;  4AQF A;  4JI1 T;  3IEE A;  2NTY A;  4DR7 T;  3FBL A;  3FZH B;  4QXC B;  5J0Z A;  1WYC A;  4GKJ T;  3PJA J;  2LLY A;  5L2L A;  4EAH A;  4GOU A;  5ETW A;  5FXZ A;  2ODV A;  2W61 A;  4LF6 T;  3TLS A;  3AE7 A;  4DUY T;  4Z91 A;  4WW0 A;  1V9D A;  1UUR A;  4HWI B;  5HCM A;  1WLX A;  2CHO A;  4NUU A;  3EDU A;  5EK2 A;  3I1A A;  1LVF A;  2X0Y A;  4KMC A;  4WBO A;  1MIV A;  2IDO B;  1LRZ A;  2XZE A;  2VKO A;  3LG7 A;  2VWA A;  3C4Z A;  4HFD A;  2J4G A;  3SOL A;  1HS7 A;  2L3L A;  2X9X A;  2W00 A;  4EV6 A;  4NUV A;  4NXM T;  3GA8 A;  2W2U A;  4KUM B;  4LMK A;  5LGN B;  2X51 A;  2ZMA A;  3K3O A;  2X9W A;  4JI3 T;  2H7O A;  3TLW A;  3JC6 C;  2A3D A;  2XHE B;  3PU8 A;  3P4P A;  3E08 A;  4PK5 A;  3UU8 A;  4JI7 T;  3AE4 A;  4L9I A;  2EHO A;  2VK9 A;  2J47 A;  2LSJ A;  2MAW A;  4UIG A;  3Q5E A;  5FKY A;  2IC9 A;  3PTR B;  3AEE A;  3C50 A;  2ZM0 A;  5CA1 E;  5AQS B;  2VKJ A;  5ABF A;  3OKQ A;  5LB7 B;  1MMN A;  4LF9 T;  2KWH A;  3B13 A;  5AQH B;  1I94 T;  3FB2 A;  3FXD B;  3Q5D A;  2LJL A;  2WDQ A;  3EHZ A;  1MMA A;  5IWA T;  3IHR A;  3RYC E;  3RRW A;  2KLQ A;  5IHY A;  2IW5 B;  5JTG A;  5KXJ A;  1KNZ A;  4HFH A;  2NP9 A;  5CB4 E;  2N1G A;  3RIU C;  2BBJ A;  2V6Y A;  4IE5 A;  1G8X A;  4TV9 E;  4OFZ A;  4HFI A;  4DR4 T;  5FVL A;  2P9B A;  3G06 A;  4B3T T;  4DV2 T;  1I6Z A;  3DP7 A;  5HXS A;  3FZK B;  5IUX A;  3AA0 B;  4I0U A;  2WBL A;  4EIW A;  3QOF A;  2YDR A;  4P1N A;  3UU5 A;  2YIN A;  4GKK T;  3AE3 A;  2CPT A;  1CHU A;  3FZF B;  3VR8 A;  2NR4 A;  2LSY A;  3R6N A;  3DTO A;  3SS1 A;  4CN6 A;  5JDM A;  1YKH B;  4DV1 T;  2BS3 A;  3RLF F;  3ESL A;  4LF7 T;  3VKH A;  4EGW A;  1D1A A;  4XAX B;  3P8C D;  4I4T E;  3O9X A;  2CM0 A;  4DV3 T;  5ABF B;  2JQH A;  5J2T E;  2A72 A;  1KEY A;  2KMF A;  3KVA A;  5FNV E;  3NRY A;  3BQI A;  5AFU L;  2Y8D A;  1UGO A;  3CQC B;  1W09 A;  3LBX B;  3UQ7 A;  4UVA B;  2J1D G;  2JQQ A;  3JCF A;  1NEN A;  5FYM A;  1VRB A;  4C90 A;  3ZMT B;  1HTJ F;  1UX5 A;  4UV8 B;  1JNR A;  4X5T A;  1FMV A;  3WAJ A;  2C0S A;  2V7L A;  1HX1 B;  2RPA A;  1VCS A;  2CBJ A;  2XQY A;  3DJB A;  3EI0 A;  5J1G A;  2NW7 A;  1W0B A;  1WFD A;  5AQR B;  3ZJ2 A;  3KV5 A;  5AQV B;  4HTE A;  2XAH B;  4JUY A;  4CN4 A;  2WMO A;  5DQW A;  2HN1 A;  2V5C A;  1OED B;  3N9M A;  2D0U A;  3QNU A;  4Z90 A;  4PJN A;  2RP4 A;  4K0U A;  4OYK A;  3RQU A;  5J2U E;  3PDY A;  3RPU A;  1ZKE A;  2JIW A;  2X9Y A;  2ES0 A;  4COF A;  1IJ6 A;  1LVK A;  3AE5 A;  1BR4 A;  1N33 T;  3K3Q C;  2I6H A;  4HN9 A;  4PK6 A;  4Z8X A;  2CEA A;  4DID B;  4DVD A;  2EHO B;  3U78 A;  5L3B B;  2NWB A;  1ZV4 X;  4JI2 T;  2VKD A;  4FI5 A;  3L3P A;  3QUJ A;  4PJM A;  2AE9 A;  2LHR A;  3O1J A;  1D1B A;  3PJA A;  5F5W A;  2PTF A;  5H6Q B;  2BKN A;  5HCJ A;  3U3I A;  5LMU T;  4DV4 T;  2WDV A;  5AQU B;  1T98 A;  1HF8 A;  4HWH A;  5AQP B;  3ZMS B;  4YTN A;  5JDL A;  3PE0 A;  1HX8 A;  2MPK A;  1SE7 A;  2YDS A;  3N9P A;  2XAQ B;  3CIR A;  2VL0 A;  4AKG A;  4ZI3 D;  2XQ7 A;  4KHP T;  2WM9 A;  3FXE B;  4ZEY A;  2WB5 A;  5EZY E;  2YU2 A;  3K8P C;  5JRC A;  3RYH E;  4ERR A;  2EHO D;  1OWA A;  1OXZ A;  3JAF A;  3ZJ1 A;  5L3D B;  2A9U A;  4DV5 T;  3ZLI A;  4ILC A;  3AVS A;  1YQ4 A;  3CX7 B;  4XZC A;  1HG2 A;  2YEV C;  4PAG A;  4ANJ A;  4A5X A;  1VOM A;  4X62 T;  4IL9 A;  1QLB A;  3HKB E;  3LK2 B;  5LG3 A;  2CHN A;  4CQI A;  4DO0 A;  4O2B E;  4P0A A;  4X1Y E;  3ZC1 A;  3P4S A;  4EOZ B;  5L3G B;  5HYA A;  5LG4 A;  2OV9 A;  3HKE E;  1Z8U A;  1J5W A;  2E9X A;  3B57 A;  3BK9 A;  2LRK A;  2HHH T;  1X9B A;  4M1P A;  3PUR A;  4PNI A;  5F8P A;  4LFA T;  4L5G A;  4JEH B;  3UQ4 A;  1CUN A;  4MHC A;  4O8S A;  4U31 A;  4H9R C;  1HFA A;  4I50 E;  3V5S A;  3D0T A;  4JI6 T;  4JI0 T;  1YQ3 A;  2FUP A;  3CVR A;  4TWH A;  1YW0 A;  2CMR A;  4TX5 A;  5M4Y A;  2E8I A;  2MBG A;  3LDQ B;  2IUB A;  2XUE A;  3IBP A;  4H9Q C;  3TLU A;  4B3R T;  1E7P A;  4UXN B;  3UUB A;  5LXT E;  2BDE A;  3P4R A;  2CWY A;  5FY0 A;  3AE2 A;  3OYX A;  1GQE A;  2WAU A;  5CA0 E;  2A2F X;  3RYF E;  2ACX A;  4QKN A;  3Q2M A;  3X1D A;  4I55 E;  2BVM A;  1QUU A;  4TNW A;  3UUX B;  3CX8 B;  4QHO A;  3ZMZ B;  2YN6 A;  4J2C A;  2PFV A;  3GN5 A;  3T8O A;  2JPF A;  2Y48 B;  2ACZ A;  3GWH A;  3RH3 A;  4LF4 T;  2DNX A;  3ZYK A;  3PUX F;  4AQG A;  4H9S E;  3ZPO A;  4P0B A;  2V8S V;  3N9L A;  4H9N C;  1ZOY A;  3AEB A;  4ZZB A;  3E22 E;  2KWI B;  1XWM A;  2XQ5 A;  4IDO A;  4CXY A;  2V6Y B;  3N2O A;  2KIN B;  2UUB T;  4C91 A;  1WR6 A;  4ZI3 C;  4EYY R;  5F3J A;  4AIU A;  3AVR A;  4KI0 F;  5CFB A;  4QX7 B;  2WZI A;  4IL4 A;  5C8Y E;  2N2N A;  5JDQ A;  5AQF B;  2K9A A;  1MMD A;  2ODU A;  5JDH A;  4O4I E;  5JDF A;  3AAE B;  3KV6 A;  2V26 A;  4QXB B;  4MLK A;  3CX6 B;  4AIS A;  2XQ8 A;  3AE6 A;  1EZ3 A;  2V7M A;  1NAF A;  2D9D A;  2QA7 A;  4G2A A;  5JVD E;  3F31 A;  3KIN B;  4ZZC A;  4AQY T;  2LEH A;  4NPP A;  4YT0 A;  5LGT B;  1S94 A;  5JRE A;  2BVL A;  1US7 B;  2V1D B;  3KV4 A;  3C51 A;  4DND A;  1YXR A;  3F2E A;  2KT9 A;  2ZLY A;  4YJ3 E;  3LSV A;  5L47 A;  3H3M A;  4QX8 B;  1X79 A;  3MZK B;  2LSG A;  2LSK A;  2XAJ B;  2CXF A;  2XAG B;  4PFO A;  1OED C;  3BQK A;  3I9W A;  5HXE A;  3ZSS A;  4CXW A;  4EXT A;  2C5I T;  2WY2 A;  4JLE A;  3ONL C;  4X20 E;  4EZ4 A;  4YSZ A;  1MMG A;  5CGM A;  4H63 H;  4DBQ A;  1U4Q A;  1FIO A;  4HFE A;  3AEA A;  5ADX L;  2B76 A;  3K1S A;  4JI5 T;  2VQE T;  2E9X B;  3AXJ B;  4BA9 A;  4X1K E;  5BMV E;  2FJD A;  2YOE A;  5DAB A;  3FBZ A;  5A1L A;  3PV0 F;  4KX6 A;  5LOV E;  1SHZ C;  4EEB A;  3Q5X A;  5EK3 A;  5AQO B;  2JQ9 A;  4ILB A;  5EK4 A;  3PUY F;  4ZS2 A;  1YD8 G;  2BS4 A;  4BAY B;  2Q9Q A;  3ZCJ A;  1KNP A;  4TNV A;  4K0K T;  2W4X A;  3O4X E;  3S4U A;  3UUN A;  3NZQ A;  1D0Z A;  5AQQ B;  4ZI2 D;  3V5U A;  5KDM C;  1BR1 A;  2LM9 A;  2XQ9 A;  1G73 A;  3UUL A;  2H3R A;  4O4J E;  5TAO A;  3RRC A;  2N9D A;  2VQF T;  3RF1 A;  4L0R A;  1N32 T;  1XZY A;  4AXP A;  3SFE A;  4YHH T;  3HKC E;  4H9P C;  2C5K T;  2JMH A;  2L9Q A;  5LA6 E;  3L8R A;  1IZN B;  3PUQ A;  2DLR A;  2WWU A;  4QXH B;  4YSX A;  5LGU B;  5FY1 A;  4HWF A;  4GK0 E;  4JYA T;  4OX9 T;  2XAS B;  5LHI B;  1HNX T;  3ZN1 B;  4LF5 T;  4GYR A;  4IDN A;  2FJB A;  2IC6 A;  2NTX A;  4U7Y A;  2XJ7 A;  3LJC A;  1XMQ T;  1HR0 T;  4AI6 A;  1XDO A;  2UXN B;  5AQT B;  3I0O A;  3N2G E;  4IT4 A;  3R84 B;  3UUM A;  3VU7 H;  3SRZ A;  3ZN0 B;  4ADZ A;  2LHN A;  2CCQ A;  2HPL A;  4G63 A;  4UF0 B;  2YU1 A;  3N5L A;  4JEU B;  3ZCI A;  4PJJ A;  3JAE A;  2E5V A;  3I0Q A;  4QH1 A;  4X1I E;  3B5M A;  2QVA A;  3LK3 B;  2NW9 A;  5HAX A;  3UU6 A;  4YJ2 E;  4DR5 T;  3QB5 K;  4LFC T;  4DR6 T;  2RA1 A;  1KNR A;  1B7T A;  3O1I A;  4TV8 E;  2BG9 C;  4B3M T;  4Q25 A;  5E0O A;  5ABE A;  1WRD A;  4IST A;  3QK6 A;  4QH4 A;  2NW8 A;  2WQY A;  2W0G A;  3JC6 D;  4IIJ E;  5DJQ C;  2ZM8 A;  5JR9 A;  4UVC B;  5AQN B;  2I0M A;  4CN1 A;  4DMW A;  4DR3 T;  2CXD A;  1ZP0 A;  2H7V C;  3MJX A;  3PUA A;  4YSY A;  5HEH A;  5FVK A;  5FMN A;  2H89 A;  4YXD A;  5LCY A;  2VVN A;  2F4V T;  3HKD E;  3AED A;  3KV9 A;  4LML A;  3RQW A;  1IBK T;  2D0T A;  2XSB A;  5FXV A;  5GON E;  4GIW A;  3QB5 A;  4U7I A;  2IML A;  3OTO T;  5HWY A;  5L3C B;  4ILA A;  1J5E T;  2ZM6 T;  5L3F B;  4PJL A;  4DUZ T;  3ONX A;  4IGU A;  2LSI A;  1T72 A;  2YKS A;  3A7M A;  3AE9 A;  3AE1 A;  1MND A;  3AA1 B;  4JBW F;  4LFB T;  3C4X A;  5JH7 E;  2IIU A;  2DCF A;  4OHF A;  1D0X A;  2HN2 A;  4JV5 T;  1VCT A;  3CQX C;  2CLY C;  2XQ3 A;  3AA6 B;  2PG8 A;  1N36 T;  3ANW A;  1XDP A;  2UXX B;  3UU3 A;  3EAB A;  2CLY B;  4HFC A;  2WCA A;  2E2A A;  4TN7 B;  4A56 A;  4HEA A;  5LHH B;  5KX5 E;  3UFE A;  1SA0 E;  3UFG A;  4A98 A;  3KFW X;  4HKA A;  3AEC A;  5AQK B;  5LP6 E;  3IA3 A;  3RIF A;  4MBQ A;  5H6R B;  3OBV E;  1R8I A;  2WDR A;  4BJN A;  3PUZ F;  5HEU A;  3J7Y q;  1UUS A;  2JRK A;  2FJA A;  2KZ7 B;  3VR9 A;  4U33 A;  3VKG A;  3C64 A;  5L4H A;  4AQF C;  4LF8 T;  3ZYM A;  1XMO T;  1IJ5 A;  2X0L B;  3KBU A;  2XM2 A;  5JDN A;  5JRC B;  2IHR 1;  2V5D A;  3FHN A;  3CPZ A;  2KXP B;  2W67 A;  2K5B B;  4N78 D;  4QWN B;  4A97 A;  3AEF A;  3RGL A;  2VAS A;  1DU2 A;  1UCU A;  4AKR B;  2LM2 A;  2XM1 A;  2UU9 T;  2PBI A;  4ZI2 C;  2Z6E A;  4I43 B;  3T1Y T;  2R6G F;  1ZHC A;  2CE7 A;  2WU5 A;  4WNK A;  4DV6 T;  3PUS A;  1SUM B;  2UXD T;  3WI3 A;  4F8H A;  4GYS A;  5AQM B;  2PJQ A;  4DV7 T;  4IHJ E;  1T8B A;  3CML A;  4ASK A;  4ZHQ E;  1KFY A;  2XY8 B;  4E7Z A;  1BR2 A;  4HGA A;  3ZEF B;  1MNE A;  4IDZ A;  3T1H T;  3RC8 A;  1OED E;  2VL8 A;  3Q9D A;  4IDP A;  3SFD A;  3TLT A;  1OED A;  2MYS A;  4B3S T;  2KSR A;  2E9X C;  5L4E A;  4HWC A;  2XQA A;  4TWF A;  4WYV A;  1FEW A;  3N9Q A;  3RIA A;  2QYW A;  4KP3 C;  3HI2 A;  2CWO A;  2E9X D;  4UVB B;  2V6X A;  2WU2 A;  5HXC A;  5ABG A;  3CK6 A;  1U5P A;  4IE6 A;  2JMK A;  3M65 A;  4PFP A;  2EHO C;  2XPK A;  4U2Y A;  4DR1 T;  3O1H A;  4H9O C;  2X9H A;  3EUH A;  4IE7 A;  3ZYL A;  5LYJ E;  3MA9 A;  5LJM A;  1Y64 B;  3LFM A;  4LMJ A;  4CI2 B;  4EZH A;  1JNZ A;  5L3E B;  2DWG A;  2Q9Q B;  5DQV A;  3NBX X;  1NEK A;  3GMI A;  3CWZ B;  1H7C A;  2BBH A;  3AB3 B;  4IRE A;  5FL1 A;  2FJE A;  2K24 A;  2DI4 A;  3ZT7 A;  3WAK A;  2Q9Q C;  2Y6X A;  4EYU A;  3MXZ A;  4X65 T;  3OJA A;  4HFB A;  3VRA A;  4CI1 B;  5JDG A;  4V1A v;  2JJ9 A;  2UXC T;  3KVB A;  2LOS A;  2MTQ A;  3TLV A;  5JQG E;  4JI4 T;  3RIU A;  3OPC A;  4ISS A;  4P09 A;  2X66 A;  5FY7 A;  2UUA T;  5BR8 T;  1IBM T;  2FBW A;  2XQ6 A;  1NWM X;  4U2Z A;  3VRB A;  3NZP A;  4PK4 A;  3AXJ A;  1WR0 A;  2YK0 A;  3F57 A;  2DHR A;  3ZT5 A;  1IBL T;  3HL6 A;  3AEG A;  2CRB A;  3ZKR A;  4CI3 B;  2X67 A;  3AAA B;  2LT3 A;  3L39 A;  3AA7 B;  4FJO A;  4HWD A;  1KK7 A;  3CKD A;  3PUW F;  3RC3 A;  4YTP A;  2BG9 B;  4OK0 A;  1L0V A;  4O2A E;  4HE8 A;  2BKO A;  3FZM B;  3BQL A;  3OYZ A;  4MFR A;  3OVU A;  4NIQ A;  4BJM A;  1N34 T;  1W9R A;  3N2K E;  2SPC A;  5LBQ B;  4XBF B;  2H88 A;  4PW8 A;  4ZXL A;  1Y01 A;  3FZL B;  3EVY A;  4YFS A;  3J9X 1;  2VKH A;  2JQK A;  2WS3 A;  2OLT A;  2V7I A;  3A8Y C;  4AKL A;  3PU3 A;  4YHJ A;  4UV9 B;  4CXX A;  2K3W A;  4KBM B;  2LKH A;  2XQ4 A;  1HCI A;  3Q5W A;  4UF0 A;  3VHL A;  2XTL A;  4MAL A;  1LKX A;  4U74 A;  3UTK A;  5LJN A;  4YTM A;  2NOX A;  4YLH A;  1UK5 A;  2KND A;  4O4H E;  5IYZ E;  5JR9 B;  1IAP A;  3TKL B;  4H63 V;  3PUG A;  4HFV A;  3ONJ A;  2M6I A;  3ABV A;  5FXX A;  3MKD A;  2QRX A;  2V7K A;  3N9N A;  5HXR A;  1WCR A;  5LBM A;  4ILU A;  4EB6 E;  3I9Y A;  3KDS E;  5C3J A;  4TUY E;  5JR9 C;  2VUR A;  3JAD A;  4CZZ B;  3IF8 B;  1MIY A;  3ETV A;  3QC9 A;  4IE0 A;  1D1C A;  2Q9Q D;  4O4L E;  4UEL A;  2G0U A;  2B1E A;  4B6X A;  4X66 T;  3ZC0 A;  4DBR A;  3MK7 C;  3EDV A;  2VVS A;  4IDQ A;  3RKO A;  5KMG P;  1M62 A;  1AJ3 A;  4AKI A;  1KF6 A;  4DMV A;  5LNK A;  2BZB A;  3NVO A;  4KHZ F;  2WZH A;  3ZMU B;  3ZMV B;  1E1H B;  3LBX A;  3P4W A;  1UX4 A;  4AKH A;  4UEM A;  2K48 A;  4IE4 A;  2L8K A;  2LE8 A;  2D5U A;  1S35 A;  1XNR T;  3M3Z B;  4OYJ A;  3AE8 A;  3UU4 A;  1Z0P A;  2BG9 E;  1D0Y A;  1W0A A;  3PUV F;  4GK5 E;  5AQI B;  5AQJ B;  2C5J A;  3H3A A;  5ABH A;  4F6R C;  4DV0 T;  5FP3 A;  2LRL A;  5FL0 A;  5HWX A;  4ZS3 A;  2HH7 A;  3NRX A;  2V7J A;  5CJ5 A;  4TWD A;  2UUC T;  2M6B A;  2WMN A;  4U3C A;  3SWH A;  2CBI A;  1ZEE A;  2XSA A;  3C98 B;  2BS2 A;  1J1J A;  5HEJ A;  3ETU A;  1YKE B;  1FMW A;  3E0Z A;  1HNZ T;  1XNQ T;  4WZX A;  5HEG A;  4E7S A;  5HXH A;  1BR0 A;  2XAF B;  2WSS V;  4U72 A;  3GN5 B;  2MOZ A;  3KBT A;  1MIW A;  3EAM A;  3RKG A;  1HNW T;  4NXN T;  4TZ4 C;  4YY3 T;  1T7S A; 
#chains in the Genus database with same CATH homology
 4X64 T;  4JI5 T;  2VQE T;  4JI8 T;  3T1H T;  2UXB T;  2E5L T;  4DR2 T;  1N33 T;  1FJG T;  4JI2 T;  4DR1 T;  4K0K T;  5LMU T;  4DV4 T;  5LMN T;  2VQF T;  4KHP T;  1N32 T;  4X65 T;  4YHH T;  4JI1 T;  4DR7 T;  4GKJ T;  4DV5 T;  2UXC T;  4JI4 T;  4LF6 T;  4X62 T;  4DUY T;  4JYA T;  4OX9 T;  2UUA T;  5BR8 T;  1HNX T;  1IBM T;  4LF5 T;  1XMQ T;  1HR0 T;  1IBL T;  4LF4 T;  2HHH T;  2UUB T;  4LFA T;  4DR5 T;  1N34 T;  4B3M T;  4NXM T;  4LFC T;  4DR6 T;  4JI0 T;  4JI6 T;  4JI3 T;  4JI7 T;  4B3R T;  4DR3 T;  4LF9 T;  2F4V T;  1I94 T;  1IBK T;  4B3S T;  5IWA T;  3OTO T;  1J5E T;  2ZM6 T;  4DUZ T;  4X66 T;  4DR4 T;  4LFB T;  4B3T T;  4DV2 T;  4JV5 T;  1N36 T;  4GKK T;  4DV1 T;  1XNR T;  4LF7 T;  4DV3 T;  4DV0 T;  4AQY T;  4LF8 T;  1XMO T;  2UUC T;  1HNZ T;  1XNQ T;  2UU9 T;  3T1Y T;  4YY3 T;  4DV6 T;  2UXD T;  1HNW T;  4NXN T;  4DV7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...